4JI6T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji6T00
4X64T 4B3MT 4B3RT 4LFAT 2HHHT 4NXNT 4AQYT 1N32T 3OTOT 4LFCT 4DV6T 4JI1T 1XMOT 2VQET 5IWAT 4DV0T 1XNRT 4JI2T 5BR8T 4DR2T 1XMQT 4X65T 4JI8T 1FJGT 4DR4T 1HNWT 4DV5T 1N36T 4LFBT 4X66T 4JV5T 4DUYT 1N34T 4LF8T 2UUCT 5LMUT 1IBLT 4LF4T 4DR7T 1HR0T 2ZM6T 4GKJT 4LF5T 2UXDT 4JI0T 2UXBT 4B3ST 4LF6T 4DV1T 3T1HT 2F4VT 4DV7T 4DV4T 1HNXT 4JI6T 2UUBT 4NXMT 1I94T 4K0KT 4KHPT 4DUZT 4JI5T 4DR3T 1J5ET 2UXCT 1XNQT 4DR1T 4DR6T 4JYAT 1N33T 3T1YT 4JI4T 4LF9T 2VQFT 1HNZT 2UUAT 1IBKT 4YY3T 4JI7T 4DR5T 4JI3T 2E5LT 4GKKT 4YHHT 4DV2T 4DV3T 4OX9T 4X62T 4B3TT 4LF7T 2UU9T 1IBMT 5LMNT
chains in the Genus database with same CATH superfamily
3ZKRA 4X1IE 2LM9A 3PUSA 2K9AA 3FB2A 1VRBA 2J62A 1XWMA 2JMHA 2C5KT 2W62A 5CGMA 4QH4A 1WR0A 4TNVA 3MKDA 4CI1B 3K8PC 1BR1A 2XQ8A 1CHUA 5FYMA 2X0LB 4H9QC 4PFOA 1UUSA 2IAKA 4L0RA 2YK0A 3OPCA 4HEAA 3GWHA 5HEOA 3RKGA 2DLRA 1HS7A 4A98A 1HR0T 4IT4A 2VKDA 2IC9A 2H7OA 3K1SA 4TUYE 4U72A 3TLVA 3C64A 4X5TA 4NPPA 4B3ST 2DWGA 3ZMZB 3T1HT 2H3RA 3G06A 4PNIA 3ZCJA 4K0KT 3RQWA 3RI5A 2CXDA 3H37A 4AKLA 2V7MA 5AQQB 3K3OA 3OVUA 4IDOA 5H6QB 3A8YC 4EV6A 3HR0A 3MA9A 3MXZA 5AQMB 2ODUA 4ILUA 3KFWX 4PK6A 3N2OA 4UEMA 3P7IA 2W66A 2IDOB 2L8KA 2X9HA 4O2BE 2WCAA 4EEBA 4QX7B 3QNUA 3PU8A 4KMCA 3H3AA 4AQFC 4CXXA 3O9XA 3PU3A 2VL0A 2VVSA 5JQGE 5IWAT 4KP3C 5HXEA 4V1Av 3ZMSB 1ZP0A 5ABFB 3V5UA 1R8IA 4CXWA 5LJNA 3LBXA 4KHZF 4C90A 3CWZB 3AE6A 2UUCT 1HF8A 5FXWA 4HFHA 5ABFA 1ZV4X 4JI0T 3N9LA 4GOUA 2PTFA 3RPUA 4I4TE 2CLYC 2XAQB 3UUNA 4KHPT 1W0BA 1WYBA 4DR1T 4G63A 3FHNA 4NUVA 1KNRA 1D1AA 4C91A 4O4JE 3C4ZA 5J2TE 1SE7A 2BBHA 3FBZA 3JAFA 4X64T 4HWHA 3SRZA 3AE2A 3ZJ1A 3KVAA 3VR8A 3ETUA 3OTOT 3CVRA 1X79A 1ZKEA 3EUHA 3L39A 3NVOA 4ZI3D 4AKIA 3KVBA 3SS1A 3AVRA 3RF1A 4F6RC 5HEJA 2BS3A 5HXRA 3DJBA 3PTRB 3HA4A 4QX8B 2WS3A 4AKGA 4HWIB 3QB5A 2GK9A 2M6BA 1YD8G 4LF4T 4EZHA 3J7Yq 5AQIB 3P50A 3AB3B 2XSBA 5HAXA 4ZEYA 3AEEA 5FKYA 5AQSB 5LJMA 3OBVE 3TLTA 4GK0E 3CIRA 2EHOB 4ZI2D 3VKGA 2X67A 1E1HB 2WDQA 3VRBA 4HWFA 5CFBA 4HWDA 1J5ET 2K3WA 4IE4A 3HI2A 4QXHB 5FY7A 3RIFA 3RX6A 2CEAA 3UUBA 4JI7T 4QWNB 2XQ4A 3O1JA 1JNZA 3Q9DA 1OWAA 2KWIB 2V7IA 2WAUA 5DJQC 1T8BA 5ABEA 3HKEE 3AA6B 1CUNA 4EAHA 3OYXA 4DV6T 3EI0A 3RC8A 1W9RA 4ILCA 3AVSA 3L09A 2ACZA 2KT9A 2YKSA 4ASKA 4P09A 4BA9A 3RYHE 4X66T 2WU2A 1UK5A 3PV0F 3NRYA 3DTOA 4TNWA 5H6RB 3UUXB 1M7KA 5L4EA 2I0MA 1UX4A 1D1BA 2JQQA 2UXBT 4DO0A 1IZNB 1V9DA 5IYZE 3RIUA 2LJLA 3AE8A 4QHOA 5FXVA 3ZC1A 2KLQA 5AQPB 5L3EB 1S35A 2H89A 3NBXX 2P9BA 4GYSA 5DABA 2VKHA 1QLBA 3KBUA 1Z8UA 4DR6T 2JIWA 3JCFA 4UVAB 3PJAJ 2WU5A 3ZLIA 4OX9T 4Z90A 4YSYA 5JDMA 3C4WA 2X66A 5L3CB 2UU9T 4OK0A 3WAKA 1WYCA 1EZ3A 2ACXA 2NR4A 2OV9A 2NP9A 4AIUA 5LBMA 2KSRA 1KK7A 1FIOA 3LDQB 3C4XA 1ZEEA 3PUXF 1XMOT 2DL1A 3F31A 5LCYA 2CMRA 2XQ6A 2NW8A 4CI3B 4YJ2E 3LK42 4IDQA 2ZM2A 3CX6B 5CB4E 3RYFE 5J0ZA 2IHR1 3I1AA 4I0UA 2YDRA 3UU6A 4JV5T 4JLEA 2VB6A 2BVLA 2ZM6T 4YXDA 3ONXA 2YDSA 5HWXA 2DCFA 4O8SA 2VL8A 1J1JA 4BAYB 5JDQA 2CWYA 2WB5A 3A5XA 2XQAA 2Y48B 4AI6A 4DR3T 2BS2A 1BR2A 1XNQT 3AE1A 3AXJB 3I9WA 2Q9QC 2E9XC 2CXLA 4HFVA 5FP3A 3P8CD 2WDVA 1D0XA 3AXJA 4BJMA 2IIUA 3U3IA 4M1PA 2XZEA 1MMDA 3GMIA 4CZZB 1OEDB 3UT5E 3NZPA 4YSXA 2W63A 3VRAA 4KX6A 4IE7A 4TV8E 5L3FB 5LA6E 2W4XA 4H63H 1AJ3A 3LFMA 1HG2A 5AQNB 4DVDA 3PDYA 1OEDA 1D0ZA 4PJNA 4MFRA 4XBFB 5JDNA 2WMOA 4XAXB 4CN4A 5CA0E 3VHLA 3CPZA 4QXCB 3ZN1B 1KEYA 4LMKA 4YTMA 3PJAA 2BDEA 2IUBA 3CQXC 2W67A 4O4HE 2JRKA 3AA7B 2LLYA 2WZIA 4OYKA 3PUAA 2F4VT 2Z6EA 2XSAA 1YXRA 5JTGA 4YJ3E 1WLXA 5JDHA 4EZ4A 1WFDA 4EGWA 2LM2A 3ZJ2A 2WP9A 2LEHA 1HX1B 5M4YA 3AEAA 1UGOA 2CM0A 4IGUA 4JI3T 2V7JA 1X9BA 2V8SV 2FBWA 5L4HA 2D0UA 2X9WA 3ONJA 4BJNA 2QYWA 2XPKA 5HCJA 2HHHT 2RA1A 3PUGA 3N2KE 1N32T 2CXFA 2Y6XA 3NKZA 2V7KA 2J4GA 3FZFB 4DV0T 3PUVF 4YFSA 4X65T 4H9NC 3O1IA 4JEHB 4ISSA 5C3JA 2M67A 1FJGT 4FJOA 1WCRA 5CA1E 3N9QA 4DV5T 1HCIA 5FL0A 2WMNA 5HCMA 5LMUT 2AE9A 5HYAA 2QA7A 4AQFA 3ZT5A 3LBXB 4AISA 1NEKA 3NWIA 3AAAB 3AE4A 3SFDA 1MIYA 2QVAA 2B1EA 1SHZC 5AQUB 5LB7B 4UVCB 3PURA 4NXMT 5IHYA 3IBPA 2XAGB 2CLYB 3ESLA 1UX5A 1FMWA 3B5MA 2CE7A 3ZPOA 3RIAA 4PW8A 5KX5E 4AKRB 4PK4A 3PUQA 3P4RA 2N1GA 3B57A 2PJQA 5L3GB 2H7VC 3M65A 2K48A 5LP6E 4DBQA 3TLWA 4B3TT 4WBOA 2RPAA 2HH7A 4ANJA 4E7SA 5LMNT 5JR9B 3LSVA 2K5BB 2MYSA 1H7CA 2CHNA 3EDVA 4TV9E 5JRCB 4NXNT 5LOVE 2CHOA 2V1DB 3CX8B 5JDLA 2E9XD 5JR9A 2X9XA 3IF8B 1KNPA 2K24A 2Y8DA 1M62A 4TX5A 3CKDA 5JRCA 4HE8A 3M3ZB 3VR9A 1KNZA 4JI8T 3F2EA 2L9QA 3P4SA 4PJLA 3CMLA 3KINB 2BG9B 4AKHA 3OKQA 4YTPA 2KNDA 3TLUA 5J1GA 3KV4A 2V5DA 2CBIA 2LE8A 1G8XA 5FVLA 5E0OA 1U5PA 4LF6T 3R6NA 2XQ9A 1IJ5A 3JAEA 2XQ5A 5LXTE 2BG9A 3JC6C 2LHRA 4JI6T 3PUWF 4P0BA 5DQWA 3K3QC 2BKOA 2LSIA 5BMVE 4K0UA 4UIGA 2X68A 2A3DA 3OYZA 4HGAA 3Q2MA 2PFVA 3N9NA 4WNKA 3RQUA 2CCQA 3FXDB 5LYJE 2E5LT 4DV2T 2C5JA 4YHJA 2CWOA 3KBTA 4ILBA 3C50A 2H88A 4IE6A 3UULA 4WZXA 2JQKA 2E8IA 2XQ3A 3QB5K 4IDNA 1E2AA 4G2AA 1DU2A 4ZXLA 2WSSV 2XQ7A 3MK7C 4JI1T 1JNRA 2V5CA 5LNKA 2X0HA 3ZSSA 3PUYF 2EHOC 2D9DA 3GN5A 4I50E 5L2LA 2V6YB 1N34T 3WI3A 1HX8A 1MMNA 4LF8T 1YKEB 2IW5B 5HXCA 4IL9A 5KMGP 3Q5XA 5LGNB 4A5XA 4YT0A 2V6YA 5AQKB 3FZHB 2CA5A 3AEBA 3VKHA 3X1DA 4DUZT 3I0QA 4H9SE 3P4QA 3EABA 4LMJA 4ZHQE 3PE0A 2YDQA 3VU7H 2W00A 2LT3A 2OLTA 1HG5A 2LSKA 4GYRA 4YY3T 3DP7A 4HFCA 4U33A 5LHHB 2CPTA 3ZMVB 3RYIE 2XHEB 3KV6A 3FZMB 4TZ4C 3RIUC 5AQGB 1MIVA 3AECA 5HEUA 5JREA 2LRKA 2KINB 2FJEA 2VQET 5BR8T 1LVFA 3ZN0B 3Q5EA 1XMQT 2LOPA 4NIQA 5EK3A 3N9PA 1E7PA 5F5WA 1HNWT 1MMAA 5EK4A 2ES0A 3ZMTB 4HKAA 4UR9A 3CX7B 3RH3A 2MOZA 4EYUA 2BKPA 3R84B 2IMLA 2LSJA 1OEDE 4DNDA 3E22E 4X1YE 1WRDA 4DV1T 3AE3A 4ZI7E 1U4QA 4N78D 4P1NA 2IC6A 2YN6A 3FZLB 4H9OC 3NRXA 3P4PA 1YKHB 2VK9A 1N33T 4LF9T 2CBJA 1B7TA 1FMVA 3FXEB 2DI4A 3UFEA 2JQ9A 5JDGA 4QH1A 1D1CA 4HFIA 1BR4A 5FY1A 2FJDA 4GKKT 4CQIA 5F3JA 3IEEA 4X62T 2A2FX 4IIJE 3ZYMA 4U3CA 5FMNA 3AA1B 5L3BB 2E9XA 1LRZA 3N2GE 2D2SA 1FEWA 1T72A 4DMWA 4ILAA 5JH7E 1UCUA 3WAJA 5TAOA 2VKJA 1IAPA 3UU8A 1YQ3A 3ZCIA 2WWUA 2N2NA 4UF0A 3ZT7A 3RC3A 2BBJA 2QRXA 4HTEA 4TWHA 2XTLA 4AQGA 2W0GA 2WWVA 2PBIA 2BKNA 3A7MA 4LF5T 4GKJT 3O1HA 2MTQA 4Z91A 2MPKA 3ZEFB 3T8OA 4ZI3C 5IUXA 1XZYA 3UQ4A 4U2YA 1T7SA 2XAJB 4A56A 2HN1A 2UUBT 1Z0PA 1I94T 1XDPA 4L5GA 3V5SA 4PFPA 2EHOD 2DWKA 1HFAA 3Q5WA 2UXCT 1QUUA 3ABVA 4ZZCA 1LKXA 1Y01A 3E0ZA 2V6XA 2UUAT 2VASA 1IBKT 4LMLA 2BS4A 4QXBB 5AQFB 4ZZBA 4I55E 4TN7B 4EB6E 4HN9A 2E5VA 4ZI2C 4LF7T 2XM2A 2NW9A 3AEDA 1KF6A 3IHRA 2JJ9A 4MLKA 2XASB 1OXZA 1US7B 4AQYT 3F57A 4PK5A 5EK2A 2LHNA 2FUPA 2NTXA 4HFBA 2HN2A 5FY0A 4JI2T 3S4UA 4DR2T 4IREA 4ADZA 3LJCA 5JVDE 5FVKA 5HXSA 1N36T 5AQHB 2V7LA 2I59A 4P0AA 1MIWA 5ABHA 3E08A 3MACA 1GQEA 3HKDE 1Y64B 4CXYA 4EEDA 5HEHA 3O4XE 4DMVA 4UVBB 3ZYLA 3PUZF 2JQHA 1NAFA 2KMFA 3KDSE 1MNEA 2WQYA 2KXPB 1VCTA 2E2AA 2X0YA 2JMKA 4J2CA 3MJXA 4WYVA 2CRBA 1SUMB 2BZBA 3LK3B 5FNVE 4E7ZA 5L3DB 1LVKA 2BVMA 4O4IE 4ZOLE 4IL4A 2PG8A 4CN6A 2BG9E 1D0YA 2NW7A 4H63V 2XAHB 5LGUB 5ETWA 1O3XA 2LSYA 3H3MA 4NUUA 4B3MT 2W61A 2UXXB 5KXJA 3L8RA 4JEUB 5JDFA 2XAFB 3W15B 2WM9A 4UELA 1IJ6A 5AQVB 3ZT6A 2XJ7A 2LSGA 1XNRT 3BQKA 4U2ZA 4EXTA 3UU4A 4DR4T 4ZS3A 3AEGA 3UU5A 3ZMUB 5A1LA 4KUMB 5FXZA 2UXNB 4X1KE 3K3NA 2Q9QD 3EHZA 3IA3A 4QKNA 2VURA 3LK2B 2UXDT 4HFDA 3TKLB 4ISTA 4TWDA 4DBRA 3SOLA 1HNXT 3CQGB 3AAEB 5LG4A 5JR9C 1W09A 1VCSA 2VVNA 3SWHA 1NWMX 4EIWA 4PJMA 3AA0B 3N9MA 4COFA 2LOSA 3RHWA 1MNDA 2NOXA 4KBMB 5ADXL 4TWFA 3OJAA 3AE9A 2D0TA 3ZC0A 3QUJA 3SFEA 3ANWB 1IBMT 2J1DG 5AFUL 5LHGB 2XUEA 1SA0E 4H9RC 2ZM8A 5J2UE 4LFAT 4O4LE 3UFGA 5EZYE 2BG9C 4A97A 2LKHA 3EVYA 3J9X1 3ANWA 4EOZB 4HWCA 5CJ5A 5KDMC 3C51A 3RGLA 4OYJA 2WDRA 2X51A 4U74A 2KZ7B 3AE7A 5ABGA 3RYCE 3CQCB 3UTKA 4U7IA 3GN5B 4MBQA 4JUYA 3RRCA 4DUYT 5HEGA 3ZSTA 5LGTB 2J47A 4EYYR 1IBLT 4YSZA 4DR7T 5AQLB 2JPFA 3FZKB 1BR0A 3HL6A 2C0SA 4HFEA 2EHOA 2FJAA 5AQJB 2KWHA 4DV7T 4WW0A 3UU3A 1S94A 2A9UA 4O2AE 4JI4T 1J5WA 1I6ZA 3ETVA 4GK5E 4DR5T 2HPLA 4I43B 2ZMAA 2B76A 3QC9A 2DNXA 2XM1A 2QGSA 3C98B 4GIWA 1NENA 3N5LA 3RKOA 3D0TA 2NTYA 4F8HA 3I9YA 4KI0F 4DIDB 2ZLYA 3BQLA 1XDOA 3AAIA 2LRLA 3EAMA 1W0AA 4IDZA 4X20E 3TLSA 3NZQA 4U31A 1UURA 3QOFA 3UUMA 2AXDS 5GONE 4Z8XA 2I6HA 3HKCE 4FI5A 4PJJA 2WBLA 3LG7A 3AEFA 5HWYA 4Q25A 2WZHA 1L0VA 2FJBA 2XY8B 3MZKB 5FL1A 1WR6A 2RP4A 3ONLC 2MAWA 2YOEA 2VKOA 4JI5T 3U78A 2L3LA 5AQTB 3T1YT 5AQRB 1HNZT 3P4WA 4MHCA 5LHIB 2YINA 2OA5A 3CK6A 4UXNB 4IE5A 2WY2A 1YQ4A 3L3PA 3UQ7A 3QK6A 4AXPA 2VWAA 4IE0A 4B6XA 3AE5A 3HKBE 3JADA 1G73A 2XQYA 4B3RT 4ZS2A 2HPJA 3I0OA 4U7YA 2Q9QB 3BK9A 5AQOB 2C5IT 3B13A 2E9XB 2W2UA 3FBLA 4LFCT 5DQVA 3ZYKA 2ZM0A 5LG3A 2DHRA 2YEVC 3KV9A 5LBQB 1MMGA 4QH5A 3JC6D 3BQIA 2Q9QA 3RLFF 1QSDA 4OFZA 4YTNA 4UV8B 4LFBT 2R6GF 5C8YE 4L9IA 4H9PC 2D5UA 1ZOYA 4UF0B 5F8PA 2NWBA 2SPCA 5FXXA 4IDPA 5HXHA 1T98A 2X9YA 4XZCA 2MBGA 4IHJE 4CN1A 2M6IA 2A72A 4OHFA 4DV4T 3RRWA 1HTJF 2LKGA 2ODVA 1VOMA 1KFYA 3Q5DA 3GA8A 4YLHA 1YW0A 4MALA 4UV9B 4JYAT 5L47A 2V26A 4PAGA 4CI2B 2VQFT 2YU1A 2G0UA 4ERRA 4YHHT 1ZHCA 3KV5A 4DV3T 3N9OA 2YU2A 2N9DA 4WBNE 4JBWF 1OEDC 3EDUA 5C2TA
chains in the Genus database with same CATH topology
4X64T 4B3MT 4B3RT 4LFAT 2HHHT 4NXNT 4AQYT 1N32T 3OTOT 4LFCT 4DV6T 4JI1T 1XMOT 2VQET 5IWAT 4DV0T 1XNRT 4JI2T 5BR8T 4DR2T 1XMQT 4X65T 4JI8T 1FJGT 4DR4T 1HNWT 4DV5T 1N36T 4LFBT 4X66T 4JV5T 4DUYT 1N34T 4LF8T 2UUCT 5LMUT 1IBLT 4LF4T 4DR7T 1HR0T 2ZM6T 4GKJT 4LF5T 2UXDT 4JI0T 2UXBT 4B3ST 4LF6T 4DV1T 3T1HT 2F4VT 4DV7T 4DV4T 1HNXT 4JI6T 2UUBT 4NXMT 1I94T 4K0KT 4KHPT 4DUZT 4JI5T 4DR3T 1J5ET 2UXCT 1XNQT 4DR1T 4DR6T 4JYAT 1N33T 3T1YT 4JI4T 4LF9T 2VQFT 1HNZT 2UUAT 1IBKT 4YY3T 4JI7T 4DR5T 4JI3T 2E5LT 4GKKT 4YHHT 4DV2T 4DV3T 4OX9T 4X62T 4B3TT 4LF7T 2UU9T 1IBMT 5LMNT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 T;  4B3M T;  4B3R T;  4LFA T;  2HHH T;  4NXN T;  4AQY T;  1N32 T;  3OTO T;  4LFC T;  4DV6 T;  4JI1 T;  1XMO T;  2VQE T;  5IWA T;  4DV0 T;  1XNR T;  4JI2 T;  5BR8 T;  4DR2 T;  1XMQ T;  4X65 T;  4JI8 T;  1FJG T;  4DR4 T;  1HNW T;  4DV5 T;  1N36 T;  4LFB T;  4X66 T;  4JV5 T;  4DUY T;  1N34 T;  4LF8 T;  2UUC T;  5LMU T;  1IBL T;  4LF4 T;  4DR7 T;  1HR0 T;  2ZM6 T;  4GKJ T;  4LF5 T;  2UXD T;  4JI0 T;  2UXB T;  4B3S T;  4LF6 T;  4DV1 T;  3T1H T;  2F4V T;  4DV7 T;  4DV4 T;  1HNX T;  4JI6 T;  2UUB T;  4NXM T;  1I94 T;  4K0K T;  4KHP T;  4DUZ T;  4JI5 T;  4DR3 T;  1J5E T;  2UXC T;  1XNQ T;  4DR1 T;  4DR6 T;  4JYA T;  1N33 T;  3T1Y T;  4JI4 T;  4LF9 T;  2VQF T;  1HNZ T;  2UUA T;  1IBK T;  4YY3 T;  4JI7 T;  4DR5 T;  4JI3 T;  2E5L T;  4GKK T;  4YHH T;  4DV2 T;  4DV3 T;  4OX9 T;  4X62 T;  4B3T T;  4LF7 T;  2UU9 T;  1IBM T;  5LMN T; 
#chains in the Genus database with same CATH topology
 3ZKR A;  4X1I E;  2LM9 A;  3PUS A;  2K9A A;  3FB2 A;  1VRB A;  2J62 A;  1XWM A;  2JMH A;  2C5K T;  2W62 A;  5CGM A;  4QH4 A;  1WR0 A;  4TNV A;  3MKD A;  4CI1 B;  3K8P C;  1BR1 A;  2XQ8 A;  1CHU A;  5FYM A;  2X0L B;  4H9Q C;  4PFO A;  1UUS A;  2IAK A;  4L0R A;  2YK0 A;  3OPC A;  4HEA A;  3GWH A;  5HEO A;  3RKG A;  2DLR A;  1HS7 A;  4A98 A;  1HR0 T;  4IT4 A;  2VKD A;  2IC9 A;  2H7O A;  3K1S A;  4TUY E;  4U72 A;  3TLV A;  3C64 A;  4X5T A;  4NPP A;  4B3S T;  2DWG A;  3ZMZ B;  3T1H T;  2H3R A;  3G06 A;  4PNI A;  3ZCJ A;  4K0K T;  3RQW A;  3RI5 A;  2CXD A;  3H37 A;  4AKL A;  2V7M A;  5AQQ B;  3K3O A;  3OVU A;  4IDO A;  5H6Q B;  3A8Y C;  4EV6 A;  3HR0 A;  3MA9 A;  3MXZ A;  5AQM B;  2ODU A;  4ILU A;  3KFW X;  4PK6 A;  3N2O A;  4UEM A;  3P7I A;  2W66 A;  2IDO B;  2L8K A;  2X9H A;  4O2B E;  2WCA A;  4EEB A;  4QX7 B;  3QNU A;  3PU8 A;  4KMC A;  3H3A A;  4AQF C;  4CXX A;  3O9X A;  3PU3 A;  2VL0 A;  2VVS A;  5JQG E;  5IWA T;  4KP3 C;  5HXE A;  4V1A v;  3ZMS B;  1ZP0 A;  5ABF B;  3V5U A;  1R8I A;  4CXW A;  5LJN A;  3LBX A;  4KHZ F;  4C90 A;  3CWZ B;  3AE6 A;  2UUC T;  1HF8 A;  5FXW A;  4HFH A;  5ABF A;  1ZV4 X;  4JI0 T;  3N9L A;  4GOU A;  2PTF A;  3RPU A;  4I4T E;  2CLY C;  2XAQ B;  3UUN A;  4KHP T;  1W0B A;  1WYB A;  4DR1 T;  4G63 A;  3FHN A;  4NUV A;  1KNR A;  1D1A A;  4C91 A;  4O4J E;  3C4Z A;  5J2T E;  1SE7 A;  2BBH A;  3FBZ A;  3JAF A;  4X64 T;  4HWH A;  3SRZ A;  3AE2 A;  3ZJ1 A;  3KVA A;  3VR8 A;  3ETU A;  3OTO T;  3CVR A;  1X79 A;  1ZKE A;  3EUH A;  3L39 A;  3NVO A;  4ZI3 D;  4AKI A;  3KVB A;  3SS1 A;  3AVR A;  3RF1 A;  4F6R C;  5HEJ A;  2BS3 A;  5HXR A;  3DJB A;  3PTR B;  3HA4 A;  4QX8 B;  2WS3 A;  4AKG A;  4HWI B;  3QB5 A;  2GK9 A;  2M6B A;  1YD8 G;  4LF4 T;  4EZH A;  3J7Y q;  5AQI B;  3P50 A;  3AB3 B;  2XSB A;  5HAX A;  4ZEY A;  3AEE A;  5FKY A;  5AQS B;  5LJM A;  3OBV E;  3TLT A;  4GK0 E;  3CIR A;  2EHO B;  4ZI2 D;  3VKG A;  2X67 A;  1E1H B;  2WDQ A;  3VRB A;  4HWF A;  5CFB A;  4HWD A;  1J5E T;  2K3W A;  4IE4 A;  3HI2 A;  4QXH B;  5FY7 A;  3RIF A;  3RX6 A;  2CEA A;  3UUB A;  4JI7 T;  4QWN B;  2XQ4 A;  3O1J A;  1JNZ A;  3Q9D A;  1OWA A;  2KWI B;  2V7I A;  2WAU A;  5DJQ C;  1T8B A;  5ABE A;  3HKE E;  3AA6 B;  1CUN A;  4EAH A;  3OYX A;  4DV6 T;  3EI0 A;  3RC8 A;  1W9R A;  4ILC A;  3AVS A;  3L09 A;  2ACZ A;  2KT9 A;  2YKS A;  4ASK A;  4P09 A;  4BA9 A;  3RYH E;  4X66 T;  2WU2 A;  1UK5 A;  3PV0 F;  3NRY A;  3DTO A;  4TNW A;  5H6R B;  3UUX B;  1M7K A;  5L4E A;  2I0M A;  1UX4 A;  1D1B A;  2JQQ A;  2UXB T;  4DO0 A;  1IZN B;  1V9D A;  5IYZ E;  3RIU A;  2LJL A;  3AE8 A;  4QHO A;  5FXV A;  3ZC1 A;  2KLQ A;  5AQP B;  5L3E B;  1S35 A;  2H89 A;  3NBX X;  2P9B A;  4GYS A;  5DAB A;  2VKH A;  1QLB A;  3KBU A;  1Z8U A;  4DR6 T;  2JIW A;  3JCF A;  4UVA B;  3PJA J;  2WU5 A;  3ZLI A;  4OX9 T;  4Z90 A;  4YSY A;  5JDM A;  3C4W A;  2X66 A;  5L3C B;  2UU9 T;  4OK0 A;  3WAK A;  1WYC A;  1EZ3 A;  2ACX A;  2NR4 A;  2OV9 A;  2NP9 A;  4AIU A;  5LBM A;  2KSR A;  1KK7 A;  1FIO A;  3LDQ B;  3C4X A;  1ZEE A;  3PUX F;  1XMO T;  2DL1 A;  3F31 A;  5LCY A;  2CMR A;  2XQ6 A;  2NW8 A;  4CI3 B;  4YJ2 E;  3LK4 2;  4IDQ A;  2ZM2 A;  3CX6 B;  5CB4 E;  3RYF E;  5J0Z A;  2IHR 1;  3I1A A;  4I0U A;  2YDR A;  3UU6 A;  4JV5 T;  4JLE A;  2VB6 A;  2BVL A;  2ZM6 T;  4YXD A;  3ONX A;  2YDS A;  5HWX A;  2DCF A;  4O8S A;  2VL8 A;  1J1J A;  4BAY B;  5JDQ A;  2CWY A;  2WB5 A;  3A5X A;  2XQA A;  2Y48 B;  4AI6 A;  4DR3 T;  2BS2 A;  1BR2 A;  1XNQ T;  3AE1 A;  3AXJ B;  3I9W A;  2Q9Q C;  2E9X C;  2CXL A;  4HFV A;  5FP3 A;  3P8C D;  2WDV A;  1D0X A;  3AXJ A;  4BJM A;  2IIU A;  3U3I A;  4M1P A;  2XZE A;  1MMD A;  3GMI A;  4CZZ B;  1OED B;  3UT5 E;  3NZP A;  4YSX A;  2W63 A;  3VRA A;  4KX6 A;  4IE7 A;  4TV8 E;  5L3F B;  5LA6 E;  2W4X A;  4H63 H;  1AJ3 A;  3LFM A;  1HG2 A;  5AQN B;  4DVD A;  3PDY A;  1OED A;  1D0Z A;  4PJN A;  4MFR A;  4XBF B;  5JDN A;  2WMO A;  4XAX B;  4CN4 A;  5CA0 E;  3VHL A;  3CPZ A;  4QXC B;  3ZN1 B;  1KEY A;  4LMK A;  4YTM A;  3PJA A;  2BDE A;  2IUB A;  3CQX C;  2W67 A;  4O4H E;  2JRK A;  3AA7 B;  2LLY A;  2WZI A;  4OYK A;  3PUA A;  2F4V T;  2Z6E A;  2XSA A;  1YXR A;  5JTG A;  4YJ3 E;  1WLX A;  5JDH A;  4EZ4 A;  1WFD A;  4EGW A;  2LM2 A;  3ZJ2 A;  2WP9 A;  2LEH A;  1HX1 B;  5M4Y A;  3AEA A;  1UGO A;  2CM0 A;  4IGU A;  4JI3 T;  2V7J A;  1X9B A;  2V8S V;  2FBW A;  5L4H A;  2D0U A;  2X9W A;  3ONJ A;  4BJN A;  2QYW A;  2XPK A;  5HCJ A;  2HHH T;  2RA1 A;  3PUG A;  3N2K E;  1N32 T;  2CXF A;  2Y6X A;  3NKZ A;  2V7K A;  2J4G A;  3FZF B;  4DV0 T;  3PUV F;  4YFS A;  4X65 T;  4H9N C;  3O1I A;  4JEH B;  4ISS A;  5C3J A;  2M67 A;  1FJG T;  4FJO A;  1WCR A;  5CA1 E;  3N9Q A;  4DV5 T;  1HCI A;  5FL0 A;  2WMN A;  5HCM A;  5LMU T;  2AE9 A;  5HYA A;  2QA7 A;  4AQF A;  3ZT5 A;  3LBX B;  4AIS A;  1NEK A;  3NWI A;  3AAA B;  3AE4 A;  3SFD A;  1MIY A;  2QVA A;  2B1E A;  1SHZ C;  5AQU B;  5LB7 B;  4UVC B;  3PUR A;  4NXM T;  5IHY A;  3IBP A;  2XAG B;  2CLY B;  3ESL A;  1UX5 A;  1FMW A;  3B5M A;  2CE7 A;  3ZPO A;  3RIA A;  4PW8 A;  5KX5 E;  4AKR B;  4PK4 A;  3PUQ A;  3P4R A;  2N1G A;  3B57 A;  2PJQ A;  5L3G B;  2H7V C;  3M65 A;  2K48 A;  5LP6 E;  4DBQ A;  3TLW A;  4B3T T;  4WBO A;  2RPA A;  2HH7 A;  4ANJ A;  4E7S A;  5LMN T;  5JR9 B;  3LSV A;  2K5B B;  2MYS A;  1H7C A;  2CHN A;  3EDV A;  4TV9 E;  5JRC B;  4NXN T;  5LOV E;  2CHO A;  2V1D B;  3CX8 B;  5JDL A;  2E9X D;  5JR9 A;  2X9X A;  3IF8 B;  1KNP A;  2K24 A;  2Y8D A;  1M62 A;  4TX5 A;  3CKD A;  5JRC A;  4HE8 A;  3M3Z B;  3VR9 A;  1KNZ A;  4JI8 T;  3F2E A;  2L9Q A;  3P4S A;  4PJL A;  3CML A;  3KIN B;  2BG9 B;  4AKH A;  3OKQ A;  4YTP A;  2KND A;  3TLU A;  5J1G A;  3KV4 A;  2V5D A;  2CBI A;  2LE8 A;  1G8X A;  5FVL A;  5E0O A;  1U5P A;  4LF6 T;  3R6N A;  2XQ9 A;  1IJ5 A;  3JAE A;  2XQ5 A;  5LXT E;  2BG9 A;  3JC6 C;  2LHR A;  4JI6 T;  3PUW F;  4P0B A;  5DQW A;  3K3Q C;  2BKO A;  2LSI A;  5BMV E;  4K0U A;  4UIG A;  2X68 A;  2A3D A;  3OYZ A;  4HGA A;  3Q2M A;  2PFV A;  3N9N A;  4WNK A;  3RQU A;  2CCQ A;  3FXD B;  5LYJ E;  2E5L T;  4DV2 T;  2C5J A;  4YHJ A;  2CWO A;  3KBT A;  4ILB A;  3C50 A;  2H88 A;  4IE6 A;  3UUL A;  4WZX A;  2JQK A;  2E8I A;  2XQ3 A;  3QB5 K;  4IDN A;  1E2A A;  4G2A A;  1DU2 A;  4ZXL A;  2WSS V;  2XQ7 A;  3MK7 C;  4JI1 T;  1JNR A;  2V5C A;  5LNK A;  2X0H A;  3ZSS A;  3PUY F;  2EHO C;  2D9D A;  3GN5 A;  4I50 E;  5L2L A;  2V6Y B;  1N34 T;  3WI3 A;  1HX8 A;  1MMN A;  4LF8 T;  1YKE B;  2IW5 B;  5HXC A;  4IL9 A;  5KMG P;  3Q5X A;  5LGN B;  4A5X A;  4YT0 A;  2V6Y A;  5AQK B;  3FZH B;  2CA5 A;  3AEB A;  3VKH A;  3X1D A;  4DUZ T;  3I0Q A;  4H9S E;  3P4Q A;  3EAB A;  4LMJ A;  4ZHQ E;  3PE0 A;  2YDQ A;  3VU7 H;  2W00 A;  2LT3 A;  2OLT A;  1HG5 A;  2LSK A;  4GYR A;  4YY3 T;  3DP7 A;  4HFC A;  4U33 A;  5LHH B;  2CPT A;  3ZMV B;  3RYI E;  2XHE B;  3KV6 A;  3FZM B;  4TZ4 C;  3RIU C;  5AQG B;  1MIV A;  3AEC A;  5HEU A;  5JRE A;  2LRK A;  2KIN B;  2FJE A;  2VQE T;  5BR8 T;  1LVF A;  3ZN0 B;  3Q5E A;  1XMQ T;  2LOP A;  4NIQ A;  5EK3 A;  3N9P A;  1E7P A;  5F5W A;  1HNW T;  1MMA A;  5EK4 A;  2ES0 A;  3ZMT B;  4HKA A;  4UR9 A;  3CX7 B;  3RH3 A;  2MOZ A;  4EYU A;  2BKP A;  3R84 B;  2IML A;  2LSJ A;  1OED E;  4DND A;  3E22 E;  4X1Y E;  1WRD A;  4DV1 T;  3AE3 A;  4ZI7 E;  1U4Q A;  4N78 D;  4P1N A;  2IC6 A;  2YN6 A;  3FZL B;  4H9O C;  3NRX A;  3P4P A;  1YKH B;  2VK9 A;  1N33 T;  4LF9 T;  2CBJ A;  1B7T A;  1FMV A;  3FXE B;  2DI4 A;  3UFE A;  2JQ9 A;  5JDG A;  4QH1 A;  1D1C A;  4HFI A;  1BR4 A;  5FY1 A;  2FJD A;  4GKK T;  4CQI A;  5F3J A;  3IEE A;  4X62 T;  2A2F X;  4IIJ E;  3ZYM A;  4U3C A;  5FMN A;  3AA1 B;  5L3B B;  2E9X A;  1LRZ A;  3N2G E;  2D2S A;  1FEW A;  1T72 A;  4DMW A;  4ILA A;  5JH7 E;  1UCU A;  3WAJ A;  5TAO A;  2VKJ A;  1IAP A;  3UU8 A;  1YQ3 A;  3ZCI A;  2WWU A;  2N2N A;  4UF0 A;  3ZT7 A;  3RC3 A;  2BBJ A;  2QRX A;  4HTE A;  4TWH A;  2XTL A;  4AQG A;  2W0G A;  2WWV A;  2PBI A;  2BKN A;  3A7M A;  4LF5 T;  4GKJ T;  3O1H A;  2MTQ A;  4Z91 A;  2MPK A;  3ZEF B;  3T8O A;  4ZI3 C;  5IUX A;  1XZY A;  3UQ4 A;  4U2Y A;  1T7S A;  2XAJ B;  4A56 A;  2HN1 A;  2UUB T;  1Z0P A;  1I94 T;  1XDP A;  4L5G A;  3V5S A;  4PFP A;  2EHO D;  2DWK A;  1HFA A;  3Q5W A;  2UXC T;  1QUU A;  3ABV A;  4ZZC A;  1LKX A;  1Y01 A;  3E0Z A;  2V6X A;  2UUA T;  2VAS A;  1IBK T;  4LML A;  2BS4 A;  4QXB B;  5AQF B;  4ZZB A;  4I55 E;  4TN7 B;  4EB6 E;  4HN9 A;  2E5V A;  4ZI2 C;  4LF7 T;  2XM2 A;  2NW9 A;  3AED A;  1KF6 A;  3IHR A;  2JJ9 A;  4MLK A;  2XAS B;  1OXZ A;  1US7 B;  4AQY T;  3F57 A;  4PK5 A;  5EK2 A;  2LHN A;  2FUP A;  2NTX A;  4HFB A;  2HN2 A;  5FY0 A;  4JI2 T;  3S4U A;  4DR2 T;  4IRE A;  4ADZ A;  3LJC A;  5JVD E;  5FVK A;  5HXS A;  1N36 T;  5AQH B;  2V7L A;  2I59 A;  4P0A A;  1MIW A;  5ABH A;  3E08 A;  3MAC A;  1GQE A;  3HKD E;  1Y64 B;  4CXY A;  4EED A;  5HEH A;  3O4X E;  4DMV A;  4UVB B;  3ZYL A;  3PUZ F;  2JQH A;  1NAF A;  2KMF A;  3KDS E;  1MNE A;  2WQY A;  2KXP B;  1VCT A;  2E2A A;  2X0Y A;  2JMK A;  4J2C A;  3MJX A;  4WYV A;  2CRB A;  1SUM B;  2BZB A;  3LK3 B;  5FNV E;  4E7Z A;  5L3D B;  1LVK A;  2BVM A;  4O4I E;  4ZOL E;  4IL4 A;  2PG8 A;  4CN6 A;  2BG9 E;  1D0Y A;  2NW7 A;  4H63 V;  2XAH B;  5LGU B;  5ETW A;  1O3X A;  2LSY A;  3H3M A;  4NUU A;  4B3M T;  2W61 A;  2UXX B;  5KXJ A;  3L8R A;  4JEU B;  5JDF A;  2XAF B;  3W15 B;  2WM9 A;  4UEL A;  1IJ6 A;  5AQV B;  3ZT6 A;  2XJ7 A;  2LSG A;  1XNR T;  3BQK A;  4U2Z A;  4EXT A;  3UU4 A;  4DR4 T;  4ZS3 A;  3AEG A;  3UU5 A;  3ZMU B;  5A1L A;  4KUM B;  5FXZ A;  2UXN B;  4X1K E;  3K3N A;  2Q9Q D;  3EHZ A;  3IA3 A;  4QKN A;  2VUR A;  3LK2 B;  2UXD T;  4HFD A;  3TKL B;  4IST A;  4TWD A;  4DBR A;  3SOL A;  1HNX T;  3CQG B;  3AAE B;  5LG4 A;  5JR9 C;  1W09 A;  1VCS A;  2VVN A;  3SWH A;  1NWM X;  4EIW A;  4PJM A;  3AA0 B;  3N9M A;  4COF A;  2LOS A;  3RHW A;  1MND A;  2NOX A;  4KBM B;  5ADX L;  4TWF A;  3OJA A;  3AE9 A;  2D0T A;  3ZC0 A;  3QUJ A;  3SFE A;  3ANW B;  1IBM T;  2J1D G;  5AFU L;  5LHG B;  2XUE A;  1SA0 E;  4H9R C;  2ZM8 A;  5J2U E;  4LFA T;  4O4L E;  3UFG A;  5EZY E;  2BG9 C;  4A97 A;  2LKH A;  3EVY A;  3J9X 1;  3ANW A;  4EOZ B;  4HWC A;  5CJ5 A;  5KDM C;  3C51 A;  3RGL A;  4OYJ A;  2WDR A;  2X51 A;  4U74 A;  2KZ7 B;  3AE7 A;  5ABG A;  3RYC E;  3CQC B;  3UTK A;  4U7I A;  3GN5 B;  4MBQ A;  4JUY A;  3RRC A;  4DUY T;  5HEG A;  3ZST A;  5LGT B;  2J47 A;  4EYY R;  1IBL T;  4YSZ A;  4DR7 T;  5AQL B;  2JPF A;  3FZK B;  1BR0 A;  3HL6 A;  2C0S A;  4HFE A;  2EHO A;  2FJA A;  5AQJ B;  2KWH A;  4DV7 T;  4WW0 A;  3UU3 A;  1S94 A;  2A9U A;  4O2A E;  4JI4 T;  1J5W A;  1I6Z A;  3ETV A;  4GK5 E;  4DR5 T;  2HPL A;  4I43 B;  2ZMA A;  2B76 A;  3QC9 A;  2DNX A;  2XM1 A;  2QGS A;  3C98 B;  4GIW A;  1NEN A;  3N5L A;  3RKO A;  3D0T A;  2NTY A;  4F8H A;  3I9Y A;  4KI0 F;  4DID B;  2ZLY A;  3BQL A;  1XDO A;  3AAI A;  2LRL A;  3EAM A;  1W0A A;  4IDZ A;  4X20 E;  3TLS A;  3NZQ A;  4U31 A;  1UUR A;  3QOF A;  3UUM A;  2AXD S;  5GON E;  4Z8X A;  2I6H A;  3HKC E;  4FI5 A;  4PJJ A;  2WBL A;  3LG7 A;  3AEF A;  5HWY A;  4Q25 A;  2WZH A;  1L0V A;  2FJB A;  2XY8 B;  3MZK B;  5FL1 A;  1WR6 A;  2RP4 A;  3ONL C;  2MAW A;  2YOE A;  2VKO A;  4JI5 T;  3U78 A;  2L3L A;  5AQT B;  3T1Y T;  5AQR B;  1HNZ T;  3P4W A;  4MHC A;  5LHI B;  2YIN A;  2OA5 A;  3CK6 A;  4UXN B;  4IE5 A;  2WY2 A;  1YQ4 A;  3L3P A;  3UQ7 A;  3QK6 A;  4AXP A;  2VWA A;  4IE0 A;  4B6X A;  3AE5 A;  3HKB E;  3JAD A;  1G73 A;  2XQY A;  4B3R T;  4ZS2 A;  2HPJ A;  3I0O A;  4U7Y A;  2Q9Q B;  3BK9 A;  5AQO B;  2C5I T;  3B13 A;  2E9X B;  2W2U A;  3FBL A;  4LFC T;  5DQV A;  3ZYK A;  2ZM0 A;  5LG3 A;  2DHR A;  2YEV C;  3KV9 A;  5LBQ B;  1MMG A;  4QH5 A;  3JC6 D;  3BQI A;  2Q9Q A;  3RLF F;  1QSD A;  4OFZ A;  4YTN A;  4UV8 B;  4LFB T;  2R6G F;  5C8Y E;  4L9I A;  4H9P C;  2D5U A;  1ZOY A;  4UF0 B;  5F8P A;  2NWB A;  2SPC A;  5FXX A;  4IDP A;  5HXH A;  1T98 A;  2X9Y A;  4XZC A;  2MBG A;  4IHJ E;  4CN1 A;  2M6I A;  2A72 A;  4OHF A;  4DV4 T;  3RRW A;  1HTJ F;  2LKG A;  2ODV A;  1VOM A;  1KFY A;  3Q5D A;  3GA8 A;  4YLH A;  1YW0 A;  4MAL A;  4UV9 B;  4JYA T;  5L47 A;  2V26 A;  4PAG A;  4CI2 B;  2VQF T;  2YU1 A;  2G0U A;  4ERR A;  4YHH T;  1ZHC A;  3KV5 A;  4DV3 T;  3N9O A;  2YU2 A;  2N9D A;  4WBN E;  4JBW F;  1OED C;  3EDU A;  5C2T A; 
#chains in the Genus database with same CATH homology
 4X64 T;  4B3M T;  4B3R T;  4LFA T;  2HHH T;  4NXN T;  4AQY T;  1N32 T;  3OTO T;  4LFC T;  4DV6 T;  4JI1 T;  1XMO T;  2VQE T;  5IWA T;  4DV0 T;  1XNR T;  4JI2 T;  5BR8 T;  4DR2 T;  1XMQ T;  4X65 T;  4JI8 T;  1FJG T;  4DR4 T;  1HNW T;  4DV5 T;  1N36 T;  4LFB T;  4X66 T;  4JV5 T;  4DUY T;  1N34 T;  4LF8 T;  2UUC T;  5LMU T;  1IBL T;  4LF4 T;  4DR7 T;  1HR0 T;  2ZM6 T;  4GKJ T;  4LF5 T;  2UXD T;  4JI0 T;  2UXB T;  4B3S T;  4LF6 T;  4DV1 T;  3T1H T;  2F4V T;  4DV7 T;  4DV4 T;  1HNX T;  4JI6 T;  2UUB T;  4NXM T;  1I94 T;  4K0K T;  4KHP T;  4DUZ T;  4JI5 T;  4DR3 T;  1J5E T;  2UXC T;  1XNQ T;  4DR1 T;  4DR6 T;  4JYA T;  1N33 T;  3T1Y T;  4JI4 T;  4LF9 T;  2VQF T;  1HNZ T;  2UUA T;  1IBK T;  4YY3 T;  4JI7 T;  4DR5 T;  4JI3 T;  2E5L T;  4GKK T;  4YHH T;  4DV2 T;  4DV3 T;  4OX9 T;  4X62 T;  4B3T T;  4LF7 T;  2UU9 T;  1IBM T;  5LMN T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...