4JI7T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji7T00
4DUZT 2UXCT 1XNRT 4LFCT 4JYAT 4JI8T 4LFAT 4GKKT 4DR7T 3OTOT 5IWAT 4DR2T 4DV3T 5BR8T 4B3MT 4DR5T 4LFBT 4DV5T 4DR1T 4DV6T 4DV4T 1N36T 4X65T 1N34T 4NXMT 4KHPT 4LF8T 2VQET 2VQFT 5LMUT 4LF7T 4X66T 2ZM6T 1FJGT 4DV0T 1J5ET 2UUCT 1XNQT 4DV7T 1IBMT 1HNXT 2F4VT 2HHHT 4JI0T 4LF4T 4LF9T 2UUBT 4LF5T 4DR6T 4B3TT 1N33T 2UXBT 1I94T 1XMOT 2UU9T 4JI7T 1HNZT 2UXDT 4OX9T 4B3RT 1IBLT 4X64T 4DV2T 4JI6T 2E5LT 4JI3T 4B3ST 3T1HT 4DR4T 4DUYT 4DR3T 5LMNT 2UUAT 4YHHT 4GKJT 4JI2T 4K0KT 4YY3T 4X62T 4JI5T 4JV5T 1XMQT 4NXNT 1IBKT 3T1YT 1HNWT 4AQYT 4JI4T 1N32T 4DV1T 1HR0T 4LF6T 4JI1T
chains in the Genus database with same CATH superfamily
5L3GB 2XUEA 2UXCT 5AQIB 4ZS3A 4I55E 2JMHA 3ETUA 1UX5A 3RRCA 3RI5A 3PUSA 5BR8T 5AQJB 4IDOA 5ABFA 4LFBT 2BBJA 5LJNA 3LBXB 3IEEA 4MLKA 4NXMT 5LXTE 4KHPT 3ZT5A 2LE8A 3AECA 3ZKRA 1ZOYA 3FZMB 1CUNA 3VU7H 2JRKA 4ZS2A 3ZJ2A 4TWHA 5AQMB 4GK5E 5HEOA 3RIAA 4LF5T 3OYZA 4B3TT 1XZYA 4I0UA 4HGAA 3O1JA 3PUVF 4JI7T 1ZEEA 4HKAA 3FZHB 4CN4A 4L9IA 3AE9A 4DV2T 3AXJA 4U31A 2RPAA 2XPKA 2W4XA 1NENA 5AQTB 5JR9A 5FY1A 3RRWA 2BG9A 2PG8A 4U2YA 2XJ7A 5FXXA 3KV5A 4LMKA 4UELA 4AKHA 3T1YT 3AVSA 5LA6E 4MBQA 4EEDA 4AQGA 4UVAB 2A9UA 3HKDE 2W62A 2I0MA 5HXEA 3GA8A 3W15B 3JADA 3CMLA 2JQQA 1CHUA 5FKYA 1VRBA 2MPKA 5ETWA 5IYZE 3ZN0B 2N1GA 1JNZA 3MK7C 4HFCA 2M6BA 4COFA 1NWMX 3UFEA 4GOUA 2N9DA 5KXJA 1OEDA 3UUMA 4YTNA 2WDRA 3UUBA 3TLTA 4LF4T 2K24A 1WRDA 1KFYA 2ZM8A 2LRKA 2BS3A 4AIUA 3D0TA 1YQ3A 4JI3T 5JR9C 3AEGA 5HEUA 2BG9C 4DUYT 3CVRA 4ZHQE 5FY0A 4QWNB 4JI2T 2C5KT 4ISTA 2IC6A 3L09A 4YSZA 4U7YA 4HWIB 3RQUA 3TLVA 1Z0PA 2NW8A 3ETVA 4O4LE 4I4TE 3F2EA 2BBHA 4JI4T 1N32T 1NAFA 4K0UA 5FXVA 4KX6A 2ACXA 5FY7A 2GK9A 4JI1T 1T7SA 4AKIA 4DO0A 3I1AA 2M67A 4YT0A 2CLYB 5AQLB 2ZLYA 3F57A 4EV6A 5AQPB 4U74A 2A72A 4GYSA 4ASKA 4DR2T 2QVAA 2NTXA 3ZPOA 4DR5T 3E08A 1D1CA 2JMKA 2I6HA 4PNIA 3H37A 5BMVE 3EI0A 2ZM6T 3OVUA 1J5ET 1L0VA 3N2KE 1XNQT 4PFOA 4GIWA 4XAXB 2SPCA 3SRZA 4ZI3D 3PJAA 1YKHB 2D2SA 2BKOA 2Q9QD 1LRZA 3N9MA 2ZM2A 5AQFB 4UXNB 4HFIA 4PJMA 2XQ8A 4HWDA 2ODUA 4BAYB 2V7JA 5FYMA 4AISA 4AKLA 2VKOA 2X0LB 4PJNA 2CHNA 2YDSA 4JEUB 2W66A 3KVAA 1MMAA 2W63A 3AE2A 2YINA 1D1AA 1T98A 2CPTA 4JUYA 2X66A 2XHEB 3J9X1 4QX8B 4PK5A 2VKJA 4DV1T 3LBXA 4ISSA 2KT9A 4CN1A 5JDLA 3O1HA 2KLQA 1BR2A 3I0OA 4DUZT 2V7KA 5L47A 3CIRA 2HPJA 4JYAT 1M62A 2YOEA 2WB5A 2X0YA 2W00A 2XQ5A 3AXJB 2ES0A 3ZMUB 1XWMA 1BR1A 1BR4A 3MZKB 5JREA 1D1BA 2KSRA 4I43B 4Z8XA 3UU8A 2E9XD 3RHWA 3U3IA 1YQ4A 4H9RC 3AB3B 4A56A 2WQYA 3BK9A 3PU8A 2LRLA 2XQYA 4QH4A 2IUBA 3UU6A 2XZEA 3FBZA 5F5WA 2ZM0A 5JDNA 4CI1B 1LKXA 3TLUA 3S4UA 4XBFB 4H9PC 4GYRA 4PW8A 1KEYA 3HI2A 3ZLIA 2YN6A 1M7KA 5AQHB 5IHYA 5CFBA 2L3LA 2WCAA 3IHRA 3C51A 2OA5A 3EDUA 1OEDB 1YD8G 5HYAA 5JVDE 2JPFA 5C2TA 5L4EA 2LSGA 3KBUA 4JI8T 4GK0E 1D0ZA 3PE0A 5HAXA 5IWAT 1WFDA 4TV9E 2YK0A 3RGLA 4EIWA 1MNEA 1X9BA 3B5MA 3C4XA 2KXPB 2WZHA 3FZLB 2VQFT 5LMUT 3ZSTA 4O4HE 2FJBA 3SS1A 5HEJA 3AE8A 1HTJF 4KBMB 1H7CA 5A1LA 2HHHT 5ADXL 3LDQB 4ILAA 4UF0A 3VRAA 3EDVA 5AQOB 1UGOA 3LJCA 4CXYA 4EZHA 4YSXA 4HWCA 3AE7A 2WU2A 3QB5K 1ZKEA 5LNKA 2EHOA 5AFUL 2Y48B 4CI2B 4TWDA 5AQUB 5HXRA 4IE4A 3NZPA 1MMGA 3WAKA 3NRXA 2LT3A 3ZSSA 3AA7B 3A8YC 5LGNB 4NPPA 5J2UE 3K3NA 4ILCA 4HFHA 2CXFA 4UV9B 1UUSA 3PTRB 2Q9QB 5J0ZA 2VVNA 4HFVA 2DHRA 1SE7A 3HKBE 3AEEA 1XNRT 4JBWF 3ZMVB 3ZT6A 2XAFB 3N9NA 4QKNA 4IE5A 2DNXA 4TWFA 5C8YE 4WZXA 3C98B 2MBGA 5L3FB 2BKPA 1HCIA 5E0OA 3HR0A 3N2GE 4IIJE 3QC9A 3RPUA 4LF7T 3ZC1A 2WMNA 3UTKA 2QGSA 3RC8A 5FMNA 5LCYA 1S35A 4HWFA 2UUBT 3FXDB 3PUQA 3J7Yq 3CX6B 4AXPA 4XZCA 1I94T 3SOLA 3QUJA 4OYJA 4Z90A 5JDGA 2XQ6A 3UUXB 4OX9T 3NBXX 4X64T 2DLRA 2CLYC 3Q5DA 2C5IT 1QSDA 4AKGA 2OLTA 2MTQA 5LGUB 3L3PA 5CA1E 5F8PA 3KVBA 2E9XB 4X62T 2VASA 2P9BA 2XQ4A 1Y64B 3UQ7A 2Y6XA 2DCFA 3BQKA 3OBVE 3UUNA 2YU1A 4L0RA 4HEAA 3P7IA 3C4WA 1V9DA 2YKSA 2XAGB 2UXNB 3AA6B 1D0YA 4EGWA 3VHLA 3ZCIA 3CQCB 4X1YE 3X1DA 2CRBA 5FL0A 3KV9A 4YTMA 3KBTA 4YFSA 1N34T 2G0UA 2LKGA 4ZI2D 5J1GA 3L39A 3LG7A 4X66T 4O2BE 2LM9A 2J47A 2XM1A 1X79A 3I9YA 4HFBA 4N78D 3QB5A 4KMCA 3ZMSB 4CN6A 2NR4A 4IL4A 5LG4A 3IBPA 4A97A 4P09A 1N33T 1B7TA 3SFDA 4DNDA 2BG9E 3ZC0A 2XQ3A 3FZFB 3OYXA 2WSSV 2LOPA 1AJ3A 3VRBA 2HH7A 5FL1A 4JV5T 4TX5A 3ANWB 1XMQT 4O8SA 1HNWT 2X9WA 4AQYT 3Q5EA 1HS7A 3AEAA 1VCTA 3C64A 3CPZA 4HE8A 4CXWA 2DWGA 4MALA 1XDPA 4UF0B 4LFAT 4GKKT 4UVCB 3QNUA 3OTOT 3V5SA 4WYVA 3AAIA 3N9PA 5M4YA 5F3JA 4YSYA 2UXXB 2LSKA 2EHOB 4B6XA 2QRXA 4KI0F 5JRCA 1FMVA 3PUWF 4H9SE 2DWKA 4G63A 3LSVA 4DMWA 3PUAA 4DV7T 4O4JE 3N9QA 1DU2A 3KDSE 2H89A 1SA0E 1MIVA 4H9OC 4AQFA 5IUXA 3EABA 2UU9T 3O9XA 1OEDC 4EB6E 4KP3C 4DVDA 3V5UA 2Q9QA 2VKDA 5JH7E 2MOZA 4B3ST 2VVSA 4QH5A 3QK6A 3ONLC 2FJAA 4YHHT 4LMLA 3NKZA 3RC3A 4KUMB 3CX8B 3RYIE 2RA1A 2CBIA 1R8IA 2LEHA 2JQKA 4NUVA 4V1Av 3PV0F 1KK7A 4PJLA 4I50E 5LHHB 1XDOA 5LGTB 5LHGB 1E7PA 2YDRA 3O4XE 2XQ7A 2WP9A 3HA4A 3P4WA 3N5LA 2YDQA 3IA3A 3GN5B 2PJQA 5CJ5A 4B3MT 1OWAA 4DV5T 3LFMA 3K1SA 3IF8B 4O4IE 2NW7A 3E22E 4EXTA 4EOZB 1MMDA 5EK2A 5AQSB 5FNVE 4JEHB 3MA9A 3EUHA 4WNKA 2UUCT 3CKDA 2LM2A 4G2AA 4UIGA 2F4VT 3Q9DA 4JI0T 3N9LA 5ABGA 2E9XA 2IIUA 1U4QA 5DJQC 3VR9A 2NTYA 2Q9QC 5KDMC 5KMGP 2V7LA 1MIWA 2D9DA 3PUYF 2VL8A 3C50A 3PUXF 3M65A 4B3RT 3JC6D 3FXEB 2XASB 1GQEA 3I9WA 3T1HT 4UV8B 3MXZA 1WYCA 2A2FX 4DR3T 1SHZC 3AVRA 4PK6A 3FB2A 3NWIA 4C90A 4K0KT 3C4ZA 1HF8A 3MACA 4QXCB 3WAJA 2CHOA 2HN2A 4HFDA 3RX6A 4ZXLA 4YTPA 3ZJ1A 5TAOA 2ACZA 2V5CA 1IJ6A 5L3EB 3RIUA 4H9QC 2WM9A 4DR7T 1YKEB 3CK6A 2KNDA 4H9NC 2MAWA 5DABA 3EVYA 3OJAA 4IL9A 2WDVA 4Q25A 5H6RB 4U7IA 5L3CB 4LF8T 4DIDB 2K9AA 4HTEA 1G73A 4X1IE 3H3AA 2IHR1 4ERRA 3ABVA 4IREA 2E9XC 1HG5A 1IBMT 3ZYMA 4DMVA 5AQRB 1WR0A 5AQQB 3T8OA 4X5TA 3ANWA 3PUZF 4IDNA 2H7OA 2LHNA 3UQ4A 2FJDA 2UXDT 4M1PA 4AI6A 3LK3B 4FJOA 2HN1A 2MYSA 4ADZA 4YXDA 5HWXA 4TZ4C 1W09A 4C91A 2BS2A 4IE7A 1QLBA 3I0QA 2KINB 2WS3A 3AEBA 1US7B 1VCSA 1S94A 5JRCB 5ABEA 3G06A 4OK0A 1E1HB 3ZT7A 3AE4A 3CQGB 2JIWA 4E7SA 2LOSA 3B13A 1J5WA 3RIUC 4OYKA 2VK9A 4LFCT 4CZZB 4P1NA 3K8PC 2H88A 3GWHA 2M6IA 2KWHA 4YJ3E 3CQXC 2WMOA 4NUUA 4U33A 2YEVC 3H3MA 1WYBA 3LK42 3AE6A 3R6NA 1O3XA 5JDHA 1MNDA 3TLSA 4BA9A 3WI3A 2L9QA 2XAQB 2W0GA 4CQIA 4ILUA 1VOMA 4ZI7E 1HNXT 1QUUA 4YLHA 4LF9T 3A5XA 3KV4A 2JQ9A 4E7ZA 2VWAA 5HXSA 5L3BB 2E5LT 3VKHA 5EK4A 3SFEA 5HWYA 1W9RA 4DBQA 5CA0E 1YW0A 3N9OA 5FVLA 2NP9A 4GKJT 3KV6A 1IAPA 4WW0A 5L2LA 2QA7A 2X67A 3M3ZB 3B57A 3GN5A 3AAEB 2EHOC 3AEDA 2ZMAA 5J2TE 3Q5WA 1LVFA 5JDFA 2FBWA 2V7MA 1J1JA 4EZ4A 4ZZCA 5FVKA 2WY2A 5JDMA 4DBRA 3ZYLA 1D0XA 4WBOA 2E5VA 2CE7A 4X20E 4H63H 2CXDA 3KFWX 4IDZA 3HKEE 4QX7B 4DR1T 5AQKB 5FP3A 2R6GF 3PDYA 2CM0A 2CXLA 5AQGB 3GMIA 2V7IA 4ANJA 5LYJE 1ZP0A 2WWVA 4QXBB 4EEBA 2LLYA 3UT5E 1UX4A 4UR9A 3MJXA 4A5XA 2K5BB 3DP7A 3CX7B 4IE0A 4H63V 2K48A 1T72A 3AE5A 2IW5B 4UVBB 2A3DA 3VKGA 5ABHA 4JI6T 4HN9A 3P4RA 3K3OA 3Q5XA 4TNVA 3EHZA 3UFGA 3HKCE 4QXHB 5LMNT 2CCQA 4HFEA 2I59A 3R84B 4OFZA 1UCUA 3UU3A 3QOFA 4YY3T 2LJLA 1Z8UA 2PTFA 4U72A 2LSJA 4L5GA 3AE1A 2D0UA 1IJ5A 1Y01A 1HR0T 5HXHA 2BVMA 1W0BA 3UU4A 2XAJB 2CBJA 4TUYE 1HG2A 1OXZA 2VKHA 3KINB 2V6YB 2D0TA 5L3DB 2B76A 2KZ7B 3O1IA 4HWHA 2C0SA 1KNPA 4ZI2C 1I6ZA 3N2OA 1MIYA 1LVKA 3PU3A 5DQVA 2KMFA 2X0HA 3LK2B 1ZHCA 4NIQA 5FXWA 2KWIB 3ZCJA 4DR6T 3ESLA 1OEDE 2X9YA 4J2CA 2JQHA 4EAHA 3ONJA 5CGMA 4ILBA 4ZEYA 3ZN1B 2WWUA 1E2AA 1KNRA 3CWZB 3NVOA 3FHNA 2NW9A 4TNWA 3L8RA 3RH3A 3BQLA 2WDQA 5HEHA 3MKDA 2IMLA 4MFRA 4CI3B 2DI4A 2Y8DA 5LBMA 3RQWA 4P0AA 5AQVB 2VB6A 1HFAA 2WAUA 2CA5A 4LF6T 4U2ZA 3NZQA 5CB4E 3HL6A 2OV9A 4LMJA 4ZOLE 4QHOA 2CWYA 2DL1A 3P50A 4JLEA 3UULA 4F6RC 1N36T 4EYYR 4U3CA 1HX1B 2IC9A 4EYUA 3A7MA 3SWHA 1G8XA 5JTGA 2Z6EA 4DV0T 2HPLA 5HXCA 3E0ZA 3P4SA 2PFVA 3JCFA 4AKRB 1UK5A 2NOXA 4TV8E 3AAAB 4PJJA 5ABFB 2ODVA 3DTOA 4YJ2E 2D5UA 5JQGE 2X68A 1XMOT 1WR6A 2VL0A 5C3JA 2X51A 2BDEA 2V8SV 2VURA 4X1KE 4IDPA 5HCMA 2H3RA 2N2NA 3FZKB 4AQFC 2PBIA 5LB7B 3P4QA 2LSIA 3RLFF 2UUAT 3RIFA 4ZI3C 5LHIB 5DQWA 3F31A 2E2AA 4BJMA 2XSAA 4NXNT 3RKGA 4Z91A 1HX8A 4YHJA 3Q2MA 5LBQB 5GONE 4WBNE 1BR0A 4FI5A 5LP6E 1SUMB 1KF6A 3AEFA 5JR9B 2BG9B 3TLWA 3ZMTB 2CWOA 4PK4A 2RP4A 3RYHE 3VR8A 4DV6T 3PUGA 4DV4T 2X9XA 2IAKA 1IZNB 4TN7B 2VQET 2XSBA 1FMWA 3NRYA 4BJNA 3RYCE 1FJGT 2JJ9A 2BZBA 1WLXA 3PURA 2AE9A 2AXDS 2BVLA 2W67A 2FJEA 2WU5A 2XQAA 2UXBT 4P0BA 4F8HA 1HNZT 3ONXA 2X9HA 4MHCA 3RF1A 5KX5E 2W2UA 3JC6C 5LJMA 2V1DB 4KHZF 1KNZA 2J4GA 3AA1B 3JAFA 4A98A 3AA0B 1W0AA 2V5DA 2FUPA 4UEMA 3OPCA 2L8KA 4JI5T 2V6YA 2QYWA 3P8CD 5HEGA 3JAEA 1IBKT 1FEWA 5L4HA 5HCJA 4ZZBA 4IT4A 4IE6A 2H7VC 2BKNA 4OHFA 2XTLA 2XM2A 3EAMA 3BQIA 3UU5A 2LHRA 4O2AE 3ZYKA 1NEKA 3PJAJ 2LKHA 2J1DG 2J62A 2V26A 2WZIA 3RYFE 4DV3T 2IDOB 5H6QB 1U5PA 5LOVE 3P4PA 2NWBA 1YXRA 2C5JA 4X65T 3ZEFB 5AQNB 3TKLB 3RKOA 1FIOA 2E8IA 5LG3A 2V6XA 4PAGA 2CMRA 5FXZA 2LSYA 5JDQA 2WBLA 3AE3A 2EHOD 4IGUA 1JNRA 5EK3A 1MMNA 3OKQA 1EZ3A 1IBLT 4CXXA 4QH1A 2CEAA 3FBLA 2K3WA 1UURA 4IHJE 4DR4T 1WCRA 2XY8B 3ZMZB 4IDQA 1ZV4X 3U78A 4PFPA 2B1EA 5EZYE 3K3QC 2W61A 1T8BA 2XAHB 2YU2A 3DJBA 2XQ9A 2BS4A
chains in the Genus database with same CATH topology
4DUZT 2UXCT 1XNRT 4LFCT 4JYAT 4JI8T 4LFAT 4GKKT 4DR7T 3OTOT 5IWAT 4DR2T 4DV3T 5BR8T 4B3MT 4DR5T 4LFBT 4DV5T 4DR1T 4DV6T 4DV4T 1N36T 4X65T 1N34T 4NXMT 4KHPT 4LF8T 2VQET 2VQFT 5LMUT 4LF7T 4X66T 2ZM6T 1FJGT 4DV0T 1J5ET 2UUCT 1XNQT 4DV7T 1IBMT 1HNXT 2F4VT 2HHHT 4JI0T 4LF4T 4LF9T 2UUBT 4LF5T 4DR6T 4B3TT 1N33T 2UXBT 1I94T 1XMOT 2UU9T 4JI7T 1HNZT 2UXDT 4OX9T 4B3RT 1IBLT 4X64T 4DV2T 4JI6T 2E5LT 4JI3T 4B3ST 3T1HT 4DR4T 4DUYT 4DR3T 5LMNT 2UUAT 4YHHT 4GKJT 4JI2T 4K0KT 4YY3T 4X62T 4JI5T 4JV5T 1XMQT 4NXNT 1IBKT 3T1YT 1HNWT 4AQYT 4JI4T 1N32T 4DV1T 1HR0T 4LF6T 4JI1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ T;  2UXC T;  1XNR T;  4LFC T;  4JYA T;  4JI8 T;  4LFA T;  4GKK T;  4DR7 T;  3OTO T;  5IWA T;  4DR2 T;  4DV3 T;  5BR8 T;  4B3M T;  4DR5 T;  4LFB T;  4DV5 T;  4DR1 T;  4DV6 T;  4DV4 T;  1N36 T;  4X65 T;  1N34 T;  4NXM T;  4KHP T;  4LF8 T;  2VQE T;  2VQF T;  5LMU T;  4LF7 T;  4X66 T;  2ZM6 T;  1FJG T;  4DV0 T;  1J5E T;  2UUC T;  1XNQ T;  4DV7 T;  1IBM T;  1HNX T;  2F4V T;  2HHH T;  4JI0 T;  4LF4 T;  4LF9 T;  2UUB T;  4LF5 T;  4DR6 T;  4B3T T;  1N33 T;  2UXB T;  1I94 T;  1XMO T;  2UU9 T;  4JI7 T;  1HNZ T;  2UXD T;  4OX9 T;  4B3R T;  1IBL T;  4X64 T;  4DV2 T;  4JI6 T;  2E5L T;  4JI3 T;  4B3S T;  3T1H T;  4DR4 T;  4DUY T;  4DR3 T;  5LMN T;  2UUA T;  4YHH T;  4GKJ T;  4JI2 T;  4K0K T;  4YY3 T;  4X62 T;  4JI5 T;  4JV5 T;  1XMQ T;  4NXN T;  1IBK T;  3T1Y T;  1HNW T;  4AQY T;  4JI4 T;  1N32 T;  4DV1 T;  1HR0 T;  4LF6 T;  4JI1 T; 
#chains in the Genus database with same CATH topology
 5L3G B;  2XUE A;  2UXC T;  5AQI B;  4ZS3 A;  4I55 E;  2JMH A;  3ETU A;  1UX5 A;  3RRC A;  3RI5 A;  3PUS A;  5BR8 T;  5AQJ B;  4IDO A;  5ABF A;  4LFB T;  2BBJ A;  5LJN A;  3LBX B;  3IEE A;  4MLK A;  4NXM T;  5LXT E;  4KHP T;  3ZT5 A;  2LE8 A;  3AEC A;  3ZKR A;  1ZOY A;  3FZM B;  1CUN A;  3VU7 H;  2JRK A;  4ZS2 A;  3ZJ2 A;  4TWH A;  5AQM B;  4GK5 E;  5HEO A;  3RIA A;  4LF5 T;  3OYZ A;  4B3T T;  1XZY A;  4I0U A;  4HGA A;  3O1J A;  3PUV F;  4JI7 T;  1ZEE A;  4HKA A;  3FZH B;  4CN4 A;  4L9I A;  3AE9 A;  4DV2 T;  3AXJ A;  4U31 A;  2RPA A;  2XPK A;  2W4X A;  1NEN A;  5AQT B;  5JR9 A;  5FY1 A;  3RRW A;  2BG9 A;  2PG8 A;  4U2Y A;  2XJ7 A;  5FXX A;  3KV5 A;  4LMK A;  4UEL A;  4AKH A;  3T1Y T;  3AVS A;  5LA6 E;  4MBQ A;  4EED A;  4AQG A;  4UVA B;  2A9U A;  3HKD E;  2W62 A;  2I0M A;  5HXE A;  3GA8 A;  3W15 B;  3JAD A;  3CML A;  2JQQ A;  1CHU A;  5FKY A;  1VRB A;  2MPK A;  5ETW A;  5IYZ E;  3ZN0 B;  2N1G A;  1JNZ A;  3MK7 C;  4HFC A;  2M6B A;  4COF A;  1NWM X;  3UFE A;  4GOU A;  2N9D A;  5KXJ A;  1OED A;  3UUM A;  4YTN A;  2WDR A;  3UUB A;  3TLT A;  4LF4 T;  2K24 A;  1WRD A;  1KFY A;  2ZM8 A;  2LRK A;  2BS3 A;  4AIU A;  3D0T A;  1YQ3 A;  4JI3 T;  5JR9 C;  3AEG A;  5HEU A;  2BG9 C;  4DUY T;  3CVR A;  4ZHQ E;  5FY0 A;  4QWN B;  4JI2 T;  2C5K T;  4IST A;  2IC6 A;  3L09 A;  4YSZ A;  4U7Y A;  4HWI B;  3RQU A;  3TLV A;  1Z0P A;  2NW8 A;  3ETV A;  4O4L E;  4I4T E;  3F2E A;  2BBH A;  4JI4 T;  1N32 T;  1NAF A;  4K0U A;  5FXV A;  4KX6 A;  2ACX A;  5FY7 A;  2GK9 A;  4JI1 T;  1T7S A;  4AKI A;  4DO0 A;  3I1A A;  2M67 A;  4YT0 A;  2CLY B;  5AQL B;  2ZLY A;  3F57 A;  4EV6 A;  5AQP B;  4U74 A;  2A72 A;  4GYS A;  4ASK A;  4DR2 T;  2QVA A;  2NTX A;  3ZPO A;  4DR5 T;  3E08 A;  1D1C A;  2JMK A;  2I6H A;  4PNI A;  3H37 A;  5BMV E;  3EI0 A;  2ZM6 T;  3OVU A;  1J5E T;  1L0V A;  3N2K E;  1XNQ T;  4PFO A;  4GIW A;  4XAX B;  2SPC A;  3SRZ A;  4ZI3 D;  3PJA A;  1YKH B;  2D2S A;  2BKO A;  2Q9Q D;  1LRZ A;  3N9M A;  2ZM2 A;  5AQF B;  4UXN B;  4HFI A;  4PJM A;  2XQ8 A;  4HWD A;  2ODU A;  4BAY B;  2V7J A;  5FYM A;  4AIS A;  4AKL A;  2VKO A;  2X0L B;  4PJN A;  2CHN A;  2YDS A;  4JEU B;  2W66 A;  3KVA A;  1MMA A;  2W63 A;  3AE2 A;  2YIN A;  1D1A A;  1T98 A;  2CPT A;  4JUY A;  2X66 A;  2XHE B;  3J9X 1;  4QX8 B;  4PK5 A;  2VKJ A;  4DV1 T;  3LBX A;  4ISS A;  2KT9 A;  4CN1 A;  5JDL A;  3O1H A;  2KLQ A;  1BR2 A;  3I0O A;  4DUZ T;  2V7K A;  5L47 A;  3CIR A;  2HPJ A;  4JYA T;  1M62 A;  2YOE A;  2WB5 A;  2X0Y A;  2W00 A;  2XQ5 A;  3AXJ B;  2ES0 A;  3ZMU B;  1XWM A;  1BR1 A;  1BR4 A;  3MZK B;  5JRE A;  1D1B A;  2KSR A;  4I43 B;  4Z8X A;  3UU8 A;  2E9X D;  3RHW A;  3U3I A;  1YQ4 A;  4H9R C;  3AB3 B;  4A56 A;  2WQY A;  3BK9 A;  3PU8 A;  2LRL A;  2XQY A;  4QH4 A;  2IUB A;  3UU6 A;  2XZE A;  3FBZ A;  5F5W A;  2ZM0 A;  5JDN A;  4CI1 B;  1LKX A;  3TLU A;  3S4U A;  4XBF B;  4H9P C;  4GYR A;  4PW8 A;  1KEY A;  3HI2 A;  3ZLI A;  2YN6 A;  1M7K A;  5AQH B;  5IHY A;  5CFB A;  2L3L A;  2WCA A;  3IHR A;  3C51 A;  2OA5 A;  3EDU A;  1OED B;  1YD8 G;  5HYA A;  5JVD E;  2JPF A;  5C2T A;  5L4E A;  2LSG A;  3KBU A;  4JI8 T;  4GK0 E;  1D0Z A;  3PE0 A;  5HAX A;  5IWA T;  1WFD A;  4TV9 E;  2YK0 A;  3RGL A;  4EIW A;  1MNE A;  1X9B A;  3B5M A;  3C4X A;  2KXP B;  2WZH A;  3FZL B;  2VQF T;  5LMU T;  3ZST A;  4O4H E;  2FJB A;  3SS1 A;  5HEJ A;  3AE8 A;  1HTJ F;  4KBM B;  1H7C A;  5A1L A;  2HHH T;  5ADX L;  3LDQ B;  4ILA A;  4UF0 A;  3VRA A;  3EDV A;  5AQO B;  1UGO A;  3LJC A;  4CXY A;  4EZH A;  4YSX A;  4HWC A;  3AE7 A;  2WU2 A;  3QB5 K;  1ZKE A;  5LNK A;  2EHO A;  5AFU L;  2Y48 B;  4CI2 B;  4TWD A;  5AQU B;  5HXR A;  4IE4 A;  3NZP A;  1MMG A;  3WAK A;  3NRX A;  2LT3 A;  3ZSS A;  3AA7 B;  3A8Y C;  5LGN B;  4NPP A;  5J2U E;  3K3N A;  4ILC A;  4HFH A;  2CXF A;  4UV9 B;  1UUS A;  3PTR B;  2Q9Q B;  5J0Z A;  2VVN A;  4HFV A;  2DHR A;  1SE7 A;  3HKB E;  3AEE A;  1XNR T;  4JBW F;  3ZMV B;  3ZT6 A;  2XAF B;  3N9N A;  4QKN A;  4IE5 A;  2DNX A;  4TWF A;  5C8Y E;  4WZX A;  3C98 B;  2MBG A;  5L3F B;  2BKP A;  1HCI A;  5E0O A;  3HR0 A;  3N2G E;  4IIJ E;  3QC9 A;  3RPU A;  4LF7 T;  3ZC1 A;  2WMN A;  3UTK A;  2QGS A;  3RC8 A;  5FMN A;  5LCY A;  1S35 A;  4HWF A;  2UUB T;  3FXD B;  3PUQ A;  3J7Y q;  3CX6 B;  4AXP A;  4XZC A;  1I94 T;  3SOL A;  3QUJ A;  4OYJ A;  4Z90 A;  5JDG A;  2XQ6 A;  3UUX B;  4OX9 T;  3NBX X;  4X64 T;  2DLR A;  2CLY C;  3Q5D A;  2C5I T;  1QSD A;  4AKG A;  2OLT A;  2MTQ A;  5LGU B;  3L3P A;  5CA1 E;  5F8P A;  3KVB A;  2E9X B;  4X62 T;  2VAS A;  2P9B A;  2XQ4 A;  1Y64 B;  3UQ7 A;  2Y6X A;  2DCF A;  3BQK A;  3OBV E;  3UUN A;  2YU1 A;  4L0R A;  4HEA A;  3P7I A;  3C4W A;  1V9D A;  2YKS A;  2XAG B;  2UXN B;  3AA6 B;  1D0Y A;  4EGW A;  3VHL A;  3ZCI A;  3CQC B;  4X1Y E;  3X1D A;  2CRB A;  5FL0 A;  3KV9 A;  4YTM A;  3KBT A;  4YFS A;  1N34 T;  2G0U A;  2LKG A;  4ZI2 D;  5J1G A;  3L39 A;  3LG7 A;  4X66 T;  4O2B E;  2LM9 A;  2J47 A;  2XM1 A;  1X79 A;  3I9Y A;  4HFB A;  4N78 D;  3QB5 A;  4KMC A;  3ZMS B;  4CN6 A;  2NR4 A;  4IL4 A;  5LG4 A;  3IBP A;  4A97 A;  4P09 A;  1N33 T;  1B7T A;  3SFD A;  4DND A;  2BG9 E;  3ZC0 A;  2XQ3 A;  3FZF B;  3OYX A;  2WSS V;  2LOP A;  1AJ3 A;  3VRB A;  2HH7 A;  5FL1 A;  4JV5 T;  4TX5 A;  3ANW B;  1XMQ T;  4O8S A;  1HNW T;  2X9W A;  4AQY T;  3Q5E A;  1HS7 A;  3AEA A;  1VCT A;  3C64 A;  3CPZ A;  4HE8 A;  4CXW A;  2DWG A;  4MAL A;  1XDP A;  4UF0 B;  4LFA T;  4GKK T;  4UVC B;  3QNU A;  3OTO T;  3V5S A;  4WYV A;  3AAI A;  3N9P A;  5M4Y A;  5F3J A;  4YSY A;  2UXX B;  2LSK A;  2EHO B;  4B6X A;  2QRX A;  4KI0 F;  5JRC A;  1FMV A;  3PUW F;  4H9S E;  2DWK A;  4G63 A;  3LSV A;  4DMW A;  3PUA A;  4DV7 T;  4O4J E;  3N9Q A;  1DU2 A;  3KDS E;  2H89 A;  1SA0 E;  1MIV A;  4H9O C;  4AQF A;  5IUX A;  3EAB A;  2UU9 T;  3O9X A;  1OED C;  4EB6 E;  4KP3 C;  4DVD A;  3V5U A;  2Q9Q A;  2VKD A;  5JH7 E;  2MOZ A;  4B3S T;  2VVS A;  4QH5 A;  3QK6 A;  3ONL C;  2FJA A;  4YHH T;  4LML A;  3NKZ A;  3RC3 A;  4KUM B;  3CX8 B;  3RYI E;  2RA1 A;  2CBI A;  1R8I A;  2LEH A;  2JQK A;  4NUV A;  4V1A v;  3PV0 F;  1KK7 A;  4PJL A;  4I50 E;  5LHH B;  1XDO A;  5LGT B;  5LHG B;  1E7P A;  2YDR A;  3O4X E;  2XQ7 A;  2WP9 A;  3HA4 A;  3P4W A;  3N5L A;  2YDQ A;  3IA3 A;  3GN5 B;  2PJQ A;  5CJ5 A;  4B3M T;  1OWA A;  4DV5 T;  3LFM A;  3K1S A;  3IF8 B;  4O4I E;  2NW7 A;  3E22 E;  4EXT A;  4EOZ B;  1MMD A;  5EK2 A;  5AQS B;  5FNV E;  4JEH B;  3MA9 A;  3EUH A;  4WNK A;  2UUC T;  3CKD A;  2LM2 A;  4G2A A;  4UIG A;  2F4V T;  3Q9D A;  4JI0 T;  3N9L A;  5ABG A;  2E9X A;  2IIU A;  1U4Q A;  5DJQ C;  3VR9 A;  2NTY A;  2Q9Q C;  5KDM C;  5KMG P;  2V7L A;  1MIW A;  2D9D A;  3PUY F;  2VL8 A;  3C50 A;  3PUX F;  3M65 A;  4B3R T;  3JC6 D;  3FXE B;  2XAS B;  1GQE A;  3I9W A;  3T1H T;  4UV8 B;  3MXZ A;  1WYC A;  2A2F X;  4DR3 T;  1SHZ C;  3AVR A;  4PK6 A;  3FB2 A;  3NWI A;  4C90 A;  4K0K T;  3C4Z A;  1HF8 A;  3MAC A;  4QXC B;  3WAJ A;  2CHO A;  2HN2 A;  4HFD A;  3RX6 A;  4ZXL A;  4YTP A;  3ZJ1 A;  5TAO A;  2ACZ A;  2V5C A;  1IJ6 A;  5L3E B;  3RIU A;  4H9Q C;  2WM9 A;  4DR7 T;  1YKE B;  3CK6 A;  2KND A;  4H9N C;  2MAW A;  5DAB A;  3EVY A;  3OJA A;  4IL9 A;  2WDV A;  4Q25 A;  5H6R B;  4U7I A;  5L3C B;  4LF8 T;  4DID B;  2K9A A;  4HTE A;  1G73 A;  4X1I E;  3H3A A;  2IHR 1;  4ERR A;  3ABV A;  4IRE A;  2E9X C;  1HG5 A;  1IBM T;  3ZYM A;  4DMV A;  5AQR B;  1WR0 A;  5AQQ B;  3T8O A;  4X5T A;  3ANW A;  3PUZ F;  4IDN A;  2H7O A;  2LHN A;  3UQ4 A;  2FJD A;  2UXD T;  4M1P A;  4AI6 A;  3LK3 B;  4FJO A;  2HN1 A;  2MYS A;  4ADZ A;  4YXD A;  5HWX A;  4TZ4 C;  1W09 A;  4C91 A;  2BS2 A;  4IE7 A;  1QLB A;  3I0Q A;  2KIN B;  2WS3 A;  3AEB A;  1US7 B;  1VCS A;  1S94 A;  5JRC B;  5ABE A;  3G06 A;  4OK0 A;  1E1H B;  3ZT7 A;  3AE4 A;  3CQG B;  2JIW A;  4E7S A;  2LOS A;  3B13 A;  1J5W A;  3RIU C;  4OYK A;  2VK9 A;  4LFC T;  4CZZ B;  4P1N A;  3K8P C;  2H88 A;  3GWH A;  2M6I A;  2KWH A;  4YJ3 E;  3CQX C;  2WMO A;  4NUU A;  4U33 A;  2YEV C;  3H3M A;  1WYB A;  3LK4 2;  3AE6 A;  3R6N A;  1O3X A;  5JDH A;  1MND A;  3TLS A;  4BA9 A;  3WI3 A;  2L9Q A;  2XAQ B;  2W0G A;  4CQI A;  4ILU A;  1VOM A;  4ZI7 E;  1HNX T;  1QUU A;  4YLH A;  4LF9 T;  3A5X A;  3KV4 A;  2JQ9 A;  4E7Z A;  2VWA A;  5HXS A;  5L3B B;  2E5L T;  3VKH A;  5EK4 A;  3SFE A;  5HWY A;  1W9R A;  4DBQ A;  5CA0 E;  1YW0 A;  3N9O A;  5FVL A;  2NP9 A;  4GKJ T;  3KV6 A;  1IAP A;  4WW0 A;  5L2L A;  2QA7 A;  2X67 A;  3M3Z B;  3B57 A;  3GN5 A;  3AAE B;  2EHO C;  3AED A;  2ZMA A;  5J2T E;  3Q5W A;  1LVF A;  5JDF A;  2FBW A;  2V7M A;  1J1J A;  4EZ4 A;  4ZZC A;  5FVK A;  2WY2 A;  5JDM A;  4DBR A;  3ZYL A;  1D0X A;  4WBO A;  2E5V A;  2CE7 A;  4X20 E;  4H63 H;  2CXD A;  3KFW X;  4IDZ A;  3HKE E;  4QX7 B;  4DR1 T;  5AQK B;  5FP3 A;  2R6G F;  3PDY A;  2CM0 A;  2CXL A;  5AQG B;  3GMI A;  2V7I A;  4ANJ A;  5LYJ E;  1ZP0 A;  2WWV A;  4QXB B;  4EEB A;  2LLY A;  3UT5 E;  1UX4 A;  4UR9 A;  3MJX A;  4A5X A;  2K5B B;  3DP7 A;  3CX7 B;  4IE0 A;  4H63 V;  2K48 A;  1T72 A;  3AE5 A;  2IW5 B;  4UVB B;  2A3D A;  3VKG A;  5ABH A;  4JI6 T;  4HN9 A;  3P4R A;  3K3O A;  3Q5X A;  4TNV A;  3EHZ A;  3UFG A;  3HKC E;  4QXH B;  5LMN T;  2CCQ A;  4HFE A;  2I59 A;  3R84 B;  4OFZ A;  1UCU A;  3UU3 A;  3QOF A;  4YY3 T;  2LJL A;  1Z8U A;  2PTF A;  4U72 A;  2LSJ A;  4L5G A;  3AE1 A;  2D0U A;  1IJ5 A;  1Y01 A;  1HR0 T;  5HXH A;  2BVM A;  1W0B A;  3UU4 A;  2XAJ B;  2CBJ A;  4TUY E;  1HG2 A;  1OXZ A;  2VKH A;  3KIN B;  2V6Y B;  2D0T A;  5L3D B;  2B76 A;  2KZ7 B;  3O1I A;  4HWH A;  2C0S A;  1KNP A;  4ZI2 C;  1I6Z A;  3N2O A;  1MIY A;  1LVK A;  3PU3 A;  5DQV A;  2KMF A;  2X0H A;  3LK2 B;  1ZHC A;  4NIQ A;  5FXW A;  2KWI B;  3ZCJ A;  4DR6 T;  3ESL A;  1OED E;  2X9Y A;  4J2C A;  2JQH A;  4EAH A;  3ONJ A;  5CGM A;  4ILB A;  4ZEY A;  3ZN1 B;  2WWU A;  1E2A A;  1KNR A;  3CWZ B;  3NVO A;  3FHN A;  2NW9 A;  4TNW A;  3L8R A;  3RH3 A;  3BQL A;  2WDQ A;  5HEH A;  3MKD A;  2IML A;  4MFR A;  4CI3 B;  2DI4 A;  2Y8D A;  5LBM A;  3RQW A;  4P0A A;  5AQV B;  2VB6 A;  1HFA A;  2WAU A;  2CA5 A;  4LF6 T;  4U2Z A;  3NZQ A;  5CB4 E;  3HL6 A;  2OV9 A;  4LMJ A;  4ZOL E;  4QHO A;  2CWY A;  2DL1 A;  3P50 A;  4JLE A;  3UUL A;  4F6R C;  1N36 T;  4EYY R;  4U3C A;  1HX1 B;  2IC9 A;  4EYU A;  3A7M A;  3SWH A;  1G8X A;  5JTG A;  2Z6E A;  4DV0 T;  2HPL A;  5HXC A;  3E0Z A;  3P4S A;  2PFV A;  3JCF A;  4AKR B;  1UK5 A;  2NOX A;  4TV8 E;  3AAA B;  4PJJ A;  5ABF B;  2ODV A;  3DTO A;  4YJ2 E;  2D5U A;  5JQG E;  2X68 A;  1XMO T;  1WR6 A;  2VL0 A;  5C3J A;  2X51 A;  2BDE A;  2V8S V;  2VUR A;  4X1K E;  4IDP A;  5HCM A;  2H3R A;  2N2N A;  3FZK B;  4AQF C;  2PBI A;  5LB7 B;  3P4Q A;  2LSI A;  3RLF F;  2UUA T;  3RIF A;  4ZI3 C;  5LHI B;  5DQW A;  3F31 A;  2E2A A;  4BJM A;  2XSA A;  4NXN T;  3RKG A;  4Z91 A;  1HX8 A;  4YHJ A;  3Q2M A;  5LBQ B;  5GON E;  4WBN E;  1BR0 A;  4FI5 A;  5LP6 E;  1SUM B;  1KF6 A;  3AEF A;  5JR9 B;  2BG9 B;  3TLW A;  3ZMT B;  2CWO A;  4PK4 A;  2RP4 A;  3RYH E;  3VR8 A;  4DV6 T;  3PUG A;  4DV4 T;  2X9X A;  2IAK A;  1IZN B;  4TN7 B;  2VQE T;  2XSB A;  1FMW A;  3NRY A;  4BJN A;  3RYC E;  1FJG T;  2JJ9 A;  2BZB A;  1WLX A;  3PUR A;  2AE9 A;  2AXD S;  2BVL A;  2W67 A;  2FJE A;  2WU5 A;  2XQA A;  2UXB T;  4P0B A;  4F8H A;  1HNZ T;  3ONX A;  2X9H A;  4MHC A;  3RF1 A;  5KX5 E;  2W2U A;  3JC6 C;  5LJM A;  2V1D B;  4KHZ F;  1KNZ A;  2J4G A;  3AA1 B;  3JAF A;  4A98 A;  3AA0 B;  1W0A A;  2V5D A;  2FUP A;  4UEM A;  3OPC A;  2L8K A;  4JI5 T;  2V6Y A;  2QYW A;  3P8C D;  5HEG A;  3JAE A;  1IBK T;  1FEW A;  5L4H A;  5HCJ A;  4ZZB A;  4IT4 A;  4IE6 A;  2H7V C;  2BKN A;  4OHF A;  2XTL A;  2XM2 A;  3EAM A;  3BQI A;  3UU5 A;  2LHR A;  4O2A E;  3ZYK A;  1NEK A;  3PJA J;  2LKH A;  2J1D G;  2J62 A;  2V26 A;  2WZI A;  3RYF E;  4DV3 T;  2IDO B;  5H6Q B;  1U5P A;  5LOV E;  3P4P A;  2NWB A;  1YXR A;  2C5J A;  4X65 T;  3ZEF B;  5AQN B;  3TKL B;  3RKO A;  1FIO A;  2E8I A;  5LG3 A;  2V6X A;  4PAG A;  2CMR A;  5FXZ A;  2LSY A;  5JDQ A;  2WBL A;  3AE3 A;  2EHO D;  4IGU A;  1JNR A;  5EK3 A;  1MMN A;  3OKQ A;  1EZ3 A;  1IBL T;  4CXX A;  4QH1 A;  2CEA A;  3FBL A;  2K3W A;  1UUR A;  4IHJ E;  4DR4 T;  1WCR A;  2XY8 B;  3ZMZ B;  4IDQ A;  1ZV4 X;  3U78 A;  4PFP A;  2B1E A;  5EZY E;  3K3Q C;  2W61 A;  1T8B A;  2XAH B;  2YU2 A;  3DJB A;  2XQ9 A;  2BS4 A; 
#chains in the Genus database with same CATH homology
 4DUZ T;  2UXC T;  1XNR T;  4LFC T;  4JYA T;  4JI8 T;  4LFA T;  4GKK T;  4DR7 T;  3OTO T;  5IWA T;  4DR2 T;  4DV3 T;  5BR8 T;  4B3M T;  4DR5 T;  4LFB T;  4DV5 T;  4DR1 T;  4DV6 T;  4DV4 T;  1N36 T;  4X65 T;  1N34 T;  4NXM T;  4KHP T;  4LF8 T;  2VQE T;  2VQF T;  5LMU T;  4LF7 T;  4X66 T;  2ZM6 T;  1FJG T;  4DV0 T;  1J5E T;  2UUC T;  1XNQ T;  4DV7 T;  1IBM T;  1HNX T;  2F4V T;  2HHH T;  4JI0 T;  4LF4 T;  4LF9 T;  2UUB T;  4LF5 T;  4DR6 T;  4B3T T;  1N33 T;  2UXB T;  1I94 T;  1XMO T;  2UU9 T;  4JI7 T;  1HNZ T;  2UXD T;  4OX9 T;  4B3R T;  1IBL T;  4X64 T;  4DV2 T;  4JI6 T;  2E5L T;  4JI3 T;  4B3S T;  3T1H T;  4DR4 T;  4DUY T;  4DR3 T;  5LMN T;  2UUA T;  4YHH T;  4GKJ T;  4JI2 T;  4K0K T;  4YY3 T;  4X62 T;  4JI5 T;  4JV5 T;  1XMQ T;  4NXN T;  1IBK T;  3T1Y T;  1HNW T;  4AQY T;  4JI4 T;  1N32 T;  4DV1 T;  1HR0 T;  4LF6 T;  4JI1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...