4JI7E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji7E02
3QT5A 4M30A 1FJGE 4DUYE 1WHQA 3WU6A 4HXZA 2IHR1 2HHHI 4X66I 1ZM4A 4LFBI 4FWHA 3J7AM 3VYXA 2HFUA 2VQEI 4WUDA 3F0NA 1YYKA 5BR8E 4P7AA 2A2CA 3WU3A 3J80C 1IBME 3ADLA 3ADIA 4DR1E 2DB2A 3B8HA 1MX0A 1FWKA 4DPYA 1N34E 1KKHA 1IBKE 1PVGA 2UUBE 1RREA 4JG4A 1IBLE 3PYFA 1RQ0A 1YYWA 1XNRE 1N36E 4DR6I 1KTVA 1ZM9A 3C4TA 1T4OA 1Z0EA 4USMA 1O0WA 1Z0BA 4DR7I 4JI8E 4KHPE 1D6TA 3WU4A 4YY3E 4JYAE 2LJPA 2Q2EB 2UXDI 4LFCE 5FLXC 2L2MA 2J7KA 3ZZ0A 4LF5E 4JI1E 3ZZTA 2X7IA 1Z5AA 1WUUA 3C4BA 1UILA 4FW9A 2VQFE 2X36A 1H73A 4DV1I 3J81Q 2UUCE 3OTOI 1T4NA 4LF8I 1HNWE 3ADJA 2NUGA 4M1KA 4DU8A 1XMQI 2EFGA 4DV7I 1GQEA 4JI5E 4GKKE 2HK3A 4JI3E 3B78A 4PRXA 4DPXA 4DV3E 4ZVIA 4KQVA 1XMOI 1J26A 4LF4I 4NXNI 3HTXA 4DV2I 4DV4E 3JAMQ 2BM0A 2V34A 3ZZUA 3PYEA 5IWAE 1J5EE 2UXCE 4LF9I 4DR2I 4NXNE 2HFSA 1HNZE 1Z5BA 1ZM2A 4XTJA 2LBSB 2LUQA 3ZKDA 2F4VE 2OI2A 3GONA 4M2ZA 4JI3I 4FWDA 1UHZA 1XMQE 3WU5A 4YHHE 2HKEA 4R1FA 4DR3E 4DV0I 4DR4E 1N0VC 5CFFE 4LF8E 4GKJI 4ED4A 2UUCI 2BM1A 4JI2E 1PIEA 3LTOA 4PU9A 4DR2E 3PYDA 1N32E 4NXME 1J5EI 4JI0I 2L3JA 1Z0WA 1ZM3A 2L2NA 4JI1I 2BV3A 2LRSA 2LTRA 5LMUI 2LUPB 2JY9A 2B7VA 3QT7A 2UXDE 2UU9E 2VF3A 5IT9Q 2ZM6E 4LF4E 2RS6A 1RC7A 4RPFA 3J81C 1N36I 1HR0I 4NXMI 2V2VA 2LJHA 1N32I 1XNRI 1FWLA 1RR9A 4HACA 5A2QQ 4DR4I 3OTOE 4DV1E 2V2ZA 5FLXQ 1EKZA 2VQFI 1N34I 2MDRA 3D4JA 1HR0E 4DKKA 2F4VI 4LF5I 1HNZI 4DR1I 4WUBA 2HKJA 1YYOA 2ZM6I 4Z7CA 4DU7A 4WFTA 1EA6A 2UU9I 4JI8I 4DR7E 2UXCI 2VQEE 5LMUE 3V2UC 5IWAI 3ZKBA 4LFBE 4I3HA 4JI0E 1NHIA 3HULA 1Z0GA 1U2RA 4JI2I 4GKJE 4DV0E 4DR3I 4YHHI 1IBKI 2A2DA 4WUCA 4DR5E 4JI5I 4GKKI 1QU6A 3CWVA 4URLA 4UT4A 1HNWI 1EI1A 1IBMI 4HACB 1NHHA 2N3GA 2KHXA 5BR8I 4LF9E 1ZXMA 2GS8A 4EMDA 5LMNI 1KIJA 3J7AG 5IT9C 3T1YE 2HHHE 2L3CA 4LFCI 1KVKA 2UXBE 4DV4I 4DV2E 1XNQE 1B63A 3PYGA 4DUYI 1QZRA 3LPSA 1XMOE 1YZ9A 2B3TB 4DV3I 2L2KB 4DV5I 2B7TA 3QT6A 1NHJA 1ZXNA 2RSMA 2N3HA 2CPNA 2RS7A 4DV7E 4AQYI 2NA2A 4JI7I 5GMEA 1IBLI 4B3ME 2EZ6A 2L33A 4OX9E 2NPFA 1S4EA 1X49A 4FWGA 4LF6I 1K47A 2V2QA 3Q1QA 4HY1A 1OJ4A 2DMYA 4MYUA 1T4LB 4HYMA 1X47A 4YY3I 4JYAI 3H4LA 4USKA 4DV6E 4DPUA 4KHPI 2JVAA 4LF7E 1H7SA 2CZ9A 2R42A 4DUZE 4DPTA 2RTXA 4DR6E 4X66E 1XHKA 4JI6E 4X64E 4JV5E 4DXLA 2ZBKB 2UUBI 2NUEA 1ZBTA 4X65E 4X65I 5LL6R 2WW4A 3P1XA 3K1JA 2AJ4A 2YT4A 1H7UA 3JAMC 4JV5I 3V5RA 4B3TE 1VISA 4X8WA 1FNMA 4JI6I 1BKNA 4X62E 1PKPA 1HNXI 1N33E 1N33I 1Z0TA 4X62I 2E5LE 2V8PA 4B3TI 1B62A 1X48A 2HK2A 1FJGI 2NUFA 4K0KE 1A6FA 1H74A 1S16A 5L3JA 1DARA 1FI4A 4B3RE 1H72C 1STUA 1I94E 3T1HI 3ADGA 2XEXA 4LF6E 1DI2A 4OX9I 3LLHA 4LFAE 3QT8A 4B3SI 2LTSA 4WYQB 1Z0CA 1WHNA 4AQYE 3T1HE 1I94I 4X64I 2DIXA 1MG7A 3VYYA 1UEKA 4DV5E 4JI4I 4DUZI 2R3VA 2ZITA 4LF7I 3LNUA 3M6AA 2UUAI 4DV6I 1XNQI 3ZM7A 2UUAE 2UXBI 2E5LI 1FKAE 2DEJA 3T1YI 3K17A 1N0UA 2DEIA 4JI4E 4DPWA 1Z0VA 3B82A 4PRVA 5LMNE 1HNXE 4MYTA 3J80Q 1Z5CA 2E1RA 5A2QC 4Z7YA 4OOGC 4B3SE 4P52A 4LFAI 1ELOA 4B3MI 5GMDA 1Z59A 3J7Yp 4JI7E 1MU5A 4DR5I 4B3RI 1NZ0A 4FN5A 4UTGA 4K0KI
chains in the Genus database with same CATH superfamily
3QT5A 2WBSA 3Q6MA 2ENAA 4M30A 4DUYE 2I9IA 1FJGE 2EL4A 1YUJA 1WHQA 4O24A 3WU6A 2M7QA 4HXZA 2IHR1 2DMIA 2HHHI 1GZ6A 4X66I 2DLQA 1YUIA 1ZM4A 4LFBI 5A69A 3GMEA 4FWHA 5AASA 3J7AM 5K36E 1ZAAC 1ZR9A 1WRJA 2C37B 3VYXA 2HFUA 2VQEI 2EPNA 3HPZA 4WUDA 5ELWA 4WXCA 1YYKA 2CGEA 5BR8E 3EPHA 1YSAC 2EN4A 3F0NA 1EH7A 4P7AA 2Z5BA 2A2CA 2M9AA 1F2IG 3WU3A 3J80C 1IBME 3H1CA 4U3BA 3ADLA 3ADIA 4DR1E 2RQLA 2DB2A 3B8HA 1MX0A 1FWKA 2PNZB 4DPYA 2EM8A 1A1LA 1X3CA 2DSYA 3PS3A 1OYPA 4MDTA 1EH6A 2PRTA 2L92A 2LV2A 1N34E 2LVHA 1KKHA 1IBKE 1YFHA 3TQMA 3DD6A 1PVGA 2UUBE 3IWBA 1UBDC 1RREA 2DLKA 1X6HA 3THOB 1PJQA 1IBLE 4JG4A 2B9DA 4FK5C 3PYFA 1RQ0A 1YYWA 2PO2A 1XNRE 5KL7A 4AIMA 5C0XF 4P7DA 1IQSA 5IV8B 1E3HA 5KL4A 2YTNA 1N36E 3P3GA 3AV0A 4DR6I 1NEIA 4WX9A 1MEYC 3C4TA 1KTVA 1ZM9A 1T4OA 4BBYA 1X5WA 2I13A 1OYSA 2LT7A 1Z0EA 4USMA 2EPKX 5JEAD 4R03A 2EM0A 5T6JA 1BB8A 1O0WA 2YRKA 1Z0BA 4DR7I 4JI8E 4KHPE 1D6TA 2O3ZA 3WU4A 4YY3E 4JYAE 1GTKA 2GLIA 2O1VA 3Q6NA 2LJPA 1VI7A 2Q2EB 4J3DA 4LCGA 3U1KA 2UXDI 5FLXC 4LFCE 2C37A 1G2FC 2L2MA 2FGGA 2J7KA 4TUGA 1USVA 3ZZ0A 2JYAA 4IZJA 5K36C 4LF5E 1Y60A 4JI1E 4M9VC 1TF6A 5C0XE 3ZZTA 1A1JA 2IESA 2X7IA 1Z5AA 4Q28A 1WUUA 3C4BA 1UILA 4FW9A 2VQFE 2X36A 4FW5A 3KZYA 1H73A 4BA1B 2O1WA 4DV1I 3J81Q 2UUCE 4IJDA 3OTOI 1T4NA 2F8BA 2EORA 4KZSA 4LF8I 4IFDA 4F9CB 1P47A 1HNWE 3ADJA 2NUGA 5DRRA 2NABA 4M1KA 2C39A 3HKMA 4DU8A 2CVEA 1XMQI 2EFGA 4DV7I 2EPXA 1GQEA 2JOBA 4JI5E 4GKKE 2HK3A 4IS9A 4JI3E 5F3WA 2FV4B 3B78A 4PRXA 4DPXA 1A1HA 1OYRA 2PNLA 5JEAB 2JPAA 4DV3E 4O4KA 4ZVIA 4KQVA 1XMOI 2R76A 1J26A 4F9BB 5DNYA 4LF4I 2AE8A 4NXNI 4WPYA 2EP3A 3HTXA 4DV2I 4DV4E 1KJKA 1HK7A 1E3PA 3JAMQ 1USUA 2ODRC 2BM0A 3QG5C 1SFEA 2EM5A 5A6KA 2V34A 2EM7A 2WNRB 3PYEA 4WSGA 4GQUA 3ZZUA 5IWAE 2HGHA 1BBOA 1J5EE 1KYQA 1Z1BA 1R6MA 2WP8B 2UXCE 4LF9I 2K7IA 4IFDE 4DR2I 2L8TA 2YTOA 2YU8A 3MHSC 2JXPA 2JEAA 2DRPA 4NXNE 1Y4UA 2JOXA 5A6AA 2H36X 3K85A 2EM2A 4TUIA 2HFSA 4FW7A 2FTXB 1HNZE 1Z5BA 4IZJB 1ZM2A 4XTJA 2LBSB 2LUQA 3ZKDA 1A1GA 2F4VE 2OI2A 3GONA 4M2ZA 1N3GA 2PO0A 4JI3I 4GEQB 5LLQA 2VE7C 1Y6ZA 1NCSA 2YTDA 1UHZA 2KONA 2CTDA 1XMQE 4FWDA 3WU5A 4BA2A 2C38A 4OO1A 1UDQA 4YHHE 2HKEA 4R1FA 2EMZA 2YTFA 4DR3E 2CT1A 4DV0I 4DR4E 1N0VC 5CFFE 4LF8E 1P42A 2PO0B 4GKJI 4IZKA 4ED4A 4F9AB 1X6EA 3THNA 2BM1A 2UUCI 4R2RA 2M4IA 4JI2E 1PDAA 2EPOA 3F6HA 1A1KA 1PIEA 3EQ1A 5KL6A 3LTOA 2V8QB 4DR2E 4PU9A 3PYDA 4QNKA 1N32E 4NXME 5A6JA 4FW6A 1J5EI 2YTIA 2EJ4A 2JP9A 4JI0I 2L3JA 2YTGA 1BBGA 1Z0WA 1ZM3A 2L2NA 4JI1I 2JE6B 2BV3A 4F2JC 2LRSA 3F6GA 5C0XB 2LTRA 1A1IA 5LMUI 2LUPB 2JY9A 2B7VA 3QT7A 2EL5A 2CSHA 2UXDE 2ELYA 2EMYA 3B4TA 2UU9E 3IWDA 2VF3A 5IT9Q 2ZM6E 4LF4E 3IWCA 3KWRA 2IERA 2RS6A 3K6QA 1RC7A 4RH8A 4RPFA 2NN6B 5JEAF 5EKWA 2ODRD 3KRNA 4OO1D 3J81C 3U1YA 4I8OA 1N36I 5JEAE 1HR0I 5K36F 1UN6B 1Y5YA 3PS2A 4NXMI 4R2EA 2LJHA 2V2VA 1N32I 1XNRI 2JEBB 4BS9A 1FWLA 4LPFA 1RR9A 3M85D 4LOMA 2EM3A 2N8XA 4HACA 2IOQA 2EPCA 2O1TA 2LJUA 3JTZA 2CG9A 2J65A 5A2QQ 4DR4I 3OTOE 2E1MA 2EM6A 4DV1E 2V2ZA 5FLXQ 1EKZA 2EOOA 2VQFI 2YWQA 1N34I 4P78A 4MQYA 1YPNA 2MDRA 1EH8A 2V85A 3L00A 3D4JA 2EOIA 1HR0E 5DRPA 4DKKA 2F4VI 2EN3A 2IOPA 5KL5A 4LF5I 2GPIA 4DR1I 4WUBA 1HNZI 1PJTA 2HKJA 2EOZA 3BGHA 2MC6A 2G7HA 1YYOA 2ZM6I 4AIDA 4ISAA 2PNZA 4DU7A 2NN6D 4Z7CA 4IFDB 4X9JA 4WFTA 2MKDA 1EA6A 2WNRA 2UU9I 1QNTA 2EPUA 2PO2B 4JI8I 3AUZA 4DR7E 2UXCI 2EOFA 3P76A 2VQEE 5LMUE 3V2UC 3L7ZA 5IWAI 3ZKBA 2MDGA 4N4RB 4F6MA 4LFBE 4I3HA 5JEAA 3BF2A 2EWLA 4JI0E 2JE6A 5C0XD 3M7ND 2EOHA 1NHIA 2VF1A 2NN6A 3HULA 1Z0GA 1RHYA 3EPJA 4MU1A 2EMBA 4LCHA 1U2RA 1UDNA 4AM3A 4JI2I 5AC4A 2V83A 4R2PA 4MU0A 4GKJE 2EN2A 2K4VA 4DV0E 4DR3I 1XXEA 2GO3A 4YHHI 1IBKI 2LMZA 3M85G 2A2DA 3DF6A 4BC7A 2HJJA 5AE3A 4WUCA 5AC5A 4DR5E 4MU3A 3KZZA 4R2AA 4JI5I 1QU6A 4DMIA 3CWVA 4GKKI 2WZOA 4IS1C 2RPCA 4URLA 4IFDD 4UT4A 4KWYA 1X6FA 1EI1A 1UDOA 2Z5EA 1HNWI 1IBMI 4R2DA 4HACB 1NHHA 2A25A 3M7NG 2N3GA 2DGCA 2EN7A 2KHXA 2YRMA 2EMGA 5BR8I 3JU0A 2YTPA 5TSEA 4R2SA 2E72A 1T39A 2EE8A 2ENCA 4LF9E 3CDIA 4OO1E 1ZXMA 2GS8A 4EMDA 5LMNI 1KIJA 3PS1A 3J7AG 5IT9C 1TF3A 2EOXA 2LCEA 4ZYDA 3T1YE 2HHHE 2BA0G 2L3CA 4LFCI 4R2QA 1KVKA 2UXBE 2BR2B 3VHTB 2YZTA 4DV4I 3M99B 4DV2E 1XNQE 1B63A 3PYGA 4DUYI 1QZRA 2LO3A 3LPSA 1XMOE 4U3DA 1YZ9A 2BR2A 2B3TB 4MLQA 2L2KB 3H09A 4DV3I 1Y4SA 2B7TA 2EM4A 2EPMX 3QT6A 4FW3A 2EMWA 1NHJA 4DV5I 1ZXNA 2GO4A 4QNJA 2RSMA 2CPNA 2N3HA 5K36A 2RS7A 3HQ1A 5AE2A 2WP8A 2NN6C 2EPRA 4DV7E 4AQYI 2NA2A 4JI7I 5GMEA 1IBLI 4B3ME 2EZ6A 3BIDA 2HC5A 5K36B 2L33A 4ZYEA 4OX9E 2NPFA 1S4EA 1ZU1A 1X49A 4FWGA 4LF6I 1YHCA 1K47A 2V2QA 2EN6A 4BHCA 4N3OA 1L4SA 2EMCA 4GZNC 3Q1QA 4HY1A 1OJ4A 2EOSA 4L5NC 2EL6A 2PNMA 2BB8A 2DMYA 1YH8A 3UK3C 2C39B 3VK6A 1T4LB 4MYUA 4HYMA 3FIGA 4BMJA 1X47A 3P06A 4YY3I 4JYAI 2YTQA 3H4LA 1JK2A 4USKA 4DV6E 2EM9A 2MC5A 4DPUA 4F6NA 4FW4A 4KHPI 4OO1C 1WJPA 2JVAA 4LF7E 1H7SA 5EL9A 2WBUA 2CZ9A 2BA1G 2R42A 2WBTA 2EPPA 4DUZE 4IZJD 4M0VA 4DPTA 3MHHC 3L7ZB 2L6MA 3DJWA 1G2DC 2RSIA 2RTXA 2EOJA 4DR6E 2YTJA 2M1SA 4X66E 4MU4A 2YSPA 1XHKA 4JI6E 2BA0D 4IFDC 4X64E 4LCFA 2F1DA 2D9HA 4JV5E 1AH5A 4DXLA 1WXRA 4NZVA 5ADZA 4Q35B 2ZBKB 2UUBI 4BHBA 4R8OA 2NUEA 2V88A 1RMDA 3C6MA 2EMAA 3EPKA 3RMPA 1ZBTA 2O1UA 2NN6F 2J7JA 5DNLA 4X65E 4X65I 4O43A 4WXDA 5LL6R 2Q8UA 3ZOQB 3ECRA 2Z5CB 1B69A 1T38A 2EN8A 2WW4A 3P1XA 3K1JA 4BCAA 1ZBQA 2KOUA 3UHMA 2AJ4A 1TN9A 2YT4A 3JAMC 4O5GA 1H7UA 2Z5BB 4JV5I 3V5RA 2EMHA 5KL2A 4B3TE 4NHRA 2EPZA 1VISA 4X8WA 1FNMA 5AE1A 2JEBA 1BKNA 3NZKA 4JI6I 4X62E 1PKPA 1HNXI 2VRDA 1N33E 1N33I 2GQ0A 4RHBB 1Z0TA 3P3CA 4X62I 2EPAA 2JR1A 2E5LE 4NBQA 4OZEA 2V8PA 1JK1A 3BBGA 4BA1A 1B62A 4B3TI 1X48A 2V89A 4F54A 4R2CA 2HK2A 2PO1A 2EOMA 2V86A 4HTGA 1FJGI 3MSWA 2NUFA 3HPSA 4K0KE 1A6FA 1H74A 2C38B 2VESA 3PRYA 4OKGA 1S16A 2BA1D 1AAYA 5L3JA 1DARA 5DNXA 2ENHA 1FI4A 3OMLA 4B3RE 3GLLA 2EOYA 3LMLA 3HJCA 1IMUA 4BA2B 1H72C 1PJSA 1STUA 1DGCA 1I94E 3T1HI 5DRQA 3ADGA 2XEXA 5K36D 2EQ3A 4LF6E 2WCC3 1DI2A 2EQ1A 4OX9I 1MGTA 3LLHA 4LFAE 3QT8A 2ELZA 2LTSA 4B3SI 2Z5CA 4WYQB 1Z0CA 1WHNA 4AQYE 3T1HE 4LU9A 1I94I 4X64I 2NN6E 4L8NA 2DIXA 2JWOA 2BBGA 1MG7A 3VYYA 2LE2A 1UEKA 4DV5E 4JI4I 4DUZI 1A1FA 2EOEA 2YTEA 4WSPA 2R3VA 2ZITA 5KL3A 4LF7I 4IFDF 3LNUA 3M6AA 5FWKA 2EQ0A 2JEAB 4LTYA 2UUAI 4DV6I 1XNQI 3ZM7A 5C0XC 2UUAE 2UXBI 2YPNA 2E5LI 1FKAE 2DEJA 3T1YI 1IQOA 3K17A 4OO1F 1N0UA 2DEIA 4JI4E 4DPWA 3EPLA 1Z0VA 3B82A 3C6KA 2ADRA 2R1FA 4ZYHA 2YRHA 5LMNE 1HNXE 2EMXA 4IZKB 4PRVA 4MYTA 3J80Q 2PO1B 1Z5CA 4J8ZA 4OO1B 3P3EA 2E1RA 5IXMB 2JT2A 5DROA 2GHFA 5A2QC 2EMIA 2EMKA 2EPLX 4MLVA 5A6BD 4Z7YA 4OOGC 4B3SE 4P52A 5JEAC 1ELOA 4LFAI 2EMFA 5GMDA 4B3MI 1Z59A 1SR9A 2V87A 2MKNA 3GCMA 3J7Yp 4JI7E 4HEIA 1MU5A 1UDSA 1LLMC 3CDJA 4DR5I 1DQ3A 4B3RI 1R6LA 5C0XA 2EN1A 4BC9A 1NZ0A 3HXLA 2EMLA 4ZYGA 4FN5A 4UTGA 2YU5A 2YSOA 5A6BA 4K0KI 2EOQA
chains in the Genus database with same CATH topology
3QT5A 3Q6MA 4M30A 1FJGE 4DUYE 1WHQA 3WU6A 2M7QA 4HXZA 2IHR1 2HHHI 1GZ6A 4X66I 1ZM4A 4LFBI 4FWHA 5AASA 3J7AM 3VYXA 2HFUA 2VQEI 3HPZA 4WUDA 2CGEA 1YYKA 3F0NA 5BR8E 4P7AA 2Z5BA 2A2CA 3WU3A 3J80C 1IBME 3ADLA 3ADIA 4DR1E 2DB2A 3B8HA 1MX0A 1FWKA 4DPYA 2DSYA 1N34E 2L92A 1KKHA 1IBKE 1PVGA 2UUBE 3IWBA 1RREA 1IBLE 4JG4A 2B9DA 3PYFA 1RQ0A 1YYWA 1XNRE 4P7DA 1N36E 3AV0A 4DR6I 1KTVA 1ZM9A 3C4TA 1T4OA 4BBYA 1Z0EA 4USMA 4R03A 5T6JA 1O0WA 1Z0BA 4DR7I 4JI8E 4KHPE 1D6TA 3WU4A 4YY3E 4JYAE 2O1VA 3Q6NA 2LJPA 2Q2EB 2UXDI 5FLXC 4LFCE 2L2MA 2FGGA 2J7KA 4TUGA 1USVA 3ZZ0A 4IZJA 4LF5E 4JI1E 3ZZTA 2X7IA 1Z5AA 4Q28A 1WUUA 3C4BA 1UILA 4FW9A 2VQFE 2X36A 1H73A 2O1WA 4DV1I 3J81Q 2UUCE 3OTOI 1T4NA 2F8BA 4LF8I 4KZSA 4F9CB 1HNWE 3ADJA 2NUGA 4M1KA 4DU8A 1XMQI 2EFGA 4DV7I 2JOBA 1GQEA 4JI5E 4GKKE 2HK3A 4JI3E 5F3WA 2FV4B 3B78A 4PRXA 4DPXA 2PNLA 4DV3E 4ZVIA 4KQVA 1XMOI 1J26A 4F9BB 5DNYA 4LF4I 4NXNI 4WPYA 3HTXA 4DV2I 4DV4E 1HK7A 3JAMQ 1USUA 2ODRC 2BM0A 2V34A 3ZZUA 3PYEA 5IWAE 1J5EE 2UXCE 4LF9I 4DR2I 2L8TA 4NXNE 1Y4UA 2JOXA 2H36X 3K85A 4TUIA 2HFSA 2FTXB 1HNZE 1Z5BA 4IZJB 1ZM2A 4XTJA 2LBSB 2LUQA 3ZKDA 2F4VE 2OI2A 3GONA 4M2ZA 4JI3I 4GEQB 2VE7C 1Y6ZA 4FWDA 1UHZA 2KONA 1XMQE 3WU5A 4YHHE 2HKEA 4R1FA 4DR3E 4DV0I 4DR4E 1N0VC 5CFFE 4LF8E 4GKJI 4IZKA 4ED4A 4F9AB 2UUCI 2BM1A 4JI2E 2M4IA 1PIEA 3F6HA 3LTOA 4PU9A 2V8QB 4DR2E 3PYDA 1N32E 4NXME 1J5EI 4JI0I 2L3JA 1Z0WA 1ZM3A 2L2NA 4JI1I 2BV3A 2LRSA 3F6GA 2LTRA 5LMUI 2LUPB 2JY9A 2B7VA 3QT7A 2UXDE 2UU9E 3IWDA 2VF3A 5IT9Q 2ZM6E 4LF4E 3IWCA 3KWRA 2RS6A 3K6QA 1RC7A 4RPFA 2ODRD 3J81C 4I8OA 1N36I 1HR0I 4NXMI 2V2VA 2LJHA 1N32I 1XNRI 4BS9A 1FWLA 1RR9A 4HACA 2IOQA 2O1TA 2CG9A 3JTZA 5A2QQ 4DR4I 3OTOE 2E1MA 4DV1E 2V2ZA 5FLXQ 1EKZA 2VQFI 1N34I 4P78A 2MDRA 2V85A 3D4JA 1HR0E 4DKKA 2F4VI 2IOPA 4LF5I 1HNZI 4DR1I 4WUBA 2HKJA 2MC6A 2G7HA 1YYOA 2ZM6I 4Z7CA 4DU7A 4WFTA 1EA6A 2UU9I 4JI8I 3AUZA 4DR7E 2UXCI 2VQEE 5LMUE 3V2UC 5IWAI 3ZKBA 4LFBE 4I3HA 2EWLA 4JI0E 1NHIA 2VF1A 3HULA 1Z0GA 1U2RA 4JI2I 2V83A 4GKJE 2K4VA 4DV0E 4DR3I 4YHHI 1IBKI 2LMZA 2A2DA 3DF6A 4BC7A 5AE3A 4WUCA 4DR5E 4JI5I 4GKKI 1QU6A 4DMIA 3CWVA 2WZOA 4URLA 4UT4A 1HNWI 1EI1A 2Z5EA 1IBMI 4HACB 1NHHA 2N3GA 2KHXA 5BR8I 3JU0A 4LF9E 1ZXMA 2GS8A 4EMDA 5LMNI 1KIJA 3J7AG 5IT9C 3T1YE 2HHHE 2L3CA 4LFCI 1KVKA 2UXBE 2YZTA 4DV4I 4DV2E 1XNQE 1B63A 3PYGA 4DUYI 1QZRA 3LPSA 1XMOE 1YZ9A 2B3TB 4DV3I 2L2KB 3H09A 1Y4SA 2B7TA 4DV5I 3QT6A 1NHJA 1ZXNA 2RSMA 2N3HA 2CPNA 2RS7A 3HQ1A 5AE2A 4DV7E 4AQYI 2NA2A 4JI7I 5GMEA 1IBLI 4B3ME 2EZ6A 2L33A 4OX9E 2NPFA 1S4EA 1X49A 4FWGA 4LF6I 1K47A 2V2QA 4N3OA 3Q1QA 4HY1A 1OJ4A 4L5NC 2PNMA 2DMYA 4MYUA 3VK6A 1T4LB 4HYMA 3FIGA 4BMJA 1X47A 3P06A 4YY3I 4JYAI 3H4LA 4USKA 4DV6E 4DPUA 2MC5A 4KHPI 2JVAA 4LF7E 1H7SA 2CZ9A 2R42A 4IZJD 4DUZE 4M0VA 4DPTA 2L6MA 3DJWA 2RTXA 4DR6E 2M1SA 4X66E 1XHKA 4JI6E 4X64E 4JV5E 4DXLA 1WXRA 5ADZA 2ZBKB 2UUBI 4R8OA 2NUEA 2V88A 3RMPA 1ZBTA 2O1UA 4X65E 4X65I 3ZOQB 5LL6R 2Z5CB 2WW4A 3P1XA 3K1JA 4BCAA 1ZBQA 2KOUA 2AJ4A 2YT4A 3JAMC 1H7UA 2Z5BB 4JV5I 3V5RA 4B3TE 1VISA 4X8WA 1FNMA 5AE1A 4JI6I 1BKNA 4X62E 1PKPA 1HNXI 1N33E 1N33I 2GQ0A 1Z0TA 4X62I 2JR1A 2E5LE 2V8PA 4B3TI 1B62A 1X48A 2V89A 4F54A 2HK2A 2V86A 1FJGI 3MSWA 4K0KE 3HPSA 1A6FA 2NUFA 1H74A 3PRYA 1S16A 5L3JA 1DARA 1FI4A 3OMLA 4B3RE 3LMLA 3HJCA 1H72C 1STUA 1I94E 3T1HI 3ADGA 2XEXA 4LF6E 1DI2A 4OX9I 3LLHA 4LFAE 3QT8A 4B3SI 2LTSA 2Z5CA 4WYQB 1Z0CA 1WHNA 4AQYE 3T1HE 4LU9A 1I94I 4X64I 4L8NA 2DIXA 2JWOA 1MG7A 3VYYA 2LE2A 1UEKA 4DV5E 4JI4I 4DUZI 2R3VA 2ZITA 4WSPA 4LF7I 3LNUA 3M6AA 5FWKA 4LTYA 2UUAI 4DV6I 1XNQI 3ZM7A 2UUAE 2UXBI 2E5LI 1FKAE 2DEJA 3T1YI 3K17A 1N0UA 2DEIA 4JI4E 4DPWA 1Z0VA 3B82A 4PRVA 5LMNE 1HNXE 4IZKB 4MYTA 3J80Q 1Z5CA 4J8ZA 2E1RA 5A2QC 4Z7YA 4OOGC 4B3SE 4P52A 4LFAI 1ELOA 4B3MI 5GMDA 1Z59A 1SR9A 2V87A 3J7Yp 4JI7E 1MU5A 4DR5I 1DQ3A 4B3RI 4BC9A 1NZ0A 3HXLA 4FN5A 4UTGA 4K0KI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT5 A;  4M30 A;  1FJG E;  4DUY E;  1WHQ A;  3WU6 A;  4HXZ A;  2IHR 1;  2HHH I;  4X66 I;  1ZM4 A;  4LFB I;  4FWH A;  3J7A M;  3VYX A;  2HFU A;  2VQE I;  4WUD A;  3F0N A;  1YYK A;  5BR8 E;  4P7A A;  2A2C A;  3WU3 A;  3J80 C;  1IBM E;  3ADL A;  3ADI A;  4DR1 E;  2DB2 A;  3B8H A;  1MX0 A;  1FWK A;  4DPY A;  1N34 E;  1KKH A;  1IBK E;  1PVG A;  2UUB E;  1RRE A;  4JG4 A;  1IBL E;  3PYF A;  1RQ0 A;  1YYW A;  1XNR E;  1N36 E;  4DR6 I;  1KTV A;  1ZM9 A;  3C4T A;  1T4O A;  1Z0E A;  4USM A;  1O0W A;  1Z0B A;  4DR7 I;  4JI8 E;  4KHP E;  1D6T A;  3WU4 A;  4YY3 E;  4JYA E;  2LJP A;  2Q2E B;  2UXD I;  4LFC E;  5FLX C;  2L2M A;  2J7K A;  3ZZ0 A;  4LF5 E;  4JI1 E;  3ZZT A;  2X7I A;  1Z5A A;  1WUU A;  3C4B A;  1UIL A;  4FW9 A;  2VQF E;  2X36 A;  1H73 A;  4DV1 I;  3J81 Q;  2UUC E;  3OTO I;  1T4N A;  4LF8 I;  1HNW E;  3ADJ A;  2NUG A;  4M1K A;  4DU8 A;  1XMQ I;  2EFG A;  4DV7 I;  1GQE A;  4JI5 E;  4GKK E;  2HK3 A;  4JI3 E;  3B78 A;  4PRX A;  4DPX A;  4DV3 E;  4ZVI A;  4KQV A;  1XMO I;  1J26 A;  4LF4 I;  4NXN I;  3HTX A;  4DV2 I;  4DV4 E;  3JAM Q;  2BM0 A;  2V34 A;  3ZZU A;  3PYE A;  5IWA E;  1J5E E;  2UXC E;  4LF9 I;  4DR2 I;  4NXN E;  2HFS A;  1HNZ E;  1Z5B A;  1ZM2 A;  4XTJ A;  2LBS B;  2LUQ A;  3ZKD A;  2F4V E;  2OI2 A;  3GON A;  4M2Z A;  4JI3 I;  4FWD A;  1UHZ A;  1XMQ E;  3WU5 A;  4YHH E;  2HKE A;  4R1F A;  4DR3 E;  4DV0 I;  4DR4 E;  1N0V C;  5CFF E;  4LF8 E;  4GKJ I;  4ED4 A;  2UUC I;  2BM1 A;  4JI2 E;  1PIE A;  3LTO A;  4PU9 A;  4DR2 E;  3PYD A;  1N32 E;  4NXM E;  1J5E I;  4JI0 I;  2L3J A;  1Z0W A;  1ZM3 A;  2L2N A;  4JI1 I;  2BV3 A;  2LRS A;  2LTR A;  5LMU I;  2LUP B;  2JY9 A;  2B7V A;  3QT7 A;  2UXD E;  2UU9 E;  2VF3 A;  5IT9 Q;  2ZM6 E;  4LF4 E;  2RS6 A;  1RC7 A;  4RPF A;  3J81 C;  1N36 I;  1HR0 I;  4NXM I;  2V2V A;  2LJH A;  1N32 I;  1XNR I;  1FWL A;  1RR9 A;  4HAC A;  5A2Q Q;  4DR4 I;  3OTO E;  4DV1 E;  2V2Z A;  5FLX Q;  1EKZ A;  2VQF I;  1N34 I;  2MDR A;  3D4J A;  1HR0 E;  4DKK A;  2F4V I;  4LF5 I;  1HNZ I;  4DR1 I;  4WUB A;  2HKJ A;  1YYO A;  2ZM6 I;  4Z7C A;  4DU7 A;  4WFT A;  1EA6 A;  2UU9 I;  4JI8 I;  4DR7 E;  2UXC I;  2VQE E;  5LMU E;  3V2U C;  5IWA I;  3ZKB A;  4LFB E;  4I3H A;  4JI0 E;  1NHI A;  3HUL A;  1Z0G A;  1U2R A;  4JI2 I;  4GKJ E;  4DV0 E;  4DR3 I;  4YHH I;  1IBK I;  2A2D A;  4WUC A;  4DR5 E;  4JI5 I;  4GKK I;  1QU6 A;  3CWV A;  4URL A;  4UT4 A;  1HNW I;  1EI1 A;  1IBM I;  4HAC B;  1NHH A;  2N3G A;  2KHX A;  5BR8 I;  4LF9 E;  1ZXM A;  2GS8 A;  4EMD A;  5LMN I;  1KIJ A;  3J7A G;  5IT9 C;  3T1Y E;  2HHH E;  2L3C A;  4LFC I;  1KVK A;  2UXB E;  4DV4 I;  4DV2 E;  1XNQ E;  1B63 A;  3PYG A;  4DUY I;  1QZR A;  3LPS A;  1XMO E;  1YZ9 A;  2B3T B;  4DV3 I;  2L2K B;  4DV5 I;  2B7T A;  3QT6 A;  1NHJ A;  1ZXN A;  2RSM A;  2N3H A;  2CPN A;  2RS7 A;  4DV7 E;  4AQY I;  2NA2 A;  4JI7 I;  5GME A;  1IBL I;  4B3M E;  2EZ6 A;  2L33 A;  4OX9 E;  2NPF A;  1S4E A;  1X49 A;  4FWG A;  4LF6 I;  1K47 A;  2V2Q A;  3Q1Q A;  4HY1 A;  1OJ4 A;  2DMY A;  4MYU A;  1T4L B;  4HYM A;  1X47 A;  4YY3 I;  4JYA I;  3H4L A;  4USK A;  4DV6 E;  4DPU A;  4KHP I;  2JVA A;  4LF7 E;  1H7S A;  2CZ9 A;  2R42 A;  4DUZ E;  4DPT A;  2RTX A;  4DR6 E;  4X66 E;  1XHK A;  4JI6 E;  4X64 E;  4JV5 E;  4DXL A;  2ZBK B;  2UUB I;  2NUE A;  1ZBT A;  4X65 E;  4X65 I;  5LL6 R;  2WW4 A;  3P1X A;  3K1J A;  2AJ4 A;  2YT4 A;  1H7U A;  3JAM C;  4JV5 I;  3V5R A;  4B3T E;  1VIS A;  4X8W A;  1FNM A;  4JI6 I;  1BKN A;  4X62 E;  1PKP A;  1HNX I;  1N33 E;  1N33 I;  1Z0T A;  4X62 I;  2E5L E;  2V8P A;  4B3T I;  1B62 A;  1X48 A;  2HK2 A;  1FJG I;  2NUF A;  4K0K E;  1A6F A;  1H74 A;  1S16 A;  5L3J A;  1DAR A;  1FI4 A;  4B3R E;  1H72 C;  1STU A;  1I94 E;  3T1H I;  3ADG A;  2XEX A;  4LF6 E;  1DI2 A;  4OX9 I;  3LLH A;  4LFA E;  3QT8 A;  4B3S I;  2LTS A;  4WYQ B;  1Z0C A;  1WHN A;  4AQY E;  3T1H E;  1I94 I;  4X64 I;  2DIX A;  1MG7 A;  3VYY A;  1UEK A;  4DV5 E;  4JI4 I;  4DUZ I;  2R3V A;  2ZIT A;  4LF7 I;  3LNU A;  3M6A A;  2UUA I;  4DV6 I;  1XNQ I;  3ZM7 A;  2UUA E;  2UXB I;  2E5L I;  1FKA E;  2DEJ A;  3T1Y I;  3K17 A;  1N0U A;  2DEI A;  4JI4 E;  4DPW A;  1Z0V A;  3B82 A;  4PRV A;  5LMN E;  1HNX E;  4MYT A;  3J80 Q;  1Z5C A;  2E1R A;  5A2Q C;  4Z7Y A;  4OOG C;  4B3S E;  4P52 A;  4LFA I;  1ELO A;  4B3M I;  5GMD A;  1Z59 A;  3J7Y p;  4JI7 E;  1MU5 A;  4DR5 I;  4B3R I;  1NZ0 A;  4FN5 A;  4UTG A;  4K0K I; 
#chains in the Genus database with same CATH topology
 3QT5 A;  2WBS A;  3Q6M A;  2ENA A;  4M30 A;  4DUY E;  2I9I A;  1FJG E;  2EL4 A;  1YUJ A;  1WHQ A;  4O24 A;  3WU6 A;  2M7Q A;  4HXZ A;  2IHR 1;  2DMI A;  2HHH I;  1GZ6 A;  4X66 I;  2DLQ A;  1YUI A;  1ZM4 A;  4LFB I;  5A69 A;  3GME A;  4FWH A;  5AAS A;  3J7A M;  5K36 E;  1ZAA C;  1ZR9 A;  1WRJ A;  2C37 B;  3VYX A;  2HFU A;  2VQE I;  2EPN A;  3HPZ A;  4WUD A;  5ELW A;  4WXC A;  1YYK A;  2CGE A;  5BR8 E;  3EPH A;  1YSA C;  2EN4 A;  3F0N A;  1EH7 A;  4P7A A;  2Z5B A;  2A2C A;  2M9A A;  1F2I G;  3WU3 A;  3J80 C;  1IBM E;  3H1C A;  4U3B A;  3ADL A;  3ADI A;  4DR1 E;  2RQL A;  2DB2 A;  3B8H A;  1MX0 A;  1FWK A;  2PNZ B;  4DPY A;  2EM8 A;  1A1L A;  1X3C A;  2DSY A;  3PS3 A;  1OYP A;  4MDT A;  1EH6 A;  2PRT A;  2L92 A;  2LV2 A;  1N34 E;  2LVH A;  1KKH A;  1IBK E;  1YFH A;  3TQM A;  3DD6 A;  1PVG A;  2UUB E;  3IWB A;  1UBD C;  1RRE A;  2DLK A;  1X6H A;  3THO B;  1PJQ A;  1IBL E;  4JG4 A;  2B9D A;  4FK5 C;  3PYF A;  1RQ0 A;  1YYW A;  2PO2 A;  1XNR E;  5KL7 A;  4AIM A;  5C0X F;  4P7D A;  1IQS A;  5IV8 B;  1E3H A;  5KL4 A;  2YTN A;  1N36 E;  3P3G A;  3AV0 A;  4DR6 I;  1NEI A;  4WX9 A;  1MEY C;  3C4T A;  1KTV A;  1ZM9 A;  1T4O A;  4BBY A;  1X5W A;  2I13 A;  1OYS A;  2LT7 A;  1Z0E A;  4USM A;  2EPK X;  5JEA D;  4R03 A;  2EM0 A;  5T6J A;  1BB8 A;  1O0W A;  2YRK A;  1Z0B A;  4DR7 I;  4JI8 E;  4KHP E;  1D6T A;  2O3Z A;  3WU4 A;  4YY3 E;  4JYA E;  1GTK A;  2GLI A;  2O1V A;  3Q6N A;  2LJP A;  1VI7 A;  2Q2E B;  4J3D A;  4LCG A;  3U1K A;  2UXD I;  5FLX C;  4LFC E;  2C37 A;  1G2F C;  2L2M A;  2FGG A;  2J7K A;  4TUG A;  1USV A;  3ZZ0 A;  2JYA A;  4IZJ A;  5K36 C;  4LF5 E;  1Y60 A;  4JI1 E;  4M9V C;  1TF6 A;  5C0X E;  3ZZT A;  1A1J A;  2IES A;  2X7I A;  1Z5A A;  4Q28 A;  1WUU A;  3C4B A;  1UIL A;  4FW9 A;  2VQF E;  2X36 A;  4FW5 A;  3KZY A;  1H73 A;  4BA1 B;  2O1W A;  4DV1 I;  3J81 Q;  2UUC E;  4IJD A;  3OTO I;  1T4N A;  2F8B A;  2EOR A;  4KZS A;  4LF8 I;  4IFD A;  4F9C B;  1P47 A;  1HNW E;  3ADJ A;  2NUG A;  5DRR A;  2NAB A;  4M1K A;  2C39 A;  3HKM A;  4DU8 A;  2CVE A;  1XMQ I;  2EFG A;  4DV7 I;  2EPX A;  1GQE A;  2JOB A;  4JI5 E;  4GKK E;  2HK3 A;  4IS9 A;  4JI3 E;  5F3W A;  2FV4 B;  3B78 A;  4PRX A;  4DPX A;  1A1H A;  1OYR A;  2PNL A;  5JEA B;  2JPA A;  4DV3 E;  4O4K A;  4ZVI A;  4KQV A;  1XMO I;  2R76 A;  1J26 A;  4F9B B;  5DNY A;  4LF4 I;  2AE8 A;  4NXN I;  4WPY A;  2EP3 A;  3HTX A;  4DV2 I;  4DV4 E;  1KJK A;  1HK7 A;  1E3P A;  3JAM Q;  1USU A;  2ODR C;  2BM0 A;  3QG5 C;  1SFE A;  2EM5 A;  5A6K A;  2V34 A;  2EM7 A;  2WNR B;  3PYE A;  4WSG A;  4GQU A;  3ZZU A;  5IWA E;  2HGH A;  1BBO A;  1J5E E;  1KYQ A;  1Z1B A;  1R6M A;  2WP8 B;  2UXC E;  4LF9 I;  2K7I A;  4IFD E;  4DR2 I;  2L8T A;  2YTO A;  2YU8 A;  3MHS C;  2JXP A;  2JEA A;  2DRP A;  4NXN E;  1Y4U A;  2JOX A;  5A6A A;  2H36 X;  3K85 A;  2EM2 A;  4TUI A;  2HFS A;  4FW7 A;  2FTX B;  1HNZ E;  1Z5B A;  4IZJ B;  1ZM2 A;  4XTJ A;  2LBS B;  2LUQ A;  3ZKD A;  1A1G A;  2F4V E;  2OI2 A;  3GON A;  4M2Z A;  1N3G A;  2PO0 A;  4JI3 I;  4GEQ B;  5LLQ A;  2VE7 C;  1Y6Z A;  1NCS A;  2YTD A;  1UHZ A;  2KON A;  2CTD A;  1XMQ E;  4FWD A;  3WU5 A;  4BA2 A;  2C38 A;  4OO1 A;  1UDQ A;  4YHH E;  2HKE A;  4R1F A;  2EMZ A;  2YTF A;  4DR3 E;  2CT1 A;  4DV0 I;  4DR4 E;  1N0V C;  5CFF E;  4LF8 E;  1P42 A;  2PO0 B;  4GKJ I;  4IZK A;  4ED4 A;  4F9A B;  1X6E A;  3THN A;  2BM1 A;  2UUC I;  4R2R A;  2M4I A;  4JI2 E;  1PDA A;  2EPO A;  3F6H A;  1A1K A;  1PIE A;  3EQ1 A;  5KL6 A;  3LTO A;  2V8Q B;  4DR2 E;  4PU9 A;  3PYD A;  4QNK A;  1N32 E;  4NXM E;  5A6J A;  4FW6 A;  1J5E I;  2YTI A;  2EJ4 A;  2JP9 A;  4JI0 I;  2L3J A;  2YTG A;  1BBG A;  1Z0W A;  1ZM3 A;  2L2N A;  4JI1 I;  2JE6 B;  2BV3 A;  4F2J C;  2LRS A;  3F6G A;  5C0X B;  2LTR A;  1A1I A;  5LMU I;  2LUP B;  2JY9 A;  2B7V A;  3QT7 A;  2EL5 A;  2CSH A;  2UXD E;  2ELY A;  2EMY A;  3B4T A;  2UU9 E;  3IWD A;  2VF3 A;  5IT9 Q;  2ZM6 E;  4LF4 E;  3IWC A;  3KWR A;  2IER A;  2RS6 A;  3K6Q A;  1RC7 A;  4RH8 A;  4RPF A;  2NN6 B;  5JEA F;  5EKW A;  2ODR D;  3KRN A;  4OO1 D;  3J81 C;  3U1Y A;  4I8O A;  1N36 I;  5JEA E;  1HR0 I;  5K36 F;  1UN6 B;  1Y5Y A;  3PS2 A;  4NXM I;  4R2E A;  2LJH A;  2V2V A;  1N32 I;  1XNR I;  2JEB B;  4BS9 A;  1FWL A;  4LPF A;  1RR9 A;  3M85 D;  4LOM A;  2EM3 A;  2N8X A;  4HAC A;  2IOQ A;  2EPC A;  2O1T A;  2LJU A;  3JTZ A;  2CG9 A;  2J65 A;  5A2Q Q;  4DR4 I;  3OTO E;  2E1M A;  2EM6 A;  4DV1 E;  2V2Z A;  5FLX Q;  1EKZ A;  2EOO A;  2VQF I;  2YWQ A;  1N34 I;  4P78 A;  4MQY A;  1YPN A;  2MDR A;  1EH8 A;  2V85 A;  3L00 A;  3D4J A;  2EOI A;  1HR0 E;  5DRP A;  4DKK A;  2F4V I;  2EN3 A;  2IOP A;  5KL5 A;  4LF5 I;  2GPI A;  4DR1 I;  4WUB A;  1HNZ I;  1PJT A;  2HKJ A;  2EOZ A;  3BGH A;  2MC6 A;  2G7H A;  1YYO A;  2ZM6 I;  4AID A;  4ISA A;  2PNZ A;  4DU7 A;  2NN6 D;  4Z7C A;  4IFD B;  4X9J A;  4WFT A;  2MKD A;  1EA6 A;  2WNR A;  2UU9 I;  1QNT A;  2EPU A;  2PO2 B;  4JI8 I;  3AUZ A;  4DR7 E;  2UXC I;  2EOF A;  3P76 A;  2VQE E;  5LMU E;  3V2U C;  3L7Z A;  5IWA I;  3ZKB A;  2MDG A;  4N4R B;  4F6M A;  4LFB E;  4I3H A;  5JEA A;  3BF2 A;  2EWL A;  4JI0 E;  2JE6 A;  5C0X D;  3M7N D;  2EOH A;  1NHI A;  2VF1 A;  2NN6 A;  3HUL A;  1Z0G A;  1RHY A;  3EPJ A;  4MU1 A;  2EMB A;  4LCH A;  1U2R A;  1UDN A;  4AM3 A;  4JI2 I;  5AC4 A;  2V83 A;  4R2P A;  4MU0 A;  4GKJ E;  2EN2 A;  2K4V A;  4DV0 E;  4DR3 I;  1XXE A;  2GO3 A;  4YHH I;  1IBK I;  2LMZ A;  3M85 G;  2A2D A;  3DF6 A;  4BC7 A;  2HJJ A;  5AE3 A;  4WUC A;  5AC5 A;  4DR5 E;  4MU3 A;  3KZZ A;  4R2A A;  4JI5 I;  1QU6 A;  4DMI A;  3CWV A;  4GKK I;  2WZO A;  4IS1 C;  2RPC A;  4URL A;  4IFD D;  4UT4 A;  4KWY A;  1X6F A;  1EI1 A;  1UDO A;  2Z5E A;  1HNW I;  1IBM I;  4R2D A;  4HAC B;  1NHH A;  2A25 A;  3M7N G;  2N3G A;  2DGC A;  2EN7 A;  2KHX A;  2YRM A;  2EMG A;  5BR8 I;  3JU0 A;  2YTP A;  5TSE A;  4R2S A;  2E72 A;  1T39 A;  2EE8 A;  2ENC A;  4LF9 E;  3CDI A;  4OO1 E;  1ZXM A;  2GS8 A;  4EMD A;  5LMN I;  1KIJ A;  3PS1 A;  3J7A G;  5IT9 C;  1TF3 A;  2EOX A;  2LCE A;  4ZYD A;  3T1Y E;  2HHH E;  2BA0 G;  2L3C A;  4LFC I;  4R2Q A;  1KVK A;  2UXB E;  2BR2 B;  3VHT B;  2YZT A;  4DV4 I;  3M99 B;  4DV2 E;  1XNQ E;  1B63 A;  3PYG A;  4DUY I;  1QZR A;  2LO3 A;  3LPS A;  1XMO E;  4U3D A;  1YZ9 A;  2BR2 A;  2B3T B;  4MLQ A;  2L2K B;  3H09 A;  4DV3 I;  1Y4S A;  2B7T A;  2EM4 A;  2EPM X;  3QT6 A;  4FW3 A;  2EMW A;  1NHJ A;  4DV5 I;  1ZXN A;  2GO4 A;  4QNJ A;  2RSM A;  2CPN A;  2N3H A;  5K36 A;  2RS7 A;  3HQ1 A;  5AE2 A;  2WP8 A;  2NN6 C;  2EPR A;  4DV7 E;  4AQY I;  2NA2 A;  4JI7 I;  5GME A;  1IBL I;  4B3M E;  2EZ6 A;  3BID A;  2HC5 A;  5K36 B;  2L33 A;  4ZYE A;  4OX9 E;  2NPF A;  1S4E A;  1ZU1 A;  1X49 A;  4FWG A;  4LF6 I;  1YHC A;  1K47 A;  2V2Q A;  2EN6 A;  4BHC A;  4N3O A;  1L4S A;  2EMC A;  4GZN C;  3Q1Q A;  4HY1 A;  1OJ4 A;  2EOS A;  4L5N C;  2EL6 A;  2PNM A;  2BB8 A;  2DMY A;  1YH8 A;  3UK3 C;  2C39 B;  3VK6 A;  1T4L B;  4MYU A;  4HYM A;  3FIG A;  4BMJ A;  1X47 A;  3P06 A;  4YY3 I;  4JYA I;  2YTQ A;  3H4L A;  1JK2 A;  4USK A;  4DV6 E;  2EM9 A;  2MC5 A;  4DPU A;  4F6N A;  4FW4 A;  4KHP I;  4OO1 C;  1WJP A;  2JVA A;  4LF7 E;  1H7S A;  5EL9 A;  2WBU A;  2CZ9 A;  2BA1 G;  2R42 A;  2WBT A;  2EPP A;  4DUZ E;  4IZJ D;  4M0V A;  4DPT A;  3MHH C;  3L7Z B;  2L6M A;  3DJW A;  1G2D C;  2RSI A;  2RTX A;  2EOJ A;  4DR6 E;  2YTJ A;  2M1S A;  4X66 E;  4MU4 A;  2YSP A;  1XHK A;  4JI6 E;  2BA0 D;  4IFD C;  4X64 E;  4LCF A;  2F1D A;  2D9H A;  4JV5 E;  1AH5 A;  4DXL A;  1WXR A;  4NZV A;  5ADZ A;  4Q35 B;  2ZBK B;  2UUB I;  4BHB A;  4R8O A;  2NUE A;  2V88 A;  1RMD A;  3C6M A;  2EMA A;  3EPK A;  3RMP A;  1ZBT A;  2O1U A;  2NN6 F;  2J7J A;  5DNL A;  4X65 E;  4X65 I;  4O43 A;  4WXD A;  5LL6 R;  2Q8U A;  3ZOQ B;  3ECR A;  2Z5C B;  1B69 A;  1T38 A;  2EN8 A;  2WW4 A;  3P1X A;  3K1J A;  4BCA A;  1ZBQ A;  2KOU A;  3UHM A;  2AJ4 A;  1TN9 A;  2YT4 A;  3JAM C;  4O5G A;  1H7U A;  2Z5B B;  4JV5 I;  3V5R A;  2EMH A;  5KL2 A;  4B3T E;  4NHR A;  2EPZ A;  1VIS A;  4X8W A;  1FNM A;  5AE1 A;  2JEB A;  1BKN A;  3NZK A;  4JI6 I;  4X62 E;  1PKP A;  1HNX I;  2VRD A;  1N33 E;  1N33 I;  2GQ0 A;  4RHB B;  1Z0T A;  3P3C A;  4X62 I;  2EPA A;  2JR1 A;  2E5L E;  4NBQ A;  4OZE A;  2V8P A;  1JK1 A;  3BBG A;  4BA1 A;  1B62 A;  4B3T I;  1X48 A;  2V89 A;  4F54 A;  4R2C A;  2HK2 A;  2PO1 A;  2EOM A;  2V86 A;  4HTG A;  1FJG I;  3MSW A;  2NUF A;  3HPS A;  4K0K E;  1A6F A;  1H74 A;  2C38 B;  2VES A;  3PRY A;  4OKG A;  1S16 A;  2BA1 D;  1AAY A;  5L3J A;  1DAR A;  5DNX A;  2ENH A;  1FI4 A;  3OML A;  4B3R E;  3GLL A;  2EOY A;  3LML A;  3HJC A;  1IMU A;  4BA2 B;  1H72 C;  1PJS A;  1STU A;  1DGC A;  1I94 E;  3T1H I;  5DRQ A;  3ADG A;  2XEX A;  5K36 D;  2EQ3 A;  4LF6 E;  2WCC 3;  1DI2 A;  2EQ1 A;  4OX9 I;  1MGT A;  3LLH A;  4LFA E;  3QT8 A;  2ELZ A;  2LTS A;  4B3S I;  2Z5C A;  4WYQ B;  1Z0C A;  1WHN A;  4AQY E;  3T1H E;  4LU9 A;  1I94 I;  4X64 I;  2NN6 E;  4L8N A;  2DIX A;  2JWO A;  2BBG A;  1MG7 A;  3VYY A;  2LE2 A;  1UEK A;  4DV5 E;  4JI4 I;  4DUZ I;  1A1F A;  2EOE A;  2YTE A;  4WSP A;  2R3V A;  2ZIT A;  5KL3 A;  4LF7 I;  4IFD F;  3LNU A;  3M6A A;  5FWK A;  2EQ0 A;  2JEA B;  4LTY A;  2UUA I;  4DV6 I;  1XNQ I;  3ZM7 A;  5C0X C;  2UUA E;  2UXB I;  2YPN A;  2E5L I;  1FKA E;  2DEJ A;  3T1Y I;  1IQO A;  3K17 A;  4OO1 F;  1N0U A;  2DEI A;  4JI4 E;  4DPW A;  3EPL A;  1Z0V A;  3B82 A;  3C6K A;  2ADR A;  2R1F A;  4ZYH A;  2YRH A;  5LMN E;  1HNX E;  2EMX A;  4IZK B;  4PRV A;  4MYT A;  3J80 Q;  2PO1 B;  1Z5C A;  4J8Z A;  4OO1 B;  3P3E A;  2E1R A;  5IXM B;  2JT2 A;  5DRO A;  2GHF A;  5A2Q C;  2EMI A;  2EMK A;  2EPL X;  4MLV A;  5A6B D;  4Z7Y A;  4OOG C;  4B3S E;  4P52 A;  5JEA C;  1ELO A;  4LFA I;  2EMF A;  5GMD A;  4B3M I;  1Z59 A;  1SR9 A;  2V87 A;  2MKN A;  3GCM A;  3J7Y p;  4JI7 E;  4HEI A;  1MU5 A;  1UDS A;  1LLM C;  3CDJ A;  4DR5 I;  1DQ3 A;  4B3R I;  1R6L A;  5C0X A;  2EN1 A;  4BC9 A;  1NZ0 A;  3HXL A;  2EML A;  4ZYG A;  4FN5 A;  4UTG A;  2YU5 A;  2YSO A;  5A6B A;  4K0K I;  2EOQ A; 
#chains in the Genus database with same CATH homology
 3QT5 A;  3Q6M A;  4M30 A;  1FJG E;  4DUY E;  1WHQ A;  3WU6 A;  2M7Q A;  4HXZ A;  2IHR 1;  2HHH I;  1GZ6 A;  4X66 I;  1ZM4 A;  4LFB I;  4FWH A;  5AAS A;  3J7A M;  3VYX A;  2HFU A;  2VQE I;  3HPZ A;  4WUD A;  2CGE A;  1YYK A;  3F0N A;  5BR8 E;  4P7A A;  2Z5B A;  2A2C A;  3WU3 A;  3J80 C;  1IBM E;  3ADL A;  3ADI A;  4DR1 E;  2DB2 A;  3B8H A;  1MX0 A;  1FWK A;  4DPY A;  2DSY A;  1N34 E;  2L92 A;  1KKH A;  1IBK E;  1PVG A;  2UUB E;  3IWB A;  1RRE A;  1IBL E;  4JG4 A;  2B9D A;  3PYF A;  1RQ0 A;  1YYW A;  1XNR E;  4P7D A;  1N36 E;  3AV0 A;  4DR6 I;  1KTV A;  1ZM9 A;  3C4T A;  1T4O A;  4BBY A;  1Z0E A;  4USM A;  4R03 A;  5T6J A;  1O0W A;  1Z0B A;  4DR7 I;  4JI8 E;  4KHP E;  1D6T A;  3WU4 A;  4YY3 E;  4JYA E;  2O1V A;  3Q6N A;  2LJP A;  2Q2E B;  2UXD I;  5FLX C;  4LFC E;  2L2M A;  2FGG A;  2J7K A;  4TUG A;  1USV A;  3ZZ0 A;  4IZJ A;  4LF5 E;  4JI1 E;  3ZZT A;  2X7I A;  1Z5A A;  4Q28 A;  1WUU A;  3C4B A;  1UIL A;  4FW9 A;  2VQF E;  2X36 A;  1H73 A;  2O1W A;  4DV1 I;  3J81 Q;  2UUC E;  3OTO I;  1T4N A;  2F8B A;  4LF8 I;  4KZS A;  4F9C B;  1HNW E;  3ADJ A;  2NUG A;  4M1K A;  4DU8 A;  1XMQ I;  2EFG A;  4DV7 I;  2JOB A;  1GQE A;  4JI5 E;  4GKK E;  2HK3 A;  4JI3 E;  5F3W A;  2FV4 B;  3B78 A;  4PRX A;  4DPX A;  2PNL A;  4DV3 E;  4ZVI A;  4KQV A;  1XMO I;  1J26 A;  4F9B B;  5DNY A;  4LF4 I;  4NXN I;  4WPY A;  3HTX A;  4DV2 I;  4DV4 E;  1HK7 A;  3JAM Q;  1USU A;  2ODR C;  2BM0 A;  2V34 A;  3ZZU A;  3PYE A;  5IWA E;  1J5E E;  2UXC E;  4LF9 I;  4DR2 I;  2L8T A;  4NXN E;  1Y4U A;  2JOX A;  2H36 X;  3K85 A;  4TUI A;  2HFS A;  2FTX B;  1HNZ E;  1Z5B A;  4IZJ B;  1ZM2 A;  4XTJ A;  2LBS B;  2LUQ A;  3ZKD A;  2F4V E;  2OI2 A;  3GON A;  4M2Z A;  4JI3 I;  4GEQ B;  2VE7 C;  1Y6Z A;  4FWD A;  1UHZ A;  2KON A;  1XMQ E;  3WU5 A;  4YHH E;  2HKE A;  4R1F A;  4DR3 E;  4DV0 I;  4DR4 E;  1N0V C;  5CFF E;  4LF8 E;  4GKJ I;  4IZK A;  4ED4 A;  4F9A B;  2UUC I;  2BM1 A;  4JI2 E;  2M4I A;  1PIE A;  3F6H A;  3LTO A;  4PU9 A;  2V8Q B;  4DR2 E;  3PYD A;  1N32 E;  4NXM E;  1J5E I;  4JI0 I;  2L3J A;  1Z0W A;  1ZM3 A;  2L2N A;  4JI1 I;  2BV3 A;  2LRS A;  3F6G A;  2LTR A;  5LMU I;  2LUP B;  2JY9 A;  2B7V A;  3QT7 A;  2UXD E;  2UU9 E;  3IWD A;  2VF3 A;  5IT9 Q;  2ZM6 E;  4LF4 E;  3IWC A;  3KWR A;  2RS6 A;  3K6Q A;  1RC7 A;  4RPF A;  2ODR D;  3J81 C;  4I8O A;  1N36 I;  1HR0 I;  4NXM I;  2V2V A;  2LJH A;  1N32 I;  1XNR I;  4BS9 A;  1FWL A;  1RR9 A;  4HAC A;  2IOQ A;  2O1T A;  2CG9 A;  3JTZ A;  5A2Q Q;  4DR4 I;  3OTO E;  2E1M A;  4DV1 E;  2V2Z A;  5FLX Q;  1EKZ A;  2VQF I;  1N34 I;  4P78 A;  2MDR A;  2V85 A;  3D4J A;  1HR0 E;  4DKK A;  2F4V I;  2IOP A;  4LF5 I;  1HNZ I;  4DR1 I;  4WUB A;  2HKJ A;  2MC6 A;  2G7H A;  1YYO A;  2ZM6 I;  4Z7C A;  4DU7 A;  4WFT A;  1EA6 A;  2UU9 I;  4JI8 I;  3AUZ A;  4DR7 E;  2UXC I;  2VQE E;  5LMU E;  3V2U C;  5IWA I;  3ZKB A;  4LFB E;  4I3H A;  2EWL A;  4JI0 E;  1NHI A;  2VF1 A;  3HUL A;  1Z0G A;  1U2R A;  4JI2 I;  2V83 A;  4GKJ E;  2K4V A;  4DV0 E;  4DR3 I;  4YHH I;  1IBK I;  2LMZ A;  2A2D A;  3DF6 A;  4BC7 A;  5AE3 A;  4WUC A;  4DR5 E;  4JI5 I;  4GKK I;  1QU6 A;  4DMI A;  3CWV A;  2WZO A;  4URL A;  4UT4 A;  1HNW I;  1EI1 A;  2Z5E A;  1IBM I;  4HAC B;  1NHH A;  2N3G A;  2KHX A;  5BR8 I;  3JU0 A;  4LF9 E;  1ZXM A;  2GS8 A;  4EMD A;  5LMN I;  1KIJ A;  3J7A G;  5IT9 C;  3T1Y E;  2HHH E;  2L3C A;  4LFC I;  1KVK A;  2UXB E;  2YZT A;  4DV4 I;  4DV2 E;  1XNQ E;  1B63 A;  3PYG A;  4DUY I;  1QZR A;  3LPS A;  1XMO E;  1YZ9 A;  2B3T B;  4DV3 I;  2L2K B;  3H09 A;  1Y4S A;  2B7T A;  4DV5 I;  3QT6 A;  1NHJ A;  1ZXN A;  2RSM A;  2N3H A;  2CPN A;  2RS7 A;  3HQ1 A;  5AE2 A;  4DV7 E;  4AQY I;  2NA2 A;  4JI7 I;  5GME A;  1IBL I;  4B3M E;  2EZ6 A;  2L33 A;  4OX9 E;  2NPF A;  1S4E A;  1X49 A;  4FWG A;  4LF6 I;  1K47 A;  2V2Q A;  4N3O A;  3Q1Q A;  4HY1 A;  1OJ4 A;  4L5N C;  2PNM A;  2DMY A;  4MYU A;  3VK6 A;  1T4L B;  4HYM A;  3FIG A;  4BMJ A;  1X47 A;  3P06 A;  4YY3 I;  4JYA I;  3H4L A;  4USK A;  4DV6 E;  4DPU A;  2MC5 A;  4KHP I;  2JVA A;  4LF7 E;  1H7S A;  2CZ9 A;  2R42 A;  4IZJ D;  4DUZ E;  4M0V A;  4DPT A;  2L6M A;  3DJW A;  2RTX A;  4DR6 E;  2M1S A;  4X66 E;  1XHK A;  4JI6 E;  4X64 E;  4JV5 E;  4DXL A;  1WXR A;  5ADZ A;  2ZBK B;  2UUB I;  4R8O A;  2NUE A;  2V88 A;  3RMP A;  1ZBT A;  2O1U A;  4X65 E;  4X65 I;  3ZOQ B;  5LL6 R;  2Z5C B;  2WW4 A;  3P1X A;  3K1J A;  4BCA A;  1ZBQ A;  2KOU A;  2AJ4 A;  2YT4 A;  3JAM C;  1H7U A;  2Z5B B;  4JV5 I;  3V5R A;  4B3T E;  1VIS A;  4X8W A;  1FNM A;  5AE1 A;  4JI6 I;  1BKN A;  4X62 E;  1PKP A;  1HNX I;  1N33 E;  1N33 I;  2GQ0 A;  1Z0T A;  4X62 I;  2JR1 A;  2E5L E;  2V8P A;  4B3T I;  1B62 A;  1X48 A;  2V89 A;  4F54 A;  2HK2 A;  2V86 A;  1FJG I;  3MSW A;  4K0K E;  3HPS A;  1A6F A;  2NUF A;  1H74 A;  3PRY A;  1S16 A;  5L3J A;  1DAR A;  1FI4 A;  3OML A;  4B3R E;  3LML A;  3HJC A;  1H72 C;  1STU A;  1I94 E;  3T1H I;  3ADG A;  2XEX A;  4LF6 E;  1DI2 A;  4OX9 I;  3LLH A;  4LFA E;  3QT8 A;  4B3S I;  2LTS A;  2Z5C A;  4WYQ B;  1Z0C A;  1WHN A;  4AQY E;  3T1H E;  4LU9 A;  1I94 I;  4X64 I;  4L8N A;  2DIX A;  2JWO A;  1MG7 A;  3VYY A;  2LE2 A;  1UEK A;  4DV5 E;  4JI4 I;  4DUZ I;  2R3V A;  2ZIT A;  4WSP A;  4LF7 I;  3LNU A;  3M6A A;  5FWK A;  4LTY A;  2UUA I;  4DV6 I;  1XNQ I;  3ZM7 A;  2UUA E;  2UXB I;  2E5L I;  1FKA E;  2DEJ A;  3T1Y I;  3K17 A;  1N0U A;  2DEI A;  4JI4 E;  4DPW A;  1Z0V A;  3B82 A;  4PRV A;  5LMN E;  1HNX E;  4IZK B;  4MYT A;  3J80 Q;  1Z5C A;  4J8Z A;  2E1R A;  5A2Q C;  4Z7Y A;  4OOG C;  4B3S E;  4P52 A;  4LFA I;  1ELO A;  4B3M I;  5GMD A;  1Z59 A;  1SR9 A;  2V87 A;  3J7Y p;  4JI7 E;  1MU5 A;  4DR5 I;  1DQ3 A;  4B3R I;  4BC9 A;  1NZ0 A;  3HXL A;  4FN5 A;  4UTG A;  4K0K I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...