4JI6Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji6Q00
4LW1A 1X3FA 4A3MG 2WFWA 2JA9A 4MTNA 3PO3G 4YCUA 4OXPA 2PQAB 4X66L 2A8VA 5IE8A 4DUZL 4LF8L 1L2FA 4DV2L 4O0AA 2PI2A 2UUCQ 3CD6A 1GD7A 1VQIA 1PH9A 1UEBA 1XMQQ 3TQYA 1SRUA 4JI6Q 4DV5Q 1N36Q 4JBKA 2E5LL 4R4IA 4DR6L 4POFA 3S1QH 4GNXC 1YHAA 4GS3A 3M4QA 3CW2C 1KQSA 2VQEL 4KHZA 1P8LA 1YJ9A 5JEAG 4AQYQ 4JI4L 2OQ0A 4JBMA 2E8GA 2Z6KC 5IT9c 3RLOA 5GAEC 4DR1Q 3FKIH 3CCMA 2I5MX 2YTYA 3CPWA 2HHHQ 3ULLA 1KRTA 1PH8A 2F4VQ 1XNRL 5DLQE 1XMOQ 4HJ9A 4B3RQ 4DV7Q 4JI7L 2B63H 4XTCS 1PH5A 3HOZG 1VQBA 1EWIA 4DV0L 3CCQA 1N8RC 1HNXL 5IP9G 1EFWA 3HOUH 2LXKA 3J7ZC 1LM0A 5HGQA 1JJ2A 1L1OA 4LFAQ 4PZ8A 2UUAQ 3HOWG 1IBKQ 2HT1A 2JEAI 4A93G 2R93H 2NVYH 3PUVA 1J5EL 3K81C 2NN6I 3HFZB 4DKAC 1HZAA 2ZJPA 1NY4A 4A3GH 1K83H 1OXSC 1OXVA 3S17H 3PIPA 2UXBQ 2VW9A 1VQDA 1UE6A 5FLXc 4Y7NH 5C3EG 5M3MG 1EOVA 2KENA 4JYAQ 3T1HL 1IZ6A 4R4OA 4GKJL 3UDFA 3J81c 3PUWA 4P73A 1P16A 1VQ5A 1QZHA 1I6HH 4LF5Q 4GKKL 4LF4L 4O2DA 2ASBA 2BH2A 4PMWA 4IOAA 4DV1Q 2HIVA 4A3MH 1X3EA 5LMNQ 3PO2H 3OYYA 4B3MQ 3F2DA 3PO3H 2ZTDA 4MNOA 5IYDG 4JV5L 4C2MH 3PUZA 4A3BH 4JBWA 1YHQA 2XGTA 1K0RA 1NE3A 3M9BA 4BA2I 4UY8C 1QZGA 2UXCQ 4OO1I 2JA5H 4HJAA 3G48A 2Q2TA 4YY3L 1WI5A 1XMQL 1L1OB 4R4CA 1HJPA 4DV5L 2NVTH 3RZOH 3OTOQ 3I2ZA 2ZJQA 2AKWB 1FJGQ 4LUZA 4AQYL 2B29A 2XTIA 4J15A 1TXYA 5GAGC 4JI0Q 3HOZH 2RCNA 4A3FH 5IWAQ 2MFIA 4DK6C 5ELOA 2HHHL 2YTVA 4A3DH 3CMEA 4JI3L 2EXDA 4HIDA 1JE5A 1E1OA 1XMOL 1TWCH 3HKSA 4B3RL 3PF5A 1HH2P 2GVBA 2IT1A 1ASZA 3PF4A 1V9PA 1WCMH 1FVIA 3U4VA 1JB7A 4YCVA 1MIUA 1FGUA 1CSPA 3MXNB 5C0XG 3GTQH 1KAWA 2N3SA 2PQAA 3F2CA 4LFAL 1D7QA 4OWXB 3FKIG 2A19A 5M3MH 3J81i 2Q2UA 4DV3L 2ES2A 1IBKL 4BBSH 4JG2A 4A3KH 4DR5Q 3S1NH 2PI2E 2I5LX 2N49A 1N33L 4DV6Q 2UXBL 1PHJA 1QUQA 1O7IA 2B63G 4YWMA 4GN4B 1VQOA 2UUBQ 3I4NH 3RR5A 4JYAL 2WB1G 1HR0Q 1Q8KA 3HOUG 4DR4Q 3GO5A 3F8TA 1LTLA 3KJPA 1KRSA 5IYDH 5EAYA 1X3GA 1N34Q 1X54A 4EQ5A 4LF5L 4QQBX 1K8AC 1PYBA 3I55A 4JI1Q 1VQ4A 1GVPA 4NPSA 1VS0A 3BJUA 4B3ML 3L2PA 2KBNA 3CCLA 4HJ8A 1VQ8A 1SN8A 4P71A 1NMFA 2ZM6Q 2GN5A 3PV0A 4DR3Q 1YEZA 4HIMA 3E9IA 4P74A 4IFDI 5BR8Q 1G291 3S1RH 1PH7A 3KYHC 2UXCL 2Z0SA 4OONA 1BBUA 2Y0SE 2JJQA 2K14A 3NBHB 4IFDJ 3M3YH 5K36G 1A62A 1I50H 1S3OA 3IRBA 3PO2G 1Y1VG 1Z9FA 2WAQG 4RMFA 1NTGA 4DAYB 4BY1H 1VQFA 1JJGA 5GADC 3W1GA 4NXNQ 3OTOL 3RNUA 3NEMA 4NXMQ 1N9WA 1L1OC 1OXXK 2NZHA 4A3BG 1FJGL 3GTKH 2KHIA 3LGJA 1BVSA 5H1SE 5JJLA 1VQEA 1QUQB 4AIMA 5FLMH 5ELNA 4AYBE 3KF8B 2JA5G 5M5YH 3HOYH 1K8GA 5E7NA 1PV4A 4LF9Q 3MEFA 4K0KQ 1ASYA 2A1AA 5GROA 2YU9H 1WFQA 3G6EA 1Q1EA 2MQHA 2NN6G 4A3FG 4R1JA 1VQPA 1XNQL 2V1CC 3AFPA 1RIPA 1T9HA 5HY6A 3RN5A 4A3DG 2D0OA 4JC0A 4X65L 2BH8A 4A3EH 3K0XA 1X9NA 2CWAA 5LMNW 4DR5L 2ID0A 3B6YA 4DV6L 1I94Q 4LFBL 1CUKA 1WCMG 1Q12A 5IYBH 3TRZA 1S72A 1HR0L 4DR4L 4TQUS 4TVAB 4GLVB 2JA7H 4YCWA 1J6QA 3ZJYC 1C7YA 1D8LA 4X62Q 1AE3A 2BA1A 2BA0A 4YHHL 2JE6I 4KLKA 4HJ7A 3CMAA 1OXUA 2D0PA 4BBSG 1B7YB 5M3FG 4A3KG 4JI1L 1EIFA 3KFUA 2IHEA 4IJLA 1XJVA 3HKZE 1Q81C 1QVGA 3HOVG 2EQSA 1QVFA 1HNZL 5JEAJ 3I4NG 4LFCL 2ZM6L 1DGSA 1GM5A 2UXDQ 1Y1VH 4HJ5A 4HIOA 1X6OA 1KHIA 3S16H 3E0EA 3GTGH 1YBYA 5C44G 3I56A 2MO1A 2K5HA 4H02A 3CPFA 2CQOA 5IY0A 3CC7A 1E3PA 1WOCA 2CFMA 4IJHA 2F3IA 1CKNA 3DM3A 3CCEA 4DUYQ 2NVQH 4B3SQ 3L7ZC 4NXNL 2HIXA 2UUCL 3K8AA 4NXML 2VZAA 4JI6L 1WJJA 5IYCG 2EIFA 4LF7Q 1A63A 1N36L 3AFQA 2JA8H 1WYDA 4DR2Q 2L15A 3M85A 2WP8J 3PUXA 4YWLA 1EUJA 2VNUD 3AYHB 4JOIA 1YZ6A 2AMCB 2N78A 4DR1L 1X56A 3K80C 5C4JH 1KC8C 1M1KC 4BY1G 1VQMA 4LF9L 2B3GA 1VQ6A 3JAMc 4QL5A 2F4VL 4C3JH 1AE2A 4BA1I 3CCJA 4UP7A 1HR0W 3GTPH 1YNXA 2QA4A 4NB3A 3KJOA 4JI5Q 3S15H 4DV7L 2PNHA 1IL2A 1PVOA 2HQLA 1CKMA 1E24A 4A76A 3KF6A 5FLMG 3W1BA 2UU9Q 3GD7A 1K3RA 3NENA 4DV2Q 2UUAL 2K4KA 1GO3E 2R7ZH 3HOYG 3S2HH 4JI8Q 3WWVA 4DV4Q 5IP7G 1R9TH 1KXLA 4OX9Q 5M3FH 1I5FA 2E5LQ 1VQAA 2RF4A 4LNQA 1KIXA 1EYGA 3HOVH 1UWVA 2AWNA 5LMUQ 2E2IH 1CKNB 1VQGA 3H3VI 4X62L 1Q86C 4C3HH 3CC2A 4YWKA 2YTXA 4L5RC 4MZ9A 5AJ3Q 3T1YQ 1Q82C 4IOCA 2PMZE 4IO9A 4A3EG 2OQKA 5C44H 4A3JG 1XNRQ 4X6AH 4JBJA 1SR3A 3EIVA 4ME3A 4WJ3M 4DV1L 3GTOH 1JJCB 2C35B 1Q46A 5IYBG 2UXDL 1W3SA 5LMNL 4DV0Q 1CKOA 1NBWA 2WB1E 2JA7G 2VUMH 3I4MG 3STBC 3RLNA 4C3IH 1N32Q 1E22A 5GAHC 1NJIC 3A0JA 1YJNA 5IYCH 1W2BA 3PCOB 3J80c 5M5WH 5C0XI 5GQOA 2VL6A 3AEVA 4IPCA 2OCEA 3CC4A 1HZCA 3STBD 1XPUA 4LUVA 3TREA 1VQCA 4QJFA 2H5XA 3KF6B 5C0XJ 1FL0A 3CAMA 4IPGA 2MO0A 1JMCA 3A5UA 3DLLA 2CCZA 4A4IA 3JAMi 2ALYB 4X64Q 4JI2Q 4L5SA 4DR2L 3FP9A 2N8NA 1AH9A 3GTJH 5JJKA 4HIKA 4GOPA 1IBLQ 4POGA 4GN5A 4JI0L 3I7FA 1VQKA 5IWAL 4LWCA 4DR7Q 3Q8DA 2WAQE 2E2JH 3S24A 1SLJA 2ZTCA 4BY7G 1MJEA 4A3LH 2R92G 4JV5Q 1MKHA 3KDFB 5M5XH 3UE1A 4KHPQ 1MJCA 1PYSB 1Y1WH 5IP7H 2AWOA 3CXCA 2JA6H 2JA8G 2OTJA 1B8AA 2JK8A 2R7DA 1LYLA 1C9OA 1PFSA 3ERSX 3A5ZB 2MNAA 3CCRA 3D0FA 2UU9L 4AYBG 2KCTA 3FHWA 3ULPA 3S14H 1VCIA 2VY3A 2F52A 4JI8L 4YY3Q 3UE0A 4DV4L 2R7FA 1EIYB 4A3CH 4OX9L 4A3JH 4DK3C 3M7NA 1TWFH 4DPGA 5C4XH 3EN2A 4BXXH 3GTLH 5LMUL 2UUBL 3F2BA 3L0OA 1EQQA 2AHOB 3UDIA 2K50A 3VDYA 1G6PA 5AJ3L 3M4PA 4KI0A 3T1YL 3I4MH 2I5HA 5FJ8G 1JT8A 4JI3Q 3EBEA 1N34L 1OXTA 2R7ZG 1SE8A 3J80i 2IHFA 4A3IH 3HOXH 1A8VA 3GTMH 1V43A 1TWGH 2KCMA 3G71A 4P75A 3CCSA 3CP0A 4GOPB 1I3QH 2OTLA 5J3BA 1SROA 4XIGS 4IPHA 3RZDH 1L0WA 3CQZH 4JOIC 1IYJB 2D62A 4AH6A 4DR3L 2K75A 4A75A 4OO1G 1N32L 4DV3Q 4FDBA 4QY7A 5BR8L 1XPOA 4GNXA 1CSQA 1UE7A 1BKBA 2LSSA 3HKZG 3CF5A 3UDGA 1N33Q 1Y14B 2Z6KA 2IX1A 2DGYA 1UE1A 4BBRG 1IBMQ 2I0QA 1YJWA 3S2DH 2VQFQ 2VUMG 1LUZA 4LF6Q 1Q7YC 4GLAC 4X64L 4UP9A 4JI2L 4BY7H 2R92H 3H0GH 3M4OH 4UP8A 3BZCA 1X55A 4DAMA 4PZ6A 1IBLL 1HNWQ 2OWOA 1HZBA 4PZ7A 2E2HH 2KHJA 4DR7L 3CCUA 2Q2HA 3OW2A 4R4QA 1B70B 2NZOA 3ER0A 3UDXA 2K5NA 1VQHA 2JQOA 4KHPL 1U0LA 4APVA 3TEHB 3ULJA 3CCVA 1K9MC 2QGQA 4RG1A 4QGUA 4K0KL 1OTCA 4B3TQ 3U4ZA 2GVAA 1KL9A 3K7UC 1U5KA 3JC66 4Y52H 4X66Q 2LXJA 2K5VA 4DUZQ 1YI2A 4LF8Q 4PG3A 5FJ8H 3PIOA 4A3LG 3KLWA 4OWTB 1G51A 1PH4A 1GKHA 2DUDA 3I4OA 4GNXB 1Y1WG 2JA6G 3F1ZA 3TS0A 3NELA 1S40A 2FXQA 2JEBI 1I94L 4EX5A 1VQ7A 3D31A 4DR6Q 1QVCA 3U58A 4R4TA 1V1QA 1XTDA 3PGZA 3RLFA 2VQEQ 5IP9H 2ZJRA 4GLXA 3RN2A 4WJ4A 4JI4Q 1SFOH 1EQRA 4L5TA 1YIJA 2NVXH 1X65A 4DNIA 3A74A 2RHQB 4A3CG 3HOWH 5JJIA 3KDFA 1K73C 1RL2A 1VQJA 3J81j 1IXRA 1H95A 4IPDA 4A93H 3ICEA 1PA6A 1KD1C 4BXXG 4IFDG 2YYZA 2ZTEA 5C4XG 3AQQA 1VQ9A 4JI7Q 3BZKA 4GOPC 4BBRH 3GDEA 3S1MH 4OWWB 5C3EH 1XNQQ 1C0AA 1HNXQ 2CKZB 4QIWE 2K52A 3K7AH 3TS2A 2VS1A 1HZ9A 4P72A 4X65Q 1NMGA 3KOJA 1VQLA 1TWAH 1YHBA 4A3IG 3HOXG 1YITA 4ALPA 4LFBQ 1J5EQ 1BBWA 1IBML 2R6GA 3BU2A 2VQFL 3G4SA 4DUYL 4LF6L 4B3SL 3U50C 1TWHH 3E9HA 3PSIA 1Z47A 3T1HQ 4YHHQ 4GKJQ 4LF7L 1UE5A 2YV5A 1A0IA 4JCVE 2R93G 1E1TA 2Q2IA 1HNWL 4GN3B 4UPAA 1SMXA 2Y0SG 4L5QA 1YVCA 4A3GG 4GKKQ 1XPRA 4LF4Q 2ATWA 3H15A 4LUOA 1PH1A 1HNZQ 2IX0A 3W5OA 1PH3A 1M90C 4LFCQ 1PH6A 1PH2A 1VQNA 2RHSB 3H3VH 3SGIA 2CWPA 3H0GG 2QEXA 3J7A5 1E7ZA 2IY5B 4B3TL 3PUYA 4JI5L 1Q1BA
chains in the Genus database with same CATH superfamily
2NB0A 2WFWA 5FO9B 3K7AB 4C3IB 4YCUA 4LF8L 2UUCQ 1SYBA 2FFKB 1SRUA 3NXWA 2F0UA 1BQQT 1I4HA 4ME5A 5JJKA 1KQSA 1EU4A 3CW2C 2VQEL 3OSOA 4DK1A 5IT9c 3K58A 3HZXA 3NTKA 3T13A 4MTKA 2F4VQ 5DLQE 2EYFA 4JI7L 1STNA 4XTCS 2F0TA 4ZCKA 3HOZG 4K8JA 2K1BA 3CCQA 1EFWA 1PRTC 1B4OA 5HGQA 1L1OA 4LFAQ 1Y1WB 2GA4B 5E3FA 2O4XA 2HT1A 1DOLA 1J5EL 2NN6I 3SR1A 4DKAC 1NY4A 2VXWA 3RUZA 1OXSC 4JW0A 3S17H 3PIPA 2VW9A 1VQDA 4Y7NH 1GUNA 2KENA 1IZ6A 4R4OA 1EQVA 2A69D 5CV9A 4FYDA 5D3IB 1DCZA 1VQ5A 4CJ1B 1QZHA 3GTLB 3TZUA 4IOAA 2HIVA 5K36H 4KN7C 1X3EA 3PO3H 5DM73 2E2DC 2A6HC 1GUTA 4EVOA 2ZXPA 1K0RA 5IIFA 4UY8C 3RZDB 1F77A 3G48A 2A68D 3CHBD 1L1OB 2A6ED 4DV5L 2KOLA 2Y0SB 3RZOH 4IUTA 2ZJQA 2KCCA 4Y7NB 2B29A 1TXYA 2B8FA 3KK7A 3CMEA 4JI3L 1KLGD 1XMOL 2K6AA 5E1FA 4B3RL 4M8AA 1FVIA 3PO3B 4AYBB 5A35A 1FGUA 3IKJA 2TMPA 1TT2A 2N3SA 2PQAA 1V1PB 5CBAE 3C46A 2IX3A 2A73B 4X3TA 4BBSH 4JG2A 4A3KH 5E4WC 1E2ZA 3S1NH 2N49A 1N33L 1DXMA 1QUQA 1AZQA 4YWMA 1VQOA 1PMRA 3RR5A 4JYAL 2WB1G 3HOUG 4DR4Q 2QEJC 3KJPA 1X3GA 1X54A 4EQ5A 4LF5L 3CRKC 1SMYC 1HHVA 2IW3A 3I55A 3A8IE 1GVPA 4O42A 3BJUA 3I4LA 4B3ML 2MPMA 3O13A 2NVXB 1VQ8A 1SN8A 4P71A 1RTOA 1WTPA 2GN5A 1LTBD 5CC4A 4DR3Q 3NE5B 4FXGC 4A93B 3E9IA 4P74A 1G291 5D14A 5G3LD 2PNRC 4PQXA 5CBEE 2UXCL 4KY7A 2RBMA 3NPPA 3NBHB 1V8QA 1Y1VG 1Z9FA 4RMFA 1H9KA 4RH6A 4BY1H 2XRQD 4NXNQ 1TWAB 3DMUA 1TY0A 1MI2A 1FJGL 2KHIA 2Z6BA 2EJMA 1VQEA 1QUQB 1BCPC 5D3DA 1QOHA 2PZUA 1B50A 2JA5G 4K2KA 3FEWX 1LT4D 1EYCA 1K28A 5C5LA 3T56B 4DF7A 2A1AA 5GROA 4OELB 4MN3A 4V0BA 5HGTA 2MQHA 2NN6G 3I90A 1V1OA 1G91A 4QUFA 2V1CC 2WV6D 1X9NA 2CWAA 4RKLA 5LMNW 2ID0A 3B6YA 1SE2A 1CUKA 1WCMG 1K8OA 1Q12A 5IYBH 1S72A 1HR0L 1EY0A 4TVAB 3NTIA 3V2TA 1D8LA 2BDOA 2B2YA 3DWQA 1LACA 3CMAA 2D0PA 1PTOF 1NR2A 4JI1L 3RD4A 3KFUA 2IHEA 4IJLA 1XJVA 2EY5A 3HOVG 1QVFA 5JEAJ 2UXDQ 1GM5A 1F2ZA 4ZK9B 3NQTA 3D4WA 1X6OA 2WINB 3E0EA 5C44G 5FO7B 4DFAA 3I56A 2CW0C 4V190 1E3PA 1WOCA 1ONLA 3VR5A 3FPPA 4RGTA 1BOSA 2HIXA 2UUCL 3K8AA 1PXUA 5IYCG 4LF7Q 1A63A 2L15A 1A3TA 2WP8J 3PUXA 2KUMA 3J7AV 4QUCA 1VQMA 4LF9L 2K05A 2B3GA 2F4VL 3JAML 3CCJA 1HR0W 1ILQA 3GTPH 2QA4A 3KJOA 3IFTA 2HUGA 4X3UA 2L11A 1FNVA 3LX0A 1STEA 4G57A 1EWCA 3HOYG 1A2TA 3S2HH 1KTKA 1Q90A 1S4ZA 2A74C 5M3FH 1VQAA 2RF4A 5FOBB 1TS4A 2R61A 3L3OC 1E2WA 2WKDA 3H3VI 5CYUA 1VQGA 1SE3A 4X62L 2YTXA 4MZ9A 5LHY1 1CM9A 4BWGB 2IL8A 1TS5A 4IO9A 2F0IA 3T51B 4JBJA 1DYQA 4WJ3M 3K57A 1W3SA 4A3DB 3RLNA 5I6YA 4L8JA 3SK6A 3GTPB 3T4AC 1N32Q 1E22A 1STGA 2PW5A 5GAHC 1CA5A 3PCOB 3MC0B 2VL6A 3CC4A 4I7AA 1XPUA 3STBD 2FINB 3S2HB 5C0XJ 4UAIA 1W6JA 1CQVA 1JMCA 3DLLA 5M3FB 2ALYB 3VA7A 4X64Q 1WVLA 3MAQA 3FP9A 4HIKA 3I4NB 4ZQ3A 4WFN3 3FVQA 2IPKD 4LWCA 4FVMA 4DR7Q 1MHWC 2E2JH 4X3KA 4BY7G 2R92G 4JV5Q 3T16A 5M5XH 1PYSB 3CXCA 1C9OA 1G8ZD 2ICEC 3NK9A 4FF1A 4AYBG 5A2QE 2KCTA 2MP1A 1VCIA 2F52A 4JI8L 2KCNA 3S1RB 3HEJA 3D8GA 4K14A 1EY5A 3M7NA 2HCCA 1TWFH 1EYDA 4DPGA 3EN2A 4BXXH 4XXEA 4IUPA 1TR5A 5EPJA 4CKBA 1EQQA 2AHOB 1G6PA 3M4PA 4KI0A 2E74C 2I5HA 3GTKB 1D2BA 3MA2B 2IHFA 4A3IH 3GV6A 1A8VA 3GTMH 5ISRA 1C4QA 2KA7A 4PMCA 2SNSA 5M5YB 5J3BA 1SROA 4IPHA 1K0SA 4DGZA 3CQZH 4JOIC 4DR3L 2K75A 1JOOA 4A75A 4OO1G 2EXZA 4FDBA 1HXYD 3H6MA 1NAPA 4HCSA 1CSQA 1IKMA 1BKBA 2LSSA 3KBXA 3UDGA 1PTOD 1D6EC 1UE1A 2VQFQ 2PZWA 4A3EB 1JWUD 4JI2L 2K7VA 4K6LA 4M1UB 1TWFB 2QDLA 1STBA 4HAEA 3RMHA 4UP8A 1X55A 4DAMA 1IBLL 1HCZA 4G7ZC 2JA7B 2JXMB 1STHA 4UDUC 3OW2A 2NZOA 3GQBA 5L37A 2JQOA 4KHPL 4APVA 3TEHB 1SEBD 2X6GA 4H13C 3ULJA 4QGUA 4RG1A 2F0LA 1OTCA 1A6XA 4B3TQ 1JORA 1KL9A 3I8ZA 1U5KA 3MFYA 3S16B 2BCOA 4LF8Q 1RJTA 1O80A 4QCLA 4OWTB 1GKHA 1I4RA 3I4OA 3HRZC 5ELCA 2NVQB 4EX5A 1VQ7A 3URYA 3RLFA 3PGZA 2VQEQ 4GLXA 5LL6S 2ZJRA 1SFOH 3WDNA 4EQNA 2JA8B 5DM63 4A3CG 1RL2A 1VQJA 4NMZA 3D3RA 1BXTA 2YYZA 1VQ9A 4JI7Q 1KNAA 4GOPC 4OWWB 2Z8LA 1NMGA 3KOJA 1IW7D 1YHBA 3I3CA 4XDXA 3HOXG 5IODA 5KNCA 4ALPA 1FGBD 1J5EQ 4LK1C 2RDHA 3G4SA 4XYOA 2R7ZB 1TWHH 4LF7L 1O78A 1UE5A 4CDEC 1A0IA 1HFNA 1E1TA 4GN3B 3D6CA 2B39A 1F9SA 1AP0A 1LT3D 2ATWA 3W5OA 4C1NK 4K5XA 4OHJA 3SGIA 2CWPA 2QEXA 3J7A5 2B2VC 3PUYA 1Q1BA 4UP7A 1X3FA 4HR7B 4A3MG 2VUMB 2JA9A 3EROA 5T1GA 4X66L 4C1NI 5IE8A 4DUZL 1L2FA 4IQZA 4ZRZA 4I65A 2BE5D 3TQYA 4DV5Q 1N36Q 1D1KA 4POFA 4GNXC 2AQ3B 4GS3A 4KHZA 1YJ9A 5JEAG 5CV7A 2Z6KC 1SYFA 5ELDA 2XSCA 3KLRA 4DAVA 1KRTA 3DEPA 1A15A 1XMOQ 5C6AA 4B3RQ 3K5MA 2I07B 2N55A 3HOUH 1JJ2A 4IURA 2UUAQ 2JA6B 1T5EA 1RDPD 3HOWG 1KNEA 3K81C 3HFZB 1PZID 1K83H 3S14B 1UE6A 5FLXc 5C3EG 5M3MG 1EOVA 4JYAQ 3T1HL 1EZ6A 2V4DA 3J81L 1P16A 1SNQA 5C4XB 1I6HH 4LF5Q 2Q8TA 2BH2A 4DV1Q 5LMNQ 3NTHA 3OYYA 1Y8OB 4B3MQ 2ZTDA 4FXKC 2FMCA 5M9OA 5IYDG 4JV5L 1YHQA 3BDCA 2L12A 5EBDA 2D2CC 4BA2I 2K5QA 2UXCQ 1HRJA 3SXHA 1D5XC 4IUVA 5CMDA 2JA5H 1S5CD 5I2YA 1G2SA 1FNUA 4RKBA 2NVTH 2QKIC 1K83B 1FJGQ 2K01A 2XTIA 5GAGC 5LL6X 3LWUA 5ELOA 3R8BA 2YTVA 3H0GB 3A55A 1ENCA 5ELEA 2VB2X 1TWCH 3D4RA 3HKSA 3PF5A 1HH2P 1ASZA 3PF4A 1WCMH 1TQOA 4HSVA 1JB7A 1MIUA 1LABA 3NQIA 5C0XG 3GTQH 1D7QA 4DAYA 4OWXB 3FKIG 2A19A 1ET9A 1EIGA 2Q2UA 5T1IA 2ES2A 1IBKL 1EU3A 2SNMA 4HMJA 2UXBL 2IWHA 2B63G 1RODA 2UUBQ 2EOTA 5BN4A 3KF8A 1HR0Q 1KDCA 3GO5A 1L0YB 2NVTB 2BOSA 5EAYA 1XWEA 2EYMA 1PYBA 4JI1Q 1RF2D 2Q8RE 5JAVA 1F2LA 1HFGA 4HJ8A 1TWCB 1HUMA 4IFDI 5BR8Q 5EKLA 1PH7A 3C2PA 1Q3LA 2XNAC 1BBUA 2K14A 4KHVA 1CHPD 2D5DA 2F0HA 1I50H 3IRBA 5CV4A 3PO2G 3M4YA 3KUPA 2WAQG 1XX8A 1WTQA 4DAYB 1JJGA 3RNUA 2DNEA 3NEMA 2NZHA 4KMUC 4A3BG 1ENFA 3SDZA 3VYRA 1HTPA 3KF8B 1HUNA 1SJHD 1EFID 3HOYH 4IALA 4ZAIA 1PV4A 4LF9Q 1GUSA 1J8IA 4DXFA 1ASYA 2B2WC 2B2TA 5EGTA 2YU9H 1WFQA 1Q1EA 2JN4A 4A3FG 1T9HA 2D0OA 5K5PA 1VF7A 2B8GA 3J7AF 4HMIA 1SDFA 4PNYA 4DV6L 1I50B 1I94Q 1LT5D 3E6ZX 2E75C 3MHBA 3TRZA 4TQUS 3SE0A 1VMPA 3ZJYC 1TY2A 4QMGA 4X62Q 2BA0A 1SJED 2JE6I 2L55A 1OXUA 4K5WA 1B7YB 1EY9A 1EL0A 1PLFA 3K5LA 2G9HD 4TRDA 4NKLA 3SHLA 1V1PA 4HJ5A 4HIOA 4K2LA 3MTSA 2OT2A 1YBYA 3BDLA 2K5HA 1JB3A 2J4XA 5J39A 2DY8A 3CC7A 1DM0B 4IJHA 2F3IA 1IKLA 4B3SQ 5IOCA 2F1MA 5JPMC 4NXML 4OEMB 4RAUC 2EIFA 4R8NA 1N36L 4N8FA 3S17B 1EUJA 3AYHB 4F8MA 1ILPA 2AMCB 2L5TA 2N78A 3IL8A 1X56A 1EEFD 5KGUA 3K80C 5C4JH 1KC8C 4I7ZC 4QL5A 4EGVA 3TMEA 2KQ3A 1AE2A 5EBCA 3TP8A 1YNXA 4ZKBB 4NB3A 1IL2A 3NHHA 3NBHA 5EJWA 1HQMC 3KF6A 3W1BA 3L9AX 3GD7A 4DV2Q 2UUAL 2K4KA 1GO3E 3CKIB 4JI8Q 4J1MA 3WWVA 4OIJA 5IP7G 1R9TH 4MHEA 2E5LQ 1B2TA 2PZTA 1EYGA 1UWVA 1EOTA 5IT9E 2E2IH 2AUKA 5CGKA 4C3HH 4OO1H 3RZOB 1Q82C 1AN8A 1YNJD 2JSOA 4IOCA 4A3JG 4WORA 2OQKA 4HN7A 3EIVA 3NBIA 4DV1L 1DZ1A 1Q46A 5KEEA 5LMNL 1CKOA 2WB1E 3I4MG 3STBC 3MXPA 1JC7A 1JQYD 1W2BA 4ILWA 3J80c 5M5WH 5GQOA 2L1BA 1FD7D 4IPCA 2OCEA 4CHTB 1DOMA 1U9RA 4QJFA 3KF6B 2CCZA 2MO0A 3FMCA 4BBSB 1JWSD 3BYYB 4A3KB 4JI2Q 3S1NB 4DR2L 3QIAA 2N8NA 3GTJH 1IBLQ 4GN5A 4C3HB 3Q8DA 3S24A 1MJEA 3BS1A 4KHPQ 2EYHA 2AWOA 2OTJA 5EKIA 2JK8A 4CDFC 4ZUJA 3ERSX 1GOZA 3D0FA 3C3LA 1GUWA 3ULPA 2CHBD 4PMBA 2VY3A 4WJWA 1BCPF 1F9QA 3UE0A 4DV4L 1EIYB 2CQAA 4A3CH 4C3JG 1PFBA 3I72A 2HD3A 5DNFA 5LMUL 2UUBL 4BY1B 3UDIA 1Y8PB 5AJ3L 3T1YL 5FJ8G 1KDBA 1SE8A 3J80i 3HOXH 1UUPA 2F0NA 1TWGH 1V43A 3G71A 3CCSA 1X3QA 1HQRD 3EJIA 2OEOA 1I3QH 1F9PA 2OTLA 2Z9HA 2D62A 5BR8L 1UE7A 4ZUIA 3MFGA 4HTHA 3SK5A 1LLRD 3S2DH 1LUZA 4UP9A 4C3IG 2CH4A 2EYOA 3BZCA 4N9TA 4PZ6A 1BR9A 1EYAA 1HZBA 3OOCA 3DWAA 1MBYA 3P75A 5IGDA 1VQHA 2NWGA 3J80E 1K9MC 3I91A 2HDMA 3VR2A 5JEAH 2IJ0A 1KABA 5FKAC 4BS9A 4X66Q 1WTRA 1A3VA 2LXJA 4DUZQ 1IL8A 4PG3A 4CJ0B 3KLWA 3BZDB 1JCKB 3ND8A 1Y1WG 3F1ZA 2DN8A 3NELA 1I94L 2FXQA 2D9UA 2JEBI 3S2DB 3U58A 3ND9A 1HPCA 4WJ4A 1CT1D 2FMMA 1B3QA 3N52A 3MZ5A 4CKCA 4DXGA 2CVRA 4DNIA 3A74A 5C3XA 3HOWH 5JJIA 1IXRA 1H95A 3ICEA 1MD2D 1PA6A 4RGOS 3AQQA 1PRTB 3I73A 3BZKA 4BBRH 3S1MH 4L63B 5C3EH 1XNQQ 2K52A 1HZ9A 4X65Q 1YITA 3MXGA 2KEEA 1S5BD 1IBML 4G4KA 3MEHA 4B3SL 4OIKA 1MGSA 3E9HA 4B9XA 1Z47A 3T1HQ 1JR0D 3G7LA 4RFBA 2Y0SG 1YVCA 3VYSA 2A5HA 3H15A 4Q5VA 3A8JE 2MUYA 3ONAB 1HNZQ 1TU2B 3TN2A 2OF1A 1SMYD 4HCEA 2EY1A 3HKZB 3BDOA 1E7ZA 3HP3A 2BE5C 4BBRB 5BN5A 3S1MB 1B1ZA 5NUCA 3PO3G 3OIQA 1QB5D 4DV2L 3CD6A 1GD7A 1VQIA 2KVMA 1PH9A 4JI6Q 2E5LL 4DR6L 1KDAA 3S1QH 3M4QA 4F87A 3F2UA 1P8LA 5C0XH 4JI4L 4JBMA 2E8GA 2ZXRA 4DR1Q 3FKIH 2L9HA 3A56A 3OIPA 1BCPD 4HJ9A 3S9WA 4DV7Q 2B63H 1PH5A 2E2JB 1N8RC 3Q22A 3DM1A 2LXKA 3J7ZC 1H9JA 5M5XB 3X3MA 1GUGA 2G9DA 2EY2A 1IBKQ 2JEAI 4A93G 2R93H 2NVYH 1GUOA 2EE1A 4A3GH 1HZAA 3AU7A 1OXVA 2B2UC 2UXBQ 3UDFA 3FDTA 1WTVA 3N6RA 2ZT9C 4GKKL 4LF4L 4O2DA 2QCPX 4PMWA 4K5VA 1BF4A 3PO2H 4RWSC 2PMZB 3F2DA 4A3IB 4C2MH 3PUZA 4A3BH 4JBWA 3GTMB 1JE4A 1QE6A 4IN3A 3P7JA 3M9BA 4KKTA 1M8AA 1EY8A 4IUUA 2QW7A 2DJFC 3CQZB 4FO2A 1QNUA 4HJAA 5CR3A 2Q2TA 2K32A 2R93B 1XMQL 2NVYB 3QWNA 1HJPA 4PV1C 4A3GB 4JK1C 4AQYL 3PMFA 1BCPB 1MSGA 4ABNA 1WTWA 4JI0Q 3HOZH 1RHPA 2RCNA 4A3FH 5IWAQ 4DK6C 2HHHL 2EXDA 4KKSA 1E1OA 3OMCA 2IT1A 2Q8IB 1V9PA 5CV5A 1DJRD 3U4VA 3NUCA 4YCVA 5IGFA 1J9OA 4C2MB 1C48A 4NDXA 2WIIB 2RDFA 3BG3A 1ZYRC 4JVZA 2Z4HA 2PI2E 2I5LX 4DV6Q 1PHJA 1O7IA 4J8QA 4RGMA 4ID6A 3OMGA 2XVSA 3PQIA 1KRSA 1X32A 3AMUA 4P2CB 3D4DA 3HOZB 4NPSA 1SFOB 2DJGC 2KBNA 2O2LD 2G5DA 2F0WA 3VR4A 4LJZC 4LAAA 2LFNA 3KYHC 4H0LC 2K03A 4NW2A 2Z0SA 4OONA 2JJQA 4IZ8A 4Z9CB 1SNCA 4IFDJ 3M3YH 2WKCA 1S3OA 1NTGA 2AQ2B 1SBBB 1VQFA 3FRPB 3OTOL 4NXMQ 1L1OC 1OXXK 3LGJA 1BVSA 5H1SE 2TSSA 1I4PA 1NNXA 5FO8B 2LMCB 2HDLA 4AIMA 1TWHB 4QB4A 5ELNA 2SDFA 4MIUA 1BBXC 3MXUA 5E7NA 4XYQA 4R8IA 4QF4A 4H7BA 4B9WA 3G6EA 3VR6A 3BVZA 1VQPA 1XNQL 3EFXD 3T53B 5KNBA 4A3DG 4EQOA 2KECA 4X65L 2BH8A 1YNND 3K0XA 4DR5L 1SSOA 1G2TA 2A69C 4EQPA 5EKKA 2K5WA 1C7YA 1AE3A 1F2YA 5C4HA 3QO2A 2EPBA 3CRLC 4KLKA 5M3FG 1L0XB 3K5NA 1AW7A 3HKZE 3KLSX 1Q81C 1QVGA 3OWEB 2PW7A 1HNZL 1WD1A 3I4NG 2ZM6L 1Y1VH 1RD9D 2AQ1B 3K6OA 3GTGH 2MGSA 2A68C 2MO1A 2CQOA 2WB1B 2A6EC 3HOUB 4QIWB 3CCEA 4DUYQ 3L7ZC 5EQ0A 5A2QL 2VZAA 2NTSA 5KYIA 4JI6L 2H4OA 4RHSA 3AFQA 4KV6A 3TDQA 4DR2Q 2NBFA 1FR3A 1KAAA 3M85A 3MVVA 3H94A 2F0OA 3U9OA 4JOIA 1YZ6A 2JYOA 2NN6H 4DR1L 1M1KC 3JAMc 3DWPA 1I6HB 1QG7A 4C3JH 4BA1I 3QJYA 2B2UA 3FPUB 3S15H 3E0JA 5DAUA 5CV6A 2F0SA 3TP6A 4DV7L 4JI5Q 1UEAB 1Y1VB 2PNHA 2EJFC 1CKMA 1E24A 1GHKA 5FLMG 4KY5A 3GTGB 5IGGA 4RA8A 1LTGD 1M4VA 3H3VC 1NR4A 3SEBA 4DV4Q 1SYGA 1B9MA 5IGCA 4LNQA 3BYTB 1KIXA 1SNMA 2JA5B 2Z4IA 3HOVH 2AWNA 5LMUQ 1D5ZC 1WTXA 1GXDC 5AJ3Q 1UNSA 3T1YQ 2O5JC 2PMZE 3OWFA 4A3EG 5C44H 1XNRQ 4X6AH 1ESRA 3X3NA 1SR3A 3GTOH 4E6IA 4DV0Q 2EYJA 2JA7G 1F2MA 5C5MA 4C3IH 1NJIC 1HA5A 1WCMB 5IYCH 1YJNA 1JOKA 1HZCA 3GTQB 3TREA 4TKOB 1SAPA 2KHSA 5FLXE 1B9NA 2H5XA 2R3ZA 4DK0A 5JOBA 1FL0A 4IPGA 5I6WA 1SYDA 1EWHA 4A4IA 3JAMi 4KJNA 3ZYYX 2X69A 5KNDA 3HOVB 1AH9A 2F0JA 4GOPA 2PPBC 1I4QA 1LTRD 1U4PA 4JI0L 1CZGA 2RSNA 5IWAL 3BVMA 1R4PB 2WAQE 3TSSA 5C44B 1SLJA 2ZTCA 4N8X1 1R4QB 1UAPA 3NP8A 4KK7A 5IGEA 4FNFA 1MKHA 3KDFB 2F03A 3UE1A 2B2YC 2QF7A 4CKEA 1Y1WH 2M00A 3A7AB 2JA8G 4DA2A 1B8AA 2R7DA 2MNAA 2UU9L 2F0GA 1RCVD 4YY3Q 2R7FA 1K3BC 3W2DA 4OX9L 3QR8A 4DK3C 3GTLH 3F2BA 4WRDA 1WD0A 4FF2A 3VDYA 2K50A 5HURA 1JT8A 3JAME 4KN4C 1OXTA 2B2VA 2R7ZG 4ZKCB 4OL7A 1PRTF 5FK9C 1Z6HA 3PIO3 4IUQA 3TBIB 3TZDA 4P75A 3CP0A 4GOPB 3HOYB 3EQLC 3WOFA 1JWMD 3RZDH 4KKUA 1L0WA 3I70A 2K5DA 4DV3Q 4GNXA 2YU9B 2I46A 1S5DD 1D5MC 3HGBA 4KTAA 2Z6KA 2IX1A 2DGYA 1IBMQ 2I0QA 1YJWA 2VUMG 1Q7YC 4GLAC 1PYWD 4BY7H 2R92H 3H91A 3HS0C 2RQXA 5I9OA 2E2HH 1SE4A 1CFMA 2Q2HA 1I4XA 3ER0A 3UDXA 2K5NA 3UI2A 4OGQC 1TS3A 3NSWA 3WOEA 2PQEA 2GVAA 3K7UC 5J22A 2J7ZA 1Y69U 2F0MA 1Y8NB 4A3LG 3PIOA 1G51A 3VYUA 3TP5A 2DUDA 2QILA 4GNXB 1HA6A 2JA6G 3TS0A 1O7ZA 3VA5A 4LMQD 4DR6Q 3D31A 5KIXA 1QVCA 4R4TA 3Q0AA 2L4NA 4BY7B 4JPBW 2R92B 4KJOA 4JI4Q 1EQRA 1YIJA 2NVXH 1H9MA 2RHQB 3OW7A 3P1HA 2RA4A 1PFMA 3J81j 2E2HB 4IPDA 4A93H 5C4XG 4IFDG 4FF3A 1LTAD 4S3SA 5C4JB 1CZWA 4QIWE 2XRSD 2VS1A 4P72A 1LTSD 3R2IA 1XTCD 2CH4W 1TWAH 5KYLA 4LFBQ 1BBWA 2R6GA 3Q6SA 4DUYL 4LF6L 3J7YW 3BVGA 4KD4A 3U50C 1R9TB 4YHHQ 4JCVE 4CDDC 1EQTA 1HNWL 4UPAA 4L5QA 4GKKQ 1WTHA 1XPRA 4LF4Q 2E2IB 1T5XD 1ZXTA 3VYTA 2RDGA 2IX0A 1ZEQX 1M90C 4LFCQ 1PH2A 3A7LA 2K04A 1A3UA 3H3VH 3H0GG 1OO9B 3QOLA 1QWYA 4JI5L 4LW1A 5JVH3 4FF4A 2XWBB 4MTNA 4OXPA 2PQAB 2A8VA 3QOJA 1RTNA 4O0AA 2PI2A 5ELBA 5M5WB 1DOKA 2F0QA 3R3OA 1UEBA 2K33A 1XMQQ 5D65A 4JBKA 1CHQD 4R4IA 3D6WA 1YHAA 4HEDA 4AQYQ 2OQ0A 3EA6A 3RLOA 1NUCA 5GAEC 4N9PA 4ODGA 3CCMA 2I5MX 2YTYA 3CPWA 2HHHQ 3ULLA 1PH8A 1EEID 1VDZA 3GTJB 1XNRL 5I9PA 5JVG3 5KRUA 3U9SA 4CDCC 1EY6A 4K8IA 2C9OA 1VQBA 1EWIA 4DV0L 1HNXL 5IP9G 1LM0A 1PTOC 2F0DA 2XN9C 5CV8A 4O1NA 4PZ8A 3SK8A 5ELFA 3PUVA 2ZJPA 1PRTD 5FLXL 2J0TD 1NSNS 1CQFA 4GKJL 4X3SA 5C3WA 3PUWA 3J81c 4P73A 2B2WA 2AUJD 2ASBA 1AZPA 1PZJD 4A3MH 3MXNA 3K5OA 1QCBD 3VR3A 1LV9A 4MNOA 1BNZA 2L0CA 1PFNA 2LKVA 3IAYA 3HOXB 5I4DA 2X6LA 1TWGB 2XGTA 1NE3A 2E76C 1I3QB 3K59A 1CTMA 1QZGA 2A6HD 4OO1I 5F2DA 1A2UA 3NWTA 4YY3L 1WI5A 4R4CA 1EY7A 3OTOQ 3I2ZA 3TP7A 4L6TB 2AKWB 4LUZA 1I4GA 4J15A 2NTTA 2MFIA 3GP7A 4A3DH 1Q8IA 3R2TA 4HIDA 1JE5A 4Q0FA 4A3MB 2GVBA 5TSSA 1B44D 1VMCA 2MHVA 2F0VA 1IW7C 1CSPA 3MXNB 1GJXA 1KAWA 1NCVA 3F2CA 4LFAL 3IFDA 5IGBA 5M3MH 3J81i 5I2XA 2WACA 4CGYB 3SVMA 4DV3L 2SOBA 3V96A 1SXTA 2LS01 4DR5Q 3E5SA 2F4IA 3C1EA 1H9SA 4GN4B 3I4NH 1ET6A 1Q8KA 3F8TA 3GV3A 1LTLA 5IYDH 1TVXA 2RSOA 2JP1A 1N34Q 4RCNA 1S5ED 2RKSA 4QQBX 1K8AC 2EJGC 1VQ4A 2F3VA 1PZKD 1VS0A 3L2PA 2F0PA 3CCLA 1NMFA 2ZM6Q 1C8CA 3HOWB 3PV0A 1YEZA 1LT6D 4HIMA 2KJXA 3S1RH 4G7OC 2NZ1D 2Y0SE 5C3EB 5M3MB 5K36G 1A62A 5EPKA 4KD3A 3J81E 5GADC 3W1GA 1N9WA 2FHTA 3GTKH 5JJLA 2BDNA 1H9SB 1SNPA 5FLMH 4AYBE 5M5YH 3K0YA 1B53A 5IT9L 1K8GA 2EYLA 3MEFA 4K0KQ 4UHVA 1YNNC 1O7YA 4R1JA 3AFPA 1RIPA 5HY6A 3RN5A 2M9VA 2MJ8A 4JC0A 4A3EH 4LFBL 4XT3B 4DN4M 4DR4L 2JA7H 4GLVB 4YCWA 1J6QA 1U4LA 2BA1A 4YHHL 3AB9A 4HJ7A 3S1QB 4BBSG 4A3KG 1EIFA 3H09A 2ENBA 4HSPA 5COYA 2EQSA 3FKIB 4LFCL 1DGSA 4C3HG 2EY6A 2C5CA 1KHIA 3S16H 1Z7TA 4U68A 1ENAA 2RVLA 1S5FD 2B63B 1TS2A 2SEBD 4H02A 1TIID 3CPFA 5IY0A 2PO4A 2CFMA 2NVQH 1CKNA 3DM3A 1VF5C 2ICIA 4NXNL 1ESFA 2CW0D 1BDOA 2Z1CA 3CU7A 3R93A 1WJJA 3M7GA 2JA8H 1JICA 1WYDA 4YWLA 2VNUD 1LTTD 4G7HC 3ITPA 4U673 4KY6A 3QG1A 4C56C 2KEDA 1PTOH 2F3WA 4BY1G 1VQ6A 4NP5A 4CBVA 4FXDA 1SYEA 2XIWA 3LNNA 3PO2B 1PVOA 2HQLA 4DNTB 1FNWA 2WAQB 4A76A 2EDGA 2UU9Q 1H9RA 2F0KA 2NUCA 4A3BB 1K3RA 3NENA 4DAPA 1ML0D 1BO0A 1HTLD 1F9RA 2R7ZH 1LO5D 1KXLA 4OX9Q 1I5FA 3KLSA 3OPOA 1CKNB 3Q23A 1Q86C 5AFWA 3CC2A 1U4MA 4YWKA 4L5RC 2F0FA 4FP5D 1SNDA 4ME3A 4F88A 4ZYSA 4A3FB 5C4ZA 1JJCB 2C35B 3QB3A 5IYBG 2UXDL 1PTOB 4CJ2C 1NBWA 3C1FA 2VUMH 3W3AA 1O7LA 3HG9A 2DY7A 2O5IC 3A0JA 1U4RA 5EPLA 5C0XI 1CK1A 3AEVA 3DUZA 3J80L 1CI3M 4LUVA 1VQCA 2B2TC 4GZYC 3A8KE 5CORA 3CAMA 3A54A 3A5UA 3DXJC 3DHQA 4L5SA 1LTID 2H1EA 1K8MA 2QDBA 1I6VC 4XT1B 4POGA 3I7FA 2NYZD 1VQKA 4A3LH 3ERQA 3EVQA 1WTOA 1MJCA 2JA6H 5IP7H 4XQNA 1QNKA 1RKNA 1LYLA 1PFSA 3A5ZB 3CCRA 2EVBA 5JJZA 3FHWA 3S14H 4R9WA 1ICFB 2EZVA 4RCOA 4A3JH 1EIHA 1ICWA 1G6ZA 5C4XH 1XYIA 4IFDH 3M3YB 4K6DA 3L0OA 1EY4A 4TSSA 2RCFA 3I4MH 4JI3Q 3EBEA 1II3A 2N88A 1N34L 3OHXC 5JPNC 3LWEA 3G6JB 4ZLTF 2KCMA 1JOQA 1TKWB 4XIGS 2F0EA 1PDQA 4AH6A 1IYJB 1IHZA 1N32L 4QY7A 1XPOA 1EZ8A 3HKZG 3CF5A 1N33Q 1Y14B 1XXGA 4B08A 1ZKOA 4BBRG 4LF6Q 4A3JB 4X64L 1IYVA 3M4OH 3H0GH 3KBGA 1DONA 2XWJB 3V05A 1HNWQ 2OWOA 1AEXA 4PZ7A 3E3XA 4H44C 5DEHA 3I4MB 2KHJA 2PCFB 3MWYW 3CCUA 4DR7L 4R4QA 1B70B 1GHJA 3SK4A 1BUVT 1U0LA 3P20A 3CCVA 4RHRA 2QGQA 4K0KL 2PYKA 3U4ZA 1AFPA 1KLUD 3JC66 4Y52H 2EYPA 2K5VA 1YI2A 2FJ2A 5FJ8H 5E4XA 1PH4A 2VB3X 4RGNA 1S40A 1E0BA 4DU9A 1E2VA 5BN3A 1YNJC 1V1QA 1XTDA 5J1ZA 3RN2A 5IP9H 1CA6A 1MSHA 1SNOA 2OXPA 3M4OB 3DEOA 2ZXOA 4L5TA 1FYCA 1DD2A 4ULLA 1X65A 3KDFA 1K73C 1STYA 4F7XA 2HQEA 3NWSA 1KD1C 4BXXG 2ZTEA 3GDEA 1C0AA 1HNXQ 2CKZB 4C3JB 3K7AH 3TS2A 3S15B 2K28A 1VQLA 4A3IG 1B3AA 4DNRB 2LY7A 3BU2A 2VQFL 1ZYRD 1W6KA 2HCIA 5G3LF 2M2LA 1QILA 3PSIA 4J6HA 4GKJQ 4XQJA 2YV5A 2R93G 2DNCA 2Q2IA 1D1IA 1SMXA 4A3GG 4IUNA 4YIJA 4LUOA 1PH1A 1PH3A 1PH6A 1VQNA 3PIP3 2RHSB 1STAA 4XQQA 1SYCA 2P5ZX 1QJOA 1IYUA 4B3TL 3GTOB 2IY5B 1X3PA 3Q24A
chains in the Genus database with same CATH topology
4LW1A 1X3FA 4A3MG 2WFWA 2JA9A 4MTNA 3PO3G 4YCUA 4OXPA 2PQAB 4X66L 2A8VA 5IE8A 4DUZL 4LF8L 1L2FA 4DV2L 4O0AA 2PI2A 2UUCQ 3CD6A 1GD7A 1VQIA 1PH9A 1UEBA 1XMQQ 3TQYA 1SRUA 4JI6Q 4DV5Q 1N36Q 4JBKA 2E5LL 4R4IA 4DR6L 4POFA 3S1QH 4GNXC 1YHAA 4GS3A 3M4QA 3CW2C 1KQSA 2VQEL 4KHZA 1P8LA 1YJ9A 5JEAG 4AQYQ 4JI4L 2OQ0A 4JBMA 2E8GA 2Z6KC 5IT9c 3RLOA 5GAEC 4DR1Q 3FKIH 3CCMA 2I5MX 2YTYA 3CPWA 2HHHQ 3ULLA 1KRTA 1PH8A 2F4VQ 1XNRL 5DLQE 1XMOQ 4HJ9A 4B3RQ 4DV7Q 4JI7L 2B63H 4XTCS 1PH5A 3HOZG 1VQBA 1EWIA 4DV0L 3CCQA 1N8RC 1HNXL 5IP9G 1EFWA 3HOUH 2LXKA 3J7ZC 1LM0A 5HGQA 1JJ2A 1L1OA 4LFAQ 4PZ8A 2UUAQ 3HOWG 1IBKQ 2HT1A 2JEAI 4A93G 2R93H 2NVYH 3PUVA 1J5EL 3K81C 2NN6I 3HFZB 4DKAC 1HZAA 2ZJPA 1NY4A 4A3GH 1K83H 1OXSC 1OXVA 3S17H 3PIPA 2UXBQ 2VW9A 1VQDA 1UE6A 5FLXc 4Y7NH 5C3EG 5M3MG 1EOVA 2KENA 4JYAQ 3T1HL 1IZ6A 4R4OA 4GKJL 3UDFA 3J81c 3PUWA 4P73A 1P16A 1VQ5A 1QZHA 1I6HH 4LF5Q 4GKKL 4LF4L 4O2DA 2ASBA 2BH2A 4PMWA 4IOAA 4DV1Q 2HIVA 4A3MH 1X3EA 5LMNQ 3PO2H 3OYYA 4B3MQ 3F2DA 3PO3H 2ZTDA 4MNOA 5IYDG 4JV5L 4C2MH 3PUZA 4A3BH 4JBWA 1YHQA 2XGTA 1K0RA 1NE3A 3M9BA 4BA2I 4UY8C 1QZGA 2UXCQ 4OO1I 2JA5H 4HJAA 3G48A 2Q2TA 4YY3L 1WI5A 1XMQL 1L1OB 4R4CA 1HJPA 4DV5L 2NVTH 3RZOH 3OTOQ 3I2ZA 2ZJQA 2AKWB 1FJGQ 4LUZA 4AQYL 2B29A 2XTIA 4J15A 1TXYA 5GAGC 4JI0Q 3HOZH 2RCNA 4A3FH 5IWAQ 2MFIA 4DK6C 5ELOA 2HHHL 2YTVA 4A3DH 3CMEA 4JI3L 2EXDA 4HIDA 1JE5A 1E1OA 1XMOL 1TWCH 3HKSA 4B3RL 3PF5A 1HH2P 2GVBA 2IT1A 1ASZA 3PF4A 1V9PA 1WCMH 1FVIA 3U4VA 1JB7A 4YCVA 1MIUA 1FGUA 1CSPA 3MXNB 5C0XG 3GTQH 1KAWA 2N3SA 2PQAA 3F2CA 4LFAL 1D7QA 4OWXB 3FKIG 2A19A 5M3MH 3J81i 2Q2UA 4DV3L 2ES2A 1IBKL 4BBSH 4JG2A 4A3KH 4DR5Q 3S1NH 2PI2E 2I5LX 2N49A 1N33L 4DV6Q 2UXBL 1PHJA 1QUQA 1O7IA 2B63G 4YWMA 4GN4B 1VQOA 2UUBQ 3I4NH 3RR5A 4JYAL 2WB1G 1HR0Q 1Q8KA 3HOUG 4DR4Q 3GO5A 3F8TA 1LTLA 3KJPA 1KRSA 5IYDH 5EAYA 1X3GA 1N34Q 1X54A 4EQ5A 4LF5L 4QQBX 1K8AC 1PYBA 3I55A 4JI1Q 1VQ4A 1GVPA 4NPSA 1VS0A 3BJUA 4B3ML 3L2PA 2KBNA 3CCLA 4HJ8A 1VQ8A 1SN8A 4P71A 1NMFA 2ZM6Q 2GN5A 3PV0A 4DR3Q 1YEZA 4HIMA 3E9IA 4P74A 4IFDI 5BR8Q 1G291 3S1RH 1PH7A 3KYHC 2UXCL 2Z0SA 4OONA 1BBUA 2Y0SE 2JJQA 2K14A 3NBHB 4IFDJ 3M3YH 5K36G 1A62A 1I50H 1S3OA 3IRBA 3PO2G 1Y1VG 1Z9FA 2WAQG 4RMFA 1NTGA 4DAYB 4BY1H 1VQFA 1JJGA 5GADC 3W1GA 4NXNQ 3OTOL 3RNUA 3NEMA 4NXMQ 1N9WA 1L1OC 1OXXK 2NZHA 4A3BG 1FJGL 3GTKH 2KHIA 3LGJA 1BVSA 5H1SE 5JJLA 1VQEA 1QUQB 4AIMA 5FLMH 5ELNA 4AYBE 3KF8B 2JA5G 5M5YH 3HOYH 1K8GA 5E7NA 1PV4A 4LF9Q 3MEFA 4K0KQ 1ASYA 2A1AA 5GROA 2YU9H 1WFQA 3G6EA 1Q1EA 2MQHA 2NN6G 4A3FG 4R1JA 1VQPA 1XNQL 2V1CC 3AFPA 1RIPA 1T9HA 5HY6A 3RN5A 4A3DG 2D0OA 4JC0A 4X65L 2BH8A 4A3EH 3K0XA 1X9NA 2CWAA 5LMNW 4DR5L 2ID0A 3B6YA 4DV6L 1I94Q 4LFBL 1CUKA 1WCMG 1Q12A 5IYBH 3TRZA 1S72A 1HR0L 4DR4L 4TQUS 4TVAB 4GLVB 2JA7H 4YCWA 1J6QA 3ZJYC 1C7YA 1D8LA 4X62Q 1AE3A 2BA1A 2BA0A 4YHHL 2JE6I 4KLKA 4HJ7A 3CMAA 1OXUA 2D0PA 4BBSG 1B7YB 5M3FG 4A3KG 4JI1L 1EIFA 3KFUA 2IHEA 4IJLA 1XJVA 3HKZE 1Q81C 1QVGA 3HOVG 2EQSA 1QVFA 1HNZL 5JEAJ 3I4NG 4LFCL 2ZM6L 1DGSA 1GM5A 2UXDQ 1Y1VH 4HJ5A 4HIOA 1X6OA 1KHIA 3S16H 3E0EA 3GTGH 1YBYA 5C44G 3I56A 2MO1A 2K5HA 4H02A 3CPFA 2CQOA 5IY0A 3CC7A 1E3PA 1WOCA 2CFMA 4IJHA 2F3IA 1CKNA 3DM3A 3CCEA 4DUYQ 2NVQH 4B3SQ 3L7ZC 4NXNL 2HIXA 2UUCL 3K8AA 4NXML 2VZAA 4JI6L 1WJJA 5IYCG 2EIFA 4LF7Q 1A63A 1N36L 3AFQA 2JA8H 1WYDA 4DR2Q 2L15A 3M85A 2WP8J 3PUXA 4YWLA 1EUJA 2VNUD 3AYHB 4JOIA 1YZ6A 2AMCB 2N78A 4DR1L 1X56A 3K80C 5C4JH 1KC8C 1M1KC 4BY1G 1VQMA 4LF9L 2B3GA 1VQ6A 3JAMc 4QL5A 2F4VL 4C3JH 1AE2A 4BA1I 3CCJA 4UP7A 1HR0W 3GTPH 1YNXA 2QA4A 4NB3A 3KJOA 4JI5Q 3S15H 4DV7L 2PNHA 1IL2A 1PVOA 2HQLA 1CKMA 1E24A 4A76A 3KF6A 5FLMG 3W1BA 2UU9Q 3GD7A 1K3RA 3NENA 4DV2Q 2UUAL 2K4KA 1GO3E 2R7ZH 3HOYG 3S2HH 4JI8Q 3WWVA 4DV4Q 5IP7G 1R9TH 1KXLA 4OX9Q 5M3FH 1I5FA 2E5LQ 1VQAA 2RF4A 4LNQA 1KIXA 1EYGA 3HOVH 1UWVA 2AWNA 5LMUQ 2E2IH 1CKNB 1VQGA 3H3VI 4X62L 1Q86C 4C3HH 3CC2A 4YWKA 2YTXA 4L5RC 4MZ9A 5AJ3Q 3T1YQ 1Q82C 4IOCA 2PMZE 4IO9A 4A3EG 2OQKA 5C44H 4A3JG 1XNRQ 4X6AH 4JBJA 1SR3A 3EIVA 4ME3A 4WJ3M 4DV1L 3GTOH 1JJCB 2C35B 1Q46A 5IYBG 2UXDL 1W3SA 5LMNL 4DV0Q 1CKOA 1NBWA 2WB1E 2JA7G 2VUMH 3I4MG 3STBC 3RLNA 4C3IH 1N32Q 1E22A 5GAHC 1NJIC 3A0JA 1YJNA 5IYCH 1W2BA 3PCOB 3J80c 5M5WH 5C0XI 5GQOA 2VL6A 3AEVA 4IPCA 2OCEA 3CC4A 1HZCA 3STBD 1XPUA 4LUVA 3TREA 1VQCA 4QJFA 2H5XA 3KF6B 5C0XJ 1FL0A 3CAMA 4IPGA 2MO0A 1JMCA 3A5UA 3DLLA 2CCZA 4A4IA 3JAMi 2ALYB 4X64Q 4JI2Q 4L5SA 4DR2L 3FP9A 2N8NA 1AH9A 3GTJH 5JJKA 4HIKA 4GOPA 1IBLQ 4POGA 4GN5A 4JI0L 3I7FA 1VQKA 5IWAL 4LWCA 4DR7Q 3Q8DA 2WAQE 2E2JH 3S24A 1SLJA 2ZTCA 4BY7G 1MJEA 4A3LH 2R92G 4JV5Q 1MKHA 3KDFB 5M5XH 3UE1A 4KHPQ 1MJCA 1PYSB 1Y1WH 5IP7H 2AWOA 3CXCA 2JA6H 2JA8G 2OTJA 1B8AA 2JK8A 2R7DA 1LYLA 1C9OA 1PFSA 3ERSX 3A5ZB 2MNAA 3CCRA 3D0FA 2UU9L 4AYBG 2KCTA 3FHWA 3ULPA 3S14H 1VCIA 2VY3A 2F52A 4JI8L 4YY3Q 3UE0A 4DV4L 2R7FA 1EIYB 4A3CH 4OX9L 4A3JH 4DK3C 3M7NA 1TWFH 4DPGA 5C4XH 3EN2A 4BXXH 3GTLH 5LMUL 2UUBL 3F2BA 3L0OA 1EQQA 2AHOB 3UDIA 2K50A 3VDYA 1G6PA 5AJ3L 3M4PA 4KI0A 3T1YL 3I4MH 2I5HA 5FJ8G 1JT8A 4JI3Q 3EBEA 1N34L 1OXTA 2R7ZG 1SE8A 3J80i 2IHFA 4A3IH 3HOXH 1A8VA 3GTMH 1V43A 1TWGH 2KCMA 3G71A 4P75A 3CCSA 3CP0A 4GOPB 1I3QH 2OTLA 5J3BA 1SROA 4XIGS 4IPHA 3RZDH 1L0WA 3CQZH 4JOIC 1IYJB 2D62A 4AH6A 4DR3L 2K75A 4A75A 4OO1G 1N32L 4DV3Q 4FDBA 4QY7A 5BR8L 1XPOA 4GNXA 1CSQA 1UE7A 1BKBA 2LSSA 3HKZG 3CF5A 3UDGA 1N33Q 1Y14B 2Z6KA 2IX1A 2DGYA 1UE1A 4BBRG 1IBMQ 2I0QA 1YJWA 3S2DH 2VQFQ 2VUMG 1LUZA 4LF6Q 1Q7YC 4GLAC 4X64L 4UP9A 4JI2L 4BY7H 2R92H 3H0GH 3M4OH 4UP8A 3BZCA 1X55A 4DAMA 4PZ6A 1IBLL 1HNWQ 2OWOA 1HZBA 4PZ7A 2E2HH 2KHJA 4DR7L 3CCUA 2Q2HA 3OW2A 4R4QA 1B70B 2NZOA 3ER0A 3UDXA 2K5NA 1VQHA 2JQOA 4KHPL 1U0LA 4APVA 3TEHB 3ULJA 3CCVA 1K9MC 2QGQA 4RG1A 4QGUA 4K0KL 1OTCA 4B3TQ 3U4ZA 2GVAA 1KL9A 3K7UC 1U5KA 3JC66 4Y52H 4X66Q 2LXJA 2K5VA 4DUZQ 1YI2A 4LF8Q 4PG3A 5FJ8H 3PIOA 4A3LG 3KLWA 4OWTB 1G51A 1PH4A 1GKHA 2DUDA 3I4OA 4GNXB 1Y1WG 2JA6G 3F1ZA 3TS0A 3NELA 1S40A 2FXQA 2JEBI 1I94L 4EX5A 1VQ7A 3D31A 4DR6Q 1QVCA 3U58A 4R4TA 1V1QA 1XTDA 3PGZA 3RLFA 2VQEQ 5IP9H 2ZJRA 4GLXA 3RN2A 4WJ4A 4JI4Q 1SFOH 1EQRA 4L5TA 1YIJA 2NVXH 1X65A 4DNIA 3A74A 2RHQB 4A3CG 3HOWH 5JJIA 3KDFA 1K73C 1RL2A 1VQJA 3J81j 1IXRA 1H95A 4IPDA 4A93H 3ICEA 1PA6A 1KD1C 4BXXG 4IFDG 2YYZA 2ZTEA 5C4XG 3AQQA 1VQ9A 4JI7Q 3BZKA 4GOPC 4BBRH 3GDEA 3S1MH 4OWWB 5C3EH 1XNQQ 1C0AA 1HNXQ 2CKZB 4QIWE 2K52A 3K7AH 3TS2A 2VS1A 1HZ9A 4P72A 4X65Q 1NMGA 3KOJA 1VQLA 1TWAH 1YHBA 4A3IG 3HOXG 1YITA 4ALPA 4LFBQ 1J5EQ 1BBWA 1IBML 2R6GA 3BU2A 2VQFL 3G4SA 4DUYL 4LF6L 4B3SL 3U50C 1TWHH 3E9HA 3PSIA 1Z47A 3T1HQ 4YHHQ 4GKJQ 4LF7L 1UE5A 2YV5A 1A0IA 4JCVE 2R93G 1E1TA 2Q2IA 1HNWL 4GN3B 4UPAA 1SMXA 2Y0SG 4L5QA 1YVCA 4A3GG 4GKKQ 1XPRA 4LF4Q 2ATWA 3H15A 4LUOA 1PH1A 1HNZQ 2IX0A 3W5OA 1PH3A 1M90C 4LFCQ 1PH6A 1PH2A 1VQNA 2RHSB 3H3VH 3SGIA 2CWPA 3H0GG 2QEXA 3J7A5 1E7ZA 2IY5B 4B3TL 3PUYA 4JI5L 1Q1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LW1 A;  1X3F A;  4A3M G;  2WFW A;  2JA9 A;  4MTN A;  3PO3 G;  4YCU A;  4OXP A;  2PQA B;  4X66 L;  2A8V A;  5IE8 A;  4DUZ L;  4LF8 L;  1L2F A;  4DV2 L;  4O0A A;  2PI2 A;  2UUC Q;  3CD6 A;  1GD7 A;  1VQI A;  1PH9 A;  1UEB A;  1XMQ Q;  3TQY A;  1SRU A;  4JI6 Q;  4DV5 Q;  1N36 Q;  4JBK A;  2E5L L;  4R4I A;  4DR6 L;  4POF A;  3S1Q H;  4GNX C;  1YHA A;  4GS3 A;  3M4Q A;  3CW2 C;  1KQS A;  2VQE L;  4KHZ A;  1P8L A;  1YJ9 A;  5JEA G;  4AQY Q;  4JI4 L;  2OQ0 A;  4JBM A;  2E8G A;  2Z6K C;  5IT9 c;  3RLO A;  5GAE C;  4DR1 Q;  3FKI H;  3CCM A;  2I5M X;  2YTY A;  3CPW A;  2HHH Q;  3ULL A;  1KRT A;  1PH8 A;  2F4V Q;  1XNR L;  5DLQ E;  1XMO Q;  4HJ9 A;  4B3R Q;  4DV7 Q;  4JI7 L;  2B63 H;  4XTC S;  1PH5 A;  3HOZ G;  1VQB A;  1EWI A;  4DV0 L;  3CCQ A;  1N8R C;  1HNX L;  5IP9 G;  1EFW A;  3HOU H;  2LXK A;  3J7Z C;  1LM0 A;  5HGQ A;  1JJ2 A;  1L1O A;  4LFA Q;  4PZ8 A;  2UUA Q;  3HOW G;  1IBK Q;  2HT1 A;  2JEA I;  4A93 G;  2R93 H;  2NVY H;  3PUV A;  1J5E L;  3K81 C;  2NN6 I;  3HFZ B;  4DKA C;  1HZA A;  2ZJP A;  1NY4 A;  4A3G H;  1K83 H;  1OXS C;  1OXV A;  3S17 H;  3PIP A;  2UXB Q;  2VW9 A;  1VQD A;  1UE6 A;  5FLX c;  4Y7N H;  5C3E G;  5M3M G;  1EOV A;  2KEN A;  4JYA Q;  3T1H L;  1IZ6 A;  4R4O A;  4GKJ L;  3UDF A;  3J81 c;  3PUW A;  4P73 A;  1P16 A;  1VQ5 A;  1QZH A;  1I6H H;  4LF5 Q;  4GKK L;  4LF4 L;  4O2D A;  2ASB A;  2BH2 A;  4PMW A;  4IOA A;  4DV1 Q;  2HIV A;  4A3M H;  1X3E A;  5LMN Q;  3PO2 H;  3OYY A;  4B3M Q;  3F2D A;  3PO3 H;  2ZTD A;  4MNO A;  5IYD G;  4JV5 L;  4C2M H;  3PUZ A;  4A3B H;  4JBW A;  1YHQ A;  2XGT A;  1K0R A;  1NE3 A;  3M9B A;  4BA2 I;  4UY8 C;  1QZG A;  2UXC Q;  4OO1 I;  2JA5 H;  4HJA A;  3G48 A;  2Q2T A;  4YY3 L;  1WI5 A;  1XMQ L;  1L1O B;  4R4C A;  1HJP A;  4DV5 L;  2NVT H;  3RZO H;  3OTO Q;  3I2Z A;  2ZJQ A;  2AKW B;  1FJG Q;  4LUZ A;  4AQY L;  2B29 A;  2XTI A;  4J15 A;  1TXY A;  5GAG C;  4JI0 Q;  3HOZ H;  2RCN A;  4A3F H;  5IWA Q;  2MFI A;  4DK6 C;  5ELO A;  2HHH L;  2YTV A;  4A3D H;  3CME A;  4JI3 L;  2EXD A;  4HID A;  1JE5 A;  1E1O A;  1XMO L;  1TWC H;  3HKS A;  4B3R L;  3PF5 A;  1HH2 P;  2GVB A;  2IT1 A;  1ASZ A;  3PF4 A;  1V9P A;  1WCM H;  1FVI A;  3U4V A;  1JB7 A;  4YCV A;  1MIU A;  1FGU A;  1CSP A;  3MXN B;  5C0X G;  3GTQ H;  1KAW A;  2N3S A;  2PQA A;  3F2C A;  4LFA L;  1D7Q A;  4OWX B;  3FKI G;  2A19 A;  5M3M H;  3J81 i;  2Q2U A;  4DV3 L;  2ES2 A;  1IBK L;  4BBS H;  4JG2 A;  4A3K H;  4DR5 Q;  3S1N H;  2PI2 E;  2I5L X;  2N49 A;  1N33 L;  4DV6 Q;  2UXB L;  1PHJ A;  1QUQ A;  1O7I A;  2B63 G;  4YWM A;  4GN4 B;  1VQO A;  2UUB Q;  3I4N H;  3RR5 A;  4JYA L;  2WB1 G;  1HR0 Q;  1Q8K A;  3HOU G;  4DR4 Q;  3GO5 A;  3F8T A;  1LTL A;  3KJP A;  1KRS A;  5IYD H;  5EAY A;  1X3G A;  1N34 Q;  1X54 A;  4EQ5 A;  4LF5 L;  4QQB X;  1K8A C;  1PYB A;  3I55 A;  4JI1 Q;  1VQ4 A;  1GVP A;  4NPS A;  1VS0 A;  3BJU A;  4B3M L;  3L2P A;  2KBN A;  3CCL A;  4HJ8 A;  1VQ8 A;  1SN8 A;  4P71 A;  1NMF A;  2ZM6 Q;  2GN5 A;  3PV0 A;  4DR3 Q;  1YEZ A;  4HIM A;  3E9I A;  4P74 A;  4IFD I;  5BR8 Q;  1G29 1;  3S1R H;  1PH7 A;  3KYH C;  2UXC L;  2Z0S A;  4OON A;  1BBU A;  2Y0S E;  2JJQ A;  2K14 A;  3NBH B;  4IFD J;  3M3Y H;  5K36 G;  1A62 A;  1I50 H;  1S3O A;  3IRB A;  3PO2 G;  1Y1V G;  1Z9F A;  2WAQ G;  4RMF A;  1NTG A;  4DAY B;  4BY1 H;  1VQF A;  1JJG A;  5GAD C;  3W1G A;  4NXN Q;  3OTO L;  3RNU A;  3NEM A;  4NXM Q;  1N9W A;  1L1O C;  1OXX K;  2NZH A;  4A3B G;  1FJG L;  3GTK H;  2KHI A;  3LGJ A;  1BVS A;  5H1S E;  5JJL A;  1VQE A;  1QUQ B;  4AIM A;  5FLM H;  5ELN A;  4AYB E;  3KF8 B;  2JA5 G;  5M5Y H;  3HOY H;  1K8G A;  5E7N A;  1PV4 A;  4LF9 Q;  3MEF A;  4K0K Q;  1ASY A;  2A1A A;  5GRO A;  2YU9 H;  1WFQ A;  3G6E A;  1Q1E A;  2MQH A;  2NN6 G;  4A3F G;  4R1J A;  1VQP A;  1XNQ L;  2V1C C;  3AFP A;  1RIP A;  1T9H A;  5HY6 A;  3RN5 A;  4A3D G;  2D0O A;  4JC0 A;  4X65 L;  2BH8 A;  4A3E H;  3K0X A;  1X9N A;  2CWA A;  5LMN W;  4DR5 L;  2ID0 A;  3B6Y A;  4DV6 L;  1I94 Q;  4LFB L;  1CUK A;  1WCM G;  1Q12 A;  5IYB H;  3TRZ A;  1S72 A;  1HR0 L;  4DR4 L;  4TQU S;  4TVA B;  4GLV B;  2JA7 H;  4YCW A;  1J6Q A;  3ZJY C;  1C7Y A;  1D8L A;  4X62 Q;  1AE3 A;  2BA1 A;  2BA0 A;  4YHH L;  2JE6 I;  4KLK A;  4HJ7 A;  3CMA A;  1OXU A;  2D0P A;  4BBS G;  1B7Y B;  5M3F G;  4A3K G;  4JI1 L;  1EIF A;  3KFU A;  2IHE A;  4IJL A;  1XJV A;  3HKZ E;  1Q81 C;  1QVG A;  3HOV G;  2EQS A;  1QVF A;  1HNZ L;  5JEA J;  3I4N G;  4LFC L;  2ZM6 L;  1DGS A;  1GM5 A;  2UXD Q;  1Y1V H;  4HJ5 A;  4HIO A;  1X6O A;  1KHI A;  3S16 H;  3E0E A;  3GTG H;  1YBY A;  5C44 G;  3I56 A;  2MO1 A;  2K5H A;  4H02 A;  3CPF A;  2CQO A;  5IY0 A;  3CC7 A;  1E3P A;  1WOC A;  2CFM A;  4IJH A;  2F3I A;  1CKN A;  3DM3 A;  3CCE A;  4DUY Q;  2NVQ H;  4B3S Q;  3L7Z C;  4NXN L;  2HIX A;  2UUC L;  3K8A A;  4NXM L;  2VZA A;  4JI6 L;  1WJJ A;  5IYC G;  2EIF A;  4LF7 Q;  1A63 A;  1N36 L;  3AFQ A;  2JA8 H;  1WYD A;  4DR2 Q;  2L15 A;  3M85 A;  2WP8 J;  3PUX A;  4YWL A;  1EUJ A;  2VNU D;  3AYH B;  4JOI A;  1YZ6 A;  2AMC B;  2N78 A;  4DR1 L;  1X56 A;  3K80 C;  5C4J H;  1KC8 C;  1M1K C;  4BY1 G;  1VQM A;  4LF9 L;  2B3G A;  1VQ6 A;  3JAM c;  4QL5 A;  2F4V L;  4C3J H;  1AE2 A;  4BA1 I;  3CCJ A;  4UP7 A;  1HR0 W;  3GTP H;  1YNX A;  2QA4 A;  4NB3 A;  3KJO A;  4JI5 Q;  3S15 H;  4DV7 L;  2PNH A;  1IL2 A;  1PVO A;  2HQL A;  1CKM A;  1E24 A;  4A76 A;  3KF6 A;  5FLM G;  3W1B A;  2UU9 Q;  3GD7 A;  1K3R A;  3NEN A;  4DV2 Q;  2UUA L;  2K4K A;  1GO3 E;  2R7Z H;  3HOY G;  3S2H H;  4JI8 Q;  3WWV A;  4DV4 Q;  5IP7 G;  1R9T H;  1KXL A;  4OX9 Q;  5M3F H;  1I5F A;  2E5L Q;  1VQA A;  2RF4 A;  4LNQ A;  1KIX A;  1EYG A;  3HOV H;  1UWV A;  2AWN A;  5LMU Q;  2E2I H;  1CKN B;  1VQG A;  3H3V I;  4X62 L;  1Q86 C;  4C3H H;  3CC2 A;  4YWK A;  2YTX A;  4L5R C;  4MZ9 A;  5AJ3 Q;  3T1Y Q;  1Q82 C;  4IOC A;  2PMZ E;  4IO9 A;  4A3E G;  2OQK A;  5C44 H;  4A3J G;  1XNR Q;  4X6A H;  4JBJ A;  1SR3 A;  3EIV A;  4ME3 A;  4WJ3 M;  4DV1 L;  3GTO H;  1JJC B;  2C35 B;  1Q46 A;  5IYB G;  2UXD L;  1W3S A;  5LMN L;  4DV0 Q;  1CKO A;  1NBW A;  2WB1 E;  2JA7 G;  2VUM H;  3I4M G;  3STB C;  3RLN A;  4C3I H;  1N32 Q;  1E22 A;  5GAH C;  1NJI C;  3A0J A;  1YJN A;  5IYC H;  1W2B A;  3PCO B;  3J80 c;  5M5W H;  5C0X I;  5GQO A;  2VL6 A;  3AEV A;  4IPC A;  2OCE A;  3CC4 A;  1HZC A;  3STB D;  1XPU A;  4LUV A;  3TRE A;  1VQC A;  4QJF A;  2H5X A;  3KF6 B;  5C0X J;  1FL0 A;  3CAM A;  4IPG A;  2MO0 A;  1JMC A;  3A5U A;  3DLL A;  2CCZ A;  4A4I A;  3JAM i;  2ALY B;  4X64 Q;  4JI2 Q;  4L5S A;  4DR2 L;  3FP9 A;  2N8N A;  1AH9 A;  3GTJ H;  5JJK A;  4HIK A;  4GOP A;  1IBL Q;  4POG A;  4GN5 A;  4JI0 L;  3I7F A;  1VQK A;  5IWA L;  4LWC A;  4DR7 Q;  3Q8D A;  2WAQ E;  2E2J H;  3S24 A;  1SLJ A;  2ZTC A;  4BY7 G;  1MJE A;  4A3L H;  2R92 G;  4JV5 Q;  1MKH A;  3KDF B;  5M5X H;  3UE1 A;  4KHP Q;  1MJC A;  1PYS B;  1Y1W H;  5IP7 H;  2AWO A;  3CXC A;  2JA6 H;  2JA8 G;  2OTJ A;  1B8A A;  2JK8 A;  2R7D A;  1LYL A;  1C9O A;  1PFS A;  3ERS X;  3A5Z B;  2MNA A;  3CCR A;  3D0F A;  2UU9 L;  4AYB G;  2KCT A;  3FHW A;  3ULP A;  3S14 H;  1VCI A;  2VY3 A;  2F52 A;  4JI8 L;  4YY3 Q;  3UE0 A;  4DV4 L;  2R7F A;  1EIY B;  4A3C H;  4OX9 L;  4A3J H;  4DK3 C;  3M7N A;  1TWF H;  4DPG A;  5C4X H;  3EN2 A;  4BXX H;  3GTL H;  5LMU L;  2UUB L;  3F2B A;  3L0O A;  1EQQ A;  2AHO B;  3UDI A;  2K50 A;  3VDY A;  1G6P A;  5AJ3 L;  3M4P A;  4KI0 A;  3T1Y L;  3I4M H;  2I5H A;  5FJ8 G;  1JT8 A;  4JI3 Q;  3EBE A;  1N34 L;  1OXT A;  2R7Z G;  1SE8 A;  3J80 i;  2IHF A;  4A3I H;  3HOX H;  1A8V A;  3GTM H;  1V43 A;  1TWG H;  2KCM A;  3G71 A;  4P75 A;  3CCS A;  3CP0 A;  4GOP B;  1I3Q H;  2OTL A;  5J3B A;  1SRO A;  4XIG S;  4IPH A;  3RZD H;  1L0W A;  3CQZ H;  4JOI C;  1IYJ B;  2D62 A;  4AH6 A;  4DR3 L;  2K75 A;  4A75 A;  4OO1 G;  1N32 L;  4DV3 Q;  4FDB A;  4QY7 A;  5BR8 L;  1XPO A;  4GNX A;  1CSQ A;  1UE7 A;  1BKB A;  2LSS A;  3HKZ G;  3CF5 A;  3UDG A;  1N33 Q;  1Y14 B;  2Z6K A;  2IX1 A;  2DGY A;  1UE1 A;  4BBR G;  1IBM Q;  2I0Q A;  1YJW A;  3S2D H;  2VQF Q;  2VUM G;  1LUZ A;  4LF6 Q;  1Q7Y C;  4GLA C;  4X64 L;  4UP9 A;  4JI2 L;  4BY7 H;  2R92 H;  3H0G H;  3M4O H;  4UP8 A;  3BZC A;  1X55 A;  4DAM A;  4PZ6 A;  1IBL L;  1HNW Q;  2OWO A;  1HZB A;  4PZ7 A;  2E2H H;  2KHJ A;  4DR7 L;  3CCU A;  2Q2H A;  3OW2 A;  4R4Q A;  1B70 B;  2NZO A;  3ER0 A;  3UDX A;  2K5N A;  1VQH A;  2JQO A;  4KHP L;  1U0L A;  4APV A;  3TEH B;  3ULJ A;  3CCV A;  1K9M C;  2QGQ A;  4RG1 A;  4QGU A;  4K0K L;  1OTC A;  4B3T Q;  3U4Z A;  2GVA A;  1KL9 A;  3K7U C;  1U5K A;  3JC6 6;  4Y52 H;  4X66 Q;  2LXJ A;  2K5V A;  4DUZ Q;  1YI2 A;  4LF8 Q;  4PG3 A;  5FJ8 H;  3PIO A;  4A3L G;  3KLW A;  4OWT B;  1G51 A;  1PH4 A;  1GKH A;  2DUD A;  3I4O A;  4GNX B;  1Y1W G;  2JA6 G;  3F1Z A;  3TS0 A;  3NEL A;  1S40 A;  2FXQ A;  2JEB I;  1I94 L;  4EX5 A;  1VQ7 A;  3D31 A;  4DR6 Q;  1QVC A;  3U58 A;  4R4T A;  1V1Q A;  1XTD A;  3PGZ A;  3RLF A;  2VQE Q;  5IP9 H;  2ZJR A;  4GLX A;  3RN2 A;  4WJ4 A;  4JI4 Q;  1SFO H;  1EQR A;  4L5T A;  1YIJ A;  2NVX H;  1X65 A;  4DNI A;  3A74 A;  2RHQ B;  4A3C G;  3HOW H;  5JJI A;  3KDF A;  1K73 C;  1RL2 A;  1VQJ A;  3J81 j;  1IXR A;  1H95 A;  4IPD A;  4A93 H;  3ICE A;  1PA6 A;  1KD1 C;  4BXX G;  4IFD G;  2YYZ A;  2ZTE A;  5C4X G;  3AQQ A;  1VQ9 A;  4JI7 Q;  3BZK A;  4GOP C;  4BBR H;  3GDE A;  3S1M H;  4OWW B;  5C3E H;  1XNQ Q;  1C0A A;  1HNX Q;  2CKZ B;  4QIW E;  2K52 A;  3K7A H;  3TS2 A;  2VS1 A;  1HZ9 A;  4P72 A;  4X65 Q;  1NMG A;  3KOJ A;  1VQL A;  1TWA H;  1YHB A;  4A3I G;  3HOX G;  1YIT A;  4ALP A;  4LFB Q;  1J5E Q;  1BBW A;  1IBM L;  2R6G A;  3BU2 A;  2VQF L;  3G4S A;  4DUY L;  4LF6 L;  4B3S L;  3U50 C;  1TWH H;  3E9H A;  3PSI A;  1Z47 A;  3T1H Q;  4YHH Q;  4GKJ Q;  4LF7 L;  1UE5 A;  2YV5 A;  1A0I A;  4JCV E;  2R93 G;  1E1T A;  2Q2I A;  1HNW L;  4GN3 B;  4UPA A;  1SMX A;  2Y0S G;  4L5Q A;  1YVC A;  4A3G G;  4GKK Q;  1XPR A;  4LF4 Q;  2ATW A;  3H15 A;  4LUO A;  1PH1 A;  1HNZ Q;  2IX0 A;  3W5O A;  1PH3 A;  1M90 C;  4LFC Q;  1PH6 A;  1PH2 A;  1VQN A;  2RHS B;  3H3V H;  3SGI A;  2CWP A;  3H0G G;  2QEX A;  3J7A 5;  1E7Z A;  2IY5 B;  4B3T L;  3PUY A;  4JI5 L;  1Q1B A; 
#chains in the Genus database with same CATH topology
 2NB0 A;  2WFW A;  5FO9 B;  3K7A B;  4C3I B;  4YCU A;  4LF8 L;  2UUC Q;  1SYB A;  2FFK B;  1SRU A;  3NXW A;  2F0U A;  1BQQ T;  1I4H A;  4ME5 A;  5JJK A;  1KQS A;  1EU4 A;  3CW2 C;  2VQE L;  3OSO A;  4DK1 A;  5IT9 c;  3K58 A;  3HZX A;  3NTK A;  3T13 A;  4MTK A;  2F4V Q;  5DLQ E;  2EYF A;  4JI7 L;  1STN A;  4XTC S;  2F0T A;  4ZCK A;  3HOZ G;  4K8J A;  2K1B A;  3CCQ A;  1EFW A;  1PRT C;  1B4O A;  5HGQ A;  1L1O A;  4LFA Q;  1Y1W B;  2GA4 B;  5E3F A;  2O4X A;  2HT1 A;  1DOL A;  1J5E L;  2NN6 I;  3SR1 A;  4DKA C;  1NY4 A;  2VXW A;  3RUZ A;  1OXS C;  4JW0 A;  3S17 H;  3PIP A;  2VW9 A;  1VQD A;  4Y7N H;  1GUN A;  2KEN A;  1IZ6 A;  4R4O A;  1EQV A;  2A69 D;  5CV9 A;  4FYD A;  5D3I B;  1DCZ A;  1VQ5 A;  4CJ1 B;  1QZH A;  3GTL B;  3TZU A;  4IOA A;  2HIV A;  5K36 H;  4KN7 C;  1X3E A;  3PO3 H;  5DM7 3;  2E2D C;  2A6H C;  1GUT A;  4EVO A;  2ZXP A;  1K0R A;  5IIF A;  4UY8 C;  3RZD B;  1F77 A;  3G48 A;  2A68 D;  3CHB D;  1L1O B;  2A6E D;  4DV5 L;  2KOL A;  2Y0S B;  3RZO H;  4IUT A;  2ZJQ A;  2KCC A;  4Y7N B;  2B29 A;  1TXY A;  2B8F A;  3KK7 A;  3CME A;  4JI3 L;  1KLG D;  1XMO L;  2K6A A;  5E1F A;  4B3R L;  4M8A A;  1FVI A;  3PO3 B;  4AYB B;  5A35 A;  1FGU A;  3IKJ A;  2TMP A;  1TT2 A;  2N3S A;  2PQA A;  1V1P B;  5CBA E;  3C46 A;  2IX3 A;  2A73 B;  4X3T A;  4BBS H;  4JG2 A;  4A3K H;  5E4W C;  1E2Z A;  3S1N H;  2N49 A;  1N33 L;  1DXM A;  1QUQ A;  1AZQ A;  4YWM A;  1VQO A;  1PMR A;  3RR5 A;  4JYA L;  2WB1 G;  3HOU G;  4DR4 Q;  2QEJ C;  3KJP A;  1X3G A;  1X54 A;  4EQ5 A;  4LF5 L;  3CRK C;  1SMY C;  1HHV A;  2IW3 A;  3I55 A;  3A8I E;  1GVP A;  4O42 A;  3BJU A;  3I4L A;  4B3M L;  2MPM A;  3O13 A;  2NVX B;  1VQ8 A;  1SN8 A;  4P71 A;  1RTO A;  1WTP A;  2GN5 A;  1LTB D;  5CC4 A;  4DR3 Q;  3NE5 B;  4FXG C;  4A93 B;  3E9I A;  4P74 A;  1G29 1;  5D14 A;  5G3L D;  2PNR C;  4PQX A;  5CBE E;  2UXC L;  4KY7 A;  2RBM A;  3NPP A;  3NBH B;  1V8Q A;  1Y1V G;  1Z9F A;  4RMF A;  1H9K A;  4RH6 A;  4BY1 H;  2XRQ D;  4NXN Q;  1TWA B;  3DMU A;  1TY0 A;  1MI2 A;  1FJG L;  2KHI A;  2Z6B A;  2EJM A;  1VQE A;  1QUQ B;  1BCP C;  5D3D A;  1QOH A;  2PZU A;  1B50 A;  2JA5 G;  4K2K A;  3FEW X;  1LT4 D;  1EYC A;  1K28 A;  5C5L A;  3T56 B;  4DF7 A;  2A1A A;  5GRO A;  4OEL B;  4MN3 A;  4V0B A;  5HGT A;  2MQH A;  2NN6 G;  3I90 A;  1V1O A;  1G91 A;  4QUF A;  2V1C C;  2WV6 D;  1X9N A;  2CWA A;  4RKL A;  5LMN W;  2ID0 A;  3B6Y A;  1SE2 A;  1CUK A;  1WCM G;  1K8O A;  1Q12 A;  5IYB H;  1S72 A;  1HR0 L;  1EY0 A;  4TVA B;  3NTI A;  3V2T A;  1D8L A;  2BDO A;  2B2Y A;  3DWQ A;  1LAC A;  3CMA A;  2D0P A;  1PTO F;  1NR2 A;  4JI1 L;  3RD4 A;  3KFU A;  2IHE A;  4IJL A;  1XJV A;  2EY5 A;  3HOV G;  1QVF A;  5JEA J;  2UXD Q;  1GM5 A;  1F2Z A;  4ZK9 B;  3NQT A;  3D4W A;  1X6O A;  2WIN B;  3E0E A;  5C44 G;  5FO7 B;  4DFA A;  3I56 A;  2CW0 C;  4V19 0;  1E3P A;  1WOC A;  1ONL A;  3VR5 A;  3FPP A;  4RGT A;  1BOS A;  2HIX A;  2UUC L;  3K8A A;  1PXU A;  5IYC G;  4LF7 Q;  1A63 A;  2L15 A;  1A3T A;  2WP8 J;  3PUX A;  2KUM A;  3J7A V;  4QUC A;  1VQM A;  4LF9 L;  2K05 A;  2B3G A;  2F4V L;  3JAM L;  3CCJ A;  1HR0 W;  1ILQ A;  3GTP H;  2QA4 A;  3KJO A;  3IFT A;  2HUG A;  4X3U A;  2L11 A;  1FNV A;  3LX0 A;  1STE A;  4G57 A;  1EWC A;  3HOY G;  1A2T A;  3S2H H;  1KTK A;  1Q90 A;  1S4Z A;  2A74 C;  5M3F H;  1VQA A;  2RF4 A;  5FOB B;  1TS4 A;  2R61 A;  3L3O C;  1E2W A;  2WKD A;  3H3V I;  5CYU A;  1VQG A;  1SE3 A;  4X62 L;  2YTX A;  4MZ9 A;  5LHY 1;  1CM9 A;  4BWG B;  2IL8 A;  1TS5 A;  4IO9 A;  2F0I A;  3T51 B;  4JBJ A;  1DYQ A;  4WJ3 M;  3K57 A;  1W3S A;  4A3D B;  3RLN A;  5I6Y A;  4L8J A;  3SK6 A;  3GTP B;  3T4A C;  1N32 Q;  1E22 A;  1STG A;  2PW5 A;  5GAH C;  1CA5 A;  3PCO B;  3MC0 B;  2VL6 A;  3CC4 A;  4I7A A;  1XPU A;  3STB D;  2FIN B;  3S2H B;  5C0X J;  4UAI A;  1W6J A;  1CQV A;  1JMC A;  3DLL A;  5M3F B;  2ALY B;  3VA7 A;  4X64 Q;  1WVL A;  3MAQ A;  3FP9 A;  4HIK A;  3I4N B;  4ZQ3 A;  4WFN 3;  3FVQ A;  2IPK D;  4LWC A;  4FVM A;  4DR7 Q;  1MHW C;  2E2J H;  4X3K A;  4BY7 G;  2R92 G;  4JV5 Q;  3T16 A;  5M5X H;  1PYS B;  3CXC A;  1C9O A;  1G8Z D;  2ICE C;  3NK9 A;  4FF1 A;  4AYB G;  5A2Q E;  2KCT A;  2MP1 A;  1VCI A;  2F52 A;  4JI8 L;  2KCN A;  3S1R B;  3HEJ A;  3D8G A;  4K14 A;  1EY5 A;  3M7N A;  2HCC A;  1TWF H;  1EYD A;  4DPG A;  3EN2 A;  4BXX H;  4XXE A;  4IUP A;  1TR5 A;  5EPJ A;  4CKB A;  1EQQ A;  2AHO B;  1G6P A;  3M4P A;  4KI0 A;  2E74 C;  2I5H A;  3GTK B;  1D2B A;  3MA2 B;  2IHF A;  4A3I H;  3GV6 A;  1A8V A;  3GTM H;  5ISR A;  1C4Q A;  2KA7 A;  4PMC A;  2SNS A;  5M5Y B;  5J3B A;  1SRO A;  4IPH A;  1K0S A;  4DGZ A;  3CQZ H;  4JOI C;  4DR3 L;  2K75 A;  1JOO A;  4A75 A;  4OO1 G;  2EXZ A;  4FDB A;  1HXY D;  3H6M A;  1NAP A;  4HCS A;  1CSQ A;  1IKM A;  1BKB A;  2LSS A;  3KBX A;  3UDG A;  1PTO D;  1D6E C;  1UE1 A;  2VQF Q;  2PZW A;  4A3E B;  1JWU D;  4JI2 L;  2K7V A;  4K6L A;  4M1U B;  1TWF B;  2QDL A;  1STB A;  4HAE A;  3RMH A;  4UP8 A;  1X55 A;  4DAM A;  1IBL L;  1HCZ A;  4G7Z C;  2JA7 B;  2JXM B;  1STH A;  4UDU C;  3OW2 A;  2NZO A;  3GQB A;  5L37 A;  2JQO A;  4KHP L;  4APV A;  3TEH B;  1SEB D;  2X6G A;  4H13 C;  3ULJ A;  4QGU A;  4RG1 A;  2F0L A;  1OTC A;  1A6X A;  4B3T Q;  1JOR A;  1KL9 A;  3I8Z A;  1U5K A;  3MFY A;  3S16 B;  2BCO A;  4LF8 Q;  1RJT A;  1O80 A;  4QCL A;  4OWT B;  1GKH A;  1I4R A;  3I4O A;  3HRZ C;  5ELC A;  2NVQ B;  4EX5 A;  1VQ7 A;  3URY A;  3RLF A;  3PGZ A;  2VQE Q;  4GLX A;  5LL6 S;  2ZJR A;  1SFO H;  3WDN A;  4EQN A;  2JA8 B;  5DM6 3;  4A3C G;  1RL2 A;  1VQJ A;  4NMZ A;  3D3R A;  1BXT A;  2YYZ A;  1VQ9 A;  4JI7 Q;  1KNA A;  4GOP C;  4OWW B;  2Z8L A;  1NMG A;  3KOJ A;  1IW7 D;  1YHB A;  3I3C A;  4XDX A;  3HOX G;  5IOD A;  5KNC A;  4ALP A;  1FGB D;  1J5E Q;  4LK1 C;  2RDH A;  3G4S A;  4XYO A;  2R7Z B;  1TWH H;  4LF7 L;  1O78 A;  1UE5 A;  4CDE C;  1A0I A;  1HFN A;  1E1T A;  4GN3 B;  3D6C A;  2B39 A;  1F9S A;  1AP0 A;  1LT3 D;  2ATW A;  3W5O A;  4C1N K;  4K5X A;  4OHJ A;  3SGI A;  2CWP A;  2QEX A;  3J7A 5;  2B2V C;  3PUY A;  1Q1B A;  4UP7 A;  1X3F A;  4HR7 B;  4A3M G;  2VUM B;  2JA9 A;  3ERO A;  5T1G A;  4X66 L;  4C1N I;  5IE8 A;  4DUZ L;  1L2F A;  4IQZ A;  4ZRZ A;  4I65 A;  2BE5 D;  3TQY A;  4DV5 Q;  1N36 Q;  1D1K A;  4POF A;  4GNX C;  2AQ3 B;  4GS3 A;  4KHZ A;  1YJ9 A;  5JEA G;  5CV7 A;  2Z6K C;  1SYF A;  5ELD A;  2XSC A;  3KLR A;  4DAV A;  1KRT A;  3DEP A;  1A15 A;  1XMO Q;  5C6A A;  4B3R Q;  3K5M A;  2I07 B;  2N55 A;  3HOU H;  1JJ2 A;  4IUR A;  2UUA Q;  2JA6 B;  1T5E A;  1RDP D;  3HOW G;  1KNE A;  3K81 C;  3HFZ B;  1PZI D;  1K83 H;  3S14 B;  1UE6 A;  5FLX c;  5C3E G;  5M3M G;  1EOV A;  4JYA Q;  3T1H L;  1EZ6 A;  2V4D A;  3J81 L;  1P16 A;  1SNQ A;  5C4X B;  1I6H H;  4LF5 Q;  2Q8T A;  2BH2 A;  4DV1 Q;  5LMN Q;  3NTH A;  3OYY A;  1Y8O B;  4B3M Q;  2ZTD A;  4FXK C;  2FMC A;  5M9O A;  5IYD G;  4JV5 L;  1YHQ A;  3BDC A;  2L12 A;  5EBD A;  2D2C C;  4BA2 I;  2K5Q A;  2UXC Q;  1HRJ A;  3SXH A;  1D5X C;  4IUV A;  5CMD A;  2JA5 H;  1S5C D;  5I2Y A;  1G2S A;  1FNU A;  4RKB A;  2NVT H;  2QKI C;  1K83 B;  1FJG Q;  2K01 A;  2XTI A;  5GAG C;  5LL6 X;  3LWU A;  5ELO A;  3R8B A;  2YTV A;  3H0G B;  3A55 A;  1ENC A;  5ELE A;  2VB2 X;  1TWC H;  3D4R A;  3HKS A;  3PF5 A;  1HH2 P;  1ASZ A;  3PF4 A;  1WCM H;  1TQO A;  4HSV A;  1JB7 A;  1MIU A;  1LAB A;  3NQI A;  5C0X G;  3GTQ H;  1D7Q A;  4DAY A;  4OWX B;  3FKI G;  2A19 A;  1ET9 A;  1EIG A;  2Q2U A;  5T1I A;  2ES2 A;  1IBK L;  1EU3 A;  2SNM A;  4HMJ A;  2UXB L;  2IWH A;  2B63 G;  1ROD A;  2UUB Q;  2EOT A;  5BN4 A;  3KF8 A;  1HR0 Q;  1KDC A;  3GO5 A;  1L0Y B;  2NVT B;  2BOS A;  5EAY A;  1XWE A;  2EYM A;  1PYB A;  4JI1 Q;  1RF2 D;  2Q8R E;  5JAV A;  1F2L A;  1HFG A;  4HJ8 A;  1TWC B;  1HUM A;  4IFD I;  5BR8 Q;  5EKL A;  1PH7 A;  3C2P A;  1Q3L A;  2XNA C;  1BBU A;  2K14 A;  4KHV A;  1CHP D;  2D5D A;  2F0H A;  1I50 H;  3IRB A;  5CV4 A;  3PO2 G;  3M4Y A;  3KUP A;  2WAQ G;  1XX8 A;  1WTQ A;  4DAY B;  1JJG A;  3RNU A;  2DNE A;  3NEM A;  2NZH A;  4KMU C;  4A3B G;  1ENF A;  3SDZ A;  3VYR A;  1HTP A;  3KF8 B;  1HUN A;  1SJH D;  1EFI D;  3HOY H;  4IAL A;  4ZAI A;  1PV4 A;  4LF9 Q;  1GUS A;  1J8I A;  4DXF A;  1ASY A;  2B2W C;  2B2T A;  5EGT A;  2YU9 H;  1WFQ A;  1Q1E A;  2JN4 A;  4A3F G;  1T9H A;  2D0O A;  5K5P A;  1VF7 A;  2B8G A;  3J7A F;  4HMI A;  1SDF A;  4PNY A;  4DV6 L;  1I50 B;  1I94 Q;  1LT5 D;  3E6Z X;  2E75 C;  3MHB A;  3TRZ A;  4TQU S;  3SE0 A;  1VMP A;  3ZJY C;  1TY2 A;  4QMG A;  4X62 Q;  2BA0 A;  1SJE D;  2JE6 I;  2L55 A;  1OXU A;  4K5W A;  1B7Y B;  1EY9 A;  1EL0 A;  1PLF A;  3K5L A;  2G9H D;  4TRD A;  4NKL A;  3SHL A;  1V1P A;  4HJ5 A;  4HIO A;  4K2L A;  3MTS A;  2OT2 A;  1YBY A;  3BDL A;  2K5H A;  1JB3 A;  2J4X A;  5J39 A;  2DY8 A;  3CC7 A;  1DM0 B;  4IJH A;  2F3I A;  1IKL A;  4B3S Q;  5IOC A;  2F1M A;  5JPM C;  4NXM L;  4OEM B;  4RAU C;  2EIF A;  4R8N A;  1N36 L;  4N8F A;  3S17 B;  1EUJ A;  3AYH B;  4F8M A;  1ILP A;  2AMC B;  2L5T A;  2N78 A;  3IL8 A;  1X56 A;  1EEF D;  5KGU A;  3K80 C;  5C4J H;  1KC8 C;  4I7Z C;  4QL5 A;  4EGV A;  3TME A;  2KQ3 A;  1AE2 A;  5EBC A;  3TP8 A;  1YNX A;  4ZKB B;  4NB3 A;  1IL2 A;  3NHH A;  3NBH A;  5EJW A;  1HQM C;  3KF6 A;  3W1B A;  3L9A X;  3GD7 A;  4DV2 Q;  2UUA L;  2K4K A;  1GO3 E;  3CKI B;  4JI8 Q;  4J1M A;  3WWV A;  4OIJ A;  5IP7 G;  1R9T H;  4MHE A;  2E5L Q;  1B2T A;  2PZT A;  1EYG A;  1UWV A;  1EOT A;  5IT9 E;  2E2I H;  2AUK A;  5CGK A;  4C3H H;  4OO1 H;  3RZO B;  1Q82 C;  1AN8 A;  1YNJ D;  2JSO A;  4IOC A;  4A3J G;  4WOR A;  2OQK A;  4HN7 A;  3EIV A;  3NBI A;  4DV1 L;  1DZ1 A;  1Q46 A;  5KEE A;  5LMN L;  1CKO A;  2WB1 E;  3I4M G;  3STB C;  3MXP A;  1JC7 A;  1JQY D;  1W2B A;  4ILW A;  3J80 c;  5M5W H;  5GQO A;  2L1B A;  1FD7 D;  4IPC A;  2OCE A;  4CHT B;  1DOM A;  1U9R A;  4QJF A;  3KF6 B;  2CCZ A;  2MO0 A;  3FMC A;  4BBS B;  1JWS D;  3BYY B;  4A3K B;  4JI2 Q;  3S1N B;  4DR2 L;  3QIA A;  2N8N A;  3GTJ H;  1IBL Q;  4GN5 A;  4C3H B;  3Q8D A;  3S24 A;  1MJE A;  3BS1 A;  4KHP Q;  2EYH A;  2AWO A;  2OTJ A;  5EKI A;  2JK8 A;  4CDF C;  4ZUJ A;  3ERS X;  1GOZ A;  3D0F A;  3C3L A;  1GUW A;  3ULP A;  2CHB D;  4PMB A;  2VY3 A;  4WJW A;  1BCP F;  1F9Q A;  3UE0 A;  4DV4 L;  1EIY B;  2CQA A;  4A3C H;  4C3J G;  1PFB A;  3I72 A;  2HD3 A;  5DNF A;  5LMU L;  2UUB L;  4BY1 B;  3UDI A;  1Y8P B;  5AJ3 L;  3T1Y L;  5FJ8 G;  1KDB A;  1SE8 A;  3J80 i;  3HOX H;  1UUP A;  2F0N A;  1TWG H;  1V43 A;  3G71 A;  3CCS A;  1X3Q A;  1HQR D;  3EJI A;  2OEO A;  1I3Q H;  1F9P A;  2OTL A;  2Z9H A;  2D62 A;  5BR8 L;  1UE7 A;  4ZUI A;  3MFG A;  4HTH A;  3SK5 A;  1LLR D;  3S2D H;  1LUZ A;  4UP9 A;  4C3I G;  2CH4 A;  2EYO A;  3BZC A;  4N9T A;  4PZ6 A;  1BR9 A;  1EYA A;  1HZB A;  3OOC A;  3DWA A;  1MBY A;  3P75 A;  5IGD A;  1VQH A;  2NWG A;  3J80 E;  1K9M C;  3I91 A;  2HDM A;  3VR2 A;  5JEA H;  2IJ0 A;  1KAB A;  5FKA C;  4BS9 A;  4X66 Q;  1WTR A;  1A3V A;  2LXJ A;  4DUZ Q;  1IL8 A;  4PG3 A;  4CJ0 B;  3KLW A;  3BZD B;  1JCK B;  3ND8 A;  1Y1W G;  3F1Z A;  2DN8 A;  3NEL A;  1I94 L;  2FXQ A;  2D9U A;  2JEB I;  3S2D B;  3U58 A;  3ND9 A;  1HPC A;  4WJ4 A;  1CT1 D;  2FMM A;  1B3Q A;  3N52 A;  3MZ5 A;  4CKC A;  4DXG A;  2CVR A;  4DNI A;  3A74 A;  5C3X A;  3HOW H;  5JJI A;  1IXR A;  1H95 A;  3ICE A;  1MD2 D;  1PA6 A;  4RGO S;  3AQQ A;  1PRT B;  3I73 A;  3BZK A;  4BBR H;  3S1M H;  4L63 B;  5C3E H;  1XNQ Q;  2K52 A;  1HZ9 A;  4X65 Q;  1YIT A;  3MXG A;  2KEE A;  1S5B D;  1IBM L;  4G4K A;  3MEH A;  4B3S L;  4OIK A;  1MGS A;  3E9H A;  4B9X A;  1Z47 A;  3T1H Q;  1JR0 D;  3G7L A;  4RFB A;  2Y0S G;  1YVC A;  3VYS A;  2A5H A;  3H15 A;  4Q5V A;  3A8J E;  2MUY A;  3ONA B;  1HNZ Q;  1TU2 B;  3TN2 A;  2OF1 A;  1SMY D;  4HCE A;  2EY1 A;  3HKZ B;  3BDO A;  1E7Z A;  3HP3 A;  2BE5 C;  4BBR B;  5BN5 A;  3S1M B;  1B1Z A;  5NUC A;  3PO3 G;  3OIQ A;  1QB5 D;  4DV2 L;  3CD6 A;  1GD7 A;  1VQI A;  2KVM A;  1PH9 A;  4JI6 Q;  2E5L L;  4DR6 L;  1KDA A;  3S1Q H;  3M4Q A;  4F87 A;  3F2U A;  1P8L A;  5C0X H;  4JI4 L;  4JBM A;  2E8G A;  2ZXR A;  4DR1 Q;  3FKI H;  2L9H A;  3A56 A;  3OIP A;  1BCP D;  4HJ9 A;  3S9W A;  4DV7 Q;  2B63 H;  1PH5 A;  2E2J B;  1N8R C;  3Q22 A;  3DM1 A;  2LXK A;  3J7Z C;  1H9J A;  5M5X B;  3X3M A;  1GUG A;  2G9D A;  2EY2 A;  1IBK Q;  2JEA I;  4A93 G;  2R93 H;  2NVY H;  1GUO A;  2EE1 A;  4A3G H;  1HZA A;  3AU7 A;  1OXV A;  2B2U C;  2UXB Q;  3UDF A;  3FDT A;  1WTV A;  3N6R A;  2ZT9 C;  4GKK L;  4LF4 L;  4O2D A;  2QCP X;  4PMW A;  4K5V A;  1BF4 A;  3PO2 H;  4RWS C;  2PMZ B;  3F2D A;  4A3I B;  4C2M H;  3PUZ A;  4A3B H;  4JBW A;  3GTM B;  1JE4 A;  1QE6 A;  4IN3 A;  3P7J A;  3M9B A;  4KKT A;  1M8A A;  1EY8 A;  4IUU A;  2QW7 A;  2DJF C;  3CQZ B;  4FO2 A;  1QNU A;  4HJA A;  5CR3 A;  2Q2T A;  2K32 A;  2R93 B;  1XMQ L;  2NVY B;  3QWN A;  1HJP A;  4PV1 C;  4A3G B;  4JK1 C;  4AQY L;  3PMF A;  1BCP B;  1MSG A;  4ABN A;  1WTW A;  4JI0 Q;  3HOZ H;  1RHP A;  2RCN A;  4A3F H;  5IWA Q;  4DK6 C;  2HHH L;  2EXD A;  4KKS A;  1E1O A;  3OMC A;  2IT1 A;  2Q8I B;  1V9P A;  5CV5 A;  1DJR D;  3U4V A;  3NUC A;  4YCV A;  5IGF A;  1J9O A;  4C2M B;  1C48 A;  4NDX A;  2WII B;  2RDF A;  3BG3 A;  1ZYR C;  4JVZ A;  2Z4H A;  2PI2 E;  2I5L X;  4DV6 Q;  1PHJ A;  1O7I A;  4J8Q A;  4RGM A;  4ID6 A;  3OMG A;  2XVS A;  3PQI A;  1KRS A;  1X32 A;  3AMU A;  4P2C B;  3D4D A;  3HOZ B;  4NPS A;  1SFO B;  2DJG C;  2KBN A;  2O2L D;  2G5D A;  2F0W A;  3VR4 A;  4LJZ C;  4LAA A;  2LFN A;  3KYH C;  4H0L C;  2K03 A;  4NW2 A;  2Z0S A;  4OON A;  2JJQ A;  4IZ8 A;  4Z9C B;  1SNC A;  4IFD J;  3M3Y H;  2WKC A;  1S3O A;  1NTG A;  2AQ2 B;  1SBB B;  1VQF A;  3FRP B;  3OTO L;  4NXM Q;  1L1O C;  1OXX K;  3LGJ A;  1BVS A;  5H1S E;  2TSS A;  1I4P A;  1NNX A;  5FO8 B;  2LMC B;  2HDL A;  4AIM A;  1TWH B;  4QB4 A;  5ELN A;  2SDF A;  4MIU A;  1BBX C;  3MXU A;  5E7N A;  4XYQ A;  4R8I A;  4QF4 A;  4H7B A;  4B9W A;  3G6E A;  3VR6 A;  3BVZ A;  1VQP A;  1XNQ L;  3EFX D;  3T53 B;  5KNB A;  4A3D G;  4EQO A;  2KEC A;  4X65 L;  2BH8 A;  1YNN D;  3K0X A;  4DR5 L;  1SSO A;  1G2T A;  2A69 C;  4EQP A;  5EKK A;  2K5W A;  1C7Y A;  1AE3 A;  1F2Y A;  5C4H A;  3QO2 A;  2EPB A;  3CRL C;  4KLK A;  5M3F G;  1L0X B;  3K5N A;  1AW7 A;  3HKZ E;  3KLS X;  1Q81 C;  1QVG A;  3OWE B;  2PW7 A;  1HNZ L;  1WD1 A;  3I4N G;  2ZM6 L;  1Y1V H;  1RD9 D;  2AQ1 B;  3K6O A;  3GTG H;  2MGS A;  2A68 C;  2MO1 A;  2CQO A;  2WB1 B;  2A6E C;  3HOU B;  4QIW B;  3CCE A;  4DUY Q;  3L7Z C;  5EQ0 A;  5A2Q L;  2VZA A;  2NTS A;  5KYI A;  4JI6 L;  2H4O A;  4RHS A;  3AFQ A;  4KV6 A;  3TDQ A;  4DR2 Q;  2NBF A;  1FR3 A;  1KAA A;  3M85 A;  3MVV A;  3H94 A;  2F0O A;  3U9O A;  4JOI A;  1YZ6 A;  2JYO A;  2NN6 H;  4DR1 L;  1M1K C;  3JAM c;  3DWP A;  1I6H B;  1QG7 A;  4C3J H;  4BA1 I;  3QJY A;  2B2U A;  3FPU B;  3S15 H;  3E0J A;  5DAU A;  5CV6 A;  2F0S A;  3TP6 A;  4DV7 L;  4JI5 Q;  1UEA B;  1Y1V B;  2PNH A;  2EJF C;  1CKM A;  1E24 A;  1GHK A;  5FLM G;  4KY5 A;  3GTG B;  5IGG A;  4RA8 A;  1LTG D;  1M4V A;  3H3V C;  1NR4 A;  3SEB A;  4DV4 Q;  1SYG A;  1B9M A;  5IGC A;  4LNQ A;  3BYT B;  1KIX A;  1SNM A;  2JA5 B;  2Z4I A;  3HOV H;  2AWN A;  5LMU Q;  1D5Z C;  1WTX A;  1GXD C;  5AJ3 Q;  1UNS A;  3T1Y Q;  2O5J C;  2PMZ E;  3OWF A;  4A3E G;  5C44 H;  1XNR Q;  4X6A H;  1ESR A;  3X3N A;  1SR3 A;  3GTO H;  4E6I A;  4DV0 Q;  2EYJ A;  2JA7 G;  1F2M A;  5C5M A;  4C3I H;  1NJI C;  1HA5 A;  1WCM B;  5IYC H;  1YJN A;  1JOK A;  1HZC A;  3GTQ B;  3TRE A;  4TKO B;  1SAP A;  2KHS A;  5FLX E;  1B9N A;  2H5X A;  2R3Z A;  4DK0 A;  5JOB A;  1FL0 A;  4IPG A;  5I6W A;  1SYD A;  1EWH A;  4A4I A;  3JAM i;  4KJN A;  3ZYY X;  2X69 A;  5KND A;  3HOV B;  1AH9 A;  2F0J A;  4GOP A;  2PPB C;  1I4Q A;  1LTR D;  1U4P A;  4JI0 L;  1CZG A;  2RSN A;  5IWA L;  3BVM A;  1R4P B;  2WAQ E;  3TSS A;  5C44 B;  1SLJ A;  2ZTC A;  4N8X 1;  1R4Q B;  1UAP A;  3NP8 A;  4KK7 A;  5IGE A;  4FNF A;  1MKH A;  3KDF B;  2F03 A;  3UE1 A;  2B2Y C;  2QF7 A;  4CKE A;  1Y1W H;  2M00 A;  3A7A B;  2JA8 G;  4DA2 A;  1B8A A;  2R7D A;  2MNA A;  2UU9 L;  2F0G A;  1RCV D;  4YY3 Q;  2R7F A;  1K3B C;  3W2D A;  4OX9 L;  3QR8 A;  4DK3 C;  3GTL H;  3F2B A;  4WRD A;  1WD0 A;  4FF2 A;  3VDY A;  2K50 A;  5HUR A;  1JT8 A;  3JAM E;  4KN4 C;  1OXT A;  2B2V A;  2R7Z G;  4ZKC B;  4OL7 A;  1PRT F;  5FK9 C;  1Z6H A;  3PIO 3;  4IUQ A;  3TBI B;  3TZD A;  4P75 A;  3CP0 A;  4GOP B;  3HOY B;  3EQL C;  3WOF A;  1JWM D;  3RZD H;  4KKU A;  1L0W A;  3I70 A;  2K5D A;  4DV3 Q;  4GNX A;  2YU9 B;  2I46 A;  1S5D D;  1D5M C;  3HGB A;  4KTA A;  2Z6K A;  2IX1 A;  2DGY A;  1IBM Q;  2I0Q A;  1YJW A;  2VUM G;  1Q7Y C;  4GLA C;  1PYW D;  4BY7 H;  2R92 H;  3H91 A;  3HS0 C;  2RQX A;  5I9O A;  2E2H H;  1SE4 A;  1CFM A;  2Q2H A;  1I4X A;  3ER0 A;  3UDX A;  2K5N A;  3UI2 A;  4OGQ C;  1TS3 A;  3NSW A;  3WOE A;  2PQE A;  2GVA A;  3K7U C;  5J22 A;  2J7Z A;  1Y69 U;  2F0M A;  1Y8N B;  4A3L G;  3PIO A;  1G51 A;  3VYU A;  3TP5 A;  2DUD A;  2QIL A;  4GNX B;  1HA6 A;  2JA6 G;  3TS0 A;  1O7Z A;  3VA5 A;  4LMQ D;  4DR6 Q;  3D31 A;  5KIX A;  1QVC A;  4R4T A;  3Q0A A;  2L4N A;  4BY7 B;  4JPB W;  2R92 B;  4KJO A;  4JI4 Q;  1EQR A;  1YIJ A;  2NVX H;  1H9M A;  2RHQ B;  3OW7 A;  3P1H A;  2RA4 A;  1PFM A;  3J81 j;  2E2H B;  4IPD A;  4A93 H;  5C4X G;  4IFD G;  4FF3 A;  1LTA D;  4S3S A;  5C4J B;  1CZW A;  4QIW E;  2XRS D;  2VS1 A;  4P72 A;  1LTS D;  3R2I A;  1XTC D;  2CH4 W;  1TWA H;  5KYL A;  4LFB Q;  1BBW A;  2R6G A;  3Q6S A;  4DUY L;  4LF6 L;  3J7Y W;  3BVG A;  4KD4 A;  3U50 C;  1R9T B;  4YHH Q;  4JCV E;  4CDD C;  1EQT A;  1HNW L;  4UPA A;  4L5Q A;  4GKK Q;  1WTH A;  1XPR A;  4LF4 Q;  2E2I B;  1T5X D;  1ZXT A;  3VYT A;  2RDG A;  2IX0 A;  1ZEQ X;  1M90 C;  4LFC Q;  1PH2 A;  3A7L A;  2K04 A;  1A3U A;  3H3V H;  3H0G G;  1OO9 B;  3QOL A;  1QWY A;  4JI5 L;  4LW1 A;  5JVH 3;  4FF4 A;  2XWB B;  4MTN A;  4OXP A;  2PQA B;  2A8V A;  3QOJ A;  1RTN A;  4O0A A;  2PI2 A;  5ELB A;  5M5W B;  1DOK A;  2F0Q A;  3R3O A;  1UEB A;  2K33 A;  1XMQ Q;  5D65 A;  4JBK A;  1CHQ D;  4R4I A;  3D6W A;  1YHA A;  4HED A;  4AQY Q;  2OQ0 A;  3EA6 A;  3RLO A;  1NUC A;  5GAE C;  4N9P A;  4ODG A;  3CCM A;  2I5M X;  2YTY A;  3CPW A;  2HHH Q;  3ULL A;  1PH8 A;  1EEI D;  1VDZ A;  3GTJ B;  1XNR L;  5I9P A;  5JVG 3;  5KRU A;  3U9S A;  4CDC C;  1EY6 A;  4K8I A;  2C9O A;  1VQB A;  1EWI A;  4DV0 L;  1HNX L;  5IP9 G;  1LM0 A;  1PTO C;  2F0D A;  2XN9 C;  5CV8 A;  4O1N A;  4PZ8 A;  3SK8 A;  5ELF A;  3PUV A;  2ZJP A;  1PRT D;  5FLX L;  2J0T D;  1NSN S;  1CQF A;  4GKJ L;  4X3S A;  5C3W A;  3PUW A;  3J81 c;  4P73 A;  2B2W A;  2AUJ D;  2ASB A;  1AZP A;  1PZJ D;  4A3M H;  3MXN A;  3K5O A;  1QCB D;  3VR3 A;  1LV9 A;  4MNO A;  1BNZ A;  2L0C A;  1PFN A;  2LKV A;  3IAY A;  3HOX B;  5I4D A;  2X6L A;  1TWG B;  2XGT A;  1NE3 A;  2E76 C;  1I3Q B;  3K59 A;  1CTM A;  1QZG A;  2A6H D;  4OO1 I;  5F2D A;  1A2U A;  3NWT A;  4YY3 L;  1WI5 A;  4R4C A;  1EY7 A;  3OTO Q;  3I2Z A;  3TP7 A;  4L6T B;  2AKW B;  4LUZ A;  1I4G A;  4J15 A;  2NTT A;  2MFI A;  3GP7 A;  4A3D H;  1Q8I A;  3R2T A;  4HID A;  1JE5 A;  4Q0F A;  4A3M B;  2GVB A;  5TSS A;  1B44 D;  1VMC A;  2MHV A;  2F0V A;  1IW7 C;  1CSP A;  3MXN B;  1GJX A;  1KAW A;  1NCV A;  3F2C A;  4LFA L;  3IFD A;  5IGB A;  5M3M H;  3J81 i;  5I2X A;  2WAC A;  4CGY B;  3SVM A;  4DV3 L;  2SOB A;  3V96 A;  1SXT A;  2LS0 1;  4DR5 Q;  3E5S A;  2F4I A;  3C1E A;  1H9S A;  4GN4 B;  3I4N H;  1ET6 A;  1Q8K A;  3F8T A;  3GV3 A;  1LTL A;  5IYD H;  1TVX A;  2RSO A;  2JP1 A;  1N34 Q;  4RCN A;  1S5E D;  2RKS A;  4QQB X;  1K8A C;  2EJG C;  1VQ4 A;  2F3V A;  1PZK D;  1VS0 A;  3L2P A;  2F0P A;  3CCL A;  1NMF A;  2ZM6 Q;  1C8C A;  3HOW B;  3PV0 A;  1YEZ A;  1LT6 D;  4HIM A;  2KJX A;  3S1R H;  4G7O C;  2NZ1 D;  2Y0S E;  5C3E B;  5M3M B;  5K36 G;  1A62 A;  5EPK A;  4KD3 A;  3J81 E;  5GAD C;  3W1G A;  1N9W A;  2FHT A;  3GTK H;  5JJL A;  2BDN A;  1H9S B;  1SNP A;  5FLM H;  4AYB E;  5M5Y H;  3K0Y A;  1B53 A;  5IT9 L;  1K8G A;  2EYL A;  3MEF A;  4K0K Q;  4UHV A;  1YNN C;  1O7Y A;  4R1J A;  3AFP A;  1RIP A;  5HY6 A;  3RN5 A;  2M9V A;  2MJ8 A;  4JC0 A;  4A3E H;  4LFB L;  4XT3 B;  4DN4 M;  4DR4 L;  2JA7 H;  4GLV B;  4YCW A;  1J6Q A;  1U4L A;  2BA1 A;  4YHH L;  3AB9 A;  4HJ7 A;  3S1Q B;  4BBS G;  4A3K G;  1EIF A;  3H09 A;  2ENB A;  4HSP A;  5COY A;  2EQS A;  3FKI B;  4LFC L;  1DGS A;  4C3H G;  2EY6 A;  2C5C A;  1KHI A;  3S16 H;  1Z7T A;  4U68 A;  1ENA A;  2RVL A;  1S5F D;  2B63 B;  1TS2 A;  2SEB D;  4H02 A;  1TII D;  3CPF A;  5IY0 A;  2PO4 A;  2CFM A;  2NVQ H;  1CKN A;  3DM3 A;  1VF5 C;  2ICI A;  4NXN L;  1ESF A;  2CW0 D;  1BDO A;  2Z1C A;  3CU7 A;  3R93 A;  1WJJ A;  3M7G A;  2JA8 H;  1JIC A;  1WYD A;  4YWL A;  2VNU D;  1LTT D;  4G7H C;  3ITP A;  4U67 3;  4KY6 A;  3QG1 A;  4C56 C;  2KED A;  1PTO H;  2F3W A;  4BY1 G;  1VQ6 A;  4NP5 A;  4CBV A;  4FXD A;  1SYE A;  2XIW A;  3LNN A;  3PO2 B;  1PVO A;  2HQL A;  4DNT B;  1FNW A;  2WAQ B;  4A76 A;  2EDG A;  2UU9 Q;  1H9R A;  2F0K A;  2NUC A;  4A3B B;  1K3R A;  3NEN A;  4DAP A;  1ML0 D;  1BO0 A;  1HTL D;  1F9R A;  2R7Z H;  1LO5 D;  1KXL A;  4OX9 Q;  1I5F A;  3KLS A;  3OPO A;  1CKN B;  3Q23 A;  1Q86 C;  5AFW A;  3CC2 A;  1U4M A;  4YWK A;  4L5R C;  2F0F A;  4FP5 D;  1SND A;  4ME3 A;  4F88 A;  4ZYS A;  4A3F B;  5C4Z A;  1JJC B;  2C35 B;  3QB3 A;  5IYB G;  2UXD L;  1PTO B;  4CJ2 C;  1NBW A;  3C1F A;  2VUM H;  3W3A A;  1O7L A;  3HG9 A;  2DY7 A;  2O5I C;  3A0J A;  1U4R A;  5EPL A;  5C0X I;  1CK1 A;  3AEV A;  3DUZ A;  3J80 L;  1CI3 M;  4LUV A;  1VQC A;  2B2T C;  4GZY C;  3A8K E;  5COR A;  3CAM A;  3A54 A;  3A5U A;  3DXJ C;  3DHQ A;  4L5S A;  1LTI D;  2H1E A;  1K8M A;  2QDB A;  1I6V C;  4XT1 B;  4POG A;  3I7F A;  2NYZ D;  1VQK A;  4A3L H;  3ERQ A;  3EVQ A;  1WTO A;  1MJC A;  2JA6 H;  5IP7 H;  4XQN A;  1QNK A;  1RKN A;  1LYL A;  1PFS A;  3A5Z B;  3CCR A;  2EVB A;  5JJZ A;  3FHW A;  3S14 H;  4R9W A;  1ICF B;  2EZV A;  4RCO A;  4A3J H;  1EIH A;  1ICW A;  1G6Z A;  5C4X H;  1XYI A;  4IFD H;  3M3Y B;  4K6D A;  3L0O A;  1EY4 A;  4TSS A;  2RCF A;  3I4M H;  4JI3 Q;  3EBE A;  1II3 A;  2N88 A;  1N34 L;  3OHX C;  5JPN C;  3LWE A;  3G6J B;  4ZLT F;  2KCM A;  1JOQ A;  1TKW B;  4XIG S;  2F0E A;  1PDQ A;  4AH6 A;  1IYJ B;  1IHZ A;  1N32 L;  4QY7 A;  1XPO A;  1EZ8 A;  3HKZ G;  3CF5 A;  1N33 Q;  1Y14 B;  1XXG A;  4B08 A;  1ZKO A;  4BBR G;  4LF6 Q;  4A3J B;  4X64 L;  1IYV A;  3M4O H;  3H0G H;  3KBG A;  1DON A;  2XWJ B;  3V05 A;  1HNW Q;  2OWO A;  1AEX A;  4PZ7 A;  3E3X A;  4H44 C;  5DEH A;  3I4M B;  2KHJ A;  2PCF B;  3MWY W;  3CCU A;  4DR7 L;  4R4Q A;  1B70 B;  1GHJ A;  3SK4 A;  1BUV T;  1U0L A;  3P20 A;  3CCV A;  4RHR A;  2QGQ A;  4K0K L;  2PYK A;  3U4Z A;  1AFP A;  1KLU D;  3JC6 6;  4Y52 H;  2EYP A;  2K5V A;  1YI2 A;  2FJ2 A;  5FJ8 H;  5E4X A;  1PH4 A;  2VB3 X;  4RGN A;  1S40 A;  1E0B A;  4DU9 A;  1E2V A;  5BN3 A;  1YNJ C;  1V1Q A;  1XTD A;  5J1Z A;  3RN2 A;  5IP9 H;  1CA6 A;  1MSH A;  1SNO A;  2OXP A;  3M4O B;  3DEO A;  2ZXO A;  4L5T A;  1FYC A;  1DD2 A;  4ULL A;  1X65 A;  3KDF A;  1K73 C;  1STY A;  4F7X A;  2HQE A;  3NWS A;  1KD1 C;  4BXX G;  2ZTE A;  3GDE A;  1C0A A;  1HNX Q;  2CKZ B;  4C3J B;  3K7A H;  3TS2 A;  3S15 B;  2K28 A;  1VQL A;  4A3I G;  1B3A A;  4DNR B;  2LY7 A;  3BU2 A;  2VQF L;  1ZYR D;  1W6K A;  2HCI A;  5G3L F;  2M2L A;  1QIL A;  3PSI A;  4J6H A;  4GKJ Q;  4XQJ A;  2YV5 A;  2R93 G;  2DNC A;  2Q2I A;  1D1I A;  1SMX A;  4A3G G;  4IUN A;  4YIJ A;  4LUO A;  1PH1 A;  1PH3 A;  1PH6 A;  1VQN A;  3PIP 3;  2RHS B;  1STA A;  4XQQ A;  1SYC A;  2P5Z X;  1QJO A;  1IYU A;  4B3T L;  3GTO B;  2IY5 B;  1X3P A;  3Q24 A; 
#chains in the Genus database with same CATH homology
 4LW1 A;  1X3F A;  4A3M G;  2WFW A;  2JA9 A;  4MTN A;  3PO3 G;  4YCU A;  4OXP A;  2PQA B;  4X66 L;  2A8V A;  5IE8 A;  4DUZ L;  4LF8 L;  1L2F A;  4DV2 L;  4O0A A;  2PI2 A;  2UUC Q;  3CD6 A;  1GD7 A;  1VQI A;  1PH9 A;  1UEB A;  1XMQ Q;  3TQY A;  1SRU A;  4JI6 Q;  4DV5 Q;  1N36 Q;  4JBK A;  2E5L L;  4R4I A;  4DR6 L;  4POF A;  3S1Q H;  4GNX C;  1YHA A;  4GS3 A;  3M4Q A;  3CW2 C;  1KQS A;  2VQE L;  4KHZ A;  1P8L A;  1YJ9 A;  5JEA G;  4AQY Q;  4JI4 L;  2OQ0 A;  4JBM A;  2E8G A;  2Z6K C;  5IT9 c;  3RLO A;  5GAE C;  4DR1 Q;  3FKI H;  3CCM A;  2I5M X;  2YTY A;  3CPW A;  2HHH Q;  3ULL A;  1KRT A;  1PH8 A;  2F4V Q;  1XNR L;  5DLQ E;  1XMO Q;  4HJ9 A;  4B3R Q;  4DV7 Q;  4JI7 L;  2B63 H;  4XTC S;  1PH5 A;  3HOZ G;  1VQB A;  1EWI A;  4DV0 L;  3CCQ A;  1N8R C;  1HNX L;  5IP9 G;  1EFW A;  3HOU H;  2LXK A;  3J7Z C;  1LM0 A;  5HGQ A;  1JJ2 A;  1L1O A;  4LFA Q;  4PZ8 A;  2UUA Q;  3HOW G;  1IBK Q;  2HT1 A;  2JEA I;  4A93 G;  2R93 H;  2NVY H;  3PUV A;  1J5E L;  3K81 C;  2NN6 I;  3HFZ B;  4DKA C;  1HZA A;  2ZJP A;  1NY4 A;  4A3G H;  1K83 H;  1OXS C;  1OXV A;  3S17 H;  3PIP A;  2UXB Q;  2VW9 A;  1VQD A;  1UE6 A;  5FLX c;  4Y7N H;  5C3E G;  5M3M G;  1EOV A;  2KEN A;  4JYA Q;  3T1H L;  1IZ6 A;  4R4O A;  4GKJ L;  3UDF A;  3J81 c;  3PUW A;  4P73 A;  1P16 A;  1VQ5 A;  1QZH A;  1I6H H;  4LF5 Q;  4GKK L;  4LF4 L;  4O2D A;  2ASB A;  2BH2 A;  4PMW A;  4IOA A;  4DV1 Q;  2HIV A;  4A3M H;  1X3E A;  5LMN Q;  3PO2 H;  3OYY A;  4B3M Q;  3F2D A;  3PO3 H;  2ZTD A;  4MNO A;  5IYD G;  4JV5 L;  4C2M H;  3PUZ A;  4A3B H;  4JBW A;  1YHQ A;  2XGT A;  1K0R A;  1NE3 A;  3M9B A;  4BA2 I;  4UY8 C;  1QZG A;  2UXC Q;  4OO1 I;  2JA5 H;  4HJA A;  3G48 A;  2Q2T A;  4YY3 L;  1WI5 A;  1XMQ L;  1L1O B;  4R4C A;  1HJP A;  4DV5 L;  2NVT H;  3RZO H;  3OTO Q;  3I2Z A;  2ZJQ A;  2AKW B;  1FJG Q;  4LUZ A;  4AQY L;  2B29 A;  2XTI A;  4J15 A;  1TXY A;  5GAG C;  4JI0 Q;  3HOZ H;  2RCN A;  4A3F H;  5IWA Q;  2MFI A;  4DK6 C;  5ELO A;  2HHH L;  2YTV A;  4A3D H;  3CME A;  4JI3 L;  2EXD A;  4HID A;  1JE5 A;  1E1O A;  1XMO L;  1TWC H;  3HKS A;  4B3R L;  3PF5 A;  1HH2 P;  2GVB A;  2IT1 A;  1ASZ A;  3PF4 A;  1V9P A;  1WCM H;  1FVI A;  3U4V A;  1JB7 A;  4YCV A;  1MIU A;  1FGU A;  1CSP A;  3MXN B;  5C0X G;  3GTQ H;  1KAW A;  2N3S A;  2PQA A;  3F2C A;  4LFA L;  1D7Q A;  4OWX B;  3FKI G;  2A19 A;  5M3M H;  3J81 i;  2Q2U A;  4DV3 L;  2ES2 A;  1IBK L;  4BBS H;  4JG2 A;  4A3K H;  4DR5 Q;  3S1N H;  2PI2 E;  2I5L X;  2N49 A;  1N33 L;  4DV6 Q;  2UXB L;  1PHJ A;  1QUQ A;  1O7I A;  2B63 G;  4YWM A;  4GN4 B;  1VQO A;  2UUB Q;  3I4N H;  3RR5 A;  4JYA L;  2WB1 G;  1HR0 Q;  1Q8K A;  3HOU G;  4DR4 Q;  3GO5 A;  3F8T A;  1LTL A;  3KJP A;  1KRS A;  5IYD H;  5EAY A;  1X3G A;  1N34 Q;  1X54 A;  4EQ5 A;  4LF5 L;  4QQB X;  1K8A C;  1PYB A;  3I55 A;  4JI1 Q;  1VQ4 A;  1GVP A;  4NPS A;  1VS0 A;  3BJU A;  4B3M L;  3L2P A;  2KBN A;  3CCL A;  4HJ8 A;  1VQ8 A;  1SN8 A;  4P71 A;  1NMF A;  2ZM6 Q;  2GN5 A;  3PV0 A;  4DR3 Q;  1YEZ A;  4HIM A;  3E9I A;  4P74 A;  4IFD I;  5BR8 Q;  1G29 1;  3S1R H;  1PH7 A;  3KYH C;  2UXC L;  2Z0S A;  4OON A;  1BBU A;  2Y0S E;  2JJQ A;  2K14 A;  3NBH B;  4IFD J;  3M3Y H;  5K36 G;  1A62 A;  1I50 H;  1S3O A;  3IRB A;  3PO2 G;  1Y1V G;  1Z9F A;  2WAQ G;  4RMF A;  1NTG A;  4DAY B;  4BY1 H;  1VQF A;  1JJG A;  5GAD C;  3W1G A;  4NXN Q;  3OTO L;  3RNU A;  3NEM A;  4NXM Q;  1N9W A;  1L1O C;  1OXX K;  2NZH A;  4A3B G;  1FJG L;  3GTK H;  2KHI A;  3LGJ A;  1BVS A;  5H1S E;  5JJL A;  1VQE A;  1QUQ B;  4AIM A;  5FLM H;  5ELN A;  4AYB E;  3KF8 B;  2JA5 G;  5M5Y H;  3HOY H;  1K8G A;  5E7N A;  1PV4 A;  4LF9 Q;  3MEF A;  4K0K Q;  1ASY A;  2A1A A;  5GRO A;  2YU9 H;  1WFQ A;  3G6E A;  1Q1E A;  2MQH A;  2NN6 G;  4A3F G;  4R1J A;  1VQP A;  1XNQ L;  2V1C C;  3AFP A;  1RIP A;  1T9H A;  5HY6 A;  3RN5 A;  4A3D G;  2D0O A;  4JC0 A;  4X65 L;  2BH8 A;  4A3E H;  3K0X A;  1X9N A;  2CWA A;  5LMN W;  4DR5 L;  2ID0 A;  3B6Y A;  4DV6 L;  1I94 Q;  4LFB L;  1CUK A;  1WCM G;  1Q12 A;  5IYB H;  3TRZ A;  1S72 A;  1HR0 L;  4DR4 L;  4TQU S;  4TVA B;  4GLV B;  2JA7 H;  4YCW A;  1J6Q A;  3ZJY C;  1C7Y A;  1D8L A;  4X62 Q;  1AE3 A;  2BA1 A;  2BA0 A;  4YHH L;  2JE6 I;  4KLK A;  4HJ7 A;  3CMA A;  1OXU A;  2D0P A;  4BBS G;  1B7Y B;  5M3F G;  4A3K G;  4JI1 L;  1EIF A;  3KFU A;  2IHE A;  4IJL A;  1XJV A;  3HKZ E;  1Q81 C;  1QVG A;  3HOV G;  2EQS A;  1QVF A;  1HNZ L;  5JEA J;  3I4N G;  4LFC L;  2ZM6 L;  1DGS A;  1GM5 A;  2UXD Q;  1Y1V H;  4HJ5 A;  4HIO A;  1X6O A;  1KHI A;  3S16 H;  3E0E A;  3GTG H;  1YBY A;  5C44 G;  3I56 A;  2MO1 A;  2K5H A;  4H02 A;  3CPF A;  2CQO A;  5IY0 A;  3CC7 A;  1E3P A;  1WOC A;  2CFM A;  4IJH A;  2F3I A;  1CKN A;  3DM3 A;  3CCE A;  4DUY Q;  2NVQ H;  4B3S Q;  3L7Z C;  4NXN L;  2HIX A;  2UUC L;  3K8A A;  4NXM L;  2VZA A;  4JI6 L;  1WJJ A;  5IYC G;  2EIF A;  4LF7 Q;  1A63 A;  1N36 L;  3AFQ A;  2JA8 H;  1WYD A;  4DR2 Q;  2L15 A;  3M85 A;  2WP8 J;  3PUX A;  4YWL A;  1EUJ A;  2VNU D;  3AYH B;  4JOI A;  1YZ6 A;  2AMC B;  2N78 A;  4DR1 L;  1X56 A;  3K80 C;  5C4J H;  1KC8 C;  1M1K C;  4BY1 G;  1VQM A;  4LF9 L;  2B3G A;  1VQ6 A;  3JAM c;  4QL5 A;  2F4V L;  4C3J H;  1AE2 A;  4BA1 I;  3CCJ A;  4UP7 A;  1HR0 W;  3GTP H;  1YNX A;  2QA4 A;  4NB3 A;  3KJO A;  4JI5 Q;  3S15 H;  4DV7 L;  2PNH A;  1IL2 A;  1PVO A;  2HQL A;  1CKM A;  1E24 A;  4A76 A;  3KF6 A;  5FLM G;  3W1B A;  2UU9 Q;  3GD7 A;  1K3R A;  3NEN A;  4DV2 Q;  2UUA L;  2K4K A;  1GO3 E;  2R7Z H;  3HOY G;  3S2H H;  4JI8 Q;  3WWV A;  4DV4 Q;  5IP7 G;  1R9T H;  1KXL A;  4OX9 Q;  5M3F H;  1I5F A;  2E5L Q;  1VQA A;  2RF4 A;  4LNQ A;  1KIX A;  1EYG A;  3HOV H;  1UWV A;  2AWN A;  5LMU Q;  2E2I H;  1CKN B;  1VQG A;  3H3V I;  4X62 L;  1Q86 C;  4C3H H;  3CC2 A;  4YWK A;  2YTX A;  4L5R C;  4MZ9 A;  5AJ3 Q;  3T1Y Q;  1Q82 C;  4IOC A;  2PMZ E;  4IO9 A;  4A3E G;  2OQK A;  5C44 H;  4A3J G;  1XNR Q;  4X6A H;  4JBJ A;  1SR3 A;  3EIV A;  4ME3 A;  4WJ3 M;  4DV1 L;  3GTO H;  1JJC B;  2C35 B;  1Q46 A;  5IYB G;  2UXD L;  1W3S A;  5LMN L;  4DV0 Q;  1CKO A;  1NBW A;  2WB1 E;  2JA7 G;  2VUM H;  3I4M G;  3STB C;  3RLN A;  4C3I H;  1N32 Q;  1E22 A;  5GAH C;  1NJI C;  3A0J A;  1YJN A;  5IYC H;  1W2B A;  3PCO B;  3J80 c;  5M5W H;  5C0X I;  5GQO A;  2VL6 A;  3AEV A;  4IPC A;  2OCE A;  3CC4 A;  1HZC A;  3STB D;  1XPU A;  4LUV A;  3TRE A;  1VQC A;  4QJF A;  2H5X A;  3KF6 B;  5C0X J;  1FL0 A;  3CAM A;  4IPG A;  2MO0 A;  1JMC A;  3A5U A;  3DLL A;  2CCZ A;  4A4I A;  3JAM i;  2ALY B;  4X64 Q;  4JI2 Q;  4L5S A;  4DR2 L;  3FP9 A;  2N8N A;  1AH9 A;  3GTJ H;  5JJK A;  4HIK A;  4GOP A;  1IBL Q;  4POG A;  4GN5 A;  4JI0 L;  3I7F A;  1VQK A;  5IWA L;  4LWC A;  4DR7 Q;  3Q8D A;  2WAQ E;  2E2J H;  3S24 A;  1SLJ A;  2ZTC A;  4BY7 G;  1MJE A;  4A3L H;  2R92 G;  4JV5 Q;  1MKH A;  3KDF B;  5M5X H;  3UE1 A;  4KHP Q;  1MJC A;  1PYS B;  1Y1W H;  5IP7 H;  2AWO A;  3CXC A;  2JA6 H;  2JA8 G;  2OTJ A;  1B8A A;  2JK8 A;  2R7D A;  1LYL A;  1C9O A;  1PFS A;  3ERS X;  3A5Z B;  2MNA A;  3CCR A;  3D0F A;  2UU9 L;  4AYB G;  2KCT A;  3FHW A;  3ULP A;  3S14 H;  1VCI A;  2VY3 A;  2F52 A;  4JI8 L;  4YY3 Q;  3UE0 A;  4DV4 L;  2R7F A;  1EIY B;  4A3C H;  4OX9 L;  4A3J H;  4DK3 C;  3M7N A;  1TWF H;  4DPG A;  5C4X H;  3EN2 A;  4BXX H;  3GTL H;  5LMU L;  2UUB L;  3F2B A;  3L0O A;  1EQQ A;  2AHO B;  3UDI A;  2K50 A;  3VDY A;  1G6P A;  5AJ3 L;  3M4P A;  4KI0 A;  3T1Y L;  3I4M H;  2I5H A;  5FJ8 G;  1JT8 A;  4JI3 Q;  3EBE A;  1N34 L;  1OXT A;  2R7Z G;  1SE8 A;  3J80 i;  2IHF A;  4A3I H;  3HOX H;  1A8V A;  3GTM H;  1V43 A;  1TWG H;  2KCM A;  3G71 A;  4P75 A;  3CCS A;  3CP0 A;  4GOP B;  1I3Q H;  2OTL A;  5J3B A;  1SRO A;  4XIG S;  4IPH A;  3RZD H;  1L0W A;  3CQZ H;  4JOI C;  1IYJ B;  2D62 A;  4AH6 A;  4DR3 L;  2K75 A;  4A75 A;  4OO1 G;  1N32 L;  4DV3 Q;  4FDB A;  4QY7 A;  5BR8 L;  1XPO A;  4GNX A;  1CSQ A;  1UE7 A;  1BKB A;  2LSS A;  3HKZ G;  3CF5 A;  3UDG A;  1N33 Q;  1Y14 B;  2Z6K A;  2IX1 A;  2DGY A;  1UE1 A;  4BBR G;  1IBM Q;  2I0Q A;  1YJW A;  3S2D H;  2VQF Q;  2VUM G;  1LUZ A;  4LF6 Q;  1Q7Y C;  4GLA C;  4X64 L;  4UP9 A;  4JI2 L;  4BY7 H;  2R92 H;  3H0G H;  3M4O H;  4UP8 A;  3BZC A;  1X55 A;  4DAM A;  4PZ6 A;  1IBL L;  1HNW Q;  2OWO A;  1HZB A;  4PZ7 A;  2E2H H;  2KHJ A;  4DR7 L;  3CCU A;  2Q2H A;  3OW2 A;  4R4Q A;  1B70 B;  2NZO A;  3ER0 A;  3UDX A;  2K5N A;  1VQH A;  2JQO A;  4KHP L;  1U0L A;  4APV A;  3TEH B;  3ULJ A;  3CCV A;  1K9M C;  2QGQ A;  4RG1 A;  4QGU A;  4K0K L;  1OTC A;  4B3T Q;  3U4Z A;  2GVA A;  1KL9 A;  3K7U C;  1U5K A;  3JC6 6;  4Y52 H;  4X66 Q;  2LXJ A;  2K5V A;  4DUZ Q;  1YI2 A;  4LF8 Q;  4PG3 A;  5FJ8 H;  3PIO A;  4A3L G;  3KLW A;  4OWT B;  1G51 A;  1PH4 A;  1GKH A;  2DUD A;  3I4O A;  4GNX B;  1Y1W G;  2JA6 G;  3F1Z A;  3TS0 A;  3NEL A;  1S40 A;  2FXQ A;  2JEB I;  1I94 L;  4EX5 A;  1VQ7 A;  3D31 A;  4DR6 Q;  1QVC A;  3U58 A;  4R4T A;  1V1Q A;  1XTD A;  3PGZ A;  3RLF A;  2VQE Q;  5IP9 H;  2ZJR A;  4GLX A;  3RN2 A;  4WJ4 A;  4JI4 Q;  1SFO H;  1EQR A;  4L5T A;  1YIJ A;  2NVX H;  1X65 A;  4DNI A;  3A74 A;  2RHQ B;  4A3C G;  3HOW H;  5JJI A;  3KDF A;  1K73 C;  1RL2 A;  1VQJ A;  3J81 j;  1IXR A;  1H95 A;  4IPD A;  4A93 H;  3ICE A;  1PA6 A;  1KD1 C;  4BXX G;  4IFD G;  2YYZ A;  2ZTE A;  5C4X G;  3AQQ A;  1VQ9 A;  4JI7 Q;  3BZK A;  4GOP C;  4BBR H;  3GDE A;  3S1M H;  4OWW B;  5C3E H;  1XNQ Q;  1C0A A;  1HNX Q;  2CKZ B;  4QIW E;  2K52 A;  3K7A H;  3TS2 A;  2VS1 A;  1HZ9 A;  4P72 A;  4X65 Q;  1NMG A;  3KOJ A;  1VQL A;  1TWA H;  1YHB A;  4A3I G;  3HOX G;  1YIT A;  4ALP A;  4LFB Q;  1J5E Q;  1BBW A;  1IBM L;  2R6G A;  3BU2 A;  2VQF L;  3G4S A;  4DUY L;  4LF6 L;  4B3S L;  3U50 C;  1TWH H;  3E9H A;  3PSI A;  1Z47 A;  3T1H Q;  4YHH Q;  4GKJ Q;  4LF7 L;  1UE5 A;  2YV5 A;  1A0I A;  4JCV E;  2R93 G;  1E1T A;  2Q2I A;  1HNW L;  4GN3 B;  4UPA A;  1SMX A;  2Y0S G;  4L5Q A;  1YVC A;  4A3G G;  4GKK Q;  1XPR A;  4LF4 Q;  2ATW A;  3H15 A;  4LUO A;  1PH1 A;  1HNZ Q;  2IX0 A;  3W5O A;  1PH3 A;  1M90 C;  4LFC Q;  1PH6 A;  1PH2 A;  1VQN A;  2RHS B;  3H3V H;  3SGI A;  2CWP A;  3H0G G;  2QEX A;  3J7A 5;  1E7Z A;  2IY5 B;  4B3T L;  3PUY A;  4JI5 L;  1Q1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...