4JI7T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji7T00
4DR2T 4JI2T 4DUZT 4X64T 1N36T 1HNXT 1HNWT 4JI0T 4DV3T 4DR7T 2UXBT 1I94T 1IBKT 1N34T 1N33T 2F4VT 4GKJT 4JI1T 4DV4T 3T1HT 4DV2T 4LFBT 1XNQT 4JV5T 4DR4T 1IBLT 4LF4T 4DV1T 4JI3T 5LMUT 2UUAT 4DR5T 4LFAT 4DUYT 4DR6T 3T1YT 1XMQT 4X66T 4JYAT 4NXNT 4YY3T 1XMOT 4JI6T 4DV7T 1HR0T 4JI4T 1HNZT 4X65T 4YHHT 4AQYT 4X62T 1J5ET 4LF6T 4LFCT 4LF9T 2UXDT 4DV0T 5BR8T 4LF5T 2ZM6T 4JI8T 4DV5T 2UUBT 4GKKT 2UU9T 2E5LT 1IBMT 4DV6T 4K0KT 4B3RT 5LMNT 4LF7T 4B3MT 4DR3T 1XNRT 2HHHT 4DR1T 4NXMT 2VQFT 2VQET 4B3ST 4OX9T 2UUCT 4B3TT 4LF8T 3OTOT 1FJGT 4JI5T 4JI7T 4KHPT 5IWAT 2UXCT 1N32T
chains in the Genus database with same CATH superfamily
2FJAA 3L39A 2WCAA 2YN6A 4KUMB 2RA1A 4UVAB 3N5LA 1OEDC 4HTEA 1N34T 3NVOA 2Y6XA 3FBZA 3FZFB 5AQRB 4UXNB 4FI5A 2JMHA 4QXHB 2MOZA 4CZZB 4BJMA 2MYSA 1LVKA 3QUJA 4QH1A 5JR9C 2XQ9A 2CPTA 2V1DB 5HCMA 4NXNT 2CM0A 2LSKA 1WCRA 1FEWA 4IGUA 2HH7A 5LB7B 2LM9A 3UT5E 2E9XB 3IBPA 2DHRA 2BKPA 3OJAA 3PJAJ 4YT0A 3RC8A 1KNZA 4C90A 1UGOA 1FMWA 3UFGA 4X1YE 2XJ7A 3B5MA 5L47A 4UEMA 5FXXA 2V5DA 3VHLA 3UU8A 5ADXL 2YKSA 2Q9QA 4GK0E 3HKEE 3PE0A 3RQUA 4OX9T 5CJ5A 1HG5A 3OYZA 2J1DG 2P9BA 1VCSA 4JI5T 5L3GB 4HWFA 3RH3A 1QLBA 4A98A 1D1CA 2IUBA 3TKLB 1HNXT 2WZIA 1YXRA 4HFBA 1UX4A 5AQQB 3Q5WA 1UCUA 4QX8B 3ANWB 1X79A 3A7MA 3RPUA 4TUYE 1VRBA 1LVFA 4F6RC 4DR6T 4HWDA 3PUGA 1US7B 3T8OA 3P4PA 4IDPA 5LGTB 3RIAA 2WAUA 4G63A 4GIWA 2VASA 2V6YA 3KFWX 2C5JA 3AEFA 3VKGA 4O4LE 3AE8A 2XQAA 4TWDA 2UU9T 1HX8A 4DV6T 3GWHA 2KWHA 2EHOD 2CBJA 1XNRT 2VQET 2XUEA 3E08A 1D0YA 3U3IA 1KFYA 4B3TT 4HEAA 4HWCA 2LT3A 3FB2A 2DNXA 5JDQA 2XAHB 4KMCA 3AEAA 3QOFA 3OBVE 3CQCB 4E7SA 2CWOA 4H63V 3C4WA 5LJMA 2BG9E 5HAXA 4K0UA 2LM2A 2XM1A 5FP3A 4DVDA 4JI1T 4COFA 4PK5A 4A97A 1XWMA 3AXJB 1H7CA 3MACA 3I9WA 2XZEA 3ZMUB 1T72A 3VR8A 1ZV4X 4O8SA 1T7SA 4UV9B 4JYAT 4IE4A 1ZOYA 2KXPB 4HFIA 2QYWA 3EAMA 2WU2A 3KV9A 2D9DA 5H6RB 2H7OA 1E1HB 3JC6C 3MZKB 1KEYA 3NBXX 1LRZA 2YU2A 2FJBA 3JAEA 2XAFB 4WW0A 1YKEB 3KINB 2FUPA 3FXDB 4AIUA 5C3JA 3RIUC 2WSSV 1S94A 2G0UA 2IIUA 5FXWA 2M6IA 3C51A 2Y48B 3HKDE 1SE7A 3AEDA 3KBUA 5CFBA 3VU7H 1E2AA 4H63H 4TNVA 2JQQA 3OYXA 4ZI2D 1WR6A 1NEKA 3PJAA 1MIVA 1Z8UA 2N2NA 2RPAA 4DMWA 2KWIB 2DCFA 2WB5A 3P4SA 2UXBT 1SHZC 1YQ4A 2Q9QD 4WBNE 2NW7A 3ETVA 3RGLA 1MMGA 3P8CD 5AQVB 4MHCA 5AQFB 2X9XA 5C8YE 3VR9A 4CN4A 3JC6D 3V5UA 3UQ7A 3HKCE 2VKJA 4U31A 4EYYR 4NUUA 1BR2A 4LFCT 4ZI7E 1G8XA 4YSXA 5GONE 2W0GA 4U7YA 5M4YA 3RKGA 2WWUA 2BKOA 4PJLA 2N1GA 3WAJA 4H9RC 4KP3C 2Y8DA 4ANJA 5JVDE 1YQ3A 5ABEA 2WU5A 4XZCA 3TLTA 5FL0A 5HXCA 4IHJE 5AQTB 2HN1A 3NKZA 4JI7T 5IWAT 2LOPA 3AA1B 1N36T 3J7Yq 1WYBA 4AQFC 2XQ3A 4GK5E 2L8KA 4ILAA 2FBWA 2NW9A 5E0OA 5LG3A 1T8BA 3GN5A 3D0TA 2LRLA 2VVSA 2D0TA 5BMVE 5LNKA 4DV1T 5HEHA 3UULA 4DUYT 1CHUA 3N9OA 4L9IA 4PK4A 2QVAA 5L3FB 3EUHA 2LKGA 2WDVA 3LK42 4JBWF 4X65T 4WNKA 3UU6A 2FJEA 4M1PA 4LF6T 3P50A 3EVYA 2LLYA 2DWGA 3AVSA 2XQ4A 3CX8B 5TAOA 3AAIA 3KDSE 3PUVF 5CA0E 4IIJE 5AQPB 4K0KT 5JRCB 1NENA 5JR9B 3ZYMA 2JQ9A 4UELA 2ACZA 3UU3A 2XQ7A 4X20E 4UVCB 2KLQA 3ZC1A 5DJQC 2WDRA 3IEEA 2UXXB 4Z90A 4DR2T 1AJ3A 3AE1A 5C2TA 3EI0A 4A56A 3K3QC 4Z91A 5J2UE 1VOMA 5JDGA 2W00A 4GYSA 4AKIA 3RI5A 4DNDA 1FMVA 2WM9A 3I0OA 2SPCA 2XQ8A 2B76A 2W62A 3NRYA 5FKYA 1UURA 3ZN1B 4DV4T 4PJMA 4JV5T 3MKDA 3FBLA 4H9OC 2CBIA 2IC9A 2EHOB 5F3JA 3TLSA 4IDQA 5FVKA 3ETUA 4ERRA 3KV5A 4IE7A 2YU1A 4ILUA 2MPKA 3Q5DA 5CA1E 2H7VC 5FNVE 3HR0A 3K3NA 5J1GA 5ABFB 2LSGA 1KNRA 3F57A 2LHRA 3H37A 2MAWA 3E0ZA 3Q5XA 1SUMB 4LF9T 4DV0T 2V7IA 5DQWA 1DU2A 3UFEA 2BZBA 2XAGB 4CQIA 3L3PA 4X1KE 5EK3A 2KMFA 5KXJA 4U3CA 3PUYF 3PUSA 1IAPA 5ETWA 1HCIA 2C5KT 3O4XE 4DIDB 1M62A 2LHNA 3CQXC 3U78A 5KX5E 2VKOA 2W61A 2UUCT 5A1LA 1S35A 2WDQA 3JADA 3AEEA 3KV4A 1N32T 4HFEA 3P4RA 4UVBB 2BG9C 4QHOA 4P09A 5AQOB 3ANWA 4NPPA 4ZZCA 3RRCA 4ILBA 4WYVA 2X51A 3RF1A 4GKJT 3I1AA 2EHOC 3T1HT 1FIOA 4AQGA 3A5XA 4WZXA 5LJNA 2V7KA 2J62A 2VB6A 5JDHA 2QA7A 5L3EB 5AQJB 2L3LA 4CI1B 1U4QA 2QGSA 1D1AA 3F31A 2MTQA 4EEDA 2YOEA 4YHHT 3FZKB 2JQHA 3CK6A 5BR8T 3CVRA 4YSZA 4JI8T 2CE7A 2J4GA 4HFHA 3ZMTB 2RP4A 2Q9QB 2E5LT 3ZC0A 2E5VA 5AQHB 2NTYA 4KHZF 2HHHT 2PTFA 5FL1A 4OYKA 3I0QA 5FY1A 2YK0A 2KSRA 2XHEB 3PU8A 3AE9A 3AE4A 4KHPT 3PUWF 3I9YA 2ZMAA 1Y64B 3AXJA 3ONLC 4KBMB 3Q9DA 2CCQA 4IL9A 2W4XA 1HFAA 2LKHA 2CHOA 3ZPOA 1LKXA 4O4IE 3SFEA 3BQIA 4EB6E 2I6HA 3AE7A 3Q2MA 2CXFA 3HKBE 4EOZB 4P1NA 4YJ3E 3ZMVB 1O3XA 2MBGA 3QK6A 2VK9A 3X1DA 3R84B 4O2AE 5AQIB 3ZSSA 2V6YB 5LHHB 4JI6T 4ZI2C 2LSJA 3K8PC 4EIWA 2VWAA 1W9RA 3VKHA 4YTNA 4ZI3C 4AKHA 2ZM0A 4CXYA 2DL1A 1B7TA 4EZHA 2Q9QC 3FZMB 5LGUB 4LF5T 2C0SA 2CXLA 2A9UA 5AQGB 5JH7E 3MJXA 1IBMT 5FMNA 3AE2A 2J47A 2AE9A 4CN1A 3RQWA 3C98B 3SFDA 2ZLYA 4CI2B 3ZKRA 1UX5A 1HG2A 4TX5A 5LP6E 4UIGA 3QC9A 3TLWA 2D5UA 4UF0B 3FZHB 3TLUA 2ACXA 2UXCT 3KVAA 3H3AA 1D0XA 5IYZE 1HNWT 4P0BA 2GK9A 4TN7B 4MALA 3VRBA 1UK5A 4EYUA 3DP7A 1IBKT 4IE5A 2HPLA 1XNQT 4UV8B 4PJJA 4A5XA 3CMLA 3T1YT 3BQLA 4ZI3D 2W66A 3JAFA 2V8SV 5HEUA 3P4QA 4L5GA 4LMJA 3LK2B 2WBLA 3M3ZB 5HYAA 3RYHE 2A2FX 3RHWA 3RLFF 2A72A 1BR1A 2VKDA 1BR0A 2V5CA 2LSYA 3AE5A 2NWBA 4IE0A 3ZT7A 4DMVA 2V6XA 3KBTA 1X9BA 2YINA 2H89A 4HWHA 2CLYB 2BVMA 3DTOA 3Q5EA 2XQYA 3O1IA 3ZT6A 3W15B 1M7KA 1FJGT 2K5BB 4U72A 3LBXB 4E7ZA 3QB5A 2WWVA 4EEBA 2NR4A 5FXZA 2VL0A 1ZP0A 5DABA 2IHR1 5CB4E 5LHGB 5L3BB 1W09A 2QRXA 3WAKA 2LE8A 4HFCA 3VRAA 5LBMA 3ZJ1A 5KMGP 4BJNA 3IHRA 4TZ4C 3LJCA 3ZYKA 2KNDA 5FVLA 3SRZA 4PNIA 1XDOA 4HN9A 1OEDA 5LA6E 2VVNA 5J0ZA 2BKNA 3LFMA 2XY8B 4JUYA 2PFVA 2XTLA 4PFOA 3O1HA 5JRCA 3SOLA 2CEAA 2CLYC 2YEVC 3PUZF 2Z6EA 5F5WA 4IT4A 5JDLA 2VURA 3B57A 3RX6A 2X0YA 4WBOA 2C5IT 4LMLA 3RYCE 3NRXA 1MMDA 1ZHCA 2JJ9A 3EHZA 3CX6B 3C4ZA 3ONJA 2OA5A 4NXMT 2ODUA 2K48A 3N9LA 2D2SA 2IAKA 1Y01A 5EK4A 3UUNA 4AI6A 2K9AA 3MXZA 3IF8B 2H88A 3CKDA 4IDOA 3RIFA 3N9MA 4O2BE 4QWNB 4XAXB 4JI2T 4L0RA 2B1EA 3CQGB 2BBHA 4OYJA 3ZMZB 4Z8XA 3NWIA 4QX7B 3AAAB 5FY7A 2WP9A 2R6GF 4EZ4A 1N33T 3CPZA 4I0UA 4IE6A 3ZMSB 2BS2A 4LFBT 1HTJF 2BDEA 4LF4T 3UU4A 4QKNA 4I43B 3C4XA 4BA9A 3NZQA 5HXSA 5LCYA 3RKOA 2BG9B 4AKRB 5KDMC 4P0AA 2V7MA 3SWHA 2CMRA 3R6NA 3UUBA 2X0HA 5F8PA 4MBQA 2HPJA 5JREA 1HNZT 5AQMB 3EDUA 2KT9A 4PFPA 3JCFA 5LHIB 4Q25A 3AECA 3ZN0B 5JDMA 2XAQB 1WYCA 2CWYA 2ZM6T 5EZYE 2E9XA 3G06A 3N2GE 3ZCIA 2I0MA 2ZM2A 1J1JA 3ONXA 4YXDA 5LOVE 1NAFA 4EGWA 4G2AA 4I4TE 1IZNB 2VQFT 4FJOA 4CI3B 2KINB 4IREA 4ZZBA 2BS4A 4HE8A 3PUQA 2XPKA 5IHYA 2YDQA 5HEJA 1CUNA 1E7PA 2CHNA 1HX1B 4X64T 4U2ZA 4DO0A 1HF8A 1ZEEA 3ESLA 3AA7B 4AKGA 5AQLB 4ISSA 1I94T 2YDSA 1W0BA 1OWAA 4QH4A 3PDYA 2XM2A 4DV2T 4H9PC 4HKAA 1Z0PA 1D0ZA 1VCTA 3J9X1 2NW8A 4YLHA 2X0LB 4JI3T 3N9NA 5LMUT 2UUAT 2YDRA 2V26A 4DBRA 3AE3A 5EK2A 1XZYA 3HL6A 4JLEA 1J5WA 1UUSA 5AQNB 4ILCA 1YD8G 2IW5B 4JI4T 5HXHA 4YTPA 3C64A 3AA0B 3UQ4A 4YHJA 3PTRB 3WI3A 2OLTA 1MIYA 2VKHA 3BQKA 4N78D 3DJBA 3PUAA 1OXZA 4YSYA 2AXDS 2UUBT 1YW0A 4O4JE 3FXEB 3ZCJA 5JDNA 3N9QA 4DR1T 5LYJE 2I59A 5HEOA 4AXPA 2BS3A 2LRKA 5FY0A 3B13A 4OK0A 4TNWA 4U7IA 3ZJ2A 4J2CA 4NUVA 4U74A 1IJ5A 2XQ5A 3RIUA 1D1BA 2LEHA 3UUXB 3SS1A 4DV3T 3ABVA 3LK3B 2N9DA 4UR9A 3K1SA 4EAHA 5LG4A 4YFSA 3F2EA 2WY2A 2E9XC 2L9QA 3AAEB 5FXVA 1OEDE 2A3DA 1IBLT 4ASKA 5CGMA 3A8YC 5ABHA 3N2OA 3V5SA 2JIWA 2JRKA 5AQUB 5HCJA 3ZYLA 3LSVA 3BK9A 3RC3A 4BAYB 1MMNA 2UXNB 4AQYT 1J5ET 1KF6A 5L3CB 2UXDT 5HXEA 4CXXA 1GQEA 5DQVA 4CN6A 3N9PA 2WMNA 2LSIA 5LBQB 4UF0A 2V7LA 4B3ST 4OHFA 4ZS3A 4YJ2E 5H6QB 4EV6A 2W2UA 3OTOT 2H3RA 2LOSA 3AB3B 4ZXLA 2E9XD 4TWHA 4DUZT 3LDQB 4H9SE 1MIWA 1I6ZA 2WMOA 3HA4A 1IJ6A 1ZKEA 2X9WA 4QXBB 2DI4A 1QUUA 4YTMA 3AEGA 2KZ7B 5FYMA 3QNUA 3OKQA 4AQFA 2WQYA 4DBQA 2NP9A 3E22E 3OPCA 1MMAA 1T98A 4HFVA 4ZOLE 1XMQT 4GOUA 3IA3A 4X66T 1W0AA 3KVBA 3KV6A 4H9NC 4DV7T 4ZEYA 2ZM8A 3PURA 2W67A 2VL8A 3M65A 3S4UA 4QH5A 3L09A 2CRBA 1MNEA 3LG7A 3GA8A 2X68A 5AQKB 4LMKA 5HWYA 4HGAA 1KNPA 1WFDA 5AFUL 4I55E 5HWXA 2NTXA 3O1JA 1EZ3A 3ZLIA 4I50E 4B3RT 3CIRA 4LF7T 2X67A 3O9XA 4B3MT 1NWMX 4DR3T 2BBJA 3LBXA 4ISTA 4TV9E 1U5PA 3C50A 3UTKA 3K3OA 2M6BA 2D0UA 4JEHB 1KK7A 3EABA 1QSDA 2FJDA 3QB5K 4PAGA 2CA5A 2LJLA 5L4HA 4HFDA 4JI0T 3PUXF 4X1IE 4DR7T 5J2TE 2DWKA 4H9QC 1V9DA 1R8IA 4XBFB 3EDVA 4NIQA 3NZPA 1JNRA 5LGNB 4OFZA 3ZEFB 2XAJB 4HWIB 4DR4T 4C91A 2M67A 4DR5T 4KX6A 4KI0F 1JNZA 1HS7A 2PBIA 4V1Av 4PW8A 1HR0T 5JDFA 3MK7C 3RYIE 3MA9A 1XDPA 2X9YA 3N2KE 1SA0E 1G73A 5HXRA 4PJNA 1WRDA 3CWZB 2PG8A 2ES0A 2JQKA 5LMNT 3P7IA 4U33A 5ABGA 4ADZA 3PV0F 2W63A 5JR9A 4GYRA 3TLVA 3L8RA 4TV8E 1L0VA 2X9HA 2IDOB 4B6XA 2IC6A 2K3WA 4MFRA 2X66A 4ZHQE 2NOXA 3RYFE 4F8HA 2E2AA 3UUMA 3CX7B 4AKLA 1YKHB 4IDZA 5HEGA 2WZHA 4IDNA 4X5TA 2F4VT 1BR4A 1MNDA 2BG9A 2CXDA 2IMLA 1OEDB 5AQSB 4IL4A 5L3DB 5L4EA 4JEUB 2PJQA 4LFAT 2DLRA 3RRWA 2EHOA 4YY3T 3P4WA 1XMOT 3GN5B 3ZSTA 2JMKA 2XSAA 4EXTA 2K24A 3UU5A 3HI2A 4X62T 2E8IA 5ABFA 2OV9A 4DV5T 5IUXA 2JPFA 4MLKA 2XQ6A 3FZLB 5JTGA 4QXCB 4GKKT 1WLXA 4TWFA 2XASB 2V7JA 2HN2A 4U2YA 3ZT5A 2BVLA 2XSBA 3AEBA 3H3MA 3OVUA 1WR0A 5JQGE 3AVRA 4PK6A 3AE6A 3AA6B 3PU3A 2WS3A 4AISA 4O4HE 5L2LA 4ZS2A 4LF8T 4CXWA 2ODVA 3FHNA 3GMIA 5LXTE
chains in the Genus database with same CATH topology
4DR2T 4JI2T 4DUZT 4X64T 1N36T 1HNXT 1HNWT 4JI0T 4DV3T 4DR7T 2UXBT 1I94T 1IBKT 1N34T 1N33T 2F4VT 4GKJT 4JI1T 4DV4T 3T1HT 4DV2T 4LFBT 1XNQT 4JV5T 4DR4T 1IBLT 4LF4T 4DV1T 4JI3T 5LMUT 2UUAT 4DR5T 4LFAT 4DUYT 4DR6T 3T1YT 1XMQT 4X66T 4JYAT 4NXNT 4YY3T 1XMOT 4JI6T 4DV7T 1HR0T 4JI4T 1HNZT 4X65T 4YHHT 4AQYT 4X62T 1J5ET 4LF6T 4LFCT 4LF9T 2UXDT 4DV0T 5BR8T 4LF5T 2ZM6T 4JI8T 4DV5T 2UUBT 4GKKT 2UU9T 2E5LT 1IBMT 4DV6T 4K0KT 4B3RT 5LMNT 4LF7T 4B3MT 4DR3T 1XNRT 2HHHT 4DR1T 4NXMT 2VQFT 2VQET 4B3ST 4OX9T 2UUCT 4B3TT 4LF8T 3OTOT 1FJGT 4JI5T 4JI7T 4KHPT 5IWAT 2UXCT 1N32T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 T;  4JI2 T;  4DUZ T;  4X64 T;  1N36 T;  1HNX T;  1HNW T;  4JI0 T;  4DV3 T;  4DR7 T;  2UXB T;  1I94 T;  1IBK T;  1N34 T;  1N33 T;  2F4V T;  4GKJ T;  4JI1 T;  4DV4 T;  3T1H T;  4DV2 T;  4LFB T;  1XNQ T;  4JV5 T;  4DR4 T;  1IBL T;  4LF4 T;  4DV1 T;  4JI3 T;  5LMU T;  2UUA T;  4DR5 T;  4LFA T;  4DUY T;  4DR6 T;  3T1Y T;  1XMQ T;  4X66 T;  4JYA T;  4NXN T;  4YY3 T;  1XMO T;  4JI6 T;  4DV7 T;  1HR0 T;  4JI4 T;  1HNZ T;  4X65 T;  4YHH T;  4AQY T;  4X62 T;  1J5E T;  4LF6 T;  4LFC T;  4LF9 T;  2UXD T;  4DV0 T;  5BR8 T;  4LF5 T;  2ZM6 T;  4JI8 T;  4DV5 T;  2UUB T;  4GKK T;  2UU9 T;  2E5L T;  1IBM T;  4DV6 T;  4K0K T;  4B3R T;  5LMN T;  4LF7 T;  4B3M T;  4DR3 T;  1XNR T;  2HHH T;  4DR1 T;  4NXM T;  2VQF T;  2VQE T;  4B3S T;  4OX9 T;  2UUC T;  4B3T T;  4LF8 T;  3OTO T;  1FJG T;  4JI5 T;  4JI7 T;  4KHP T;  5IWA T;  2UXC T;  1N32 T; 
#chains in the Genus database with same CATH topology
 2FJA A;  3L39 A;  2WCA A;  2YN6 A;  4KUM B;  2RA1 A;  4UVA B;  3N5L A;  1OED C;  4HTE A;  1N34 T;  3NVO A;  2Y6X A;  3FBZ A;  3FZF B;  5AQR B;  4UXN B;  4FI5 A;  2JMH A;  4QXH B;  2MOZ A;  4CZZ B;  4BJM A;  2MYS A;  1LVK A;  3QUJ A;  4QH1 A;  5JR9 C;  2XQ9 A;  2CPT A;  2V1D B;  5HCM A;  4NXN T;  2CM0 A;  2LSK A;  1WCR A;  1FEW A;  4IGU A;  2HH7 A;  5LB7 B;  2LM9 A;  3UT5 E;  2E9X B;  3IBP A;  2DHR A;  2BKP A;  3OJA A;  3PJA J;  4YT0 A;  3RC8 A;  1KNZ A;  4C90 A;  1UGO A;  1FMW A;  3UFG A;  4X1Y E;  2XJ7 A;  3B5M A;  5L47 A;  4UEM A;  5FXX A;  2V5D A;  3VHL A;  3UU8 A;  5ADX L;  2YKS A;  2Q9Q A;  4GK0 E;  3HKE E;  3PE0 A;  3RQU A;  4OX9 T;  5CJ5 A;  1HG5 A;  3OYZ A;  2J1D G;  2P9B A;  1VCS A;  4JI5 T;  5L3G B;  4HWF A;  3RH3 A;  1QLB A;  4A98 A;  1D1C A;  2IUB A;  3TKL B;  1HNX T;  2WZI A;  1YXR A;  4HFB A;  1UX4 A;  5AQQ B;  3Q5W A;  1UCU A;  4QX8 B;  3ANW B;  1X79 A;  3A7M A;  3RPU A;  4TUY E;  1VRB A;  1LVF A;  4F6R C;  4DR6 T;  4HWD A;  3PUG A;  1US7 B;  3T8O A;  3P4P A;  4IDP A;  5LGT B;  3RIA A;  2WAU A;  4G63 A;  4GIW A;  2VAS A;  2V6Y A;  3KFW X;  2C5J A;  3AEF A;  3VKG A;  4O4L E;  3AE8 A;  2XQA A;  4TWD A;  2UU9 T;  1HX8 A;  4DV6 T;  3GWH A;  2KWH A;  2EHO D;  2CBJ A;  1XNR T;  2VQE T;  2XUE A;  3E08 A;  1D0Y A;  3U3I A;  1KFY A;  4B3T T;  4HEA A;  4HWC A;  2LT3 A;  3FB2 A;  2DNX A;  5JDQ A;  2XAH B;  4KMC A;  3AEA A;  3QOF A;  3OBV E;  3CQC B;  4E7S A;  2CWO A;  4H63 V;  3C4W A;  5LJM A;  2BG9 E;  5HAX A;  4K0U A;  2LM2 A;  2XM1 A;  5FP3 A;  4DVD A;  4JI1 T;  4COF A;  4PK5 A;  4A97 A;  1XWM A;  3AXJ B;  1H7C A;  3MAC A;  3I9W A;  2XZE A;  3ZMU B;  1T72 A;  3VR8 A;  1ZV4 X;  4O8S A;  1T7S A;  4UV9 B;  4JYA T;  4IE4 A;  1ZOY A;  2KXP B;  4HFI A;  2QYW A;  3EAM A;  2WU2 A;  3KV9 A;  2D9D A;  5H6R B;  2H7O A;  1E1H B;  3JC6 C;  3MZK B;  1KEY A;  3NBX X;  1LRZ A;  2YU2 A;  2FJB A;  3JAE A;  2XAF B;  4WW0 A;  1YKE B;  3KIN B;  2FUP A;  3FXD B;  4AIU A;  5C3J A;  3RIU C;  2WSS V;  1S94 A;  2G0U A;  2IIU A;  5FXW A;  2M6I A;  3C51 A;  2Y48 B;  3HKD E;  1SE7 A;  3AED A;  3KBU A;  5CFB A;  3VU7 H;  1E2A A;  4H63 H;  4TNV A;  2JQQ A;  3OYX A;  4ZI2 D;  1WR6 A;  1NEK A;  3PJA A;  1MIV A;  1Z8U A;  2N2N A;  2RPA A;  4DMW A;  2KWI B;  2DCF A;  2WB5 A;  3P4S A;  2UXB T;  1SHZ C;  1YQ4 A;  2Q9Q D;  4WBN E;  2NW7 A;  3ETV A;  3RGL A;  1MMG A;  3P8C D;  5AQV B;  4MHC A;  5AQF B;  2X9X A;  5C8Y E;  3VR9 A;  4CN4 A;  3JC6 D;  3V5U A;  3UQ7 A;  3HKC E;  2VKJ A;  4U31 A;  4EYY R;  4NUU A;  1BR2 A;  4LFC T;  4ZI7 E;  1G8X A;  4YSX A;  5GON E;  2W0G A;  4U7Y A;  5M4Y A;  3RKG A;  2WWU A;  2BKO A;  4PJL A;  2N1G A;  3WAJ A;  4H9R C;  4KP3 C;  2Y8D A;  4ANJ A;  5JVD E;  1YQ3 A;  5ABE A;  2WU5 A;  4XZC A;  3TLT A;  5FL0 A;  5HXC A;  4IHJ E;  5AQT B;  2HN1 A;  3NKZ A;  4JI7 T;  5IWA T;  2LOP A;  3AA1 B;  1N36 T;  3J7Y q;  1WYB A;  4AQF C;  2XQ3 A;  4GK5 E;  2L8K A;  4ILA A;  2FBW A;  2NW9 A;  5E0O A;  5LG3 A;  1T8B A;  3GN5 A;  3D0T A;  2LRL A;  2VVS A;  2D0T A;  5BMV E;  5LNK A;  4DV1 T;  5HEH A;  3UUL A;  4DUY T;  1CHU A;  3N9O A;  4L9I A;  4PK4 A;  2QVA A;  5L3F B;  3EUH A;  2LKG A;  2WDV A;  3LK4 2;  4JBW F;  4X65 T;  4WNK A;  3UU6 A;  2FJE A;  4M1P A;  4LF6 T;  3P50 A;  3EVY A;  2LLY A;  2DWG A;  3AVS A;  2XQ4 A;  3CX8 B;  5TAO A;  3AAI A;  3KDS E;  3PUV F;  5CA0 E;  4IIJ E;  5AQP B;  4K0K T;  5JRC B;  1NEN A;  5JR9 B;  3ZYM A;  2JQ9 A;  4UEL A;  2ACZ A;  3UU3 A;  2XQ7 A;  4X20 E;  4UVC B;  2KLQ A;  3ZC1 A;  5DJQ C;  2WDR A;  3IEE A;  2UXX B;  4Z90 A;  4DR2 T;  1AJ3 A;  3AE1 A;  5C2T A;  3EI0 A;  4A56 A;  3K3Q C;  4Z91 A;  5J2U E;  1VOM A;  5JDG A;  2W00 A;  4GYS A;  4AKI A;  3RI5 A;  4DND A;  1FMV A;  2WM9 A;  3I0O A;  2SPC A;  2XQ8 A;  2B76 A;  2W62 A;  3NRY A;  5FKY A;  1UUR A;  3ZN1 B;  4DV4 T;  4PJM A;  4JV5 T;  3MKD A;  3FBL A;  4H9O C;  2CBI A;  2IC9 A;  2EHO B;  5F3J A;  3TLS A;  4IDQ A;  5FVK A;  3ETU A;  4ERR A;  3KV5 A;  4IE7 A;  2YU1 A;  4ILU A;  2MPK A;  3Q5D A;  5CA1 E;  2H7V C;  5FNV E;  3HR0 A;  3K3N A;  5J1G A;  5ABF B;  2LSG A;  1KNR A;  3F57 A;  2LHR A;  3H37 A;  2MAW A;  3E0Z A;  3Q5X A;  1SUM B;  4LF9 T;  4DV0 T;  2V7I A;  5DQW A;  1DU2 A;  3UFE A;  2BZB A;  2XAG B;  4CQI A;  3L3P A;  4X1K E;  5EK3 A;  2KMF A;  5KXJ A;  4U3C A;  3PUY F;  3PUS A;  1IAP A;  5ETW A;  1HCI A;  2C5K T;  3O4X E;  4DID B;  1M62 A;  2LHN A;  3CQX C;  3U78 A;  5KX5 E;  2VKO A;  2W61 A;  2UUC T;  5A1L A;  1S35 A;  2WDQ A;  3JAD A;  3AEE A;  3KV4 A;  1N32 T;  4HFE A;  3P4R A;  4UVB B;  2BG9 C;  4QHO A;  4P09 A;  5AQO B;  3ANW A;  4NPP A;  4ZZC A;  3RRC A;  4ILB A;  4WYV A;  2X51 A;  3RF1 A;  4GKJ T;  3I1A A;  2EHO C;  3T1H T;  1FIO A;  4AQG A;  3A5X A;  4WZX A;  5LJN A;  2V7K A;  2J62 A;  2VB6 A;  5JDH A;  2QA7 A;  5L3E B;  5AQJ B;  2L3L A;  4CI1 B;  1U4Q A;  2QGS A;  1D1A A;  3F31 A;  2MTQ A;  4EED A;  2YOE A;  4YHH T;  3FZK B;  2JQH A;  3CK6 A;  5BR8 T;  3CVR A;  4YSZ A;  4JI8 T;  2CE7 A;  2J4G A;  4HFH A;  3ZMT B;  2RP4 A;  2Q9Q B;  2E5L T;  3ZC0 A;  2E5V A;  5AQH B;  2NTY A;  4KHZ F;  2HHH T;  2PTF A;  5FL1 A;  4OYK A;  3I0Q A;  5FY1 A;  2YK0 A;  2KSR A;  2XHE B;  3PU8 A;  3AE9 A;  3AE4 A;  4KHP T;  3PUW F;  3I9Y A;  2ZMA A;  1Y64 B;  3AXJ A;  3ONL C;  4KBM B;  3Q9D A;  2CCQ A;  4IL9 A;  2W4X A;  1HFA A;  2LKH A;  2CHO A;  3ZPO A;  1LKX A;  4O4I E;  3SFE A;  3BQI A;  4EB6 E;  2I6H A;  3AE7 A;  3Q2M A;  2CXF A;  3HKB E;  4EOZ B;  4P1N A;  4YJ3 E;  3ZMV B;  1O3X A;  2MBG A;  3QK6 A;  2VK9 A;  3X1D A;  3R84 B;  4O2A E;  5AQI B;  3ZSS A;  2V6Y B;  5LHH B;  4JI6 T;  4ZI2 C;  2LSJ A;  3K8P C;  4EIW A;  2VWA A;  1W9R A;  3VKH A;  4YTN A;  4ZI3 C;  4AKH A;  2ZM0 A;  4CXY A;  2DL1 A;  1B7T A;  4EZH A;  2Q9Q C;  3FZM B;  5LGU B;  4LF5 T;  2C0S A;  2CXL A;  2A9U A;  5AQG B;  5JH7 E;  3MJX A;  1IBM T;  5FMN A;  3AE2 A;  2J47 A;  2AE9 A;  4CN1 A;  3RQW A;  3C98 B;  3SFD A;  2ZLY A;  4CI2 B;  3ZKR A;  1UX5 A;  1HG2 A;  4TX5 A;  5LP6 E;  4UIG A;  3QC9 A;  3TLW A;  2D5U A;  4UF0 B;  3FZH B;  3TLU A;  2ACX A;  2UXC T;  3KVA A;  3H3A A;  1D0X A;  5IYZ E;  1HNW T;  4P0B A;  2GK9 A;  4TN7 B;  4MAL A;  3VRB A;  1UK5 A;  4EYU A;  3DP7 A;  1IBK T;  4IE5 A;  2HPL A;  1XNQ T;  4UV8 B;  4PJJ A;  4A5X A;  3CML A;  3T1Y T;  3BQL A;  4ZI3 D;  2W66 A;  3JAF A;  2V8S V;  5HEU A;  3P4Q A;  4L5G A;  4LMJ A;  3LK2 B;  2WBL A;  3M3Z B;  5HYA A;  3RYH E;  2A2F X;  3RHW A;  3RLF F;  2A72 A;  1BR1 A;  2VKD A;  1BR0 A;  2V5C A;  2LSY A;  3AE5 A;  2NWB A;  4IE0 A;  3ZT7 A;  4DMV A;  2V6X A;  3KBT A;  1X9B A;  2YIN A;  2H89 A;  4HWH A;  2CLY B;  2BVM A;  3DTO A;  3Q5E A;  2XQY A;  3O1I A;  3ZT6 A;  3W15 B;  1M7K A;  1FJG T;  2K5B B;  4U72 A;  3LBX B;  4E7Z A;  3QB5 A;  2WWV A;  4EEB A;  2NR4 A;  5FXZ A;  2VL0 A;  1ZP0 A;  5DAB A;  2IHR 1;  5CB4 E;  5LHG B;  5L3B B;  1W09 A;  2QRX A;  3WAK A;  2LE8 A;  4HFC A;  3VRA A;  5LBM A;  3ZJ1 A;  5KMG P;  4BJN A;  3IHR A;  4TZ4 C;  3LJC A;  3ZYK A;  2KND A;  5FVL A;  3SRZ A;  4PNI A;  1XDO A;  4HN9 A;  1OED A;  5LA6 E;  2VVN A;  5J0Z A;  2BKN A;  3LFM A;  2XY8 B;  4JUY A;  2PFV A;  2XTL A;  4PFO A;  3O1H A;  5JRC A;  3SOL A;  2CEA A;  2CLY C;  2YEV C;  3PUZ F;  2Z6E A;  5F5W A;  4IT4 A;  5JDL A;  2VUR A;  3B57 A;  3RX6 A;  2X0Y A;  4WBO A;  2C5I T;  4LML A;  3RYC E;  3NRX A;  1MMD A;  1ZHC A;  2JJ9 A;  3EHZ A;  3CX6 B;  3C4Z A;  3ONJ A;  2OA5 A;  4NXM T;  2ODU A;  2K48 A;  3N9L A;  2D2S A;  2IAK A;  1Y01 A;  5EK4 A;  3UUN A;  4AI6 A;  2K9A A;  3MXZ A;  3IF8 B;  2H88 A;  3CKD A;  4IDO A;  3RIF A;  3N9M A;  4O2B E;  4QWN B;  4XAX B;  4JI2 T;  4L0R A;  2B1E A;  3CQG B;  2BBH A;  4OYJ A;  3ZMZ B;  4Z8X A;  3NWI A;  4QX7 B;  3AAA B;  5FY7 A;  2WP9 A;  2R6G F;  4EZ4 A;  1N33 T;  3CPZ A;  4I0U A;  4IE6 A;  3ZMS B;  2BS2 A;  4LFB T;  1HTJ F;  2BDE A;  4LF4 T;  3UU4 A;  4QKN A;  4I43 B;  3C4X A;  4BA9 A;  3NZQ A;  5HXS A;  5LCY A;  3RKO A;  2BG9 B;  4AKR B;  5KDM C;  4P0A A;  2V7M A;  3SWH A;  2CMR A;  3R6N A;  3UUB A;  2X0H A;  5F8P A;  4MBQ A;  2HPJ A;  5JRE A;  1HNZ T;  5AQM B;  3EDU A;  2KT9 A;  4PFP A;  3JCF A;  5LHI B;  4Q25 A;  3AEC A;  3ZN0 B;  5JDM A;  2XAQ B;  1WYC A;  2CWY A;  2ZM6 T;  5EZY E;  2E9X A;  3G06 A;  3N2G E;  3ZCI A;  2I0M A;  2ZM2 A;  1J1J A;  3ONX A;  4YXD A;  5LOV E;  1NAF A;  4EGW A;  4G2A A;  4I4T E;  1IZN B;  2VQF T;  4FJO A;  4CI3 B;  2KIN B;  4IRE A;  4ZZB A;  2BS4 A;  4HE8 A;  3PUQ A;  2XPK A;  5IHY A;  2YDQ A;  5HEJ A;  1CUN A;  1E7P A;  2CHN A;  1HX1 B;  4X64 T;  4U2Z A;  4DO0 A;  1HF8 A;  1ZEE A;  3ESL A;  3AA7 B;  4AKG A;  5AQL B;  4ISS A;  1I94 T;  2YDS A;  1W0B A;  1OWA A;  4QH4 A;  3PDY A;  2XM2 A;  4DV2 T;  4H9P C;  4HKA A;  1Z0P A;  1D0Z A;  1VCT A;  3J9X 1;  2NW8 A;  4YLH A;  2X0L B;  4JI3 T;  3N9N A;  5LMU T;  2UUA T;  2YDR A;  2V26 A;  4DBR A;  3AE3 A;  5EK2 A;  1XZY A;  3HL6 A;  4JLE A;  1J5W A;  1UUS A;  5AQN B;  4ILC A;  1YD8 G;  2IW5 B;  4JI4 T;  5HXH A;  4YTP A;  3C64 A;  3AA0 B;  3UQ4 A;  4YHJ A;  3PTR B;  3WI3 A;  2OLT A;  1MIY A;  2VKH A;  3BQK A;  4N78 D;  3DJB A;  3PUA A;  1OXZ A;  4YSY A;  2AXD S;  2UUB T;  1YW0 A;  4O4J E;  3FXE B;  3ZCJ A;  5JDN A;  3N9Q A;  4DR1 T;  5LYJ E;  2I59 A;  5HEO A;  4AXP A;  2BS3 A;  2LRK A;  5FY0 A;  3B13 A;  4OK0 A;  4TNW A;  4U7I A;  3ZJ2 A;  4J2C A;  4NUV A;  4U74 A;  1IJ5 A;  2XQ5 A;  3RIU A;  1D1B A;  2LEH A;  3UUX B;  3SS1 A;  4DV3 T;  3ABV A;  3LK3 B;  2N9D A;  4UR9 A;  3K1S A;  4EAH A;  5LG4 A;  4YFS A;  3F2E A;  2WY2 A;  2E9X C;  2L9Q A;  3AAE B;  5FXV A;  1OED E;  2A3D A;  1IBL T;  4ASK A;  5CGM A;  3A8Y C;  5ABH A;  3N2O A;  3V5S A;  2JIW A;  2JRK A;  5AQU B;  5HCJ A;  3ZYL A;  3LSV A;  3BK9 A;  3RC3 A;  4BAY B;  1MMN A;  2UXN B;  4AQY T;  1J5E T;  1KF6 A;  5L3C B;  2UXD T;  5HXE A;  4CXX A;  1GQE A;  5DQV A;  4CN6 A;  3N9P A;  2WMN A;  2LSI A;  5LBQ B;  4UF0 A;  2V7L A;  4B3S T;  4OHF A;  4ZS3 A;  4YJ2 E;  5H6Q B;  4EV6 A;  2W2U A;  3OTO T;  2H3R A;  2LOS A;  3AB3 B;  4ZXL A;  2E9X D;  4TWH A;  4DUZ T;  3LDQ B;  4H9S E;  1MIW A;  1I6Z A;  2WMO A;  3HA4 A;  1IJ6 A;  1ZKE A;  2X9W A;  4QXB B;  2DI4 A;  1QUU A;  4YTM A;  3AEG A;  2KZ7 B;  5FYM A;  3QNU A;  3OKQ A;  4AQF A;  2WQY A;  4DBQ A;  2NP9 A;  3E22 E;  3OPC A;  1MMA A;  1T98 A;  4HFV A;  4ZOL E;  1XMQ T;  4GOU A;  3IA3 A;  4X66 T;  1W0A A;  3KVB A;  3KV6 A;  4H9N C;  4DV7 T;  4ZEY A;  2ZM8 A;  3PUR A;  2W67 A;  2VL8 A;  3M65 A;  3S4U A;  4QH5 A;  3L09 A;  2CRB A;  1MNE A;  3LG7 A;  3GA8 A;  2X68 A;  5AQK B;  4LMK A;  5HWY A;  4HGA A;  1KNP A;  1WFD A;  5AFU L;  4I55 E;  5HWX A;  2NTX A;  3O1J A;  1EZ3 A;  3ZLI A;  4I50 E;  4B3R T;  3CIR A;  4LF7 T;  2X67 A;  3O9X A;  4B3M T;  1NWM X;  4DR3 T;  2BBJ A;  3LBX A;  4IST A;  4TV9 E;  1U5P A;  3C50 A;  3UTK A;  3K3O A;  2M6B A;  2D0U A;  4JEH B;  1KK7 A;  3EAB A;  1QSD A;  2FJD A;  3QB5 K;  4PAG A;  2CA5 A;  2LJL A;  5L4H A;  4HFD A;  4JI0 T;  3PUX F;  4X1I E;  4DR7 T;  5J2T E;  2DWK A;  4H9Q C;  1V9D A;  1R8I A;  4XBF B;  3EDV A;  4NIQ A;  3NZP A;  1JNR A;  5LGN B;  4OFZ A;  3ZEF B;  2XAJ B;  4HWI B;  4DR4 T;  4C91 A;  2M67 A;  4DR5 T;  4KX6 A;  4KI0 F;  1JNZ A;  1HS7 A;  2PBI A;  4V1A v;  4PW8 A;  1HR0 T;  5JDF A;  3MK7 C;  3RYI E;  3MA9 A;  1XDP A;  2X9Y A;  3N2K E;  1SA0 E;  1G73 A;  5HXR A;  4PJN A;  1WRD A;  3CWZ B;  2PG8 A;  2ES0 A;  2JQK A;  5LMN T;  3P7I A;  4U33 A;  5ABG A;  4ADZ A;  3PV0 F;  2W63 A;  5JR9 A;  4GYR A;  3TLV A;  3L8R A;  4TV8 E;  1L0V A;  2X9H A;  2IDO B;  4B6X A;  2IC6 A;  2K3W A;  4MFR A;  2X66 A;  4ZHQ E;  2NOX A;  3RYF E;  4F8H A;  2E2A A;  3UUM A;  3CX7 B;  4AKL A;  1YKH B;  4IDZ A;  5HEG A;  2WZH A;  4IDN A;  4X5T A;  2F4V T;  1BR4 A;  1MND A;  2BG9 A;  2CXD A;  2IML A;  1OED B;  5AQS B;  4IL4 A;  5L3D B;  5L4E A;  4JEU B;  2PJQ A;  4LFA T;  2DLR A;  3RRW A;  2EHO A;  4YY3 T;  3P4W A;  1XMO T;  3GN5 B;  3ZST A;  2JMK A;  2XSA A;  4EXT A;  2K24 A;  3UU5 A;  3HI2 A;  4X62 T;  2E8I A;  5ABF A;  2OV9 A;  4DV5 T;  5IUX A;  2JPF A;  4MLK A;  2XQ6 A;  3FZL B;  5JTG A;  4QXC B;  4GKK T;  1WLX A;  4TWF A;  2XAS B;  2V7J A;  2HN2 A;  4U2Y A;  3ZT5 A;  2BVL A;  2XSB A;  3AEB A;  3H3M A;  3OVU A;  1WR0 A;  5JQG E;  3AVR A;  4PK6 A;  3AE6 A;  3AA6 B;  3PU3 A;  2WS3 A;  4AIS A;  4O4H E;  5L2L A;  4ZS2 A;  4LF8 T;  4CXW A;  2ODV A;  3FHN A;  3GMI A;  5LXT E; 
#chains in the Genus database with same CATH homology
 4DR2 T;  4JI2 T;  4DUZ T;  4X64 T;  1N36 T;  1HNX T;  1HNW T;  4JI0 T;  4DV3 T;  4DR7 T;  2UXB T;  1I94 T;  1IBK T;  1N34 T;  1N33 T;  2F4V T;  4GKJ T;  4JI1 T;  4DV4 T;  3T1H T;  4DV2 T;  4LFB T;  1XNQ T;  4JV5 T;  4DR4 T;  1IBL T;  4LF4 T;  4DV1 T;  4JI3 T;  5LMU T;  2UUA T;  4DR5 T;  4LFA T;  4DUY T;  4DR6 T;  3T1Y T;  1XMQ T;  4X66 T;  4JYA T;  4NXN T;  4YY3 T;  1XMO T;  4JI6 T;  4DV7 T;  1HR0 T;  4JI4 T;  1HNZ T;  4X65 T;  4YHH T;  4AQY T;  4X62 T;  1J5E T;  4LF6 T;  4LFC T;  4LF9 T;  2UXD T;  4DV0 T;  5BR8 T;  4LF5 T;  2ZM6 T;  4JI8 T;  4DV5 T;  2UUB T;  4GKK T;  2UU9 T;  2E5L T;  1IBM T;  4DV6 T;  4K0K T;  4B3R T;  5LMN T;  4LF7 T;  4B3M T;  4DR3 T;  1XNR T;  2HHH T;  4DR1 T;  4NXM T;  2VQF T;  2VQE T;  4B3S T;  4OX9 T;  2UUC T;  4B3T T;  4LF8 T;  3OTO T;  1FJG T;  4JI5 T;  4JI7 T;  4KHP T;  5IWA T;  2UXC T;  1N32 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...