4JI7I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji7I00
4JI7I 4DPTA 4I3HA 4P52A 1Z0VA 4HY1A 4URLA 3WU6A 3B78A 4HXZA 3J7AM 3LPSA 1PKPA 3J7AG 4Z7CA 4R1FA 1S16A 4DR7I 4JI8E 1ZM3A 1UEKA 4MYTA 2V2ZA 4FWHA 1N33I 2R42A 2DEJA 2R3VA 4JI6I 2F4VI 1H74A 3M6AA 1ZM9A 4GKJI 4JI1E 1QZRA 1XNQI 2VQFE 1DARA 5GMEA 4B3MI 4DV4E 1NHJA 4K0KI 4YHHI 1VISA 4M1KA 2UU9I 1XMOE 2HFUA 4JI3E 4DR5I 1XMQI 2ZM6E 1IBLE 4NXNI 2VQEI 1RREA 4KHPI 3T1YI 5FLXQ 1FWKA 4DV6I 4DV2E 1N0UA 3K1JA 1H73A 2HKJA 4AQYE 2HK3A 1IBKI 1Z0WA 1MU5A 4WUCA 1N34E 5A2QC 4PRVA 4JV5E 4LF5E 1Z0TA 4DPXA 3T1HI 4X66I 1J5EI 1HNXE 4DR3E 4OX9E 2Q2EB 4FN5A 4YY3E 4MYUA 4DR1I 2ZITA 3QT8A 4JI7E 4DU7A 2V2VA 3PYFA 4WUBA 4UT4A 2J7KA 3B82A 1Z0GA 4LFAI 3QT6A 4LF4I 2E5LI 1N36I 2OI2A 2UUBI 4DR7E 1H72C 3J81C 3ZZUA 3V2UC 1PIEA 1N33E 4B3RI 2LJPA 4X65I 2EFGA 4JI6E 2DEIA 4DUZI 2F4VE 4GKJE 1ZM2A 5IT9Q 1XNQE 5BR8I 4RPFA 3Q1QA 4X62I 4B3ME 3K17A 4DU8A 5L3JA 4DUYE 4KQVA 4K0KE 4YHHE 3H4LA 4LF6I 4FWDA 5IWAI 2HFSA 4DV3I 4LFCI 4DR2E 2V34A 2UU9E 2V2QA 2HHHI 2UUCI 4DR5E 1S4EA 1XMQE 4DV5I 1EI1A 4B3SE 3ZKDA 4NXNE 4EMDA 2VQEE 4KHPE 3ZKBA 3T1YE 4JI2I 3F0NA 4DV6E 4DR4I 1EA6A 1IBKE 3T1HE 4X66E 2ZBKB 1Z0EA 3QT7A 4JYAI 4DV1I 4DV7I 2AJ4A 4DR1E 3LTOA 1HNZI 3V5RA 3ZZ0A 4DR6I 2UXDI 2CZ9A 4HACB 5LMUE 4LF8I 1ZXMA 4LFAE 4LF4E 2E5LE 1N36E 2UUBE 1N32E 2UXCI 5LL6R 2WW4A 3J80C 4GKKI 1Z5BA 4JI8I 4B3RE 4X65E 1KTVA 4LF7I 4DUZE 1H7SA 1NHIA 3HULA 5LMNI 4LFBI 2BV3A 2X36A 4LF9I 2VF3A 1Z59A 3PYEA 5A2QQ 2VQFI 2V8PA 3JAMC 2XEXA 4LF6E 5IWAE 4DV3E 2E1RA 4LFCE 3D4JA 4JI4I 3OTOI 2HHHE 1Z0BA 2UUCE 4DV5E 2ZM6I 1OJ4A 4JG4A 4JI2E 1KVKA 4DR4E 1MG7A 4B3TI 3J81Q 2X7IA 4JI0I 4DPWA 3WU5A 4JV5I 1FWLA 4JYAE 1D6TA 2NPFA 1ZM4A 4WUDA 4DPUA 4DV7E 1K47A 1HNZE 4DR3I 4DR6E 2UXDE 4NXMI 4PRXA 1MX0A 1XNRI 1N0VC 4LF8E 1WUUA 3WU4A 1RR9A 4DV0I 2UXCE 1HNWI 1FJGI 4GKKE 2UUAI 3LNUA 1IBMI 4LF7E 1ZXNA 5LMNE 4LFBE 1Z5CA 1HR0I 3QT5A 1KIJA 1J5EE 4X64I 4LF9E 2A2CA 2UXBI 1I94I 4JI5I 1B63A 4UTGA 1FNMA 3GONA 1XHKA 2BM1A 4DUYI 1NZ0A 3B8HA 4JI4E 2A2DA 5FLXC 1FI4A 3OTOE 4DR2I 1U2RA 1FKAE 5GMDA 2HK2A 4USMA 1KKHA 4B3SI 4ED4A 1ELOA 2BM0A 3PYDA 3WU3A 4PU9A 5BR8E 4B3TE 4JI1I 3J80Q 4X62E 1BKNA 2GS8A 4JI0E 3CWVA 4DPYA 4DV4I 1H7UA 4Z7YA 1B62A 4NXME 1XMOI 1XNRE 4JI3I 1Z5AA 3JAMQ 1A6FA 3ZZTA 4P7AA 5LMUI 1IBLI 4ZVIA 4HACA 4DV0E 1HNWE 4USKA 1FJGE 5IT9C 3PYGA 4DV2I 1N32I 2UUAE 4AQYI 1IBME 4DXLA 1Z0CA 4XTJA 2HKEA 1N34I 1HR0E 4LF5I 4FW9A 4HYMA 4X64E 4DV1E 3ZM7A 1HNXI 4FWGA 2UXBE 1NHHA 4OX9I 1PVGA 4YY3I 1I94E 4JI5E
chains in the Genus database with same CATH superfamily
4JI7I 4DPTA 4ISAA 4I3HA 4P52A 1Z0VA 4HY1A 4URLA 5DROA 1R6LA 3B78A 3WU6A 2C38A 4HXZA 3J7AM 5C0XA 3LPSA 4LOMA 1PKPA 2PNLA 3J7AG 4Z7CA 3UHMA 4LCGA 4LCFA 3U1KA 4R1FA 1S16A 4DR7I 4BA2A 4JI8E 1ZM3A 1UEKA 4MYTA 5K36B 3M7NG 2V2ZA 4FWHA 1N33I 2R42A 3PS2A 2DEJA 2R3VA 4LCHA 4IFDC 4JI6I 2F4VI 1H74A 4AIMA 3HJCA 4BA1A 2NN6F 3M6AA 1ZM9A 4GKJI 4JI1E 2JEAA 1RHYA 1QZRA 1XNQI 2VQFE 1DARA 1P42A 5GMEA 2NN6D 4DV4E 4B3MI 1NHJA 4K0KI 4IZKB 3GCMA 2NN6E 2NN6A 4YHHI 1XXEA 5JEAF 1VISA 4M1KA 2UU9I 2AE8A 1XMOE 2HFUA 2WP8A 4JI3E 5JEAD 4DR5I 1XMQI 2ZM6E 2BA1D 5JEAE 5JEAA 1IBLE 2JE6B 4NXNI 3L7ZB 2VQEI 2O1UA 1RREA 4KHPI 3T1YI 5FLXQ 1FWKA 4MDTA 4DV6I 4DV2E 1N0UA 3K1JA 1H73A 2HKJA 4AQYE 2HK3A 1UDNA 1IBKI 1Z0WA 1MU5A 4WUCA 4FW5A 1N34E 5A2QC 4PRVA 4JV5E 4LF5E 1Z0TA 4DPXA 3T1HI 4X66I 1Y4SA 1J5EI 4OO1F 1HNXE 4DR3E 4OX9E 2Q2EB 4FN5A 4YY3E 4MYUA 4MU3A 4DR1I 2ZITA 3Q6MA 3QT8A 4JI7E 4DU7A 5C0XC 2V2VA 3PYFA 4OO1D 4WUBA 1E3PA 1Y60A 5C0XB 2WNRB 4UT4A 3PRYA 2J7KA 4OO1E 3B82A 4FW3A 1Z0GA 1OYPA 3KRNA 4LFAI 3QT6A 4LF4I 2E5LI 1N36I 2OI2A 2UUBI 4DR7E 1H72C 4IZJA 3J81C 3ZZUA 3V2UC 1Y5YA 2C39A 1PIEA 1N33E 4B3RI 2LJPA 4X65I 2EFGA 4JI6E 2DEIA 4DUZI 2F4VE 2Z5CA 2JEAB 4GKJE 1ZM2A 2BR2B 5FWKA 5IT9Q 2PNZA 1XNQE 5BR8I 4NBQA 4RPFA 3Q1QA 4U3DA 4X62I 4B3ME 3K17A 4DU8A 5L3JA 4DUYE 4KQVA 2Z5BA 4K0KE 1UDSA 4YHHE 3H4LA 4LF6I 4FWDA 2J65A 2HFSA 5IWAI 4DV3I 4LFCI 1E3HA 4DR2E 2CGEA 2V34A 2JT2A 2UU9E 5JEAC 4QNJA 2V2QA 2HHHI 2BA1G 2UUCI 4DR5E 1S4EA 1XMQE 4DV5I 1EI1A 3U1YA 4B3SE 3ZKDA 4FW4A 4NXNE 4EMDA 2VQEE 4KHPE 4FW7A 3ZKBA 3T1YE 3PS1A 4IFDB 4JI2I 3F0NA 4DV6E 1UDQA 4DR4I 1EA6A 2Z5EA 2JEBA 1UDOA 1IBKE 2PO2A 3GMEA 3T1HE 4X66E 2ZBKB 1Z0EA 3QT7A 4JYAI 5DRPA 4DV1I 2C37B 4DV7I 2AJ4A 2BA0D 2PO0B 4DR1E 3LTOA 1HNZI 2PO1A 3V5RA 3ZZ0A 4DR6I 2UXDI 2CZ9A 4HACB 5LMUE 4LF8I 2GO4A 3Q6NA 1ZXMA 5EL9A 3P06A 4LFAE 2IERA 4LF4E 4IZJB 2E5LE 1N36E 2UUBE 1N32E 5K36F 4QNKA 2UXCI 5LL6R 2WW4A 3J80C 4GKKI 1Z5BA 4JI8I 4B3RE 2Z5CB 4X65E 1KTVA 4AM3A 4LF7I 4DUZE 1H7SA 1NHIA 4MU4A 5K36D 1YHCA 4MQYA 3HULA 5LMNI 3GLLA 4LFBI 2CG9A 2BV3A 5K36E 2X36A 5K36A 4LF9I 4FW6A 2VF3A 4IFDD 2C38B 2O3ZA 4MU1A 1Z59A 3PYEA 5A2QQ 2VQFI 2V8PA 3JAMC 2XEXA 4IS9A 4LF6E 5IWAE 4OO1A 2E1RA 4DV3E 4LFCE 2O1TA 3D4JA 4BA2B 4JI4I 3B4TA 4IZKA 3OTOI 2HHHE 1Z0BA 1USVA 3CDIA 2UUCE 4DV5E 4BA1B 2ZM6I 1OJ4A 4JG4A 4J3DA 2JEBB 4JI2E 1KVKA 4DR4E 1MG7A 2JE6A 2NN6C 3L7ZA 4B3TI 3J81Q 3DD6A 2NN6B 3PS3A 2X7IA 2IESA 4JI0I 4DPWA 3WU5A 3NZKA 4JV5I 1FWLA 3M85D 4JYAE 1D6TA 2WP8B 2NPFA 1ZM4A 4WUDA 4DPUA 4DV7E 1K47A 4AIDA 1HNZE 4OZEA 4DR3I 5C0XF 4DR6E 2UXDE 4LPFA 5JEAB 4NXMI 4PRXA 1MX0A 5DRRA 1XNRI 1N0VC 4LF8E 1WUUA 2CVEA 3P76A 3HKMA 5C0XD 3WU4A 5C0XE 2O1WA 2WNRA 1RR9A 4DV0I 2UXCE 1HNWI 1FJGI 4GKKE 2O1VA 2UUAI 3P3CA 5K36C 3LNUA 1IBMI 4LF7E 1ZXNA 2GQ0A 5LMNE 4LFBE 1Z5CA 1HR0I 3QT5A 1KIJA 1J5EE 4X64I 5DRQA 4LF9E 4OO1C 2A2CA 2UXBI 4OO1B 2BR2A 1I94I 4JI5I 1B63A 4UTGA 1FNMA 2GO3A 3GONA 1XHKA 4MU0A 5DNLA 2BM1A 4DUYI 1NZ0A 3B8HA 4JI4E 4GQUA 2A2DA 4U3BA 1FI4A 5FLXC 3OTOE 1OYRA 4DR2I 1U2RA 2C39B 1FKAE 5ELWA 5GMDA 2HK2A 4IFDF 2F1DA 4N3OA 4USMA 1KKHA 2IOPA 3H1CA 4B3SI 4ED4A 4OKGA 2PNZB 1ELOA 2BM0A 3M7ND 3PYDA 3WU3A 2PNMA 4PU9A 3K85A 5BR8E 4B3TE 2Z5BB 4JI1I 3J80Q 3CDJA 4X62E 1VI7A 4IFDE 4IFDA 1BKNA 2GS8A 3M85G 4JI0E 3CWVA 4DPYA 5DNXA 4DV4I 1H7UA 4Z7YA 1B62A 4NXME 1OYSA 1XMOI 1XNRE 4JI3I 1Z5AA 2C37A 2PO0A 3JAMQ 1A6FA 3ZZTA 4P7AA 5LMUI 1IBLI 4ZVIA 1YH8A 2IOQA 4HACA 4DV0E 2PO2B 1R6MA 4IZJD 1HNWE 4USKA 3P3GA 1FJGE 5IT9C 3PYGA 4DV2I 1N32I 2UUAE 2VESA 4AQYI 1IBME 4DXLA 1Z0CA 4XTJA 2HKEA 1N34I 1HR0E 4LF5I 2BA0G 2PO1B 4FW9A 4HYMA 5EKWA 4X64E 4DV1E 1USUA 3ZM7A 1Y4UA 3P3EA 1HNXI 4FWGA 2UXBE 1NHHA 1HK7A 1PVGA 4OX9I 4YY3I 1Y6ZA 1I94E 4JI5E
chains in the Genus database with same CATH topology
4JI7I 4DPTA 4I3HA 4P52A 1Z0VA 4HY1A 4URLA 3WU6A 3B78A 4HXZA 3J7AM 3LPSA 1PKPA 2PNLA 3J7AG 4Z7CA 4R1FA 1S16A 4DR7I 4JI8E 1ZM3A 1UEKA 4MYTA 2V2ZA 4FWHA 1N33I 2R42A 2DEJA 2R3VA 4JI6I 2F4VI 1H74A 3HJCA 3M6AA 1ZM9A 4GKJI 4JI1E 1QZRA 1XNQI 2VQFE 1DARA 5GMEA 4B3MI 4DV4E 1NHJA 4K0KI 4IZKB 4YHHI 1VISA 4M1KA 2UU9I 1XMOE 2HFUA 4JI3E 4DR5I 1XMQI 2ZM6E 1IBLE 4NXNI 2VQEI 2O1UA 1RREA 4KHPI 3T1YI 5FLXQ 1FWKA 4DV6I 4DV2E 1N0UA 3K1JA 1H73A 2HKJA 4AQYE 2HK3A 1IBKI 1Z0WA 1MU5A 4WUCA 1N34E 5A2QC 4PRVA 4JV5E 4LF5E 1Z0TA 4DPXA 3T1HI 4X66I 1Y4SA 1J5EI 1HNXE 4DR3E 4OX9E 2Q2EB 4FN5A 4YY3E 4MYUA 4DR1I 2ZITA 3Q6MA 3QT8A 4JI7E 4DU7A 2V2VA 3PYFA 4WUBA 4UT4A 3PRYA 2J7KA 3B82A 1Z0GA 4LFAI 3QT6A 4LF4I 2E5LI 1N36I 2OI2A 2UUBI 4DR7E 1H72C 4IZJA 3J81C 3ZZUA 3V2UC 1PIEA 1N33E 4B3RI 2LJPA 4X65I 2EFGA 4JI6E 2DEIA 4DUZI 2F4VE 2Z5CA 4GKJE 1ZM2A 5FWKA 5IT9Q 1XNQE 5BR8I 4RPFA 3Q1QA 4X62I 4B3ME 3K17A 4DU8A 5L3JA 4DUYE 4KQVA 2Z5BA 4K0KE 4YHHE 3H4LA 4LF6I 4FWDA 5IWAI 2HFSA 4DV3I 4LFCI 4DR2E 2CGEA 2V34A 2UU9E 2V2QA 2HHHI 2UUCI 4DR5E 1S4EA 1XMQE 4DV5I 1EI1A 4B3SE 3ZKDA 4NXNE 4EMDA 2VQEE 4KHPE 3ZKBA 3T1YE 4JI2I 3F0NA 4DV6E 4DR4I 1EA6A 2Z5EA 1IBKE 3T1HE 4X66E 2ZBKB 1Z0EA 3QT7A 4JYAI 4DV1I 4DV7I 2AJ4A 4DR1E 3LTOA 1HNZI 3V5RA 3ZZ0A 4DR6I 2UXDI 2CZ9A 4HACB 5LMUE 4LF8I 3Q6NA 1ZXMA 3P06A 4LFAE 4LF4E 4IZJB 2E5LE 1N36E 2UUBE 1N32E 2UXCI 5LL6R 2WW4A 3J80C 4GKKI 1Z5BA 4JI8I 4B3RE 2Z5CB 4X65E 1KTVA 4LF7I 4DUZE 1H7SA 1NHIA 3HULA 5LMNI 4LFBI 2CG9A 2BV3A 2X36A 4LF9I 2VF3A 1Z59A 3PYEA 5A2QQ 2VQFI 2V8PA 3JAMC 2XEXA 4LF6E 5IWAE 4DV3E 2E1RA 4LFCE 2O1TA 3D4JA 4JI4I 4IZKA 3OTOI 2HHHE 1Z0BA 1USVA 2UUCE 4DV5E 2ZM6I 1OJ4A 4JG4A 4JI2E 1KVKA 4DR4E 1MG7A 4B3TI 3J81Q 2X7IA 4JI0I 4DPWA 3WU5A 4JV5I 1FWLA 4JYAE 1D6TA 2NPFA 1ZM4A 4WUDA 4DPUA 4DV7E 1K47A 1HNZE 4DR3I 4DR6E 2UXDE 4NXMI 4PRXA 1MX0A 1XNRI 1N0VC 4LF8E 1WUUA 3WU4A 2O1WA 1RR9A 4DV0I 2UXCE 1HNWI 1FJGI 4GKKE 2O1VA 2UUAI 3LNUA 1IBMI 4LF7E 1ZXNA 2GQ0A 5LMNE 4LFBE 1Z5CA 1HR0I 3QT5A 1KIJA 1J5EE 4X64I 4LF9E 2A2CA 2UXBI 1I94I 4JI5I 1B63A 4UTGA 1FNMA 3GONA 1XHKA 2BM1A 4DUYI 1NZ0A 3B8HA 4JI4E 2A2DA 5FLXC 1FI4A 3OTOE 4DR2I 1U2RA 1FKAE 5GMDA 2HK2A 4N3OA 4USMA 1KKHA 2IOPA 4B3SI 4ED4A 1ELOA 2BM0A 3PYDA 3WU3A 2PNMA 4PU9A 3K85A 5BR8E 4B3TE 2Z5BB 4JI1I 3J80Q 4X62E 1BKNA 2GS8A 4JI0E 3CWVA 4DPYA 4DV4I 1H7UA 4Z7YA 1B62A 4NXME 1XMOI 1XNRE 4JI3I 1Z5AA 3JAMQ 1A6FA 3ZZTA 4P7AA 5LMUI 1IBLI 4ZVIA 2IOQA 4HACA 4DV0E 4IZJD 1HNWE 4USKA 1FJGE 5IT9C 3PYGA 4DV2I 1N32I 2UUAE 4AQYI 1IBME 4DXLA 1Z0CA 4XTJA 2HKEA 1N34I 1HR0E 4LF5I 4FW9A 4DV1E 4HYMA 4X64E 1USUA 3ZM7A 1Y4UA 1HNXI 4FWGA 2UXBE 1NHHA 1HK7A 1PVGA 4OX9I 4YY3I 1Y6ZA 1I94E 4JI5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 I;  4DPT A;  4I3H A;  4P52 A;  1Z0V A;  4HY1 A;  4URL A;  3WU6 A;  3B78 A;  4HXZ A;  3J7A M;  3LPS A;  1PKP A;  3J7A G;  4Z7C A;  4R1F A;  1S16 A;  4DR7 I;  4JI8 E;  1ZM3 A;  1UEK A;  4MYT A;  2V2Z A;  4FWH A;  1N33 I;  2R42 A;  2DEJ A;  2R3V A;  4JI6 I;  2F4V I;  1H74 A;  3M6A A;  1ZM9 A;  4GKJ I;  4JI1 E;  1QZR A;  1XNQ I;  2VQF E;  1DAR A;  5GME A;  4B3M I;  4DV4 E;  1NHJ A;  4K0K I;  4YHH I;  1VIS A;  4M1K A;  2UU9 I;  1XMO E;  2HFU A;  4JI3 E;  4DR5 I;  1XMQ I;  2ZM6 E;  1IBL E;  4NXN I;  2VQE I;  1RRE A;  4KHP I;  3T1Y I;  5FLX Q;  1FWK A;  4DV6 I;  4DV2 E;  1N0U A;  3K1J A;  1H73 A;  2HKJ A;  4AQY E;  2HK3 A;  1IBK I;  1Z0W A;  1MU5 A;  4WUC A;  1N34 E;  5A2Q C;  4PRV A;  4JV5 E;  4LF5 E;  1Z0T A;  4DPX A;  3T1H I;  4X66 I;  1J5E I;  1HNX E;  4DR3 E;  4OX9 E;  2Q2E B;  4FN5 A;  4YY3 E;  4MYU A;  4DR1 I;  2ZIT A;  3QT8 A;  4JI7 E;  4DU7 A;  2V2V A;  3PYF A;  4WUB A;  4UT4 A;  2J7K A;  3B82 A;  1Z0G A;  4LFA I;  3QT6 A;  4LF4 I;  2E5L I;  1N36 I;  2OI2 A;  2UUB I;  4DR7 E;  1H72 C;  3J81 C;  3ZZU A;  3V2U C;  1PIE A;  1N33 E;  4B3R I;  2LJP A;  4X65 I;  2EFG A;  4JI6 E;  2DEI A;  4DUZ I;  2F4V E;  4GKJ E;  1ZM2 A;  5IT9 Q;  1XNQ E;  5BR8 I;  4RPF A;  3Q1Q A;  4X62 I;  4B3M E;  3K17 A;  4DU8 A;  5L3J A;  4DUY E;  4KQV A;  4K0K E;  4YHH E;  3H4L A;  4LF6 I;  4FWD A;  5IWA I;  2HFS A;  4DV3 I;  4LFC I;  4DR2 E;  2V34 A;  2UU9 E;  2V2Q A;  2HHH I;  2UUC I;  4DR5 E;  1S4E A;  1XMQ E;  4DV5 I;  1EI1 A;  4B3S E;  3ZKD A;  4NXN E;  4EMD A;  2VQE E;  4KHP E;  3ZKB A;  3T1Y E;  4JI2 I;  3F0N A;  4DV6 E;  4DR4 I;  1EA6 A;  1IBK E;  3T1H E;  4X66 E;  2ZBK B;  1Z0E A;  3QT7 A;  4JYA I;  4DV1 I;  4DV7 I;  2AJ4 A;  4DR1 E;  3LTO A;  1HNZ I;  3V5R A;  3ZZ0 A;  4DR6 I;  2UXD I;  2CZ9 A;  4HAC B;  5LMU E;  4LF8 I;  1ZXM A;  4LFA E;  4LF4 E;  2E5L E;  1N36 E;  2UUB E;  1N32 E;  2UXC I;  5LL6 R;  2WW4 A;  3J80 C;  4GKK I;  1Z5B A;  4JI8 I;  4B3R E;  4X65 E;  1KTV A;  4LF7 I;  4DUZ E;  1H7S A;  1NHI A;  3HUL A;  5LMN I;  4LFB I;  2BV3 A;  2X36 A;  4LF9 I;  2VF3 A;  1Z59 A;  3PYE A;  5A2Q Q;  2VQF I;  2V8P A;  3JAM C;  2XEX A;  4LF6 E;  5IWA E;  4DV3 E;  2E1R A;  4LFC E;  3D4J A;  4JI4 I;  3OTO I;  2HHH E;  1Z0B A;  2UUC E;  4DV5 E;  2ZM6 I;  1OJ4 A;  4JG4 A;  4JI2 E;  1KVK A;  4DR4 E;  1MG7 A;  4B3T I;  3J81 Q;  2X7I A;  4JI0 I;  4DPW A;  3WU5 A;  4JV5 I;  1FWL A;  4JYA E;  1D6T A;  2NPF A;  1ZM4 A;  4WUD A;  4DPU A;  4DV7 E;  1K47 A;  1HNZ E;  4DR3 I;  4DR6 E;  2UXD E;  4NXM I;  4PRX A;  1MX0 A;  1XNR I;  1N0V C;  4LF8 E;  1WUU A;  3WU4 A;  1RR9 A;  4DV0 I;  2UXC E;  1HNW I;  1FJG I;  4GKK E;  2UUA I;  3LNU A;  1IBM I;  4LF7 E;  1ZXN A;  5LMN E;  4LFB E;  1Z5C A;  1HR0 I;  3QT5 A;  1KIJ A;  1J5E E;  4X64 I;  4LF9 E;  2A2C A;  2UXB I;  1I94 I;  4JI5 I;  1B63 A;  4UTG A;  1FNM A;  3GON A;  1XHK A;  2BM1 A;  4DUY I;  1NZ0 A;  3B8H A;  4JI4 E;  2A2D A;  5FLX C;  1FI4 A;  3OTO E;  4DR2 I;  1U2R A;  1FKA E;  5GMD A;  2HK2 A;  4USM A;  1KKH A;  4B3S I;  4ED4 A;  1ELO A;  2BM0 A;  3PYD A;  3WU3 A;  4PU9 A;  5BR8 E;  4B3T E;  4JI1 I;  3J80 Q;  4X62 E;  1BKN A;  2GS8 A;  4JI0 E;  3CWV A;  4DPY A;  4DV4 I;  1H7U A;  4Z7Y A;  1B62 A;  4NXM E;  1XMO I;  1XNR E;  4JI3 I;  1Z5A A;  3JAM Q;  1A6F A;  3ZZT A;  4P7A A;  5LMU I;  1IBL I;  4ZVI A;  4HAC A;  4DV0 E;  1HNW E;  4USK A;  1FJG E;  5IT9 C;  3PYG A;  4DV2 I;  1N32 I;  2UUA E;  4AQY I;  1IBM E;  4DXL A;  1Z0C A;  4XTJ A;  2HKE A;  1N34 I;  1HR0 E;  4LF5 I;  4FW9 A;  4HYM A;  4X64 E;  4DV1 E;  3ZM7 A;  1HNX I;  4FWG A;  2UXB E;  1NHH A;  4OX9 I;  1PVG A;  4YY3 I;  1I94 E;  4JI5 E; 
#chains in the Genus database with same CATH topology
 4JI7 I;  4DPT A;  4ISA A;  4I3H A;  4P52 A;  1Z0V A;  4HY1 A;  4URL A;  5DRO A;  1R6L A;  3B78 A;  3WU6 A;  2C38 A;  4HXZ A;  3J7A M;  5C0X A;  3LPS A;  4LOM A;  1PKP A;  2PNL A;  3J7A G;  4Z7C A;  3UHM A;  4LCG A;  4LCF A;  3U1K A;  4R1F A;  1S16 A;  4DR7 I;  4BA2 A;  4JI8 E;  1ZM3 A;  1UEK A;  4MYT A;  5K36 B;  3M7N G;  2V2Z A;  4FWH A;  1N33 I;  2R42 A;  3PS2 A;  2DEJ A;  2R3V A;  4LCH A;  4IFD C;  4JI6 I;  2F4V I;  1H74 A;  4AIM A;  3HJC A;  4BA1 A;  2NN6 F;  3M6A A;  1ZM9 A;  4GKJ I;  4JI1 E;  2JEA A;  1RHY A;  1QZR A;  1XNQ I;  2VQF E;  1DAR A;  1P42 A;  5GME A;  2NN6 D;  4DV4 E;  4B3M I;  1NHJ A;  4K0K I;  4IZK B;  3GCM A;  2NN6 E;  2NN6 A;  4YHH I;  1XXE A;  5JEA F;  1VIS A;  4M1K A;  2UU9 I;  2AE8 A;  1XMO E;  2HFU A;  2WP8 A;  4JI3 E;  5JEA D;  4DR5 I;  1XMQ I;  2ZM6 E;  2BA1 D;  5JEA E;  5JEA A;  1IBL E;  2JE6 B;  4NXN I;  3L7Z B;  2VQE I;  2O1U A;  1RRE A;  4KHP I;  3T1Y I;  5FLX Q;  1FWK A;  4MDT A;  4DV6 I;  4DV2 E;  1N0U A;  3K1J A;  1H73 A;  2HKJ A;  4AQY E;  2HK3 A;  1UDN A;  1IBK I;  1Z0W A;  1MU5 A;  4WUC A;  4FW5 A;  1N34 E;  5A2Q C;  4PRV A;  4JV5 E;  4LF5 E;  1Z0T A;  4DPX A;  3T1H I;  4X66 I;  1Y4S A;  1J5E I;  4OO1 F;  1HNX E;  4DR3 E;  4OX9 E;  2Q2E B;  4FN5 A;  4YY3 E;  4MYU A;  4MU3 A;  4DR1 I;  2ZIT A;  3Q6M A;  3QT8 A;  4JI7 E;  4DU7 A;  5C0X C;  2V2V A;  3PYF A;  4OO1 D;  4WUB A;  1E3P A;  1Y60 A;  5C0X B;  2WNR B;  4UT4 A;  3PRY A;  2J7K A;  4OO1 E;  3B82 A;  4FW3 A;  1Z0G A;  1OYP A;  3KRN A;  4LFA I;  3QT6 A;  4LF4 I;  2E5L I;  1N36 I;  2OI2 A;  2UUB I;  4DR7 E;  1H72 C;  4IZJ A;  3J81 C;  3ZZU A;  3V2U C;  1Y5Y A;  2C39 A;  1PIE A;  1N33 E;  4B3R I;  2LJP A;  4X65 I;  2EFG A;  4JI6 E;  2DEI A;  4DUZ I;  2F4V E;  2Z5C A;  2JEA B;  4GKJ E;  1ZM2 A;  2BR2 B;  5FWK A;  5IT9 Q;  2PNZ A;  1XNQ E;  5BR8 I;  4NBQ A;  4RPF A;  3Q1Q A;  4U3D A;  4X62 I;  4B3M E;  3K17 A;  4DU8 A;  5L3J A;  4DUY E;  4KQV A;  2Z5B A;  4K0K E;  1UDS A;  4YHH E;  3H4L A;  4LF6 I;  4FWD A;  2J65 A;  2HFS A;  5IWA I;  4DV3 I;  4LFC I;  1E3H A;  4DR2 E;  2CGE A;  2V34 A;  2JT2 A;  2UU9 E;  5JEA C;  4QNJ A;  2V2Q A;  2HHH I;  2BA1 G;  2UUC I;  4DR5 E;  1S4E A;  1XMQ E;  4DV5 I;  1EI1 A;  3U1Y A;  4B3S E;  3ZKD A;  4FW4 A;  4NXN E;  4EMD A;  2VQE E;  4KHP E;  4FW7 A;  3ZKB A;  3T1Y E;  3PS1 A;  4IFD B;  4JI2 I;  3F0N A;  4DV6 E;  1UDQ A;  4DR4 I;  1EA6 A;  2Z5E A;  2JEB A;  1UDO A;  1IBK E;  2PO2 A;  3GME A;  3T1H E;  4X66 E;  2ZBK B;  1Z0E A;  3QT7 A;  4JYA I;  5DRP A;  4DV1 I;  2C37 B;  4DV7 I;  2AJ4 A;  2BA0 D;  2PO0 B;  4DR1 E;  3LTO A;  1HNZ I;  2PO1 A;  3V5R A;  3ZZ0 A;  4DR6 I;  2UXD I;  2CZ9 A;  4HAC B;  5LMU E;  4LF8 I;  2GO4 A;  3Q6N A;  1ZXM A;  5EL9 A;  3P06 A;  4LFA E;  2IER A;  4LF4 E;  4IZJ B;  2E5L E;  1N36 E;  2UUB E;  1N32 E;  5K36 F;  4QNK A;  2UXC I;  5LL6 R;  2WW4 A;  3J80 C;  4GKK I;  1Z5B A;  4JI8 I;  4B3R E;  2Z5C B;  4X65 E;  1KTV A;  4AM3 A;  4LF7 I;  4DUZ E;  1H7S A;  1NHI A;  4MU4 A;  5K36 D;  1YHC A;  4MQY A;  3HUL A;  5LMN I;  3GLL A;  4LFB I;  2CG9 A;  2BV3 A;  5K36 E;  2X36 A;  5K36 A;  4LF9 I;  4FW6 A;  2VF3 A;  4IFD D;  2C38 B;  2O3Z A;  4MU1 A;  1Z59 A;  3PYE A;  5A2Q Q;  2VQF I;  2V8P A;  3JAM C;  2XEX A;  4IS9 A;  4LF6 E;  5IWA E;  4OO1 A;  2E1R A;  4DV3 E;  4LFC E;  2O1T A;  3D4J A;  4BA2 B;  4JI4 I;  3B4T A;  4IZK A;  3OTO I;  2HHH E;  1Z0B A;  1USV A;  3CDI A;  2UUC E;  4DV5 E;  4BA1 B;  2ZM6 I;  1OJ4 A;  4JG4 A;  4J3D A;  2JEB B;  4JI2 E;  1KVK A;  4DR4 E;  1MG7 A;  2JE6 A;  2NN6 C;  3L7Z A;  4B3T I;  3J81 Q;  3DD6 A;  2NN6 B;  3PS3 A;  2X7I A;  2IES A;  4JI0 I;  4DPW A;  3WU5 A;  3NZK A;  4JV5 I;  1FWL A;  3M85 D;  4JYA E;  1D6T A;  2WP8 B;  2NPF A;  1ZM4 A;  4WUD A;  4DPU A;  4DV7 E;  1K47 A;  4AID A;  1HNZ E;  4OZE A;  4DR3 I;  5C0X F;  4DR6 E;  2UXD E;  4LPF A;  5JEA B;  4NXM I;  4PRX A;  1MX0 A;  5DRR A;  1XNR I;  1N0V C;  4LF8 E;  1WUU A;  2CVE A;  3P76 A;  3HKM A;  5C0X D;  3WU4 A;  5C0X E;  2O1W A;  2WNR A;  1RR9 A;  4DV0 I;  2UXC E;  1HNW I;  1FJG I;  4GKK E;  2O1V A;  2UUA I;  3P3C A;  5K36 C;  3LNU A;  1IBM I;  4LF7 E;  1ZXN A;  2GQ0 A;  5LMN E;  4LFB E;  1Z5C A;  1HR0 I;  3QT5 A;  1KIJ A;  1J5E E;  4X64 I;  5DRQ A;  4LF9 E;  4OO1 C;  2A2C A;  2UXB I;  4OO1 B;  2BR2 A;  1I94 I;  4JI5 I;  1B63 A;  4UTG A;  1FNM A;  2GO3 A;  3GON A;  1XHK A;  4MU0 A;  5DNL A;  2BM1 A;  4DUY I;  1NZ0 A;  3B8H A;  4JI4 E;  4GQU A;  2A2D A;  4U3B A;  1FI4 A;  5FLX C;  3OTO E;  1OYR A;  4DR2 I;  1U2R A;  2C39 B;  1FKA E;  5ELW A;  5GMD A;  2HK2 A;  4IFD F;  2F1D A;  4N3O A;  4USM A;  1KKH A;  2IOP A;  3H1C A;  4B3S I;  4ED4 A;  4OKG A;  2PNZ B;  1ELO A;  2BM0 A;  3M7N D;  3PYD A;  3WU3 A;  2PNM A;  4PU9 A;  3K85 A;  5BR8 E;  4B3T E;  2Z5B B;  4JI1 I;  3J80 Q;  3CDJ A;  4X62 E;  1VI7 A;  4IFD E;  4IFD A;  1BKN A;  2GS8 A;  3M85 G;  4JI0 E;  3CWV A;  4DPY A;  5DNX A;  4DV4 I;  1H7U A;  4Z7Y A;  1B62 A;  4NXM E;  1OYS A;  1XMO I;  1XNR E;  4JI3 I;  1Z5A A;  2C37 A;  2PO0 A;  3JAM Q;  1A6F A;  3ZZT A;  4P7A A;  5LMU I;  1IBL I;  4ZVI A;  1YH8 A;  2IOQ A;  4HAC A;  4DV0 E;  2PO2 B;  1R6M A;  4IZJ D;  1HNW E;  4USK A;  3P3G A;  1FJG E;  5IT9 C;  3PYG A;  4DV2 I;  1N32 I;  2UUA E;  2VES A;  4AQY I;  1IBM E;  4DXL A;  1Z0C A;  4XTJ A;  2HKE A;  1N34 I;  1HR0 E;  4LF5 I;  2BA0 G;  2PO1 B;  4FW9 A;  4HYM A;  5EKW A;  4X64 E;  4DV1 E;  1USU A;  3ZM7 A;  1Y4U A;  3P3E A;  1HNX I;  4FWG A;  2UXB E;  1NHH A;  1HK7 A;  1PVG A;  4OX9 I;  4YY3 I;  1Y6Z A;  1I94 E;  4JI5 E; 
#chains in the Genus database with same CATH homology
 4JI7 I;  4DPT A;  4I3H A;  4P52 A;  1Z0V A;  4HY1 A;  4URL A;  3WU6 A;  3B78 A;  4HXZ A;  3J7A M;  3LPS A;  1PKP A;  2PNL A;  3J7A G;  4Z7C A;  4R1F A;  1S16 A;  4DR7 I;  4JI8 E;  1ZM3 A;  1UEK A;  4MYT A;  2V2Z A;  4FWH A;  1N33 I;  2R42 A;  2DEJ A;  2R3V A;  4JI6 I;  2F4V I;  1H74 A;  3HJC A;  3M6A A;  1ZM9 A;  4GKJ I;  4JI1 E;  1QZR A;  1XNQ I;  2VQF E;  1DAR A;  5GME A;  4B3M I;  4DV4 E;  1NHJ A;  4K0K I;  4IZK B;  4YHH I;  1VIS A;  4M1K A;  2UU9 I;  1XMO E;  2HFU A;  4JI3 E;  4DR5 I;  1XMQ I;  2ZM6 E;  1IBL E;  4NXN I;  2VQE I;  2O1U A;  1RRE A;  4KHP I;  3T1Y I;  5FLX Q;  1FWK A;  4DV6 I;  4DV2 E;  1N0U A;  3K1J A;  1H73 A;  2HKJ A;  4AQY E;  2HK3 A;  1IBK I;  1Z0W A;  1MU5 A;  4WUC A;  1N34 E;  5A2Q C;  4PRV A;  4JV5 E;  4LF5 E;  1Z0T A;  4DPX A;  3T1H I;  4X66 I;  1Y4S A;  1J5E I;  1HNX E;  4DR3 E;  4OX9 E;  2Q2E B;  4FN5 A;  4YY3 E;  4MYU A;  4DR1 I;  2ZIT A;  3Q6M A;  3QT8 A;  4JI7 E;  4DU7 A;  2V2V A;  3PYF A;  4WUB A;  4UT4 A;  3PRY A;  2J7K A;  3B82 A;  1Z0G A;  4LFA I;  3QT6 A;  4LF4 I;  2E5L I;  1N36 I;  2OI2 A;  2UUB I;  4DR7 E;  1H72 C;  4IZJ A;  3J81 C;  3ZZU A;  3V2U C;  1PIE A;  1N33 E;  4B3R I;  2LJP A;  4X65 I;  2EFG A;  4JI6 E;  2DEI A;  4DUZ I;  2F4V E;  2Z5C A;  4GKJ E;  1ZM2 A;  5FWK A;  5IT9 Q;  1XNQ E;  5BR8 I;  4RPF A;  3Q1Q A;  4X62 I;  4B3M E;  3K17 A;  4DU8 A;  5L3J A;  4DUY E;  4KQV A;  2Z5B A;  4K0K E;  4YHH E;  3H4L A;  4LF6 I;  4FWD A;  5IWA I;  2HFS A;  4DV3 I;  4LFC I;  4DR2 E;  2CGE A;  2V34 A;  2UU9 E;  2V2Q A;  2HHH I;  2UUC I;  4DR5 E;  1S4E A;  1XMQ E;  4DV5 I;  1EI1 A;  4B3S E;  3ZKD A;  4NXN E;  4EMD A;  2VQE E;  4KHP E;  3ZKB A;  3T1Y E;  4JI2 I;  3F0N A;  4DV6 E;  4DR4 I;  1EA6 A;  2Z5E A;  1IBK E;  3T1H E;  4X66 E;  2ZBK B;  1Z0E A;  3QT7 A;  4JYA I;  4DV1 I;  4DV7 I;  2AJ4 A;  4DR1 E;  3LTO A;  1HNZ I;  3V5R A;  3ZZ0 A;  4DR6 I;  2UXD I;  2CZ9 A;  4HAC B;  5LMU E;  4LF8 I;  3Q6N A;  1ZXM A;  3P06 A;  4LFA E;  4LF4 E;  4IZJ B;  2E5L E;  1N36 E;  2UUB E;  1N32 E;  2UXC I;  5LL6 R;  2WW4 A;  3J80 C;  4GKK I;  1Z5B A;  4JI8 I;  4B3R E;  2Z5C B;  4X65 E;  1KTV A;  4LF7 I;  4DUZ E;  1H7S A;  1NHI A;  3HUL A;  5LMN I;  4LFB I;  2CG9 A;  2BV3 A;  2X36 A;  4LF9 I;  2VF3 A;  1Z59 A;  3PYE A;  5A2Q Q;  2VQF I;  2V8P A;  3JAM C;  2XEX A;  4LF6 E;  5IWA E;  4DV3 E;  2E1R A;  4LFC E;  2O1T A;  3D4J A;  4JI4 I;  4IZK A;  3OTO I;  2HHH E;  1Z0B A;  1USV A;  2UUC E;  4DV5 E;  2ZM6 I;  1OJ4 A;  4JG4 A;  4JI2 E;  1KVK A;  4DR4 E;  1MG7 A;  4B3T I;  3J81 Q;  2X7I A;  4JI0 I;  4DPW A;  3WU5 A;  4JV5 I;  1FWL A;  4JYA E;  1D6T A;  2NPF A;  1ZM4 A;  4WUD A;  4DPU A;  4DV7 E;  1K47 A;  1HNZ E;  4DR3 I;  4DR6 E;  2UXD E;  4NXM I;  4PRX A;  1MX0 A;  1XNR I;  1N0V C;  4LF8 E;  1WUU A;  3WU4 A;  2O1W A;  1RR9 A;  4DV0 I;  2UXC E;  1HNW I;  1FJG I;  4GKK E;  2O1V A;  2UUA I;  3LNU A;  1IBM I;  4LF7 E;  1ZXN A;  2GQ0 A;  5LMN E;  4LFB E;  1Z5C A;  1HR0 I;  3QT5 A;  1KIJ A;  1J5E E;  4X64 I;  4LF9 E;  2A2C A;  2UXB I;  1I94 I;  4JI5 I;  1B63 A;  4UTG A;  1FNM A;  3GON A;  1XHK A;  2BM1 A;  4DUY I;  1NZ0 A;  3B8H A;  4JI4 E;  2A2D A;  5FLX C;  1FI4 A;  3OTO E;  4DR2 I;  1U2R A;  1FKA E;  5GMD A;  2HK2 A;  4N3O A;  4USM A;  1KKH A;  2IOP A;  4B3S I;  4ED4 A;  1ELO A;  2BM0 A;  3PYD A;  3WU3 A;  2PNM A;  4PU9 A;  3K85 A;  5BR8 E;  4B3T E;  2Z5B B;  4JI1 I;  3J80 Q;  4X62 E;  1BKN A;  2GS8 A;  4JI0 E;  3CWV A;  4DPY A;  4DV4 I;  1H7U A;  4Z7Y A;  1B62 A;  4NXM E;  1XMO I;  1XNR E;  4JI3 I;  1Z5A A;  3JAM Q;  1A6F A;  3ZZT A;  4P7A A;  5LMU I;  1IBL I;  4ZVI A;  2IOQ A;  4HAC A;  4DV0 E;  4IZJ D;  1HNW E;  4USK A;  1FJG E;  5IT9 C;  3PYG A;  4DV2 I;  1N32 I;  2UUA E;  4AQY I;  1IBM E;  4DXL A;  1Z0C A;  4XTJ A;  2HKE A;  1N34 I;  1HR0 E;  4LF5 I;  4FW9 A;  4DV1 E;  4HYM A;  4X64 E;  1USU A;  3ZM7 A;  1Y4U A;  1HNX I;  4FWG A;  2UXB E;  1NHH A;  1HK7 A;  1PVG A;  4OX9 I;  4YY3 I;  1Y6Z A;  1I94 E;  4JI5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...