4JI7I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji7I00
1EA6A 4JI4I 4X64I 4MYTA 3V2UC 1EI1A 1N36E 2ZM6E 5IWAE 4LF9I 2HFSA 5A2QQ 1ZXNA 4B3SI 3ZZTA 4LF4E 1Z0TA 4DR5I 4FWHA 2V8PA 1N34E 4Z7CA 4X62E 4LF7E 2VQFI 1K47A 4DV4I 1D6TA 1S4EA 1FJGE 4NXNI 1XNRE 3QT7A 1KTVA 1H7UA 4K0KI 1BKNA 2UXCI 4EMDA 4USKA 4ED4A 1HNXI 4DU8A 4DXLA 1IBLI 4GKKE 2BM1A 4LFAI 1IBMI 2UUCE 2BV3A 1Z0WA 1QZRA 1H7SA 3K17A 4JI0I 2WW4A 3ZZUA 3T1YI 4DV7I 1XMOE 3F0NA 2J7KA 4YY3I 5LMNI 2X7IA 1ZXMA 4DUZE 2VQEE 3J7AM 5BR8E 4LF6I 2UUAE 4DV0E 4DV1I 4DR1E 1FNMA 1J5EE 4DV6I 1PIEA 1UEKA 4Z7YA 4DR4E 4AQYI 2V2VA 2UU9I 1NHJA 3WU5A 4NXME 4HYMA 4JI4E 2LJPA 5BR8I 4X64E 1XHKA 3LTOA 4DUYI 4JI3I 1Z5CA 4LF9E 4YHHI 1Z0VA 1PVGA 1IBKI 4DV2I 4B3SE 4DR5E 1Z5AA 4DPUA 1DARA 2BM0A 1H74A 3B82A 3T1HI 4JI5I 2VQFE 4DV4E 2E5LI 2F4VI 4DR6I 2V2ZA 2HFUA 4NXNE 1I94I 4HACB 2E1RA 1NHHA 3J7AG 4USMA 4DR7I 4K0KE 1ZM3A 2UXCE 4B3RI 1KIJA 1NHIA 5FLXC 1N32I 3JAMC 4WUCA 1HNXE 4JV5I 4JI8I 1IBLE 4HY1A 4KQVA 1NZ0A 4LFAE 1IBME 4LF8I 1Z0BA 1N0VC 4ZVIA 4X66I 2DEJA 4DV5I 4JI0E 3QT5A 2UUBI 3WU3A 3T1YE 4DV7E 1VISA 4GKJI 2CZ9A 5GMDA 4MYUA 2HHHI 3CWVA 1N33I 1B63A 4DR2I 5FLXQ 4YY3E 5LMNE 3JAMQ 1ZM4A 4DV3I 4LF6E 4M1KA 1HNWI 1ZM2A 4DV1E 4DV6E 4I3HA 1RREA 2A2CA 1HR0I 4DPWA 4DU7A 1B62A 3J81C 4AQYE 2EFGA 1S16A 5IT9C 5L3JA 2DEIA 2UU9E 2R3VA 4LFBI 4JI7I 3K1JA 1Z59A 3ZM7A 2X36A 4DUYE 2HK3A 1PKPA 4JI3E 1Z5BA 4OX9I 5LMUE 4YHHE 1Z0GA 4B3MI 1KKHA 2UXBI 1IBKE 4DV2E 1FKAE 3J80C 3OTOI 4DPXA 3T1HE 4JI5E 4XTJA 2A2DA 1FWKA 3J81Q 2E5LE 2F4VE 5IT9Q 4DR6E 1I94E 4B3TI 4PU9A 3D4JA 2UXDI 4LFCI 1A6FA 2HKJA 4DPYA 5LMUI 4LF5I 1XMQI 4DR7E 1FWLA 3Q1QA 4HACA 4B3RE 2ZBKB 4JI2I 1N32E 3V5RA 5A2QC 4FWDA 1MX0A 4JV5E 4JI8E 3J80Q 4FN5A 2AJ4A 1KVKA 4LF8E 1OJ4A 4X66E 2XEXA 4DV5E 4HXZA 5LL6R 2UUBE 4DR3I 2V2QA 4GKJE 4KHPI 4X65I 4JI1I 1HNZI 2HHHE 1N33E 4DR2E 4JYAI 1XNQI 3PYDA 4DV3E 3WU6A 4WUBA 4PRVA 1HNWE 2R42A 4UT4A 4JG4A 1N36I 1HR0E 2ZM6I 1N0UA 4RPFA 5IWAI 2GS8A 3QT6A 3M6AA 4LFBE 2ZITA 4JI7E 2NPFA 3ZZ0A 4LF4I 3WU4A 3LPSA 4UTGA 3LNUA 3PYEA 1N34I 4X62I 4LF7I 4DPTA 1Z0CA 4OX9E 1XNRI 1FJGI 4B3ME 3GONA 4URLA 2UXBE 1MU5A 2HK2A 3OTOE 3H4LA 1ELOA 4WUDA 2HKEA 2V34A 2VF3A 4FWGA 1Z0EA 1H73A 4B3TE 2UXDE 4LFCE 3ZKBA 4GKKI 1FI4A 3ZKDA 4LF5E 1XMQE 2UUCI 3PYFA 1RR9A 1MG7A 4JI2E 1WUUA 3PYGA 4P7AA 4P52A 1XMOI 4PRXA 4JI6E 2Q2EB 4R1FA 3B78A 1H72C 3B8HA 4DUZI 5GMEA 2VQEI 2OI2A 4DR3E 4KHPE 4X65E 1HNZE 4JI1E 4DV0I 2UUAI 1U2RA 3HULA 4DR1I 1J5EI 4FW9A 4JYAE 4DR4I 1XNQE 4JI6I 1ZM9A 3QT8A 4NXMI
chains in the Genus database with same CATH superfamily
1EA6A 2Z5BA 4JI4I 3PS2A 4MU0A 2O1TA 5K36C 4IFDB 5JEAF 4X64I 4MYTA 3V2UC 1EI1A 2C39B 3UHMA 4FW3A 1N36E 2ZM6E 5IWAE 5K36B 4LF9I 3Q6NA 2HFSA 5A2QQ 1ZXNA 4B3SI 3ZZTA 3CDIA 1Z0TA 4LF4E 4DR5I 4FWHA 5DNXA 2V8PA 4AIMA 4NBQA 5JEAD 1N34E 4Z7CA 4X62E 4LF7E 2VQFI 1K47A 4DV4I 1D6TA 5K36F 1S4EA 1FJGE 4NXNI 1XNRE 3GCMA 3QT7A 4QNJA 1KTVA 4MQYA 2WP8A 1H7UA 4QNKA 1R6LA 4K0KI 2C37B 2PO1B 4AIDA 1BKNA 4LPFA 2UXCI 3H1CA 4EMDA 4USKA 5K36D 4ED4A 1HNXI 4DU8A 5DNLA 4DXLA 1OYPA 4MU4A 1IBLI 4GKKE 2BM1A 1YH8A 4LFAI 1IBMI 2UUCE 2BV3A 3M85D 1Z0WA 1QZRA 4BA1A 3M85G 1H7SA 3K17A 4JI0I 1Y4SA 1VI7A 5EL9A 2WW4A 4LCFA 3ZZUA 3T1YI 4DV7I 3Q6MA 1OYSA 1XMOE 3F0NA 2J7KA 4IZKB 4OO1A 4FW6A 4YY3I 5LMNI 4BA2A 2X7IA 1ZXMA 4DUZE 2VQEE 3J7AM 5BR8E 4GQUA 4LF6I 1UDOA 5JEAE 4LCGA 4U3DA 4DV0E 2UUAE 4DV1I 4DR1E 1FNMA 4MU1A 4DV6I 1PIEA 1J5EE 1UEKA 4Z7YA 4DR4E 3L7ZB 2O3ZA 4AQYI 2V2VA 1YHCA 2BR2A 2UU9I 5JEAA 1NHJA 3WU5A 4NXME 4HYMA 4OO1F 4JI4E 2LJPA 2AE8A 5DROA 5BR8I 1Y5YA 2Z5CB 4X64E 5K36E 1XHKA 3LTOA 4DUYI 4JI3I 2CG9A 2GO4A 1Z5CA 4IFDA 4LF9E 4YHHI 1Z0VA 2NN6C 2JEBB 2C39A 2IESA 1PVGA 1IBKI 4DV2I 4B3SE 4DR5E 1Z5AA 4OO1D 4DPUA 5K36A 1DARA 3P76A 2BM0A 1H74A 2NN6B 3B82A 2JE6B 3T1HI 4JI5I 5ELWA 2VQFE 4DV4E 2E5LI 2F4VI 2CGEA 4DR6I 2V2ZA 2HFUA 5DRQA 1I94I 4NXNE 3HKMA 4HACB 3NZKA 2E1RA 1HK7A 1NHHA 3J7AG 4USMA 4N3OA 4DR7I 4K0KE 2NN6F 1ZM3A 2C38B 4IFDF 2UXCE 4B3RI 1KIJA 1NHIA 5FLXC 1N32I 3JAMC 4WUCA 2C37A 2PO1A 2PO2B 1HNXE 4JV5I 4JI8I 1IBLE 4HY1A 4KQVA 4U3BA 1NZ0A 4LFAE 1IBME 2GQ0A 4LF8I 1Z0BA 4ZVIA 1N0VC 2O1WA 2NN6D 2BA1D 4X66I 4IFDD 2DEJA 3KRNA 4DV5I 4JI0E 3QT5A 2CVEA 2UUBI 3WU3A 3CDJA 3T1YE 3HJCA 1VISA 4DV7E 4GKJI 4AM3A 2CZ9A 5DRPA 5GMDA 1Y60A 4MYUA 2HHHI 3CWVA 1N33I 1B63A 4DR2I 3PRYA 5FLXQ 4YY3E 5LMNE 3JAMQ 1ZM4A 4DV3I 4OO1E 4IZKA 4LF6E 4M1KA 1HNWI 1ZM2A 1E3HA 4MDTA 2PNMA 4DV1E 4DV6E 2WP8B 1RREA 4I3HA 2A2CA 2WNRB 1RHYA 1HR0I 4DPWA 4DU7A 1B62A 2PNZB 3J81C 4AQYE 2EFGA 1S16A 5IT9C 4J3DA 5L3JA 2DEIA 2UU9E 2R3VA 4LFBI 4JI7I 4IZJB 3K1JA 1Z59A 3L7ZA 1Y4UA 3ZM7A 2X36A 4DUYE 2IOQA 2HK3A 1PKPA 4JI3E 1Z5BA 4OX9I 5LMUE 2IOPA 1Z0GA 2Z5CA 4YHHE 1KKHA 4B3MI 2UXBI 2JEAB 1IBKE 4DV2E 1FKAE 2NN6E 4IFDE 3J80C 3OTOI 2PNLA 2JEBA 4DPXA 3T1HE 4JI5E 4XTJA 5FWKA 2A2DA 1FWKA 5C0XC 3J81Q 2E5LE 2F4VE 5IT9Q 4DR6E 1I94E 4B3TI 4PU9A 3D4JA 2UXDI 4MU3A 4LFCI 1A6FA 2HKJA 4DPYA 2NN6A 3U1YA 2JE6A 5LMUI 4IZJD 4LF5I 5C0XB 1XMQI 4DR7E 1UDQA 1FWLA 3Q1QA 3P06A 4HACA 4B3RE 2ZBKB 2BA0D 4JI2I 1N32E 3V5RA 5A2QC 2C38A 4FWDA 1MX0A 4JV5E 4JI8E 5C0XF 2JT2A 3J80Q 4FN5A 1Y6ZA 2AJ4A 1KVKA 2PO0B 2PO2A 4LF8E 1OJ4A 2O1VA 4X66E 2XEXA 4DV5E 4HXZA 3PS1A 5LL6R 2UUBE 4DR3I 2V2QA 4GKJE 2J65A 4KHPI 4X65I 4JI1I 5C0XD 1HNZI 2HHHE 1N33E 2IERA 4OZEA 4DR2E 1XXEA 4JYAI 2Z5BB 1XNQI 3PS3A 3PYDA 4DV3E 3WU6A 4WUBA 3K85A 4PRVA 3P3CA 2BA1G 1HNWE 2R42A 1USVA 4UT4A 4JG4A 1N36I 1HR0E 2ZM6I 1N0UA 4RPFA 5IWAI 2GS8A 3QT6A 1E3PA 3M6AA 4LFBE 2WNRA 2ZITA 4JI7E 2NPFA 3ZZ0A 4LF4I 3WU4A 3LPSA 4UTGA 3LNUA 2PNZA 2Z5EA 4IS9A 3PYEA 1N34I 4X62I 4LF7I 4DPTA 4IZJA 1Z0CA 4OX9E 1XNRI 3DD6A 4B3ME 1FJGI 3GONA 1USUA 3P3EA 4URLA 2UXBE 1MU5A 2VESA 2HK2A 3OTOE 1OYRA 3H4LA 1ELOA 4WUDA 2JEAA 1R6MA 2HKEA 5DRRA 3M7ND 2V34A 2VF3A 4FWGA 1Z0EA 1H73A 5C0XE 2GO3A 4B3TE 2UXDE 4LOMA 4LFCE 3M7NG 1P42A 3ZKBA 4GKKI 4BA1B 1FI4A 3ZKDA 4LF5E 1XMQE 3U1KA 2UUCI 4OO1C 3PYFA 1RR9A 1MG7A 5C0XA 4JI2E 2O1UA 4OO1B 1WUUA 3PYGA 4P7AA 4BA2B 2F1DA 4P52A 5EKWA 1XMOI 4LCHA 4FW4A 4PRXA 4JI6E 2Q2EB 4R1FA 3B78A 3GLLA 1H72C 3B8HA 5JEAC 4DUZI 2PO0A 5GMEA 2VQEI 2OI2A 3P3GA 4FW7A 4DR3E 4KHPE 2BA0G 4FW5A 4X65E 1HNZE 4DV0I 2UUAI 1U2RA 3HULA 4OKGA 4DR1I 1J5EI 4JI1E 2BR2B 4FW9A 5JEAB 1UDNA 4JYAE 4DR4I 3GMEA 1XNQE 4JI6I 3B4TA 4IFDC 1ZM9A 3QT8A 1UDSA 4ISAA 4NXMI
chains in the Genus database with same CATH topology
1EA6A 2Z5BA 4JI4I 2O1TA 4X64I 4MYTA 3V2UC 1EI1A 1N36E 2ZM6E 5IWAE 4LF9I 3Q6NA 2HFSA 5A2QQ 1ZXNA 4B3SI 3ZZTA 4LF4E 1Z0TA 4DR5I 4FWHA 2V8PA 1N34E 4Z7CA 4X62E 4LF7E 2VQFI 1K47A 4DV4I 1D6TA 1S4EA 1FJGE 4NXNI 1XNRE 3QT7A 1KTVA 1H7UA 4K0KI 1BKNA 2UXCI 4EMDA 4USKA 4ED4A 1HNXI 4DU8A 4DXLA 1IBLI 4GKKE 2BM1A 4LFAI 1IBMI 2UUCE 2BV3A 1Z0WA 1QZRA 1H7SA 3K17A 4JI0I 1Y4SA 2WW4A 3ZZUA 3T1YI 4DV7I 3Q6MA 1XMOE 3F0NA 2J7KA 4IZKB 4YY3I 5LMNI 2X7IA 1ZXMA 4DUZE 2VQEE 3J7AM 5BR8E 4LF6I 4DV0E 2UUAE 4DV1I 4DR1E 1FNMA 1J5EE 4DV6I 1PIEA 1UEKA 4Z7YA 4DR4E 4AQYI 2V2VA 2UU9I 1NHJA 3WU5A 4NXME 4HYMA 4JI4E 2LJPA 5BR8I 2Z5CB 4X64E 1XHKA 3LTOA 4DUYI 4JI3I 2CG9A 1Z5CA 4LF9E 4YHHI 1Z0VA 1PVGA 1IBKI 4DV2I 4B3SE 4DR5E 1Z5AA 4DPUA 1DARA 2BM0A 1H74A 3B82A 3T1HI 4JI5I 2VQFE 4DV4E 2E5LI 2F4VI 2CGEA 4DR6I 2V2ZA 2HFUA 4NXNE 1I94I 4HACB 2E1RA 1HK7A 1NHHA 3J7AG 4USMA 4N3OA 4DR7I 4K0KE 1ZM3A 2UXCE 4B3RI 1KIJA 1NHIA 5FLXC 1N32I 3JAMC 4WUCA 1HNXE 4JV5I 4JI8I 1IBLE 4HY1A 4KQVA 1NZ0A 4LFAE 1IBME 2GQ0A 4LF8I 1Z0BA 1N0VC 2O1WA 4ZVIA 4X66I 2DEJA 4DV5I 4JI0E 3QT5A 2UUBI 3WU3A 3T1YE 3HJCA 1VISA 4DV7E 4GKJI 2CZ9A 5GMDA 4MYUA 2HHHI 3CWVA 1N33I 1B63A 4DR2I 3PRYA 5FLXQ 4YY3E 5LMNE 3JAMQ 1ZM4A 4DV3I 4IZKA 4LF6E 4M1KA 1HNWI 1ZM2A 4DV1E 2PNMA 4DV6E 4I3HA 1RREA 2A2CA 1HR0I 4DPWA 4DU7A 1B62A 3J81C 4AQYE 2EFGA 1S16A 5IT9C 5L3JA 2DEIA 2UU9E 2R3VA 4LFBI 4JI7I 4IZJB 3K1JA 1Z59A 1Y4UA 3ZM7A 2X36A 4DUYE 2IOQA 2HK3A 1PKPA 4JI3E 1Z5BA 4OX9I 5LMUE 2IOPA 1Z0GA 2Z5CA 4YHHE 1KKHA 4B3MI 2UXBI 1IBKE 4DV2E 1FKAE 3J80C 3OTOI 2PNLA 4DPXA 3T1HE 4JI5E 4XTJA 5FWKA 2A2DA 1FWKA 3J81Q 2E5LE 2F4VE 5IT9Q 4DR6E 1I94E 4B3TI 4PU9A 3D4JA 2UXDI 4LFCI 1A6FA 2HKJA 4DPYA 5LMUI 4IZJD 4LF5I 1XMQI 4DR7E 1FWLA 3Q1QA 3P06A 4HACA 4B3RE 2ZBKB 4JI2I 1N32E 3V5RA 5A2QC 4FWDA 1MX0A 4JV5E 4JI8E 3J80Q 4FN5A 1Y6ZA 2AJ4A 1KVKA 4LF8E 1OJ4A 2O1VA 4X66E 2XEXA 4DV5E 4HXZA 5LL6R 2UUBE 4DR3I 2V2QA 4GKJE 4KHPI 4X65I 4JI1I 1HNZI 2HHHE 1N33E 4DR2E 4JYAI 2Z5BB 1XNQI 3PYDA 4DV3E 3WU6A 4WUBA 3K85A 4PRVA 1HNWE 2R42A 1USVA 4UT4A 4JG4A 1N36I 1HR0E 2ZM6I 1N0UA 4RPFA 5IWAI 2GS8A 3QT6A 3M6AA 4LFBE 2ZITA 4JI7E 2NPFA 3ZZ0A 4LF4I 3WU4A 3LPSA 4UTGA 3LNUA 2Z5EA 3PYEA 1N34I 4X62I 4LF7I 4DPTA 4IZJA 1Z0CA 4OX9E 1XNRI 1FJGI 4B3ME 3GONA 1USUA 4URLA 2UXBE 1MU5A 2HK2A 3OTOE 3H4LA 1ELOA 4WUDA 2HKEA 2V34A 2VF3A 4FWGA 1Z0EA 1H73A 4B3TE 2UXDE 4LFCE 3ZKBA 4GKKI 1FI4A 3ZKDA 4LF5E 1XMQE 2UUCI 3PYFA 1RR9A 1MG7A 4JI2E 2O1UA 1WUUA 3PYGA 4P7AA 4P52A 1XMOI 4PRXA 4JI6E 2Q2EB 4R1FA 3B78A 1H72C 3B8HA 4DUZI 5GMEA 2VQEI 2OI2A 4DR3E 4KHPE 4X65E 1HNZE 4JI1E 4DV0I 2UUAI 1U2RA 3HULA 4DR1I 1J5EI 4FW9A 4JYAE 4DR4I 1XNQE 4JI6I 1ZM9A 3QT8A 4NXMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA6 A;  4JI4 I;  4X64 I;  4MYT A;  3V2U C;  1EI1 A;  1N36 E;  2ZM6 E;  5IWA E;  4LF9 I;  2HFS A;  5A2Q Q;  1ZXN A;  4B3S I;  3ZZT A;  4LF4 E;  1Z0T A;  4DR5 I;  4FWH A;  2V8P A;  1N34 E;  4Z7C A;  4X62 E;  4LF7 E;  2VQF I;  1K47 A;  4DV4 I;  1D6T A;  1S4E A;  1FJG E;  4NXN I;  1XNR E;  3QT7 A;  1KTV A;  1H7U A;  4K0K I;  1BKN A;  2UXC I;  4EMD A;  4USK A;  4ED4 A;  1HNX I;  4DU8 A;  4DXL A;  1IBL I;  4GKK E;  2BM1 A;  4LFA I;  1IBM I;  2UUC E;  2BV3 A;  1Z0W A;  1QZR A;  1H7S A;  3K17 A;  4JI0 I;  2WW4 A;  3ZZU A;  3T1Y I;  4DV7 I;  1XMO E;  3F0N A;  2J7K A;  4YY3 I;  5LMN I;  2X7I A;  1ZXM A;  4DUZ E;  2VQE E;  3J7A M;  5BR8 E;  4LF6 I;  2UUA E;  4DV0 E;  4DV1 I;  4DR1 E;  1FNM A;  1J5E E;  4DV6 I;  1PIE A;  1UEK A;  4Z7Y A;  4DR4 E;  4AQY I;  2V2V A;  2UU9 I;  1NHJ A;  3WU5 A;  4NXM E;  4HYM A;  4JI4 E;  2LJP A;  5BR8 I;  4X64 E;  1XHK A;  3LTO A;  4DUY I;  4JI3 I;  1Z5C A;  4LF9 E;  4YHH I;  1Z0V A;  1PVG A;  1IBK I;  4DV2 I;  4B3S E;  4DR5 E;  1Z5A A;  4DPU A;  1DAR A;  2BM0 A;  1H74 A;  3B82 A;  3T1H I;  4JI5 I;  2VQF E;  4DV4 E;  2E5L I;  2F4V I;  4DR6 I;  2V2Z A;  2HFU A;  4NXN E;  1I94 I;  4HAC B;  2E1R A;  1NHH A;  3J7A G;  4USM A;  4DR7 I;  4K0K E;  1ZM3 A;  2UXC E;  4B3R I;  1KIJ A;  1NHI A;  5FLX C;  1N32 I;  3JAM C;  4WUC A;  1HNX E;  4JV5 I;  4JI8 I;  1IBL E;  4HY1 A;  4KQV A;  1NZ0 A;  4LFA E;  1IBM E;  4LF8 I;  1Z0B A;  1N0V C;  4ZVI A;  4X66 I;  2DEJ A;  4DV5 I;  4JI0 E;  3QT5 A;  2UUB I;  3WU3 A;  3T1Y E;  4DV7 E;  1VIS A;  4GKJ I;  2CZ9 A;  5GMD A;  4MYU A;  2HHH I;  3CWV A;  1N33 I;  1B63 A;  4DR2 I;  5FLX Q;  4YY3 E;  5LMN E;  3JAM Q;  1ZM4 A;  4DV3 I;  4LF6 E;  4M1K A;  1HNW I;  1ZM2 A;  4DV1 E;  4DV6 E;  4I3H A;  1RRE A;  2A2C A;  1HR0 I;  4DPW A;  4DU7 A;  1B62 A;  3J81 C;  4AQY E;  2EFG A;  1S16 A;  5IT9 C;  5L3J A;  2DEI A;  2UU9 E;  2R3V A;  4LFB I;  4JI7 I;  3K1J A;  1Z59 A;  3ZM7 A;  2X36 A;  4DUY E;  2HK3 A;  1PKP A;  4JI3 E;  1Z5B A;  4OX9 I;  5LMU E;  4YHH E;  1Z0G A;  4B3M I;  1KKH A;  2UXB I;  1IBK E;  4DV2 E;  1FKA E;  3J80 C;  3OTO I;  4DPX A;  3T1H E;  4JI5 E;  4XTJ A;  2A2D A;  1FWK A;  3J81 Q;  2E5L E;  2F4V E;  5IT9 Q;  4DR6 E;  1I94 E;  4B3T I;  4PU9 A;  3D4J A;  2UXD I;  4LFC I;  1A6F A;  2HKJ A;  4DPY A;  5LMU I;  4LF5 I;  1XMQ I;  4DR7 E;  1FWL A;  3Q1Q A;  4HAC A;  4B3R E;  2ZBK B;  4JI2 I;  1N32 E;  3V5R A;  5A2Q C;  4FWD A;  1MX0 A;  4JV5 E;  4JI8 E;  3J80 Q;  4FN5 A;  2AJ4 A;  1KVK A;  4LF8 E;  1OJ4 A;  4X66 E;  2XEX A;  4DV5 E;  4HXZ A;  5LL6 R;  2UUB E;  4DR3 I;  2V2Q A;  4GKJ E;  4KHP I;  4X65 I;  4JI1 I;  1HNZ I;  2HHH E;  1N33 E;  4DR2 E;  4JYA I;  1XNQ I;  3PYD A;  4DV3 E;  3WU6 A;  4WUB A;  4PRV A;  1HNW E;  2R42 A;  4UT4 A;  4JG4 A;  1N36 I;  1HR0 E;  2ZM6 I;  1N0U A;  4RPF A;  5IWA I;  2GS8 A;  3QT6 A;  3M6A A;  4LFB E;  2ZIT A;  4JI7 E;  2NPF A;  3ZZ0 A;  4LF4 I;  3WU4 A;  3LPS A;  4UTG A;  3LNU A;  3PYE A;  1N34 I;  4X62 I;  4LF7 I;  4DPT A;  1Z0C A;  4OX9 E;  1XNR I;  1FJG I;  4B3M E;  3GON A;  4URL A;  2UXB E;  1MU5 A;  2HK2 A;  3OTO E;  3H4L A;  1ELO A;  4WUD A;  2HKE A;  2V34 A;  2VF3 A;  4FWG A;  1Z0E A;  1H73 A;  4B3T E;  2UXD E;  4LFC E;  3ZKB A;  4GKK I;  1FI4 A;  3ZKD A;  4LF5 E;  1XMQ E;  2UUC I;  3PYF A;  1RR9 A;  1MG7 A;  4JI2 E;  1WUU A;  3PYG A;  4P7A A;  4P52 A;  1XMO I;  4PRX A;  4JI6 E;  2Q2E B;  4R1F A;  3B78 A;  1H72 C;  3B8H A;  4DUZ I;  5GME A;  2VQE I;  2OI2 A;  4DR3 E;  4KHP E;  4X65 E;  1HNZ E;  4JI1 E;  4DV0 I;  2UUA I;  1U2R A;  3HUL A;  4DR1 I;  1J5E I;  4FW9 A;  4JYA E;  4DR4 I;  1XNQ E;  4JI6 I;  1ZM9 A;  3QT8 A;  4NXM I; 
#chains in the Genus database with same CATH topology
 1EA6 A;  2Z5B A;  4JI4 I;  3PS2 A;  4MU0 A;  2O1T A;  5K36 C;  4IFD B;  5JEA F;  4X64 I;  4MYT A;  3V2U C;  1EI1 A;  2C39 B;  3UHM A;  4FW3 A;  1N36 E;  2ZM6 E;  5IWA E;  5K36 B;  4LF9 I;  3Q6N A;  2HFS A;  5A2Q Q;  1ZXN A;  4B3S I;  3ZZT A;  3CDI A;  1Z0T A;  4LF4 E;  4DR5 I;  4FWH A;  5DNX A;  2V8P A;  4AIM A;  4NBQ A;  5JEA D;  1N34 E;  4Z7C A;  4X62 E;  4LF7 E;  2VQF I;  1K47 A;  4DV4 I;  1D6T A;  5K36 F;  1S4E A;  1FJG E;  4NXN I;  1XNR E;  3GCM A;  3QT7 A;  4QNJ A;  1KTV A;  4MQY A;  2WP8 A;  1H7U A;  4QNK A;  1R6L A;  4K0K I;  2C37 B;  2PO1 B;  4AID A;  1BKN A;  4LPF A;  2UXC I;  3H1C A;  4EMD A;  4USK A;  5K36 D;  4ED4 A;  1HNX I;  4DU8 A;  5DNL A;  4DXL A;  1OYP A;  4MU4 A;  1IBL I;  4GKK E;  2BM1 A;  1YH8 A;  4LFA I;  1IBM I;  2UUC E;  2BV3 A;  3M85 D;  1Z0W A;  1QZR A;  4BA1 A;  3M85 G;  1H7S A;  3K17 A;  4JI0 I;  1Y4S A;  1VI7 A;  5EL9 A;  2WW4 A;  4LCF A;  3ZZU A;  3T1Y I;  4DV7 I;  3Q6M A;  1OYS A;  1XMO E;  3F0N A;  2J7K A;  4IZK B;  4OO1 A;  4FW6 A;  4YY3 I;  5LMN I;  4BA2 A;  2X7I A;  1ZXM A;  4DUZ E;  2VQE E;  3J7A M;  5BR8 E;  4GQU A;  4LF6 I;  1UDO A;  5JEA E;  4LCG A;  4U3D A;  4DV0 E;  2UUA E;  4DV1 I;  4DR1 E;  1FNM A;  4MU1 A;  4DV6 I;  1PIE A;  1J5E E;  1UEK A;  4Z7Y A;  4DR4 E;  3L7Z B;  2O3Z A;  4AQY I;  2V2V A;  1YHC A;  2BR2 A;  2UU9 I;  5JEA A;  1NHJ A;  3WU5 A;  4NXM E;  4HYM A;  4OO1 F;  4JI4 E;  2LJP A;  2AE8 A;  5DRO A;  5BR8 I;  1Y5Y A;  2Z5C B;  4X64 E;  5K36 E;  1XHK A;  3LTO A;  4DUY I;  4JI3 I;  2CG9 A;  2GO4 A;  1Z5C A;  4IFD A;  4LF9 E;  4YHH I;  1Z0V A;  2NN6 C;  2JEB B;  2C39 A;  2IES A;  1PVG A;  1IBK I;  4DV2 I;  4B3S E;  4DR5 E;  1Z5A A;  4OO1 D;  4DPU A;  5K36 A;  1DAR A;  3P76 A;  2BM0 A;  1H74 A;  2NN6 B;  3B82 A;  2JE6 B;  3T1H I;  4JI5 I;  5ELW A;  2VQF E;  4DV4 E;  2E5L I;  2F4V I;  2CGE A;  4DR6 I;  2V2Z A;  2HFU A;  5DRQ A;  1I94 I;  4NXN E;  3HKM A;  4HAC B;  3NZK A;  2E1R A;  1HK7 A;  1NHH A;  3J7A G;  4USM A;  4N3O A;  4DR7 I;  4K0K E;  2NN6 F;  1ZM3 A;  2C38 B;  4IFD F;  2UXC E;  4B3R I;  1KIJ A;  1NHI A;  5FLX C;  1N32 I;  3JAM C;  4WUC A;  2C37 A;  2PO1 A;  2PO2 B;  1HNX E;  4JV5 I;  4JI8 I;  1IBL E;  4HY1 A;  4KQV A;  4U3B A;  1NZ0 A;  4LFA E;  1IBM E;  2GQ0 A;  4LF8 I;  1Z0B A;  4ZVI A;  1N0V C;  2O1W A;  2NN6 D;  2BA1 D;  4X66 I;  4IFD D;  2DEJ A;  3KRN A;  4DV5 I;  4JI0 E;  3QT5 A;  2CVE A;  2UUB I;  3WU3 A;  3CDJ A;  3T1Y E;  3HJC A;  1VIS A;  4DV7 E;  4GKJ I;  4AM3 A;  2CZ9 A;  5DRP A;  5GMD A;  1Y60 A;  4MYU A;  2HHH I;  3CWV A;  1N33 I;  1B63 A;  4DR2 I;  3PRY A;  5FLX Q;  4YY3 E;  5LMN E;  3JAM Q;  1ZM4 A;  4DV3 I;  4OO1 E;  4IZK A;  4LF6 E;  4M1K A;  1HNW I;  1ZM2 A;  1E3H A;  4MDT A;  2PNM A;  4DV1 E;  4DV6 E;  2WP8 B;  1RRE A;  4I3H A;  2A2C A;  2WNR B;  1RHY A;  1HR0 I;  4DPW A;  4DU7 A;  1B62 A;  2PNZ B;  3J81 C;  4AQY E;  2EFG A;  1S16 A;  5IT9 C;  4J3D A;  5L3J A;  2DEI A;  2UU9 E;  2R3V A;  4LFB I;  4JI7 I;  4IZJ B;  3K1J A;  1Z59 A;  3L7Z A;  1Y4U A;  3ZM7 A;  2X36 A;  4DUY E;  2IOQ A;  2HK3 A;  1PKP A;  4JI3 E;  1Z5B A;  4OX9 I;  5LMU E;  2IOP A;  1Z0G A;  2Z5C A;  4YHH E;  1KKH A;  4B3M I;  2UXB I;  2JEA B;  1IBK E;  4DV2 E;  1FKA E;  2NN6 E;  4IFD E;  3J80 C;  3OTO I;  2PNL A;  2JEB A;  4DPX A;  3T1H E;  4JI5 E;  4XTJ A;  5FWK A;  2A2D A;  1FWK A;  5C0X C;  3J81 Q;  2E5L E;  2F4V E;  5IT9 Q;  4DR6 E;  1I94 E;  4B3T I;  4PU9 A;  3D4J A;  2UXD I;  4MU3 A;  4LFC I;  1A6F A;  2HKJ A;  4DPY A;  2NN6 A;  3U1Y A;  2JE6 A;  5LMU I;  4IZJ D;  4LF5 I;  5C0X B;  1XMQ I;  4DR7 E;  1UDQ A;  1FWL A;  3Q1Q A;  3P06 A;  4HAC A;  4B3R E;  2ZBK B;  2BA0 D;  4JI2 I;  1N32 E;  3V5R A;  5A2Q C;  2C38 A;  4FWD A;  1MX0 A;  4JV5 E;  4JI8 E;  5C0X F;  2JT2 A;  3J80 Q;  4FN5 A;  1Y6Z A;  2AJ4 A;  1KVK A;  2PO0 B;  2PO2 A;  4LF8 E;  1OJ4 A;  2O1V A;  4X66 E;  2XEX A;  4DV5 E;  4HXZ A;  3PS1 A;  5LL6 R;  2UUB E;  4DR3 I;  2V2Q A;  4GKJ E;  2J65 A;  4KHP I;  4X65 I;  4JI1 I;  5C0X D;  1HNZ I;  2HHH E;  1N33 E;  2IER A;  4OZE A;  4DR2 E;  1XXE A;  4JYA I;  2Z5B B;  1XNQ I;  3PS3 A;  3PYD A;  4DV3 E;  3WU6 A;  4WUB A;  3K85 A;  4PRV A;  3P3C A;  2BA1 G;  1HNW E;  2R42 A;  1USV A;  4UT4 A;  4JG4 A;  1N36 I;  1HR0 E;  2ZM6 I;  1N0U A;  4RPF A;  5IWA I;  2GS8 A;  3QT6 A;  1E3P A;  3M6A A;  4LFB E;  2WNR A;  2ZIT A;  4JI7 E;  2NPF A;  3ZZ0 A;  4LF4 I;  3WU4 A;  3LPS A;  4UTG A;  3LNU A;  2PNZ A;  2Z5E A;  4IS9 A;  3PYE A;  1N34 I;  4X62 I;  4LF7 I;  4DPT A;  4IZJ A;  1Z0C A;  4OX9 E;  1XNR I;  3DD6 A;  4B3M E;  1FJG I;  3GON A;  1USU A;  3P3E A;  4URL A;  2UXB E;  1MU5 A;  2VES A;  2HK2 A;  3OTO E;  1OYR A;  3H4L A;  1ELO A;  4WUD A;  2JEA A;  1R6M A;  2HKE A;  5DRR A;  3M7N D;  2V34 A;  2VF3 A;  4FWG A;  1Z0E A;  1H73 A;  5C0X E;  2GO3 A;  4B3T E;  2UXD E;  4LOM A;  4LFC E;  3M7N G;  1P42 A;  3ZKB A;  4GKK I;  4BA1 B;  1FI4 A;  3ZKD A;  4LF5 E;  1XMQ E;  3U1K A;  2UUC I;  4OO1 C;  3PYF A;  1RR9 A;  1MG7 A;  5C0X A;  4JI2 E;  2O1U A;  4OO1 B;  1WUU A;  3PYG A;  4P7A A;  4BA2 B;  2F1D A;  4P52 A;  5EKW A;  1XMO I;  4LCH A;  4FW4 A;  4PRX A;  4JI6 E;  2Q2E B;  4R1F A;  3B78 A;  3GLL A;  1H72 C;  3B8H A;  5JEA C;  4DUZ I;  2PO0 A;  5GME A;  2VQE I;  2OI2 A;  3P3G A;  4FW7 A;  4DR3 E;  4KHP E;  2BA0 G;  4FW5 A;  4X65 E;  1HNZ E;  4DV0 I;  2UUA I;  1U2R A;  3HUL A;  4OKG A;  4DR1 I;  1J5E I;  4JI1 E;  2BR2 B;  4FW9 A;  5JEA B;  1UDN A;  4JYA E;  4DR4 I;  3GME A;  1XNQ E;  4JI6 I;  3B4T A;  4IFD C;  1ZM9 A;  3QT8 A;  1UDS A;  4ISA A;  4NXM I; 
#chains in the Genus database with same CATH homology
 1EA6 A;  2Z5B A;  4JI4 I;  2O1T A;  4X64 I;  4MYT A;  3V2U C;  1EI1 A;  1N36 E;  2ZM6 E;  5IWA E;  4LF9 I;  3Q6N A;  2HFS A;  5A2Q Q;  1ZXN A;  4B3S I;  3ZZT A;  4LF4 E;  1Z0T A;  4DR5 I;  4FWH A;  2V8P A;  1N34 E;  4Z7C A;  4X62 E;  4LF7 E;  2VQF I;  1K47 A;  4DV4 I;  1D6T A;  1S4E A;  1FJG E;  4NXN I;  1XNR E;  3QT7 A;  1KTV A;  1H7U A;  4K0K I;  1BKN A;  2UXC I;  4EMD A;  4USK A;  4ED4 A;  1HNX I;  4DU8 A;  4DXL A;  1IBL I;  4GKK E;  2BM1 A;  4LFA I;  1IBM I;  2UUC E;  2BV3 A;  1Z0W A;  1QZR A;  1H7S A;  3K17 A;  4JI0 I;  1Y4S A;  2WW4 A;  3ZZU A;  3T1Y I;  4DV7 I;  3Q6M A;  1XMO E;  3F0N A;  2J7K A;  4IZK B;  4YY3 I;  5LMN I;  2X7I A;  1ZXM A;  4DUZ E;  2VQE E;  3J7A M;  5BR8 E;  4LF6 I;  4DV0 E;  2UUA E;  4DV1 I;  4DR1 E;  1FNM A;  1J5E E;  4DV6 I;  1PIE A;  1UEK A;  4Z7Y A;  4DR4 E;  4AQY I;  2V2V A;  2UU9 I;  1NHJ A;  3WU5 A;  4NXM E;  4HYM A;  4JI4 E;  2LJP A;  5BR8 I;  2Z5C B;  4X64 E;  1XHK A;  3LTO A;  4DUY I;  4JI3 I;  2CG9 A;  1Z5C A;  4LF9 E;  4YHH I;  1Z0V A;  1PVG A;  1IBK I;  4DV2 I;  4B3S E;  4DR5 E;  1Z5A A;  4DPU A;  1DAR A;  2BM0 A;  1H74 A;  3B82 A;  3T1H I;  4JI5 I;  2VQF E;  4DV4 E;  2E5L I;  2F4V I;  2CGE A;  4DR6 I;  2V2Z A;  2HFU A;  4NXN E;  1I94 I;  4HAC B;  2E1R A;  1HK7 A;  1NHH A;  3J7A G;  4USM A;  4N3O A;  4DR7 I;  4K0K E;  1ZM3 A;  2UXC E;  4B3R I;  1KIJ A;  1NHI A;  5FLX C;  1N32 I;  3JAM C;  4WUC A;  1HNX E;  4JV5 I;  4JI8 I;  1IBL E;  4HY1 A;  4KQV A;  1NZ0 A;  4LFA E;  1IBM E;  2GQ0 A;  4LF8 I;  1Z0B A;  1N0V C;  2O1W A;  4ZVI A;  4X66 I;  2DEJ A;  4DV5 I;  4JI0 E;  3QT5 A;  2UUB I;  3WU3 A;  3T1Y E;  3HJC A;  1VIS A;  4DV7 E;  4GKJ I;  2CZ9 A;  5GMD A;  4MYU A;  2HHH I;  3CWV A;  1N33 I;  1B63 A;  4DR2 I;  3PRY A;  5FLX Q;  4YY3 E;  5LMN E;  3JAM Q;  1ZM4 A;  4DV3 I;  4IZK A;  4LF6 E;  4M1K A;  1HNW I;  1ZM2 A;  4DV1 E;  2PNM A;  4DV6 E;  4I3H A;  1RRE A;  2A2C A;  1HR0 I;  4DPW A;  4DU7 A;  1B62 A;  3J81 C;  4AQY E;  2EFG A;  1S16 A;  5IT9 C;  5L3J A;  2DEI A;  2UU9 E;  2R3V A;  4LFB I;  4JI7 I;  4IZJ B;  3K1J A;  1Z59 A;  1Y4U A;  3ZM7 A;  2X36 A;  4DUY E;  2IOQ A;  2HK3 A;  1PKP A;  4JI3 E;  1Z5B A;  4OX9 I;  5LMU E;  2IOP A;  1Z0G A;  2Z5C A;  4YHH E;  1KKH A;  4B3M I;  2UXB I;  1IBK E;  4DV2 E;  1FKA E;  3J80 C;  3OTO I;  2PNL A;  4DPX A;  3T1H E;  4JI5 E;  4XTJ A;  5FWK A;  2A2D A;  1FWK A;  3J81 Q;  2E5L E;  2F4V E;  5IT9 Q;  4DR6 E;  1I94 E;  4B3T I;  4PU9 A;  3D4J A;  2UXD I;  4LFC I;  1A6F A;  2HKJ A;  4DPY A;  5LMU I;  4IZJ D;  4LF5 I;  1XMQ I;  4DR7 E;  1FWL A;  3Q1Q A;  3P06 A;  4HAC A;  4B3R E;  2ZBK B;  4JI2 I;  1N32 E;  3V5R A;  5A2Q C;  4FWD A;  1MX0 A;  4JV5 E;  4JI8 E;  3J80 Q;  4FN5 A;  1Y6Z A;  2AJ4 A;  1KVK A;  4LF8 E;  1OJ4 A;  2O1V A;  4X66 E;  2XEX A;  4DV5 E;  4HXZ A;  5LL6 R;  2UUB E;  4DR3 I;  2V2Q A;  4GKJ E;  4KHP I;  4X65 I;  4JI1 I;  1HNZ I;  2HHH E;  1N33 E;  4DR2 E;  4JYA I;  2Z5B B;  1XNQ I;  3PYD A;  4DV3 E;  3WU6 A;  4WUB A;  3K85 A;  4PRV A;  1HNW E;  2R42 A;  1USV A;  4UT4 A;  4JG4 A;  1N36 I;  1HR0 E;  2ZM6 I;  1N0U A;  4RPF A;  5IWA I;  2GS8 A;  3QT6 A;  3M6A A;  4LFB E;  2ZIT A;  4JI7 E;  2NPF A;  3ZZ0 A;  4LF4 I;  3WU4 A;  3LPS A;  4UTG A;  3LNU A;  2Z5E A;  3PYE A;  1N34 I;  4X62 I;  4LF7 I;  4DPT A;  4IZJ A;  1Z0C A;  4OX9 E;  1XNR I;  1FJG I;  4B3M E;  3GON A;  1USU A;  4URL A;  2UXB E;  1MU5 A;  2HK2 A;  3OTO E;  3H4L A;  1ELO A;  4WUD A;  2HKE A;  2V34 A;  2VF3 A;  4FWG A;  1Z0E A;  1H73 A;  4B3T E;  2UXD E;  4LFC E;  3ZKB A;  4GKK I;  1FI4 A;  3ZKD A;  4LF5 E;  1XMQ E;  2UUC I;  3PYF A;  1RR9 A;  1MG7 A;  4JI2 E;  2O1U A;  1WUU A;  3PYG A;  4P7A A;  4P52 A;  1XMO I;  4PRX A;  4JI6 E;  2Q2E B;  4R1F A;  3B78 A;  1H72 C;  3B8H A;  4DUZ I;  5GME A;  2VQE I;  2OI2 A;  4DR3 E;  4KHP E;  4X65 E;  1HNZ E;  4JI1 E;  4DV0 I;  2UUA I;  1U2R A;  3HUL A;  4DR1 I;  1J5E I;  4FW9 A;  4JYA E;  4DR4 I;  1XNQ E;  4JI6 I;  1ZM9 A;  3QT8 A;  4NXM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...