4JI7T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji7T00
4X64T 4OX9T 4JI4T 5LMNT 4DR2T 1N36T 4GKKT 4DV2T 4JV5T 1N32T 4JI5T 4DV0T 4DR5T 1IBLT 4DV4T 4DUYT 4JI2T 4LF8T 1IBMT 1HNWT 2UUAT 5LMUT 4B3RT 4DR1T 3T1HT 1I94T 1XMQT 2UUCT 4X65T 4B3ST 4DR3T 4LF9T 2UXCT 5BR8T 1HNZT 4LFCT 2ZM6T 4NXMT 2UXBT 1IBKT 4KHPT 4JI3T 2HHHT 4LF5T 4DV6T 4B3TT 1J5ET 1HNXT 2UU9T 4DUZT 3OTOT 4GKJT 1N34T 4YHHT 4LFBT 2UUBT 4X62T 4YY3T 2VQFT 4AQYT 4DR4T 4DV1T 1XMOT 4X66T 4NXNT 2F4VT 4JI6T 5IWAT 4DV5T 4JI7T 4JI8T 1N33T 4DV3T 4LFAT 2VQET 4JI1T 4K0KT 4B3MT 3T1YT 1XNRT 1XNQT 2UXDT 4JI0T 4DV7T 4LF4T 2E5LT 4JYAT 4DR6T 1FJGT 1HR0T 4LF7T 4LF6T 4DR7T
chains in the Genus database with same CATH superfamily
2BKPA 5AQHB 1OXZA 3OKQA 3N9MA 5DQWA 2CA5A 4U2ZA 3AA7B 3OBVE 4IGUA 4IE7A 4EV6A 4XZCA 2PG8A 4TX5A 5L3DB 2XHEB 4JI4T 4L0RA 2H88A 3RH3A 4UF0A 2L9QA 4MLKA 4DV7T 5JRCA 2XJ7A 3C98B 4BAYB 3UFGA 4I50E 4X1YE 1N32T 3KV6A 4NUUA 4LMKA 1MNEA 2P9BA 4I55E 5AQVB 4JI5T 3N2KE 5IUXA 2D9DA 5HWXA 4N78D 3JADA 5LGNB 3ZN1B 4GK0E 3SRZA 2HN1A 4ZZBA 1WRDA 3C4WA 5IYZE 2XASB 4A98A 2UUAT 4NIQA 2CLYB 1S94A 4OFZA 2BG9B 1MMGA 1VOMA 2IIUA 4B3RT 5FXWA 4DR1T 2WQYA 3AE4A 4JEUB 4O4JE 3T1HT 2CXFA 2W2UA 1ZOYA 3DJBA 3UU8A 2LJLA 3P4SA 2CLYC 3RIFA 3U78A 2N9DA 4X1KE 3RHWA 3K3OA 2UUCT 3AAEB 2JQKA 4ZI2C 2KT9A 2YEVC 1WYBA 1X79A 2K48A 3CVRA 5LJMA 4FI5A 2WDRA 3PU3A 3CX6B 5JQGE 3EDVA 1UK5A 4DR3T 2WP9A 5FXZA 5AQLB 1XWMA 2JQQA 3O1JA 4IE5A 1HNZT 4LFCT 3P50A 5L4EA 4IL9A 3PUXF 3SWHA 2ZM6T 1FMVA 5J2UE 1IBKT 1UGOA 3RIUC 4A56A 2HHHT 4HKAA 5L3EB 1VCTA 3ZMZB 2C0SA 1HCIA 5HEHA 3ZT7A 3QK6A 5LOVE 4PAGA 2ZM8A 3MK7C 2XSBA 4AXPA 2FJBA 2VKHA 5FKYA 3HR0A 2WU2A 3EI0A 3IF8B 5ETWA 4XBFB 3JC6C 2RPAA 3NZPA 4HFEA 3F31A 5FNVE 5JR9A 5LGUB 1N34T 2XQ8A 4HN9A 2LM2A 4O4LE 1YQ3A 2XQ3A 5JR9B 4TNWA 4IIJE 2ZLYA 2UXNB 4IE4A 5HAXA 3L39A 4DMWA 2UUBT 5L3FB 3UU4A 2XM2A 1XDOA 1UURA 3Q5XA 4X62T 5H6QB 5EK2A 5AQMB 2VQFT 3QC9A 2YKSA 3RYIE 2KMFA 4U3CA 4DV1T 3KDSE 5FL0A 2JIWA 1M7KA 4X66T 2XZEA 4HWFA 4ZI3D 1D1AA 3FBZA 3EDUA 4UV8B 1D1BA 3RYHE 2MAWA 3AA0B 5IHYA 4AQFA 3HL6A 4H9OC 2YU2A 2X0YA 4YJ3E 5FYMA 3P8CD 5JRCB 3EAMA 3P7IA 4ANJA 4DV5T 4EB6E 5F8PA 3PUVF 2XQYA 4JI7T 3PUWF 1US7B 1ZV4X 3NRYA 2YDSA 2QGSA 2YN6A 3AEGA 3LBXA 2C5KT 3O4XE 3PURA 2BG9C 2W67A 4H63H 3M65A 4XAXB 5CA1E 4LFAT 2JRKA 3AECA 2KINB 3VR9A 1SE7A 3Q5EA 1ZP0A 3CK6A 2WMNA 1IJ6A 2WDVA 2XM1A 2M67A 4QKNA 3IBPA 5C3JA 4K0KT 5AQUB 3A5XA 4OYJA 2FJDA 2MPKA 3AVSA 2HH7A 4HFHA 4H63V 2BVMA 4QH1A 4QX7B 4TV9E 3RC8A 4KUMB 4CZZB 1UCUA 1ZKEA 3AA6B 1BR2A 2KLQA 3PUGA 2G0UA 4ILBA 2CXLA 1O3XA 4LMLA 2RP4A 1IJ5A 2V6YA 4HE8A 4IDPA 5C2TA 5JVDE 3TKLB 1LRZA 3MZKB 3C4XA 4ZI3C 1D0XA 3RKGA 3UU5A 3LSVA 1WFDA 3KV4A 3DP7A 3VHLA 4DIDB 4YTPA 4JYAT 2VWAA 4AKIA 2LHNA 2YINA 4MBQA 3KV9A 3ZC1A 4QH4A 5L3BB 2V5DA 2VURA 4LF7T 1NAFA 3QB5K 3V5UA 2LE8A 2W63A 4LF6T 3TLSA 2XAFB 5CA0E 2CXDA 4IT4A 3M3ZB 2VKDA 4DBQA 2CHOA 3UQ4A 4UEMA 2FJAA 2WAUA 3RIAA 4NPPA 2V26A 2WU5A 1J5WA 2XTLA 3WAJA 2JMHA 2V6XA 4IL4A 1UUSA 4O2BE 5J2TE 1FEWA 2XAHB 4HEAA 3RC3A 4BJMA 2XAQB 1Y01A 2K24A 1T7SA 2Q9QA 4HWDA 5DJQC 5AQKB 2LRLA 3CX8B 3OPCA 4X20E 4QXBB 5E0OA 5LCYA 1W0AA 4HFDA 3GMIA 5CFBA 2JJ9A 4F6RC 2XQ5A 2CCQA 4H9RC 3ETUA 4TWHA 1D1CA 1B7TA 2LRKA 2YK0A 2IUBA 3NVOA 3TLVA 4QXHB 5LBQB 3ANWA 3L3PA 3CQXC 3PUZF 4AKLA 3AEAA 3MJXA 2NW8A 2VL0A 3PJAJ 3PUAA 2Q9QD 5AQNB 2L8KA 5JTGA 2BBHA 1HNWT 3UFEA 2V1DB 4EAHA 5AQFB 5HXSA 4TNVA 2V7IA 2WWUA 2IW5B 1T72A 4ZXLA 3F2EA 5FL1A 2V5CA 3PE0A 5AQGB 3UTKA 2BG9A 2BKOA 4EIWA 2X9HA 4GIWA 1D0ZA 4YSZA 1XMQT 4HGAA 4CN4A 4X65T 5F3JA 3FZKB 2X9YA 2V7JA 1KK7A 3UU3A 3G06A 3ZLIA 3N9OA 3CKDA 5FY7A 2KWHA 2BBJA 4P1NA 3ONJA 2WM9A 2UXCT 4QHOA 1SHZC 3KBUA 5KXJA 2VB6A 5FVKA 5BR8T 2HPLA 4Z91A 5L3CB 5EZYE 1W9RA 3NBXX 3UT5E 3IEEA 4AISA 5CGMA 3MKDA 3VRAA 4CXWA 3MACA 3AB3B 3X1DA 3ZT5A 2UXXB 4WNKA 1NEKA 4DV6T 3VR8A 1HX8A 3PUSA 4PK6A 4EZ4A 5AQOB 3UULA 2DLRA 5CB4E 2V7MA 1W0BA 2X9XA 4GYSA 4WW0A 5HYAA 3OTOT 4CI2B 2CM0A 5JR9C 1XZYA 3Q2MA 1Z8UA 2H7VC 5LBMA 3IHRA 3CX7B 4CI1B 2W4XA 3AE3A 4YHHT 1E2AA 2DWGA 4DUZT 4P0BA 1HFAA 1DU2A 4IDZA 3ZCJA 5HXRA 2D2SA 4DMVA 5ABFB 5J0ZA 2M6BA 3E22E 4JEHB 5AQSB 4YJ2E 4YLHA 4YY3T 3FBLA 1I6ZA 2D0UA 2JMKA 4UVBB 5AQRB 4H9NC 2XY8B 1JNZA 2IAKA 1E1HB 3CWZB 5AFUL 3QNUA 3VKHA 2A72A 2KWIB 4LMJA 5TAOA 5KDMC 4ZEYA 1OEDE 4ERRA 1NENA 2DNXA 5FMNA 3BQIA 1MMAA 4IDQA 3VRBA 5L3GB 2EHOC 2NWBA 3FZLB 3LFMA 3BQKA 3IA3A 4HWCA 4ILUA 3V5SA 4OYKA 3I0OA 2LOSA 4IE6A 3RX6A 3ZYKA 3J7Yq 2PFVA 4HWIB 2NTXA 1N33T 1IAPA 2BS4A 5CJ5A 1W09A 5FY0A 4AIUA 2NW9A 4H9SE 2W61A 2D5UA 5HXHA 4DBRA 2ZM0A 3FZFB 2DL1A 3FXDB 3RRCA 5JH7E 2VQET 4JI1T 4EGWA 2ZMAA 3U3IA 2J62A 2NTYA 4B3MT 3TLWA 3L8RA 1OEDB 1XNRT 1XNQT 3SFEA 2UXDT 2I59A 2E2AA 5HWYA 3ZKRA 5JDMA 1OWAA 4Q25A 3ZMVB 3GWHA 3ZSSA 5LJNA 2LT3A 3CPZA 4MALA 4KP3C 3NKZA 4Z8XA 3RRWA 2EHOB 4Z90A 3ZMTB 2E5LT 2WDQA 4HTEA 4A97A 2WBLA 4DR6T 3LK42 4JUYA 2CHNA 2CBJA 4PJNA 3P4QA 1JNRA 3AEBA 4WBOA 2A2FX 1ZEEA 2XQ4A 2A9UA 1WCRA 2XSAA 1MIVA 3KV5A 4GYRA 4PJMA 4U31A 3ZSTA 5JDHA 2X67A 1HG2A 2WZHA 5L2LA 5LHIB 4KX6A 4QXCB 2VKJA 3DTOA 4H9QC 3I1AA 3Q5DA 3AXJA 4K0UA 1YW0A 5LG4A 2IMLA 1LKXA 3ZPOA 4UVAB 4X64T 5EK4A 5JDLA 2HN2A 5AQTB 4PJJA 4E7ZA 3E0ZA 3OYXA 3ETVA 4PFOA 2C5IT 4PW8A 4CN6A 1KF6A 5LA6E 4DR2T 3E08A 5L4HA 3AE6A 2HPJA 3ANWB 1QSDA 3Q9DA 4UF0B 5F5WA 3R6NA 4U72A 3ZJ1A 4JBWF 4U7IA 5HEUA 4C91A 4IHJE 4DV0T 4DR5T 1IBLT 5ABEA 1MIWA 3RI5A 5AQIB 2BKNA 3ZN0B 4O8SA 4JI2T 1T8BA 2V7LA 3JAEA 3NRXA 4ZS3A 1HTJF 1IBMT 4JI0T 2Z6EA 4NUVA 5A1LA 1U5PA 2FBWA 3SFDA 5LYJE 2FJEA 3B5MA 1MIYA 5BMVE 5L47A 4EEBA 2B76A 2W66A 3UUMA 2H89A 2E9XA 1I94T 5FXXA 4ZZCA 3UQ7A 2NOXA 1WYCA 2QRXA 2ODVA 2WSSV 5LG3A 4CXYA 4HWHA 5LHGB 2E9XB 3LJCA 4JLEA 1V9DA 2X9WA 4B3ST 1UX4A 3LBXB 5HEGA 4ISTA 2E8IA 1GQEA 1T98A 2BDEA 4PK4A 4YTMA 5FP3A 3R84B 2X0LB 4L5GA 4AQGA 4ASKA 3JCFA 5GONE 3AEFA 3FB2A 3ZC0A 3UUXB 3AA1B 2CBIA 3VU7H 4TV8E 3QUJA 3AE9A 4NXMT 5FVLA 4PK5A 4WYVA 3RYFE 3J9X1 2CMRA 3PJAA 3P4RA 3EHZA 1CHUA 3Q5WA 4YTNA 3TLUA 1X9BA 2DHRA 1KNZA 3NZQA 2K9AA 2LSIA 2YOEA 3K3NA 2CE7A 2L3LA 4IDOA 2CEAA 4C90A 1HNXT 3VKGA 5AQQB 5J1GA 4BJNA 4PFPA 2AE9A 2LSJA 3AEDA 3LK2B 3PDYA 1Z0PA 2Q9QB 4ZI7E 3C50A 4KMCA 2VASA 4QX8B 3H3AA 3ABVA 1D0YA 5M4YA 2DCFA 3CMLA 3AAIA 3ZEFB 1WLXA 4GOUA 4UIGA 1XDPA 4YT0A 4E7SA 4P09A 3FXEB 5JDFA 3SOLA 2PJQA 4EYUA 5LXTE 3GN5B 4YFSA 4ZHQE 1HX1B 4F8HA 2W00A 3WI3A 1XMOT 3I9YA 2W0GA 5EK3A 4ADZA 1WR0A 2X0HA 1HG5A 3KINB 1QLBA 3B13A 2C5JA 3K3QC 4KHZF 4JI6T 3OVUA 3B57A 2LEHA 2LKGA 3EUHA 3FHNA 5AQJB 4JI8T 2Q9QC 4UXNB 4CQIA 3QB5A 4QWNB 1SUMB 3HKDE 5FY1A 4DV3T 3A7MA 5LHHB 3RLFF 4A5XA 3HKBE 3AEEA 2IHR1 3KBTA 1ZHCA 2KZ7B 5DQVA 2PTFA 1SA0E 2FUPA 2LSGA 3WAKA 5HXEA 5LNKA 3ZT6A 1KFYA 2A3DA 2J47A 3O1HA 3D0TA 4KI0F 4ILAA 3N9NA 2NR4A 1MMNA 1OEDA 2AXDS 1KNRA 1WR6A 1FIOA 2OA5A 2XQAA 3AE2A 3K8PC 3O1IA 2CPTA 2E5VA 4GK5E 3ZMSB 3O9XA 1U4QA 2Y6XA 3RQUA 4OHFA 3TLTA 5JREA 2JQ9A 3C64A 1FJGT 2YU1A 4ILCA 1L0VA 4WBNE 1HS7A 1LVKA 2VK9A 2XUEA 2XQ7A 3HA4A 3JC6D 3QOFA 2WY2A 4ZS2A 4HFCA 1CUNA 3P4PA 2VL8A 4H9PC 2MBGA 2X68A 3EVYA 2N2NA 4X5TA 3UUNA 4P0AA 4CXXA 4IE0A 2QA7A 2QVAA 2V7KA 3KVAA 2LLYA 2DWKA 4UV9B 2X66A 4OX9T 4HFVA 4AI6A 2BVLA 4TWFA 3T8OA 5HEOA 3C4ZA 3PUQA 2PBIA 1Y64B 3FZHB 5LMNT 2IC9A 2NW7A 3N2GE 1N36T 3LK3B 4ZI2D 4GKKT 5ABFA 1OEDC 2K3WA 4DV2T 2ACZA 1LVFA 2I6HA 5KX5E 4AKGA 4G63A 4AQFC 3AE5A 4ZOLE 5HCMA 1AJ3A 4DUYT 2MTQA 2X51A 2BZBA 4LF8T 1QUUA 4DNDA 3KVBA 3HKEE 5LMUT 5HXCA 3ZCIA 4L9IA 4J2CA 4EZHA 3RQWA 2WZIA 2EHOD 4M1PA 1NWMX 3H37A 1KNPA 4O4HE 4U33A 4DO0A 4BA9A 2VVNA 4EOZB 2IDOB 2H3RA 3I0QA 3ONLC 4YSXA 4AKHA 3RGLA 3PTRB 3CIRA 2BG9E 4X1IE 4IDNA 2V8SV 3N9LA 2XQ9A 4IREA 2XAGB 4PJLA 2CRBA 5KMGP 2ES0A 2JQHA 4HFBA 3RKOA 2LSKA 3JAFA 4LF9T 1YD8G 2WMOA 2LSYA 4O2AE 2YDRA 4DVDA 5HEJA 5JDNA 3ZYLA 1IZNB 3RIUA 3UU6A 1S35A 2UXBT 3RPUA 4KHPT 2KSRA 3A8YC 3N9QA 4YXDA 4JI3T 1YXRA 3PV0F 4YHJA 3OYZA 4LF5T 2MOZA 2DI4A 2I0MA 5LP6E 2J1DG 2M6IA 4B3TT 2KXPB 1YQ4A 2V6YB 1J5ET 1YKEB 3KFWX 3HI2A 4CI3B 2LHRA 2LOPA 2BS3A 2UU9T 4EXTA 4TWDA 4GKJT 1VCSA 2YDQA 3GA8A 3CQCB 4TUYE 3SS1A 3N5LA 3PU8A 2LM9A 4FJOA 5H6RB 4MFRA 4AKRB 2N1GA 4I0UA 4UR9A 2IC6A 1UX5A 4MHCA 2J4GA 4LFBT 4V1Av 4COFA 2LKHA 4TN7B 3F57A 5FXVA 3UUBA 4AQYT 2WS3A 2H7OA 4PNIA 3AXJB 4DR4T 2CWOA 4I43B 2GK9A 4QH5A 3GN5A 5AQPB 4I4TE 3OJAA 3S4UA 5ADXL 4NXNT 4JV5T 2F4VT 2ACXA 2XAJB 4O4IE 3PUYF 1M62A 4KBMB 5C8YE 2ODUA 2W62A 3RYCE 5IWAT 2VKOA 1J1JA 3ESLA 2ZM2A 1MMDA 1R8IA 4UVCB 3ZMUB 2R6GF 1BR1A 2CWYA 3MA9A 4TZ4C 1E7PA 2QYWA 2WB5A 3MXZA 4UELA 1EZ3A 2K5BB 3C51A 1G73A 5ABHA 2E9XC 4CN1A 2OV9A 4U2YA 2XPKA 5ABGA 3W15B 4B6XA 5JDQA 3P4WA 1MNDA 2D0TA 2WWVA 3FZMB 5LGTB 3K1SA 3BK9A 3AE7A 3RF1A 3AE8A 3AE1A 3CQGB 4G2AA 1FMWA 1VRBA 1BR0A 2Y48B 2XQ6A 3BQLA 3I9WA 3T1YT 1YKHB 2OLTA 3AVRA 2MYSA 4U74A 2JPFA 1HF8A 2Y8DA 1G8XA 3HKCE 3AAAB 2KNDA 4ISSA 4EEDA 1KEYA 4WZXA 4LF4T 3EABA 4OK0A 5HCJA 2WCAA 2VVSA 3LDQB 1H7CA 3N9PA 5JDGA 2EHOA 3H3MA 1HR0T 2BS2A 4EYYR 2RA1A 4YSYA 3L09A 3ONXA 5LB7B 3ZJ2A 2B1EA 3N2OA 3NWIA 4HFIA 1BR4A 4DR7T 3LG7A 2SPCA 2E9XD 5DABA 4DV4T 4U7YA 3ZYMA 2NP9A
chains in the Genus database with same CATH topology
4X64T 4OX9T 4JI4T 5LMNT 4DR2T 1N36T 4GKKT 4DV2T 4JV5T 1N32T 4JI5T 4DV0T 4DR5T 1IBLT 4DV4T 4DUYT 4JI2T 4LF8T 1IBMT 1HNWT 2UUAT 5LMUT 4B3RT 4DR1T 3T1HT 1I94T 1XMQT 2UUCT 4X65T 4B3ST 4DR3T 4LF9T 2UXCT 5BR8T 1HNZT 4LFCT 2ZM6T 4NXMT 2UXBT 1IBKT 4KHPT 4JI3T 2HHHT 4LF5T 4DV6T 4B3TT 1J5ET 1HNXT 2UU9T 4DUZT 3OTOT 4GKJT 1N34T 4YHHT 4LFBT 2UUBT 4X62T 4YY3T 2VQFT 4AQYT 4DR4T 4DV1T 1XMOT 4X66T 4NXNT 2F4VT 4JI6T 5IWAT 4DV5T 4JI7T 4JI8T 1N33T 4DV3T 4LFAT 2VQET 4JI1T 4K0KT 4B3MT 3T1YT 1XNRT 1XNQT 2UXDT 4JI0T 4DV7T 4LF4T 2E5LT 4JYAT 4DR6T 1FJGT 1HR0T 4LF7T 4LF6T 4DR7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 T;  4OX9 T;  4JI4 T;  5LMN T;  4DR2 T;  1N36 T;  4GKK T;  4DV2 T;  4JV5 T;  1N32 T;  4JI5 T;  4DV0 T;  4DR5 T;  1IBL T;  4DV4 T;  4DUY T;  4JI2 T;  4LF8 T;  1IBM T;  1HNW T;  2UUA T;  5LMU T;  4B3R T;  4DR1 T;  3T1H T;  1I94 T;  1XMQ T;  2UUC T;  4X65 T;  4B3S T;  4DR3 T;  4LF9 T;  2UXC T;  5BR8 T;  1HNZ T;  4LFC T;  2ZM6 T;  4NXM T;  2UXB T;  1IBK T;  4KHP T;  4JI3 T;  2HHH T;  4LF5 T;  4DV6 T;  4B3T T;  1J5E T;  1HNX T;  2UU9 T;  4DUZ T;  3OTO T;  4GKJ T;  1N34 T;  4YHH T;  4LFB T;  2UUB T;  4X62 T;  4YY3 T;  2VQF T;  4AQY T;  4DR4 T;  4DV1 T;  1XMO T;  4X66 T;  4NXN T;  2F4V T;  4JI6 T;  5IWA T;  4DV5 T;  4JI7 T;  4JI8 T;  1N33 T;  4DV3 T;  4LFA T;  2VQE T;  4JI1 T;  4K0K T;  4B3M T;  3T1Y T;  1XNR T;  1XNQ T;  2UXD T;  4JI0 T;  4DV7 T;  4LF4 T;  2E5L T;  4JYA T;  4DR6 T;  1FJG T;  1HR0 T;  4LF7 T;  4LF6 T;  4DR7 T; 
#chains in the Genus database with same CATH topology
 2BKP A;  5AQH B;  1OXZ A;  3OKQ A;  3N9M A;  5DQW A;  2CA5 A;  4U2Z A;  3AA7 B;  3OBV E;  4IGU A;  4IE7 A;  4EV6 A;  4XZC A;  2PG8 A;  4TX5 A;  5L3D B;  2XHE B;  4JI4 T;  4L0R A;  2H88 A;  3RH3 A;  4UF0 A;  2L9Q A;  4MLK A;  4DV7 T;  5JRC A;  2XJ7 A;  3C98 B;  4BAY B;  3UFG A;  4I50 E;  4X1Y E;  1N32 T;  3KV6 A;  4NUU A;  4LMK A;  1MNE A;  2P9B A;  4I55 E;  5AQV B;  4JI5 T;  3N2K E;  5IUX A;  2D9D A;  5HWX A;  4N78 D;  3JAD A;  5LGN B;  3ZN1 B;  4GK0 E;  3SRZ A;  2HN1 A;  4ZZB A;  1WRD A;  3C4W A;  5IYZ E;  2XAS B;  4A98 A;  2UUA T;  4NIQ A;  2CLY B;  1S94 A;  4OFZ A;  2BG9 B;  1MMG A;  1VOM A;  2IIU A;  4B3R T;  5FXW A;  4DR1 T;  2WQY A;  3AE4 A;  4JEU B;  4O4J E;  3T1H T;  2CXF A;  2W2U A;  1ZOY A;  3DJB A;  3UU8 A;  2LJL A;  3P4S A;  2CLY C;  3RIF A;  3U78 A;  2N9D A;  4X1K E;  3RHW A;  3K3O A;  2UUC T;  3AAE B;  2JQK A;  4ZI2 C;  2KT9 A;  2YEV C;  1WYB A;  1X79 A;  2K48 A;  3CVR A;  5LJM A;  4FI5 A;  2WDR A;  3PU3 A;  3CX6 B;  5JQG E;  3EDV A;  1UK5 A;  4DR3 T;  2WP9 A;  5FXZ A;  5AQL B;  1XWM A;  2JQQ A;  3O1J A;  4IE5 A;  1HNZ T;  4LFC T;  3P50 A;  5L4E A;  4IL9 A;  3PUX F;  3SWH A;  2ZM6 T;  1FMV A;  5J2U E;  1IBK T;  1UGO A;  3RIU C;  4A56 A;  2HHH T;  4HKA A;  5L3E B;  1VCT A;  3ZMZ B;  2C0S A;  1HCI A;  5HEH A;  3ZT7 A;  3QK6 A;  5LOV E;  4PAG A;  2ZM8 A;  3MK7 C;  2XSB A;  4AXP A;  2FJB A;  2VKH A;  5FKY A;  3HR0 A;  2WU2 A;  3EI0 A;  3IF8 B;  5ETW A;  4XBF B;  3JC6 C;  2RPA A;  3NZP A;  4HFE A;  3F31 A;  5FNV E;  5JR9 A;  5LGU B;  1N34 T;  2XQ8 A;  4HN9 A;  2LM2 A;  4O4L E;  1YQ3 A;  2XQ3 A;  5JR9 B;  4TNW A;  4IIJ E;  2ZLY A;  2UXN B;  4IE4 A;  5HAX A;  3L39 A;  4DMW A;  2UUB T;  5L3F B;  3UU4 A;  2XM2 A;  1XDO A;  1UUR A;  3Q5X A;  4X62 T;  5H6Q B;  5EK2 A;  5AQM B;  2VQF T;  3QC9 A;  2YKS A;  3RYI E;  2KMF A;  4U3C A;  4DV1 T;  3KDS E;  5FL0 A;  2JIW A;  1M7K A;  4X66 T;  2XZE A;  4HWF A;  4ZI3 D;  1D1A A;  3FBZ A;  3EDU A;  4UV8 B;  1D1B A;  3RYH E;  2MAW A;  3AA0 B;  5IHY A;  4AQF A;  3HL6 A;  4H9O C;  2YU2 A;  2X0Y A;  4YJ3 E;  5FYM A;  3P8C D;  5JRC B;  3EAM A;  3P7I A;  4ANJ A;  4DV5 T;  4EB6 E;  5F8P A;  3PUV F;  2XQY A;  4JI7 T;  3PUW F;  1US7 B;  1ZV4 X;  3NRY A;  2YDS A;  2QGS A;  2YN6 A;  3AEG A;  3LBX A;  2C5K T;  3O4X E;  3PUR A;  2BG9 C;  2W67 A;  4H63 H;  3M65 A;  4XAX B;  5CA1 E;  4LFA T;  2JRK A;  3AEC A;  2KIN B;  3VR9 A;  1SE7 A;  3Q5E A;  1ZP0 A;  3CK6 A;  2WMN A;  1IJ6 A;  2WDV A;  2XM1 A;  2M67 A;  4QKN A;  3IBP A;  5C3J A;  4K0K T;  5AQU B;  3A5X A;  4OYJ A;  2FJD A;  2MPK A;  3AVS A;  2HH7 A;  4HFH A;  4H63 V;  2BVM A;  4QH1 A;  4QX7 B;  4TV9 E;  3RC8 A;  4KUM B;  4CZZ B;  1UCU A;  1ZKE A;  3AA6 B;  1BR2 A;  2KLQ A;  3PUG A;  2G0U A;  4ILB A;  2CXL A;  1O3X A;  4LML A;  2RP4 A;  1IJ5 A;  2V6Y A;  4HE8 A;  4IDP A;  5C2T A;  5JVD E;  3TKL B;  1LRZ A;  3MZK B;  3C4X A;  4ZI3 C;  1D0X A;  3RKG A;  3UU5 A;  3LSV A;  1WFD A;  3KV4 A;  3DP7 A;  3VHL A;  4DID B;  4YTP A;  4JYA T;  2VWA A;  4AKI A;  2LHN A;  2YIN A;  4MBQ A;  3KV9 A;  3ZC1 A;  4QH4 A;  5L3B B;  2V5D A;  2VUR A;  4LF7 T;  1NAF A;  3QB5 K;  3V5U A;  2LE8 A;  2W63 A;  4LF6 T;  3TLS A;  2XAF B;  5CA0 E;  2CXD A;  4IT4 A;  3M3Z B;  2VKD A;  4DBQ A;  2CHO A;  3UQ4 A;  4UEM A;  2FJA A;  2WAU A;  3RIA A;  4NPP A;  2V26 A;  2WU5 A;  1J5W A;  2XTL A;  3WAJ A;  2JMH A;  2V6X A;  4IL4 A;  1UUS A;  4O2B E;  5J2T E;  1FEW A;  2XAH B;  4HEA A;  3RC3 A;  4BJM A;  2XAQ B;  1Y01 A;  2K24 A;  1T7S A;  2Q9Q A;  4HWD A;  5DJQ C;  5AQK B;  2LRL A;  3CX8 B;  3OPC A;  4X20 E;  4QXB B;  5E0O A;  5LCY A;  1W0A A;  4HFD A;  3GMI A;  5CFB A;  2JJ9 A;  4F6R C;  2XQ5 A;  2CCQ A;  4H9R C;  3ETU A;  4TWH A;  1D1C A;  1B7T A;  2LRK A;  2YK0 A;  2IUB A;  3NVO A;  3TLV A;  4QXH B;  5LBQ B;  3ANW A;  3L3P A;  3CQX C;  3PUZ F;  4AKL A;  3AEA A;  3MJX A;  2NW8 A;  2VL0 A;  3PJA J;  3PUA A;  2Q9Q D;  5AQN B;  2L8K A;  5JTG A;  2BBH A;  1HNW T;  3UFE A;  2V1D B;  4EAH A;  5AQF B;  5HXS A;  4TNV A;  2V7I A;  2WWU A;  2IW5 B;  1T72 A;  4ZXL A;  3F2E A;  5FL1 A;  2V5C A;  3PE0 A;  5AQG B;  3UTK A;  2BG9 A;  2BKO A;  4EIW A;  2X9H A;  4GIW A;  1D0Z A;  4YSZ A;  1XMQ T;  4HGA A;  4CN4 A;  4X65 T;  5F3J A;  3FZK B;  2X9Y A;  2V7J A;  1KK7 A;  3UU3 A;  3G06 A;  3ZLI A;  3N9O A;  3CKD A;  5FY7 A;  2KWH A;  2BBJ A;  4P1N A;  3ONJ A;  2WM9 A;  2UXC T;  4QHO A;  1SHZ C;  3KBU A;  5KXJ A;  2VB6 A;  5FVK A;  5BR8 T;  2HPL A;  4Z91 A;  5L3C B;  5EZY E;  1W9R A;  3NBX X;  3UT5 E;  3IEE A;  4AIS A;  5CGM A;  3MKD A;  3VRA A;  4CXW A;  3MAC A;  3AB3 B;  3X1D A;  3ZT5 A;  2UXX B;  4WNK A;  1NEK A;  4DV6 T;  3VR8 A;  1HX8 A;  3PUS A;  4PK6 A;  4EZ4 A;  5AQO B;  3UUL A;  2DLR A;  5CB4 E;  2V7M A;  1W0B A;  2X9X A;  4GYS A;  4WW0 A;  5HYA A;  3OTO T;  4CI2 B;  2CM0 A;  5JR9 C;  1XZY A;  3Q2M A;  1Z8U A;  2H7V C;  5LBM A;  3IHR A;  3CX7 B;  4CI1 B;  2W4X A;  3AE3 A;  4YHH T;  1E2A A;  2DWG A;  4DUZ T;  4P0B A;  1HFA A;  1DU2 A;  4IDZ A;  3ZCJ A;  5HXR A;  2D2S A;  4DMV A;  5ABF B;  5J0Z A;  2M6B A;  3E22 E;  4JEH B;  5AQS B;  4YJ2 E;  4YLH A;  4YY3 T;  3FBL A;  1I6Z A;  2D0U A;  2JMK A;  4UVB B;  5AQR B;  4H9N C;  2XY8 B;  1JNZ A;  2IAK A;  1E1H B;  3CWZ B;  5AFU L;  3QNU A;  3VKH A;  2A72 A;  2KWI B;  4LMJ A;  5TAO A;  5KDM C;  4ZEY A;  1OED E;  4ERR A;  1NEN A;  2DNX A;  5FMN A;  3BQI A;  1MMA A;  4IDQ A;  3VRB A;  5L3G B;  2EHO C;  2NWB A;  3FZL B;  3LFM A;  3BQK A;  3IA3 A;  4HWC A;  4ILU A;  3V5S A;  4OYK A;  3I0O A;  2LOS A;  4IE6 A;  3RX6 A;  3ZYK A;  3J7Y q;  2PFV A;  4HWI B;  2NTX A;  1N33 T;  1IAP A;  2BS4 A;  5CJ5 A;  1W09 A;  5FY0 A;  4AIU A;  2NW9 A;  4H9S E;  2W61 A;  2D5U A;  5HXH A;  4DBR A;  2ZM0 A;  3FZF B;  2DL1 A;  3FXD B;  3RRC A;  5JH7 E;  2VQE T;  4JI1 T;  4EGW A;  2ZMA A;  3U3I A;  2J62 A;  2NTY A;  4B3M T;  3TLW A;  3L8R A;  1OED B;  1XNR T;  1XNQ T;  3SFE A;  2UXD T;  2I59 A;  2E2A A;  5HWY A;  3ZKR A;  5JDM A;  1OWA A;  4Q25 A;  3ZMV B;  3GWH A;  3ZSS A;  5LJN A;  2LT3 A;  3CPZ A;  4MAL A;  4KP3 C;  3NKZ A;  4Z8X A;  3RRW A;  2EHO B;  4Z90 A;  3ZMT B;  2E5L T;  2WDQ A;  4HTE A;  4A97 A;  2WBL A;  4DR6 T;  3LK4 2;  4JUY A;  2CHN A;  2CBJ A;  4PJN A;  3P4Q A;  1JNR A;  3AEB A;  4WBO A;  2A2F X;  1ZEE A;  2XQ4 A;  2A9U A;  1WCR A;  2XSA A;  1MIV A;  3KV5 A;  4GYR A;  4PJM A;  4U31 A;  3ZST A;  5JDH A;  2X67 A;  1HG2 A;  2WZH A;  5L2L A;  5LHI B;  4KX6 A;  4QXC B;  2VKJ A;  3DTO A;  4H9Q C;  3I1A A;  3Q5D A;  3AXJ A;  4K0U A;  1YW0 A;  5LG4 A;  2IML A;  1LKX A;  3ZPO A;  4UVA B;  4X64 T;  5EK4 A;  5JDL A;  2HN2 A;  5AQT B;  4PJJ A;  4E7Z A;  3E0Z A;  3OYX A;  3ETV A;  4PFO A;  2C5I T;  4PW8 A;  4CN6 A;  1KF6 A;  5LA6 E;  4DR2 T;  3E08 A;  5L4H A;  3AE6 A;  2HPJ A;  3ANW B;  1QSD A;  3Q9D A;  4UF0 B;  5F5W A;  3R6N A;  4U72 A;  3ZJ1 A;  4JBW F;  4U7I A;  5HEU A;  4C91 A;  4IHJ E;  4DV0 T;  4DR5 T;  1IBL T;  5ABE A;  1MIW A;  3RI5 A;  5AQI B;  2BKN A;  3ZN0 B;  4O8S A;  4JI2 T;  1T8B A;  2V7L A;  3JAE A;  3NRX A;  4ZS3 A;  1HTJ F;  1IBM T;  4JI0 T;  2Z6E A;  4NUV A;  5A1L A;  1U5P A;  2FBW A;  3SFD A;  5LYJ E;  2FJE A;  3B5M A;  1MIY A;  5BMV E;  5L47 A;  4EEB A;  2B76 A;  2W66 A;  3UUM A;  2H89 A;  2E9X A;  1I94 T;  5FXX A;  4ZZC A;  3UQ7 A;  2NOX A;  1WYC A;  2QRX A;  2ODV A;  2WSS V;  5LG3 A;  4CXY A;  4HWH A;  5LHG B;  2E9X B;  3LJC A;  4JLE A;  1V9D A;  2X9W A;  4B3S T;  1UX4 A;  3LBX B;  5HEG A;  4IST A;  2E8I A;  1GQE A;  1T98 A;  2BDE A;  4PK4 A;  4YTM A;  5FP3 A;  3R84 B;  2X0L B;  4L5G A;  4AQG A;  4ASK A;  3JCF A;  5GON E;  3AEF A;  3FB2 A;  3ZC0 A;  3UUX B;  3AA1 B;  2CBI A;  3VU7 H;  4TV8 E;  3QUJ A;  3AE9 A;  4NXM T;  5FVL A;  4PK5 A;  4WYV A;  3RYF E;  3J9X 1;  2CMR A;  3PJA A;  3P4R A;  3EHZ A;  1CHU A;  3Q5W A;  4YTN A;  3TLU A;  1X9B A;  2DHR A;  1KNZ A;  3NZQ A;  2K9A A;  2LSI A;  2YOE A;  3K3N A;  2CE7 A;  2L3L A;  4IDO A;  2CEA A;  4C90 A;  1HNX T;  3VKG A;  5AQQ B;  5J1G A;  4BJN A;  4PFP A;  2AE9 A;  2LSJ A;  3AED A;  3LK2 B;  3PDY A;  1Z0P A;  2Q9Q B;  4ZI7 E;  3C50 A;  4KMC A;  2VAS A;  4QX8 B;  3H3A A;  3ABV A;  1D0Y A;  5M4Y A;  2DCF A;  3CML A;  3AAI A;  3ZEF B;  1WLX A;  4GOU A;  4UIG A;  1XDP A;  4YT0 A;  4E7S A;  4P09 A;  3FXE B;  5JDF A;  3SOL A;  2PJQ A;  4EYU A;  5LXT E;  3GN5 B;  4YFS A;  4ZHQ E;  1HX1 B;  4F8H A;  2W00 A;  3WI3 A;  1XMO T;  3I9Y A;  2W0G A;  5EK3 A;  4ADZ A;  1WR0 A;  2X0H A;  1HG5 A;  3KIN B;  1QLB A;  3B13 A;  2C5J A;  3K3Q C;  4KHZ F;  4JI6 T;  3OVU A;  3B57 A;  2LEH A;  2LKG A;  3EUH A;  3FHN A;  5AQJ B;  4JI8 T;  2Q9Q C;  4UXN B;  4CQI A;  3QB5 A;  4QWN B;  1SUM B;  3HKD E;  5FY1 A;  4DV3 T;  3A7M A;  5LHH B;  3RLF F;  4A5X A;  3HKB E;  3AEE A;  2IHR 1;  3KBT A;  1ZHC A;  2KZ7 B;  5DQV A;  2PTF A;  1SA0 E;  2FUP A;  2LSG A;  3WAK A;  5HXE A;  5LNK A;  3ZT6 A;  1KFY A;  2A3D A;  2J47 A;  3O1H A;  3D0T A;  4KI0 F;  4ILA A;  3N9N A;  2NR4 A;  1MMN A;  1OED A;  2AXD S;  1KNR A;  1WR6 A;  1FIO A;  2OA5 A;  2XQA A;  3AE2 A;  3K8P C;  3O1I A;  2CPT A;  2E5V A;  4GK5 E;  3ZMS B;  3O9X A;  1U4Q A;  2Y6X A;  3RQU A;  4OHF A;  3TLT A;  5JRE A;  2JQ9 A;  3C64 A;  1FJG T;  2YU1 A;  4ILC A;  1L0V A;  4WBN E;  1HS7 A;  1LVK A;  2VK9 A;  2XUE A;  2XQ7 A;  3HA4 A;  3JC6 D;  3QOF A;  2WY2 A;  4ZS2 A;  4HFC A;  1CUN A;  3P4P A;  2VL8 A;  4H9P C;  2MBG A;  2X68 A;  3EVY A;  2N2N A;  4X5T A;  3UUN A;  4P0A A;  4CXX A;  4IE0 A;  2QA7 A;  2QVA A;  2V7K A;  3KVA A;  2LLY A;  2DWK A;  4UV9 B;  2X66 A;  4OX9 T;  4HFV A;  4AI6 A;  2BVL A;  4TWF A;  3T8O A;  5HEO A;  3C4Z A;  3PUQ A;  2PBI A;  1Y64 B;  3FZH B;  5LMN T;  2IC9 A;  2NW7 A;  3N2G E;  1N36 T;  3LK3 B;  4ZI2 D;  4GKK T;  5ABF A;  1OED C;  2K3W A;  4DV2 T;  2ACZ A;  1LVF A;  2I6H A;  5KX5 E;  4AKG A;  4G63 A;  4AQF C;  3AE5 A;  4ZOL E;  5HCM A;  1AJ3 A;  4DUY T;  2MTQ A;  2X51 A;  2BZB A;  4LF8 T;  1QUU A;  4DND A;  3KVB A;  3HKE E;  5LMU T;  5HXC A;  3ZCI A;  4L9I A;  4J2C A;  4EZH A;  3RQW A;  2WZI A;  2EHO D;  4M1P A;  1NWM X;  3H37 A;  1KNP A;  4O4H E;  4U33 A;  4DO0 A;  4BA9 A;  2VVN A;  4EOZ B;  2IDO B;  2H3R A;  3I0Q A;  3ONL C;  4YSX A;  4AKH A;  3RGL A;  3PTR B;  3CIR A;  2BG9 E;  4X1I E;  4IDN A;  2V8S V;  3N9L A;  2XQ9 A;  4IRE A;  2XAG B;  4PJL A;  2CRB A;  5KMG P;  2ES0 A;  2JQH A;  4HFB A;  3RKO A;  2LSK A;  3JAF A;  4LF9 T;  1YD8 G;  2WMO A;  2LSY A;  4O2A E;  2YDR A;  4DVD A;  5HEJ A;  5JDN A;  3ZYL A;  1IZN B;  3RIU A;  3UU6 A;  1S35 A;  2UXB T;  3RPU A;  4KHP T;  2KSR A;  3A8Y C;  3N9Q A;  4YXD A;  4JI3 T;  1YXR A;  3PV0 F;  4YHJ A;  3OYZ A;  4LF5 T;  2MOZ A;  2DI4 A;  2I0M A;  5LP6 E;  2J1D G;  2M6I A;  4B3T T;  2KXP B;  1YQ4 A;  2V6Y B;  1J5E T;  1YKE B;  3KFW X;  3HI2 A;  4CI3 B;  2LHR A;  2LOP A;  2BS3 A;  2UU9 T;  4EXT A;  4TWD A;  4GKJ T;  1VCS A;  2YDQ A;  3GA8 A;  3CQC B;  4TUY E;  3SS1 A;  3N5L A;  3PU8 A;  2LM9 A;  4FJO A;  5H6R B;  4MFR A;  4AKR B;  2N1G A;  4I0U A;  4UR9 A;  2IC6 A;  1UX5 A;  4MHC A;  2J4G A;  4LFB T;  4V1A v;  4COF A;  2LKH A;  4TN7 B;  3F57 A;  5FXV A;  3UUB A;  4AQY T;  2WS3 A;  2H7O A;  4PNI A;  3AXJ B;  4DR4 T;  2CWO A;  4I43 B;  2GK9 A;  4QH5 A;  3GN5 A;  5AQP B;  4I4T E;  3OJA A;  3S4U A;  5ADX L;  4NXN T;  4JV5 T;  2F4V T;  2ACX A;  2XAJ B;  4O4I E;  3PUY F;  1M62 A;  4KBM B;  5C8Y E;  2ODU A;  2W62 A;  3RYC E;  5IWA T;  2VKO A;  1J1J A;  3ESL A;  2ZM2 A;  1MMD A;  1R8I A;  4UVC B;  3ZMU B;  2R6G F;  1BR1 A;  2CWY A;  3MA9 A;  4TZ4 C;  1E7P A;  2QYW A;  2WB5 A;  3MXZ A;  4UEL A;  1EZ3 A;  2K5B B;  3C51 A;  1G73 A;  5ABH A;  2E9X C;  4CN1 A;  2OV9 A;  4U2Y A;  2XPK A;  5ABG A;  3W15 B;  4B6X A;  5JDQ A;  3P4W A;  1MND A;  2D0T A;  2WWV A;  3FZM B;  5LGT B;  3K1S A;  3BK9 A;  3AE7 A;  3RF1 A;  3AE8 A;  3AE1 A;  3CQG B;  4G2A A;  1FMW A;  1VRB A;  1BR0 A;  2Y48 B;  2XQ6 A;  3BQL A;  3I9W A;  3T1Y T;  1YKH B;  2OLT A;  3AVR A;  2MYS A;  4U74 A;  2JPF A;  1HF8 A;  2Y8D A;  1G8X A;  3HKC E;  3AAA B;  2KND A;  4ISS A;  4EED A;  1KEY A;  4WZX A;  4LF4 T;  3EAB A;  4OK0 A;  5HCJ A;  2WCA A;  2VVS A;  3LDQ B;  1H7C A;  3N9P A;  5JDG A;  2EHO A;  3H3M A;  1HR0 T;  2BS2 A;  4EYY R;  2RA1 A;  4YSY A;  3L09 A;  3ONX A;  5LB7 B;  3ZJ2 A;  2B1E A;  3N2O A;  3NWI A;  4HFI A;  1BR4 A;  4DR7 T;  3LG7 A;  2SPC A;  2E9X D;  5DAB A;  4DV4 T;  4U7Y A;  3ZYM A;  2NP9 A; 
#chains in the Genus database with same CATH homology
 4X64 T;  4OX9 T;  4JI4 T;  5LMN T;  4DR2 T;  1N36 T;  4GKK T;  4DV2 T;  4JV5 T;  1N32 T;  4JI5 T;  4DV0 T;  4DR5 T;  1IBL T;  4DV4 T;  4DUY T;  4JI2 T;  4LF8 T;  1IBM T;  1HNW T;  2UUA T;  5LMU T;  4B3R T;  4DR1 T;  3T1H T;  1I94 T;  1XMQ T;  2UUC T;  4X65 T;  4B3S T;  4DR3 T;  4LF9 T;  2UXC T;  5BR8 T;  1HNZ T;  4LFC T;  2ZM6 T;  4NXM T;  2UXB T;  1IBK T;  4KHP T;  4JI3 T;  2HHH T;  4LF5 T;  4DV6 T;  4B3T T;  1J5E T;  1HNX T;  2UU9 T;  4DUZ T;  3OTO T;  4GKJ T;  1N34 T;  4YHH T;  4LFB T;  2UUB T;  4X62 T;  4YY3 T;  2VQF T;  4AQY T;  4DR4 T;  4DV1 T;  1XMO T;  4X66 T;  4NXN T;  2F4V T;  4JI6 T;  5IWA T;  4DV5 T;  4JI7 T;  4JI8 T;  1N33 T;  4DV3 T;  4LFA T;  2VQE T;  4JI1 T;  4K0K T;  4B3M T;  3T1Y T;  1XNR T;  1XNQ T;  2UXD T;  4JI0 T;  4DV7 T;  4LF4 T;  2E5L T;  4JYA T;  4DR6 T;  1FJG T;  1HR0 T;  4LF7 T;  4LF6 T;  4DR7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...