4JI6T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji6T00
2F4VT 5LMNT 4DV3T 4JI3T 4DR6T 4JI6T 1HNXT 4DR4T 4DR3T 1I94T 4NXMT 2UUBT 4K0KT 4B3ST 2UXDT 4YY3T 4DV0T 4LF6T 2VQFT 4JI1T 5LMUT 3T1HT 4DV6T 1HNWT 1N33T 4JI4T 2HHHT 4DR5T 4X64T 1IBMT 4JV5T 4YHHT 4JYAT 4KHPT 4DV1T 4LF7T 1XMOT 2UUAT 4X62T 4LF9T 4OX9T 4DV4T 1J5ET 4DV7T 1XMQT 4JI8T 1HNZT 2VQET 1FJGT 4LF4T 1N34T 4AQYT 3T1YT 4DR1T 4LFCT 4B3RT 4NXNT 2ZM6T 4B3TT 5IWAT 4X65T 4JI5T 1XNQT 4GKKT 4DUZT 4X66T 4LF5T 4B3MT 4LFAT 4DR7T 4GKJT 2UXCT 1N32T 2E5LT 1IBLT 5BR8T 2UXBT 4DR2T 1XNRT 4JI7T 4LF8T 1IBKT 4LFBT 3OTOT 4DUYT 1HR0T 2UU9T 4JI0T 2UUCT 4DV2T 1N36T 4JI2T 4DV5T
chains in the Genus database with same CATH superfamily
5FKYA 3P4SA 4DV3T 3WAKA 3FZKB 5FMNA 3VKHA 3L8RA 4YY3T 2LE8A 2VKJA 3L09A 1US7B 3W15B 2FJAA 2QVAA 2BVLA 1E2AA 2D0TA 5FL1A 4IIJE 3KV4A 3RQUA 4FI5A 1X9BA 3AE3A 3MA9A 3PU3A 1D1BA 3IEEA 4X62T 5FY7A 5LHGB 3VU7H 2IMLA 3ZT5A 3O4XE 4V1Av 2X68A 4N78D 2L8KA 5AQTB 5J0ZA 4DR1T 3UUMA 1WRDA 2KXPB 2MYSA 5JDLA 2K5BB 3PUWF 2A9UA 3NRXA 4TV9E 2WZIA 2ZM2A 2XAHB 1MIYA 4UR9A 4LMJA 4G2AA 3Q5WA 4JI7T 3OVUA 3PE0A 4CN6A 4AQFA 3KDSE 2X51A 3Q9DA 1VCTA 2LOPA 2FJBA 4DMWA 4QX8B 3B57A 1HG5A 4HGAA 4IDQA 1Z0PA 4EEDA 3MJXA 2ACXA 1W0BA 2BVMA 2CBIA 3VR8A 3QUJA 2JMKA 2K48A 4HFIA 3MACA 4HWFA 2KSRA 4DV6T 3CX7B 5KMGP 4GIWA 4EYYR 3JC6D 2WP9A 2NTXA 4P09A 4FJOA 1OEDC 2W61A 2M67A 3ANWA 1GQEA 2V6XA 3CWZB 4PK6A 3N2GE 3ZN0B 3C4WA 2XQ5A 4OK0A 3ZCIA 3AE8A 1J5ET 3K1SA 1XMQT 2VWAA 4BA9A 4LF4T 3EABA 5L47A 2ZM6T 5TAOA 5L4EA 4O4JE 3FXDB 5LG3A 4EGWA 4IL9A 3VHLA 2D0UA 2X9HA 2PJQA 3LFMA 4CXXA 4EAHA 2WB5A 4LFBT 4CQIA 3UU3A 2ZM8A 2V26A 3O1IA 1DU2A 5FVKA 1KNPA 4O8SA 2ZM0A 3AE6A 5LGTB 1MNEA 4AQGA 2HN1A 2Y6XA 2JMHA 3QK6A 2UXDT 5M4YA 4XBFB 2V7KA 3LBXA 4Z90A 3I0QA 3N9LA 3NZQA 5AQUB 2MPKA 3ZPOA 5HXHA 1BR2A 5JREA 2IUBA 2Q9QC 5L3FB 2BS2A 1D0XA 1OEDB 2XM1A 1Z8UA 3A5XA 3PUGA 2K9AA 2JQQA 1XMOT 2IHR1 1IJ5A 5ABFB 1UURA 3UU4A 4IHJE 2XAFB 1HNZT 2JRKA 2G0UA 1G8XA 1JNZA 4YLHA 4Q25A 3ZKRA 2XASB 3AEFA 3K3OA 4X65T 3Q5EA 1J5WA 2RPAA 3R6NA 3KINB 2IAKA 2UXXB 1SHZC 2V6YB 1L0VA 4MLKA 4DR2T 3ONJA 3I9YA 4A5XA 5LP6E 2XPKA 3UFEA 5LJNA 2BBJA 3CX6B 2DLRA 3KFWX 4AIUA 3LK2B 5L3BB 3PUSA 5AQLB 2C5IT 2V7IA 5BMVE 5LXTE 2WDVA 2WZHA 1ZP0A 2PG8A 5C3JA 2Y8DA 4TX5A 5FVLA 5JH7E 4IDOA 4EV6A 1M62A 4DV0T 1UCUA 5AQHB 1EZ3A 3AA7B 2XQ7A 3UU6A 3HI2A 4I0UA 3LG7A 3N2KE 3AECA 3HKDE 2HPLA 2WU2A 5H6RB 4DBQA 2A72A 4LMLA 2Q9QB 4UF0A 5JVDE 4JYAT 4QH1A 4CI1B 4LF9T 2NW8A 2EHOC 4PJNA 4CN1A 4ZI2D 2LSKA 2KNDA 2W67A 3E22E 4AI6A 5KX5E 4KI0F 1S94A 2W2UA 3ZYKA 3CPZA 4GK5E 2HN2A 1D1AA 4CXWA 3ZJ1A 3CKDA 5AQJB 4QH4A 3SWHA 2BKOA 4XAXB 4GYSA 3H3MA 2UXBT 4PJLA 2YU1A 4H63V 4HFDA 3C64A 1LVKA 5CA0E 2NTYA 4WZXA 2XY8B 3GN5B 4TNVA 4BJNA 5L3DB 2XUEA 3OKQA 2H7OA 2AXDS 2V1DB 3AEBA 3N9MA 1D1CA 4JI6T 5JR9A 5HWXA 2IC9A 5CB4E 4B3ST 3CK6A 4X20E 2XQ3A 3N9OA 4AKRB 5AQIB 2L3LA 5ETWA 2AE9A 3N9NA 3BQIA 5LBMA 2W66A 1UX5A 4QHOA 5IHYA 2LHRA 5EZYE 4G63A 4IE0A 3RIFA 2H3RA 1LVFA 4DV1T 4AKHA 3N9QA 4UIGA 4ZZBA 2EHOB 3BQLA 2X0LB 4ZI7E 4ZEYA 4AQFC 3ESLA 3ETVA 3LJCA 3NWIA 3RQWA 1NWMX 2CCQA 4DUZT 4X66T 3C98B 4LFAT 5CJ5A 2J1DG 3H37A 2J47A 2LSYA 2PFVA 5AQSB 2LHNA 2C5JA 5LCYA 5DABA 3HKBE 1IBKT 3LK42 4HWCA 1YD8G 1WR0A 1T72A 2CXLA 5J1GA 2D2SA 1WYBA 4MFRA 1YKHB 2V8SV 2WS3A 5HCMA 4YTNA 4A98A 4H9RC 2YKSA 2C0SA 3ZYLA 3C4XA 3AXJB 2R6GF 4P0BA 4TWFA 4O2BE 2CHOA 2XQAA 2LKGA 4P1NA 5IYZE 3EUHA 3IA3A 1JNRA 1MMDA 2E5VA 5LHHB 2I59A 3C50A 3A8YC 4P0AA 3B5MA 4X64T 4IREA 2XJ7A 2YDSA 2DWKA 4QXHB 5AQVB 1G73A 3ZCJA 3J7Yq 3MXZA 3AAAB 2CBJA 1HCIA 4QKNA 4IT4A 3AEDA 1SUMB 4UXNB 3UQ4A 2VKOA 3NZPA 3Q5DA 3MK7C 3FXEB 2NWBA 4K0UA 2CXFA 4PK4A 2FBWA 4WBOA 3LK3B 2X9XA 2V5DA 5BR8T 2E9XA 2VK9A 2XQYA 5L3CB 3JCFA 3AE9A 4HFHA 2UU9T 3RF1A 3JADA 5LJMA 1SA0E 2WDRA 2YDQA 2XHEB 2MOZA 4HWDA 2LKHA 4JI3T 5LGUB 2XQ8A 3ETUA 2B1EA 2ODVA 1KK7A 4IE6A 1OXZA 4QX7B 1M7KA 4Z91A 5LNKA 3ZN1B 2YDRA 1E1HB 3P4PA 1HTJF 3CQCB 2KLQA 4JV5T 4U72A 3CIRA 4X5TA 1UGOA 2W0GA 5JTGA 4YSXA 4A97A 5J2UE 1IZNB 2DWGA 4HE8A 4DV4T 3K3QC 2E9XD 4YXDA 2YINA 2VQET 4ZOLE 3MKDA 2NW9A 2DNXA 3L39A 4LFCT 5HXCA 3RGLA 2M6BA 4F8HA 5L3EB 1E7PA 2HPJA 2VURA 2W62A 3VRAA 4HKAA 2V7JA 3NBXX 3P4RA 4DBRA 4EB6E 3PUZF 3AB3B 3EDVA 3LSVA 3UUBA 2LJLA 1S35A 4BJMA 2LEHA 3QB5K 3RPUA 1J1JA 5FXWA 4DR3T 4DR4T 4IE7A 4KP3C 3U78A 3PV0F 5FY1A 3UQ7A 3IHRA 3CVRA 3AE7A 4A56A 3RRCA 5LA6E 2VKDA 3OPCA 4TUYE 2WAUA 2HHHT 4YHJA 4DNDA 4ISTA 4I55E 1KFYA 3DJBA 5AQQB 4AKIA 4H9QC 2LSIA 2SPCA 5EK3A 5DQWA 3A7MA 2XAQB 4O4IE 4U31A 2NOXA 2OA5A 3PDYA 1SE7A 4L0RA 3RH3A 1D0YA 5LYJE 3T1YT 2IDOB 3S4UA 2BG9A 4U3CA 4JI5T 4GYRA 5AQOB 4E7SA 3KV9A 2IIUA 3FZHB 3O1HA 3IF8B 5A1LA 3ZT7A 3UUNA 3OTOT 1HR0T 3C51A 5CGMA 5LB7B 3HA4A 3UULA 3V5UA 4DV5T 2BS4A 2F4VT 2DL1A 3TLWA 3AEAA 5LMNT 3ABVA 4UEMA 3AA1B 2Y48B 4H9NC 1YXRA 4ZI3C 2LOSA 3U3IA 2KWIB 2YU2A 3KVAA 4JLEA 4PJJA 4UF0B 4OYJA 3TLTA 4Z8XA 4WYVA 2P9BA 3D0TA 2LM2A 1W0AA 1OEDA 3P4WA 5H6QB 3F57A 3FHNA 3H3AA 4ISSA 4UVBB 1CUNA 3FZFB 1W9RA 5JDQA 5ABFA 3R84B 1WFDA 4IDNA 3FZMB 5AQMB 3RC8A 2XSAA 2CLYC 2X66A 2BKNA 4ASKA 2XAGB 4ZS2A 1XNQT 1MIVA 4QXCB 1MMGA 4B3MT 2V6YA 4OYKA 4DR7T 1N32T 2H7VC 2E5LT 3ZSSA 3TLSA 3UU8A 2VASA 4PJMA 5FP3A 4DUYT 2JQHA 3GMIA 2K24A 2WQYA 3AEEA 5FL0A 3AE4A 2XM2A 3HR0A 3BK9A 5HCJA 1O3XA 4TNWA 5FNVE 4WW0A 1U4QA 4DR6T 4U2ZA 2LT3A 3HKEE 4M1PA 2MTQA 1LKXA 4GOUA 1AJ3A 1FMVA 2CPTA 4TZ4C 5LMUT 3ZMVB 3ZT6A 1IAPA 1HS7A 2Q9QA 4U2YA 4UVCB 3TLUA 2QRXA 4ILAA 2W00A 5AQNB 2CXDA 4U74A 3VR9A 5JRCA 4X1YE 3GA8A 1IJ6A 5ABHA 2VVNA 4TV8E 3CX8B 1V9DA 2XZEA 3AEGA 2CLYB 5CFBA 2KZ7B 5IWAT 3KVBA 2ODUA 3JC6C 4TWHA 2IW5B 2KMFA 1Y01A 4H9PC 4UV8B 2IC6A 5HEGA 1IBLT 4AKLA 2VL0A 2N2NA 1H7CA 2WDQA 4LF8T 1LRZA 5F8PA 5LBQB 2K3WA 5HEOA 1HX8A 4DV2T 4WNKA 1HFAA 4ERRA 2Q9QD 4H63H 3PUAA 2NP9A 4L9IA 4PW8A 4UELA 3C4ZA 1XWMA 2UUBT 4K0KT 4O2AE 2DI4A 4NPPA 4QWNB 3L3PA 4IDPA 1T98A 4U7YA 3P50A 1T8BA 4PFOA 5AQPB 3EVYA 1W09A 2Z6EA 1N33T 3ONLC 4DR5T 1CHUA 1IBMT 3PUYF 4UV9B 5LOVE 2J62A 2BG9E 3X1DA 2EHOA 4EYUA 2QA7A 5ABGA 2BBHA 3SFDA 4KHZF 1FJGT 5JDMA 3I9WA 1WYCA 4AQYT 2XAJB 4AKGA 3I1AA 4JEUB 3ONXA 2JIWA 5ADXL 3TLVA 2LRLA 2UXCT 4DIDB 1ZOYA 3ZMUB 2C5KT 4JBWF 4NUUA 4IDZA 3SFEA 1ZEEA 4O4LE 2I0MA 4IE4A 3O9XA 2WMNA 4X1IE 3BQKA 1B7TA 2X0HA 3RHWA 5CA1E 4KX6A 4DMVA 1N36T 2ES0A 5HEHA 5JDGA 3P8CD 3ZC0A 1KNZA 1BR0A 3AE5A 2LSGA 3AXJA 5F3JA 3RLFF 4MALA 4HFCA 1OWAA 2EHOD 1OEDE 2V7MA 5FXZA 3FBLA 1QLBA 4JI1T 1XZYA 3DP7A 4L5GA 3KBTA 3SS1A 2BDEA 5JQGE 2ACZA 3PUXF 1WCRA 2BG9C 1KNRA 4PNIA 2V7LA 4ZHQE 4DO0A 4H9OC 3P7IA 1XDOA 1I6ZA 3ANWB 4QH5A 4ZXLA 2KT9A 4IE5A 5IUXA 3F2EA 4DV7T 4PAGA 3N2OA 3HKCE 4BAYB 4YSYA 1R8IA 4NXNT 1NEKA 2W4XA 4GKKT 3QOFA 2VB6A 5DJQC 2JPFA 4NIQA 4TWDA 4U33A 2CE7A 3RIUA 2QYWA 4KUMB 1WLXA 3ZLIA 5JDHA 2X9YA 5HAXA 1U5PA 4ZI2C 5LG4A 3DTOA 2VL8A 2DCFA 4JI0T 2UUCT 3PJAA 3RX6A 2I6HA 4ZZCA 3M3ZB 3RRWA 1UX4A 2VVSA 3GWHA 5HWYA 3CMLA 2XQ9A 3RYCE 3ZC1A 4HFVA 5J2TE 4NXMT 3RYIE 5EK2A 3EI0A 1BR1A 5EK4A 3PJAJ 3LBXB 3AE1A 4MBQA 1HX1B 3T1HT 5AQFB 1UK5A 3UT5E 2YOEA 4EZHA 4MHCA 1MMAA 4CI3B 5L2LA 3NRYA 4ILUA 2BG9B 1Y64B 4EXTA 4YHHT 1YQ3A 3Q5XA 2A2FX 3K8PC 4LF7T 2UUAT 4F6RC 4WBNE 5FYMA 2WCAA 2WY2A 3UTKA 4JI8T 2WSSV 1ZHCA 3AVSA 5FXXA 3SRZA 4E7ZA 4B3TT 2WWVA 5KDMC 3N9PA 5F5WA 2CWYA 2FJEA 2NR4A 3E0ZA 2H88A 2KWHA 2KINB 3OBVE 4TN7B 3PUVF 2B76A 5L3GB 3M65A 1QUUA 4YSZA 2WBLA 4HTEA 4QXBB 3AE2A 3UUXB 3LDQB 1FMWA 4CZZB 4ANJA 3RI5A 2BZBA 2VKHA 3Q2MA 2PTFA 1I94T 5JR9C 1VCSA 2JQKA 4IL4A 3EDUA 2E2AA 3FBZA 2WU5A 4AXPA 3UU5A 3J9X1 4B6XA 3PUQA 4HWHA 4JI4T 3T8OA 3ZMTB 3ZEFB 4HFBA 3VKGA 3AA0B 3EHZA 2GK9A 1KF6A 3P4QA 4KHPT 3RIAA 4OFZA 4I4TE 5DQVA 3RC3A 2YK0A 2N1GA 1FIOA 2BS3A 4OHFA 1QSDA 4KBMB 2WWUA 3OYXA 4O4HE 5HXEA 3F31A 3OYZA 5C8YE 1VOMA 2YEVC 3VRBA 5AQRB 4JEHB 4GK0E 4IGUA 4C91A 3V5SA 3HL6A 3PURA 5ABEA 4C90A 5HEJA 1NAFA 3NKZA 1YW0A 1XNRT 3QB5A 5AFUL 4KMCA 2NW7A 2H89A 5HYAA 3KBUA 4EIWA 2CRBA 1ZV4X 1BR4A 3OJAA 4YTMA 1D0ZA 4HEAA 5LHIB 3FZLB 3WAJA 2LSJA 4YT0A 1MMNA 5GONE 2L9QA 3N5LA 1XDPA 5JR9B 3CQXC 4HN9A 4EZ4A 2LM9A 5JRCB 3FB2A 3NVOA 3SOLA 5HXRA 2FUPA 2M6IA 4EOZB 2CWOA 2XQ6A 5AQGB 4JUYA 2V5CA 4CN4A 2PBIA 5HEUA 4YFSA 1VRBA 2D5UA 4X1KE 2WMOA 3ZSTA 2E8IA 2OLTA 1X79A 3I0OA 2UXNB 4HFEA 5FY0A 3AAIA 2XTLA 3QC9A 2A3DA 1N34T 2WM9A 3WI3A 2D9DA 2CA5A 4YJ2E 3MZKB 5HXSA 2YN6A 5FXVA 4LF5T 2QGSA 2FJDA 3RYFE 5JDFA 4COFA 4CXYA 2XQ4A 1YQ4A 4CI2B 2XSBA 3RYHE 3ZYMA 2E9XC 3IBPA 3ZMSB 2ZMAA 5KXJA 3E08A 3QNUA 4H9SE 4YJ3E 3G06A 1HF8A 3ZMZB 4EEBA 4JI2T 2CM0A 2N9DA 1T7SA 1NENA 1WR6A 3PU8A 5AQKB 4YTPA 3ZJ2A 1UUSA 2MAWA 2LLYA 2W63A 5JDNA 3TKLB 3UFGA 1HNXT 2X67A 3GN5A 4LF6T 2ZLYA 2RP4A 2CHNA 2X9WA 1FEWA 2HH7A 1MIWA 2VQFT 4HWIB 3PTRB 5C2TA 3B13A 1HNWT 3AVRA 2OV9A 4ILBA 4DVDA 5E0OA 2CMRA 3RKOA 1YKEB 2JJ9A 3JAFA 3KV6A 2MBGA 5LGNB 3EAMA 4OX9T 3KV5A 1MNDA 3RIUC 4NUVA 4I50E 3O1JA 4I43B 4AISA 4B3RT 2JQ9A 2BKPA 4J2CA 2J4GA 2LRKA 4PK5A 2RA1A 4UVAB 2X0YA 2DHRA 4GKJT 3RKGA 4XZCA 1ZKEA 4PFPA 3JAEA 4U7IA 4ZI3D 3CQGB 4ADZA 1HG2A 2E9XB 5L4HA 4LMKA 4ILCA 1KEYA 2CEAA 3AA6B 3AAEB 4ZS3A 3K3NA
chains in the Genus database with same CATH topology
2F4VT 5LMNT 4DV3T 4JI3T 4DR6T 4JI6T 1HNXT 4DR4T 4DR3T 1I94T 4NXMT 2UUBT 4K0KT 4B3ST 2UXDT 4YY3T 4DV0T 4LF6T 2VQFT 4JI1T 5LMUT 3T1HT 4DV6T 1HNWT 1N33T 4JI4T 2HHHT 4DR5T 4X64T 1IBMT 4JV5T 4YHHT 4JYAT 4KHPT 4DV1T 4LF7T 1XMOT 2UUAT 4X62T 4LF9T 4OX9T 4DV4T 1J5ET 4DV7T 1XMQT 4JI8T 1HNZT 2VQET 1FJGT 4LF4T 1N34T 4AQYT 3T1YT 4DR1T 4LFCT 4B3RT 4NXNT 2ZM6T 4B3TT 5IWAT 4X65T 4JI5T 1XNQT 4GKKT 4DUZT 4X66T 4LF5T 4B3MT 4LFAT 4DR7T 4GKJT 2UXCT 1N32T 2E5LT 1IBLT 5BR8T 2UXBT 4DR2T 1XNRT 4JI7T 4LF8T 1IBKT 4LFBT 3OTOT 4DUYT 1HR0T 2UU9T 4JI0T 2UUCT 4DV2T 1N36T 4JI2T 4DV5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V T;  5LMN T;  4DV3 T;  4JI3 T;  4DR6 T;  4JI6 T;  1HNX T;  4DR4 T;  4DR3 T;  1I94 T;  4NXM T;  2UUB T;  4K0K T;  4B3S T;  2UXD T;  4YY3 T;  4DV0 T;  4LF6 T;  2VQF T;  4JI1 T;  5LMU T;  3T1H T;  4DV6 T;  1HNW T;  1N33 T;  4JI4 T;  2HHH T;  4DR5 T;  4X64 T;  1IBM T;  4JV5 T;  4YHH T;  4JYA T;  4KHP T;  4DV1 T;  4LF7 T;  1XMO T;  2UUA T;  4X62 T;  4LF9 T;  4OX9 T;  4DV4 T;  1J5E T;  4DV7 T;  1XMQ T;  4JI8 T;  1HNZ T;  2VQE T;  1FJG T;  4LF4 T;  1N34 T;  4AQY T;  3T1Y T;  4DR1 T;  4LFC T;  4B3R T;  4NXN T;  2ZM6 T;  4B3T T;  5IWA T;  4X65 T;  4JI5 T;  1XNQ T;  4GKK T;  4DUZ T;  4X66 T;  4LF5 T;  4B3M T;  4LFA T;  4DR7 T;  4GKJ T;  2UXC T;  1N32 T;  2E5L T;  1IBL T;  5BR8 T;  2UXB T;  4DR2 T;  1XNR T;  4JI7 T;  4LF8 T;  1IBK T;  4LFB T;  3OTO T;  4DUY T;  1HR0 T;  2UU9 T;  4JI0 T;  2UUC T;  4DV2 T;  1N36 T;  4JI2 T;  4DV5 T; 
#chains in the Genus database with same CATH topology
 5FKY A;  3P4S A;  4DV3 T;  3WAK A;  3FZK B;  5FMN A;  3VKH A;  3L8R A;  4YY3 T;  2LE8 A;  2VKJ A;  3L09 A;  1US7 B;  3W15 B;  2FJA A;  2QVA A;  2BVL A;  1E2A A;  2D0T A;  5FL1 A;  4IIJ E;  3KV4 A;  3RQU A;  4FI5 A;  1X9B A;  3AE3 A;  3MA9 A;  3PU3 A;  1D1B A;  3IEE A;  4X62 T;  5FY7 A;  5LHG B;  3VU7 H;  2IML A;  3ZT5 A;  3O4X E;  4V1A v;  2X68 A;  4N78 D;  2L8K A;  5AQT B;  5J0Z A;  4DR1 T;  3UUM A;  1WRD A;  2KXP B;  2MYS A;  5JDL A;  2K5B B;  3PUW F;  2A9U A;  3NRX A;  4TV9 E;  2WZI A;  2ZM2 A;  2XAH B;  1MIY A;  4UR9 A;  4LMJ A;  4G2A A;  3Q5W A;  4JI7 T;  3OVU A;  3PE0 A;  4CN6 A;  4AQF A;  3KDS E;  2X51 A;  3Q9D A;  1VCT A;  2LOP A;  2FJB A;  4DMW A;  4QX8 B;  3B57 A;  1HG5 A;  4HGA A;  4IDQ A;  1Z0P A;  4EED A;  3MJX A;  2ACX A;  1W0B A;  2BVM A;  2CBI A;  3VR8 A;  3QUJ A;  2JMK A;  2K48 A;  4HFI A;  3MAC A;  4HWF A;  2KSR A;  4DV6 T;  3CX7 B;  5KMG P;  4GIW A;  4EYY R;  3JC6 D;  2WP9 A;  2NTX A;  4P09 A;  4FJO A;  1OED C;  2W61 A;  2M67 A;  3ANW A;  1GQE A;  2V6X A;  3CWZ B;  4PK6 A;  3N2G E;  3ZN0 B;  3C4W A;  2XQ5 A;  4OK0 A;  3ZCI A;  3AE8 A;  1J5E T;  3K1S A;  1XMQ T;  2VWA A;  4BA9 A;  4LF4 T;  3EAB A;  5L47 A;  2ZM6 T;  5TAO A;  5L4E A;  4O4J E;  3FXD B;  5LG3 A;  4EGW A;  4IL9 A;  3VHL A;  2D0U A;  2X9H A;  2PJQ A;  3LFM A;  4CXX A;  4EAH A;  2WB5 A;  4LFB T;  4CQI A;  3UU3 A;  2ZM8 A;  2V26 A;  3O1I A;  1DU2 A;  5FVK A;  1KNP A;  4O8S A;  2ZM0 A;  3AE6 A;  5LGT B;  1MNE A;  4AQG A;  2HN1 A;  2Y6X A;  2JMH A;  3QK6 A;  2UXD T;  5M4Y A;  4XBF B;  2V7K A;  3LBX A;  4Z90 A;  3I0Q A;  3N9L A;  3NZQ A;  5AQU B;  2MPK A;  3ZPO A;  5HXH A;  1BR2 A;  5JRE A;  2IUB A;  2Q9Q C;  5L3F B;  2BS2 A;  1D0X A;  1OED B;  2XM1 A;  1Z8U A;  3A5X A;  3PUG A;  2K9A A;  2JQQ A;  1XMO T;  2IHR 1;  1IJ5 A;  5ABF B;  1UUR A;  3UU4 A;  4IHJ E;  2XAF B;  1HNZ T;  2JRK A;  2G0U A;  1G8X A;  1JNZ A;  4YLH A;  4Q25 A;  3ZKR A;  2XAS B;  3AEF A;  3K3O A;  4X65 T;  3Q5E A;  1J5W A;  2RPA A;  3R6N A;  3KIN B;  2IAK A;  2UXX B;  1SHZ C;  2V6Y B;  1L0V A;  4MLK A;  4DR2 T;  3ONJ A;  3I9Y A;  4A5X A;  5LP6 E;  2XPK A;  3UFE A;  5LJN A;  2BBJ A;  3CX6 B;  2DLR A;  3KFW X;  4AIU A;  3LK2 B;  5L3B B;  3PUS A;  5AQL B;  2C5I T;  2V7I A;  5BMV E;  5LXT E;  2WDV A;  2WZH A;  1ZP0 A;  2PG8 A;  5C3J A;  2Y8D A;  4TX5 A;  5FVL A;  5JH7 E;  4IDO A;  4EV6 A;  1M62 A;  4DV0 T;  1UCU A;  5AQH B;  1EZ3 A;  3AA7 B;  2XQ7 A;  3UU6 A;  3HI2 A;  4I0U A;  3LG7 A;  3N2K E;  3AEC A;  3HKD E;  2HPL A;  2WU2 A;  5H6R B;  4DBQ A;  2A72 A;  4LML A;  2Q9Q B;  4UF0 A;  5JVD E;  4JYA T;  4QH1 A;  4CI1 B;  4LF9 T;  2NW8 A;  2EHO C;  4PJN A;  4CN1 A;  4ZI2 D;  2LSK A;  2KND A;  2W67 A;  3E22 E;  4AI6 A;  5KX5 E;  4KI0 F;  1S94 A;  2W2U A;  3ZYK A;  3CPZ A;  4GK5 E;  2HN2 A;  1D1A A;  4CXW A;  3ZJ1 A;  3CKD A;  5AQJ B;  4QH4 A;  3SWH A;  2BKO A;  4XAX B;  4GYS A;  3H3M A;  2UXB T;  4PJL A;  2YU1 A;  4H63 V;  4HFD A;  3C64 A;  1LVK A;  5CA0 E;  2NTY A;  4WZX A;  2XY8 B;  3GN5 B;  4TNV A;  4BJN A;  5L3D B;  2XUE A;  3OKQ A;  2H7O A;  2AXD S;  2V1D B;  3AEB A;  3N9M A;  1D1C A;  4JI6 T;  5JR9 A;  5HWX A;  2IC9 A;  5CB4 E;  4B3S T;  3CK6 A;  4X20 E;  2XQ3 A;  3N9O A;  4AKR B;  5AQI B;  2L3L A;  5ETW A;  2AE9 A;  3N9N A;  3BQI A;  5LBM A;  2W66 A;  1UX5 A;  4QHO A;  5IHY A;  2LHR A;  5EZY E;  4G63 A;  4IE0 A;  3RIF A;  2H3R A;  1LVF A;  4DV1 T;  4AKH A;  3N9Q A;  4UIG A;  4ZZB A;  2EHO B;  3BQL A;  2X0L B;  4ZI7 E;  4ZEY A;  4AQF C;  3ESL A;  3ETV A;  3LJC A;  3NWI A;  3RQW A;  1NWM X;  2CCQ A;  4DUZ T;  4X66 T;  3C98 B;  4LFA T;  5CJ5 A;  2J1D G;  3H37 A;  2J47 A;  2LSY A;  2PFV A;  5AQS B;  2LHN A;  2C5J A;  5LCY A;  5DAB A;  3HKB E;  1IBK T;  3LK4 2;  4HWC A;  1YD8 G;  1WR0 A;  1T72 A;  2CXL A;  5J1G A;  2D2S A;  1WYB A;  4MFR A;  1YKH B;  2V8S V;  2WS3 A;  5HCM A;  4YTN A;  4A98 A;  4H9R C;  2YKS A;  2C0S A;  3ZYL A;  3C4X A;  3AXJ B;  2R6G F;  4P0B A;  4TWF A;  4O2B E;  2CHO A;  2XQA A;  2LKG A;  4P1N A;  5IYZ E;  3EUH A;  3IA3 A;  1JNR A;  1MMD A;  2E5V A;  5LHH B;  2I59 A;  3C50 A;  3A8Y C;  4P0A A;  3B5M A;  4X64 T;  4IRE A;  2XJ7 A;  2YDS A;  2DWK A;  4QXH B;  5AQV B;  1G73 A;  3ZCJ A;  3J7Y q;  3MXZ A;  3AAA B;  2CBJ A;  1HCI A;  4QKN A;  4IT4 A;  3AED A;  1SUM B;  4UXN B;  3UQ4 A;  2VKO A;  3NZP A;  3Q5D A;  3MK7 C;  3FXE B;  2NWB A;  4K0U A;  2CXF A;  4PK4 A;  2FBW A;  4WBO A;  3LK3 B;  2X9X A;  2V5D A;  5BR8 T;  2E9X A;  2VK9 A;  2XQY A;  5L3C B;  3JCF A;  3AE9 A;  4HFH A;  2UU9 T;  3RF1 A;  3JAD A;  5LJM A;  1SA0 E;  2WDR A;  2YDQ A;  2XHE B;  2MOZ A;  4HWD A;  2LKH A;  4JI3 T;  5LGU B;  2XQ8 A;  3ETU A;  2B1E A;  2ODV A;  1KK7 A;  4IE6 A;  1OXZ A;  4QX7 B;  1M7K A;  4Z91 A;  5LNK A;  3ZN1 B;  2YDR A;  1E1H B;  3P4P A;  1HTJ F;  3CQC B;  2KLQ A;  4JV5 T;  4U72 A;  3CIR A;  4X5T A;  1UGO A;  2W0G A;  5JTG A;  4YSX A;  4A97 A;  5J2U E;  1IZN B;  2DWG A;  4HE8 A;  4DV4 T;  3K3Q C;  2E9X D;  4YXD A;  2YIN A;  2VQE T;  4ZOL E;  3MKD A;  2NW9 A;  2DNX A;  3L39 A;  4LFC T;  5HXC A;  3RGL A;  2M6B A;  4F8H A;  5L3E B;  1E7P A;  2HPJ A;  2VUR A;  2W62 A;  3VRA A;  4HKA A;  2V7J A;  3NBX X;  3P4R A;  4DBR A;  4EB6 E;  3PUZ F;  3AB3 B;  3EDV A;  3LSV A;  3UUB A;  2LJL A;  1S35 A;  4BJM A;  2LEH A;  3QB5 K;  3RPU A;  1J1J A;  5FXW A;  4DR3 T;  4DR4 T;  4IE7 A;  4KP3 C;  3U78 A;  3PV0 F;  5FY1 A;  3UQ7 A;  3IHR A;  3CVR A;  3AE7 A;  4A56 A;  3RRC A;  5LA6 E;  2VKD A;  3OPC A;  4TUY E;  2WAU A;  2HHH T;  4YHJ A;  4DND A;  4IST A;  4I55 E;  1KFY A;  3DJB A;  5AQQ B;  4AKI A;  4H9Q C;  2LSI A;  2SPC A;  5EK3 A;  5DQW A;  3A7M A;  2XAQ B;  4O4I E;  4U31 A;  2NOX A;  2OA5 A;  3PDY A;  1SE7 A;  4L0R A;  3RH3 A;  1D0Y A;  5LYJ E;  3T1Y T;  2IDO B;  3S4U A;  2BG9 A;  4U3C A;  4JI5 T;  4GYR A;  5AQO B;  4E7S A;  3KV9 A;  2IIU A;  3FZH B;  3O1H A;  3IF8 B;  5A1L A;  3ZT7 A;  3UUN A;  3OTO T;  1HR0 T;  3C51 A;  5CGM A;  5LB7 B;  3HA4 A;  3UUL A;  3V5U A;  4DV5 T;  2BS4 A;  2F4V T;  2DL1 A;  3TLW A;  3AEA A;  5LMN T;  3ABV A;  4UEM A;  3AA1 B;  2Y48 B;  4H9N C;  1YXR A;  4ZI3 C;  2LOS A;  3U3I A;  2KWI B;  2YU2 A;  3KVA A;  4JLE A;  4PJJ A;  4UF0 B;  4OYJ A;  3TLT A;  4Z8X A;  4WYV A;  2P9B A;  3D0T A;  2LM2 A;  1W0A A;  1OED A;  3P4W A;  5H6Q B;  3F57 A;  3FHN A;  3H3A A;  4ISS A;  4UVB B;  1CUN A;  3FZF B;  1W9R A;  5JDQ A;  5ABF A;  3R84 B;  1WFD A;  4IDN A;  3FZM B;  5AQM B;  3RC8 A;  2XSA A;  2CLY C;  2X66 A;  2BKN A;  4ASK A;  2XAG B;  4ZS2 A;  1XNQ T;  1MIV A;  4QXC B;  1MMG A;  4B3M T;  2V6Y A;  4OYK A;  4DR7 T;  1N32 T;  2H7V C;  2E5L T;  3ZSS A;  3TLS A;  3UU8 A;  2VAS A;  4PJM A;  5FP3 A;  4DUY T;  2JQH A;  3GMI A;  2K24 A;  2WQY A;  3AEE A;  5FL0 A;  3AE4 A;  2XM2 A;  3HR0 A;  3BK9 A;  5HCJ A;  1O3X A;  4TNW A;  5FNV E;  4WW0 A;  1U4Q A;  4DR6 T;  4U2Z A;  2LT3 A;  3HKE E;  4M1P A;  2MTQ A;  1LKX A;  4GOU A;  1AJ3 A;  1FMV A;  2CPT A;  4TZ4 C;  5LMU T;  3ZMV B;  3ZT6 A;  1IAP A;  1HS7 A;  2Q9Q A;  4U2Y A;  4UVC B;  3TLU A;  2QRX A;  4ILA A;  2W00 A;  5AQN B;  2CXD A;  4U74 A;  3VR9 A;  5JRC A;  4X1Y E;  3GA8 A;  1IJ6 A;  5ABH A;  2VVN A;  4TV8 E;  3CX8 B;  1V9D A;  2XZE A;  3AEG A;  2CLY B;  5CFB A;  2KZ7 B;  5IWA T;  3KVB A;  2ODU A;  3JC6 C;  4TWH A;  2IW5 B;  2KMF A;  1Y01 A;  4H9P C;  4UV8 B;  2IC6 A;  5HEG A;  1IBL T;  4AKL A;  2VL0 A;  2N2N A;  1H7C A;  2WDQ A;  4LF8 T;  1LRZ A;  5F8P A;  5LBQ B;  2K3W A;  5HEO A;  1HX8 A;  4DV2 T;  4WNK A;  1HFA A;  4ERR A;  2Q9Q D;  4H63 H;  3PUA A;  2NP9 A;  4L9I A;  4PW8 A;  4UEL A;  3C4Z A;  1XWM A;  2UUB T;  4K0K T;  4O2A E;  2DI4 A;  4NPP A;  4QWN B;  3L3P A;  4IDP A;  1T98 A;  4U7Y A;  3P50 A;  1T8B A;  4PFO A;  5AQP B;  3EVY A;  1W09 A;  2Z6E A;  1N33 T;  3ONL C;  4DR5 T;  1CHU A;  1IBM T;  3PUY F;  4UV9 B;  5LOV E;  2J62 A;  2BG9 E;  3X1D A;  2EHO A;  4EYU A;  2QA7 A;  5ABG A;  2BBH A;  3SFD A;  4KHZ F;  1FJG T;  5JDM A;  3I9W A;  1WYC A;  4AQY T;  2XAJ B;  4AKG A;  3I1A A;  4JEU B;  3ONX A;  2JIW A;  5ADX L;  3TLV A;  2LRL A;  2UXC T;  4DID B;  1ZOY A;  3ZMU B;  2C5K T;  4JBW F;  4NUU A;  4IDZ A;  3SFE A;  1ZEE A;  4O4L E;  2I0M A;  4IE4 A;  3O9X A;  2WMN A;  4X1I E;  3BQK A;  1B7T A;  2X0H A;  3RHW A;  5CA1 E;  4KX6 A;  4DMV A;  1N36 T;  2ES0 A;  5HEH A;  5JDG A;  3P8C D;  3ZC0 A;  1KNZ A;  1BR0 A;  3AE5 A;  2LSG A;  3AXJ A;  5F3J A;  3RLF F;  4MAL A;  4HFC A;  1OWA A;  2EHO D;  1OED E;  2V7M A;  5FXZ A;  3FBL A;  1QLB A;  4JI1 T;  1XZY A;  3DP7 A;  4L5G A;  3KBT A;  3SS1 A;  2BDE A;  5JQG E;  2ACZ A;  3PUX F;  1WCR A;  2BG9 C;  1KNR A;  4PNI A;  2V7L A;  4ZHQ E;  4DO0 A;  4H9O C;  3P7I A;  1XDO A;  1I6Z A;  3ANW B;  4QH5 A;  4ZXL A;  2KT9 A;  4IE5 A;  5IUX A;  3F2E A;  4DV7 T;  4PAG A;  3N2O A;  3HKC E;  4BAY B;  4YSY A;  1R8I A;  4NXN T;  1NEK A;  2W4X A;  4GKK T;  3QOF A;  2VB6 A;  5DJQ C;  2JPF A;  4NIQ A;  4TWD A;  4U33 A;  2CE7 A;  3RIU A;  2QYW A;  4KUM B;  1WLX A;  3ZLI A;  5JDH A;  2X9Y A;  5HAX A;  1U5P A;  4ZI2 C;  5LG4 A;  3DTO A;  2VL8 A;  2DCF A;  4JI0 T;  2UUC T;  3PJA A;  3RX6 A;  2I6H A;  4ZZC A;  3M3Z B;  3RRW A;  1UX4 A;  2VVS A;  3GWH A;  5HWY A;  3CML A;  2XQ9 A;  3RYC E;  3ZC1 A;  4HFV A;  5J2T E;  4NXM T;  3RYI E;  5EK2 A;  3EI0 A;  1BR1 A;  5EK4 A;  3PJA J;  3LBX B;  3AE1 A;  4MBQ A;  1HX1 B;  3T1H T;  5AQF B;  1UK5 A;  3UT5 E;  2YOE A;  4EZH A;  4MHC A;  1MMA A;  4CI3 B;  5L2L A;  3NRY A;  4ILU A;  2BG9 B;  1Y64 B;  4EXT A;  4YHH T;  1YQ3 A;  3Q5X A;  2A2F X;  3K8P C;  4LF7 T;  2UUA T;  4F6R C;  4WBN E;  5FYM A;  2WCA A;  2WY2 A;  3UTK A;  4JI8 T;  2WSS V;  1ZHC A;  3AVS A;  5FXX A;  3SRZ A;  4E7Z A;  4B3T T;  2WWV A;  5KDM C;  3N9P A;  5F5W A;  2CWY A;  2FJE A;  2NR4 A;  3E0Z A;  2H88 A;  2KWH A;  2KIN B;  3OBV E;  4TN7 B;  3PUV F;  2B76 A;  5L3G B;  3M65 A;  1QUU A;  4YSZ A;  2WBL A;  4HTE A;  4QXB B;  3AE2 A;  3UUX B;  3LDQ B;  1FMW A;  4CZZ B;  4ANJ A;  3RI5 A;  2BZB A;  2VKH A;  3Q2M A;  2PTF A;  1I94 T;  5JR9 C;  1VCS A;  2JQK A;  4IL4 A;  3EDU A;  2E2A A;  3FBZ A;  2WU5 A;  4AXP A;  3UU5 A;  3J9X 1;  4B6X A;  3PUQ A;  4HWH A;  4JI4 T;  3T8O A;  3ZMT B;  3ZEF B;  4HFB A;  3VKG A;  3AA0 B;  3EHZ A;  2GK9 A;  1KF6 A;  3P4Q A;  4KHP T;  3RIA A;  4OFZ A;  4I4T E;  5DQV A;  3RC3 A;  2YK0 A;  2N1G A;  1FIO A;  2BS3 A;  4OHF A;  1QSD A;  4KBM B;  2WWU A;  3OYX A;  4O4H E;  5HXE A;  3F31 A;  3OYZ A;  5C8Y E;  1VOM A;  2YEV C;  3VRB A;  5AQR B;  4JEH B;  4GK0 E;  4IGU A;  4C91 A;  3V5S A;  3HL6 A;  3PUR A;  5ABE A;  4C90 A;  5HEJ A;  1NAF A;  3NKZ A;  1YW0 A;  1XNR T;  3QB5 A;  5AFU L;  4KMC A;  2NW7 A;  2H89 A;  5HYA A;  3KBU A;  4EIW A;  2CRB A;  1ZV4 X;  1BR4 A;  3OJA A;  4YTM A;  1D0Z A;  4HEA A;  5LHI B;  3FZL B;  3WAJ A;  2LSJ A;  4YT0 A;  1MMN A;  5GON E;  2L9Q A;  3N5L A;  1XDP A;  5JR9 B;  3CQX C;  4HN9 A;  4EZ4 A;  2LM9 A;  5JRC B;  3FB2 A;  3NVO A;  3SOL A;  5HXR A;  2FUP A;  2M6I A;  4EOZ B;  2CWO A;  2XQ6 A;  5AQG B;  4JUY A;  2V5C A;  4CN4 A;  2PBI A;  5HEU A;  4YFS A;  1VRB A;  2D5U A;  4X1K E;  2WMO A;  3ZST A;  2E8I A;  2OLT A;  1X79 A;  3I0O A;  2UXN B;  4HFE A;  5FY0 A;  3AAI A;  2XTL A;  3QC9 A;  2A3D A;  1N34 T;  2WM9 A;  3WI3 A;  2D9D A;  2CA5 A;  4YJ2 E;  3MZK B;  5HXS A;  2YN6 A;  5FXV A;  4LF5 T;  2QGS A;  2FJD A;  3RYF E;  5JDF A;  4COF A;  4CXY A;  2XQ4 A;  1YQ4 A;  4CI2 B;  2XSB A;  3RYH E;  3ZYM A;  2E9X C;  3IBP A;  3ZMS B;  2ZMA A;  5KXJ A;  3E08 A;  3QNU A;  4H9S E;  4YJ3 E;  3G06 A;  1HF8 A;  3ZMZ B;  4EEB A;  4JI2 T;  2CM0 A;  2N9D A;  1T7S A;  1NEN A;  1WR6 A;  3PU8 A;  5AQK B;  4YTP A;  3ZJ2 A;  1UUS A;  2MAW A;  2LLY A;  2W63 A;  5JDN A;  3TKL B;  3UFG A;  1HNX T;  2X67 A;  3GN5 A;  4LF6 T;  2ZLY A;  2RP4 A;  2CHN A;  2X9W A;  1FEW A;  2HH7 A;  1MIW A;  2VQF T;  4HWI B;  3PTR B;  5C2T A;  3B13 A;  1HNW T;  3AVR A;  2OV9 A;  4ILB A;  4DVD A;  5E0O A;  2CMR A;  3RKO A;  1YKE B;  2JJ9 A;  3JAF A;  3KV6 A;  2MBG A;  5LGN B;  3EAM A;  4OX9 T;  3KV5 A;  1MND A;  3RIU C;  4NUV A;  4I50 E;  3O1J A;  4I43 B;  4AIS A;  4B3R T;  2JQ9 A;  2BKP A;  4J2C A;  2J4G A;  2LRK A;  4PK5 A;  2RA1 A;  4UVA B;  2X0Y A;  2DHR A;  4GKJ T;  3RKG A;  4XZC A;  1ZKE A;  4PFP A;  3JAE A;  4U7I A;  4ZI3 D;  3CQG B;  4ADZ A;  1HG2 A;  2E9X B;  5L4H A;  4LMK A;  4ILC A;  1KEY A;  2CEA A;  3AA6 B;  3AAE B;  4ZS3 A;  3K3N A; 
#chains in the Genus database with same CATH homology
 2F4V T;  5LMN T;  4DV3 T;  4JI3 T;  4DR6 T;  4JI6 T;  1HNX T;  4DR4 T;  4DR3 T;  1I94 T;  4NXM T;  2UUB T;  4K0K T;  4B3S T;  2UXD T;  4YY3 T;  4DV0 T;  4LF6 T;  2VQF T;  4JI1 T;  5LMU T;  3T1H T;  4DV6 T;  1HNW T;  1N33 T;  4JI4 T;  2HHH T;  4DR5 T;  4X64 T;  1IBM T;  4JV5 T;  4YHH T;  4JYA T;  4KHP T;  4DV1 T;  4LF7 T;  1XMO T;  2UUA T;  4X62 T;  4LF9 T;  4OX9 T;  4DV4 T;  1J5E T;  4DV7 T;  1XMQ T;  4JI8 T;  1HNZ T;  2VQE T;  1FJG T;  4LF4 T;  1N34 T;  4AQY T;  3T1Y T;  4DR1 T;  4LFC T;  4B3R T;  4NXN T;  2ZM6 T;  4B3T T;  5IWA T;  4X65 T;  4JI5 T;  1XNQ T;  4GKK T;  4DUZ T;  4X66 T;  4LF5 T;  4B3M T;  4LFA T;  4DR7 T;  4GKJ T;  2UXC T;  1N32 T;  2E5L T;  1IBL T;  5BR8 T;  2UXB T;  4DR2 T;  1XNR T;  4JI7 T;  4LF8 T;  1IBK T;  4LFB T;  3OTO T;  4DUY T;  1HR0 T;  2UU9 T;  4JI0 T;  2UUC T;  4DV2 T;  1N36 T;  4JI2 T;  4DV5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...