4JI7I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji7I00
4X62I 4K0KE 5A2QQ 3F0NA 3ZZTA 4LF9I 3ZKBA 4USMA 1N33I 4DV3E 4LFAE 2V2ZA 4WUCA 3T1YI 4DR2E 3PYDA 2VQFI 1HR0I 1Z0TA 1MU5A 4DV1E 4GKKE 2UXDI 3B78A 1EI1A 4JI1E 2VQEE 1H72C 2EFGA 2J7KA 2X36A 2VQEI 4LF6E 2UUCI 4HYMA 1UEKA 3WU6A 4DV7E 4DV5I 4LF8I 4NXNE 1IBKE 4X64I 1H73A 2HK2A 4DR5E 1IBME 4B3RI 1FKAE 4DPYA 1IBLE 2HKEA 4FWGA 2DEIA 2UXCE 2X7IA 2UUBE 4URLA 1Z5CA 2ZM6E 4DPWA 4Z7CA 3HULA 1N36E 1MG7A 4PRXA 4DV6I 4RPFA 2HK3A 4JI3E 4X66I 3K17A 1S4EA 4ZVIA 4FWHA 4JI3I 3ZM7A 2HHHI 1N34E 1OJ4A 2HFSA 3K1JA 4PU9A 1HNWI 4MYTA 4YY3E 4GKJE 4JI7E 5BR8I 4USKA 3QT6A 4DR7E 1B63A 1Z0CA 3J80C 1Z59A 1ZM2A 4JI5E 2R42A 4HACB 4DR3I 4DUYI 1NHJA 1ZM9A 4LFBE 4ED4A 1J5EE 2GS8A 4JI8E 2HHHE 3JAMC 3V5RA 2UU9I 4DV4I 4JI2E 3CWVA 5IT9Q 1N33E 5IWAE 4B3RE 4DV4E 4GKJI 3WU4A 2BV3A 4YHHE 2LJPA 2V34A 2UXDE 2ZM6I 1XMQE 1XNRI 4X62E 4B3SE 4LF7I 2ZITA 4DR6E 4NXNI 4LF8E 1RR9A 4DV7I 4K0KI 4DPUA 4HY1A 4DV2I 4LF4E 4YHHI 3GONA 3PYEA 3T1YE 2UXBI 1XMOI 4JI6I 5BR8E 1XHKA 3LNUA 3ZZUA 1N32E 4DR1E 5LMNE 4DR7I 1FWLA 5A2QC 4DV0E 4GKKI 4FWDA 2E5LE 1Z0EA 4B3ME 4NXME 2F4VI 2UUAI 1D6TA 3LTOA 1Z0VA 4R1FA 2F4VE 2V2VA 2VQFE 4DV3I 4DR6I 4AQYE 1ZXNA 4LF5I 2E1RA 3WU5A 3B82A 4JI4E 4KQVA 4JI4I 1XNQE 4DU7A 1HNWE 4LF4I 4DU8A 1XNQI 1FNMA 1VISA 4LF9E 4JYAE 4Z7YA 5FLXQ 1N32I 1KKHA 1A6FA 2R3VA 2E5LI 4B3MI 4LF6I 1HNZI 4XTJA 2UUAE 3J7AG 4X66E 4DXLA 4DV0I 1IBKI 1MX0A 2UUBI 1Z0GA 4JI1I 1N36I 2UU9E 4DR4I 4X65I 4DV6E 3J81Q 4OX9I 2A2CA 4JI2I 4DPTA 4HACA 4EMDA 1N34I 3J80Q 3OTOE 1NHIA 1N0UA 1Z5BA 1FJGI 3M6AA 4UT4A 1S16A 4MYUA 1EA6A 4JI6E 1IBMI 1FWKA 4NXMI 1BKNA 1DARA 4I3HA 4JYAI 1Z5AA 1KTVA 3H4LA 3QT5A 4WUBA 5IT9C 1NHHA 1B62A 2Q2EB 4DV1I 3J7AM 2VF3A 5GMEA 1KIJA 3QT8A 4DR5I 4LFCE 1I94E 1HNXE 4LFCI 4DV2E 1I94I 1HNXI 4LFBI 4JI7I 2UXCI 4JI0E 2HFUA 4B3TE 4X65E 3PYFA 2HKJA 3V2UC 4JI0I 2NPFA 4HXZA 3D4JA 1HR0E 1ZXMA 5LMUI 1PIEA 5LMUE 4DUYE 1XNRE 3QT7A 4M1KA 2ZBKB 3ZKDA 4UTGA 1Z0BA 4DR4E 1ZM4A 1H7UA 2CZ9A 2V8PA 4P52A 4WUDA 2BM0A 4LF5E 4DUZI 4DPXA 4X64E 1PKPA 1RREA 5GMDA 4JV5E 3J81C 3T1HE 4JV5I 4FW9A 4FN5A 3JAMQ 3LPSA 5LMNI 4YY3I 4P7AA 4B3TI 1FI4A 3B8HA 2AJ4A 4JI8I 5LL6R 1XMOE 4JI5I 4LF7E 4KHPI 1N0VC 1U2RA 2WW4A 2XEXA 1QZRA 1HNZE 1J5EI 2A2DA 3PYGA 4DR3E 1K47A 4LFAI 4DR2I 2UUCE 1PVGA 5FLXC 1ELOA 3Q1QA 1FJGE 4OX9E 1H7SA 4DV5E 4DR1I 3OTOI 1Z0WA 1KVKA 2V2QA 4PRVA 1XMQI 2BM1A 1IBLI 5IWAI 3T1HI 5L3JA 2UXBE 4B3SI 1NZ0A 1H74A 1WUUA 4KHPE 4AQYI 2DEJA 3WU3A 4JG4A 1ZM3A 2OI2A 3ZZ0A 4DUZE
chains in the Genus database with same CATH superfamily
1UDNA 4X62I 2VESA 4K0KE 5K36C 5A2QQ 5JEAC 3PS3A 3F0NA 3ZZTA 2O3ZA 4LF9I 3ZKBA 4USMA 1N33I 4DV3E 2BA0G 4LFAE 2V2ZA 2PO1B 4WUCA 3T1YI 4DR2E 3U1KA 4FW7A 2J65A 3PYDA 4LPFA 2VQFI 4MU1A 4IFDE 1HR0I 1Z0TA 1MU5A 5JEAE 4DV1E 4FW4A 4GKKE 2UXDI 1Y60A 3B78A 1EI1A 4IFDC 1OYSA 4JI1E 5DRPA 3M7NG 2IOPA 2VQEE 1H72C 2EFGA 2Z5EA 2J7KA 2X36A 2VQEI 4LF6E 2UUCI 4HYMA 1UEKA 3WU6A 2NN6D 4DV7E 4DV5I 1UDSA 4LF8I 4NXNE 5C0XA 4IFDF 1IBKE 3H1CA 5DNXA 4X64I 2C37B 1H73A 2HK2A 4OO1C 4DR5E 1IBME 4B3RI 1FKAE 4DPYA 4U3DA 3Q6NA 1IBLE 2HKEA 4FWGA 2DEIA 2UXCE 4IZJA 1OYPA 2X7IA 2UUBE 5C0XF 4URLA 4BA2A 1Z5CA 5EL9A 3HKMA 2CG9A 2ZM6E 4DPWA 1Y4UA 4Z7CA 5JEAF 2Z5CB 3HULA 1N36E 1MG7A 4PRXA 4IFDD 4DV6I 4RPFA 2HK3A 4JI3E 4X66I 5C0XE 3K17A 1S4EA 4ZVIA 4FWHA 2PO1A 4JI3I 3ZM7A 2HHHI 1N34E 2GQ0A 2NN6C 1E3PA 1OJ4A 2HFSA 3K1JA 4PU9A 1HNWI 3P06A 4OO1E 4MYTA 4YY3E 4GKJE 4JI7E 5BR8I 2PO0A 2WNRB 1YHCA 4BA1A 4USKA 3QT6A 4DR7E 1B63A 2PO2B 1Z0CA 3J80C 1Z59A 1ZM2A 4JI5E 1P42A 2R42A 4HACB 5FWKA 4DR3I 2PNZA 3M85G 4DUYI 1NHJA 1ZM9A 2O1VA 4BA2B 4LFBE 3NZKA 4ED4A 1J5EE 2GS8A 2BA1D 4JI8E 2HHHE 5DNLA 3CDIA 3JAMC 3V5RA 2UU9I 4DV4I 4JI2E 3CWVA 5IT9Q 1N33E 5IWAE 4B3RE 4DV4E 4GKJI 3WU4A 2BV3A 2IESA 4YHHE 3P3EA 2JEAA 4N3OA 2AE8A 5C0XB 3P76A 4NBQA 2LJPA 5K36B 2V34A 4OKGA 2UXDE 2ZM6I 2NN6E 4OZEA 2WP8A 1XMQE 1XNRI 4MU4A 4X62E 4B3SE 4QNJA 5JEAA 4LF7I 2JT2A 2ZITA 4DR6E 1OYRA 4FW6A 4NXNI 4LF8E 1RR9A 4GQUA 4DV7I 4K0KI 4DPUA 4HY1A 4DV2I 2Z5BA 4LF4E 4YHHI 3GONA 3PYEA 3T1YE 2JE6B 2UXBI 1XMOI 4JI6I 5BR8E 1XHKA 3LNUA 2JEBA 3ZZUA 5K36E 2GO3A 1Y6ZA 1N32E 4DR1E 5LMNE 4DR7I 1FWLA 5A2QC 4DV0E 4GKKI 2BR2B 4IFDA 4FWDA 2E5LE 1Z0EA 2C39A 4B3ME 4NXME 2UUAI 2F4VI 3LTOA 1D6TA 1Z0VA 4R1FA 2F4VE 2V2VA 2VQFE 4FW3A 4DV3I 4LCFA 4DR6I 4AQYE 4MQYA 1ZXNA 5K36D 4LF5I 2E1RA 3WU5A 3B82A 4JI4E 4OO1F 4IZJD 4KQVA 5DROA 4JI4I 1XNQE 4IZKA 4DU7A 1HNWE 4LF4I 4DU8A 5C0XC 1XNQI 1FNMA 1VISA 3L7ZA 5K36A 4LF9E 4JYAE 3DD6A 4Z7YA 5FLXQ 1XXEA 1N32I 1KKHA 1A6FA 2R3VA 2E5LI 4B3MI 1E3HA 2BA1G 4OO1B 4LF6I 4MDTA 1HNZI 3L7ZB 3PS2A 4XTJA 2UUAE 3J7AG 4X66E 4DXLA 4DV0I 1IBKI 1MX0A 2UUBI 1Z0GA 4JI1I 1N36I 2UU9E 4DR4I 4X65I 4DV6E 3J81Q 3Q6MA 1USUA 4J3DA 4OX9I 2A2CA 4JI2I 4DPTA 4HACA 4EMDA 1N34I 1R6MA 3J80Q 3OTOE 3KRNA 4LCGA 1NHIA 1N0UA 1Z5BA 1FJGI 3M6AA 4UT4A 4OO1A 5K36F 1S16A 4MYUA 1EA6A 4JI6E 1IBMI 1FWKA 4LOMA 4NXMI 2O1UA 1BKNA 4AIDA 1HK7A 1DARA 5JEAD 4I3HA 4JYAI 5ELWA 2CGEA 1Z5AA 1KTVA 3H4LA 3QT5A 4IZKB 4WUBA 5IT9C 5DRQA 1NHHA 1B62A 2Q2EB 3P3CA 4DV1I 3J7AM 2VF3A 3PS1A 3K85A 5GMEA 2Z5CA 1KIJA 3QT8A 4DR5I 2JE6A 3PRYA 1I94E 1HNXE 4LFCE 5EKWA 4LFCI 4DV2E 1I94I 1HNXI 2C38A 1R6LA 4MU3A 4LFBI 4JI7I 2UXCI 2PO2A 2HFUA 5JEAB 4JI0E 4B3TE 4X65E 3PYFA 3V2UC 2HKJA 4JI0I 2BR2A 4IFDB 2NPFA 2WNRA 4HXZA 2O1TA 2WP8B 3D4JA 2C38B 1HR0E 2BA0D 1ZXMA 5LMUI 4IS9A 1PIEA 2C39B 5LMUE 2JEBB 4AM3A 4DUYE 4QNKA 2IOQA 1XNRE 3QT7A 4M1KA 2ZBKB 3ZKDA 4UTGA 3P3GA 1UDQA 1Z0BA 1USVA 2F1DA 4DR4E 2JEAB 1ZM4A 4OO1D 1H7UA 2CZ9A 2V8PA 4P52A 4WUDA 2BM0A 5C0XD 2Z5BB 4LF5E 4DUZI 4DPXA 2PNMA 4FW5A 4X64E 1PKPA 1RREA 5GMDA 1UDOA 4JV5E 3J81C 3M85D 3T1HE 4JV5I 4FW9A 1Y5YA 4LCHA 2PNLA 4FN5A 3JAMQ 3LPSA 5LMNI 4YY3I 4P7AA 1VI7A 4B3TI 2C37A 3M7ND 1FI4A 3B8HA 2AJ4A 4JI8I 5LL6R 4U3BA 1XMOE 4JI5I 4LF7E 3GMEA 4KHPI 1N0VC 1U2RA 2WW4A 3U1YA 2XEXA 3B4TA 4AIMA 2GO4A 1QZRA 1HNZE 1J5EI 2A2DA 3PYGA 4DR3E 1K47A 4LFAI 4BA1B 4DR2I 2CVEA 2UUCE 1PVGA 5DRRA 1ELOA 5FLXC 3Q1QA 1FJGE 4OX9E 1H7SA 2NN6F 3OTOI 4DV5E 4DR1I 1Z0WA 1KVKA 2V2QA 2PNZB 4PRVA 1XMQI 2NN6B 3CDJA 2BM1A 3GCMA 1IBLI 5IWAI 3T1HI 5L3JA 2UXBE 2NN6A 1YH8A 2O1WA 4B3SI 1NZ0A 1H74A 1WUUA 4KHPE 4AQYI 2PO0B 2DEJA 3WU3A 2IERA 4JG4A 4MU0A 3GLLA 4IZJB 1ZM3A 3UHMA 3ZZ0A 2OI2A 3HJCA 4DUZE 1Y4SA 1RHYA 4ISAA
chains in the Genus database with same CATH topology
4X62I 4K0KE 5A2QQ 3F0NA 3ZZTA 4LF9I 3ZKBA 4USMA 1N33I 4DV3E 4LFAE 2V2ZA 4WUCA 3T1YI 4DR2E 3PYDA 2VQFI 1HR0I 1Z0TA 1MU5A 4DV1E 4GKKE 2UXDI 3B78A 1EI1A 4JI1E 2IOPA 2VQEE 1H72C 2EFGA 2Z5EA 2J7KA 2X36A 2VQEI 4LF6E 2UUCI 4HYMA 1UEKA 3WU6A 4DV7E 4DV5I 4LF8I 4NXNE 1IBKE 4X64I 1H73A 2HK2A 4DR5E 1IBME 4B3RI 1FKAE 4DPYA 3Q6NA 1IBLE 2HKEA 4FWGA 2DEIA 2UXCE 4IZJA 2X7IA 2UUBE 4URLA 1Z5CA 2CG9A 2ZM6E 4DPWA 1Y4UA 4Z7CA 2Z5CB 3HULA 1N36E 1MG7A 4PRXA 4DV6I 4RPFA 2HK3A 4JI3E 4X66I 3K17A 1S4EA 4ZVIA 4FWHA 4JI3I 3ZM7A 2HHHI 1N34E 2GQ0A 1OJ4A 2HFSA 3K1JA 4PU9A 1HNWI 3P06A 4YY3E 4MYTA 4GKJE 4JI7E 5BR8I 4USKA 3QT6A 4DR7E 1B63A 1Z0CA 3J80C 1Z59A 1ZM2A 4JI5E 2R42A 4HACB 5FWKA 4DR3I 4DUYI 1NHJA 1ZM9A 2O1VA 4LFBE 4ED4A 1J5EE 2GS8A 4JI8E 2HHHE 3JAMC 3V5RA 2UU9I 4DV4I 4JI2E 3CWVA 5IT9Q 1N33E 5IWAE 4B3RE 4DV4E 4GKJI 3WU4A 2BV3A 4YHHE 4N3OA 2LJPA 2V34A 2UXDE 2ZM6I 1XMQE 1XNRI 4X62E 4B3SE 4LF7I 2ZITA 4DR6E 4NXNI 4LF8E 1RR9A 4DV7I 4K0KI 4DPUA 4HY1A 4DV2I 2Z5BA 4LF4E 4YHHI 3GONA 3PYEA 3T1YE 2UXBI 1XMOI 4JI6I 5BR8E 1XHKA 3LNUA 3ZZUA 1Y6ZA 1N32E 4DR1E 5LMNE 4DR7I 1FWLA 5A2QC 4DV0E 4GKKI 4FWDA 2E5LE 1Z0EA 4B3ME 4NXME 2F4VI 2UUAI 1D6TA 3LTOA 1Z0VA 4R1FA 2F4VE 2V2VA 2VQFE 4DV3I 4DR6I 4AQYE 1ZXNA 4LF5I 2E1RA 3WU5A 3B82A 4JI4E 4IZJD 4KQVA 4JI4I 1XNQE 4IZKA 4DU7A 1HNWE 4LF4I 4DU8A 1XNQI 1FNMA 1VISA 4LF9E 4JYAE 4Z7YA 5FLXQ 1N32I 1KKHA 1A6FA 2R3VA 2E5LI 4B3MI 4LF6I 1HNZI 4XTJA 2UUAE 3J7AG 4X66E 4DXLA 4DV0I 1IBKI 1MX0A 2UUBI 1Z0GA 4JI1I 1N36I 2UU9E 4DR4I 4X65I 4DV6E 3J81Q 3Q6MA 1USUA 4OX9I 2A2CA 4JI2I 4DPTA 4HACA 4EMDA 1N34I 3J80Q 3OTOE 1NHIA 1N0UA 1Z5BA 1FJGI 3M6AA 4UT4A 1S16A 4MYUA 1EA6A 4JI6E 1IBMI 1FWKA 4NXMI 2O1UA 1BKNA 1HK7A 1DARA 4I3HA 4JYAI 2CGEA 1Z5AA 1KTVA 3H4LA 3QT5A 4IZKB 4WUBA 5IT9C 1NHHA 1B62A 2Q2EB 4DV1I 3J7AM 2VF3A 3K85A 5GMEA 2Z5CA 1KIJA 4DR5I 3QT8A 1HNXE 3PRYA 1I94E 4LFCE 4LFCI 4DV2E 1I94I 1HNXI 4LFBI 4JI7I 2UXCI 4JI0E 2HFUA 4B3TE 4X65E 3PYFA 2HKJA 3V2UC 4JI0I 2NPFA 4HXZA 2O1TA 3D4JA 1HR0E 1ZXMA 5LMUI 1PIEA 5LMUE 4DUYE 2IOQA 1XNRE 3QT7A 4M1KA 2ZBKB 3ZKDA 4UTGA 1Z0BA 1USVA 4DR4E 1ZM4A 1H7UA 2CZ9A 2V8PA 4P52A 4WUDA 2BM0A 2Z5BB 4LF5E 4DUZI 4DPXA 2PNMA 4X64E 1PKPA 1RREA 5GMDA 4JV5E 3J81C 3T1HE 4JV5I 4FW9A 2PNLA 4FN5A 3JAMQ 3LPSA 5LMNI 4YY3I 4P7AA 4B3TI 1FI4A 3B8HA 2AJ4A 4JI8I 5LL6R 1XMOE 4JI5I 4LF7E 4KHPI 1N0VC 1U2RA 2WW4A 2XEXA 1QZRA 1HNZE 1J5EI 2A2DA 3PYGA 4DR3E 1K47A 4LFAI 4DR2I 2UUCE 1PVGA 5FLXC 1ELOA 3Q1QA 1FJGE 4OX9E 1H7SA 4DV5E 4DR1I 3OTOI 1Z0WA 1KVKA 2V2QA 4PRVA 1XMQI 2BM1A 1IBLI 5IWAI 3T1HI 5L3JA 2UXBE 2O1WA 4B3SI 1NZ0A 1H74A 1WUUA 4KHPE 4AQYI 2DEJA 3WU3A 4JG4A 4IZJB 1ZM3A 3ZZ0A 2OI2A 3HJCA 4DUZE 1Y4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 I;  4K0K E;  5A2Q Q;  3F0N A;  3ZZT A;  4LF9 I;  3ZKB A;  4USM A;  1N33 I;  4DV3 E;  4LFA E;  2V2Z A;  4WUC A;  3T1Y I;  4DR2 E;  3PYD A;  2VQF I;  1HR0 I;  1Z0T A;  1MU5 A;  4DV1 E;  4GKK E;  2UXD I;  3B78 A;  1EI1 A;  4JI1 E;  2VQE E;  1H72 C;  2EFG A;  2J7K A;  2X36 A;  2VQE I;  4LF6 E;  2UUC I;  4HYM A;  1UEK A;  3WU6 A;  4DV7 E;  4DV5 I;  4LF8 I;  4NXN E;  1IBK E;  4X64 I;  1H73 A;  2HK2 A;  4DR5 E;  1IBM E;  4B3R I;  1FKA E;  4DPY A;  1IBL E;  2HKE A;  4FWG A;  2DEI A;  2UXC E;  2X7I A;  2UUB E;  4URL A;  1Z5C A;  2ZM6 E;  4DPW A;  4Z7C A;  3HUL A;  1N36 E;  1MG7 A;  4PRX A;  4DV6 I;  4RPF A;  2HK3 A;  4JI3 E;  4X66 I;  3K17 A;  1S4E A;  4ZVI A;  4FWH A;  4JI3 I;  3ZM7 A;  2HHH I;  1N34 E;  1OJ4 A;  2HFS A;  3K1J A;  4PU9 A;  1HNW I;  4MYT A;  4YY3 E;  4GKJ E;  4JI7 E;  5BR8 I;  4USK A;  3QT6 A;  4DR7 E;  1B63 A;  1Z0C A;  3J80 C;  1Z59 A;  1ZM2 A;  4JI5 E;  2R42 A;  4HAC B;  4DR3 I;  4DUY I;  1NHJ A;  1ZM9 A;  4LFB E;  4ED4 A;  1J5E E;  2GS8 A;  4JI8 E;  2HHH E;  3JAM C;  3V5R A;  2UU9 I;  4DV4 I;  4JI2 E;  3CWV A;  5IT9 Q;  1N33 E;  5IWA E;  4B3R E;  4DV4 E;  4GKJ I;  3WU4 A;  2BV3 A;  4YHH E;  2LJP A;  2V34 A;  2UXD E;  2ZM6 I;  1XMQ E;  1XNR I;  4X62 E;  4B3S E;  4LF7 I;  2ZIT A;  4DR6 E;  4NXN I;  4LF8 E;  1RR9 A;  4DV7 I;  4K0K I;  4DPU A;  4HY1 A;  4DV2 I;  4LF4 E;  4YHH I;  3GON A;  3PYE A;  3T1Y E;  2UXB I;  1XMO I;  4JI6 I;  5BR8 E;  1XHK A;  3LNU A;  3ZZU A;  1N32 E;  4DR1 E;  5LMN E;  4DR7 I;  1FWL A;  5A2Q C;  4DV0 E;  4GKK I;  4FWD A;  2E5L E;  1Z0E A;  4B3M E;  4NXM E;  2F4V I;  2UUA I;  1D6T A;  3LTO A;  1Z0V A;  4R1F A;  2F4V E;  2V2V A;  2VQF E;  4DV3 I;  4DR6 I;  4AQY E;  1ZXN A;  4LF5 I;  2E1R A;  3WU5 A;  3B82 A;  4JI4 E;  4KQV A;  4JI4 I;  1XNQ E;  4DU7 A;  1HNW E;  4LF4 I;  4DU8 A;  1XNQ I;  1FNM A;  1VIS A;  4LF9 E;  4JYA E;  4Z7Y A;  5FLX Q;  1N32 I;  1KKH A;  1A6F A;  2R3V A;  2E5L I;  4B3M I;  4LF6 I;  1HNZ I;  4XTJ A;  2UUA E;  3J7A G;  4X66 E;  4DXL A;  4DV0 I;  1IBK I;  1MX0 A;  2UUB I;  1Z0G A;  4JI1 I;  1N36 I;  2UU9 E;  4DR4 I;  4X65 I;  4DV6 E;  3J81 Q;  4OX9 I;  2A2C A;  4JI2 I;  4DPT A;  4HAC A;  4EMD A;  1N34 I;  3J80 Q;  3OTO E;  1NHI A;  1N0U A;  1Z5B A;  1FJG I;  3M6A A;  4UT4 A;  1S16 A;  4MYU A;  1EA6 A;  4JI6 E;  1IBM I;  1FWK A;  4NXM I;  1BKN A;  1DAR A;  4I3H A;  4JYA I;  1Z5A A;  1KTV A;  3H4L A;  3QT5 A;  4WUB A;  5IT9 C;  1NHH A;  1B62 A;  2Q2E B;  4DV1 I;  3J7A M;  2VF3 A;  5GME A;  1KIJ A;  3QT8 A;  4DR5 I;  4LFC E;  1I94 E;  1HNX E;  4LFC I;  4DV2 E;  1I94 I;  1HNX I;  4LFB I;  4JI7 I;  2UXC I;  4JI0 E;  2HFU A;  4B3T E;  4X65 E;  3PYF A;  2HKJ A;  3V2U C;  4JI0 I;  2NPF A;  4HXZ A;  3D4J A;  1HR0 E;  1ZXM A;  5LMU I;  1PIE A;  5LMU E;  4DUY E;  1XNR E;  3QT7 A;  4M1K A;  2ZBK B;  3ZKD A;  4UTG A;  1Z0B A;  4DR4 E;  1ZM4 A;  1H7U A;  2CZ9 A;  2V8P A;  4P52 A;  4WUD A;  2BM0 A;  4LF5 E;  4DUZ I;  4DPX A;  4X64 E;  1PKP A;  1RRE A;  5GMD A;  4JV5 E;  3J81 C;  3T1H E;  4JV5 I;  4FW9 A;  4FN5 A;  3JAM Q;  3LPS A;  5LMN I;  4YY3 I;  4P7A A;  4B3T I;  1FI4 A;  3B8H A;  2AJ4 A;  4JI8 I;  5LL6 R;  1XMO E;  4JI5 I;  4LF7 E;  4KHP I;  1N0V C;  1U2R A;  2WW4 A;  2XEX A;  1QZR A;  1HNZ E;  1J5E I;  2A2D A;  3PYG A;  4DR3 E;  1K47 A;  4LFA I;  4DR2 I;  2UUC E;  1PVG A;  5FLX C;  1ELO A;  3Q1Q A;  1FJG E;  4OX9 E;  1H7S A;  4DV5 E;  4DR1 I;  3OTO I;  1Z0W A;  1KVK A;  2V2Q A;  4PRV A;  1XMQ I;  2BM1 A;  1IBL I;  5IWA I;  3T1H I;  5L3J A;  2UXB E;  4B3S I;  1NZ0 A;  1H74 A;  1WUU A;  4KHP E;  4AQY I;  2DEJ A;  3WU3 A;  4JG4 A;  1ZM3 A;  2OI2 A;  3ZZ0 A;  4DUZ E; 
#chains in the Genus database with same CATH topology
 1UDN A;  4X62 I;  2VES A;  4K0K E;  5K36 C;  5A2Q Q;  5JEA C;  3PS3 A;  3F0N A;  3ZZT A;  2O3Z A;  4LF9 I;  3ZKB A;  4USM A;  1N33 I;  4DV3 E;  2BA0 G;  4LFA E;  2V2Z A;  2PO1 B;  4WUC A;  3T1Y I;  4DR2 E;  3U1K A;  4FW7 A;  2J65 A;  3PYD A;  4LPF A;  2VQF I;  4MU1 A;  4IFD E;  1HR0 I;  1Z0T A;  1MU5 A;  5JEA E;  4DV1 E;  4FW4 A;  4GKK E;  2UXD I;  1Y60 A;  3B78 A;  1EI1 A;  4IFD C;  1OYS A;  4JI1 E;  5DRP A;  3M7N G;  2IOP A;  2VQE E;  1H72 C;  2EFG A;  2Z5E A;  2J7K A;  2X36 A;  2VQE I;  4LF6 E;  2UUC I;  4HYM A;  1UEK A;  3WU6 A;  2NN6 D;  4DV7 E;  4DV5 I;  1UDS A;  4LF8 I;  4NXN E;  5C0X A;  4IFD F;  1IBK E;  3H1C A;  5DNX A;  4X64 I;  2C37 B;  1H73 A;  2HK2 A;  4OO1 C;  4DR5 E;  1IBM E;  4B3R I;  1FKA E;  4DPY A;  4U3D A;  3Q6N A;  1IBL E;  2HKE A;  4FWG A;  2DEI A;  2UXC E;  4IZJ A;  1OYP A;  2X7I A;  2UUB E;  5C0X F;  4URL A;  4BA2 A;  1Z5C A;  5EL9 A;  3HKM A;  2CG9 A;  2ZM6 E;  4DPW A;  1Y4U A;  4Z7C A;  5JEA F;  2Z5C B;  3HUL A;  1N36 E;  1MG7 A;  4PRX A;  4IFD D;  4DV6 I;  4RPF A;  2HK3 A;  4JI3 E;  4X66 I;  5C0X E;  3K17 A;  1S4E A;  4ZVI A;  4FWH A;  2PO1 A;  4JI3 I;  3ZM7 A;  2HHH I;  1N34 E;  2GQ0 A;  2NN6 C;  1E3P A;  1OJ4 A;  2HFS A;  3K1J A;  4PU9 A;  1HNW I;  3P06 A;  4OO1 E;  4MYT A;  4YY3 E;  4GKJ E;  4JI7 E;  5BR8 I;  2PO0 A;  2WNR B;  1YHC A;  4BA1 A;  4USK A;  3QT6 A;  4DR7 E;  1B63 A;  2PO2 B;  1Z0C A;  3J80 C;  1Z59 A;  1ZM2 A;  4JI5 E;  1P42 A;  2R42 A;  4HAC B;  5FWK A;  4DR3 I;  2PNZ A;  3M85 G;  4DUY I;  1NHJ A;  1ZM9 A;  2O1V A;  4BA2 B;  4LFB E;  3NZK A;  4ED4 A;  1J5E E;  2GS8 A;  2BA1 D;  4JI8 E;  2HHH E;  5DNL A;  3CDI A;  3JAM C;  3V5R A;  2UU9 I;  4DV4 I;  4JI2 E;  3CWV A;  5IT9 Q;  1N33 E;  5IWA E;  4B3R E;  4DV4 E;  4GKJ I;  3WU4 A;  2BV3 A;  2IES A;  4YHH E;  3P3E A;  2JEA A;  4N3O A;  2AE8 A;  5C0X B;  3P76 A;  4NBQ A;  2LJP A;  5K36 B;  2V34 A;  4OKG A;  2UXD E;  2ZM6 I;  2NN6 E;  4OZE A;  2WP8 A;  1XMQ E;  1XNR I;  4MU4 A;  4X62 E;  4B3S E;  4QNJ A;  5JEA A;  4LF7 I;  2JT2 A;  2ZIT A;  4DR6 E;  1OYR A;  4FW6 A;  4NXN I;  4LF8 E;  1RR9 A;  4GQU A;  4DV7 I;  4K0K I;  4DPU A;  4HY1 A;  4DV2 I;  2Z5B A;  4LF4 E;  4YHH I;  3GON A;  3PYE A;  3T1Y E;  2JE6 B;  2UXB I;  1XMO I;  4JI6 I;  5BR8 E;  1XHK A;  3LNU A;  2JEB A;  3ZZU A;  5K36 E;  2GO3 A;  1Y6Z A;  1N32 E;  4DR1 E;  5LMN E;  4DR7 I;  1FWL A;  5A2Q C;  4DV0 E;  4GKK I;  2BR2 B;  4IFD A;  4FWD A;  2E5L E;  1Z0E A;  2C39 A;  4B3M E;  4NXM E;  2UUA I;  2F4V I;  3LTO A;  1D6T A;  1Z0V A;  4R1F A;  2F4V E;  2V2V A;  2VQF E;  4FW3 A;  4DV3 I;  4LCF A;  4DR6 I;  4AQY E;  4MQY A;  1ZXN A;  5K36 D;  4LF5 I;  2E1R A;  3WU5 A;  3B82 A;  4JI4 E;  4OO1 F;  4IZJ D;  4KQV A;  5DRO A;  4JI4 I;  1XNQ E;  4IZK A;  4DU7 A;  1HNW E;  4LF4 I;  4DU8 A;  5C0X C;  1XNQ I;  1FNM A;  1VIS A;  3L7Z A;  5K36 A;  4LF9 E;  4JYA E;  3DD6 A;  4Z7Y A;  5FLX Q;  1XXE A;  1N32 I;  1KKH A;  1A6F A;  2R3V A;  2E5L I;  4B3M I;  1E3H A;  2BA1 G;  4OO1 B;  4LF6 I;  4MDT A;  1HNZ I;  3L7Z B;  3PS2 A;  4XTJ A;  2UUA E;  3J7A G;  4X66 E;  4DXL A;  4DV0 I;  1IBK I;  1MX0 A;  2UUB I;  1Z0G A;  4JI1 I;  1N36 I;  2UU9 E;  4DR4 I;  4X65 I;  4DV6 E;  3J81 Q;  3Q6M A;  1USU A;  4J3D A;  4OX9 I;  2A2C A;  4JI2 I;  4DPT A;  4HAC A;  4EMD A;  1N34 I;  1R6M A;  3J80 Q;  3OTO E;  3KRN A;  4LCG A;  1NHI A;  1N0U A;  1Z5B A;  1FJG I;  3M6A A;  4UT4 A;  4OO1 A;  5K36 F;  1S16 A;  4MYU A;  1EA6 A;  4JI6 E;  1IBM I;  1FWK A;  4LOM A;  4NXM I;  2O1U A;  1BKN A;  4AID A;  1HK7 A;  1DAR A;  5JEA D;  4I3H A;  4JYA I;  5ELW A;  2CGE A;  1Z5A A;  1KTV A;  3H4L A;  3QT5 A;  4IZK B;  4WUB A;  5IT9 C;  5DRQ A;  1NHH A;  1B62 A;  2Q2E B;  3P3C A;  4DV1 I;  3J7A M;  2VF3 A;  3PS1 A;  3K85 A;  5GME A;  2Z5C A;  1KIJ A;  3QT8 A;  4DR5 I;  2JE6 A;  3PRY A;  1I94 E;  1HNX E;  4LFC E;  5EKW A;  4LFC I;  4DV2 E;  1I94 I;  1HNX I;  2C38 A;  1R6L A;  4MU3 A;  4LFB I;  4JI7 I;  2UXC I;  2PO2 A;  2HFU A;  5JEA B;  4JI0 E;  4B3T E;  4X65 E;  3PYF A;  3V2U C;  2HKJ A;  4JI0 I;  2BR2 A;  4IFD B;  2NPF A;  2WNR A;  4HXZ A;  2O1T A;  2WP8 B;  3D4J A;  2C38 B;  1HR0 E;  2BA0 D;  1ZXM A;  5LMU I;  4IS9 A;  1PIE A;  2C39 B;  5LMU E;  2JEB B;  4AM3 A;  4DUY E;  4QNK A;  2IOQ A;  1XNR E;  3QT7 A;  4M1K A;  2ZBK B;  3ZKD A;  4UTG A;  3P3G A;  1UDQ A;  1Z0B A;  1USV A;  2F1D A;  4DR4 E;  2JEA B;  1ZM4 A;  4OO1 D;  1H7U A;  2CZ9 A;  2V8P A;  4P52 A;  4WUD A;  2BM0 A;  5C0X D;  2Z5B B;  4LF5 E;  4DUZ I;  4DPX A;  2PNM A;  4FW5 A;  4X64 E;  1PKP A;  1RRE A;  5GMD A;  1UDO A;  4JV5 E;  3J81 C;  3M85 D;  3T1H E;  4JV5 I;  4FW9 A;  1Y5Y A;  4LCH A;  2PNL A;  4FN5 A;  3JAM Q;  3LPS A;  5LMN I;  4YY3 I;  4P7A A;  1VI7 A;  4B3T I;  2C37 A;  3M7N D;  1FI4 A;  3B8H A;  2AJ4 A;  4JI8 I;  5LL6 R;  4U3B A;  1XMO E;  4JI5 I;  4LF7 E;  3GME A;  4KHP I;  1N0V C;  1U2R A;  2WW4 A;  3U1Y A;  2XEX A;  3B4T A;  4AIM A;  2GO4 A;  1QZR A;  1HNZ E;  1J5E I;  2A2D A;  3PYG A;  4DR3 E;  1K47 A;  4LFA I;  4BA1 B;  4DR2 I;  2CVE A;  2UUC E;  1PVG A;  5DRR A;  1ELO A;  5FLX C;  3Q1Q A;  1FJG E;  4OX9 E;  1H7S A;  2NN6 F;  3OTO I;  4DV5 E;  4DR1 I;  1Z0W A;  1KVK A;  2V2Q A;  2PNZ B;  4PRV A;  1XMQ I;  2NN6 B;  3CDJ A;  2BM1 A;  3GCM A;  1IBL I;  5IWA I;  3T1H I;  5L3J A;  2UXB E;  2NN6 A;  1YH8 A;  2O1W A;  4B3S I;  1NZ0 A;  1H74 A;  1WUU A;  4KHP E;  4AQY I;  2PO0 B;  2DEJ A;  3WU3 A;  2IER A;  4JG4 A;  4MU0 A;  3GLL A;  4IZJ B;  1ZM3 A;  3UHM A;  3ZZ0 A;  2OI2 A;  3HJC A;  4DUZ E;  1Y4S A;  1RHY A;  4ISA A; 
#chains in the Genus database with same CATH homology
 4X62 I;  4K0K E;  5A2Q Q;  3F0N A;  3ZZT A;  4LF9 I;  3ZKB A;  4USM A;  1N33 I;  4DV3 E;  4LFA E;  2V2Z A;  4WUC A;  3T1Y I;  4DR2 E;  3PYD A;  2VQF I;  1HR0 I;  1Z0T A;  1MU5 A;  4DV1 E;  4GKK E;  2UXD I;  3B78 A;  1EI1 A;  4JI1 E;  2IOP A;  2VQE E;  1H72 C;  2EFG A;  2Z5E A;  2J7K A;  2X36 A;  2VQE I;  4LF6 E;  2UUC I;  4HYM A;  1UEK A;  3WU6 A;  4DV7 E;  4DV5 I;  4LF8 I;  4NXN E;  1IBK E;  4X64 I;  1H73 A;  2HK2 A;  4DR5 E;  1IBM E;  4B3R I;  1FKA E;  4DPY A;  3Q6N A;  1IBL E;  2HKE A;  4FWG A;  2DEI A;  2UXC E;  4IZJ A;  2X7I A;  2UUB E;  4URL A;  1Z5C A;  2CG9 A;  2ZM6 E;  4DPW A;  1Y4U A;  4Z7C A;  2Z5C B;  3HUL A;  1N36 E;  1MG7 A;  4PRX A;  4DV6 I;  4RPF A;  2HK3 A;  4JI3 E;  4X66 I;  3K17 A;  1S4E A;  4ZVI A;  4FWH A;  4JI3 I;  3ZM7 A;  2HHH I;  1N34 E;  2GQ0 A;  1OJ4 A;  2HFS A;  3K1J A;  4PU9 A;  1HNW I;  3P06 A;  4YY3 E;  4MYT A;  4GKJ E;  4JI7 E;  5BR8 I;  4USK A;  3QT6 A;  4DR7 E;  1B63 A;  1Z0C A;  3J80 C;  1Z59 A;  1ZM2 A;  4JI5 E;  2R42 A;  4HAC B;  5FWK A;  4DR3 I;  4DUY I;  1NHJ A;  1ZM9 A;  2O1V A;  4LFB E;  4ED4 A;  1J5E E;  2GS8 A;  4JI8 E;  2HHH E;  3JAM C;  3V5R A;  2UU9 I;  4DV4 I;  4JI2 E;  3CWV A;  5IT9 Q;  1N33 E;  5IWA E;  4B3R E;  4DV4 E;  4GKJ I;  3WU4 A;  2BV3 A;  4YHH E;  4N3O A;  2LJP A;  2V34 A;  2UXD E;  2ZM6 I;  1XMQ E;  1XNR I;  4X62 E;  4B3S E;  4LF7 I;  2ZIT A;  4DR6 E;  4NXN I;  4LF8 E;  1RR9 A;  4DV7 I;  4K0K I;  4DPU A;  4HY1 A;  4DV2 I;  2Z5B A;  4LF4 E;  4YHH I;  3GON A;  3PYE A;  3T1Y E;  2UXB I;  1XMO I;  4JI6 I;  5BR8 E;  1XHK A;  3LNU A;  3ZZU A;  1Y6Z A;  1N32 E;  4DR1 E;  5LMN E;  4DR7 I;  1FWL A;  5A2Q C;  4DV0 E;  4GKK I;  4FWD A;  2E5L E;  1Z0E A;  4B3M E;  4NXM E;  2F4V I;  2UUA I;  1D6T A;  3LTO A;  1Z0V A;  4R1F A;  2F4V E;  2V2V A;  2VQF E;  4DV3 I;  4DR6 I;  4AQY E;  1ZXN A;  4LF5 I;  2E1R A;  3WU5 A;  3B82 A;  4JI4 E;  4IZJ D;  4KQV A;  4JI4 I;  1XNQ E;  4IZK A;  4DU7 A;  1HNW E;  4LF4 I;  4DU8 A;  1XNQ I;  1FNM A;  1VIS A;  4LF9 E;  4JYA E;  4Z7Y A;  5FLX Q;  1N32 I;  1KKH A;  1A6F A;  2R3V A;  2E5L I;  4B3M I;  4LF6 I;  1HNZ I;  4XTJ A;  2UUA E;  3J7A G;  4X66 E;  4DXL A;  4DV0 I;  1IBK I;  1MX0 A;  2UUB I;  1Z0G A;  4JI1 I;  1N36 I;  2UU9 E;  4DR4 I;  4X65 I;  4DV6 E;  3J81 Q;  3Q6M A;  1USU A;  4OX9 I;  2A2C A;  4JI2 I;  4DPT A;  4HAC A;  4EMD A;  1N34 I;  3J80 Q;  3OTO E;  1NHI A;  1N0U A;  1Z5B A;  1FJG I;  3M6A A;  4UT4 A;  1S16 A;  4MYU A;  1EA6 A;  4JI6 E;  1IBM I;  1FWK A;  4NXM I;  2O1U A;  1BKN A;  1HK7 A;  1DAR A;  4I3H A;  4JYA I;  2CGE A;  1Z5A A;  1KTV A;  3H4L A;  3QT5 A;  4IZK B;  4WUB A;  5IT9 C;  1NHH A;  1B62 A;  2Q2E B;  4DV1 I;  3J7A M;  2VF3 A;  3K85 A;  5GME A;  2Z5C A;  1KIJ A;  4DR5 I;  3QT8 A;  1HNX E;  3PRY A;  1I94 E;  4LFC E;  4LFC I;  4DV2 E;  1I94 I;  1HNX I;  4LFB I;  4JI7 I;  2UXC I;  4JI0 E;  2HFU A;  4B3T E;  4X65 E;  3PYF A;  2HKJ A;  3V2U C;  4JI0 I;  2NPF A;  4HXZ A;  2O1T A;  3D4J A;  1HR0 E;  1ZXM A;  5LMU I;  1PIE A;  5LMU E;  4DUY E;  2IOQ A;  1XNR E;  3QT7 A;  4M1K A;  2ZBK B;  3ZKD A;  4UTG A;  1Z0B A;  1USV A;  4DR4 E;  1ZM4 A;  1H7U A;  2CZ9 A;  2V8P A;  4P52 A;  4WUD A;  2BM0 A;  2Z5B B;  4LF5 E;  4DUZ I;  4DPX A;  2PNM A;  4X64 E;  1PKP A;  1RRE A;  5GMD A;  4JV5 E;  3J81 C;  3T1H E;  4JV5 I;  4FW9 A;  2PNL A;  4FN5 A;  3JAM Q;  3LPS A;  5LMN I;  4YY3 I;  4P7A A;  4B3T I;  1FI4 A;  3B8H A;  2AJ4 A;  4JI8 I;  5LL6 R;  1XMO E;  4JI5 I;  4LF7 E;  4KHP I;  1N0V C;  1U2R A;  2WW4 A;  2XEX A;  1QZR A;  1HNZ E;  1J5E I;  2A2D A;  3PYG A;  4DR3 E;  1K47 A;  4LFA I;  4DR2 I;  2UUC E;  1PVG A;  5FLX C;  1ELO A;  3Q1Q A;  1FJG E;  4OX9 E;  1H7S A;  4DV5 E;  4DR1 I;  3OTO I;  1Z0W A;  1KVK A;  2V2Q A;  4PRV A;  1XMQ I;  2BM1 A;  1IBL I;  5IWA I;  3T1H I;  5L3J A;  2UXB E;  2O1W A;  4B3S I;  1NZ0 A;  1H74 A;  1WUU A;  4KHP E;  4AQY I;  2DEJ A;  3WU3 A;  4JG4 A;  4IZJ B;  1ZM3 A;  3ZZ0 A;  2OI2 A;  3HJC A;  4DUZ E;  1Y4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...