4JI7E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji7E02
4DV0E 2RTXA 3PYFA 3OTOI 3Q1QA 4B3SI 4WUDA 4HY1A 4HACA 1Z0VA 1Z59A 4FW9A 2RSMA 4LFCI 4LF5I 1KVKA 2UU9E 3ZKBA 3B82A 1ZM4A 3PYDA 4DR1I 2HFSA 1I94I 1H7UA 3D4JA 4X66I 1J5EE 2DIXA 4K0KE 2UXCE 4DUYI 2VQEE 2CZ9A 1N32I 1ELOA 2DEIA 2LJPA 3J80Q 1ZBTA 1S4EA 2DEJA 4DV4I 4USKA 2KHXA 4LFAE 1MU5A 4HACB 2B7VA 1O0WA 4YY3E 5IT9C 4B3TE 3J81Q 5A2QC 2L33A 1ZM9A 1HNXE 4OX9E 2Q2EB 4X62I 3V2UC 2NPFA 2HFUA 1T4LB 1STUA 4DV0I 1H74A 4DPUA 2L3JA 1YYOA 4DKKA 3CWVA 2UUCE 1H72C 2V2QA 4PRVA 4DPXA 4B3RE 2V2ZA 2BV3A 4KHPE 2DMYA 2UU9I 4URLA 4B3SE 3J80C 3HTXA 4GKKE 1J5EI 4JG4A 4K0KI 2RS6A 2LBSB 4DR2E 3LTOA 2LJHA 4R1FA 5A2QQ 3B8HA 3J81C 4JI5E 4LFAI 1B62A 4DUYE 4YY3I 4B3TI 1Z5BA 3PYEA 1X48A 4WYQB 4FWHA 1H73A 4LF8E 1HNXI 4DV4E 2NUGA 1S16A 4ZVIA 1XNQE 3ZM7A 1XMQE 2F4VE 4OX9I 1NHIA 1N0VC 4B3ME 2RS7A 5GMEA 1HNZE 1ZXMA 3ADLA 2L2KB 4DV2E 4DV6E 2UUCI 1HR0E 4JI7E 4I3HA 2VQFI 1ZM3A 3K1JA 4JI6E 4B3RI 4FWGA 1ZXNA 4KHPI 2UUAE 1FNMA 2N3HA 4JI3E 1IBKE 3T1HE 1NHJA 4DUZI 3PYGA 2NUEA 4GKKI 4DR2I 4DV1E 1UEKA 1X47A 4MYTA 2ZM6E 4JI5I 2VF3A 2L2NA 3F0NA 4LF7E 2E5LE 1T4OA 4LF8I 1XNQI 2NA2A 1XMQI 2F4VI 4WUBA 3ZZTA 3K17A 4B3MI 1RREA 1WUUA 1HNZI 1RR9A 1FJGE 1K47A 4HXZA 4DV2I 4DR6E 2HK3A 4DV6I 1HR0I 4JI7I 1FKAE 2HHHE 2UUBE 4JI6I 4JV5E 4JI2E 3QT6A 2CPNA 3C4BA 3T1YE 2UUAI 3J7AG 3B78A 4JI3I 2LTSA 1IBKI 3ADGA 4DR3E 3T1HI 1PIEA 4LFBE 2VQFE 5LL6R 1H7SA 1VISA 4Z7YA 4LF6E 4ED4A 4AQYE 4DV1I 3WU3A 4PU9A 4DR4E 5BR8E 4X64I 1D6TA 2ZM6I 4JI1I 4DUZE 2NUFA 3VYYA 1YYKA 1N36E 1XMOI 2V34A 3H4LA 4LF7I 4NXME 2E5LI 3M6AA 4LF4E 3P1XA 2GS8A 4LF9E 2EFGA 4WFTA 3QT7A 2ZBKB 4DPTA 1FJGI 4M1KA 2V2VA 1A6FA 4DR6I 1Z0BA 4WUCA 4DPYA 2L3CA 2A2CA 1N33E 2XEXA 4JYAE 2HHHI 4DR5E 2UUBI 4JV5I 1IBME 4JI2I 3T1YI 5LMNE 2HKEA 5FLXQ 4PRXA 2LRSA 3V5RA 3ZKDA 1IBLE 4DR3I 4LFBI 1GQEA 1EKZA 2EZ6A 4LF6I 2WW4A 4AQYI 4DV7E 1MX0A 4RPFA 2L2MA 1EI1A 1XNRI 5BR8I 4DR4I 3HULA 1Z0GA 1KKHA 1N36I 4DXLA 4NXMI 4X64E 4X65E 1Z0WA 4JI1E 2ZITA 4LF4I 4LF9I 1J26A 1XMOE 4P52A 4JI0E 4XTJA 1OJ4A 3QT8A 3JAMQ 5FLXC 3GONA 2JVAA 2BM1A 2V8PA 1PKPA 4FN5A 1N33I 4JYAI 4DR5I 1UILA 1IBMI 3LNUA 5LMNI 1NZ0A 4JI4E 1NHHA 1T4NA 4DR7E 3ZZ0A 1IBLI 1QU6A 2UXBI 1HNWE 4JI8E 2LTRA 2N3GA 2J7KA 4MYUA 5IWAI 3LLHA 1ZM2A 5GMDA 4FWDA 3ADIA 3ZZUA 4DV7I 2B3TB 1KIJA 5L3JA 1U2RA 3WU5A 2LUPB 1Z5AA 1RQ0A 3J7AM 1BKNA 2A2DA 2UXDE 1FI4A 4M30A 5LMUE 2X36A 1XNRE 3WU6A 4GKJE 3LPSA 2JY9A 1FWLA 2R42A 1KTVA 4X65I 3C4TA 1RC7A 4DV3E 2AJ4A 2X7IA 3JAMC 1N34E 4DU7A 2LUQA 1UHZA 4NXNE 4JI0I 4KQVA 3ADJA 4DPWA 4DV5E 1MG7A 2YT4A 1X49A 2E1RA 4X8WA 4YHHE 4M2ZA 4OOGC 1N0UA 4Z7CA 3WU4A 2R3VA 3OTOE 1WHNA 4UT4A 1DI2A 1FWKA 4P7AA 1Z5CA 4JI4I 1QZRA 4DR7I 2UXCI 1EA6A 2VQEI 4LFCE 2HKJA 2IHR1 1HNWI 4JI8I 4LF5E 4DU8A 3J7Yp 2B7TA 1DARA 4DR1E 1I94E 2HK2A 2MDRA 4X66E 5CFFE 2DB2A 1N32E 4USMA 2UXBE 1Z0CA 3VYXA 4EMDA 1YYWA 1XHKA 5IWAE 2UXDI 1YZ9A 1B63A 1PVGA 5LMUI 3QT5A 2BM0A 1WHQA 4GKJI 4DV3I 1N34I 4NXNI 4DV5I 1Z0EA 5IT9Q 4UTGA 4X62E 1Z0TA 4YHHI 4HYMA 2OI2A
chains in the Genus database with same CATH superfamily
2YTGA 1IQSA 1PJQA 4DV0E 1A1GA 2RTXA 3PYFA 2V85A 2NN6C 3OTOI 3Q1QA 5DNXA 1BB8A 4B3SI 1YUJA 4HY1A 4WUDA 4HACA 3C6MA 1Z0VA 1RMDA 2HC5A 4L5NC 1Z59A 1Z1BA 4FW9A 2EMWA 2RSMA 2YSPA 4LFCI 2LJUA 5AE1A 2M7QA 4LF5I 3CDJA 2MKDA 1KVKA 2JYAA 3FIGA 2UU9E 3ZKBA 1USVA 3B82A 1ZM4A 3PYDA 2Q8UA 4GZNC 2HFSA 4DR1I 1I94I 1H7UA 2EMZA 5EL9A 5ELWA 3D4JA 4X66I 2EM2A 1KJKA 2C37B 4N3OA 4BA2B 2WCC3 1J5EE 2DIXA 2NABA 4K0KE 2UXCE 4DUYI 4R2AA 2VQEE 2CZ9A 1ELOA 1N32I 5K36C 1ZU1A 2EN6A 2DEIA 1MGTA 2LJPA 2BR2A 3IWBA 3J80Q 2EPUA 1ZBTA 3HXLA 5K36E 1S4EA 2DEJA 4DV4I 4BC7A 2VF1A 4USKA 2YRKA 2KHXA 3F6HA 4LFAE 1MU5A 5C0XA 4HACB 2B7VA 1O0WA 2DSYA 2EPOA 4YY3E 5IT9C 4B3TE 3J81Q 4ZYEA 2V8QB 4R2QA 4WSGA 2YZTA 2EPKX 2VE7C 1UBDC 5A2QC 2L33A 2EN4A 1ZM9A 5AC5A 5IXMB 1HNXE 2IERA 4LOMA 2BB8A 4O24A 2EWLA 2EOHA 3JTZA 4OX9E 1TF3A 2Q2EB 4X62I 3V2UC 3P06A 5TSEA 2E1MA 2NPFA 1YH8A 2HFUA 2JEAA 1T4LB 1STUA 3UK3C 4AIMA 4DV0I 1H74A 4DPUA 2L3JA 2BR2B 2EPZA 2EOIA 5JEAD 4MLVA 2O1VA 1YYOA 4DKKA 3CWVA 1GZ6A 2EM3A 2UUCE 1A1FA 1H72C 2EL6A 4BS9A 2V2QA 4PRVA 4DPXA 4R2SA 4B3RE 2V2ZA 2BV3A 1A1KA 4FW7A 4KHPE 5C0XB 5KL6A 2DMYA 1A1HA 2YRHA 2RQLA 2UU9I 4URLA 2CG9A 2PRTA 2EMYA 1YHCA 2YPNA 4B3SE 2JR1A 5A6BA 3J80C 5DNLA 2AE8A 4IFDC 3HTXA 4GKKE 4OO1D 1J5EI 2EM5A 4JG4A 4K0KI 2CSHA 2ELYA 2RS6A 2LBSB 4DR2E 3LTOA 2LJHA 4R1FA 4IFDE 5A2QQ 3P76A 3B8HA 4R2DA 3J81C 2EMCA 2ADRA 2YTDA 5JEAE 2EN2A 4JI5E 4LFAI 2ELZA 2EOEA 2ODRD 5KL7A 2YTJA 2IOPA 4MDTA 1B62A 4J8ZA 5KL3A 4DUYE 4YY3I 4MU4A 5IV8B 4Q28A 1Z5BA 4B3TI 4GEQB 1OYRA 4BCAA 3PYEA 1X48A 4WYQB 4FWHA 1H73A 4WPYA 2Z5BA 4LF8E 1HNXI 4DV4E 2YSOA 4IZJA 2NUGA 1S16A 4ZVIA 5JEAF 1XNQE 3K6QA 3ZM7A 2NN6D 1XMQE 1Y4SA 2F4VE 2PO0A 4BA1A 4OX9I 1NHIA 1N0VC 2EOZA 2EPLX 2RS7A 4B3ME 1ZR9A 5C0XC 4OO1E 2EMKA 2EQ0A 1HNZE 1BBOA 5GMEA 1ZXMA 3ADLA 2DRPA 2L2KB 4NBQA 3HQ1A 4DV2E 2B9DA 5C0XE 4DV6E 1R6LA 2UUCI 3F6GA 1HR0E 4JI7E 2EPRA 3QG5C 4I3HA 1ZM3A 3K1JA 2VQFI 4LCFA 2PO2A 4JI6E 4B3RI 2PNMA 4FWGA 1ZXNA 4KHPI 3B4TA 2EL5A 2V83A 4O4KA 4MU3A 2EM0A 2I13A 2UUAE 1FNMA 4OO1F 5K36D 4MLQA 1X5WA 4P7DA 2N3HA 4R2CA 3PS1A 4I8OA 4JI3E 5A6JA 2E72A 1IBKE 3Q6NA 2ENAA 2C38A 3MHHC 3T1HE 1IMUA 2Z5CA 3KRNA 4F6NA 1NHJA 2Z5BB 4DUZI 1L4SA 3L00A 4IZJB 3PYGA 2NUEA 2F1DA 4FW6A 4P78A 4R2RA 2LCEA 4O5GA 2DLQA 2NN6E 4GKKI 5DROA 4LU9A 5KL4A 3GCMA 4ISAA 2PO0B 1P47A 4BA1B 4DR2I 3IWDA 2MC6A 2O1WA 4DV1E 3C6KA 2EP3A 1UEKA 1TN9A 2CVEA 1X47A 4BHCA 2JT2A 4MYTA 2ZM6E 4JI5I 2WBTA 4WSPA 4AIDA 1WJPA 2LE2A 2LMZA 3EPJA 2VF3A 2NN6F 2VESA 2L2NA 3F0NA 4IZKA 2PO2B 2KOUA 2GLIA 3THNA 4BHBA 2EJ4A 4BMJA 4LF7E 1QNTA 2E5LE 1T4OA 2EOXA 3P3CA 4LF8I 3DD6A 1UDNA 1USUA 2JOXA 1XNQI 3KZZA 2NA2A 5F3WA 1XMQI 2C38B 2Z5CB 2F4VI 1PDAA 2LO3A 4WUBA 5KL5A 3ZZTA 2EMFA 3K17A 5A69A 1Y5YA 4B3MI 1RREA 3RMPA 2EN1A 2FTXB 1WUUA 2PO1A 1OYSA 1HNZI 4NZVA 2RPCA 1RR9A 1FJGE 1K47A 3GLLA 1Y6ZA 4HXZA 5K36F 4DV2I 4DR6E 5KL2A 2F8BA 2EN8A 2HK3A 2I9IA 4DV6I 2BA0G 3BF2A 1HR0I 4JI7I 1FKAE 2HHHE 2UUBE 4JI6I 3MHSC 4JV5E 3NZKA 2BA1D 1WXRA 4JI2E 2ENHA 4IFDD 3QT6A 2CPNA 3C4BA 3T1YE 3J7AG 4IZKB 2UUAI 3B78A 4JI3I 2LTSA 1IBKI 3ADGA 4DR3E 3T1HI 1PIEA 3EPHA 4LFBE 1IQOA 3H1CA 2VQFE 4QNKA 3U1KA 5LL6R 2JE6A 1H7SA 4R2EA 1VISA 3HPZA 4Z7YA 4LF6E 3Q6MA 4ED4A 4F9BB 4AQYE 4F9CB 1ZAAC 4DV1I 3WU3A 4PU9A 4MU0A 2PO1B 2HJJA 2A25A 5BR8E 4DR4E 1P42A 4X64I 3M7ND 1D6TA 1E3PA 2ZM6I 4JI1I 1Y4UA 4DUZE 1G2FC 2NUFA 2L8TA 3VYYA 2EORA 1YYKA 1GTKA 1N36E 2BA0D 1XMOI 4R2PA 2V34A 2GPIA 3H4LA 4LF7I 4NXME 1UDOA 2DMIA 2E5LI 2OI2A 1NCSA 5C0XD 4WX9A 3M6AA 4AM3A 1UDSA 4J3DA 2JEAB 2EOMA 2JP9A 4N4RB 2EL4A 4LF4E 4F6MA 1N3GA 3P1XA 4LF9E 3AV0A 2GS8A 4FW5A 2EFGA 4WFTA 1A1LA 3MSWA 2V86A 3QT7A 3IWCA 2ZBKB 2JE6B 2FV4B 1JK2A 4DPTA 5AASA 4MQYA 2ENCA 3M85D 3PS2A 4IFDF 4HEIA 1FJGI 4LTYA 4M1KA 2V2VA 1A6FA 4LPFA 4DR6I 1EH6A 1Z0BA 4WUCA 5DRRA 4DPYA 2L3CA 2EQ3A 2HGHA 2A2CA 1N33E 2XEXA 4JYAE 2HHHI 2MC5A 2EE8A 2EOYA 4DR5E 2UUBI 4JV5I 2EMHA 1IBME 4JI2I 3KZYA 3T1YI 5LMNE 2HKEA 1EH7A 5FLXQ 4PRXA 3K85A 2LRSA 4F2JC 3V5RA 3ZKDA 4ZYDA 2WZOA 1ZBQA 1IBLE 4DR3I 5DNYA 4TUIA 1T38A 4MU1A 3TQMA 4BC9A 4LFBI 1GQEA 3P3EA 3BIDA 2O1UA 4ZYHA 1EKZA 5AE2A 4HTGA 4LF6I 2D9HA 2JEBA 2JWOA 5A6BD 2J65A 2WW4A 2GO4A 4DV7E 4AQYI 1MX0A 4RPFA 2M1SA 1UN6B 5EKWA 2L2MA 1EI1A 3HKMA 1XNRI 5BR8I 4DR4I 2YTFA 4KWYA 5C0XF 1AH5A 4IS1C 3HULA 1JK1A 1Z0GA 3KWRA 1TF6A 2EQ1A 1G2DC 1KKHA 1X6HA 1N36I 4DXLA 1YPNA 2MKNA 4KZSA 4NXMI 2GHFA 1PJSA 2EPXA 4X64E 4F9AB 4X65E 1Z0WA 4JI1E 2ZITA 2BA1G 4FW4A 4RHBB 4LF4I 4LF9I 2BBGA 1HK7A 1RHYA 2YTQA 2EPMX 2J7JA 1YUIA 1J26A 1XXEA 1XMOE 4P52A 2YU5A 4JI0E 4IZJD 2LVHA 3GMEA 4U3DA 4IFDA 3VHTB 4XTJA 3DF6A 4OKGA 2JEBB 2R76A 2H36X 2FGGA 1OJ4A 3QT8A 2M4IA 3JAMQ 2EMLA 5FLXC 3GONA 5JEAA 2JVAA 2JOBA 4TUGA 2BM1A 2V8PA 2K4VA 2PNZA 1PKPA 4FN5A 2IESA 1N33I 2EM9A 1SFEA 2EOQA 2V88A 4DR5I 4JYAI 5DRPA 1UILA 1IBMI 3LNUA 4LCGA 5FWKA 5LMNI 4BBYA 3EPLA 1NZ0A 3M7NG 4JI4E 1NHHA 1T4NA 4DR7E 3ZZ0A 2EM7A 1A1IA 1IBLI 4X9JA 1QU6A 2EMXA 2UXBI 2EN7A 4LCHA 1HNWE 4JI8E 2EMAA 2LTRA 2N3GA 2J7KA 4MYUA 5IWAI 3LLHA 1R6MA 1ZM2A 4OO1A 5GMDA 2EN3A 1F2IG 4FWDA 4O43A 3ADIA 1EH8A 3ZZUA 2WNRA 4DV7I 2EOFA 2B3TB 1KIJA 5L3JA 1OYPA 1U2RA 4IFDB 1E3HA 3WU5A 4L8NA 2LUPB 1Z5AA 2V87A 5JEAB 5AE3A 2GQ0A 1RQ0A 1X6FA 3J7AM 4DMIA 1BKNA 2IOQA 2L6MA 2DGCA 2A2DA 2PNZB 2UXDE 1FI4A 3M85G 2N8XA 4NHRA 1DQ3A 4M30A 2WBSA 5LMUE 1LLMC 1B69A 2YTEA 4OZEA 2X36A 5AC4A 1XNRE 3WU6A 4GKJE 3LPSA 2JY9A 3OMLA 2DLKA 1FWLA 2R42A 3P3GA 2JXPA 1KTVA 4X65I 3C4TA 3JU0A 4ZYGA 2YTIA 2VRDA 4DV3E 1RC7A 2AJ4A 5DRQA 3JAMC 2X7IA 2NN6A 1X6EA 1N34E 4DU7A 5A6KA 2LUQA 1UHZA 2M9AA 4NXNE 4U3BA 4JI0I 2C39A 2EOOA 3U1YA 4KQVA 2K7IA 3ADJA 4DPWA 4OO1B 4DV5E 1MG7A 2YT4A 1X49A 2E1RA 2WNRB 3H09A 2WP8A 4X8WA 3L7ZA 4YHHE 4M2ZA 2EPCA 2JPAA 4OOGC 2RSIA 1N0UA 2O1TA 4F54A 4GQUA 4FK5C 3BGHA 3PS3A 5A6AA 1VI7A 4IJDA 4Z7CA 3WU4A 2R3VA 3OTOE 1WHNA 4UT4A 4IS9A 2L92A 3ZOQB 1DI2A 1FWKA 2EMBA 2MDGA 1Z5CA 4R03A 4P7AA 2LT7A 4JI4I 2EPAA 5K36A 1QZRA 3AUZA 3M99B 4DR7I 1NEIA 2UXCI 2G7HA 3HJCA 2CGEA 1EA6A 2VQEI 5T6JA 1BBGA 3EPKA 4LFCE 2HKJA 2IHR1 1UDQA 1T39A 2EOJA 4JI8I 4LF5E 5JEAC 2EMIA 2WBUA 1HNWI 2V89A 3J7Yp 4DU8A 2NN6B 2B7TA 2EM4A 1DARA 3LMLA 4DR1E 1I94E 2MDRA 2HK2A 1DGCA 2C39B 2CTDA 3THOB 4X66E 4QNJA 5CFFE 2YTPA 2DB2A 5ADZA 1MEYC 3HPSA 2PNLA 2YRMA 3CDIA 1N32E 4USMA 2WP8B 3L7ZB 2UXBE 2YTOA 1Z0CA 1PJTA 3BBGA 3VYXA 1KYQA 2Z5EA 4EMDA 1YYWA 4WXDA 1XHKA 3EQ1A 5IWAE 2UXDI 1YZ9A 1B63A 4Q35B 1PVGA 5LMUI 2KONA 1YFHA 4OO1C 2R1FA 5LLQA 3QT5A 2EPPA 3VK6A 2BM0A 1WHQA 2EM8A 2YTNA 4GKJI 2LV2A 3UHMA 4R8OA 5K36B 2YU8A 1A1JA 2EMGA 2CT1A 4FW3A 4DV3I 2GO3A 1N34I 2EPNA 4NXNI 3ECRA 1X3CA 3DJWA 4WXCA 1Y60A 1WRJA 3PRYA 4M9VC 2ODRC 1SR9A 2C37A 2YWQA 4BA2A 2EOSA 4DV5I 1Z0EA 5IT9Q 1AAYA 4UTGA 4X62E 1Z0TA 4YHHI 4RH8A 2O3ZA 2EM6A 4HYMA 4M0VA 1YSAC 2EZ6A
chains in the Genus database with same CATH topology
4DV0E 2RTXA 3PYFA 2V85A 3OTOI 3Q1QA 4B3SI 4WUDA 4HY1A 4HACA 1Z0VA 4L5NC 1Z59A 4FW9A 2RSMA 4LFCI 5AE1A 2M7QA 4LF5I 1KVKA 3FIGA 2UU9E 3ZKBA 1USVA 3B82A 1ZM4A 3PYDA 4DR1I 2HFSA 1I94I 1H7UA 3D4JA 4X66I 4N3OA 1J5EE 2DIXA 4K0KE 2UXCE 4DUYI 2VQEE 2CZ9A 1N32I 1ELOA 2DEIA 2LJPA 3IWBA 3J80Q 1ZBTA 3HXLA 1S4EA 2DEJA 4DV4I 4BC7A 2VF1A 4USKA 2KHXA 3F6HA 4LFAE 1MU5A 4HACB 2B7VA 1O0WA 2DSYA 4YY3E 5IT9C 4B3TE 3J81Q 2V8QB 2YZTA 2VE7C 5A2QC 2L33A 1ZM9A 1HNXE 2EWLA 3JTZA 4OX9E 2Q2EB 4X62I 3V2UC 3P06A 2E1MA 2NPFA 2HFUA 1T4LB 1STUA 4DV0I 1H74A 4DPUA 2L3JA 2O1VA 1YYOA 4DKKA 3CWVA 1GZ6A 2UUCE 1H72C 4BS9A 2V2QA 4PRVA 4DPXA 4B3RE 2V2ZA 2BV3A 4KHPE 2DMYA 2UU9I 4URLA 2CG9A 4B3SE 2JR1A 3J80C 3HTXA 4GKKE 1J5EI 4JG4A 4K0KI 2RS6A 2LBSB 4DR2E 3LTOA 2LJHA 4R1FA 5A2QQ 3B8HA 3J81C 4JI5E 4LFAI 2IOPA 2ODRD 1B62A 4J8ZA 4DUYE 4YY3I 4B3TI 4Q28A 1Z5BA 4GEQB 4BCAA 3PYEA 1X48A 4WYQB 4FWHA 1H73A 4WPYA 2Z5BA 4LF8E 1HNXI 4DV4E 4IZJA 2NUGA 1S16A 4ZVIA 1XNQE 3K6QA 3ZM7A 1XMQE 1Y4SA 2F4VE 4OX9I 1NHIA 1N0VC 4B3ME 2RS7A 5GMEA 1HNZE 1ZXMA 3ADLA 2L2KB 3HQ1A 4DV2E 2B9DA 4DV6E 2UUCI 3F6GA 1HR0E 4JI7E 4I3HA 2VQFI 1ZM3A 3K1JA 4JI6E 4B3RI 2PNMA 4FWGA 1ZXNA 4KHPI 2V83A 2UUAE 1FNMA 4P7DA 2N3HA 4I8OA 4JI3E 1IBKE 3Q6NA 2Z5CA 3T1HE 1NHJA 2Z5BB 4DUZI 4IZJB 3PYGA 2NUEA 4P78A 4GKKI 4LU9A 4DR2I 3IWDA 2MC6A 2O1WA 4DV1E 1UEKA 1X47A 4MYTA 2ZM6E 4JI5I 4WSPA 2LE2A 2LMZA 2VF3A 2L2NA 3F0NA 4IZKA 2KOUA 4LF7E 4BMJA 2E5LE 1T4OA 4LF8I 1USUA 2JOXA 1XNQI 2NA2A 5F3WA 1XMQI 2Z5CB 2F4VI 4WUBA 3ZZTA 3K17A 4B3MI 1RREA 3RMPA 2FTXB 1WUUA 1HNZI 1RR9A 1FJGE 1K47A 4HXZA 1Y6ZA 4DV2I 4DR6E 2F8BA 2HK3A 4DV6I 1HR0I 4JI7I 1FKAE 2HHHE 2UUBE 4JI6I 4JV5E 1WXRA 4JI2E 3QT6A 2CPNA 3C4BA 3T1YE 3J7AG 4IZKB 2UUAI 3B78A 4JI3I 2LTSA 1IBKI 3ADGA 4DR3E 3T1HI 1PIEA 4LFBE 2VQFE 5LL6R 1H7SA 1VISA 3HPZA 4Z7YA 4LF6E 3Q6MA 4ED4A 4F9BB 4AQYE 4F9CB 4DV1I 3WU3A 4PU9A 4DR4E 5BR8E 4X64I 1D6TA 2ZM6I 4JI1I 1Y4UA 4DUZE 2NUFA 2L8TA 3VYYA 1YYKA 1N36E 1XMOI 2V34A 3H4LA 4LF7I 4NXME 2E5LI 2OI2A 3M6AA 4LF4E 3P1XA 2GS8A 4LF9E 3AV0A 2EFGA 4WFTA 3MSWA 2V86A 3QT7A 3IWCA 2ZBKB 2FV4B 4DPTA 5AASA 1FJGI 4LTYA 4M1KA 2V2VA 1A6FA 4DR6I 1Z0BA 4WUCA 4DPYA 2L3CA 2A2CA 1N33E 2XEXA 4JYAE 2HHHI 2MC5A 4DR5E 2UUBI 4JV5I 1IBME 4JI2I 3T1YI 5LMNE 2HKEA 5FLXQ 4PRXA 3K85A 2LRSA 3V5RA 3ZKDA 2WZOA 1ZBQA 1IBLE 4DR3I 5DNYA 4TUIA 4BC9A 4LFBI 1GQEA 2O1UA 1EKZA 5AE2A 4LF6I 2JWOA 2WW4A 4AQYI 4DV7E 1MX0A 4RPFA 2M1SA 2L2MA 1EI1A 1XNRI 5BR8I 4DR4I 3HULA 1Z0GA 3KWRA 1KKHA 1N36I 4DXLA 4KZSA 4NXMI 4X64E 4F9AB 4X65E 1Z0WA 4JI1E 2ZITA 4LF4I 4LF9I 1HK7A 1J26A 1XMOE 4P52A 4IZJD 4JI0E 4XTJA 3DF6A 2H36X 2FGGA 1OJ4A 3QT8A 2M4IA 3JAMQ 5FLXC 3GONA 2JVAA 2JOBA 4TUGA 2BM1A 2V8PA 2K4VA 1PKPA 4FN5A 1N33I 4JYAI 2V88A 4DR5I 1UILA 1IBMI 3LNUA 5FWKA 5LMNI 4BBYA 1NZ0A 4JI4E 1NHHA 1T4NA 4DR7E 3ZZ0A 1IBLI 1QU6A 2UXBI 1HNWE 4JI8E 2LTRA 2N3GA 2J7KA 4MYUA 5IWAI 3LLHA 1ZM2A 5GMDA 4FWDA 3ADIA 3ZZUA 4DV7I 2B3TB 1KIJA 5L3JA 1U2RA 3WU5A 4L8NA 2LUPB 1Z5AA 2V87A 5AE3A 2GQ0A 1RQ0A 3J7AM 4DMIA 1BKNA 2IOQA 2L6MA 2A2DA 2UXDE 1FI4A 1DQ3A 4M30A 5LMUE 2X36A 1XNRE 3WU6A 4GKJE 3LPSA 2JY9A 3OMLA 1FWLA 2R42A 1KTVA 4X65I 3C4TA 3JU0A 1RC7A 4DV3E 2AJ4A 3JAMC 2X7IA 1N34E 4DU7A 2LUQA 1UHZA 4NXNE 4JI0I 4KQVA 3ADJA 4DPWA 4DV5E 1MG7A 2YT4A 1X49A 2E1RA 3H09A 4X8WA 4YHHE 4M2ZA 4OOGC 2O1TA 1N0UA 4F54A 4Z7CA 3WU4A 2R3VA 3OTOE 1WHNA 4UT4A 2L92A 3ZOQB 1DI2A 1FWKA 4P7AA 1Z5CA 4R03A 4JI4I 1QZRA 3AUZA 4DR7I 2UXCI 2G7HA 3HJCA 2CGEA 1EA6A 2VQEI 5T6JA 4LFCE 2HKJA 2IHR1 1HNWI 4JI8I 4LF5E 2V89A 3J7Yp 4DU8A 2B7TA 1DARA 3LMLA 4DR1E 1I94E 2MDRA 2HK2A 4X66E 5CFFE 2DB2A 5ADZA 3HPSA 2PNLA 1N32E 4USMA 2UXBE 1Z0CA 3VYXA 2Z5EA 4EMDA 1YYWA 1XHKA 5IWAE 2UXDI 1YZ9A 1B63A 1PVGA 5LMUI 2KONA 3QT5A 3VK6A 2BM0A 1WHQA 4GKJI 4R8OA 4DV3I 1N34I 4NXNI 3DJWA 3PRYA 2ODRC 1SR9A 4DV5I 1Z0EA 5IT9Q 4UTGA 4X62E 1Z0TA 4YHHI 4HYMA 4M0VA 2EZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 E;  2RTX A;  3PYF A;  3OTO I;  3Q1Q A;  4B3S I;  4WUD A;  4HY1 A;  4HAC A;  1Z0V A;  1Z59 A;  4FW9 A;  2RSM A;  4LFC I;  4LF5 I;  1KVK A;  2UU9 E;  3ZKB A;  3B82 A;  1ZM4 A;  3PYD A;  4DR1 I;  2HFS A;  1I94 I;  1H7U A;  3D4J A;  4X66 I;  1J5E E;  2DIX A;  4K0K E;  2UXC E;  4DUY I;  2VQE E;  2CZ9 A;  1N32 I;  1ELO A;  2DEI A;  2LJP A;  3J80 Q;  1ZBT A;  1S4E A;  2DEJ A;  4DV4 I;  4USK A;  2KHX A;  4LFA E;  1MU5 A;  4HAC B;  2B7V A;  1O0W A;  4YY3 E;  5IT9 C;  4B3T E;  3J81 Q;  5A2Q C;  2L33 A;  1ZM9 A;  1HNX E;  4OX9 E;  2Q2E B;  4X62 I;  3V2U C;  2NPF A;  2HFU A;  1T4L B;  1STU A;  4DV0 I;  1H74 A;  4DPU A;  2L3J A;  1YYO A;  4DKK A;  3CWV A;  2UUC E;  1H72 C;  2V2Q A;  4PRV A;  4DPX A;  4B3R E;  2V2Z A;  2BV3 A;  4KHP E;  2DMY A;  2UU9 I;  4URL A;  4B3S E;  3J80 C;  3HTX A;  4GKK E;  1J5E I;  4JG4 A;  4K0K I;  2RS6 A;  2LBS B;  4DR2 E;  3LTO A;  2LJH A;  4R1F A;  5A2Q Q;  3B8H A;  3J81 C;  4JI5 E;  4LFA I;  1B62 A;  4DUY E;  4YY3 I;  4B3T I;  1Z5B A;  3PYE A;  1X48 A;  4WYQ B;  4FWH A;  1H73 A;  4LF8 E;  1HNX I;  4DV4 E;  2NUG A;  1S16 A;  4ZVI A;  1XNQ E;  3ZM7 A;  1XMQ E;  2F4V E;  4OX9 I;  1NHI A;  1N0V C;  4B3M E;  2RS7 A;  5GME A;  1HNZ E;  1ZXM A;  3ADL A;  2L2K B;  4DV2 E;  4DV6 E;  2UUC I;  1HR0 E;  4JI7 E;  4I3H A;  2VQF I;  1ZM3 A;  3K1J A;  4JI6 E;  4B3R I;  4FWG A;  1ZXN A;  4KHP I;  2UUA E;  1FNM A;  2N3H A;  4JI3 E;  1IBK E;  3T1H E;  1NHJ A;  4DUZ I;  3PYG A;  2NUE A;  4GKK I;  4DR2 I;  4DV1 E;  1UEK A;  1X47 A;  4MYT A;  2ZM6 E;  4JI5 I;  2VF3 A;  2L2N A;  3F0N A;  4LF7 E;  2E5L E;  1T4O A;  4LF8 I;  1XNQ I;  2NA2 A;  1XMQ I;  2F4V I;  4WUB A;  3ZZT A;  3K17 A;  4B3M I;  1RRE A;  1WUU A;  1HNZ I;  1RR9 A;  1FJG E;  1K47 A;  4HXZ A;  4DV2 I;  4DR6 E;  2HK3 A;  4DV6 I;  1HR0 I;  4JI7 I;  1FKA E;  2HHH E;  2UUB E;  4JI6 I;  4JV5 E;  4JI2 E;  3QT6 A;  2CPN A;  3C4B A;  3T1Y E;  2UUA I;  3J7A G;  3B78 A;  4JI3 I;  2LTS A;  1IBK I;  3ADG A;  4DR3 E;  3T1H I;  1PIE A;  4LFB E;  2VQF E;  5LL6 R;  1H7S A;  1VIS A;  4Z7Y A;  4LF6 E;  4ED4 A;  4AQY E;  4DV1 I;  3WU3 A;  4PU9 A;  4DR4 E;  5BR8 E;  4X64 I;  1D6T A;  2ZM6 I;  4JI1 I;  4DUZ E;  2NUF A;  3VYY A;  1YYK A;  1N36 E;  1XMO I;  2V34 A;  3H4L A;  4LF7 I;  4NXM E;  2E5L I;  3M6A A;  4LF4 E;  3P1X A;  2GS8 A;  4LF9 E;  2EFG A;  4WFT A;  3QT7 A;  2ZBK B;  4DPT A;  1FJG I;  4M1K A;  2V2V A;  1A6F A;  4DR6 I;  1Z0B A;  4WUC A;  4DPY A;  2L3C A;  2A2C A;  1N33 E;  2XEX A;  4JYA E;  2HHH I;  4DR5 E;  2UUB I;  4JV5 I;  1IBM E;  4JI2 I;  3T1Y I;  5LMN E;  2HKE A;  5FLX Q;  4PRX A;  2LRS A;  3V5R A;  3ZKD A;  1IBL E;  4DR3 I;  4LFB I;  1GQE A;  1EKZ A;  2EZ6 A;  4LF6 I;  2WW4 A;  4AQY I;  4DV7 E;  1MX0 A;  4RPF A;  2L2M A;  1EI1 A;  1XNR I;  5BR8 I;  4DR4 I;  3HUL A;  1Z0G A;  1KKH A;  1N36 I;  4DXL A;  4NXM I;  4X64 E;  4X65 E;  1Z0W A;  4JI1 E;  2ZIT A;  4LF4 I;  4LF9 I;  1J26 A;  1XMO E;  4P52 A;  4JI0 E;  4XTJ A;  1OJ4 A;  3QT8 A;  3JAM Q;  5FLX C;  3GON A;  2JVA A;  2BM1 A;  2V8P A;  1PKP A;  4FN5 A;  1N33 I;  4JYA I;  4DR5 I;  1UIL A;  1IBM I;  3LNU A;  5LMN I;  1NZ0 A;  4JI4 E;  1NHH A;  1T4N A;  4DR7 E;  3ZZ0 A;  1IBL I;  1QU6 A;  2UXB I;  1HNW E;  4JI8 E;  2LTR A;  2N3G A;  2J7K A;  4MYU A;  5IWA I;  3LLH A;  1ZM2 A;  5GMD A;  4FWD A;  3ADI A;  3ZZU A;  4DV7 I;  2B3T B;  1KIJ A;  5L3J A;  1U2R A;  3WU5 A;  2LUP B;  1Z5A A;  1RQ0 A;  3J7A M;  1BKN A;  2A2D A;  2UXD E;  1FI4 A;  4M30 A;  5LMU E;  2X36 A;  1XNR E;  3WU6 A;  4GKJ E;  3LPS A;  2JY9 A;  1FWL A;  2R42 A;  1KTV A;  4X65 I;  3C4T A;  1RC7 A;  4DV3 E;  2AJ4 A;  2X7I A;  3JAM C;  1N34 E;  4DU7 A;  2LUQ A;  1UHZ A;  4NXN E;  4JI0 I;  4KQV A;  3ADJ A;  4DPW A;  4DV5 E;  1MG7 A;  2YT4 A;  1X49 A;  2E1R A;  4X8W A;  4YHH E;  4M2Z A;  4OOG C;  1N0U A;  4Z7C A;  3WU4 A;  2R3V A;  3OTO E;  1WHN A;  4UT4 A;  1DI2 A;  1FWK A;  4P7A A;  1Z5C A;  4JI4 I;  1QZR A;  4DR7 I;  2UXC I;  1EA6 A;  2VQE I;  4LFC E;  2HKJ A;  2IHR 1;  1HNW I;  4JI8 I;  4LF5 E;  4DU8 A;  3J7Y p;  2B7T A;  1DAR A;  4DR1 E;  1I94 E;  2HK2 A;  2MDR A;  4X66 E;  5CFF E;  2DB2 A;  1N32 E;  4USM A;  2UXB E;  1Z0C A;  3VYX A;  4EMD A;  1YYW A;  1XHK A;  5IWA E;  2UXD I;  1YZ9 A;  1B63 A;  1PVG A;  5LMU I;  3QT5 A;  2BM0 A;  1WHQ A;  4GKJ I;  4DV3 I;  1N34 I;  4NXN I;  4DV5 I;  1Z0E A;  5IT9 Q;  4UTG A;  4X62 E;  1Z0T A;  4YHH I;  4HYM A;  2OI2 A; 
#chains in the Genus database with same CATH topology
 2YTG A;  1IQS A;  1PJQ A;  4DV0 E;  1A1G A;  2RTX A;  3PYF A;  2V85 A;  2NN6 C;  3OTO I;  3Q1Q A;  5DNX A;  1BB8 A;  4B3S I;  1YUJ A;  4HY1 A;  4WUD A;  4HAC A;  3C6M A;  1Z0V A;  1RMD A;  2HC5 A;  4L5N C;  1Z59 A;  1Z1B A;  4FW9 A;  2EMW A;  2RSM A;  2YSP A;  4LFC I;  2LJU A;  5AE1 A;  2M7Q A;  4LF5 I;  3CDJ A;  2MKD A;  1KVK A;  2JYA A;  3FIG A;  2UU9 E;  3ZKB A;  1USV A;  3B82 A;  1ZM4 A;  3PYD A;  2Q8U A;  4GZN C;  2HFS A;  4DR1 I;  1I94 I;  1H7U A;  2EMZ A;  5EL9 A;  5ELW A;  3D4J A;  4X66 I;  2EM2 A;  1KJK A;  2C37 B;  4N3O A;  4BA2 B;  2WCC 3;  1J5E E;  2DIX A;  2NAB A;  4K0K E;  2UXC E;  4DUY I;  4R2A A;  2VQE E;  2CZ9 A;  1ELO A;  1N32 I;  5K36 C;  1ZU1 A;  2EN6 A;  2DEI A;  1MGT A;  2LJP A;  2BR2 A;  3IWB A;  3J80 Q;  2EPU A;  1ZBT A;  3HXL A;  5K36 E;  1S4E A;  2DEJ A;  4DV4 I;  4BC7 A;  2VF1 A;  4USK A;  2YRK A;  2KHX A;  3F6H A;  4LFA E;  1MU5 A;  5C0X A;  4HAC B;  2B7V A;  1O0W A;  2DSY A;  2EPO A;  4YY3 E;  5IT9 C;  4B3T E;  3J81 Q;  4ZYE A;  2V8Q B;  4R2Q A;  4WSG A;  2YZT A;  2EPK X;  2VE7 C;  1UBD C;  5A2Q C;  2L33 A;  2EN4 A;  1ZM9 A;  5AC5 A;  5IXM B;  1HNX E;  2IER A;  4LOM A;  2BB8 A;  4O24 A;  2EWL A;  2EOH A;  3JTZ A;  4OX9 E;  1TF3 A;  2Q2E B;  4X62 I;  3V2U C;  3P06 A;  5TSE A;  2E1M A;  2NPF A;  1YH8 A;  2HFU A;  2JEA A;  1T4L B;  1STU A;  3UK3 C;  4AIM A;  4DV0 I;  1H74 A;  4DPU A;  2L3J A;  2BR2 B;  2EPZ A;  2EOI A;  5JEA D;  4MLV A;  2O1V A;  1YYO A;  4DKK A;  3CWV A;  1GZ6 A;  2EM3 A;  2UUC E;  1A1F A;  1H72 C;  2EL6 A;  4BS9 A;  2V2Q A;  4PRV A;  4DPX A;  4R2S A;  4B3R E;  2V2Z A;  2BV3 A;  1A1K A;  4FW7 A;  4KHP E;  5C0X B;  5KL6 A;  2DMY A;  1A1H A;  2YRH A;  2RQL A;  2UU9 I;  4URL A;  2CG9 A;  2PRT A;  2EMY A;  1YHC A;  2YPN A;  4B3S E;  2JR1 A;  5A6B A;  3J80 C;  5DNL A;  2AE8 A;  4IFD C;  3HTX A;  4GKK E;  4OO1 D;  1J5E I;  2EM5 A;  4JG4 A;  4K0K I;  2CSH A;  2ELY A;  2RS6 A;  2LBS B;  4DR2 E;  3LTO A;  2LJH A;  4R1F A;  4IFD E;  5A2Q Q;  3P76 A;  3B8H A;  4R2D A;  3J81 C;  2EMC A;  2ADR A;  2YTD A;  5JEA E;  2EN2 A;  4JI5 E;  4LFA I;  2ELZ A;  2EOE A;  2ODR D;  5KL7 A;  2YTJ A;  2IOP A;  4MDT A;  1B62 A;  4J8Z A;  5KL3 A;  4DUY E;  4YY3 I;  4MU4 A;  5IV8 B;  4Q28 A;  1Z5B A;  4B3T I;  4GEQ B;  1OYR A;  4BCA A;  3PYE A;  1X48 A;  4WYQ B;  4FWH A;  1H73 A;  4WPY A;  2Z5B A;  4LF8 E;  1HNX I;  4DV4 E;  2YSO A;  4IZJ A;  2NUG A;  1S16 A;  4ZVI A;  5JEA F;  1XNQ E;  3K6Q A;  3ZM7 A;  2NN6 D;  1XMQ E;  1Y4S A;  2F4V E;  2PO0 A;  4BA1 A;  4OX9 I;  1NHI A;  1N0V C;  2EOZ A;  2EPL X;  2RS7 A;  4B3M E;  1ZR9 A;  5C0X C;  4OO1 E;  2EMK A;  2EQ0 A;  1HNZ E;  1BBO A;  5GME A;  1ZXM A;  3ADL A;  2DRP A;  2L2K B;  4NBQ A;  3HQ1 A;  4DV2 E;  2B9D A;  5C0X E;  4DV6 E;  1R6L A;  2UUC I;  3F6G A;  1HR0 E;  4JI7 E;  2EPR A;  3QG5 C;  4I3H A;  1ZM3 A;  3K1J A;  2VQF I;  4LCF A;  2PO2 A;  4JI6 E;  4B3R I;  2PNM A;  4FWG A;  1ZXN A;  4KHP I;  3B4T A;  2EL5 A;  2V83 A;  4O4K A;  4MU3 A;  2EM0 A;  2I13 A;  2UUA E;  1FNM A;  4OO1 F;  5K36 D;  4MLQ A;  1X5W A;  4P7D A;  2N3H A;  4R2C A;  3PS1 A;  4I8O A;  4JI3 E;  5A6J A;  2E72 A;  1IBK E;  3Q6N A;  2ENA A;  2C38 A;  3MHH C;  3T1H E;  1IMU A;  2Z5C A;  3KRN A;  4F6N A;  1NHJ A;  2Z5B B;  4DUZ I;  1L4S A;  3L00 A;  4IZJ B;  3PYG A;  2NUE A;  2F1D A;  4FW6 A;  4P78 A;  4R2R A;  2LCE A;  4O5G A;  2DLQ A;  2NN6 E;  4GKK I;  5DRO A;  4LU9 A;  5KL4 A;  3GCM A;  4ISA A;  2PO0 B;  1P47 A;  4BA1 B;  4DR2 I;  3IWD A;  2MC6 A;  2O1W A;  4DV1 E;  3C6K A;  2EP3 A;  1UEK A;  1TN9 A;  2CVE A;  1X47 A;  4BHC A;  2JT2 A;  4MYT A;  2ZM6 E;  4JI5 I;  2WBT A;  4WSP A;  4AID A;  1WJP A;  2LE2 A;  2LMZ A;  3EPJ A;  2VF3 A;  2NN6 F;  2VES A;  2L2N A;  3F0N A;  4IZK A;  2PO2 B;  2KOU A;  2GLI A;  3THN A;  4BHB A;  2EJ4 A;  4BMJ A;  4LF7 E;  1QNT A;  2E5L E;  1T4O A;  2EOX A;  3P3C A;  4LF8 I;  3DD6 A;  1UDN A;  1USU A;  2JOX A;  1XNQ I;  3KZZ A;  2NA2 A;  5F3W A;  1XMQ I;  2C38 B;  2Z5C B;  2F4V I;  1PDA A;  2LO3 A;  4WUB A;  5KL5 A;  3ZZT A;  2EMF A;  3K17 A;  5A69 A;  1Y5Y A;  4B3M I;  1RRE A;  3RMP A;  2EN1 A;  2FTX B;  1WUU A;  2PO1 A;  1OYS A;  1HNZ I;  4NZV A;  2RPC A;  1RR9 A;  1FJG E;  1K47 A;  3GLL A;  1Y6Z A;  4HXZ A;  5K36 F;  4DV2 I;  4DR6 E;  5KL2 A;  2F8B A;  2EN8 A;  2HK3 A;  2I9I A;  4DV6 I;  2BA0 G;  3BF2 A;  1HR0 I;  4JI7 I;  1FKA E;  2HHH E;  2UUB E;  4JI6 I;  3MHS C;  4JV5 E;  3NZK A;  2BA1 D;  1WXR A;  4JI2 E;  2ENH A;  4IFD D;  3QT6 A;  2CPN A;  3C4B A;  3T1Y E;  3J7A G;  4IZK B;  2UUA I;  3B78 A;  4JI3 I;  2LTS A;  1IBK I;  3ADG A;  4DR3 E;  3T1H I;  1PIE A;  3EPH A;  4LFB E;  1IQO A;  3H1C A;  2VQF E;  4QNK A;  3U1K A;  5LL6 R;  2JE6 A;  1H7S A;  4R2E A;  1VIS A;  3HPZ A;  4Z7Y A;  4LF6 E;  3Q6M A;  4ED4 A;  4F9B B;  4AQY E;  4F9C B;  1ZAA C;  4DV1 I;  3WU3 A;  4PU9 A;  4MU0 A;  2PO1 B;  2HJJ A;  2A25 A;  5BR8 E;  4DR4 E;  1P42 A;  4X64 I;  3M7N D;  1D6T A;  1E3P A;  2ZM6 I;  4JI1 I;  1Y4U A;  4DUZ E;  1G2F C;  2NUF A;  2L8T A;  3VYY A;  2EOR A;  1YYK A;  1GTK A;  1N36 E;  2BA0 D;  1XMO I;  4R2P A;  2V34 A;  2GPI A;  3H4L A;  4LF7 I;  4NXM E;  1UDO A;  2DMI A;  2E5L I;  2OI2 A;  1NCS A;  5C0X D;  4WX9 A;  3M6A A;  4AM3 A;  1UDS A;  4J3D A;  2JEA B;  2EOM A;  2JP9 A;  4N4R B;  2EL4 A;  4LF4 E;  4F6M A;  1N3G A;  3P1X A;  4LF9 E;  3AV0 A;  2GS8 A;  4FW5 A;  2EFG A;  4WFT A;  1A1L A;  3MSW A;  2V86 A;  3QT7 A;  3IWC A;  2ZBK B;  2JE6 B;  2FV4 B;  1JK2 A;  4DPT A;  5AAS A;  4MQY A;  2ENC A;  3M85 D;  3PS2 A;  4IFD F;  4HEI A;  1FJG I;  4LTY A;  4M1K A;  2V2V A;  1A6F A;  4LPF A;  4DR6 I;  1EH6 A;  1Z0B A;  4WUC A;  5DRR A;  4DPY A;  2L3C A;  2EQ3 A;  2HGH A;  2A2C A;  1N33 E;  2XEX A;  4JYA E;  2HHH I;  2MC5 A;  2EE8 A;  2EOY A;  4DR5 E;  2UUB I;  4JV5 I;  2EMH A;  1IBM E;  4JI2 I;  3KZY A;  3T1Y I;  5LMN E;  2HKE A;  1EH7 A;  5FLX Q;  4PRX A;  3K85 A;  2LRS A;  4F2J C;  3V5R A;  3ZKD A;  4ZYD A;  2WZO A;  1ZBQ A;  1IBL E;  4DR3 I;  5DNY A;  4TUI A;  1T38 A;  4MU1 A;  3TQM A;  4BC9 A;  4LFB I;  1GQE A;  3P3E A;  3BID A;  2O1U A;  4ZYH A;  1EKZ A;  5AE2 A;  4HTG A;  4LF6 I;  2D9H A;  2JEB A;  2JWO A;  5A6B D;  2J65 A;  2WW4 A;  2GO4 A;  4DV7 E;  4AQY I;  1MX0 A;  4RPF A;  2M1S A;  1UN6 B;  5EKW A;  2L2M A;  1EI1 A;  3HKM A;  1XNR I;  5BR8 I;  4DR4 I;  2YTF A;  4KWY A;  5C0X F;  1AH5 A;  4IS1 C;  3HUL A;  1JK1 A;  1Z0G A;  3KWR A;  1TF6 A;  2EQ1 A;  1G2D C;  1KKH A;  1X6H A;  1N36 I;  4DXL A;  1YPN A;  2MKN A;  4KZS A;  4NXM I;  2GHF A;  1PJS A;  2EPX A;  4X64 E;  4F9A B;  4X65 E;  1Z0W A;  4JI1 E;  2ZIT A;  2BA1 G;  4FW4 A;  4RHB B;  4LF4 I;  4LF9 I;  2BBG A;  1HK7 A;  1RHY A;  2YTQ A;  2EPM X;  2J7J A;  1YUI A;  1J26 A;  1XXE A;  1XMO E;  4P52 A;  2YU5 A;  4JI0 E;  4IZJ D;  2LVH A;  3GME A;  4U3D A;  4IFD A;  3VHT B;  4XTJ A;  3DF6 A;  4OKG A;  2JEB B;  2R76 A;  2H36 X;  2FGG A;  1OJ4 A;  3QT8 A;  2M4I A;  3JAM Q;  2EML A;  5FLX C;  3GON A;  5JEA A;  2JVA A;  2JOB A;  4TUG A;  2BM1 A;  2V8P A;  2K4V A;  2PNZ A;  1PKP A;  4FN5 A;  2IES A;  1N33 I;  2EM9 A;  1SFE A;  2EOQ A;  2V88 A;  4DR5 I;  4JYA I;  5DRP A;  1UIL A;  1IBM I;  3LNU A;  4LCG A;  5FWK A;  5LMN I;  4BBY A;  3EPL A;  1NZ0 A;  3M7N G;  4JI4 E;  1NHH A;  1T4N A;  4DR7 E;  3ZZ0 A;  2EM7 A;  1A1I A;  1IBL I;  4X9J A;  1QU6 A;  2EMX A;  2UXB I;  2EN7 A;  4LCH A;  1HNW E;  4JI8 E;  2EMA A;  2LTR A;  2N3G A;  2J7K A;  4MYU A;  5IWA I;  3LLH A;  1R6M A;  1ZM2 A;  4OO1 A;  5GMD A;  2EN3 A;  1F2I G;  4FWD A;  4O43 A;  3ADI A;  1EH8 A;  3ZZU A;  2WNR A;  4DV7 I;  2EOF A;  2B3T B;  1KIJ A;  5L3J A;  1OYP A;  1U2R A;  4IFD B;  1E3H A;  3WU5 A;  4L8N A;  2LUP B;  1Z5A A;  2V87 A;  5JEA B;  5AE3 A;  2GQ0 A;  1RQ0 A;  1X6F A;  3J7A M;  4DMI A;  1BKN A;  2IOQ A;  2L6M A;  2DGC A;  2A2D A;  2PNZ B;  2UXD E;  1FI4 A;  3M85 G;  2N8X A;  4NHR A;  1DQ3 A;  4M30 A;  2WBS A;  5LMU E;  1LLM C;  1B69 A;  2YTE A;  4OZE A;  2X36 A;  5AC4 A;  1XNR E;  3WU6 A;  4GKJ E;  3LPS A;  2JY9 A;  3OML A;  2DLK A;  1FWL A;  2R42 A;  3P3G A;  2JXP A;  1KTV A;  4X65 I;  3C4T A;  3JU0 A;  4ZYG A;  2YTI A;  2VRD A;  4DV3 E;  1RC7 A;  2AJ4 A;  5DRQ A;  3JAM C;  2X7I A;  2NN6 A;  1X6E A;  1N34 E;  4DU7 A;  5A6K A;  2LUQ A;  1UHZ A;  2M9A A;  4NXN E;  4U3B A;  4JI0 I;  2C39 A;  2EOO A;  3U1Y A;  4KQV A;  2K7I A;  3ADJ A;  4DPW A;  4OO1 B;  4DV5 E;  1MG7 A;  2YT4 A;  1X49 A;  2E1R A;  2WNR B;  3H09 A;  2WP8 A;  4X8W A;  3L7Z A;  4YHH E;  4M2Z A;  2EPC A;  2JPA A;  4OOG C;  2RSI A;  1N0U A;  2O1T A;  4F54 A;  4GQU A;  4FK5 C;  3BGH A;  3PS3 A;  5A6A A;  1VI7 A;  4IJD A;  4Z7C A;  3WU4 A;  2R3V A;  3OTO E;  1WHN A;  4UT4 A;  4IS9 A;  2L92 A;  3ZOQ B;  1DI2 A;  1FWK A;  2EMB A;  2MDG A;  1Z5C A;  4R03 A;  4P7A A;  2LT7 A;  4JI4 I;  2EPA A;  5K36 A;  1QZR A;  3AUZ A;  3M99 B;  4DR7 I;  1NEI A;  2UXC I;  2G7H A;  3HJC A;  2CGE A;  1EA6 A;  2VQE I;  5T6J A;  1BBG A;  3EPK A;  4LFC E;  2HKJ A;  2IHR 1;  1UDQ A;  1T39 A;  2EOJ A;  4JI8 I;  4LF5 E;  5JEA C;  2EMI A;  2WBU A;  1HNW I;  2V89 A;  3J7Y p;  4DU8 A;  2NN6 B;  2B7T A;  2EM4 A;  1DAR A;  3LML A;  4DR1 E;  1I94 E;  2MDR A;  2HK2 A;  1DGC A;  2C39 B;  2CTD A;  3THO B;  4X66 E;  4QNJ A;  5CFF E;  2YTP A;  2DB2 A;  5ADZ A;  1MEY C;  3HPS A;  2PNL A;  2YRM A;  3CDI A;  1N32 E;  4USM A;  2WP8 B;  3L7Z B;  2UXB E;  2YTO A;  1Z0C A;  1PJT A;  3BBG A;  3VYX A;  1KYQ A;  2Z5E A;  4EMD A;  1YYW A;  4WXD A;  1XHK A;  3EQ1 A;  5IWA E;  2UXD I;  1YZ9 A;  1B63 A;  4Q35 B;  1PVG A;  5LMU I;  2KON A;  1YFH A;  4OO1 C;  2R1F A;  5LLQ A;  3QT5 A;  2EPP A;  3VK6 A;  2BM0 A;  1WHQ A;  2EM8 A;  2YTN A;  4GKJ I;  2LV2 A;  3UHM A;  4R8O A;  5K36 B;  2YU8 A;  1A1J A;  2EMG A;  2CT1 A;  4FW3 A;  4DV3 I;  2GO3 A;  1N34 I;  2EPN A;  4NXN I;  3ECR A;  1X3C A;  3DJW A;  4WXC A;  1Y60 A;  1WRJ A;  3PRY A;  4M9V C;  2ODR C;  1SR9 A;  2C37 A;  2YWQ A;  4BA2 A;  2EOS A;  4DV5 I;  1Z0E A;  5IT9 Q;  1AAY A;  4UTG A;  4X62 E;  1Z0T A;  4YHH I;  4RH8 A;  2O3Z A;  2EM6 A;  4HYM A;  4M0V A;  1YSA C;  2EZ6 A; 
#chains in the Genus database with same CATH homology
 4DV0 E;  2RTX A;  3PYF A;  2V85 A;  3OTO I;  3Q1Q A;  4B3S I;  4WUD A;  4HY1 A;  4HAC A;  1Z0V A;  4L5N C;  1Z59 A;  4FW9 A;  2RSM A;  4LFC I;  5AE1 A;  2M7Q A;  4LF5 I;  1KVK A;  3FIG A;  2UU9 E;  3ZKB A;  1USV A;  3B82 A;  1ZM4 A;  3PYD A;  4DR1 I;  2HFS A;  1I94 I;  1H7U A;  3D4J A;  4X66 I;  4N3O A;  1J5E E;  2DIX A;  4K0K E;  2UXC E;  4DUY I;  2VQE E;  2CZ9 A;  1N32 I;  1ELO A;  2DEI A;  2LJP A;  3IWB A;  3J80 Q;  1ZBT A;  3HXL A;  1S4E A;  2DEJ A;  4DV4 I;  4BC7 A;  2VF1 A;  4USK A;  2KHX A;  3F6H A;  4LFA E;  1MU5 A;  4HAC B;  2B7V A;  1O0W A;  2DSY A;  4YY3 E;  5IT9 C;  4B3T E;  3J81 Q;  2V8Q B;  2YZT A;  2VE7 C;  5A2Q C;  2L33 A;  1ZM9 A;  1HNX E;  2EWL A;  3JTZ A;  4OX9 E;  2Q2E B;  4X62 I;  3V2U C;  3P06 A;  2E1M A;  2NPF A;  2HFU A;  1T4L B;  1STU A;  4DV0 I;  1H74 A;  4DPU A;  2L3J A;  2O1V A;  1YYO A;  4DKK A;  3CWV A;  1GZ6 A;  2UUC E;  1H72 C;  4BS9 A;  2V2Q A;  4PRV A;  4DPX A;  4B3R E;  2V2Z A;  2BV3 A;  4KHP E;  2DMY A;  2UU9 I;  4URL A;  2CG9 A;  4B3S E;  2JR1 A;  3J80 C;  3HTX A;  4GKK E;  1J5E I;  4JG4 A;  4K0K I;  2RS6 A;  2LBS B;  4DR2 E;  3LTO A;  2LJH A;  4R1F A;  5A2Q Q;  3B8H A;  3J81 C;  4JI5 E;  4LFA I;  2IOP A;  2ODR D;  1B62 A;  4J8Z A;  4DUY E;  4YY3 I;  4B3T I;  4Q28 A;  1Z5B A;  4GEQ B;  4BCA A;  3PYE A;  1X48 A;  4WYQ B;  4FWH A;  1H73 A;  4WPY A;  2Z5B A;  4LF8 E;  1HNX I;  4DV4 E;  4IZJ A;  2NUG A;  1S16 A;  4ZVI A;  1XNQ E;  3K6Q A;  3ZM7 A;  1XMQ E;  1Y4S A;  2F4V E;  4OX9 I;  1NHI A;  1N0V C;  4B3M E;  2RS7 A;  5GME A;  1HNZ E;  1ZXM A;  3ADL A;  2L2K B;  3HQ1 A;  4DV2 E;  2B9D A;  4DV6 E;  2UUC I;  3F6G A;  1HR0 E;  4JI7 E;  4I3H A;  2VQF I;  1ZM3 A;  3K1J A;  4JI6 E;  4B3R I;  2PNM A;  4FWG A;  1ZXN A;  4KHP I;  2V83 A;  2UUA E;  1FNM A;  4P7D A;  2N3H A;  4I8O A;  4JI3 E;  1IBK E;  3Q6N A;  2Z5C A;  3T1H E;  1NHJ A;  2Z5B B;  4DUZ I;  4IZJ B;  3PYG A;  2NUE A;  4P78 A;  4GKK I;  4LU9 A;  4DR2 I;  3IWD A;  2MC6 A;  2O1W A;  4DV1 E;  1UEK A;  1X47 A;  4MYT A;  2ZM6 E;  4JI5 I;  4WSP A;  2LE2 A;  2LMZ A;  2VF3 A;  2L2N A;  3F0N A;  4IZK A;  2KOU A;  4LF7 E;  4BMJ A;  2E5L E;  1T4O A;  4LF8 I;  1USU A;  2JOX A;  1XNQ I;  2NA2 A;  5F3W A;  1XMQ I;  2Z5C B;  2F4V I;  4WUB A;  3ZZT A;  3K17 A;  4B3M I;  1RRE A;  3RMP A;  2FTX B;  1WUU A;  1HNZ I;  1RR9 A;  1FJG E;  1K47 A;  4HXZ A;  1Y6Z A;  4DV2 I;  4DR6 E;  2F8B A;  2HK3 A;  4DV6 I;  1HR0 I;  4JI7 I;  1FKA E;  2HHH E;  2UUB E;  4JI6 I;  4JV5 E;  1WXR A;  4JI2 E;  3QT6 A;  2CPN A;  3C4B A;  3T1Y E;  3J7A G;  4IZK B;  2UUA I;  3B78 A;  4JI3 I;  2LTS A;  1IBK I;  3ADG A;  4DR3 E;  3T1H I;  1PIE A;  4LFB E;  2VQF E;  5LL6 R;  1H7S A;  1VIS A;  3HPZ A;  4Z7Y A;  4LF6 E;  3Q6M A;  4ED4 A;  4F9B B;  4AQY E;  4F9C B;  4DV1 I;  3WU3 A;  4PU9 A;  4DR4 E;  5BR8 E;  4X64 I;  1D6T A;  2ZM6 I;  4JI1 I;  1Y4U A;  4DUZ E;  2NUF A;  2L8T A;  3VYY A;  1YYK A;  1N36 E;  1XMO I;  2V34 A;  3H4L A;  4LF7 I;  4NXM E;  2E5L I;  2OI2 A;  3M6A A;  4LF4 E;  3P1X A;  2GS8 A;  4LF9 E;  3AV0 A;  2EFG A;  4WFT A;  3MSW A;  2V86 A;  3QT7 A;  3IWC A;  2ZBK B;  2FV4 B;  4DPT A;  5AAS A;  1FJG I;  4LTY A;  4M1K A;  2V2V A;  1A6F A;  4DR6 I;  1Z0B A;  4WUC A;  4DPY A;  2L3C A;  2A2C A;  1N33 E;  2XEX A;  4JYA E;  2HHH I;  2MC5 A;  4DR5 E;  2UUB I;  4JV5 I;  1IBM E;  4JI2 I;  3T1Y I;  5LMN E;  2HKE A;  5FLX Q;  4PRX A;  3K85 A;  2LRS A;  3V5R A;  3ZKD A;  2WZO A;  1ZBQ A;  1IBL E;  4DR3 I;  5DNY A;  4TUI A;  4BC9 A;  4LFB I;  1GQE A;  2O1U A;  1EKZ A;  5AE2 A;  4LF6 I;  2JWO A;  2WW4 A;  4AQY I;  4DV7 E;  1MX0 A;  4RPF A;  2M1S A;  2L2M A;  1EI1 A;  1XNR I;  5BR8 I;  4DR4 I;  3HUL A;  1Z0G A;  3KWR A;  1KKH A;  1N36 I;  4DXL A;  4KZS A;  4NXM I;  4X64 E;  4F9A B;  4X65 E;  1Z0W A;  4JI1 E;  2ZIT A;  4LF4 I;  4LF9 I;  1HK7 A;  1J26 A;  1XMO E;  4P52 A;  4IZJ D;  4JI0 E;  4XTJ A;  3DF6 A;  2H36 X;  2FGG A;  1OJ4 A;  3QT8 A;  2M4I A;  3JAM Q;  5FLX C;  3GON A;  2JVA A;  2JOB A;  4TUG A;  2BM1 A;  2V8P A;  2K4V A;  1PKP A;  4FN5 A;  1N33 I;  4JYA I;  2V88 A;  4DR5 I;  1UIL A;  1IBM I;  3LNU A;  5FWK A;  5LMN I;  4BBY A;  1NZ0 A;  4JI4 E;  1NHH A;  1T4N A;  4DR7 E;  3ZZ0 A;  1IBL I;  1QU6 A;  2UXB I;  1HNW E;  4JI8 E;  2LTR A;  2N3G A;  2J7K A;  4MYU A;  5IWA I;  3LLH A;  1ZM2 A;  5GMD A;  4FWD A;  3ADI A;  3ZZU A;  4DV7 I;  2B3T B;  1KIJ A;  5L3J A;  1U2R A;  3WU5 A;  4L8N A;  2LUP B;  1Z5A A;  2V87 A;  5AE3 A;  2GQ0 A;  1RQ0 A;  3J7A M;  4DMI A;  1BKN A;  2IOQ A;  2L6M A;  2A2D A;  2UXD E;  1FI4 A;  1DQ3 A;  4M30 A;  5LMU E;  2X36 A;  1XNR E;  3WU6 A;  4GKJ E;  3LPS A;  2JY9 A;  3OML A;  1FWL A;  2R42 A;  1KTV A;  4X65 I;  3C4T A;  3JU0 A;  1RC7 A;  4DV3 E;  2AJ4 A;  3JAM C;  2X7I A;  1N34 E;  4DU7 A;  2LUQ A;  1UHZ A;  4NXN E;  4JI0 I;  4KQV A;  3ADJ A;  4DPW A;  4DV5 E;  1MG7 A;  2YT4 A;  1X49 A;  2E1R A;  3H09 A;  4X8W A;  4YHH E;  4M2Z A;  4OOG C;  2O1T A;  1N0U A;  4F54 A;  4Z7C A;  3WU4 A;  2R3V A;  3OTO E;  1WHN A;  4UT4 A;  2L92 A;  3ZOQ B;  1DI2 A;  1FWK A;  4P7A A;  1Z5C A;  4R03 A;  4JI4 I;  1QZR A;  3AUZ A;  4DR7 I;  2UXC I;  2G7H A;  3HJC A;  2CGE A;  1EA6 A;  2VQE I;  5T6J A;  4LFC E;  2HKJ A;  2IHR 1;  1HNW I;  4JI8 I;  4LF5 E;  2V89 A;  3J7Y p;  4DU8 A;  2B7T A;  1DAR A;  3LML A;  4DR1 E;  1I94 E;  2MDR A;  2HK2 A;  4X66 E;  5CFF E;  2DB2 A;  5ADZ A;  3HPS A;  2PNL A;  1N32 E;  4USM A;  2UXB E;  1Z0C A;  3VYX A;  2Z5E A;  4EMD A;  1YYW A;  1XHK A;  5IWA E;  2UXD I;  1YZ9 A;  1B63 A;  1PVG A;  5LMU I;  2KON A;  3QT5 A;  3VK6 A;  2BM0 A;  1WHQ A;  4GKJ I;  4R8O A;  4DV3 I;  1N34 I;  4NXN I;  3DJW A;  3PRY A;  2ODR C;  1SR9 A;  4DV5 I;  1Z0E A;  5IT9 Q;  4UTG A;  4X62 E;  1Z0T A;  4YHH I;  4HYM A;  4M0V A;  2EZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...