4JI6T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji6T00
2UXCT 4B3MT 4YY3T 1IBMT 1XNQT 4JI4T 4DR7T 4KHPT 1XMOT 4DR2T 1N36T 4X62T 1J5ET 4DV2T 4DV1T 2UXBT 1HNZT 4YHHT 4LFCT 5LMNT 5BR8T 4GKKT 2VQFT 2VQET 1N34T 4LF5T 2ZM6T 4LFAT 4X64T 1I94T 4LF9T 2UU9T 4LFBT 1N32T 4LF7T 1FJGT 4JI0T 4DV6T 2UUAT 4NXNT 4DV0T 5IWAT 1IBKT 3OTOT 4DV4T 2UUBT 4B3TT 2UUCT 4LF4T 4DV7T 4AQYT 2UXDT 4JI6T 4DR1T 4DUYT 4DR3T 5LMUT 4JI7T 4JYAT 4DV3T 4K0KT 4OX9T 1HR0T 2F4VT 4B3RT 4X66T 4DR4T 1HNWT 4JI3T 4JI8T 4JI5T 4DUZT 4GKJT 4B3ST 4DR6T 4LF8T 4DR5T 4NXMT 2E5LT 1IBLT 1XNRT 3T1YT 4JV5T 1XMQT 4JI2T 1N33T 4DV5T 1HNXT 2HHHT 3T1HT 4X65T 4LF6T 4JI1T
chains in the Genus database with same CATH superfamily
4NUVA 4PFOA 3RRWA 4ZI2C 1KEYA 3LFMA 4UVAB 1IJ5A 3PV0F 1CHUA 4YSYA 1YKEB 4ASKA 2H3RA 3B13A 1GQEA 2FUPA 4U33A 2XM1A 5FP3A 1E2AA 2CHNA 1M7KA 5LXTE 4P0AA 3P8CD 3RF1A 4G2AA 2YK0A 1B7TA 2SPCA 3K3OA 1XMOT 5LOVE 3FZHB 4IE6A 1NEKA 4UXNB 4ISTA 4P09A 4TUYE 1WR0A 4H9PC 1KFYA 2V7JA 3VKGA 3AA1B 1H7CA 2YDSA 3KV4A 2E9XB 5LG3A 2CLYC 2LJLA 1Y01A 2KINB 4KMCA 4I0UA 4X1YE 4YHHT 3UT5E 4DIDB 1I6ZA 3AB3B 4PFPA 2WWVA 2E9XA 3HKDE 4PNIA 1FMWA 4QXHB 2JIWA 5L2LA 2XQ7A 3CK6A 1IAPA 2E5VA 2E9XC 1WCRA 5A1LA 4ISSA 3TLSA 3QC9A 2KWHA 4TNWA 3UUXB 1YD8G 2XHEB 3UQ4A 3UTKA 4ZXLA 3GWHA 5DABA 4EYYR 3P4SA 3FB2A 4OYJA 4YTNA 4QX8B 3RPUA 4TX5A 3ZN0B 3ZMZB 3QB5K 2JMKA 4HWFA 2ACXA 2LKGA 4LFAT 3RRCA 2JMHA 2C0SA 3H37A 4IDPA 5AQTB 3R6NA 2FJAA 3ZT5A 3EHZA 4IT4A 4F6RC 2VL0A 4FJOA 1JNRA 5AQSB 2XSAA 3N5LA 4H9RC 2FJEA 3NRXA 5CJ5A 2RA1A 3ETVA 5KX5E 3O9XA 3I9WA 2J47A 4LF7T 4FI5A 3KFWX 3PUSA 3ETUA 3RI5A 2CE7A 3ZEFB 4WNKA 3UU3A 1U5PA 2XQ5A 3AE5A 4DV6T 2V7KA 1IBKT 4HFVA 3OTOT 2UUBT 4B3TT 1UCUA 3MZKB 3OPCA 5CB4E 3AVRA 4IDOA 5J2UE 2CMRA 1D1AA 4DV7T 3A5XA 1W9RA 3SS1A 3RIAA 1D0XA 2LLYA 2XAHB 2ACZA 1J5WA 5FVKA 2CA5A 2M6IA 2V1DB 5L3BB 2WU5A 2BBHA 5AQPB 5HEGA 2KSRA 2X0YA 3AAAB 3L3PA 1LVFA 2LOPA 2BVLA 2XSBA 3C4WA 4DV3T 1WYCA 4IL9A 4OX9T 4IDNA 1S94A 2J4GA 4TWDA 5JR9A 3N9NA 1ZV4X 3GA8A 3L8RA 4WYVA 2KWIB 4PJNA 4IE7A 2CBJA 2CXFA 3J9X1 4YTPA 2DWGA 2PJQA 3UUNA 4ILCA 2PFVA 3AVSA 3AE1A 5JH7E 2ES0A 2LSIA 4H9SE 3FXEB 4QH1A 4ZOLE 4X1IE 3PUAA 4EV6A 1T8BA 1X9BA 2IMLA 3ZLIA 3Q9DA 3WAKA 3IHRA 5L3FB 3RQUA 3ZYKA 3RIFA 2NOXA 5ABFA 4GOUA 3KVBA 3F31A 3C4ZA 4HWDA 2XY8B 3FZLB 2M67A 1LKXA 2YKSA 3LG7A 5LGUB 3AE7A 4OK0A 2XUEA 4MLKA 3ONLC 4GYRA 4HE8A 1J1JA 2BS3A 2D5UA 2XQAA 1D0ZA 1SUMB 4ZS3A 5LBQB 2CHOA 5FNVE 4LF8T 2E5LT 1IBLT 1ZOYA 3ZC1A 5LHIB 1XNRT 1KNRA 3UU8A 4JV5T 3N9QA 1G8XA 3TLVA 2CRBA 3RKGA 2Y48B 2MTQA 1KNZA 4HFBA 4IDZA 2EHOA 2E2AA 2G0UA 2JQ9A 2Q9QA 3IF8B 2V8SV 5FVLA 3I1AA 5ABGA 1HNXT 3VHLA 3AE4A 4HFDA 2IC9A 2JQHA 3R84B 3ZSTA 4QHOA 5FMNA 3EDUA 4CN4A 3CWZB 2W61A 3OYXA 3E22E 4O8SA 3QK6A 4AISA 3MJXA 2A9UA 2WM9A 2OA5A 2ZLYA 4KI0F 3EUHA 2A3DA 4DVDA 4EIWA 2V6YB 1FIOA 4TNVA 4ZZBA 2UXCT 2FJDA 1QUUA 5L3GB 2WU2A 3AAEB 2XAFB 1IBMT 1XNQT 3JCFA 2VKJA 4HFEA 3CQXC 4IIJE 2CPTA 3ANWA 3CPZA 4KHPT 1HX8A 3KV9A 3PUXF 3UU4A 4C91A 4HN9A 3HKCE 1N36T 1OWAA 1Y64B 3Q5WA 1J5ET 4UVBB 2LKHA 3ESLA 4DV2T 2UXBT 2H7VC 2LM2A 1BR2A 2XZEA 2WQYA 2DLRA 5JDLA 4M1PA 3C64A 5JR9B 4U2ZA 3N2OA 1MMGA 2NTYA 3AEGA 3FBZA 2DWKA 4IHJE 5AQKB 1O3XA 2Y6XA 3AECA 4TN7B 4TZ4C 4DMWA 4PJMA 5L3EB 4LFCT 3RKOA 2XQYA 4TWHA 3ZCIA 2QA7A 3K1SA 4IE0A 3ZYMA 2K48A 5JDQA 1YW0A 3RQWA 4AIUA 3ZCJA 4H9QC 4CZZB 2BG9B 5HWYA 3NKZA 2ZM2A 4YHJA 5LNKA 4AKIA 4O4HE 3L39A 2JQQA 2X9XA 3KDSE 3PDYA 2VKOA 2WY2A 5LA6E 1W0BA 2WZHA 5AQQB 4DNDA 5J1GA 4LF5T 3HI2A 3DTOA 5AQIB 3RHWA 5LG4A 5IYZE 2MBGA 5HXSA 4BA9A 1VOMA 3N9MA 1I94T 2UXXB 1NENA 3VRBA 2VVNA 5J0ZA 4LF9T 1M62A 3FHNA 2NW8A 4JLEA 4XZCA 2K5BB 1HTJF 2LM9A 2V5CA 5LB7B 3J7Yq 2EHOC 5IUXA 1FJGT 3TKLB 3ZMVB 2ZM8A 4OFZA 2I0MA 4CXWA 4K0UA 3GMIA 3AXJA 3PUYF 5F5WA 2LSJA 2JJ9A 4LF4T 1OEDB 3UUBA 4JUYA 1XWMA 4WBNE 4JEUB 3UU5A 5C3JA 2CWOA 5IHYA 1NWMX 4H9OC 2XQ9A 2H89A 2LT3A 4CI1B 4U7YA 5LP6E 1KF6A 2HH7A 4CXXA 1G73A 3CQGB 2UXDT 4IREA 4LMLA 4DUYT 4QH5A 4ZHQE 3HKEE 2MPKA 3Q5EA 3AXJB 4HFHA 2WDQA 2Q9QC 4A56A 4DR3T 3N2GE 3CX8B 2CM0A 4JI7T 5DJQC 3HR0A 4GIWA 3K3QC 4IE5A 4GYSA 4PK5A 4EEBA 3JAFA 4A97A 4PK4A 2W2UA 2R6GF 3PJAJ 2XTLA 4HFIA 4MHCA 4DBRA 4Q25A 4E7ZA 2F4VT 1NAFA 5GONE 5LCYA 5LJNA 2QVAA 4B3RT 3HL6A 3WAJA 2DCFA 4ZI3D 1W09A 4X5TA 3QOFA 4CI2B 3AEEA 5HEJA 2DI4A 3Q2MA 4UR9A 2XPKA 3AEDA 5AQJB 2C5IT 1HG5A 5HEUA 5JDHA 3VR8A 1HNWT 4I4TE 3F2EA 2ZMAA 4I50E 2BVMA 4C90A 4YXDA 1YKHB 4JI3T 2A72A 2CCQA 2CLYB 3RH3A 4H63H 3ZJ1A 2D0TA 3TLTA 1OXZA 1U4QA 4ILUA 4JI5T 2X9HA 3N2KE 5ETWA 4CI3B 3KV5A 4U74A 2W67A 3LK3B 3DJBA 3EDVA 2ZM0A 1MMNA 2VWAA 1DU2A 1HS7A 5J2TE 3VU7H 4WBOA 3PUVF 5CGMA 1MNEA 5E0OA 3FZFB 3T1YT 2CXDA 2JQKA 2HN2A 1VRBA 2N1GA 2YOEA 3CIRA 3BQIA 3RLFF 4O2AE 3ZMUB 3ZT7A 2I6HA 1XMQT 4DBQA 4ZI3C 4O2BE 3P4WA 5JTGA 4EOZB 5CA0E 1KK7A 2EHOD 3OJAA 4ILBA 5L4HA 4UEMA 4LMJA 1VCSA 4COFA 4CN1A 3HKBE 2BKOA 1QLBA 2NWBA 1OEDC 2WCAA 4LMKA 5KXJA 5AQOB 4YY3T 3RC3A 1L0VA 3UFEA 3RC8A 4UF0B 5C8YE 4YJ3E 4JI4T 4AKRB 2DL1A 3A8YC 4U31A 4DR7T 4UV9B 1HCIA 2H88A 5HEOA 3U78A 3O1IA 2EHOB 2QRXA 2LOSA 3JAEA 2LRLA 4AKLA 4X62T 4MFRA 4JBWF 3UULA 5FL1A 3JC6C 2W62A 4L0RA 5AQRB 1MMDA 5LBMA 3SWHA 3ZT6A 1HNZT 3KBTA 3BK9A 1MMAA 1LRZA 5CFBA 3U3IA 2ODVA 4G63A 2WBLA 1HG2A 2E9XD 4B6XA 2FJBA 2HPJA 2OLTA 2YDRA 3T8OA 2KT9A 5LMNT 2LSKA 2LHRA 2V6XA 2I59A 2YU2A 4O4JE 1BR1A 4PW8A 2BS2A 5BR8T 2YU1A 4GKKT 3WI3A 4NUUA 4H63V 2VQET 2BG9E 2BKPA 2BS4A 3LK2B 2XQ4A 2Y8DA 3C4XA 4MALA 2D0UA 3MACA 2IHR1 3GN5A 4Z91A 3CX6B 5AQNB 2K9AA 1OEDA 2L8KA 1JNZA 5L47A 2V26A 3EI0A 4EEDA 2ZM6T 2Q9QD 2L9QA 4EXTA 5FYMA 2DNXA 5BMVE 4X64T 5CA1E 5ABEA 2PTFA 2W63A 3EAMA 2IAKA 4QKNA 4KBMB 4YFSA 1BR4A 5HXHA 3UFGA 3HA4A 4QXBB 2PG8A 4CXYA 4LFBT 4DO0A 1WYBA 1WRDA 4QWNB 2IW5B 1S35A 2KZ7B 2CXLA 3LBXA 3AE2A 3V5UA 5F3JA 4JI0T 5FXWA 5JDGA 3A7MA 4JI2T 4WZXA 3ZMTB 5IWAT 2UUAT 2LRKA 3K3NA 5EK4A 4P1NA 4DV4T 4NXNT 3PUGA 5LHGB 3H3MA 4V1Av 3H3AA 4YJ2E 3LSVA 2GK9A 3M3ZB 5FXVA 2W66A 3ZKRA 4YT0A 4U7IA 2IIUA 2BG9A 4B3MT 4EB6E 3CVRA 2KMFA 2XQ6A 3FZKB 4F8HA 4DR1T 4JI6T 1AJ3A 4TV9E 2ODUA 4HWCA 3ANWB 2FBWA 5HXCA 2N9DA 1MNDA 1FMVA 1D1CA 1V9DA 3ABVA 3FZMB 3AA7B 3AEBA 4ERRA 3SFEA 4EYUA 4YSZA 4AXPA 4JYAT 4ZEYA 1XZYA 4YSXA 2V6YA 3LK42 2NR4A 3F57A 5DQWA 1ZP0A 2LHNA 3KV6A 2N2NA 2NW9A 3OYZA 5JDFA 1KNPA 1WFDA 2VURA 3AAIA 2WWUA 3QUJA 4A98A 3B57A 1SHZC 4ZZCA 5LYJE 2X0LB 4KX6A 3D0TA 4WW0A 3ZJ2A 3FXDB 3G06A 3QB5A 4HWHA 4KHZF 3IBPA 3N9OA 4GK0E 3AEAA 4KUMB 4A5XA 3SFDA 3Q5DA 2CWYA 4AKGA 2XJ7A 5LHHB 5AQMB 4PJLA 2V7MA 3N9PA 3O4XE 4TV8E 5HXEA 4DUZT 3RGLA 2WP9A 4BAYB 5AQFB 4E7SA 4AI6A 3PU8A 3P7IA 1D1BA 2V7IA 2HPLA 2D9DA 3P4RA 3UUMA 3RYCE 3UQ7A 3I9YA 2VKDA 5H6QB 2Q9QB 2X9WA 4IDQA 5HEHA 3RX6A 4AKHA 1EZ3A 1X79A 2KNDA 2UXNB 5HCMA 5L3CB 2XAJB 3UU6A 3DP7A 5HAXA 2J62A 2QGSA 2XM2A 5ABFB 2V5DA 4X1KE 2YDQA 2VK9A 3BQLA 3EABA 5FY0A 2IDOB 4CQIA 2KLQA 3AE6A 4NPPA 1ZKEA 2VVSA 2YN6A 1E1HB 3VR9A 2NW7A 3ZMSB 3ZYLA 4U72A 2A2FX 5EZYE 5HYAA 3T1HT 2IUBA 5FL0A 5KMGP 5HXRA 2WDRA 3FBLA 2X0HA 4IGUA 3TLWA 3VRAA 5DQVA 3ZPOA 5JDNA 2BBJA 4EZHA 4LF6T 1T98A 1D0YA 1HF8A 1UX5A 4ZI7E 5C2TA 4JI1T 4K0KT 3X1DA 2XQ3A 1ZHCA 1UUSA 2MOZA 3JADA 3N9LA 4J2CA 2DHRA 3LDQB 4MBQA 5AQGB 2JRKA 1IJ6A 2CEAA 1XDOA 4NIQA 1UK5A 5AQHB 4HKAA 5TAOA 2WSSV 5L4EA 4AQGA 1YQ3A 4DR2T 3MKDA 3PTRB 4PK6A 3IA3A 3PJAA 2C5KT 1SA0E 1CUNA 2MAWA 1HFAA 2WZIA 2Z6EA 1UGOA 3KVAA 4DV1T 3OBVE 4H9NC 4UVCB 3RYHE 2BG9C 4ILAA 1WLXA 4IE4A 2L3LA 4HFCA 4JEHB 3OKQA 2HN1A 4Z90A 2X9YA 2RPAA 5JRCB 4O4IE 3C50A 1LVKA 2WS3A 3NRYA 5FY1A 2VL8A 3PUQA 2K24A 2W0GA 2WMOA 3AE8A 4EZ4A 4AQFC 4XAXB 2OV9A 3QNUA 4QX7B 5L3DB 2VQFT 4ZI2D 2VKHA 5LGTB 3OVUA 4YLHA 3ONXA 4IL4A 4L9IA 3VKHA 5AFUL 2NTXA 4I43B 2E8IA 3C51A 1US7B 3MA9A 4P0BA 4ZS2A 1N34T 3IEEA 5JQGE 1YXRA 3P4QA 1YQ4A 2X67A 2P9BA 3TLUA 3RIUA 3SOLA 4EGWA 3P4PA 3Q5XA 2WB5A 5HCJA 2LE8A 3PU3A 4PJJA 5HWXA 2UU9T 2XAGB 3AA0B 3LJCA 1MIVA 1ZEEA 1OEDE 1N32T 3NBXX 2B76A 1MIYA 2D2SA 4CN6A 3CKDA 3CQCB 3KINB 4DMVA 5FKYA 1UURA 1BR0A 3AEFA 3I0OA 5FXXA 5JDMA 4DV0T 1SE7A 5EK2A 2LSGA 2UUCT 4KP3C 1WR6A 2XAQB 1W0AA 3GN5B 2B1EA 3PURA 2VASA 4TWFA 3RYFE 4ANJA 4AQFA 4EAHA 4AQYT 2V7LA 4QH4A 3O1HA 2LSYA 2AE9A 1UX4A 3AE3A 3M65A 2XASB 4O4LE 5AQLB 5FXZA 4BJMA 4PAGA 2H7OA 3E0ZA 3RYIE 3BQKA 2RP4A 4YTMA 3C98B 1Z8UA 5LMUT 3NWIA 2X51A 4UF0A 3AA6B 2J1DG 3E08A 5EK3A 3NZPA 5H6RB 1HR0T 3JC6D 3O1JA 2M6BA 5FY7A 4X65T 2BKNA 5AQUB 4X66T 2IC6A 1Z0PA 3L09A 5LJMA 2VB6A 2X66A 5LGNB 1HX1B 1T72A 3I0QA 5M4YA 4DR4T 2W00A 2AXDS 4I55E 3ZN1B 3SRZA 2WMNA 2X68A 1VCTA 2BZBA 3P50A 2WAUA 3S4UA 1R8IA 2CBIA 4JI8T 1FEWA 3NVOA 5F8PA 4N78D 4U2YA 2XQ8A 1MIWA 4HEAA 1XDPA 2MYSA 3W15B 4ADZA 4HGAA 4HWIB 4L5GA 3NZQA 4GKJT 2WDVA 1IZNB 2K3WA 2KXPB 2W4XA 3RIUC 4HTEA 4B3ST 4BJNA 3ZC0A 5JRCA 1T7SA 4DR6T 4GK5E 5ADXL 5JR9C 4DR5T 3PUWF 4X20E 4NXMT 3KBUA 5JVDE 1QSDA 3V5SA 3CX7B 2LEHA 2JPFA 3PUZF 2QYWA 4QXCB 3MXZA 4UV8B 5JREA 2PBIA 1E7PA 4Z8XA 3MK7C 2YINA 2YEVC 4OYKA 5KDMC 1N33T 3AE9A 4XBFB 2BDEA 4UELA 3ZSSA 4U3CA 4DV5T 5ABHA 4UIGA 2HHHT 3B5MA 3LBXB 3PE0A 3CMLA 4OHFA 2NP9A 3ONJA 3EVYA 3K8PC 2C5JA 5AQVB
chains in the Genus database with same CATH topology
2UXCT 4B3MT 4YY3T 1IBMT 1XNQT 4JI4T 4DR7T 4KHPT 1XMOT 4DR2T 1N36T 4X62T 1J5ET 4DV2T 4DV1T 2UXBT 1HNZT 4YHHT 4LFCT 5LMNT 5BR8T 4GKKT 2VQFT 2VQET 1N34T 4LF5T 2ZM6T 4LFAT 4X64T 1I94T 4LF9T 2UU9T 4LFBT 1N32T 4LF7T 1FJGT 4JI0T 4DV6T 2UUAT 4NXNT 4DV0T 5IWAT 1IBKT 3OTOT 4DV4T 2UUBT 4B3TT 2UUCT 4LF4T 4DV7T 4AQYT 2UXDT 4JI6T 4DR1T 4DUYT 4DR3T 5LMUT 4JI7T 4JYAT 4DV3T 4K0KT 4OX9T 1HR0T 2F4VT 4B3RT 4X66T 4DR4T 1HNWT 4JI3T 4JI8T 4JI5T 4DUZT 4GKJT 4B3ST 4DR6T 4LF8T 4DR5T 4NXMT 2E5LT 1IBLT 1XNRT 3T1YT 4JV5T 1XMQT 4JI2T 1N33T 4DV5T 1HNXT 2HHHT 3T1HT 4X65T 4LF6T 4JI1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC T;  4B3M T;  4YY3 T;  1IBM T;  1XNQ T;  4JI4 T;  4DR7 T;  4KHP T;  1XMO T;  4DR2 T;  1N36 T;  4X62 T;  1J5E T;  4DV2 T;  4DV1 T;  2UXB T;  1HNZ T;  4YHH T;  4LFC T;  5LMN T;  5BR8 T;  4GKK T;  2VQF T;  2VQE T;  1N34 T;  4LF5 T;  2ZM6 T;  4LFA T;  4X64 T;  1I94 T;  4LF9 T;  2UU9 T;  4LFB T;  1N32 T;  4LF7 T;  1FJG T;  4JI0 T;  4DV6 T;  2UUA T;  4NXN T;  4DV0 T;  5IWA T;  1IBK T;  3OTO T;  4DV4 T;  2UUB T;  4B3T T;  2UUC T;  4LF4 T;  4DV7 T;  4AQY T;  2UXD T;  4JI6 T;  4DR1 T;  4DUY T;  4DR3 T;  5LMU T;  4JI7 T;  4JYA T;  4DV3 T;  4K0K T;  4OX9 T;  1HR0 T;  2F4V T;  4B3R T;  4X66 T;  4DR4 T;  1HNW T;  4JI3 T;  4JI8 T;  4JI5 T;  4DUZ T;  4GKJ T;  4B3S T;  4DR6 T;  4LF8 T;  4DR5 T;  4NXM T;  2E5L T;  1IBL T;  1XNR T;  3T1Y T;  4JV5 T;  1XMQ T;  4JI2 T;  1N33 T;  4DV5 T;  1HNX T;  2HHH T;  3T1H T;  4X65 T;  4LF6 T;  4JI1 T; 
#chains in the Genus database with same CATH topology
 4NUV A;  4PFO A;  3RRW A;  4ZI2 C;  1KEY A;  3LFM A;  4UVA B;  1IJ5 A;  3PV0 F;  1CHU A;  4YSY A;  1YKE B;  4ASK A;  2H3R A;  3B13 A;  1GQE A;  2FUP A;  4U33 A;  2XM1 A;  5FP3 A;  1E2A A;  2CHN A;  1M7K A;  5LXT E;  4P0A A;  3P8C D;  3RF1 A;  4G2A A;  2YK0 A;  1B7T A;  2SPC A;  3K3O A;  1XMO T;  5LOV E;  3FZH B;  4IE6 A;  1NEK A;  4UXN B;  4IST A;  4P09 A;  4TUY E;  1WR0 A;  4H9P C;  1KFY A;  2V7J A;  3VKG A;  3AA1 B;  1H7C A;  2YDS A;  3KV4 A;  2E9X B;  5LG3 A;  2CLY C;  2LJL A;  1Y01 A;  2KIN B;  4KMC A;  4I0U A;  4X1Y E;  4YHH T;  3UT5 E;  4DID B;  1I6Z A;  3AB3 B;  4PFP A;  2WWV A;  2E9X A;  3HKD E;  4PNI A;  1FMW A;  4QXH B;  2JIW A;  5L2L A;  2XQ7 A;  3CK6 A;  1IAP A;  2E5V A;  2E9X C;  1WCR A;  5A1L A;  4ISS A;  3TLS A;  3QC9 A;  2KWH A;  4TNW A;  3UUX B;  1YD8 G;  2XHE B;  3UQ4 A;  3UTK A;  4ZXL A;  3GWH A;  5DAB A;  4EYY R;  3P4S A;  3FB2 A;  4OYJ A;  4YTN A;  4QX8 B;  3RPU A;  4TX5 A;  3ZN0 B;  3ZMZ B;  3QB5 K;  2JMK A;  4HWF A;  2ACX A;  2LKG A;  4LFA T;  3RRC A;  2JMH A;  2C0S A;  3H37 A;  4IDP A;  5AQT B;  3R6N A;  2FJA A;  3ZT5 A;  3EHZ A;  4IT4 A;  4F6R C;  2VL0 A;  4FJO A;  1JNR A;  5AQS B;  2XSA A;  3N5L A;  4H9R C;  2FJE A;  3NRX A;  5CJ5 A;  2RA1 A;  3ETV A;  5KX5 E;  3O9X A;  3I9W A;  2J47 A;  4LF7 T;  4FI5 A;  3KFW X;  3PUS A;  3ETU A;  3RI5 A;  2CE7 A;  3ZEF B;  4WNK A;  3UU3 A;  1U5P A;  2XQ5 A;  3AE5 A;  4DV6 T;  2V7K A;  1IBK T;  4HFV A;  3OTO T;  2UUB T;  4B3T T;  1UCU A;  3MZK B;  3OPC A;  5CB4 E;  3AVR A;  4IDO A;  5J2U E;  2CMR A;  1D1A A;  4DV7 T;  3A5X A;  1W9R A;  3SS1 A;  3RIA A;  1D0X A;  2LLY A;  2XAH B;  2ACZ A;  1J5W A;  5FVK A;  2CA5 A;  2M6I A;  2V1D B;  5L3B B;  2WU5 A;  2BBH A;  5AQP B;  5HEG A;  2KSR A;  2X0Y A;  3AAA B;  3L3P A;  1LVF A;  2LOP A;  2BVL A;  2XSB A;  3C4W A;  4DV3 T;  1WYC A;  4IL9 A;  4OX9 T;  4IDN A;  1S94 A;  2J4G A;  4TWD A;  5JR9 A;  3N9N A;  1ZV4 X;  3GA8 A;  3L8R A;  4WYV A;  2KWI B;  4PJN A;  4IE7 A;  2CBJ A;  2CXF A;  3J9X 1;  4YTP A;  2DWG A;  2PJQ A;  3UUN A;  4ILC A;  2PFV A;  3AVS A;  3AE1 A;  5JH7 E;  2ES0 A;  2LSI A;  4H9S E;  3FXE B;  4QH1 A;  4ZOL E;  4X1I E;  3PUA A;  4EV6 A;  1T8B A;  1X9B A;  2IML A;  3ZLI A;  3Q9D A;  3WAK A;  3IHR A;  5L3F B;  3RQU A;  3ZYK A;  3RIF A;  2NOX A;  5ABF A;  4GOU A;  3KVB A;  3F31 A;  3C4Z A;  4HWD A;  2XY8 B;  3FZL B;  2M67 A;  1LKX A;  2YKS A;  3LG7 A;  5LGU B;  3AE7 A;  4OK0 A;  2XUE A;  4MLK A;  3ONL C;  4GYR A;  4HE8 A;  1J1J A;  2BS3 A;  2D5U A;  2XQA A;  1D0Z A;  1SUM B;  4ZS3 A;  5LBQ B;  2CHO A;  5FNV E;  4LF8 T;  2E5L T;  1IBL T;  1ZOY A;  3ZC1 A;  5LHI B;  1XNR T;  1KNR A;  3UU8 A;  4JV5 T;  3N9Q A;  1G8X A;  3TLV A;  2CRB A;  3RKG A;  2Y48 B;  2MTQ A;  1KNZ A;  4HFB A;  4IDZ A;  2EHO A;  2E2A A;  2G0U A;  2JQ9 A;  2Q9Q A;  3IF8 B;  2V8S V;  5FVL A;  3I1A A;  5ABG A;  1HNX T;  3VHL A;  3AE4 A;  4HFD A;  2IC9 A;  2JQH A;  3R84 B;  3ZST A;  4QHO A;  5FMN A;  3EDU A;  4CN4 A;  3CWZ B;  2W61 A;  3OYX A;  3E22 E;  4O8S A;  3QK6 A;  4AIS A;  3MJX A;  2A9U A;  2WM9 A;  2OA5 A;  2ZLY A;  4KI0 F;  3EUH A;  2A3D A;  4DVD A;  4EIW A;  2V6Y B;  1FIO A;  4TNV A;  4ZZB A;  2UXC T;  2FJD A;  1QUU A;  5L3G B;  2WU2 A;  3AAE B;  2XAF B;  1IBM T;  1XNQ T;  3JCF A;  2VKJ A;  4HFE A;  3CQX C;  4IIJ E;  2CPT A;  3ANW A;  3CPZ A;  4KHP T;  1HX8 A;  3KV9 A;  3PUX F;  3UU4 A;  4C91 A;  4HN9 A;  3HKC E;  1N36 T;  1OWA A;  1Y64 B;  3Q5W A;  1J5E T;  4UVB B;  2LKH A;  3ESL A;  4DV2 T;  2UXB T;  2H7V C;  2LM2 A;  1BR2 A;  2XZE A;  2WQY A;  2DLR A;  5JDL A;  4M1P A;  3C64 A;  5JR9 B;  4U2Z A;  3N2O A;  1MMG A;  2NTY A;  3AEG A;  3FBZ A;  2DWK A;  4IHJ E;  5AQK B;  1O3X A;  2Y6X A;  3AEC A;  4TN7 B;  4TZ4 C;  4DMW A;  4PJM A;  5L3E B;  4LFC T;  3RKO A;  2XQY A;  4TWH A;  3ZCI A;  2QA7 A;  3K1S A;  4IE0 A;  3ZYM A;  2K48 A;  5JDQ A;  1YW0 A;  3RQW A;  4AIU A;  3ZCJ A;  4H9Q C;  4CZZ B;  2BG9 B;  5HWY A;  3NKZ A;  2ZM2 A;  4YHJ A;  5LNK A;  4AKI A;  4O4H E;  3L39 A;  2JQQ A;  2X9X A;  3KDS E;  3PDY A;  2VKO A;  2WY2 A;  5LA6 E;  1W0B A;  2WZH A;  5AQQ B;  4DND A;  5J1G A;  4LF5 T;  3HI2 A;  3DTO A;  5AQI B;  3RHW A;  5LG4 A;  5IYZ E;  2MBG A;  5HXS A;  4BA9 A;  1VOM A;  3N9M A;  1I94 T;  2UXX B;  1NEN A;  3VRB A;  2VVN A;  5J0Z A;  4LF9 T;  1M62 A;  3FHN A;  2NW8 A;  4JLE A;  4XZC A;  2K5B B;  1HTJ F;  2LM9 A;  2V5C A;  5LB7 B;  3J7Y q;  2EHO C;  5IUX A;  1FJG T;  3TKL B;  3ZMV B;  2ZM8 A;  4OFZ A;  2I0M A;  4CXW A;  4K0U A;  3GMI A;  3AXJ A;  3PUY F;  5F5W A;  2LSJ A;  2JJ9 A;  4LF4 T;  1OED B;  3UUB A;  4JUY A;  1XWM A;  4WBN E;  4JEU B;  3UU5 A;  5C3J A;  2CWO A;  5IHY A;  1NWM X;  4H9O C;  2XQ9 A;  2H89 A;  2LT3 A;  4CI1 B;  4U7Y A;  5LP6 E;  1KF6 A;  2HH7 A;  4CXX A;  1G73 A;  3CQG B;  2UXD T;  4IRE A;  4LML A;  4DUY T;  4QH5 A;  4ZHQ E;  3HKE E;  2MPK A;  3Q5E A;  3AXJ B;  4HFH A;  2WDQ A;  2Q9Q C;  4A56 A;  4DR3 T;  3N2G E;  3CX8 B;  2CM0 A;  4JI7 T;  5DJQ C;  3HR0 A;  4GIW A;  3K3Q C;  4IE5 A;  4GYS A;  4PK5 A;  4EEB A;  3JAF A;  4A97 A;  4PK4 A;  2W2U A;  2R6G F;  3PJA J;  2XTL A;  4HFI A;  4MHC A;  4DBR A;  4Q25 A;  4E7Z A;  2F4V T;  1NAF A;  5GON E;  5LCY A;  5LJN A;  2QVA A;  4B3R T;  3HL6 A;  3WAJ A;  2DCF A;  4ZI3 D;  1W09 A;  4X5T A;  3QOF A;  4CI2 B;  3AEE A;  5HEJ A;  2DI4 A;  3Q2M A;  4UR9 A;  2XPK A;  3AED A;  5AQJ B;  2C5I T;  1HG5 A;  5HEU A;  5JDH A;  3VR8 A;  1HNW T;  4I4T E;  3F2E A;  2ZMA A;  4I50 E;  2BVM A;  4C90 A;  4YXD A;  1YKH B;  4JI3 T;  2A72 A;  2CCQ A;  2CLY B;  3RH3 A;  4H63 H;  3ZJ1 A;  2D0T A;  3TLT A;  1OXZ A;  1U4Q A;  4ILU A;  4JI5 T;  2X9H A;  3N2K E;  5ETW A;  4CI3 B;  3KV5 A;  4U74 A;  2W67 A;  3LK3 B;  3DJB A;  3EDV A;  2ZM0 A;  1MMN A;  2VWA A;  1DU2 A;  1HS7 A;  5J2T E;  3VU7 H;  4WBO A;  3PUV F;  5CGM A;  1MNE A;  5E0O A;  3FZF B;  3T1Y T;  2CXD A;  2JQK A;  2HN2 A;  1VRB A;  2N1G A;  2YOE A;  3CIR A;  3BQI A;  3RLF F;  4O2A E;  3ZMU B;  3ZT7 A;  2I6H A;  1XMQ T;  4DBQ A;  4ZI3 C;  4O2B E;  3P4W A;  5JTG A;  4EOZ B;  5CA0 E;  1KK7 A;  2EHO D;  3OJA A;  4ILB A;  5L4H A;  4UEM A;  4LMJ A;  1VCS A;  4COF A;  4CN1 A;  3HKB E;  2BKO A;  1QLB A;  2NWB A;  1OED C;  2WCA A;  4LMK A;  5KXJ A;  5AQO B;  4YY3 T;  3RC3 A;  1L0V A;  3UFE A;  3RC8 A;  4UF0 B;  5C8Y E;  4YJ3 E;  4JI4 T;  4AKR B;  2DL1 A;  3A8Y C;  4U31 A;  4DR7 T;  4UV9 B;  1HCI A;  2H88 A;  5HEO A;  3U78 A;  3O1I A;  2EHO B;  2QRX A;  2LOS A;  3JAE A;  2LRL A;  4AKL A;  4X62 T;  4MFR A;  4JBW F;  3UUL A;  5FL1 A;  3JC6 C;  2W62 A;  4L0R A;  5AQR B;  1MMD A;  5LBM A;  3SWH A;  3ZT6 A;  1HNZ T;  3KBT A;  3BK9 A;  1MMA A;  1LRZ A;  5CFB A;  3U3I A;  2ODV A;  4G63 A;  2WBL A;  1HG2 A;  2E9X D;  4B6X A;  2FJB A;  2HPJ A;  2OLT A;  2YDR A;  3T8O A;  2KT9 A;  5LMN T;  2LSK A;  2LHR A;  2V6X A;  2I59 A;  2YU2 A;  4O4J E;  1BR1 A;  4PW8 A;  2BS2 A;  5BR8 T;  2YU1 A;  4GKK T;  3WI3 A;  4NUU A;  4H63 V;  2VQE T;  2BG9 E;  2BKP A;  2BS4 A;  3LK2 B;  2XQ4 A;  2Y8D A;  3C4X A;  4MAL A;  2D0U A;  3MAC A;  2IHR 1;  3GN5 A;  4Z91 A;  3CX6 B;  5AQN B;  2K9A A;  1OED A;  2L8K A;  1JNZ A;  5L47 A;  2V26 A;  3EI0 A;  4EED A;  2ZM6 T;  2Q9Q D;  2L9Q A;  4EXT A;  5FYM A;  2DNX A;  5BMV E;  4X64 T;  5CA1 E;  5ABE A;  2PTF A;  2W63 A;  3EAM A;  2IAK A;  4QKN A;  4KBM B;  4YFS A;  1BR4 A;  5HXH A;  3UFG A;  3HA4 A;  4QXB B;  2PG8 A;  4CXY A;  4LFB T;  4DO0 A;  1WYB A;  1WRD A;  4QWN B;  2IW5 B;  1S35 A;  2KZ7 B;  2CXL A;  3LBX A;  3AE2 A;  3V5U A;  5F3J A;  4JI0 T;  5FXW A;  5JDG A;  3A7M A;  4JI2 T;  4WZX A;  3ZMT B;  5IWA T;  2UUA T;  2LRK A;  3K3N A;  5EK4 A;  4P1N A;  4DV4 T;  4NXN T;  3PUG A;  5LHG B;  3H3M A;  4V1A v;  3H3A A;  4YJ2 E;  3LSV A;  2GK9 A;  3M3Z B;  5FXV A;  2W66 A;  3ZKR A;  4YT0 A;  4U7I A;  2IIU A;  2BG9 A;  4B3M T;  4EB6 E;  3CVR A;  2KMF A;  2XQ6 A;  3FZK B;  4F8H A;  4DR1 T;  4JI6 T;  1AJ3 A;  4TV9 E;  2ODU A;  4HWC A;  3ANW B;  2FBW A;  5HXC A;  2N9D A;  1MND A;  1FMV A;  1D1C A;  1V9D A;  3ABV A;  3FZM B;  3AA7 B;  3AEB A;  4ERR A;  3SFE A;  4EYU A;  4YSZ A;  4AXP A;  4JYA T;  4ZEY A;  1XZY A;  4YSX A;  2V6Y A;  3LK4 2;  2NR4 A;  3F57 A;  5DQW A;  1ZP0 A;  2LHN A;  3KV6 A;  2N2N A;  2NW9 A;  3OYZ A;  5JDF A;  1KNP A;  1WFD A;  2VUR A;  3AAI A;  2WWU A;  3QUJ A;  4A98 A;  3B57 A;  1SHZ C;  4ZZC A;  5LYJ E;  2X0L B;  4KX6 A;  3D0T A;  4WW0 A;  3ZJ2 A;  3FXD B;  3G06 A;  3QB5 A;  4HWH A;  4KHZ F;  3IBP A;  3N9O A;  4GK0 E;  3AEA A;  4KUM B;  4A5X A;  3SFD A;  3Q5D A;  2CWY A;  4AKG A;  2XJ7 A;  5LHH B;  5AQM B;  4PJL A;  2V7M A;  3N9P A;  3O4X E;  4TV8 E;  5HXE A;  4DUZ T;  3RGL A;  2WP9 A;  4BAY B;  5AQF B;  4E7S A;  4AI6 A;  3PU8 A;  3P7I A;  1D1B A;  2V7I A;  2HPL A;  2D9D A;  3P4R A;  3UUM A;  3RYC E;  3UQ7 A;  3I9Y A;  2VKD A;  5H6Q B;  2Q9Q B;  2X9W A;  4IDQ A;  5HEH A;  3RX6 A;  4AKH A;  1EZ3 A;  1X79 A;  2KND A;  2UXN B;  5HCM A;  5L3C B;  2XAJ B;  3UU6 A;  3DP7 A;  5HAX A;  2J62 A;  2QGS A;  2XM2 A;  5ABF B;  2V5D A;  4X1K E;  2YDQ A;  2VK9 A;  3BQL A;  3EAB A;  5FY0 A;  2IDO B;  4CQI A;  2KLQ A;  3AE6 A;  4NPP A;  1ZKE A;  2VVS A;  2YN6 A;  1E1H B;  3VR9 A;  2NW7 A;  3ZMS B;  3ZYL A;  4U72 A;  2A2F X;  5EZY E;  5HYA A;  3T1H T;  2IUB A;  5FL0 A;  5KMG P;  5HXR A;  2WDR A;  3FBL A;  2X0H A;  4IGU A;  3TLW A;  3VRA A;  5DQV A;  3ZPO A;  5JDN A;  2BBJ A;  4EZH A;  4LF6 T;  1T98 A;  1D0Y A;  1HF8 A;  1UX5 A;  4ZI7 E;  5C2T A;  4JI1 T;  4K0K T;  3X1D A;  2XQ3 A;  1ZHC A;  1UUS A;  2MOZ A;  3JAD A;  3N9L A;  4J2C A;  2DHR A;  3LDQ B;  4MBQ A;  5AQG B;  2JRK A;  1IJ6 A;  2CEA A;  1XDO A;  4NIQ A;  1UK5 A;  5AQH B;  4HKA A;  5TAO A;  2WSS V;  5L4E A;  4AQG A;  1YQ3 A;  4DR2 T;  3MKD A;  3PTR B;  4PK6 A;  3IA3 A;  3PJA A;  2C5K T;  1SA0 E;  1CUN A;  2MAW A;  1HFA A;  2WZI A;  2Z6E A;  1UGO A;  3KVA A;  4DV1 T;  3OBV E;  4H9N C;  4UVC B;  3RYH E;  2BG9 C;  4ILA A;  1WLX A;  4IE4 A;  2L3L A;  4HFC A;  4JEH B;  3OKQ A;  2HN1 A;  4Z90 A;  2X9Y A;  2RPA A;  5JRC B;  4O4I E;  3C50 A;  1LVK A;  2WS3 A;  3NRY A;  5FY1 A;  2VL8 A;  3PUQ A;  2K24 A;  2W0G A;  2WMO A;  3AE8 A;  4EZ4 A;  4AQF C;  4XAX B;  2OV9 A;  3QNU A;  4QX7 B;  5L3D B;  2VQF T;  4ZI2 D;  2VKH A;  5LGT B;  3OVU A;  4YLH A;  3ONX A;  4IL4 A;  4L9I A;  3VKH A;  5AFU L;  2NTX A;  4I43 B;  2E8I A;  3C51 A;  1US7 B;  3MA9 A;  4P0B A;  4ZS2 A;  1N34 T;  3IEE A;  5JQG E;  1YXR A;  3P4Q A;  1YQ4 A;  2X67 A;  2P9B A;  3TLU A;  3RIU A;  3SOL A;  4EGW A;  3P4P A;  3Q5X A;  2WB5 A;  5HCJ A;  2LE8 A;  3PU3 A;  4PJJ A;  5HWX A;  2UU9 T;  2XAG B;  3AA0 B;  3LJC A;  1MIV A;  1ZEE A;  1OED E;  1N32 T;  3NBX X;  2B76 A;  1MIY A;  2D2S A;  4CN6 A;  3CKD A;  3CQC B;  3KIN B;  4DMV A;  5FKY A;  1UUR A;  1BR0 A;  3AEF A;  3I0O A;  5FXX A;  5JDM A;  4DV0 T;  1SE7 A;  5EK2 A;  2LSG A;  2UUC T;  4KP3 C;  1WR6 A;  2XAQ B;  1W0A A;  3GN5 B;  2B1E A;  3PUR A;  2VAS A;  4TWF A;  3RYF E;  4ANJ A;  4AQF A;  4EAH A;  4AQY T;  2V7L A;  4QH4 A;  3O1H A;  2LSY A;  2AE9 A;  1UX4 A;  3AE3 A;  3M65 A;  2XAS B;  4O4L E;  5AQL B;  5FXZ A;  4BJM A;  4PAG A;  2H7O A;  3E0Z A;  3RYI E;  3BQK A;  2RP4 A;  4YTM A;  3C98 B;  1Z8U A;  5LMU T;  3NWI A;  2X51 A;  4UF0 A;  3AA6 B;  2J1D G;  3E08 A;  5EK3 A;  3NZP A;  5H6R B;  1HR0 T;  3JC6 D;  3O1J A;  2M6B A;  5FY7 A;  4X65 T;  2BKN A;  5AQU B;  4X66 T;  2IC6 A;  1Z0P A;  3L09 A;  5LJM A;  2VB6 A;  2X66 A;  5LGN B;  1HX1 B;  1T72 A;  3I0Q A;  5M4Y A;  4DR4 T;  2W00 A;  2AXD S;  4I55 E;  3ZN1 B;  3SRZ A;  2WMN A;  2X68 A;  1VCT A;  2BZB A;  3P50 A;  2WAU A;  3S4U A;  1R8I A;  2CBI A;  4JI8 T;  1FEW A;  3NVO A;  5F8P A;  4N78 D;  4U2Y A;  2XQ8 A;  1MIW A;  4HEA A;  1XDP A;  2MYS A;  3W15 B;  4ADZ A;  4HGA A;  4HWI B;  4L5G A;  3NZQ A;  4GKJ T;  2WDV A;  1IZN B;  2K3W A;  2KXP B;  2W4X A;  3RIU C;  4HTE A;  4B3S T;  4BJN A;  3ZC0 A;  5JRC A;  1T7S A;  4DR6 T;  4GK5 E;  5ADX L;  5JR9 C;  4DR5 T;  3PUW F;  4X20 E;  4NXM T;  3KBU A;  5JVD E;  1QSD A;  3V5S A;  3CX7 B;  2LEH A;  2JPF A;  3PUZ F;  2QYW A;  4QXC B;  3MXZ A;  4UV8 B;  5JRE A;  2PBI A;  1E7P A;  4Z8X A;  3MK7 C;  2YIN A;  2YEV C;  4OYK A;  5KDM C;  1N33 T;  3AE9 A;  4XBF B;  2BDE A;  4UEL A;  3ZSS A;  4U3C A;  4DV5 T;  5ABH A;  4UIG A;  2HHH T;  3B5M A;  3LBX B;  3PE0 A;  3CML A;  4OHF A;  2NP9 A;  3ONJ A;  3EVY A;  3K8P C;  2C5J A;  5AQV B; 
#chains in the Genus database with same CATH homology
 2UXC T;  4B3M T;  4YY3 T;  1IBM T;  1XNQ T;  4JI4 T;  4DR7 T;  4KHP T;  1XMO T;  4DR2 T;  1N36 T;  4X62 T;  1J5E T;  4DV2 T;  4DV1 T;  2UXB T;  1HNZ T;  4YHH T;  4LFC T;  5LMN T;  5BR8 T;  4GKK T;  2VQF T;  2VQE T;  1N34 T;  4LF5 T;  2ZM6 T;  4LFA T;  4X64 T;  1I94 T;  4LF9 T;  2UU9 T;  4LFB T;  1N32 T;  4LF7 T;  1FJG T;  4JI0 T;  4DV6 T;  2UUA T;  4NXN T;  4DV0 T;  5IWA T;  1IBK T;  3OTO T;  4DV4 T;  2UUB T;  4B3T T;  2UUC T;  4LF4 T;  4DV7 T;  4AQY T;  2UXD T;  4JI6 T;  4DR1 T;  4DUY T;  4DR3 T;  5LMU T;  4JI7 T;  4JYA T;  4DV3 T;  4K0K T;  4OX9 T;  1HR0 T;  2F4V T;  4B3R T;  4X66 T;  4DR4 T;  1HNW T;  4JI3 T;  4JI8 T;  4JI5 T;  4DUZ T;  4GKJ T;  4B3S T;  4DR6 T;  4LF8 T;  4DR5 T;  4NXM T;  2E5L T;  1IBL T;  1XNR T;  3T1Y T;  4JV5 T;  1XMQ T;  4JI2 T;  1N33 T;  4DV5 T;  1HNX T;  2HHH T;  3T1H T;  4X65 T;  4LF6 T;  4JI1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...