4JI6Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji6Q00
1PHJA 1YEZA 2EIFA 3J7A5 1L2FA 5FJ8H 4HIKA 4A3EH 1S40A 2F52A 4JI3L 5HGQA 1B7YB 2Q2HA 2NZHA 3E9HA 2BH8A 3CCEA 1JB7A 4LWCA 4IPDA 2Z6KA 2GVAA 1HZBA 2VZAA 3F8TA 3G4SA 4YWMA 4GN3B 4DK3C 4JYAL 1QZGA 2BA1A 1PH4A 3HOZG 1L1OB 4YHHQ 3T1HQ 1VQPA 1XNRQ 2QGQA 4B3RQ 2DGYA 1VQ8A 3L2PA 2I5MX 4BY1G 1GO3E 4A3DG 2VW9A 4LF4L 2E2IH 3A5UA 3S2HH 1EIYB 3K8AA 3WWVA 1XPOA 3CF5A 1Q82C 1EIFA 2YTYA 2AKWB 2VY3A 3GTMH 2FXQA 4YWLA 4GKJL 4POFA 4HIDA 2JA8G 2KENA 3G6EA 4JI0Q 3I4OA 4LUZA 4JI7Q 4QL5A 4DV7L 1YJWA 2VNUD 2JA7H 3ERSX 2Q2IA 2AHOB 1XNQQ 3STBC 5JEAG 1XMOQ 1Y1WH 3T1HL 4YHHL 1N32Q 1X3EA 2UXDQ 5AJ3Q 1V43A 4B3RL 1Y1VG 3M4QA 3PUZA 4ME3A 4DR2Q 1PH2A 3VDYA 5C4XG 1AH9A 1TWCH 2ZTEA 2NVYH 4IOAA 4PMWA 2OQKA 4C3IH 3S1RH 2Z0SA 1KAWA 2Q2UA 1K0RA 1PH5A 2BA0A 4P73A 2C35B 3CCLA 3PO2H 1YITA 1KD1C 1JJ2A 4BBRH 4A75A 1EFWA 4O0AA 4BA1I 1EOVA 3PF5A 3CD6A 1SRUA 1Z9FA 1HH2P 2XGTA 1WFQA 3EN2A 4JI0L 4JI7L 3FP9A 3HKZE 1EQQA 4RMFA 5IYCH 4B3MQ 4YCWA 3AEVA 2WAQG 4OXPA 3PCOB 4JI8Q 1XMOL 3GTGH 3H3VI 2UXDL 1S3OA 5AJ3L 4BA2I 4DR2L 4TVAB 4K0KQ 4UP9A 2YU9H 4DR1Q 3CCMA 3CC7A 1VQ4A 4L5RC 4HJ5A 3CQZH 4XTCS 3ICEA 1CKOA 2A19A 4DV3Q 3JC66 1L1OC 3U50C 2B63G 4X6AH 2QEXA 3NENA 4A3LG 4GOPA 4OWWB 3I56A 3PUYA 4HJ9A 3G48A 4JBKA 3S2DH 1IL2A 5LMNW 2E5LQ 1Y14B 1VS0A 2CWAA 4P74A 1BKBA 1NTGA 1XMQQ 5LMNQ 2JA5G 1PFSA 2UXBL 5ELOA 1W3SA 4PG3A 3U4VA 5IP9H 4DR5Q 3RN2A 1VQ5A 4B3ML 4LF8Q 1PH1A 4A93H 4JI8L 2ZTDA 1FVIA 1UE6A 4DV5Q 1N8RC 2UUBQ 3HOWG 4H02A 4K0KL 2JK8A 2JE6I 4KI0A 3GTJH 2OTLA 5H1SE 4A3BG 2JEBI 4GNXB 1PH3A 4DV3L 4PZ6A 5M3FG 3IRBA 5IYDH 1VQOA 3SGIA 4GLAC 5J3BA 4A3FG 3KOJA 2RHQB 3UE0A 3TEHB 5IYBG 4A3JH 4LF6L 5JEAJ 3M4PA 3PO3G 2UUAQ 2VQFL 1L0WA 1QUQA 2UU9Q 3J81i 1YIJA 3FKIG 3HOVH 2HT1A 1C0AA 3KF6B 3U4ZA 1XMQL 1VQHA 2IX0A 5LMNL 3J80c 4DV2Q 1N36Q 1WCMH 1JJCB 1QVFA 4DR5L 5GQOA 2PI2A 3S16H 2LXKA 1I3QH 5ELNA 2ZJPA 4DV5L 4X64Q 1VQKA 5M5XH 3BJUA 4AYBE 4LF5Q 4QGUA 4LF9Q 4A4IA 3G71A 4JI4Q 1FGUA 2JEAI 1YHBA 4OX9Q 1HNWQ 1I50H 1Q86C 3Q8DA 3I4MG 1YI2A 3M85A 4BBSG 1VQIA 2ID0A 1M90C 3RZDH 2MNAA 3JAMi 3EIVA 4JV5Q 2PMZE 4DV1Q 2A8VA 2RCNA 2D0OA 3DLLA 4DV2L 3L7ZC 2HIXA 4AH6A 1VCIA 3W5OA 4A76A 3KFUA 4RG1A 5C3EH 3ER0A 2ASBA 3I7FA 1EQRA 4X64L 2WFWA 1A8VA 4JBMA 4BY7H 1RIPA 5C44H 3PIOA 2K14A 3UE1A 4GS3A 1TWAH 2GN5A 4JI4L 4IPCA 4OX9L 1HNWL 1PYBA 3CXCA 3CPWA 1NMGA 3K0XA 2K5VA 2IHFA 3KDFB 1N9WA 4OWXB 1XPRA 4BXXG 1HZCA 1MJCA 3H15A 4GNXC 1YBYA 4JV5L 4GKJQ 1SN8A 1IBMQ 1IYJB 3H0GH 4DV1L 3PUXA 1NJIC 2B3GA 4DV7Q 5FLMG 2QA4A 1Q46A 3ULLA 4NB3A 4O2DA 4A3EG 4QY7A 3K7UC 1G291 3FHWA 3UDXA 3GTLH 1YZ6A 4C2MH 1LYLA 1EUJA 2MO1A 1CSPA 1NE3A 5M5YH 3U58A 1HNZQ 4GNXA 2EXDA 3JAMc 3CMEA 4Y7NH 1EYGA 3BZCA 1WOCA 4BY1H 3RZOH 1RL2A 3PGZA 1IBML 1PVOA 1QVGA 1U5KA 2N78A 4JBJA 4JBWA 1E22A 1I5FA 3KF6A 3UDIA 4DPGA 2PQAA 5GAEC 1YHAA 4R4OA 1SMXA 2CCZA 3M3YH 4X66Q 1GVPA 2WP8J 4IFDI 1P16A 3KJOA 1WI5A 4R4QA 2NN6I 2PNHA 2JA8H 2VUMG 1OXVA 4KHZA 1AE3A 2D62A 1HNZL 4EX5A 1YHQA 2KHJA 2JA7G 2GVBA 5M3MH 3CCRA 2K5HA 5C0XJ 2R93G 1GD7A 2Y0SG 4YCVA 5IWAQ 3RNUA 1VQJA 3NEMA 3TS0A 2KCTA 1Y1VH 5BR8Q 4A3IG 1I94Q 4DUZQ 3CC2A 5C4XH 3OTOQ 3D31A 2JA6G 1X6OA 4GN4B 1KIXA 1IBKQ 1E7ZA 1FL0A 4ALPA 2R92G 4IO9A 2NVQH 4GLXA 1KC8C 1FJGQ 5JJIA 4LW1A 3BZKA 3HKSA 2VQEQ 3HOYG 1VQMA 4X66L 4DV4L 1D7QA 1K8GA 1C9OA 2AWOA 1N34L 2WB1E 3I4NH 2A1AA 4A3MG 4A3LH 1YJ9A 1VQ9A 4JI1Q 4AIMA 2D0PA 3K80C 1B8AA 1YNXA 1PH9A 4LF6Q 4YWKA 3F2DA 5IWAL 2JA9A 1X9NA 1I94L 5BR8L 2K50A 5E7NA 2VQFQ 4DUZL 3OTOL 1JJGA 3KDFA 1U0LA 4P72A 1R9TH 1CUKA 2L15A 2F3IA 1PH6A 1K73C 1IBKL 4IJHA 3GDEA 3GO5A 1FJGL 5GROA 4C3HH 4HIOA 2B63H 2VQEL 4TQUS 2KHIA 5JJLA 4A3CH 3TQYA 4DAYB 3LGJA 4IJLA 1SFOH 1L1OA 4L5QA 4QQBX 2OQ0A 2E2HH 3CC4A 2ES2A 4UP8A 1D8LA 1J6QA 2RF4A 4R4IA 1HJPA 4UPAA 1KL9A 2JA5H 3L0OA 4AYBG 2R7FA 4JI1L 5IP9G 4L5TA 2I0QA 4A93G 4KHPQ 1K83H 4PZ8A 2R7ZH 3HOWH 4A3GH 2WAQE 1VQAA 1UEBA 3J81j 2CKZB 3AFQA 3E0EA 3S1NH 5M3FH 2ZM6Q 1P8LA 3T1YQ 4A3FH 1OXXK 1PV4A 5IYBH 3PO3H 3CAMA 1IBLQ 1OXUA 2YTXA 3A74A 2MFIA 4DAMA 3TREA 4FDBA 4JOIC 4LFCQ 3OW2A 4DR6Q 3K81C 4JI5Q 1WCMG 2IY5B 3HOXG 1UE5A 4UP7A 4KHPL 3ULPA 4EQ5A 1Q81C 1HZ9A 3PUWA 3GTPH 2NVXH 4MZ9A 4HJ7A 2AMCB 3CCQA 4NXNQ 2I5HA 1EWIA 1VQFA 3STBD 3HOUH 2N3SA 1SROA 1C7YA 3W1BA 4DUYQ 1YVCA 3AFPA 3I4MH 2ZM6L 2LSSA 4C3JH 3T1YL 4BBSH 1BBUA 4JOIA 4OO1I 1IBLL 4QIWE 5IP7H 1PH8A 4A3KG 1UE7A 4X62Q 4JC0A 1TXYA 4L5SA 4LFCL 4DR6L 1IZ6A 3S1QH 4JI5L 1BVSA 1E1OA 1WJJA 1E3PA 4JG2A 1GM5A 1YJNA 1CKNB 3KJPA 1BBWA 5EAYA 3J81c 5HY6A 4NXNL 1UWVA 1XJVA 5C44G 2K52A 2HIVA 1Q1BA 1HZAA 1X65A 3CP0A 4DUYL 4POGA 3DM3A 5FJ8G 1CKMA 2XTIA 3TRZA 1V1QA 2K4KA 4B3TL 1NY4A 4MNOA 4X62L 5LMUL 4IPHA 4DV6Q 2R6GA 3UDGA 5GAHC 1I6HH 3M7NA 4UY8C 4LUVA 3W1GA 3ZJYC 5FLMH 2F4VQ 4LNQA 4GOPB 1Q12A 3HOZH 4B3SL 1H95A 3A5ZB 1MKHA 3PF4A 3M4OH 4KLKA 1G51A 2CWPA 5GAGC 3S1MH 2ALYB 3RN5A 4WJ3M 4LFAL 2YYZA 4A3DH 4PZ7A 1PYSB 2HHHQ 4NXMQ 1T9HA 4X65Q 2PI2E 1G6PA 1J5EQ 3GD7A 3S14H 1MIUA 3BU2A 3CW2C 2CFMA 2N49A 4DV4Q 2ZJQA 2K5NA 3HKZG 1IXRA 4J15A 2KBNA 4DV6L 1N34Q 1PA6A 2LXJA 5M5WH 3M9BA 4IPGA 4LF7Q 2F4VL 3GTKH 1Q8KA 1Y1WG 2WB1G 2CQOA 1QUQB 3ULJA 2ZJRA 1NMFA 1VQ6A 3F1ZA 3MEFA 2JJQA 4NXML 4R4TA 1OTCA 2HHHL 2VUMH 1TWHH 2YTVA 1E1TA 4X65L 4DV0Q 3K7AH 2MO0A 1J5EL 1X3GA 1O7IA 3PV0A 4XIGS 5M3MG 2ZTCA 3RLFA 3PO2G 2R93H 1KXLA 1XNRL 1N33Q 4P71A 2YV5A 5DLQE 4BBRG 4A3IH 4JI6Q 5FLXc 3CCUA 2JA6H 1DGSA 1VQBA 1VQDA 2AWNA 1W2BA 1M1KC 4HIMA 4IFDG 2R92H 2NN6G 5JJKA 2I5LX 3J7ZC 2UUCQ 3S24A 2MQHA 4LF7L 4WJ4A 1SR3A 5IYCG 3HOYH 1VQCA 1V9PA 5C4JH 5K36G 1OXTA 2H5XA 1CKNA 3AYHB 3KYHC 2NVTH 4GOPC 4A3MH 3I4NG 3MXNB 1UE1A 4DV0L 1HR0W 4HJAA 3KF8B 1WYDA 3J80i 1XNQL 3CCVA 1HR0Q 1OXSC 1N32L 2BH2A 3GTOH 1N33L 2E8GA 3RR5A 4JI6L 2B29A 2Q2TA 1A63A 3AQQA 1LUZA 1VQGA 4P75A 1AE2A 1KRSA 2Y0SE 3I55A 2UUCL 4R1JA 1Q7YC 1MJEA 1HNXQ 2HQLA 4DKAC 4A3CG 1QVCA 3H3VH 3EBEA 4JI2Q 2IX1A 4GLVB 4YCUA 1VQEA 1XPUA 3TS2A 4A3BH 1X55A 4GKKQ 1K9MC 3D0FA 3F2BA 4DK6C 5IYDG 4AQYQ 5GADC 1JE5A 4YY3Q 1X3FA 2E2JH 1A62A 1K3RA 4A3JG 1QZHA 1HR0L 3RLNA 1ASZA 2R7ZG 3NBHB 3CMAA 1E24A 1KHIA 1Q1EA 3A0JA 4DR1L 2KCMA 1XTDA 3FKIH 4GN5A 4R4CA 4LUOA 3HOVG 4A3GG 1B70B 1TWGH 2IT1A 1HNXL 2V1CC 3S17H 4DR4Q 3OYYA 1X54A 1PH7A 1GKHA 1X56A 3RLOA 4DR7Q 4JI2L 3B6YA 3F2CA 2E5LL 1SE8A 1VQ7A 2OWOA 4IFDJ 5C0XI 4GKKL 4OONA 1Z47A 2PQAB 4DR3Q 3I2ZA 3HOXH 4AQYL 4LF8L 3S15H 2JQOA 3KLWA 2VS1A 4YY3L 2K75A 1TWFH 2IHEA 1KRTA 2UUBL 1NBWA 4B3TQ 4LFBQ 4OWTB 2R7DA 5LMUQ 3GTQH 2VL6A 2UXBQ 3HFZB 1K8AC 3CPFA 3HOUG 2EQSA 3PIPA 3PUVA 4APVA 1KQSA 2UXCQ 4DNIA 1CSQA 4Y52H 4DR4L 2OTJA 1S72A 1SLJA 3CCSA 4B3SQ 4JI3Q 5C3EG 3CCJA 5IY0A 2UUAL 5IP7G 1A0IA 1VQNA 4DR7L 1JMCA 4QJFA 4A3KH 4LFAQ 2UU9L 4BY7G 4NPSA 1LM0A 1N36L 4JCVE 5C0XG 4IOCA 5IE8A 4DR3L 4JYAQ 1LTLA 2DUDA 2RHSB 4HJ8A 2NZOA 1VQLA 4BXXH 2OCEA 2Z6KC 3UDFA 4OO1G 4MTNA 3PSIA 1ASYA 2ATWA 4LFBL 1JT8A 4LF5L 3NELA 5IT9c 4LF4Q 4LF9L 3H0GG 2N8NA 2UXCL 3E9IA
chains in the Genus database with same CATH superfamily
2KUMA 1YEZA 2EJGC 2AUJD 1B7YB 2BH8A 1JB7A 3S17B 1V1PB 2VZAA 3I70A 2XWBB 5CBAE 4DK3C 1L0XB 3GP7A 4K2KA 3T56B 1U9RA 1VQPA 1HQMC 3L2PA 2L5TA 5JPNC 1GO3E 4A3DG 4LF4L 1I3QB 1QNUA 3A5UA 3S2HH 3K8AA 2BE5D 5M5XB 3MFGA 3BYTB 2YTYA 2VY3A 1CFMA 3E6ZX 4JI7Q 3NP8A 1YJWA 2Q2IA 1XNQQ 1SYBA 3OHXC 1Y1WH 3T1HL 4YHHL 1X3EA 3BDLA 4B3RL 1Y1VG 3M4QA 4DR2Q 4RKBA 5NUCA 1AH9A 3VDYA 1KAAA 2NVYH 3EROA 3H3VC 2P5ZX 4C3IH 2Q2UA 1KAWA 1I4RA 1PH5A 2BA0A 4P73A 3PO2H 1YITA 1F9SA 1CI3M 5C44B 4EQNA 1JJ2A 1EFWA 3BVMA 1EOVA 4IFDH 2NN6H 1GOZA 3MZ5A 1HH2P 2XGTA 3U9OA 4A3LG 3AEVA 5I2XA 4TVAB 4DR1Q 2K01A 3CC7A 4L5RC 1BXTA 3JC66 1L1OC 3I4LA 5FK9C 5D3IB 4X6AH 2QEXA 5CV8A 1JB3A 1D5ZC 4CDEC 1AZQA 3S2DH 5M5YB 2Z8LA 4RCNA 1Y14B 1PZID 2JA5G 1HPCA 4HSPA 4PG3A 4A93H 4DR5Q 5ISRA 2IW3A 1E2ZA 2UUBQ 4K0KL 3K5OA 3H94A 4K8IA 1STHA 2F3VA 4GNXB 1PH3A 4KD4A 3IRBA 2I07B 1VQOA 5IYDH 2X69A 5JJZA 2PYKA 3PO3G 3KBXA 1IYUA 5JEAJ 3M4PA 1L0WA 4K5WA 1C0AA 1N36Q 2IX0A 4DV2Q 4ZUIA 1PTOB 1ZYRD 5GQOA 1O7YA 1I3QH 5ELNA 1TKWB 2L55A 5M5XH 4AYBE 3K5NA 1KLUD 4LF9Q 4A4IA 3GTGB 1FGUA 2JEAI 4CGYB 1HNWQ 3I4MG 3TZUA 3M85A 4BBSG 1WTRA 1QG7A 3I4NB 2VB2X 4IALA 1KDCA 1LTTD 2FHTA 2HIXA 1Q3LA 4HTHA 1R9TB 3ER0A 3TP6A 5C44H 3UE1A 1EYDA 2M9VA 5A35A 3QR8A 1SFOB 4OX9L 1SE3A 2IHFA 1DM0B 1M4VA 1EWHA 4ZYSA 1IKMA 4JV5L 1IBMQ 3H0GH 1KNEA 1K83B 3GQBA 1NJIC 1PXUA 1HA6A 2F0EA 3VR3A 5KRUA 2QA4A 3ULLA 4NB3A 4Q5VA 3HOVB 1G291 4KKTA 4QIWB 1S5DD 1S5BD 1X3PA 3NBHA 1LYLA 4OELB 3S16B 3PO3B 1NE3A 5M5YH 2K5WA 1AN8A 4Y7NH 3BZCA 5IIFA 1RL2A 3PGZA 1LT3D 1PVOA 1QVGA 2F0SA 3GTPB 2N78A 2SDFA 4JBWA 3UDIA 1DZ1A 3D6WA 1STEA 1SNMA 2CCZA 1DOLA 1GVPA 1ZYRC 4IFDI 3HOUB 2NN6I 4L63B 5ELEA 3I4MB 1OXVA 4BBSB 3NXWA 5CV7A 4EX5A 2PNRC 2GVBA 3CCRA 4BY7B 1GD7A 3RNUA 1PTOH 4DAPA 4DNTB 2KCTA 1Y1VH 3NTKA 5BR8Q 1I94Q 4DN4M 1ESRA 2Z4IA 3X3MA 4ZKBB 1FJGQ 3BZKA 3HKSA 3OWEB 1IW7C 1RJTA 2HDLA 1UEAB 3IL8A 1K8GA 3A7AB 1C9OA 1TT2A 1N34L 1HUNA 3I4NH 2R61A 4RKLA 1ET9A 4A3LH 4XQNA 2D0PA 1B8AA 4CDCC 4YWKA 4C2MB 2G9DA 1KDAA 2VQFQ 3KDFA 1U0LA 1R9TH 4G7HC 2L15A 2F3IA 3E3XA 4IJHA 2MHVA 1V1PA 2EOTA 2VQEL 3QWNA 2A68D 4DAYB 1SFOH 3LGJA 4IJLA 1TS4A 4L5QA 3AU7A 2F0NA 1EIHA 1CM9A 1O7LA 1D8LA 3J7YW 1X3QA 4XT1B 3S14B 1J6QA 2RF4A 3L3OC 1HJPA 2JA5H 3TDQA 1STYA 4JI1L 1FD7D 4NMZA 2I0QA 2RQXA 1K83H 2Z4HA 5CV6A 4TRDA 5M5WB 3GTKB 5FKAC 2IPKD 4PMBA 2CKZB 3AFQA 1IL8A 3KBGA 3T1YQ 5C4XB 2F0VA 1PV4A 1OXXK 3PO3H 1OXUA 2N55A 2NVQB 1E2WA 1SYFA 2MFIA 3RD4A 1DYQA 4FDBA 4G57A 4JOIC 4LFCQ 5ELFA 2SOBA 3OW2A 1WCMG 3M7GA 3GTPH 4HJ7A 1W6KA 5CV5A 5T1GA 2WAQB 3HOUH 3H91A 1SROA 4N8FA 1YVCA 3AFPA 3I4MH 2LSSA 4J6HA 1BBUA 4BBSH 1PFBA 2O5JC 3Q0AA 4CBVA 1UE7A 4JC0A 1TXYA 1TS3A 2A6ED 1IZ6A 1STAA 1BVSA 4XXEA 5EPLA 4HSVA 3I3CA 2XRSD 1NR2A 2HIVA 4FYDA 4DUYL 3DM3A 1KNAA 2H4OA 3C1EA 5FJ8G 1WVLA 1I4HA 1FNWA 1V1QA 3V96A 2MP1A 1AZPA 1SYDA 1NY4A 4XT3B 3LNNA 2A68C 4IPHA 2F0HA 2R6GA 3UDGA 1O78A 2TSSA 4UY8C 5EQ0A 3TP8A 3EVQA 5CV4A 1MKHA 3PF4A 1EIGA 2LY7A 5GAGC 2B2WC 2YYZA 1UAPA 4PZ7A 4NXMQ 4OHJA 3S14H 4F87A 1HTLD 2GA4B 3BU2A 5LHY1 3H09A 3I90A 2KBNA 4C3JB 5KNBA 2LXJA 5M5WH 3GTKH 1D1KA 3CKIB 4DF7A 5DNFA 4IUNA 2WB1G 5EKLA 3ULJA 4KD3A 1E2VA 1NMFA 1II3A 3F1ZA 5D65A 3MEFA 3OOCA 5T1IA 1OTCA 1PDQA 1TWHH 2DNCA 1X3GA 1O7IA 2B2YA 3LX0A 3MWYW 4K6DA 1JWMD 5M3MG 5KYLA 4BBRG 1SE4A 5FLXc 1DGSA 2J7ZA 4K6LA 5LL6X 3J7AV 4S3SA 1TS5A 1S5ED 4WJ4A 4KKUA 5IYCG 3A7LA 5C4JH 2RCFA 2A6EC 1LABA 1IYVA 2O2LD 4JW0A 4QCLA 1UE1A 1RTOA 1XNQL 2XNAC 1ILQA 5CV9A 3QOLA 1S5FD 1ML0D 2Z1CA 4WORA 4E6IA 1H9SB 1PRTF 1VQGA 1AE2A 1KRSA 2RA4A 2HQLA 4N9TA 4DKAC 4A3CG 2OEOA 1SYEA 3DEPA 2IX1A 1A2TA 1SNQA 1GUNA 3TS2A 1VQEA 1X55A 2EZVA 3F2BA 4DK6C 3GTMB 2HD3A 4YY3Q 1K3RA 2CH4A 4A3JG 1QZHA 3D4RA 3RLNA 1ASZA 1CA5A 2R7ZG 1X32A 2F0TA 3CMAA 4DR1L 2KCMA 4GN5A 4A3GG 4LUOA 1B70B 4JPBW 4K2LA 2JA6B 4DR4Q 4L8JA 2Q8IB 2RSNA 4B9WA 4CJ0B 2E75C 2JYOA 4BBRB 2EYJA 3KLWA 2JQOA 1KRTA 2UUBL 4LFBQ 2B8GA 4OWTB 2EYLA 2J4XA 2VL6A 5LMUQ 2H1EA 3CPFA 3SEBA 4RHSA 1HQRD 3PIPA 3A8IE 3PUVA 2UXCQ 2ICEC 2EY2A 1CSQA 3CCSA 1VQNA 3CQZB 1JMCA 4NPSA 2PCFB 2EYPA 4CDFC 1N36L 5BN5A 3VYTA 2DUDA 4WRDA 2EJFC 4BXXH 2Z6KC 1OO9B 1Q8IA 4OO1G 5I6WA 1ASYA 3PSIA 1JT8A 4AYBB 1SXTA 2F0FA 5IT9c 4LF9L 1EL0A 1WTHA 1SNPA 1L2FA 5FJ8H 1U4PA 4IUVA 2F52A 4JI3L 5HGQA 3E9HA 4DGZA 4LWCA 2GVAA 3F8TA 3G4SA 4GN3B 2DN8A 1FYCA 2QGQA 5HURA 1A2UA 3S15B 5CYUA 5E4XA 5DM63 4EVOA 3NWTA 3GTQB 1HA5A 2AKWB 4N8X1 3GTMH 4DK1A 4CHTB 1I50B 4POFA 5ELBA 3G6EA 4JI0Q 3FRPB 2DY7A 1D2BA 2UXDQ 4ME5A 5AJ3Q 3PUZA 4ME3A 2ZTEA 1PZJD 4UHVA 4IOAA 3NHHA 1PFMA 4RH6A 1NCVA 1WTQA 2K6AA 1HFGA 1DCZA 3QB3A 1WTPA 4BBRH 2XVSA 4O0AA 3A55A 1EFID 2DNEA 1UUPA 3CD6A 1SRUA 1BCPB 2UXBQ 3FP9A 5IYCH 4YCWA 4KJOA 1XMOL 4JI8Q 1GUSA 3VA7A 3SK5A 1TY0A 2VB3X 1LTRD 2NUCA 1VQ4A 2WKDA 3CQZH 1WTOA 4XTCS 3ICEA 4KV6A 3KLRA 2XN9C 2B63G 3T16A 3A54A 3GTLB 2F1MA 1EY6A 3I56A 3PUYA 1IL2A 5LMNW 2E5LQ 3S2HB 1XMQQ 5LMNQ 5IP9H 3HKZB 3BDCA 1VQ5A 4B3ML 2A74C 1VF5C 2IX3A 1PTOD 1AEXA 4DV5Q 2DJGC 3HOWG 2B2TA 2JK8A 2JE6I 1ET6A 1FNVA 5H1SE 5FO7B 1Y1WB 4JK1C 4DV3L 3M3YB 3SGIA 4GLAC 4A3FG 3DWAA 2RHQB 3KOJA 3UE0A 4A3JH 2NVYB 2VQFL 4R8IA 1YIJA 2MPMA 1JOKA 2HT1A 2ZT9C 3PO2B 1MD2D 3BDOA 4I65A 4P2CB 3J80c 1EYAA 3QIAA 1JJCB 1JE4A 2PI2A 5EGTA 1WTVA 3MXUA 4X64Q 3C46A 1VMPA 4LF5Q 1CQVA 4JI4Q 4QB4A 1YHBA 3T53B 1BQQT 1I50H 3Q8DA 3PIP3 5DAUA 1J9OA 1YI2A 1VQIA 1ESFA 2MNAA 3QOJA 3TP7A 1RDPD 2XIWA 4DV1Q 2A8VA 2RCNA 2D0OA 2K33A 3S2DB 2B2VA 4H0LC 3W5OA 4M1UB 1XX8A 1I4GA 2WFWA 4B9XA 1QCBD 4C3HB 2EVBA 2B63B 1H9SA 4RCOA 2GN5A 4RGMA 3W3AA 4IPCA 5IOCA 2EYOA 1CK1A 3K0XA 3KDFB 1N9WA 4OO1H 4KTAA 4GNXC 1Y8PB 2PMZB 1IYJB 3VYUA 3HOWB 2X6LA 2SEBD 4G7ZC 4TSSA 4A3EG 4FF2A 3UDXA 3GTLH 3DUZA 1CSPA 3U58A 3OSOA 4OL7A 1YNJD 4IUTA 3JAMc 3CMEA 1A15A 1EQVA 3UI2A 1WOCA 3HP3A 1EYGA 2WACA 2BCOA 4JBJA 4DPGA 1YHAA 4R4OA 1SMXA 1GUGA 3M3YH 2CHBD 2O5IC 2WP8J 3Q22A 5I9OA 3KJOA 1WI5A 5JVG3 2F3WA 2B2YC 2PNHA 1SNOA 1ICWA 4KHZA 1HHVA 1HNZL 4KN7C 2JA7G 1QNKA 5C0XJ 1L0YB 4YCVA 5IWAQ 3CC2A 2QKIC 4DUZQ 3OTOQ 4XDXA 4ALPA 1FL0A 1NAPA 5IGBA 4ODGA 1GJXA 1GUOA 1KC8C 5JJIA 1QJOA 5C3XA 5FOBB 1VQMA 5C4HA 2PZUA 4X66L 2L11A 3FPUB 3H0GB 1EQTA 4C56C 3BVZA 2QW7A 5JPMC 4DXGA 4XYQA 2WB1E 4A3MG 4ZLTF 2X6GA 4LF6Q 1X9NA 2D2CC 2K50A 1IBKL 2PW7A 4RGTA 1XWEA 1PMRA 3DWQA 1DJRD 3QG1A 5GROA 4C3HH 2B63H 3K59A 4Y7NB 2RDFA 2SNMA 4TQUS 1C8CA 4A3DB 5JJLA 3NTIA 3TQYA 4UP8A 3M4YA 4TKOB 3WDNA 1KL9A 4CKBA 2D9UA 1WTXA 4KHPQ 2LFNA 5IGFA 2J0TD 3HOWH 3SDZA 1B53A 4C1NI 2BE5C 1QILA 3DMUA 1MI2A 3G6JB 3S1NH 4MIUA 5I4DA 1Y1VB 2ZM6Q 4A3FH 1SBBB 5KYIA 1IBLQ 5KGUA 3A74A 1EOTA 3K81C 3HOXG 4HMJA 3NTHA 4UP7A 1Y69U 1GHKA 1D6EC 4XYOA 1HZ9A 3PUWA 2PPBC 4MZ9A 2EDGA 1XXGA 2AMCB 3CCQA 1VQFA 3STBD 5IGGA 2N3SA 1C7YA 4B08A 4OO1I 1PLFA 5IP7H 1PH8A 4BWGB 4RAUC 3MAQA 1CA6A 4DR6L 4JI5L 1E1OA 4JG2A 1E3PA 4H13C 2WKCA 1YJNA 3J81c 1RKNA 2JA5B 5HY6A 4NXNL 1UWVA 1XJVA 3LWUA 5E4WC 1Q1BA 4FXGC 3CP0A 4POGA 4XQQA 2K4KA 4LJZC 4FVMA 4IUQA 5FLXL 4X62L 5LMUL 3ZYYX 4DV6Q 5GAHC 1I6HH 4LUVA 1RF2D 3ZJYC 2F4VQ 4GOPB 1Q12A 1H95A 3M4OH 4KLKA 1G51A 1RCVD 4WJ3M 4DA2A 4A3DH 5IODA 1LTBD 4PQXA 3W2DA 3E5SA 1J5EQ 4G4KA 1LTAD 2CFMA 4DV4Q 2ZJQA 2K5NA 1IXRA 4J15A 3M9BA 5ELDA 4LF7Q 2CQOA 4PMCA 2ZJRA 2JJQA 3URYA 2HHHL 5JOBA 2YTVA 1F77A 1E1TA 4X65L 4DV0Q 4X3SA 5G3LF 1B2TA 2ZTCA 3D6CA 3PQIA 1D1IA 1TR5A 4FP5D 1VQBA 1M1KC 4C1NK 4HIMA 3J7ZC 2PZTA 1B1ZA 1VQCA 4HMIA 5AFWA 1DD2A 3FPPA 3EA6A 4FNFA 1DXMA 2A5HA 4A3MH 4HJAA 3OW7A 3J80i 1WYDA 2JSOA 3CRKC 3N52A 1H9KA 1OXSC 1V8QA 2KCCA 1N33L 4JI6L 4PV1C 1EU3A 1A63A 2R3ZA 1BBXC 3P75A 2NZ1D 2Y0SE 2UUCL 1Q7YC 2KJXA 2L12A 2F0MA 1CHPD 1R4QB 1LO5D 1QVCA 2A69D 3VR2A 3H3VH 4YCUA 3SVMA 2F0KA 5I9PA 1HR0L 1ENCA 3NPPA 1TWHB 4IUUA 1KHIA 2HUGA 5IT9L 2FINB 3C3LA 4K5VA 1HNXL 3OYYA 1TWCB 1X56A 2EYMA 3TP5A 4DR7Q 4JI2L 3V2TA 3F2CA 4EQOA 2E5LL 3U9SA 1VQ7A 5C4JB 4IFDJ 4GKKL 1VMCA 1Z47A 2PQAB 2ZXPA 4DR3Q 3I2ZA 3HOXH 4AQYL 2VS1A 4CDDC 1MSGA 2NTTA 4B3TQ 1KQSA 5IGEA 4B3SQ 1HFNA 2E76C 1K8MA 2F0JA 3MHBA 1XYIA 1CZWA 2E74C 1LM0A 4DXFA 2WIIB 4KMUC 4FF1A 2I46A 5C0XG 2BDOA 2B2UA 5IE8A 1AW7A 2RHSB 3MXNA 2NZOA 1IKLA 2OT2A 2IJ0A 3WOFA 1VQLA 2OCEA 4ZCKA 5COYA 4MTNA 4LF5L 2KQ3A 3N6RA 3NELA 4LF4Q 2KOLA 4HIKA 5EPKA 3VR6A 2NZHA 4IURA 1HUMA 4IPDA 1EWCA 3DEOA 2A69C 1SDFA 4Q0FA 5C6AA 5M9OA 4YWMA 4JYAL 5FLXE 1PH4A 3HOZG 3T1HQ 4YHHQ 1Y8NB 4B3RQ 2DGYA 3TSSA 1VQ8A 2EYFA 1SE2A 3I73A 4RA8A 1WCMB 2I5MX 4XQJA 1I4PA 1PRTB 4F8MA 2ENBA 3CF5A 4DFAA 1Q82C 1W6JA 4YWLA 2JA8G 1QWYA 3I4OA 2VNUD 3TMEA 2MUYA 2NTSA 4X3TA 4I7AA 1BCPD 5JEAG 1N32Q 1TQOA 2KCNA 1TWCH 4V0BA 2OQKA 3S1RH 2Z0SA 4OEMB 2C35B 2NB0A 1KD1C 3QJYA 4A75A 4OIKA 4QUFA 1TWAB 3Q6SA 5KNCA 2V4DA 1RD9D 1Z9FA 4JI7L 3EN2A 3J80L 1V1OA 1EQQA 4RMFA 3H3VI 2F0PA 4KHVA 2EY6A 1S3OA 4BA2I 4DR2L 1B9NA 4K0KQ 2F0WA 1GUWA 1GHJA 4UP9A 2YU9H 4V190 1KTKA 3MVVA 1CKOA 2ICIA 3U50C 2KECA 3NENA 4GOPA 4HJ9A 3G48A 4JBKA 1F2ZA 1LT6D 2CWAA 1VS0A 5KNDA 1BKBA 4ZAIA 3RMHA 5FO9B 1W3SA 3RN2A 3NWSA 4LF8Q 4KKSA 1A3TA 1PH1A 3RZOB 2ZTDA 1HRJA 1N8RC 1QE6A 2L4NA 2TMPA 4KI0A 2OTLA 3VYRA 4A3BG 3OMGA 1O7ZA 2K32A 2WB1B 4PZ6A 5M3FG 3DXJC 1B4OA 3BYYB 5J3BA 4LF6L 4KN4C 3TEHB 2UUAQ 2UU9Q 3R8BA 3J81i 5M3MB 3FKIG 2EPBA 2KVMA 1VQHA 1M8AA 1WCMH 1QVFA 4DR5L 5FO8B 2LXKA 2ZJPA 5IT9E 4NKLA 3K58A 4QGUA 3EQLC 4F7XA 3G71A 3I91A 4OX9Q 1Q86C 1G6ZA 2ID0A 3R2IA 3JAML 3EIVA 3ND8A 4JV5Q 3CRLC 1GUTA 3DLLA 4DV2L 1LTID 1NNXA 3KFUA 4RG1A 5JVH3 2ASBA 3I7FA 1TVXA 1EQRA 3K57A 4JBMA 2EYHA 1RIPA 3D8GA 4KY7A 4MHEA 3PIOA 3C2PA 1TWAH 3ERQA 1G91A 3R3OA 1HNWL 3CXCA 3CPWA 1NMGA 2K5VA 1XPRA 1G2TA 1HZCA 1MJCA 5F2DA 3H15A 4GKJQ 5EPJA 1MHWC 4FF4A 4A3JB 2L9HA 4DV7Q 2R7ZB 1HTPA 2HCIA 4QY7A 4A3GB 4NP5A 5M3FB 1XTCD 1YZ6A 2MO1A 2EXDA 2FFKB 5E1FA 3RZOH 2O4XA 4DAVA 3K5MA 2D5DA 2M00A 2RVLA 3RUZA 1IBML 1U5KA 2NVXB 1E22A 3KF6A 5D14A 5GAEC 2PQAA 3NE5B 3K6OA 3P7JA 4OIJA 2JA8H 2VUMG 2CVRA 1WTWA 1ZKOA 3OMCA 1YHQA 5CC4A 5M3MH 1EY9A 3HRZC 5JEAH 2R93G 1Y8OB 2QDBA 2Y0SG 3J7AF 3CCLA 4QMGA 3NEMA 4QUCA 4A3IG 1QB5D 1KIXA 1BF4A 1C4QA 2R92G 1ZXTA 1K8OA 4GLXA 3HZXA 4LW1A 2VQEQ 1SNDA 4DV4L 2B8FA 4KK7A 1S4ZA 3ONAB 1YJ9A 1VQ9A 4JI1Q 3K80C 1YNXA 1STNA 3FEWX 1PH9A 1I94L 5BR8L 3MC0B 5E7NA 4Z9CB 3J80E 1JJGA 1CUKA 1PH6A 3GDEA 3K0YA 2RDGA 1FJGL 1EY4A 1EY8A 2FMCA 2KHIA 4A3CH 4K5XA 3X3NA 4QQBX 2OQ0A 3HG9A 1A6XA 3S9WA 2R7FA 1CT1D 3MTSA 4A93G 4RFBA 2FJ2A 5HGTA 1HCZA 2R7ZH 4IZ8A 1CHQD 3LWEA 2L1BA 3J81L 4A3GH 2WAQE 1VQAA 2Z6BA 4OGQC 5M3FH 4IUPA 5CR3A 1P8LA 3Q24A 2BOSA 3CAMA 3AMUA 2YTXA 4RWSC 4DAMA 4YIJA 3TN2A 3VYSA 2Y0SB 2IY5B 3NK9A 1UE5A 2N88A 3ULPA 2NVXH 1JORA 2A73B 1EWIA 2PQEA 2L0CA 1KLGD 1B9MA 3W1BA 4DUYQ 3T1YL 1BR9A 4JOIA 1JWUD 4JVZA 4A3KG 1C48A 1BO0A 4L5SA 1J8IA 4NW2A 4LFCL 3CU7A 3S1QH 4BS9A 3PIO3 1R4PB 1MBYA 1WJJA 3KJPA 5C44G 5J1ZA 2KEDA 1CKMA 1G2SA 2WV6D 3S1NB 3G7LA 4B3TL 2LMCB 1PTOC 3FDTA 2Q8TA 4A3FB 1TS2A 1H9MA 4B3SL 3A5ZB 4FF3A 3RN5A 1E0BA 1TWGB 1PYSB 2HQEA 1STBA 1T9HA 2PI2E 3GD7A 4HCSA 1T5XD 4UAIA 2XSCA 1LT5D 2MJ8A 2HDMA 4RGNA 3SHLA 4IPGA 5BN3A 2B2WA 1Q8KA 4DU9A 3IFDA 3K5LA 5KIXA 1K3BC 1QUQB 3BG3A 1VQ6A 4R8NA 4NXML 2VUMH 4M8AA 3GV3A 3K7AH 3VA5A 4A3KB 2R93H 1EY7A 1BDOA 5DLQE 4A3IH 4ILWA 4ZKCB 1W2BA 3OIQA 2R92H 3MXGA 3SE0A 5JJKA 2I5LX 1K0SA 3S24A 1V9PA 1F2MA 3F2UA 5K36G 3OIPA 1I6HB 5D3DA 3KK7A 2H5XA 4U673 1CKNA 3AYHB 3KYHC 4A3EB 2NVTH 4GOPC 3I4NG 3MXNB 3M4OB 5CBEE 3KF8B 3CCVA 1N32L 3D4DA 1JOOA 4IQZA 1EEFD 3RR5A 4KY6A 3VR4A 4O1NA 1LUZA 3O13A 1MJEA 4WFN3 3SXHA 1B3QA 1YNJC 2E2IB 3D0FA 3IAYA 2EY1A 1JE5A 1X3FA 3BS1A 1AP0A 3SK4A 3KUPA 3DM1A 1E24A 3HGBA 3A0JA 2JA7B 1XTDA 2AUKA 3HOVG 4R4CA 1JICA 2C5CA 4ZK9B 1TWGH 2QDLA 3J81E 2V1CC 3PMFA 3S17H 1VF7A 1PH7A 2DY8A 1LACA 1FGBD 3DWPA 3B6YA 1SE8A 4HR7B 2OWOA 4OONA 1MGSA 1SMYD 4LF8L 1K28A 1EU4A 4YY3L 2NWGA 1VDZA 1NBWA 4A3MB 2R7DA 2RKSA 1K8AC 1O80A 4U68A 2EQSA 5EBDA 3HOUG 2JN4A 4APVA 4DNIA 4FO2A 4CJ1B 4DR4L 4JI3Q 5C3EG 3CCJA 5IY0A 2UUAL 3FMCA 1A0IA 4QJFA 3V05A 3NSWA 4LFAQ 4A3KH 2UU9L 4BY7G 3GV6A 4G7OC 1IW7D 3NBIA 4IOCA 3MA2B 3SK8A 1D5MC 1LTLA 4HJ8A 1EYCA 3UDFA 1SAPA 4LFBL 2JP1A 2N8NA 2UXCL 3E9IA 1PHJA 2EIFA 3R93A 1PRTD 4A3EH 3GTJB 1TIID 1S40A 2Q2HA 5E3FA 3CCEA 2AQ3B 5TSSA 2PO4A 3T13A 1PTOF 2Z6KA 1I6VC 1HZBA 3VR5A 4O42A 1QZGA 1RHPA 2BA1A 1L1OB 1U4LA 1XNRQ 4BY1G 3HOXB 2VW9A 4MTKA 2E2IH 3IFTA 1EIYB 3WWVA 1XPOA 1YNND 1EIFA 2K05A 4HN7A 4X3KA 2FXQA 4RGOS 4GKJL 1PFNA 4HIDA 2KENA 4LUZA 3Q23A 4QL5A 4DV7L 2JA7H 3ERSX 3RZDB 2AHOB 3STBC 1XMOQ 2PZWA 1SMYC 1V43A 1PH2A 1G8ZD 5JAVA 5C4XG 3D4WA 1TY2A 1F2LA 4PMWA 4KJNA 3TBIB 5C3EB 1K0RA 1F9PA 2JXMB 2ZXOA 2QCPX 4BA1I 3MEHA 1SYCA 3PF5A 2NBFA 4JI0L 3J7A5 1WFQA 4CKEA 3HKZE 4B3MQ 1EZ6A 3GTGH 2WAQG 4OXPA 3PCOB 2A6HD 4IN3A 5K36H 1JCKB 2UXDL 5AJ3L 3NQIA 3CCMA 1JWSD 4HJ5A 2CQAA 4H44C 2A19A 4DV3Q 3HS0C 2B2TC 1BUVT 3ITPA 4OWWB 5DM73 3MXPA 4CKCA 1PRTC 4P74A 2XRQD 1NTGA 4RHRA 2UXBL 1PFSA 5ELOA 3U4VA 1FR3A 4JI8L 4BY1B 5EKIA 1FVIA 1SNCA 1SSOA 1UE6A 4QF4A 3I8ZA 4H02A 3GTJH 1U4RA 2JEBI 2LKVA 1I4XA 5IYBG 4EQPA 4J1MA 3S1RB 1QUQA 1F9QA 3P1HA 1AFPA 1YNNC 3HOVH 3KF6B 3U4ZA 1XMQL 5LMNL 5C3WA 1RODA 4WJWA 3S16H 2K04A 4KY5A 2K03A 4DV5L 2KHSA 1VQKA 3KLSX 1S5CD 3BJUA 2F03A 2B2VC 3BVGA 3I72A 2K1BA 2KEEA 4C3JG 2YU9B 1Q90A 1M90C 3RZDH 3JAMi 4CJ2C 2PMZE 4N9PA 3L7ZC 4AH6A 1VCIA 4A76A 4HAEA 1DONA 3KF8A 5C3EH 1DOKA 3A8JE 4X64L 1A8VA 2F0UA 4BY7H 1PYWD 2A6HC 1H9JA 2K14A 1TU2B 4GS3A 4JI4L 1PYBA 2E2HB 4BXXG 2DJFC 4K14A 4OWXB 1GXDC 1YBYA 4MN3A 1SN8A 5CGKA 4DV1L 3PUXA 2B3GA 2QEJC 5FLMG 1Q46A 4O2DA 3K7UC 3FHWA 4C2MH 1SYGA 1EUJA 1HNZQ 4GNXA 3T4AC 2F0GA 3DHQA 1ENFA 3T51B 4BY1H 1EZ8A 5A2QL 1I5FA 2ZXRA 4X66Q 1P16A 3OWFA 4R4QA 3QO2A 1AE3A 2D62A 2KHJA 4FXDA 2K5HA 2F4IA 3OPOA 1VQJA 3TS0A 2E2DC 3IKJA 2FMMA 5C4XH 2JA6G 3D31A 1JR0D 1X6OA 1STGA 4GN4B 2RBMA 3CHBD 1E7ZA 4DNRB 5BN4A 1IBKQ 4IO9A 2NVQH 1LTGD 1EY0A 3HOYG 2EJMA 2F0IA 1D7QA 1PZKD 2AWOA 1WD1A 2A1AA 1IHZA 2B39A 4AIMA 2F0OA 3F2DA 5IWAL 2JA9A 4DUZL 3OTOL 4P72A 2G5DA 1K73C 3HOZB 3GO5A 2K5QA 4HIOA 3S1MB 1JOQA 5KEEA 1Z6HA 1CQFA 1L1OA 1BNZA 2E2HH 2ES2A 3CC4A 1ILPA 4LK1C 4R4IA 1A3UA 4F88A 4UPAA 3L0OA 4R9WA 4AYBG 5IP9G 4L5TA 4PZ8A 4H7BA 2JA8B 2F0LA 1ICFB 2KA7A 2OF1A 1UEBA 3J81j 2AQ2B 3E0EA 1FNUA 2XWJB 2QILA 5IYBH 2WINB 5C4ZA 1BCPC 3E0JA 3A8KE 3TREA 3R2TA 2G9HD 2IL8A 4DR6Q 4JI5Q 3SR1A 1CZGA 2K7VA 4KHPL 4EQ5A 1Q81C 4ULLA 4NXNQ 2I5HA 1JC7A 4J8QA 3HOYB 1BOSA 3L9AX 2EY5A 2CW0D 2ZM6L 4C3JH 1RTNA 1IBLL 4QIWE 3SK6A 1ZEQX 4X62Q 5C0XH 3GTOB 3D3RA 4NDXA 1GM5A 1CKNB 1BBWA 5EAYA 3NUCA 1DOMA 2K52A 4K8JA 1HZAA 1X65A 5IGDA 4ID6A 2XTIA 3TRZA 1WD0A 4A3BB 3WOEA 1EEID 4LMQD 4I7ZC 4MNOA 4DAYA 1H9RA 5C5LA 3H6MA 2E2JB 1Z7TA 3M7NA 3W1GA 5FLMH 3FVQA 4LNQA 4ZRZA 3ND9A 3HOZH 2OXPA 3FKIB 1B50A 1UNSA 1D5XC 2CWPA 4DK0A 3S1MH 2ALYB 4LFAL 1CTMA 2HHHQ 3EJIA 4X65Q 1G6PA 4GZYC 1ONLA 5LL6S 3NQTA 3KLSA 5EKKA 1MIUA 3CW2C 2IWHA 1LLRD 2N49A 4HEDA 3HKZG 1EY5A 2EXZA 4DV6L 1N34Q 1TWFB 1PA6A 2F4VL 1Y1WG 1SJHD 5A2QE 2PW5A 4PNYA 2K28A 2SNSA 3MFYA 3S1QB 4R4TA 1SJED 4C3IG 1JQYD 1MSHA 2MO0A 5I6YA 2Z9HA 1J5EL 3PV0A 4XIGS 5EBCA 1KXLA 3RLFA 1HXYD 3PO2G 1XNRL 1N33Q 4P71A 2YV5A 4JI6Q 2CW0C 3CCUA 2JA6H 2AWNA 5K5PA 1VQDA 4IFDG 2F0DA 2NN6G 2UUCQ 2MQHA 4LF7L 1SR3A 3HOYH 5CMDA 2Q8RE 1OXTA 5DEHA 5ELCA 1I4QA 2LS01 3AB9A 2M2LA 4DV0L 1HR0W 5IGCA 1F9RA 1HR0Q 2BH2A 3GTOH 1LTSD 2E8GA 2B29A 2Q2TA 3AQQA 1ENAA 4P75A 2EE1A 3I55A 4R1JA 4C3HG 1HNXQ 4ABNA 3EBEA 4JI2Q 4GLVB 1XPUA 4A3BH 2BDNA 3C1FA 4GKKQ 2QF7A 1K9MC 5IYDG 4AQYQ 5I2YA 1LV9A 5GADC 2E2JH 1A62A 2MGSA 1NR4A 2VUMB 3NBHB 2VXWA 3K7AB 1Q1EA 3FKIH 2R93B 3EFXD 5EJWA 4X3UA 1F2YA 1B44D 1T5EA 4HCEA 2AQ1B 4A3IB 1A3VA 2IT1A 3HEJA 1X54A 2RDHA 1GKHA 3RLOA 2R92B 4C3IB 2C9OA 5CORA 1BCPF 5C0XI 1LT4D 4UDUC 3S15H 2NYZD 2CH4W 4LAAA 2K75A 1TWFH 1B3AA 2IHEA 5J22A 2NVTB 1U4MA 2B2UC 5G3LD 2HCCA 3GTQH 3HFZB 4EGVA 3JAME 1SEBD 3BZDB 4Y52H 4FXKC 1S72A 2OTJA 1SLJA 5C5MA 2K5DA 3TZDA 5IP7G 1KABA 3P20A 4DR7L 2F0QA 3A56A 5J39A 1QOHA 5L37A 4JCVE 4DR3L 4JYAQ 1NUCA 1KDBA 4ZQ3A 2RSOA 1NSNS 4ZUJA 2ATWA 4A93B 3H0GG 4L6TB
chains in the Genus database with same CATH topology
1PHJA 1YEZA 2EIFA 3J7A5 1L2FA 5FJ8H 4HIKA 4A3EH 1S40A 2F52A 4JI3L 5HGQA 1B7YB 2Q2HA 2NZHA 3E9HA 2BH8A 3CCEA 1JB7A 4LWCA 4IPDA 2Z6KA 2GVAA 1HZBA 2VZAA 3F8TA 3G4SA 4YWMA 4GN3B 4DK3C 4JYAL 1QZGA 2BA1A 1PH4A 3HOZG 1L1OB 4YHHQ 3T1HQ 1VQPA 1XNRQ 2QGQA 4B3RQ 2DGYA 1VQ8A 3L2PA 2I5MX 4BY1G 1GO3E 4A3DG 2VW9A 4LF4L 2E2IH 3A5UA 3S2HH 1EIYB 3K8AA 3WWVA 1XPOA 3CF5A 1Q82C 1EIFA 2YTYA 2AKWB 2VY3A 3GTMH 2FXQA 4YWLA 4GKJL 4POFA 4HIDA 2JA8G 2KENA 3G6EA 4JI0Q 3I4OA 4LUZA 4JI7Q 4QL5A 4DV7L 1YJWA 2VNUD 2JA7H 3ERSX 2Q2IA 2AHOB 1XNQQ 3STBC 5JEAG 1XMOQ 1Y1WH 3T1HL 4YHHL 1N32Q 1X3EA 2UXDQ 5AJ3Q 1V43A 4B3RL 1Y1VG 3M4QA 3PUZA 4ME3A 4DR2Q 1PH2A 3VDYA 5C4XG 1AH9A 1TWCH 2ZTEA 2NVYH 4IOAA 4PMWA 2OQKA 4C3IH 3S1RH 2Z0SA 1KAWA 2Q2UA 1K0RA 1PH5A 2BA0A 4P73A 2C35B 3CCLA 3PO2H 1YITA 1KD1C 1JJ2A 4BBRH 4A75A 1EFWA 4O0AA 4BA1I 1EOVA 3PF5A 3CD6A 1SRUA 1Z9FA 1HH2P 2XGTA 1WFQA 3EN2A 4JI0L 4JI7L 3FP9A 3HKZE 1EQQA 4RMFA 5IYCH 4B3MQ 4YCWA 3AEVA 2WAQG 4OXPA 3PCOB 4JI8Q 1XMOL 3GTGH 3H3VI 2UXDL 1S3OA 5AJ3L 4BA2I 4DR2L 4TVAB 4K0KQ 4UP9A 2YU9H 4DR1Q 3CCMA 3CC7A 1VQ4A 4L5RC 4HJ5A 3CQZH 4XTCS 3ICEA 1CKOA 2A19A 4DV3Q 3JC66 1L1OC 3U50C 2B63G 4X6AH 2QEXA 3NENA 4A3LG 4GOPA 4OWWB 3I56A 3PUYA 4HJ9A 3G48A 4JBKA 3S2DH 1IL2A 5LMNW 2E5LQ 1Y14B 1VS0A 2CWAA 4P74A 1BKBA 1NTGA 1XMQQ 5LMNQ 2JA5G 1PFSA 2UXBL 5ELOA 1W3SA 4PG3A 3U4VA 5IP9H 4DR5Q 3RN2A 1VQ5A 4B3ML 4LF8Q 1PH1A 4A93H 4JI8L 2ZTDA 1FVIA 1UE6A 4DV5Q 1N8RC 2UUBQ 3HOWG 4H02A 4K0KL 2JK8A 2JE6I 4KI0A 3GTJH 2OTLA 5H1SE 4A3BG 2JEBI 4GNXB 1PH3A 4DV3L 4PZ6A 5M3FG 3IRBA 5IYDH 1VQOA 3SGIA 4GLAC 5J3BA 4A3FG 3KOJA 2RHQB 3UE0A 3TEHB 5IYBG 4A3JH 4LF6L 5JEAJ 3M4PA 3PO3G 2UUAQ 2VQFL 1L0WA 1QUQA 2UU9Q 3J81i 1YIJA 3FKIG 3HOVH 2HT1A 1C0AA 3KF6B 3U4ZA 1XMQL 1VQHA 2IX0A 5LMNL 3J80c 4DV2Q 1N36Q 1WCMH 1JJCB 1QVFA 4DR5L 5GQOA 2PI2A 3S16H 2LXKA 1I3QH 5ELNA 2ZJPA 4DV5L 4X64Q 1VQKA 5M5XH 3BJUA 4AYBE 4LF5Q 4QGUA 4LF9Q 4A4IA 3G71A 4JI4Q 1FGUA 2JEAI 1YHBA 4OX9Q 1HNWQ 1I50H 1Q86C 3Q8DA 3I4MG 1YI2A 3M85A 4BBSG 1VQIA 2ID0A 1M90C 3RZDH 2MNAA 3JAMi 3EIVA 4JV5Q 2PMZE 4DV1Q 2A8VA 2RCNA 2D0OA 3DLLA 4DV2L 3L7ZC 2HIXA 4AH6A 1VCIA 3W5OA 4A76A 3KFUA 4RG1A 5C3EH 3ER0A 2ASBA 3I7FA 1EQRA 4X64L 2WFWA 1A8VA 4JBMA 4BY7H 1RIPA 5C44H 3PIOA 2K14A 3UE1A 4GS3A 1TWAH 2GN5A 4JI4L 4IPCA 4OX9L 1HNWL 1PYBA 3CXCA 3CPWA 1NMGA 3K0XA 2K5VA 2IHFA 3KDFB 1N9WA 4OWXB 1XPRA 4BXXG 1HZCA 1MJCA 3H15A 4GNXC 1YBYA 4JV5L 4GKJQ 1SN8A 1IBMQ 1IYJB 3H0GH 4DV1L 3PUXA 1NJIC 2B3GA 4DV7Q 5FLMG 2QA4A 1Q46A 3ULLA 4NB3A 4O2DA 4A3EG 4QY7A 3K7UC 1G291 3FHWA 3UDXA 3GTLH 1YZ6A 4C2MH 1LYLA 1EUJA 2MO1A 1CSPA 1NE3A 5M5YH 3U58A 1HNZQ 4GNXA 2EXDA 3JAMc 3CMEA 4Y7NH 1EYGA 3BZCA 1WOCA 4BY1H 3RZOH 1RL2A 3PGZA 1IBML 1PVOA 1QVGA 1U5KA 2N78A 4JBJA 4JBWA 1E22A 1I5FA 3KF6A 3UDIA 4DPGA 2PQAA 5GAEC 1YHAA 4R4OA 1SMXA 2CCZA 3M3YH 4X66Q 1GVPA 2WP8J 4IFDI 1P16A 3KJOA 1WI5A 4R4QA 2NN6I 2PNHA 2JA8H 2VUMG 1OXVA 4KHZA 1AE3A 2D62A 1HNZL 4EX5A 1YHQA 2KHJA 2JA7G 2GVBA 5M3MH 3CCRA 2K5HA 5C0XJ 2R93G 1GD7A 2Y0SG 4YCVA 5IWAQ 3RNUA 1VQJA 3NEMA 3TS0A 2KCTA 1Y1VH 5BR8Q 4A3IG 1I94Q 4DUZQ 3CC2A 5C4XH 3OTOQ 3D31A 2JA6G 1X6OA 4GN4B 1KIXA 1IBKQ 1E7ZA 1FL0A 4ALPA 2R92G 4IO9A 2NVQH 4GLXA 1KC8C 1FJGQ 5JJIA 4LW1A 3BZKA 3HKSA 2VQEQ 3HOYG 1VQMA 4X66L 4DV4L 1D7QA 1K8GA 1C9OA 2AWOA 1N34L 2WB1E 3I4NH 2A1AA 4A3MG 4A3LH 1YJ9A 1VQ9A 4JI1Q 4AIMA 2D0PA 3K80C 1B8AA 1YNXA 1PH9A 4LF6Q 4YWKA 3F2DA 5IWAL 2JA9A 1X9NA 1I94L 5BR8L 2K50A 5E7NA 2VQFQ 4DUZL 3OTOL 1JJGA 3KDFA 1U0LA 4P72A 1R9TH 1CUKA 2L15A 2F3IA 1PH6A 1K73C 1IBKL 4IJHA 3GDEA 3GO5A 1FJGL 5GROA 4C3HH 4HIOA 2B63H 2VQEL 4TQUS 2KHIA 5JJLA 4A3CH 3TQYA 4DAYB 3LGJA 4IJLA 1SFOH 1L1OA 4L5QA 4QQBX 2OQ0A 2E2HH 3CC4A 2ES2A 4UP8A 1D8LA 1J6QA 2RF4A 4R4IA 1HJPA 4UPAA 1KL9A 2JA5H 3L0OA 4AYBG 2R7FA 4JI1L 5IP9G 4L5TA 2I0QA 4A93G 4KHPQ 1K83H 4PZ8A 2R7ZH 3HOWH 4A3GH 2WAQE 1VQAA 1UEBA 3J81j 2CKZB 3AFQA 3E0EA 3S1NH 5M3FH 2ZM6Q 1P8LA 3T1YQ 4A3FH 1OXXK 1PV4A 5IYBH 3PO3H 3CAMA 1IBLQ 1OXUA 2YTXA 3A74A 2MFIA 4DAMA 3TREA 4FDBA 4JOIC 4LFCQ 3OW2A 4DR6Q 3K81C 4JI5Q 1WCMG 2IY5B 3HOXG 1UE5A 4UP7A 4KHPL 3ULPA 4EQ5A 1Q81C 1HZ9A 3PUWA 3GTPH 2NVXH 4MZ9A 4HJ7A 2AMCB 3CCQA 4NXNQ 2I5HA 1EWIA 1VQFA 3STBD 3HOUH 2N3SA 1SROA 1C7YA 3W1BA 4DUYQ 1YVCA 3AFPA 3I4MH 2ZM6L 2LSSA 4C3JH 3T1YL 4BBSH 1BBUA 4JOIA 4OO1I 1IBLL 4QIWE 5IP7H 1PH8A 4A3KG 1UE7A 4X62Q 4JC0A 1TXYA 4L5SA 4LFCL 4DR6L 1IZ6A 3S1QH 4JI5L 1BVSA 1E1OA 1WJJA 1E3PA 4JG2A 1GM5A 1YJNA 1CKNB 3KJPA 1BBWA 5EAYA 3J81c 5HY6A 4NXNL 1UWVA 1XJVA 5C44G 2K52A 2HIVA 1Q1BA 1HZAA 1X65A 3CP0A 4DUYL 4POGA 3DM3A 5FJ8G 1CKMA 2XTIA 3TRZA 1V1QA 2K4KA 4B3TL 1NY4A 4MNOA 4X62L 5LMUL 4IPHA 4DV6Q 2R6GA 3UDGA 5GAHC 1I6HH 3M7NA 4UY8C 4LUVA 3W1GA 3ZJYC 5FLMH 2F4VQ 4LNQA 4GOPB 1Q12A 3HOZH 4B3SL 1H95A 3A5ZB 1MKHA 3PF4A 3M4OH 4KLKA 1G51A 2CWPA 5GAGC 3S1MH 2ALYB 3RN5A 4WJ3M 4LFAL 2YYZA 4A3DH 4PZ7A 1PYSB 2HHHQ 4NXMQ 1T9HA 4X65Q 2PI2E 1G6PA 1J5EQ 3GD7A 3S14H 1MIUA 3BU2A 3CW2C 2CFMA 2N49A 4DV4Q 2ZJQA 2K5NA 3HKZG 1IXRA 4J15A 2KBNA 4DV6L 1N34Q 1PA6A 2LXJA 5M5WH 3M9BA 4IPGA 4LF7Q 2F4VL 3GTKH 1Q8KA 1Y1WG 2WB1G 2CQOA 1QUQB 3ULJA 2ZJRA 1NMFA 1VQ6A 3F1ZA 3MEFA 2JJQA 4NXML 4R4TA 1OTCA 2HHHL 2VUMH 1TWHH 2YTVA 1E1TA 4X65L 4DV0Q 3K7AH 2MO0A 1J5EL 1X3GA 1O7IA 3PV0A 4XIGS 5M3MG 2ZTCA 3RLFA 3PO2G 2R93H 1KXLA 1XNRL 1N33Q 4P71A 2YV5A 5DLQE 4BBRG 4A3IH 4JI6Q 5FLXc 3CCUA 2JA6H 1DGSA 1VQBA 1VQDA 2AWNA 1W2BA 1M1KC 4HIMA 4IFDG 2R92H 2NN6G 5JJKA 2I5LX 3J7ZC 2UUCQ 3S24A 2MQHA 4LF7L 4WJ4A 1SR3A 5IYCG 3HOYH 1VQCA 1V9PA 5C4JH 5K36G 1OXTA 2H5XA 1CKNA 3AYHB 3KYHC 2NVTH 4GOPC 4A3MH 3I4NG 3MXNB 1UE1A 4DV0L 1HR0W 4HJAA 3KF8B 1WYDA 3J80i 1XNQL 3CCVA 1HR0Q 1OXSC 1N32L 2BH2A 3GTOH 1N33L 2E8GA 3RR5A 4JI6L 2B29A 2Q2TA 1A63A 3AQQA 1LUZA 1VQGA 4P75A 1AE2A 1KRSA 2Y0SE 3I55A 2UUCL 4R1JA 1Q7YC 1MJEA 1HNXQ 2HQLA 4DKAC 4A3CG 1QVCA 3H3VH 3EBEA 4JI2Q 2IX1A 4GLVB 4YCUA 1VQEA 1XPUA 3TS2A 4A3BH 1X55A 4GKKQ 1K9MC 3D0FA 3F2BA 4DK6C 5IYDG 4AQYQ 5GADC 1JE5A 4YY3Q 1X3FA 2E2JH 1A62A 1K3RA 4A3JG 1QZHA 1HR0L 3RLNA 1ASZA 2R7ZG 3NBHB 3CMAA 1E24A 1KHIA 1Q1EA 3A0JA 4DR1L 2KCMA 1XTDA 3FKIH 4GN5A 4R4CA 4LUOA 3HOVG 4A3GG 1B70B 1TWGH 2IT1A 1HNXL 2V1CC 3S17H 4DR4Q 3OYYA 1X54A 1PH7A 1GKHA 1X56A 3RLOA 4DR7Q 4JI2L 3B6YA 3F2CA 2E5LL 1SE8A 1VQ7A 2OWOA 4IFDJ 5C0XI 4GKKL 4OONA 1Z47A 2PQAB 4DR3Q 3I2ZA 3HOXH 4AQYL 4LF8L 3S15H 2JQOA 3KLWA 2VS1A 4YY3L 2K75A 1TWFH 2IHEA 1KRTA 2UUBL 1NBWA 4B3TQ 4LFBQ 4OWTB 2R7DA 5LMUQ 3GTQH 2VL6A 2UXBQ 3HFZB 1K8AC 3CPFA 3HOUG 2EQSA 3PIPA 3PUVA 4APVA 1KQSA 2UXCQ 4DNIA 1CSQA 4Y52H 4DR4L 2OTJA 1S72A 1SLJA 3CCSA 4B3SQ 4JI3Q 5C3EG 3CCJA 5IY0A 2UUAL 5IP7G 1A0IA 1VQNA 4DR7L 1JMCA 4QJFA 4A3KH 4LFAQ 2UU9L 4BY7G 4NPSA 1LM0A 1N36L 4JCVE 5C0XG 4IOCA 5IE8A 4DR3L 4JYAQ 1LTLA 2DUDA 2RHSB 4HJ8A 2NZOA 1VQLA 4BXXH 2OCEA 2Z6KC 3UDFA 4OO1G 4MTNA 3PSIA 1ASYA 2ATWA 4LFBL 1JT8A 4LF5L 3NELA 5IT9c 4LF4Q 4LF9L 3H0GG 2N8NA 2UXCL 3E9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PHJ A;  1YEZ A;  2EIF A;  3J7A 5;  1L2F A;  5FJ8 H;  4HIK A;  4A3E H;  1S40 A;  2F52 A;  4JI3 L;  5HGQ A;  1B7Y B;  2Q2H A;  2NZH A;  3E9H A;  2BH8 A;  3CCE A;  1JB7 A;  4LWC A;  4IPD A;  2Z6K A;  2GVA A;  1HZB A;  2VZA A;  3F8T A;  3G4S A;  4YWM A;  4GN3 B;  4DK3 C;  4JYA L;  1QZG A;  2BA1 A;  1PH4 A;  3HOZ G;  1L1O B;  4YHH Q;  3T1H Q;  1VQP A;  1XNR Q;  2QGQ A;  4B3R Q;  2DGY A;  1VQ8 A;  3L2P A;  2I5M X;  4BY1 G;  1GO3 E;  4A3D G;  2VW9 A;  4LF4 L;  2E2I H;  3A5U A;  3S2H H;  1EIY B;  3K8A A;  3WWV A;  1XPO A;  3CF5 A;  1Q82 C;  1EIF A;  2YTY A;  2AKW B;  2VY3 A;  3GTM H;  2FXQ A;  4YWL A;  4GKJ L;  4POF A;  4HID A;  2JA8 G;  2KEN A;  3G6E A;  4JI0 Q;  3I4O A;  4LUZ A;  4JI7 Q;  4QL5 A;  4DV7 L;  1YJW A;  2VNU D;  2JA7 H;  3ERS X;  2Q2I A;  2AHO B;  1XNQ Q;  3STB C;  5JEA G;  1XMO Q;  1Y1W H;  3T1H L;  4YHH L;  1N32 Q;  1X3E A;  2UXD Q;  5AJ3 Q;  1V43 A;  4B3R L;  1Y1V G;  3M4Q A;  3PUZ A;  4ME3 A;  4DR2 Q;  1PH2 A;  3VDY A;  5C4X G;  1AH9 A;  1TWC H;  2ZTE A;  2NVY H;  4IOA A;  4PMW A;  2OQK A;  4C3I H;  3S1R H;  2Z0S A;  1KAW A;  2Q2U A;  1K0R A;  1PH5 A;  2BA0 A;  4P73 A;  2C35 B;  3CCL A;  3PO2 H;  1YIT A;  1KD1 C;  1JJ2 A;  4BBR H;  4A75 A;  1EFW A;  4O0A A;  4BA1 I;  1EOV A;  3PF5 A;  3CD6 A;  1SRU A;  1Z9F A;  1HH2 P;  2XGT A;  1WFQ A;  3EN2 A;  4JI0 L;  4JI7 L;  3FP9 A;  3HKZ E;  1EQQ A;  4RMF A;  5IYC H;  4B3M Q;  4YCW A;  3AEV A;  2WAQ G;  4OXP A;  3PCO B;  4JI8 Q;  1XMO L;  3GTG H;  3H3V I;  2UXD L;  1S3O A;  5AJ3 L;  4BA2 I;  4DR2 L;  4TVA B;  4K0K Q;  4UP9 A;  2YU9 H;  4DR1 Q;  3CCM A;  3CC7 A;  1VQ4 A;  4L5R C;  4HJ5 A;  3CQZ H;  4XTC S;  3ICE A;  1CKO A;  2A19 A;  4DV3 Q;  3JC6 6;  1L1O C;  3U50 C;  2B63 G;  4X6A H;  2QEX A;  3NEN A;  4A3L G;  4GOP A;  4OWW B;  3I56 A;  3PUY A;  4HJ9 A;  3G48 A;  4JBK A;  3S2D H;  1IL2 A;  5LMN W;  2E5L Q;  1Y14 B;  1VS0 A;  2CWA A;  4P74 A;  1BKB A;  1NTG A;  1XMQ Q;  5LMN Q;  2JA5 G;  1PFS A;  2UXB L;  5ELO A;  1W3S A;  4PG3 A;  3U4V A;  5IP9 H;  4DR5 Q;  3RN2 A;  1VQ5 A;  4B3M L;  4LF8 Q;  1PH1 A;  4A93 H;  4JI8 L;  2ZTD A;  1FVI A;  1UE6 A;  4DV5 Q;  1N8R C;  2UUB Q;  3HOW G;  4H02 A;  4K0K L;  2JK8 A;  2JE6 I;  4KI0 A;  3GTJ H;  2OTL A;  5H1S E;  4A3B G;  2JEB I;  4GNX B;  1PH3 A;  4DV3 L;  4PZ6 A;  5M3F G;  3IRB A;  5IYD H;  1VQO A;  3SGI A;  4GLA C;  5J3B A;  4A3F G;  3KOJ A;  2RHQ B;  3UE0 A;  3TEH B;  5IYB G;  4A3J H;  4LF6 L;  5JEA J;  3M4P A;  3PO3 G;  2UUA Q;  2VQF L;  1L0W A;  1QUQ A;  2UU9 Q;  3J81 i;  1YIJ A;  3FKI G;  3HOV H;  2HT1 A;  1C0A A;  3KF6 B;  3U4Z A;  1XMQ L;  1VQH A;  2IX0 A;  5LMN L;  3J80 c;  4DV2 Q;  1N36 Q;  1WCM H;  1JJC B;  1QVF A;  4DR5 L;  5GQO A;  2PI2 A;  3S16 H;  2LXK A;  1I3Q H;  5ELN A;  2ZJP A;  4DV5 L;  4X64 Q;  1VQK A;  5M5X H;  3BJU A;  4AYB E;  4LF5 Q;  4QGU A;  4LF9 Q;  4A4I A;  3G71 A;  4JI4 Q;  1FGU A;  2JEA I;  1YHB A;  4OX9 Q;  1HNW Q;  1I50 H;  1Q86 C;  3Q8D A;  3I4M G;  1YI2 A;  3M85 A;  4BBS G;  1VQI A;  2ID0 A;  1M90 C;  3RZD H;  2MNA A;  3JAM i;  3EIV A;  4JV5 Q;  2PMZ E;  4DV1 Q;  2A8V A;  2RCN A;  2D0O A;  3DLL A;  4DV2 L;  3L7Z C;  2HIX A;  4AH6 A;  1VCI A;  3W5O A;  4A76 A;  3KFU A;  4RG1 A;  5C3E H;  3ER0 A;  2ASB A;  3I7F A;  1EQR A;  4X64 L;  2WFW A;  1A8V A;  4JBM A;  4BY7 H;  1RIP A;  5C44 H;  3PIO A;  2K14 A;  3UE1 A;  4GS3 A;  1TWA H;  2GN5 A;  4JI4 L;  4IPC A;  4OX9 L;  1HNW L;  1PYB A;  3CXC A;  3CPW A;  1NMG A;  3K0X A;  2K5V A;  2IHF A;  3KDF B;  1N9W A;  4OWX B;  1XPR A;  4BXX G;  1HZC A;  1MJC A;  3H15 A;  4GNX C;  1YBY A;  4JV5 L;  4GKJ Q;  1SN8 A;  1IBM Q;  1IYJ B;  3H0G H;  4DV1 L;  3PUX A;  1NJI C;  2B3G A;  4DV7 Q;  5FLM G;  2QA4 A;  1Q46 A;  3ULL A;  4NB3 A;  4O2D A;  4A3E G;  4QY7 A;  3K7U C;  1G29 1;  3FHW A;  3UDX A;  3GTL H;  1YZ6 A;  4C2M H;  1LYL A;  1EUJ A;  2MO1 A;  1CSP A;  1NE3 A;  5M5Y H;  3U58 A;  1HNZ Q;  4GNX A;  2EXD A;  3JAM c;  3CME A;  4Y7N H;  1EYG A;  3BZC A;  1WOC A;  4BY1 H;  3RZO H;  1RL2 A;  3PGZ A;  1IBM L;  1PVO A;  1QVG A;  1U5K A;  2N78 A;  4JBJ A;  4JBW A;  1E22 A;  1I5F A;  3KF6 A;  3UDI A;  4DPG A;  2PQA A;  5GAE C;  1YHA A;  4R4O A;  1SMX A;  2CCZ A;  3M3Y H;  4X66 Q;  1GVP A;  2WP8 J;  4IFD I;  1P16 A;  3KJO A;  1WI5 A;  4R4Q A;  2NN6 I;  2PNH A;  2JA8 H;  2VUM G;  1OXV A;  4KHZ A;  1AE3 A;  2D62 A;  1HNZ L;  4EX5 A;  1YHQ A;  2KHJ A;  2JA7 G;  2GVB A;  5M3M H;  3CCR A;  2K5H A;  5C0X J;  2R93 G;  1GD7 A;  2Y0S G;  4YCV A;  5IWA Q;  3RNU A;  1VQJ A;  3NEM A;  3TS0 A;  2KCT A;  1Y1V H;  5BR8 Q;  4A3I G;  1I94 Q;  4DUZ Q;  3CC2 A;  5C4X H;  3OTO Q;  3D31 A;  2JA6 G;  1X6O A;  4GN4 B;  1KIX A;  1IBK Q;  1E7Z A;  1FL0 A;  4ALP A;  2R92 G;  4IO9 A;  2NVQ H;  4GLX A;  1KC8 C;  1FJG Q;  5JJI A;  4LW1 A;  3BZK A;  3HKS A;  2VQE Q;  3HOY G;  1VQM A;  4X66 L;  4DV4 L;  1D7Q A;  1K8G A;  1C9O A;  2AWO A;  1N34 L;  2WB1 E;  3I4N H;  2A1A A;  4A3M G;  4A3L H;  1YJ9 A;  1VQ9 A;  4JI1 Q;  4AIM A;  2D0P A;  3K80 C;  1B8A A;  1YNX A;  1PH9 A;  4LF6 Q;  4YWK A;  3F2D A;  5IWA L;  2JA9 A;  1X9N A;  1I94 L;  5BR8 L;  2K50 A;  5E7N A;  2VQF Q;  4DUZ L;  3OTO L;  1JJG A;  3KDF A;  1U0L A;  4P72 A;  1R9T H;  1CUK A;  2L15 A;  2F3I A;  1PH6 A;  1K73 C;  1IBK L;  4IJH A;  3GDE A;  3GO5 A;  1FJG L;  5GRO A;  4C3H H;  4HIO A;  2B63 H;  2VQE L;  4TQU S;  2KHI A;  5JJL A;  4A3C H;  3TQY A;  4DAY B;  3LGJ A;  4IJL A;  1SFO H;  1L1O A;  4L5Q A;  4QQB X;  2OQ0 A;  2E2H H;  3CC4 A;  2ES2 A;  4UP8 A;  1D8L A;  1J6Q A;  2RF4 A;  4R4I A;  1HJP A;  4UPA A;  1KL9 A;  2JA5 H;  3L0O A;  4AYB G;  2R7F A;  4JI1 L;  5IP9 G;  4L5T A;  2I0Q A;  4A93 G;  4KHP Q;  1K83 H;  4PZ8 A;  2R7Z H;  3HOW H;  4A3G H;  2WAQ E;  1VQA A;  1UEB A;  3J81 j;  2CKZ B;  3AFQ A;  3E0E A;  3S1N H;  5M3F H;  2ZM6 Q;  1P8L A;  3T1Y Q;  4A3F H;  1OXX K;  1PV4 A;  5IYB H;  3PO3 H;  3CAM A;  1IBL Q;  1OXU A;  2YTX A;  3A74 A;  2MFI A;  4DAM A;  3TRE A;  4FDB A;  4JOI C;  4LFC Q;  3OW2 A;  4DR6 Q;  3K81 C;  4JI5 Q;  1WCM G;  2IY5 B;  3HOX G;  1UE5 A;  4UP7 A;  4KHP L;  3ULP A;  4EQ5 A;  1Q81 C;  1HZ9 A;  3PUW A;  3GTP H;  2NVX H;  4MZ9 A;  4HJ7 A;  2AMC B;  3CCQ A;  4NXN Q;  2I5H A;  1EWI A;  1VQF A;  3STB D;  3HOU H;  2N3S A;  1SRO A;  1C7Y A;  3W1B A;  4DUY Q;  1YVC A;  3AFP A;  3I4M H;  2ZM6 L;  2LSS A;  4C3J H;  3T1Y L;  4BBS H;  1BBU A;  4JOI A;  4OO1 I;  1IBL L;  4QIW E;  5IP7 H;  1PH8 A;  4A3K G;  1UE7 A;  4X62 Q;  4JC0 A;  1TXY A;  4L5S A;  4LFC L;  4DR6 L;  1IZ6 A;  3S1Q H;  4JI5 L;  1BVS A;  1E1O A;  1WJJ A;  1E3P A;  4JG2 A;  1GM5 A;  1YJN A;  1CKN B;  3KJP A;  1BBW A;  5EAY A;  3J81 c;  5HY6 A;  4NXN L;  1UWV A;  1XJV A;  5C44 G;  2K52 A;  2HIV A;  1Q1B A;  1HZA A;  1X65 A;  3CP0 A;  4DUY L;  4POG A;  3DM3 A;  5FJ8 G;  1CKM A;  2XTI A;  3TRZ A;  1V1Q A;  2K4K A;  4B3T L;  1NY4 A;  4MNO A;  4X62 L;  5LMU L;  4IPH A;  4DV6 Q;  2R6G A;  3UDG A;  5GAH C;  1I6H H;  3M7N A;  4UY8 C;  4LUV A;  3W1G A;  3ZJY C;  5FLM H;  2F4V Q;  4LNQ A;  4GOP B;  1Q12 A;  3HOZ H;  4B3S L;  1H95 A;  3A5Z B;  1MKH A;  3PF4 A;  3M4O H;  4KLK A;  1G51 A;  2CWP A;  5GAG C;  3S1M H;  2ALY B;  3RN5 A;  4WJ3 M;  4LFA L;  2YYZ A;  4A3D H;  4PZ7 A;  1PYS B;  2HHH Q;  4NXM Q;  1T9H A;  4X65 Q;  2PI2 E;  1G6P A;  1J5E Q;  3GD7 A;  3S14 H;  1MIU A;  3BU2 A;  3CW2 C;  2CFM A;  2N49 A;  4DV4 Q;  2ZJQ A;  2K5N A;  3HKZ G;  1IXR A;  4J15 A;  2KBN A;  4DV6 L;  1N34 Q;  1PA6 A;  2LXJ A;  5M5W H;  3M9B A;  4IPG A;  4LF7 Q;  2F4V L;  3GTK H;  1Q8K A;  1Y1W G;  2WB1 G;  2CQO A;  1QUQ B;  3ULJ A;  2ZJR A;  1NMF A;  1VQ6 A;  3F1Z A;  3MEF A;  2JJQ A;  4NXM L;  4R4T A;  1OTC A;  2HHH L;  2VUM H;  1TWH H;  2YTV A;  1E1T A;  4X65 L;  4DV0 Q;  3K7A H;  2MO0 A;  1J5E L;  1X3G A;  1O7I A;  3PV0 A;  4XIG S;  5M3M G;  2ZTC A;  3RLF A;  3PO2 G;  2R93 H;  1KXL A;  1XNR L;  1N33 Q;  4P71 A;  2YV5 A;  5DLQ E;  4BBR G;  4A3I H;  4JI6 Q;  5FLX c;  3CCU A;  2JA6 H;  1DGS A;  1VQB A;  1VQD A;  2AWN A;  1W2B A;  1M1K C;  4HIM A;  4IFD G;  2R92 H;  2NN6 G;  5JJK A;  2I5L X;  3J7Z C;  2UUC Q;  3S24 A;  2MQH A;  4LF7 L;  4WJ4 A;  1SR3 A;  5IYC G;  3HOY H;  1VQC A;  1V9P A;  5C4J H;  5K36 G;  1OXT A;  2H5X A;  1CKN A;  3AYH B;  3KYH C;  2NVT H;  4GOP C;  4A3M H;  3I4N G;  3MXN B;  1UE1 A;  4DV0 L;  1HR0 W;  4HJA A;  3KF8 B;  1WYD A;  3J80 i;  1XNQ L;  3CCV A;  1HR0 Q;  1OXS C;  1N32 L;  2BH2 A;  3GTO H;  1N33 L;  2E8G A;  3RR5 A;  4JI6 L;  2B29 A;  2Q2T A;  1A63 A;  3AQQ A;  1LUZ A;  1VQG A;  4P75 A;  1AE2 A;  1KRS A;  2Y0S E;  3I55 A;  2UUC L;  4R1J A;  1Q7Y C;  1MJE A;  1HNX Q;  2HQL A;  4DKA C;  4A3C G;  1QVC A;  3H3V H;  3EBE A;  4JI2 Q;  2IX1 A;  4GLV B;  4YCU A;  1VQE A;  1XPU A;  3TS2 A;  4A3B H;  1X55 A;  4GKK Q;  1K9M C;  3D0F A;  3F2B A;  4DK6 C;  5IYD G;  4AQY Q;  5GAD C;  1JE5 A;  4YY3 Q;  1X3F A;  2E2J H;  1A62 A;  1K3R A;  4A3J G;  1QZH A;  1HR0 L;  3RLN A;  1ASZ A;  2R7Z G;  3NBH B;  3CMA A;  1E24 A;  1KHI A;  1Q1E A;  3A0J A;  4DR1 L;  2KCM A;  1XTD A;  3FKI H;  4GN5 A;  4R4C A;  4LUO A;  3HOV G;  4A3G G;  1B70 B;  1TWG H;  2IT1 A;  1HNX L;  2V1C C;  3S17 H;  4DR4 Q;  3OYY A;  1X54 A;  1PH7 A;  1GKH A;  1X56 A;  3RLO A;  4DR7 Q;  4JI2 L;  3B6Y A;  3F2C A;  2E5L L;  1SE8 A;  1VQ7 A;  2OWO A;  4IFD J;  5C0X I;  4GKK L;  4OON A;  1Z47 A;  2PQA B;  4DR3 Q;  3I2Z A;  3HOX H;  4AQY L;  4LF8 L;  3S15 H;  2JQO A;  3KLW A;  2VS1 A;  4YY3 L;  2K75 A;  1TWF H;  2IHE A;  1KRT A;  2UUB L;  1NBW A;  4B3T Q;  4LFB Q;  4OWT B;  2R7D A;  5LMU Q;  3GTQ H;  2VL6 A;  2UXB Q;  3HFZ B;  1K8A C;  3CPF A;  3HOU G;  2EQS A;  3PIP A;  3PUV A;  4APV A;  1KQS A;  2UXC Q;  4DNI A;  1CSQ A;  4Y52 H;  4DR4 L;  2OTJ A;  1S72 A;  1SLJ A;  3CCS A;  4B3S Q;  4JI3 Q;  5C3E G;  3CCJ A;  5IY0 A;  2UUA L;  5IP7 G;  1A0I A;  1VQN A;  4DR7 L;  1JMC A;  4QJF A;  4A3K H;  4LFA Q;  2UU9 L;  4BY7 G;  4NPS A;  1LM0 A;  1N36 L;  4JCV E;  5C0X G;  4IOC A;  5IE8 A;  4DR3 L;  4JYA Q;  1LTL A;  2DUD A;  2RHS B;  4HJ8 A;  2NZO A;  1VQL A;  4BXX H;  2OCE A;  2Z6K C;  3UDF A;  4OO1 G;  4MTN A;  3PSI A;  1ASY A;  2ATW A;  4LFB L;  1JT8 A;  4LF5 L;  3NEL A;  5IT9 c;  4LF4 Q;  4LF9 L;  3H0G G;  2N8N A;  2UXC L;  3E9I A; 
#chains in the Genus database with same CATH topology
 2KUM A;  1YEZ A;  2EJG C;  2AUJ D;  1B7Y B;  2BH8 A;  1JB7 A;  3S17 B;  1V1P B;  2VZA A;  3I70 A;  2XWB B;  5CBA E;  4DK3 C;  1L0X B;  3GP7 A;  4K2K A;  3T56 B;  1U9R A;  1VQP A;  1HQM C;  3L2P A;  2L5T A;  5JPN C;  1GO3 E;  4A3D G;  4LF4 L;  1I3Q B;  1QNU A;  3A5U A;  3S2H H;  3K8A A;  2BE5 D;  5M5X B;  3MFG A;  3BYT B;  2YTY A;  2VY3 A;  1CFM A;  3E6Z X;  4JI7 Q;  3NP8 A;  1YJW A;  2Q2I A;  1XNQ Q;  1SYB A;  3OHX C;  1Y1W H;  3T1H L;  4YHH L;  1X3E A;  3BDL A;  4B3R L;  1Y1V G;  3M4Q A;  4DR2 Q;  4RKB A;  5NUC A;  1AH9 A;  3VDY A;  1KAA A;  2NVY H;  3ERO A;  3H3V C;  2P5Z X;  4C3I H;  2Q2U A;  1KAW A;  1I4R A;  1PH5 A;  2BA0 A;  4P73 A;  3PO2 H;  1YIT A;  1F9S A;  1CI3 M;  5C44 B;  4EQN A;  1JJ2 A;  1EFW A;  3BVM A;  1EOV A;  4IFD H;  2NN6 H;  1GOZ A;  3MZ5 A;  1HH2 P;  2XGT A;  3U9O A;  4A3L G;  3AEV A;  5I2X A;  4TVA B;  4DR1 Q;  2K01 A;  3CC7 A;  4L5R C;  1BXT A;  3JC6 6;  1L1O C;  3I4L A;  5FK9 C;  5D3I B;  4X6A H;  2QEX A;  5CV8 A;  1JB3 A;  1D5Z C;  4CDE C;  1AZQ A;  3S2D H;  5M5Y B;  2Z8L A;  4RCN A;  1Y14 B;  1PZI D;  2JA5 G;  1HPC A;  4HSP A;  4PG3 A;  4A93 H;  4DR5 Q;  5ISR A;  2IW3 A;  1E2Z A;  2UUB Q;  4K0K L;  3K5O A;  3H94 A;  4K8I A;  1STH A;  2F3V A;  4GNX B;  1PH3 A;  4KD4 A;  3IRB A;  2I07 B;  1VQO A;  5IYD H;  2X69 A;  5JJZ A;  2PYK A;  3PO3 G;  3KBX A;  1IYU A;  5JEA J;  3M4P A;  1L0W A;  4K5W A;  1C0A A;  1N36 Q;  2IX0 A;  4DV2 Q;  4ZUI A;  1PTO B;  1ZYR D;  5GQO A;  1O7Y A;  1I3Q H;  5ELN A;  1TKW B;  2L55 A;  5M5X H;  4AYB E;  3K5N A;  1KLU D;  4LF9 Q;  4A4I A;  3GTG B;  1FGU A;  2JEA I;  4CGY B;  1HNW Q;  3I4M G;  3TZU A;  3M85 A;  4BBS G;  1WTR A;  1QG7 A;  3I4N B;  2VB2 X;  4IAL A;  1KDC A;  1LTT D;  2FHT A;  2HIX A;  1Q3L A;  4HTH A;  1R9T B;  3ER0 A;  3TP6 A;  5C44 H;  3UE1 A;  1EYD A;  2M9V A;  5A35 A;  3QR8 A;  1SFO B;  4OX9 L;  1SE3 A;  2IHF A;  1DM0 B;  1M4V A;  1EWH A;  4ZYS A;  1IKM A;  4JV5 L;  1IBM Q;  3H0G H;  1KNE A;  1K83 B;  3GQB A;  1NJI C;  1PXU A;  1HA6 A;  2F0E A;  3VR3 A;  5KRU A;  2QA4 A;  3ULL A;  4NB3 A;  4Q5V A;  3HOV B;  1G29 1;  4KKT A;  4QIW B;  1S5D D;  1S5B D;  1X3P A;  3NBH A;  1LYL A;  4OEL B;  3S16 B;  3PO3 B;  1NE3 A;  5M5Y H;  2K5W A;  1AN8 A;  4Y7N H;  3BZC A;  5IIF A;  1RL2 A;  3PGZ A;  1LT3 D;  1PVO A;  1QVG A;  2F0S A;  3GTP B;  2N78 A;  2SDF A;  4JBW A;  3UDI A;  1DZ1 A;  3D6W A;  1STE A;  1SNM A;  2CCZ A;  1DOL A;  1GVP A;  1ZYR C;  4IFD I;  3HOU B;  2NN6 I;  4L63 B;  5ELE A;  3I4M B;  1OXV A;  4BBS B;  3NXW A;  5CV7 A;  4EX5 A;  2PNR C;  2GVB A;  3CCR A;  4BY7 B;  1GD7 A;  3RNU A;  1PTO H;  4DAP A;  4DNT B;  2KCT A;  1Y1V H;  3NTK A;  5BR8 Q;  1I94 Q;  4DN4 M;  1ESR A;  2Z4I A;  3X3M A;  4ZKB B;  1FJG Q;  3BZK A;  3HKS A;  3OWE B;  1IW7 C;  1RJT A;  2HDL A;  1UEA B;  3IL8 A;  1K8G A;  3A7A B;  1C9O A;  1TT2 A;  1N34 L;  1HUN A;  3I4N H;  2R61 A;  4RKL A;  1ET9 A;  4A3L H;  4XQN A;  2D0P A;  1B8A A;  4CDC C;  4YWK A;  4C2M B;  2G9D A;  1KDA A;  2VQF Q;  3KDF A;  1U0L A;  1R9T H;  4G7H C;  2L15 A;  2F3I A;  3E3X A;  4IJH A;  2MHV A;  1V1P A;  2EOT A;  2VQE L;  3QWN A;  2A68 D;  4DAY B;  1SFO H;  3LGJ A;  4IJL A;  1TS4 A;  4L5Q A;  3AU7 A;  2F0N A;  1EIH A;  1CM9 A;  1O7L A;  1D8L A;  3J7Y W;  1X3Q A;  4XT1 B;  3S14 B;  1J6Q A;  2RF4 A;  3L3O C;  1HJP A;  2JA5 H;  3TDQ A;  1STY A;  4JI1 L;  1FD7 D;  4NMZ A;  2I0Q A;  2RQX A;  1K83 H;  2Z4H A;  5CV6 A;  4TRD A;  5M5W B;  3GTK B;  5FKA C;  2IPK D;  4PMB A;  2CKZ B;  3AFQ A;  1IL8 A;  3KBG A;  3T1Y Q;  5C4X B;  2F0V A;  1PV4 A;  1OXX K;  3PO3 H;  1OXU A;  2N55 A;  2NVQ B;  1E2W A;  1SYF A;  2MFI A;  3RD4 A;  1DYQ A;  4FDB A;  4G57 A;  4JOI C;  4LFC Q;  5ELF A;  2SOB A;  3OW2 A;  1WCM G;  3M7G A;  3GTP H;  4HJ7 A;  1W6K A;  5CV5 A;  5T1G A;  2WAQ B;  3HOU H;  3H91 A;  1SRO A;  4N8F A;  1YVC A;  3AFP A;  3I4M H;  2LSS A;  4J6H A;  1BBU A;  4BBS H;  1PFB A;  2O5J C;  3Q0A A;  4CBV A;  1UE7 A;  4JC0 A;  1TXY A;  1TS3 A;  2A6E D;  1IZ6 A;  1STA A;  1BVS A;  4XXE A;  5EPL A;  4HSV A;  3I3C A;  2XRS D;  1NR2 A;  2HIV A;  4FYD A;  4DUY L;  3DM3 A;  1KNA A;  2H4O A;  3C1E A;  5FJ8 G;  1WVL A;  1I4H A;  1FNW A;  1V1Q A;  3V96 A;  2MP1 A;  1AZP A;  1SYD A;  1NY4 A;  4XT3 B;  3LNN A;  2A68 C;  4IPH A;  2F0H A;  2R6G A;  3UDG A;  1O78 A;  2TSS A;  4UY8 C;  5EQ0 A;  3TP8 A;  3EVQ A;  5CV4 A;  1MKH A;  3PF4 A;  1EIG A;  2LY7 A;  5GAG C;  2B2W C;  2YYZ A;  1UAP A;  4PZ7 A;  4NXM Q;  4OHJ A;  3S14 H;  4F87 A;  1HTL D;  2GA4 B;  3BU2 A;  5LHY 1;  3H09 A;  3I90 A;  2KBN A;  4C3J B;  5KNB A;  2LXJ A;  5M5W H;  3GTK H;  1D1K A;  3CKI B;  4DF7 A;  5DNF A;  4IUN A;  2WB1 G;  5EKL A;  3ULJ A;  4KD3 A;  1E2V A;  1NMF A;  1II3 A;  3F1Z A;  5D65 A;  3MEF A;  3OOC A;  5T1I A;  1OTC A;  1PDQ A;  1TWH H;  2DNC A;  1X3G A;  1O7I A;  2B2Y A;  3LX0 A;  3MWY W;  4K6D A;  1JWM D;  5M3M G;  5KYL A;  4BBR G;  1SE4 A;  5FLX c;  1DGS A;  2J7Z A;  4K6L A;  5LL6 X;  3J7A V;  4S3S A;  1TS5 A;  1S5E D;  4WJ4 A;  4KKU A;  5IYC G;  3A7L A;  5C4J H;  2RCF A;  2A6E C;  1LAB A;  1IYV A;  2O2L D;  4JW0 A;  4QCL A;  1UE1 A;  1RTO A;  1XNQ L;  2XNA C;  1ILQ A;  5CV9 A;  3QOL A;  1S5F D;  1ML0 D;  2Z1C A;  4WOR A;  4E6I A;  1H9S B;  1PRT F;  1VQG A;  1AE2 A;  1KRS A;  2RA4 A;  2HQL A;  4N9T A;  4DKA C;  4A3C G;  2OEO A;  1SYE A;  3DEP A;  2IX1 A;  1A2T A;  1SNQ A;  1GUN A;  3TS2 A;  1VQE A;  1X55 A;  2EZV A;  3F2B A;  4DK6 C;  3GTM B;  2HD3 A;  4YY3 Q;  1K3R A;  2CH4 A;  4A3J G;  1QZH A;  3D4R A;  3RLN A;  1ASZ A;  1CA5 A;  2R7Z G;  1X32 A;  2F0T A;  3CMA A;  4DR1 L;  2KCM A;  4GN5 A;  4A3G G;  4LUO A;  1B70 B;  4JPB W;  4K2L A;  2JA6 B;  4DR4 Q;  4L8J A;  2Q8I B;  2RSN A;  4B9W A;  4CJ0 B;  2E75 C;  2JYO A;  4BBR B;  2EYJ A;  3KLW A;  2JQO A;  1KRT A;  2UUB L;  4LFB Q;  2B8G A;  4OWT B;  2EYL A;  2J4X A;  2VL6 A;  5LMU Q;  2H1E A;  3CPF A;  3SEB A;  4RHS A;  1HQR D;  3PIP A;  3A8I E;  3PUV A;  2UXC Q;  2ICE C;  2EY2 A;  1CSQ A;  3CCS A;  1VQN A;  3CQZ B;  1JMC A;  4NPS A;  2PCF B;  2EYP A;  4CDF C;  1N36 L;  5BN5 A;  3VYT A;  2DUD A;  4WRD A;  2EJF C;  4BXX H;  2Z6K C;  1OO9 B;  1Q8I A;  4OO1 G;  5I6W A;  1ASY A;  3PSI A;  1JT8 A;  4AYB B;  1SXT A;  2F0F A;  5IT9 c;  4LF9 L;  1EL0 A;  1WTH A;  1SNP A;  1L2F A;  5FJ8 H;  1U4P A;  4IUV A;  2F52 A;  4JI3 L;  5HGQ A;  3E9H A;  4DGZ A;  4LWC A;  2GVA A;  3F8T A;  3G4S A;  4GN3 B;  2DN8 A;  1FYC A;  2QGQ A;  5HUR A;  1A2U A;  3S15 B;  5CYU A;  5E4X A;  5DM6 3;  4EVO A;  3NWT A;  3GTQ B;  1HA5 A;  2AKW B;  4N8X 1;  3GTM H;  4DK1 A;  4CHT B;  1I50 B;  4POF A;  5ELB A;  3G6E A;  4JI0 Q;  3FRP B;  2DY7 A;  1D2B A;  2UXD Q;  4ME5 A;  5AJ3 Q;  3PUZ A;  4ME3 A;  2ZTE A;  1PZJ D;  4UHV A;  4IOA A;  3NHH A;  1PFM A;  4RH6 A;  1NCV A;  1WTQ A;  2K6A A;  1HFG A;  1DCZ A;  3QB3 A;  1WTP A;  4BBR H;  2XVS A;  4O0A A;  3A55 A;  1EFI D;  2DNE A;  1UUP A;  3CD6 A;  1SRU A;  1BCP B;  2UXB Q;  3FP9 A;  5IYC H;  4YCW A;  4KJO A;  1XMO L;  4JI8 Q;  1GUS A;  3VA7 A;  3SK5 A;  1TY0 A;  2VB3 X;  1LTR D;  2NUC A;  1VQ4 A;  2WKD A;  3CQZ H;  1WTO A;  4XTC S;  3ICE A;  4KV6 A;  3KLR A;  2XN9 C;  2B63 G;  3T16 A;  3A54 A;  3GTL B;  2F1M A;  1EY6 A;  3I56 A;  3PUY A;  1IL2 A;  5LMN W;  2E5L Q;  3S2H B;  1XMQ Q;  5LMN Q;  5IP9 H;  3HKZ B;  3BDC A;  1VQ5 A;  4B3M L;  2A74 C;  1VF5 C;  2IX3 A;  1PTO D;  1AEX A;  4DV5 Q;  2DJG C;  3HOW G;  2B2T A;  2JK8 A;  2JE6 I;  1ET6 A;  1FNV A;  5H1S E;  5FO7 B;  1Y1W B;  4JK1 C;  4DV3 L;  3M3Y B;  3SGI A;  4GLA C;  4A3F G;  3DWA A;  2RHQ B;  3KOJ A;  3UE0 A;  4A3J H;  2NVY B;  2VQF L;  4R8I A;  1YIJ A;  2MPM A;  1JOK A;  2HT1 A;  2ZT9 C;  3PO2 B;  1MD2 D;  3BDO A;  4I65 A;  4P2C B;  3J80 c;  1EYA A;  3QIA A;  1JJC B;  1JE4 A;  2PI2 A;  5EGT A;  1WTV A;  3MXU A;  4X64 Q;  3C46 A;  1VMP A;  4LF5 Q;  1CQV A;  4JI4 Q;  4QB4 A;  1YHB A;  3T53 B;  1BQQ T;  1I50 H;  3Q8D A;  3PIP 3;  5DAU A;  1J9O A;  1YI2 A;  1VQI A;  1ESF A;  2MNA A;  3QOJ A;  3TP7 A;  1RDP D;  2XIW A;  4DV1 Q;  2A8V A;  2RCN A;  2D0O A;  2K33 A;  3S2D B;  2B2V A;  4H0L C;  3W5O A;  4M1U B;  1XX8 A;  1I4G A;  2WFW A;  4B9X A;  1QCB D;  4C3H B;  2EVB A;  2B63 B;  1H9S A;  4RCO A;  2GN5 A;  4RGM A;  3W3A A;  4IPC A;  5IOC A;  2EYO A;  1CK1 A;  3K0X A;  3KDF B;  1N9W A;  4OO1 H;  4KTA A;  4GNX C;  1Y8P B;  2PMZ B;  1IYJ B;  3VYU A;  3HOW B;  2X6L A;  2SEB D;  4G7Z C;  4TSS A;  4A3E G;  4FF2 A;  3UDX A;  3GTL H;  3DUZ A;  1CSP A;  3U58 A;  3OSO A;  4OL7 A;  1YNJ D;  4IUT A;  3JAM c;  3CME A;  1A15 A;  1EQV A;  3UI2 A;  1WOC A;  3HP3 A;  1EYG A;  2WAC A;  2BCO A;  4JBJ A;  4DPG A;  1YHA A;  4R4O A;  1SMX A;  1GUG A;  3M3Y H;  2CHB D;  2O5I C;  2WP8 J;  3Q22 A;  5I9O A;  3KJO A;  1WI5 A;  5JVG 3;  2F3W A;  2B2Y C;  2PNH A;  1SNO A;  1ICW A;  4KHZ A;  1HHV A;  1HNZ L;  4KN7 C;  2JA7 G;  1QNK A;  5C0X J;  1L0Y B;  4YCV A;  5IWA Q;  3CC2 A;  2QKI C;  4DUZ Q;  3OTO Q;  4XDX A;  4ALP A;  1FL0 A;  1NAP A;  5IGB A;  4ODG A;  1GJX A;  1GUO A;  1KC8 C;  5JJI A;  1QJO A;  5C3X A;  5FOB B;  1VQM A;  5C4H A;  2PZU A;  4X66 L;  2L11 A;  3FPU B;  3H0G B;  1EQT A;  4C56 C;  3BVZ A;  2QW7 A;  5JPM C;  4DXG A;  4XYQ A;  2WB1 E;  4A3M G;  4ZLT F;  2X6G A;  4LF6 Q;  1X9N A;  2D2C C;  2K50 A;  1IBK L;  2PW7 A;  4RGT A;  1XWE A;  1PMR A;  3DWQ A;  1DJR D;  3QG1 A;  5GRO A;  4C3H H;  2B63 H;  3K59 A;  4Y7N B;  2RDF A;  2SNM A;  4TQU S;  1C8C A;  4A3D B;  5JJL A;  3NTI A;  3TQY A;  4UP8 A;  3M4Y A;  4TKO B;  3WDN A;  1KL9 A;  4CKB A;  2D9U A;  1WTX A;  4KHP Q;  2LFN A;  5IGF A;  2J0T D;  3HOW H;  3SDZ A;  1B53 A;  4C1N I;  2BE5 C;  1QIL A;  3DMU A;  1MI2 A;  3G6J B;  3S1N H;  4MIU A;  5I4D A;  1Y1V B;  2ZM6 Q;  4A3F H;  1SBB B;  5KYI A;  1IBL Q;  5KGU A;  3A74 A;  1EOT A;  3K81 C;  3HOX G;  4HMJ A;  3NTH A;  4UP7 A;  1Y69 U;  1GHK A;  1D6E C;  4XYO A;  1HZ9 A;  3PUW A;  2PPB C;  4MZ9 A;  2EDG A;  1XXG A;  2AMC B;  3CCQ A;  1VQF A;  3STB D;  5IGG A;  2N3S A;  1C7Y A;  4B08 A;  4OO1 I;  1PLF A;  5IP7 H;  1PH8 A;  4BWG B;  4RAU C;  3MAQ A;  1CA6 A;  4DR6 L;  4JI5 L;  1E1O A;  4JG2 A;  1E3P A;  4H13 C;  2WKC A;  1YJN A;  3J81 c;  1RKN A;  2JA5 B;  5HY6 A;  4NXN L;  1UWV A;  1XJV A;  3LWU A;  5E4W C;  1Q1B A;  4FXG C;  3CP0 A;  4POG A;  4XQQ A;  2K4K A;  4LJZ C;  4FVM A;  4IUQ A;  5FLX L;  4X62 L;  5LMU L;  3ZYY X;  4DV6 Q;  5GAH C;  1I6H H;  4LUV A;  1RF2 D;  3ZJY C;  2F4V Q;  4GOP B;  1Q12 A;  1H95 A;  3M4O H;  4KLK A;  1G51 A;  1RCV D;  4WJ3 M;  4DA2 A;  4A3D H;  5IOD A;  1LTB D;  4PQX A;  3W2D A;  3E5S A;  1J5E Q;  4G4K A;  1LTA D;  2CFM A;  4DV4 Q;  2ZJQ A;  2K5N A;  1IXR A;  4J15 A;  3M9B A;  5ELD A;  4LF7 Q;  2CQO A;  4PMC A;  2ZJR A;  2JJQ A;  3URY A;  2HHH L;  5JOB A;  2YTV A;  1F77 A;  1E1T A;  4X65 L;  4DV0 Q;  4X3S A;  5G3L F;  1B2T A;  2ZTC A;  3D6C A;  3PQI A;  1D1I A;  1TR5 A;  4FP5 D;  1VQB A;  1M1K C;  4C1N K;  4HIM A;  3J7Z C;  2PZT A;  1B1Z A;  1VQC A;  4HMI A;  5AFW A;  1DD2 A;  3FPP A;  3EA6 A;  4FNF A;  1DXM A;  2A5H A;  4A3M H;  4HJA A;  3OW7 A;  3J80 i;  1WYD A;  2JSO A;  3CRK C;  3N52 A;  1H9K A;  1OXS C;  1V8Q A;  2KCC A;  1N33 L;  4JI6 L;  4PV1 C;  1EU3 A;  1A63 A;  2R3Z A;  1BBX C;  3P75 A;  2NZ1 D;  2Y0S E;  2UUC L;  1Q7Y C;  2KJX A;  2L12 A;  2F0M A;  1CHP D;  1R4Q B;  1LO5 D;  1QVC A;  2A69 D;  3VR2 A;  3H3V H;  4YCU A;  3SVM A;  2F0K A;  5I9P A;  1HR0 L;  1ENC A;  3NPP A;  1TWH B;  4IUU A;  1KHI A;  2HUG A;  5IT9 L;  2FIN B;  3C3L A;  4K5V A;  1HNX L;  3OYY A;  1TWC B;  1X56 A;  2EYM A;  3TP5 A;  4DR7 Q;  4JI2 L;  3V2T A;  3F2C A;  4EQO A;  2E5L L;  3U9S A;  1VQ7 A;  5C4J B;  4IFD J;  4GKK L;  1VMC A;  1Z47 A;  2PQA B;  2ZXP A;  4DR3 Q;  3I2Z A;  3HOX H;  4AQY L;  2VS1 A;  4CDD C;  1MSG A;  2NTT A;  4B3T Q;  1KQS A;  5IGE A;  4B3S Q;  1HFN A;  2E76 C;  1K8M A;  2F0J A;  3MHB A;  1XYI A;  1CZW A;  2E74 C;  1LM0 A;  4DXF A;  2WII B;  4KMU C;  4FF1 A;  2I46 A;  5C0X G;  2BDO A;  2B2U A;  5IE8 A;  1AW7 A;  2RHS B;  3MXN A;  2NZO A;  1IKL A;  2OT2 A;  2IJ0 A;  3WOF A;  1VQL A;  2OCE A;  4ZCK A;  5COY A;  4MTN A;  4LF5 L;  2KQ3 A;  3N6R A;  3NEL A;  4LF4 Q;  2KOL A;  4HIK A;  5EPK A;  3VR6 A;  2NZH A;  4IUR A;  1HUM A;  4IPD A;  1EWC A;  3DEO A;  2A69 C;  1SDF A;  4Q0F A;  5C6A A;  5M9O A;  4YWM A;  4JYA L;  5FLX E;  1PH4 A;  3HOZ G;  3T1H Q;  4YHH Q;  1Y8N B;  4B3R Q;  2DGY A;  3TSS A;  1VQ8 A;  2EYF A;  1SE2 A;  3I73 A;  4RA8 A;  1WCM B;  2I5M X;  4XQJ A;  1I4P A;  1PRT B;  4F8M A;  2ENB A;  3CF5 A;  4DFA A;  1Q82 C;  1W6J A;  4YWL A;  2JA8 G;  1QWY A;  3I4O A;  2VNU D;  3TME A;  2MUY A;  2NTS A;  4X3T A;  4I7A A;  1BCP D;  5JEA G;  1N32 Q;  1TQO A;  2KCN A;  1TWC H;  4V0B A;  2OQK A;  3S1R H;  2Z0S A;  4OEM B;  2C35 B;  2NB0 A;  1KD1 C;  3QJY A;  4A75 A;  4OIK A;  4QUF A;  1TWA B;  3Q6S A;  5KNC A;  2V4D A;  1RD9 D;  1Z9F A;  4JI7 L;  3EN2 A;  3J80 L;  1V1O A;  1EQQ A;  4RMF A;  3H3V I;  2F0P A;  4KHV A;  2EY6 A;  1S3O A;  4BA2 I;  4DR2 L;  1B9N A;  4K0K Q;  2F0W A;  1GUW A;  1GHJ A;  4UP9 A;  2YU9 H;  4V19 0;  1KTK A;  3MVV A;  1CKO A;  2ICI A;  3U50 C;  2KEC A;  3NEN A;  4GOP A;  4HJ9 A;  3G48 A;  4JBK A;  1F2Z A;  1LT6 D;  2CWA A;  1VS0 A;  5KND A;  1BKB A;  4ZAI A;  3RMH A;  5FO9 B;  1W3S A;  3RN2 A;  3NWS A;  4LF8 Q;  4KKS A;  1A3T A;  1PH1 A;  3RZO B;  2ZTD A;  1HRJ A;  1N8R C;  1QE6 A;  2L4N A;  2TMP A;  4KI0 A;  2OTL A;  3VYR A;  4A3B G;  3OMG A;  1O7Z A;  2K32 A;  2WB1 B;  4PZ6 A;  5M3F G;  3DXJ C;  1B4O A;  3BYY B;  5J3B A;  4LF6 L;  4KN4 C;  3TEH B;  2UUA Q;  2UU9 Q;  3R8B A;  3J81 i;  5M3M B;  3FKI G;  2EPB A;  2KVM A;  1VQH A;  1M8A A;  1WCM H;  1QVF A;  4DR5 L;  5FO8 B;  2LXK A;  2ZJP A;  5IT9 E;  4NKL A;  3K58 A;  4QGU A;  3EQL C;  4F7X A;  3G71 A;  3I91 A;  4OX9 Q;  1Q86 C;  1G6Z A;  2ID0 A;  3R2I A;  3JAM L;  3EIV A;  3ND8 A;  4JV5 Q;  3CRL C;  1GUT A;  3DLL A;  4DV2 L;  1LTI D;  1NNX A;  3KFU A;  4RG1 A;  5JVH 3;  2ASB A;  3I7F A;  1TVX A;  1EQR A;  3K57 A;  4JBM A;  2EYH A;  1RIP A;  3D8G A;  4KY7 A;  4MHE A;  3PIO A;  3C2P A;  1TWA H;  3ERQ A;  1G91 A;  3R3O A;  1HNW L;  3CXC A;  3CPW A;  1NMG A;  2K5V A;  1XPR A;  1G2T A;  1HZC A;  1MJC A;  5F2D A;  3H15 A;  4GKJ Q;  5EPJ A;  1MHW C;  4FF4 A;  4A3J B;  2L9H A;  4DV7 Q;  2R7Z B;  1HTP A;  2HCI A;  4QY7 A;  4A3G B;  4NP5 A;  5M3F B;  1XTC D;  1YZ6 A;  2MO1 A;  2EXD A;  2FFK B;  5E1F A;  3RZO H;  2O4X A;  4DAV A;  3K5M A;  2D5D A;  2M00 A;  2RVL A;  3RUZ A;  1IBM L;  1U5K A;  2NVX B;  1E22 A;  3KF6 A;  5D14 A;  5GAE C;  2PQA A;  3NE5 B;  3K6O A;  3P7J A;  4OIJ A;  2JA8 H;  2VUM G;  2CVR A;  1WTW A;  1ZKO A;  3OMC A;  1YHQ A;  5CC4 A;  5M3M H;  1EY9 A;  3HRZ C;  5JEA H;  2R93 G;  1Y8O B;  2QDB A;  2Y0S G;  3J7A F;  3CCL A;  4QMG A;  3NEM A;  4QUC A;  4A3I G;  1QB5 D;  1KIX A;  1BF4 A;  1C4Q A;  2R92 G;  1ZXT A;  1K8O A;  4GLX A;  3HZX A;  4LW1 A;  2VQE Q;  1SND A;  4DV4 L;  2B8F A;  4KK7 A;  1S4Z A;  3ONA B;  1YJ9 A;  1VQ9 A;  4JI1 Q;  3K80 C;  1YNX A;  1STN A;  3FEW X;  1PH9 A;  1I94 L;  5BR8 L;  3MC0 B;  5E7N A;  4Z9C B;  3J80 E;  1JJG A;  1CUK A;  1PH6 A;  3GDE A;  3K0Y A;  2RDG A;  1FJG L;  1EY4 A;  1EY8 A;  2FMC A;  2KHI A;  4A3C H;  4K5X A;  3X3N A;  4QQB X;  2OQ0 A;  3HG9 A;  1A6X A;  3S9W A;  2R7F A;  1CT1 D;  3MTS A;  4A93 G;  4RFB A;  2FJ2 A;  5HGT A;  1HCZ A;  2R7Z H;  4IZ8 A;  1CHQ D;  3LWE A;  2L1B A;  3J81 L;  4A3G H;  2WAQ E;  1VQA A;  2Z6B A;  4OGQ C;  5M3F H;  4IUP A;  5CR3 A;  1P8L A;  3Q24 A;  2BOS A;  3CAM A;  3AMU A;  2YTX A;  4RWS C;  4DAM A;  4YIJ A;  3TN2 A;  3VYS A;  2Y0S B;  2IY5 B;  3NK9 A;  1UE5 A;  2N88 A;  3ULP A;  2NVX H;  1JOR A;  2A73 B;  1EWI A;  2PQE A;  2L0C A;  1KLG D;  1B9M A;  3W1B A;  4DUY Q;  3T1Y L;  1BR9 A;  4JOI A;  1JWU D;  4JVZ A;  4A3K G;  1C48 A;  1BO0 A;  4L5S A;  1J8I A;  4NW2 A;  4LFC L;  3CU7 A;  3S1Q H;  4BS9 A;  3PIO 3;  1R4P B;  1MBY A;  1WJJ A;  3KJP A;  5C44 G;  5J1Z A;  2KED A;  1CKM A;  1G2S A;  2WV6 D;  3S1N B;  3G7L A;  4B3T L;  2LMC B;  1PTO C;  3FDT A;  2Q8T A;  4A3F B;  1TS2 A;  1H9M A;  4B3S L;  3A5Z B;  4FF3 A;  3RN5 A;  1E0B A;  1TWG B;  1PYS B;  2HQE A;  1STB A;  1T9H A;  2PI2 E;  3GD7 A;  4HCS A;  1T5X D;  4UAI A;  2XSC A;  1LT5 D;  2MJ8 A;  2HDM A;  4RGN A;  3SHL A;  4IPG A;  5BN3 A;  2B2W A;  1Q8K A;  4DU9 A;  3IFD A;  3K5L A;  5KIX A;  1K3B C;  1QUQ B;  3BG3 A;  1VQ6 A;  4R8N A;  4NXM L;  2VUM H;  4M8A A;  3GV3 A;  3K7A H;  3VA5 A;  4A3K B;  2R93 H;  1EY7 A;  1BDO A;  5DLQ E;  4A3I H;  4ILW A;  4ZKC B;  1W2B A;  3OIQ A;  2R92 H;  3MXG A;  3SE0 A;  5JJK A;  2I5L X;  1K0S A;  3S24 A;  1V9P A;  1F2M A;  3F2U A;  5K36 G;  3OIP A;  1I6H B;  5D3D A;  3KK7 A;  2H5X A;  4U67 3;  1CKN A;  3AYH B;  3KYH C;  4A3E B;  2NVT H;  4GOP C;  3I4N G;  3MXN B;  3M4O B;  5CBE E;  3KF8 B;  3CCV A;  1N32 L;  3D4D A;  1JOO A;  4IQZ A;  1EEF D;  3RR5 A;  4KY6 A;  3VR4 A;  4O1N A;  1LUZ A;  3O13 A;  1MJE A;  4WFN 3;  3SXH A;  1B3Q A;  1YNJ C;  2E2I B;  3D0F A;  3IAY A;  2EY1 A;  1JE5 A;  1X3F A;  3BS1 A;  1AP0 A;  3SK4 A;  3KUP A;  3DM1 A;  1E24 A;  3HGB A;  3A0J A;  2JA7 B;  1XTD A;  2AUK A;  3HOV G;  4R4C A;  1JIC A;  2C5C A;  4ZK9 B;  1TWG H;  2QDL A;  3J81 E;  2V1C C;  3PMF A;  3S17 H;  1VF7 A;  1PH7 A;  2DY8 A;  1LAC A;  1FGB D;  3DWP A;  3B6Y A;  1SE8 A;  4HR7 B;  2OWO A;  4OON A;  1MGS A;  1SMY D;  4LF8 L;  1K28 A;  1EU4 A;  4YY3 L;  2NWG A;  1VDZ A;  1NBW A;  4A3M B;  2R7D A;  2RKS A;  1K8A C;  1O80 A;  4U68 A;  2EQS A;  5EBD A;  3HOU G;  2JN4 A;  4APV A;  4DNI A;  4FO2 A;  4CJ1 B;  4DR4 L;  4JI3 Q;  5C3E G;  3CCJ A;  5IY0 A;  2UUA L;  3FMC A;  1A0I A;  4QJF A;  3V05 A;  3NSW A;  4LFA Q;  4A3K H;  2UU9 L;  4BY7 G;  3GV6 A;  4G7O C;  1IW7 D;  3NBI A;  4IOC A;  3MA2 B;  3SK8 A;  1D5M C;  1LTL A;  4HJ8 A;  1EYC A;  3UDF A;  1SAP A;  4LFB L;  2JP1 A;  2N8N A;  2UXC L;  3E9I A;  1PHJ A;  2EIF A;  3R93 A;  1PRT D;  4A3E H;  3GTJ B;  1TII D;  1S40 A;  2Q2H A;  5E3F A;  3CCE A;  2AQ3 B;  5TSS A;  2PO4 A;  3T13 A;  1PTO F;  2Z6K A;  1I6V C;  1HZB A;  3VR5 A;  4O42 A;  1QZG A;  1RHP A;  2BA1 A;  1L1O B;  1U4L A;  1XNR Q;  4BY1 G;  3HOX B;  2VW9 A;  4MTK A;  2E2I H;  3IFT A;  1EIY B;  3WWV A;  1XPO A;  1YNN D;  1EIF A;  2K05 A;  4HN7 A;  4X3K A;  2FXQ A;  4RGO S;  4GKJ L;  1PFN A;  4HID A;  2KEN A;  4LUZ A;  3Q23 A;  4QL5 A;  4DV7 L;  2JA7 H;  3ERS X;  3RZD B;  2AHO B;  3STB C;  1XMO Q;  2PZW A;  1SMY C;  1V43 A;  1PH2 A;  1G8Z D;  5JAV A;  5C4X G;  3D4W A;  1TY2 A;  1F2L A;  4PMW A;  4KJN A;  3TBI B;  5C3E B;  1K0R A;  1F9P A;  2JXM B;  2ZXO A;  2QCP X;  4BA1 I;  3MEH A;  1SYC A;  3PF5 A;  2NBF A;  4JI0 L;  3J7A 5;  1WFQ A;  4CKE A;  3HKZ E;  4B3M Q;  1EZ6 A;  3GTG H;  2WAQ G;  4OXP A;  3PCO B;  2A6H D;  4IN3 A;  5K36 H;  1JCK B;  2UXD L;  5AJ3 L;  3NQI A;  3CCM A;  1JWS D;  4HJ5 A;  2CQA A;  4H44 C;  2A19 A;  4DV3 Q;  3HS0 C;  2B2T C;  1BUV T;  3ITP A;  4OWW B;  5DM7 3;  3MXP A;  4CKC A;  1PRT C;  4P74 A;  2XRQ D;  1NTG A;  4RHR A;  2UXB L;  1PFS A;  5ELO A;  3U4V A;  1FR3 A;  4JI8 L;  4BY1 B;  5EKI A;  1FVI A;  1SNC A;  1SSO A;  1UE6 A;  4QF4 A;  3I8Z A;  4H02 A;  3GTJ H;  1U4R A;  2JEB I;  2LKV A;  1I4X A;  5IYB G;  4EQP A;  4J1M A;  3S1R B;  1QUQ A;  1F9Q A;  3P1H A;  1AFP A;  1YNN C;  3HOV H;  3KF6 B;  3U4Z A;  1XMQ L;  5LMN L;  5C3W A;  1ROD A;  4WJW A;  3S16 H;  2K04 A;  4KY5 A;  2K03 A;  4DV5 L;  2KHS A;  1VQK A;  3KLS X;  1S5C D;  3BJU A;  2F03 A;  2B2V C;  3BVG A;  3I72 A;  2K1B A;  2KEE A;  4C3J G;  2YU9 B;  1Q90 A;  1M90 C;  3RZD H;  3JAM i;  4CJ2 C;  2PMZ E;  4N9P A;  3L7Z C;  4AH6 A;  1VCI A;  4A76 A;  4HAE A;  1DON A;  3KF8 A;  5C3E H;  1DOK A;  3A8J E;  4X64 L;  1A8V A;  2F0U A;  4BY7 H;  1PYW D;  2A6H C;  1H9J A;  2K14 A;  1TU2 B;  4GS3 A;  4JI4 L;  1PYB A;  2E2H B;  4BXX G;  2DJF C;  4K14 A;  4OWX B;  1GXD C;  1YBY A;  4MN3 A;  1SN8 A;  5CGK A;  4DV1 L;  3PUX A;  2B3G A;  2QEJ C;  5FLM G;  1Q46 A;  4O2D A;  3K7U C;  3FHW A;  4C2M H;  1SYG A;  1EUJ A;  1HNZ Q;  4GNX A;  3T4A C;  2F0G A;  3DHQ A;  1ENF A;  3T51 B;  4BY1 H;  1EZ8 A;  5A2Q L;  1I5F A;  2ZXR A;  4X66 Q;  1P16 A;  3OWF A;  4R4Q A;  3QO2 A;  1AE3 A;  2D62 A;  2KHJ A;  4FXD A;  2K5H A;  2F4I A;  3OPO A;  1VQJ A;  3TS0 A;  2E2D C;  3IKJ A;  2FMM A;  5C4X H;  2JA6 G;  3D31 A;  1JR0 D;  1X6O A;  1STG A;  4GN4 B;  2RBM A;  3CHB D;  1E7Z A;  4DNR B;  5BN4 A;  1IBK Q;  4IO9 A;  2NVQ H;  1LTG D;  1EY0 A;  3HOY G;  2EJM A;  2F0I A;  1D7Q A;  1PZK D;  2AWO A;  1WD1 A;  2A1A A;  1IHZ A;  2B39 A;  4AIM A;  2F0O A;  3F2D A;  5IWA L;  2JA9 A;  4DUZ L;  3OTO L;  4P72 A;  2G5D A;  1K73 C;  3HOZ B;  3GO5 A;  2K5Q A;  4HIO A;  3S1M B;  1JOQ A;  5KEE A;  1Z6H A;  1CQF A;  1L1O A;  1BNZ A;  2E2H H;  2ES2 A;  3CC4 A;  1ILP A;  4LK1 C;  4R4I A;  1A3U A;  4F88 A;  4UPA A;  3L0O A;  4R9W A;  4AYB G;  5IP9 G;  4L5T A;  4PZ8 A;  4H7B A;  2JA8 B;  2F0L A;  1ICF B;  2KA7 A;  2OF1 A;  1UEB A;  3J81 j;  2AQ2 B;  3E0E A;  1FNU A;  2XWJ B;  2QIL A;  5IYB H;  2WIN B;  5C4Z A;  1BCP C;  3E0J A;  3A8K E;  3TRE A;  3R2T A;  2G9H D;  2IL8 A;  4DR6 Q;  4JI5 Q;  3SR1 A;  1CZG A;  2K7V A;  4KHP L;  4EQ5 A;  1Q81 C;  4ULL A;  4NXN Q;  2I5H A;  1JC7 A;  4J8Q A;  3HOY B;  1BOS A;  3L9A X;  2EY5 A;  2CW0 D;  2ZM6 L;  4C3J H;  1RTN A;  1IBL L;  4QIW E;  3SK6 A;  1ZEQ X;  4X62 Q;  5C0X H;  3GTO B;  3D3R A;  4NDX A;  1GM5 A;  1CKN B;  1BBW A;  5EAY A;  3NUC A;  1DOM A;  2K52 A;  4K8J A;  1HZA A;  1X65 A;  5IGD A;  4ID6 A;  2XTI A;  3TRZ A;  1WD0 A;  4A3B B;  3WOE A;  1EEI D;  4LMQ D;  4I7Z C;  4MNO A;  4DAY A;  1H9R A;  5C5L A;  3H6M A;  2E2J B;  1Z7T A;  3M7N A;  3W1G A;  5FLM H;  3FVQ A;  4LNQ A;  4ZRZ A;  3ND9 A;  3HOZ H;  2OXP A;  3FKI B;  1B50 A;  1UNS A;  1D5X C;  2CWP A;  4DK0 A;  3S1M H;  2ALY B;  4LFA L;  1CTM A;  2HHH Q;  3EJI A;  4X65 Q;  1G6P A;  4GZY C;  1ONL A;  5LL6 S;  3NQT A;  3KLS A;  5EKK A;  1MIU A;  3CW2 C;  2IWH A;  1LLR D;  2N49 A;  4HED A;  3HKZ G;  1EY5 A;  2EXZ A;  4DV6 L;  1N34 Q;  1TWF B;  1PA6 A;  2F4V L;  1Y1W G;  1SJH D;  5A2Q E;  2PW5 A;  4PNY A;  2K28 A;  2SNS A;  3MFY A;  3S1Q B;  4R4T A;  1SJE D;  4C3I G;  1JQY D;  1MSH A;  2MO0 A;  5I6Y A;  2Z9H A;  1J5E L;  3PV0 A;  4XIG S;  5EBC A;  1KXL A;  3RLF A;  1HXY D;  3PO2 G;  1XNR L;  1N33 Q;  4P71 A;  2YV5 A;  4JI6 Q;  2CW0 C;  3CCU A;  2JA6 H;  2AWN A;  5K5P A;  1VQD A;  4IFD G;  2F0D A;  2NN6 G;  2UUC Q;  2MQH A;  4LF7 L;  1SR3 A;  3HOY H;  5CMD A;  2Q8R E;  1OXT A;  5DEH A;  5ELC A;  1I4Q A;  2LS0 1;  3AB9 A;  2M2L A;  4DV0 L;  1HR0 W;  5IGC A;  1F9R A;  1HR0 Q;  2BH2 A;  3GTO H;  1LTS D;  2E8G A;  2B29 A;  2Q2T A;  3AQQ A;  1ENA A;  4P75 A;  2EE1 A;  3I55 A;  4R1J A;  4C3H G;  1HNX Q;  4ABN A;  3EBE A;  4JI2 Q;  4GLV B;  1XPU A;  4A3B H;  2BDN A;  3C1F A;  4GKK Q;  2QF7 A;  1K9M C;  5IYD G;  4AQY Q;  5I2Y A;  1LV9 A;  5GAD C;  2E2J H;  1A62 A;  2MGS A;  1NR4 A;  2VUM B;  3NBH B;  2VXW A;  3K7A B;  1Q1E A;  3FKI H;  2R93 B;  3EFX D;  5EJW A;  4X3U A;  1F2Y A;  1B44 D;  1T5E A;  4HCE A;  2AQ1 B;  4A3I B;  1A3V A;  2IT1 A;  3HEJ A;  1X54 A;  2RDH A;  1GKH A;  3RLO A;  2R92 B;  4C3I B;  2C9O A;  5COR A;  1BCP F;  5C0X I;  1LT4 D;  4UDU C;  3S15 H;  2NYZ D;  2CH4 W;  4LAA A;  2K75 A;  1TWF H;  1B3A A;  2IHE A;  5J22 A;  2NVT B;  1U4M A;  2B2U C;  5G3L D;  2HCC A;  3GTQ H;  3HFZ B;  4EGV A;  3JAM E;  1SEB D;  3BZD B;  4Y52 H;  4FXK C;  1S72 A;  2OTJ A;  1SLJ A;  5C5M A;  2K5D A;  3TZD A;  5IP7 G;  1KAB A;  3P20 A;  4DR7 L;  2F0Q A;  3A56 A;  5J39 A;  1QOH A;  5L37 A;  4JCV E;  4DR3 L;  4JYA Q;  1NUC A;  1KDB A;  4ZQ3 A;  2RSO A;  1NSN S;  4ZUJ A;  2ATW A;  4A93 B;  3H0G G;  4L6T B; 
#chains in the Genus database with same CATH homology
 1PHJ A;  1YEZ A;  2EIF A;  3J7A 5;  1L2F A;  5FJ8 H;  4HIK A;  4A3E H;  1S40 A;  2F52 A;  4JI3 L;  5HGQ A;  1B7Y B;  2Q2H A;  2NZH A;  3E9H A;  2BH8 A;  3CCE A;  1JB7 A;  4LWC A;  4IPD A;  2Z6K A;  2GVA A;  1HZB A;  2VZA A;  3F8T A;  3G4S A;  4YWM A;  4GN3 B;  4DK3 C;  4JYA L;  1QZG A;  2BA1 A;  1PH4 A;  3HOZ G;  1L1O B;  4YHH Q;  3T1H Q;  1VQP A;  1XNR Q;  2QGQ A;  4B3R Q;  2DGY A;  1VQ8 A;  3L2P A;  2I5M X;  4BY1 G;  1GO3 E;  4A3D G;  2VW9 A;  4LF4 L;  2E2I H;  3A5U A;  3S2H H;  1EIY B;  3K8A A;  3WWV A;  1XPO A;  3CF5 A;  1Q82 C;  1EIF A;  2YTY A;  2AKW B;  2VY3 A;  3GTM H;  2FXQ A;  4YWL A;  4GKJ L;  4POF A;  4HID A;  2JA8 G;  2KEN A;  3G6E A;  4JI0 Q;  3I4O A;  4LUZ A;  4JI7 Q;  4QL5 A;  4DV7 L;  1YJW A;  2VNU D;  2JA7 H;  3ERS X;  2Q2I A;  2AHO B;  1XNQ Q;  3STB C;  5JEA G;  1XMO Q;  1Y1W H;  3T1H L;  4YHH L;  1N32 Q;  1X3E A;  2UXD Q;  5AJ3 Q;  1V43 A;  4B3R L;  1Y1V G;  3M4Q A;  3PUZ A;  4ME3 A;  4DR2 Q;  1PH2 A;  3VDY A;  5C4X G;  1AH9 A;  1TWC H;  2ZTE A;  2NVY H;  4IOA A;  4PMW A;  2OQK A;  4C3I H;  3S1R H;  2Z0S A;  1KAW A;  2Q2U A;  1K0R A;  1PH5 A;  2BA0 A;  4P73 A;  2C35 B;  3CCL A;  3PO2 H;  1YIT A;  1KD1 C;  1JJ2 A;  4BBR H;  4A75 A;  1EFW A;  4O0A A;  4BA1 I;  1EOV A;  3PF5 A;  3CD6 A;  1SRU A;  1Z9F A;  1HH2 P;  2XGT A;  1WFQ A;  3EN2 A;  4JI0 L;  4JI7 L;  3FP9 A;  3HKZ E;  1EQQ A;  4RMF A;  5IYC H;  4B3M Q;  4YCW A;  3AEV A;  2WAQ G;  4OXP A;  3PCO B;  4JI8 Q;  1XMO L;  3GTG H;  3H3V I;  2UXD L;  1S3O A;  5AJ3 L;  4BA2 I;  4DR2 L;  4TVA B;  4K0K Q;  4UP9 A;  2YU9 H;  4DR1 Q;  3CCM A;  3CC7 A;  1VQ4 A;  4L5R C;  4HJ5 A;  3CQZ H;  4XTC S;  3ICE A;  1CKO A;  2A19 A;  4DV3 Q;  3JC6 6;  1L1O C;  3U50 C;  2B63 G;  4X6A H;  2QEX A;  3NEN A;  4A3L G;  4GOP A;  4OWW B;  3I56 A;  3PUY A;  4HJ9 A;  3G48 A;  4JBK A;  3S2D H;  1IL2 A;  5LMN W;  2E5L Q;  1Y14 B;  1VS0 A;  2CWA A;  4P74 A;  1BKB A;  1NTG A;  1XMQ Q;  5LMN Q;  2JA5 G;  1PFS A;  2UXB L;  5ELO A;  1W3S A;  4PG3 A;  3U4V A;  5IP9 H;  4DR5 Q;  3RN2 A;  1VQ5 A;  4B3M L;  4LF8 Q;  1PH1 A;  4A93 H;  4JI8 L;  2ZTD A;  1FVI A;  1UE6 A;  4DV5 Q;  1N8R C;  2UUB Q;  3HOW G;  4H02 A;  4K0K L;  2JK8 A;  2JE6 I;  4KI0 A;  3GTJ H;  2OTL A;  5H1S E;  4A3B G;  2JEB I;  4GNX B;  1PH3 A;  4DV3 L;  4PZ6 A;  5M3F G;  3IRB A;  5IYD H;  1VQO A;  3SGI A;  4GLA C;  5J3B A;  4A3F G;  3KOJ A;  2RHQ B;  3UE0 A;  3TEH B;  5IYB G;  4A3J H;  4LF6 L;  5JEA J;  3M4P A;  3PO3 G;  2UUA Q;  2VQF L;  1L0W A;  1QUQ A;  2UU9 Q;  3J81 i;  1YIJ A;  3FKI G;  3HOV H;  2HT1 A;  1C0A A;  3KF6 B;  3U4Z A;  1XMQ L;  1VQH A;  2IX0 A;  5LMN L;  3J80 c;  4DV2 Q;  1N36 Q;  1WCM H;  1JJC B;  1QVF A;  4DR5 L;  5GQO A;  2PI2 A;  3S16 H;  2LXK A;  1I3Q H;  5ELN A;  2ZJP A;  4DV5 L;  4X64 Q;  1VQK A;  5M5X H;  3BJU A;  4AYB E;  4LF5 Q;  4QGU A;  4LF9 Q;  4A4I A;  3G71 A;  4JI4 Q;  1FGU A;  2JEA I;  1YHB A;  4OX9 Q;  1HNW Q;  1I50 H;  1Q86 C;  3Q8D A;  3I4M G;  1YI2 A;  3M85 A;  4BBS G;  1VQI A;  2ID0 A;  1M90 C;  3RZD H;  2MNA A;  3JAM i;  3EIV A;  4JV5 Q;  2PMZ E;  4DV1 Q;  2A8V A;  2RCN A;  2D0O A;  3DLL A;  4DV2 L;  3L7Z C;  2HIX A;  4AH6 A;  1VCI A;  3W5O A;  4A76 A;  3KFU A;  4RG1 A;  5C3E H;  3ER0 A;  2ASB A;  3I7F A;  1EQR A;  4X64 L;  2WFW A;  1A8V A;  4JBM A;  4BY7 H;  1RIP A;  5C44 H;  3PIO A;  2K14 A;  3UE1 A;  4GS3 A;  1TWA H;  2GN5 A;  4JI4 L;  4IPC A;  4OX9 L;  1HNW L;  1PYB A;  3CXC A;  3CPW A;  1NMG A;  3K0X A;  2K5V A;  2IHF A;  3KDF B;  1N9W A;  4OWX B;  1XPR A;  4BXX G;  1HZC A;  1MJC A;  3H15 A;  4GNX C;  1YBY A;  4JV5 L;  4GKJ Q;  1SN8 A;  1IBM Q;  1IYJ B;  3H0G H;  4DV1 L;  3PUX A;  1NJI C;  2B3G A;  4DV7 Q;  5FLM G;  2QA4 A;  1Q46 A;  3ULL A;  4NB3 A;  4O2D A;  4A3E G;  4QY7 A;  3K7U C;  1G29 1;  3FHW A;  3UDX A;  3GTL H;  1YZ6 A;  4C2M H;  1LYL A;  1EUJ A;  2MO1 A;  1CSP A;  1NE3 A;  5M5Y H;  3U58 A;  1HNZ Q;  4GNX A;  2EXD A;  3JAM c;  3CME A;  4Y7N H;  1EYG A;  3BZC A;  1WOC A;  4BY1 H;  3RZO H;  1RL2 A;  3PGZ A;  1IBM L;  1PVO A;  1QVG A;  1U5K A;  2N78 A;  4JBJ A;  4JBW A;  1E22 A;  1I5F A;  3KF6 A;  3UDI A;  4DPG A;  2PQA A;  5GAE C;  1YHA A;  4R4O A;  1SMX A;  2CCZ A;  3M3Y H;  4X66 Q;  1GVP A;  2WP8 J;  4IFD I;  1P16 A;  3KJO A;  1WI5 A;  4R4Q A;  2NN6 I;  2PNH A;  2JA8 H;  2VUM G;  1OXV A;  4KHZ A;  1AE3 A;  2D62 A;  1HNZ L;  4EX5 A;  1YHQ A;  2KHJ A;  2JA7 G;  2GVB A;  5M3M H;  3CCR A;  2K5H A;  5C0X J;  2R93 G;  1GD7 A;  2Y0S G;  4YCV A;  5IWA Q;  3RNU A;  1VQJ A;  3NEM A;  3TS0 A;  2KCT A;  1Y1V H;  5BR8 Q;  4A3I G;  1I94 Q;  4DUZ Q;  3CC2 A;  5C4X H;  3OTO Q;  3D31 A;  2JA6 G;  1X6O A;  4GN4 B;  1KIX A;  1IBK Q;  1E7Z A;  1FL0 A;  4ALP A;  2R92 G;  4IO9 A;  2NVQ H;  4GLX A;  1KC8 C;  1FJG Q;  5JJI A;  4LW1 A;  3BZK A;  3HKS A;  2VQE Q;  3HOY G;  1VQM A;  4X66 L;  4DV4 L;  1D7Q A;  1K8G A;  1C9O A;  2AWO A;  1N34 L;  2WB1 E;  3I4N H;  2A1A A;  4A3M G;  4A3L H;  1YJ9 A;  1VQ9 A;  4JI1 Q;  4AIM A;  2D0P A;  3K80 C;  1B8A A;  1YNX A;  1PH9 A;  4LF6 Q;  4YWK A;  3F2D A;  5IWA L;  2JA9 A;  1X9N A;  1I94 L;  5BR8 L;  2K50 A;  5E7N A;  2VQF Q;  4DUZ L;  3OTO L;  1JJG A;  3KDF A;  1U0L A;  4P72 A;  1R9T H;  1CUK A;  2L15 A;  2F3I A;  1PH6 A;  1K73 C;  1IBK L;  4IJH A;  3GDE A;  3GO5 A;  1FJG L;  5GRO A;  4C3H H;  4HIO A;  2B63 H;  2VQE L;  4TQU S;  2KHI A;  5JJL A;  4A3C H;  3TQY A;  4DAY B;  3LGJ A;  4IJL A;  1SFO H;  1L1O A;  4L5Q A;  4QQB X;  2OQ0 A;  2E2H H;  3CC4 A;  2ES2 A;  4UP8 A;  1D8L A;  1J6Q A;  2RF4 A;  4R4I A;  1HJP A;  4UPA A;  1KL9 A;  2JA5 H;  3L0O A;  4AYB G;  2R7F A;  4JI1 L;  5IP9 G;  4L5T A;  2I0Q A;  4A93 G;  4KHP Q;  1K83 H;  4PZ8 A;  2R7Z H;  3HOW H;  4A3G H;  2WAQ E;  1VQA A;  1UEB A;  3J81 j;  2CKZ B;  3AFQ A;  3E0E A;  3S1N H;  5M3F H;  2ZM6 Q;  1P8L A;  3T1Y Q;  4A3F H;  1OXX K;  1PV4 A;  5IYB H;  3PO3 H;  3CAM A;  1IBL Q;  1OXU A;  2YTX A;  3A74 A;  2MFI A;  4DAM A;  3TRE A;  4FDB A;  4JOI C;  4LFC Q;  3OW2 A;  4DR6 Q;  3K81 C;  4JI5 Q;  1WCM G;  2IY5 B;  3HOX G;  1UE5 A;  4UP7 A;  4KHP L;  3ULP A;  4EQ5 A;  1Q81 C;  1HZ9 A;  3PUW A;  3GTP H;  2NVX H;  4MZ9 A;  4HJ7 A;  2AMC B;  3CCQ A;  4NXN Q;  2I5H A;  1EWI A;  1VQF A;  3STB D;  3HOU H;  2N3S A;  1SRO A;  1C7Y A;  3W1B A;  4DUY Q;  1YVC A;  3AFP A;  3I4M H;  2ZM6 L;  2LSS A;  4C3J H;  3T1Y L;  4BBS H;  1BBU A;  4JOI A;  4OO1 I;  1IBL L;  4QIW E;  5IP7 H;  1PH8 A;  4A3K G;  1UE7 A;  4X62 Q;  4JC0 A;  1TXY A;  4L5S A;  4LFC L;  4DR6 L;  1IZ6 A;  3S1Q H;  4JI5 L;  1BVS A;  1E1O A;  1WJJ A;  1E3P A;  4JG2 A;  1GM5 A;  1YJN A;  1CKN B;  3KJP A;  1BBW A;  5EAY A;  3J81 c;  5HY6 A;  4NXN L;  1UWV A;  1XJV A;  5C44 G;  2K52 A;  2HIV A;  1Q1B A;  1HZA A;  1X65 A;  3CP0 A;  4DUY L;  4POG A;  3DM3 A;  5FJ8 G;  1CKM A;  2XTI A;  3TRZ A;  1V1Q A;  2K4K A;  4B3T L;  1NY4 A;  4MNO A;  4X62 L;  5LMU L;  4IPH A;  4DV6 Q;  2R6G A;  3UDG A;  5GAH C;  1I6H H;  3M7N A;  4UY8 C;  4LUV A;  3W1G A;  3ZJY C;  5FLM H;  2F4V Q;  4LNQ A;  4GOP B;  1Q12 A;  3HOZ H;  4B3S L;  1H95 A;  3A5Z B;  1MKH A;  3PF4 A;  3M4O H;  4KLK A;  1G51 A;  2CWP A;  5GAG C;  3S1M H;  2ALY B;  3RN5 A;  4WJ3 M;  4LFA L;  2YYZ A;  4A3D H;  4PZ7 A;  1PYS B;  2HHH Q;  4NXM Q;  1T9H A;  4X65 Q;  2PI2 E;  1G6P A;  1J5E Q;  3GD7 A;  3S14 H;  1MIU A;  3BU2 A;  3CW2 C;  2CFM A;  2N49 A;  4DV4 Q;  2ZJQ A;  2K5N A;  3HKZ G;  1IXR A;  4J15 A;  2KBN A;  4DV6 L;  1N34 Q;  1PA6 A;  2LXJ A;  5M5W H;  3M9B A;  4IPG A;  4LF7 Q;  2F4V L;  3GTK H;  1Q8K A;  1Y1W G;  2WB1 G;  2CQO A;  1QUQ B;  3ULJ A;  2ZJR A;  1NMF A;  1VQ6 A;  3F1Z A;  3MEF A;  2JJQ A;  4NXM L;  4R4T A;  1OTC A;  2HHH L;  2VUM H;  1TWH H;  2YTV A;  1E1T A;  4X65 L;  4DV0 Q;  3K7A H;  2MO0 A;  1J5E L;  1X3G A;  1O7I A;  3PV0 A;  4XIG S;  5M3M G;  2ZTC A;  3RLF A;  3PO2 G;  2R93 H;  1KXL A;  1XNR L;  1N33 Q;  4P71 A;  2YV5 A;  5DLQ E;  4BBR G;  4A3I H;  4JI6 Q;  5FLX c;  3CCU A;  2JA6 H;  1DGS A;  1VQB A;  1VQD A;  2AWN A;  1W2B A;  1M1K C;  4HIM A;  4IFD G;  2R92 H;  2NN6 G;  5JJK A;  2I5L X;  3J7Z C;  2UUC Q;  3S24 A;  2MQH A;  4LF7 L;  4WJ4 A;  1SR3 A;  5IYC G;  3HOY H;  1VQC A;  1V9P A;  5C4J H;  5K36 G;  1OXT A;  2H5X A;  1CKN A;  3AYH B;  3KYH C;  2NVT H;  4GOP C;  4A3M H;  3I4N G;  3MXN B;  1UE1 A;  4DV0 L;  1HR0 W;  4HJA A;  3KF8 B;  1WYD A;  3J80 i;  1XNQ L;  3CCV A;  1HR0 Q;  1OXS C;  1N32 L;  2BH2 A;  3GTO H;  1N33 L;  2E8G A;  3RR5 A;  4JI6 L;  2B29 A;  2Q2T A;  1A63 A;  3AQQ A;  1LUZ A;  1VQG A;  4P75 A;  1AE2 A;  1KRS A;  2Y0S E;  3I55 A;  2UUC L;  4R1J A;  1Q7Y C;  1MJE A;  1HNX Q;  2HQL A;  4DKA C;  4A3C G;  1QVC A;  3H3V H;  3EBE A;  4JI2 Q;  2IX1 A;  4GLV B;  4YCU A;  1VQE A;  1XPU A;  3TS2 A;  4A3B H;  1X55 A;  4GKK Q;  1K9M C;  3D0F A;  3F2B A;  4DK6 C;  5IYD G;  4AQY Q;  5GAD C;  1JE5 A;  4YY3 Q;  1X3F A;  2E2J H;  1A62 A;  1K3R A;  4A3J G;  1QZH A;  1HR0 L;  3RLN A;  1ASZ A;  2R7Z G;  3NBH B;  3CMA A;  1E24 A;  1KHI A;  1Q1E A;  3A0J A;  4DR1 L;  2KCM A;  1XTD A;  3FKI H;  4GN5 A;  4R4C A;  4LUO A;  3HOV G;  4A3G G;  1B70 B;  1TWG H;  2IT1 A;  1HNX L;  2V1C C;  3S17 H;  4DR4 Q;  3OYY A;  1X54 A;  1PH7 A;  1GKH A;  1X56 A;  3RLO A;  4DR7 Q;  4JI2 L;  3B6Y A;  3F2C A;  2E5L L;  1SE8 A;  1VQ7 A;  2OWO A;  4IFD J;  5C0X I;  4GKK L;  4OON A;  1Z47 A;  2PQA B;  4DR3 Q;  3I2Z A;  3HOX H;  4AQY L;  4LF8 L;  3S15 H;  2JQO A;  3KLW A;  2VS1 A;  4YY3 L;  2K75 A;  1TWF H;  2IHE A;  1KRT A;  2UUB L;  1NBW A;  4B3T Q;  4LFB Q;  4OWT B;  2R7D A;  5LMU Q;  3GTQ H;  2VL6 A;  2UXB Q;  3HFZ B;  1K8A C;  3CPF A;  3HOU G;  2EQS A;  3PIP A;  3PUV A;  4APV A;  1KQS A;  2UXC Q;  4DNI A;  1CSQ A;  4Y52 H;  4DR4 L;  2OTJ A;  1S72 A;  1SLJ A;  3CCS A;  4B3S Q;  4JI3 Q;  5C3E G;  3CCJ A;  5IY0 A;  2UUA L;  5IP7 G;  1A0I A;  1VQN A;  4DR7 L;  1JMC A;  4QJF A;  4A3K H;  4LFA Q;  2UU9 L;  4BY7 G;  4NPS A;  1LM0 A;  1N36 L;  4JCV E;  5C0X G;  4IOC A;  5IE8 A;  4DR3 L;  4JYA Q;  1LTL A;  2DUD A;  2RHS B;  4HJ8 A;  2NZO A;  1VQL A;  4BXX H;  2OCE A;  2Z6K C;  3UDF A;  4OO1 G;  4MTN A;  3PSI A;  1ASY A;  2ATW A;  4LFB L;  1JT8 A;  4LF5 L;  3NEL A;  5IT9 c;  4LF4 Q;  4LF9 L;  3H0G G;  2N8N A;  2UXC L;  3E9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...