4JI8L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji8L00
3AEVA 1B7YB 4DV4L 4DR7L 5M3FG 1DGSA 4GOPB 3E9IA 3MEFA 3DLLA 1PH4A 2MQHA 1S72A 2WB1G 4BY1G 3K7AH 2B3GA 2JA7G 4BY7G 4HIMA 1XJVA 1PH1A 2AHOB 1VQHA 4DAYB 1J5EQ 3CP0A 5K36G 3CPFA 1LM0A 1HNWQ 4DR1Q 1HZBA 3F2BA 1XMQL 1BBWA 1LYLA 2JA9A 1GKHA 1SR3A 5AJ3Q 1QZGA 5ELNA 1SFOH 3HOYG 1Y1WG 4NB3A 2CWPA 2AKWB 2JJQA 4LFCL 1X3FA 4X64L 3G6EA 3S14H 4A3DG 3AFQA 4DV7L 1VQLA 4L5RC 3I4MG 4AYBG 1ASYA 2VS1A 3CQZH 2E8GA 4DV3Q 4HJ9A 1GM5A 2R92H 2R7ZG 3T1YL 4GKKQ 4A3CH 1Q1BA 4L5TA 2NVYH 1PYSB 1J6QA 4MZ9A 4DK6C 1JE5A 3JAMi 4DR4Q 2RCNA 4BXXH 3HFZB 1JJGA 3HOZH 3HKSA 1IBKL 3GD7A 3GTLH 3HOUH 5GROA 4OX9Q 3CCEA 2HT1A 2IX1A 4DV1Q 1V43A 5C3EH 4KI0A 4B3TL 1TWGH 2IY5B 1PA6A 4YY3Q 4IOAA 3A0JA 3CC2A 3TRZA 1HZ9A 4JI1L 3TREA 3HOXH 3M9BA 1PV4A 3K80C 4P72A 4UP9A 4X66L 1M90C 3F8TA 2KHJA 4DV6L 4DR2Q 4JI4L 4POFA 4C3IH 4LFAQ 2GVAA 4NXNL 3RLOA 1JMCA 5BR8L 2EIFA 2NN6I 4IOCA 2VNUD 2R93H 1X3GA 5M5XH 4LF5Q 2E2JH 4PZ6A 5LMNL 1K0RA 3AFPA 1A0IA 3CC4A 4L5QA 1IYJB 3I4NG 2JA6H 2MO1A 4DV4Q 4YCUA 4DR7Q 1HH2P 1AE3A 2KCTA 1NE3A 5LMUL 1PVOA 5HGQA 4BBSG 4YWMA 1G291 3GO5A 1XTDA 4DV5L 4A3GH 3GDEA 3Q8DA 1G6PA 1HZCA 4JOIC 4LFBL 1VQEA 1FJGL 2R7DA 4X6AH 4HJ8A 3E9HA 4B3RL 2ZJQA 3BZCA 3GTMH 2ZM6L 4GS3A 3PF5A 4AH6A 4DNIA 3NELA 2JA8G 1X54A 1PH6A 1KAWA 3A74A 2LXJA 3PIPA 4LF4Q 3FKIG 1QUQA 2I5MX 4A3GG 4JOIA 4OWWB 2CWAA 5HY6A 4JI8L 4IPHA 1YZ6A 2PMZE 5AJ3L 4X64Q 4LFCQ 2BH8A 4DV7Q 3I7FA 1VQ9A 1E3PA 5GQOA 1N36L 2F3IA 4A3LG 3T1YQ 4A3JH 2D0OA 1TXYA 3RNUA 1VQNA 4BBRH 4A4IA 2DGYA 1WCMG 3HOWH 3PO3G 1WYDA 1C0AA 1VQ7A 1EIFA 2WAQG 3KF8B 2JQOA 3CCVA 4DV2L 3PV0A 2PQAB 2QEXA 4X65L 1XPOA 1SN8A 3W1GA 3PO2G 4C2MH 1NTGA 3RLFA 1JJCB 1IBKQ 4QQBX 1N8RC 3SGIA 1HZAA 4DPGA 4KHZA 4DUZL 1GVPA 2UU9L 3KF6A 4UP7A 1EUJA 4A3EG 5GAEC 2UUBL 4R4TA 1KQSA 3ER0A 4JI1Q 3U50C 5IP9G 4HJ5A 3AQQA 1UE1A 4X66Q 2Y0SE 2VUMG 1VQOA 4RMFA 4DV6Q 4BA2I 2D62A 2Q2TA 3J81j 5DLQE 4NXNQ 3CCMA 5M3FH 3UDIA 5BR8Q 3HKZE 2VQEL 3CD6A 4DR2L 1CKNB 4BY1H 5LMNQ 2JA7H 1W2BA 5C0XJ 2UUAQ 3J81c 4JG2A 2HIVA 2OCEA 4R4IA 4IFDJ 3PIOA 5LMUQ 2KHIA 4JCVE 5GADC 2HIXA 5FJ8G 4YHHQ 1OXXK 2DUDA 3K0XA 3RN5A 1X65A 2WB1E 1KL9A 1X55A 1Y1VG 3B6YA 4P74A 3A5UA 2ID0A 4DV5Q 4GNXB 3S1RH 1M1KC 2ZTDA 2ZTEA 1FJGQ 1GO3E 4LFBQ 4A76A 1P8LA 3HOYH 4B3RQ 1K83H 1HR0L 4GKJL 4OONA 1Y1WH 2YTVA 1CKOA 2AWNA 3UDXA 2MNAA 1UE7A 2ZM6Q 1EOVA 4JC0A 1QZHA 3H0GG 4YCVA 3CCLA 4JI0L 1WFQA 3OTOL 3KLWA 4A3DH 2UXCL 2YTYA 2NVQH 3K8AA 3OW2A 3CC7A 3I4MH 3MXNB 5M5WH 3NENA 3W5OA 1Q82C 1EYGA 5C0XG 2R7ZH 1IBML 5FLMG 2Z6KC 1E7ZA 4JI8Q 4XTCS 4LF4L 4LF6Q 5C0XI 1QVFA 1E22A 4R4QA 4JI5L 2NZOA 4IFDG 1EWIA 2GN5A 4GOPC 3CMEA 1N36Q 1K8AC 4IFDI 4B3ML 1B70B 4AYBE 1T9HA 1C9OA 2Z6KA 4PZ8A 2Q2UA 3UE1A 4JI7L 2XTIA 4DKAC 2A8VA 4R4OA 3KJPA 2MFIA 3WWVA 4RG1A 4DV2Q 4X65Q 4GOPA 3M3YH 1YEZA 1U0LA 1I50H 3H15A 3E0EA 2UXDL 3T1HL 1X56A 3S24A 4AQYL 4A93H 2VQFL 4DUZQ 1ASZA 2UU9Q 3U58A 1HNXQ 1PHJA 2UUBQ 3LGJA 3D0FA 1U5KA 2HHHL 1YHQA 4X62L 1QVCA 2N49A 4GLXA 1D7QA 1SLJA 3FP9A 4OO1I 1L2FA 3L7ZC 1KRTA 3GTJH 4BA1I 3I4NH 1GD7A 4APVA 2VQEQ 1TWCH 2NVXH 2NN6G 1H95A 4A93G 5IYDG 4QIWE 5LMNW 2LSSA 4MTNA 1UE6A 4JI2L 4PMWA 1PH5A 3GTQH 1A63A 4BBSH 2C35B 3STBC 3AYHB 4OWXB 1E1OA 2OQKA 3F1ZA 1CKMA 2UUAL 1BKBA 5IYBG 2JEBI 2MO0A 3U4ZA 1XNQL 3H3VH 4NXML 3S16H 5IWAQ 2JA8H 4WJ3M 1Q46A 4A3IG 4YHHL 2N78A 3KYHC 4QL5A 1NBWA 3FKIH 4QGUA 2VW9A 1JB7A 1HR0Q 4LF8L 4QY7A 4JYAL 4GKJQ 1RL2A 4JI0Q 4K0KL 2VY3A 1Q86C 3STBD 3OTOQ 1UE5A 3PUZA 1YI2A 1BBUA 3L2PA 3CW2C 4A3MG 2F4VL 2UXCQ 5ELOA 2XGTA 4A3LH 3M85A 1IBMQ 1JJ2A 2ZTCA 1TWFH 2UUCL 1WCMH 3PO3H 2PI2A 4JI5Q 3G48A 1OXSC 5IP7G 3TS2A 3NBHB 2FXQA 2R7FA 3EIVA 3TEHB 4DUYL 1Q7YC 4LF6L 5M3MG 4B3MQ 3PO2H 3S2DH 2QA4A 3CCUA 4JI7Q 1YJWA 3I4OA 3KJOA 4A3EH 1MJEA 2IX0A 1VQAA 2UXBL 2Z0SA 3UE0A 5IP9H 4HJ7A 2WAQE 2L15A 3KOJA 3KDFB 3BJUA 5H1SE 2VUMH 3GTGH 2UXDQ 3EN2A 2OQ0A 4AQYQ 3T1HQ 4JBKA 2VQFQ 5JJIA 1VQCA 1K8GA 3HOVG 3EBEA 3M4PA 5C44G 1WI5A 2B63G 1A8VA 2HHHQ 1N9WA 4X62Q 4A3BG 1YHAA 4A3KG 3PUXA 2CCZA 2YYZA 3UDGA 1X9NA 2KBNA 4DR5L 4DV0L 5IYCG 1HNXL 2JA5G 3S15H 1K3RA 1CUKA 3NEMA 4LW1A 4OXPA 2BA0A 4P71A 2RF4A 3K7UC 4C3HH 4DAMA 2K5NA 3J7ZC 4JI2Q 2NZHA 2OTJA 1SE8A 5FJ8H 2CQOA 1Y1VH 2YTXA 2PNHA 1NMGA 3BU2A 4FDBA 1HNZL 1VQ4A 1UWVA 3ULJA 4YCWA 1PH8A 1XNRL 4HIDA 1Q8KA 1SRUA 1N34L 1YIJA 4NXMQ 1LTLA 1XNQQ 3H0GH 1IL2A 1N32L 4ME3A 4DR6L 4XIGS 3RZOH 1HR0W 2EQSA 4UPAA 5IWAL 4LF8Q 4JYAQ 1SMXA 1TWAH 3J7A5 5FLMH 2PQAA 2B29A 4DR3Q 2QGQA 3ICEA 4K0KQ 2V1CC 1YITA 4LF7L 2F4VQ 5C4XG 2A19A 4IPGA 5GAHC 1A62A 3HKZG 2K50A 2WFWA 1MJCA 4IO9A 1K73C 3S1QH 1O7IA 4KHPL 4HJAA 4NPSA 2UUCQ 4GLAC 1YVCA 3J80c 4JBMA 1N33Q 1TWHH 4MNOA 1V1QA 1VQFA 1FL0A 2N3SA 2K5HA 3M4QA 4DUYQ 5IE8A 1PH7A 1RIPA 1VQMA 1KC8C 2JEAI 1VQDA 1CKNA 1LUZA 4HIKA 4R1JA 3OYYA 3PUYA 4GNXC 4A75A 4JI6L 1QVGA 3PF4A 4LNQA 4C3JH 2CFMA 2ZJRA 2VL6A 4KLKA 4WJ4A 4O0AA 1L0WA 1VQ6A 1D8LA 5IT9c 3JC66 1IBLL 1OXVA 3BZKA 4EQ5A 3RR5A 3CCSA 3KFUA 3RN2A 3ZJYC 1C7YA 2E2IH 1CSQA 4GNXA 1E24A 4UP8A 1MIUA 4GN3B 5IYDH 4Y52H 3PCOB 1IXRA 4JI3L 1PH9A 3PSIA 2UXBQ 1L1OB 2K5VA 1YJ9A 4DR5Q 4DV0Q 1XPRA 4OO1G 1KXLA 4IPDA 1FVIA 1OXUA 2GVBA 4B3SL 2RHQB 3CPWA 3VDYA 1VCIA 1VQPA 3UDFA 4ALPA 5IYBH 4YWLA 2ASBA 1XPUA 1X3EA 2Q2IA 1P16A 1HNZQ 4A3IH 3TS0A 2I5HA 3CMAA 3CCRA 4A3FH 2R6GA 4P75A 2Q2HA 1XNRQ 5C4JH 3U4VA 1N34Q 2K4KA 1N32Q 2F52A 1VQ8A 1G51A 1KRSA 4DR6Q 2E5LL 3GTKH 1L1OC 2PI2E 4A3MH 1OTCA 2R92G 4QJFA 4UY8C 2E2HH 2EXDA 2K75A 2HQLA 1I5FA 1PYBA 2K14A 1XMOL 1VS0A 1I94L 4POGA 4A3CG 1B8AA 2AWOA 1YNXA 2ALYB 1QUQB 4A3FG 4LF7Q 4BXXG 5IP7H 4LF9L 4DR3L 3HOZG 4KHPQ 1L1OA 5M3MH 4JBJA 3JAMc 3IRBA 3G71A 1UEBA 3HOUG 1NJIC 2KENA 1EFWA 5C3EG 1SROA 2BH2A 1BVSA 4JV5L 1VQJA 1AE2A 1PFSA 3ERSX 1KHIA 3GTOH 3HOXG 4YWKA 1N33L 5GAGC 4TVAB 4LWCA 1Q12A 2CKZB 3M4OH 4JI6Q 2N8NA 1AH9A 1PH2A 2LXKA 3HOVH 2R93G 3PUVA 5C44H 2B63H 1OXTA 2K52A 1Q81C 3PGZA 1VQKA 4A3BH 4A3KH 2OWOA 1I3QH 1IBLQ 2JA6G 2JA5H 3KF6B 4P73A 5IYCH 1YJNA 3S1MH 4IJLA 1J5EL 1R9TH 2BA1A 2JK8A 2D0PA 5JEAJ 5IY0A 1XMQQ 1PH3A 3CF5A 4JI3Q 3H3VI 2YV5A 3FHWA 4LUOA 5FLXc 3J81i 3PUWA 4DR1L 2ES2A 3S2HH 1HNWL 3G4SA 4B3SQ 1KIXA 1YHBA 4HIOA 2NVTH 4J15A 2VZAA 3I2ZA 1S3OA 1Q1EA 3F2DA 1VQIA 1Z47A 4TQUS 1IZ6A 4GN5A 3RZDH 1HJPA 1W3SA 2RHSB 1X6OA 1MKHA 3I55A 1S40A 2ATWA 3TQYA 3ULPA 3RLNA 1K9MC 4DV3L 3S17H 3K81C 2YU9H 4H02A 1EQQA 4GKKL 1EIYB 3GTPH 2ZJPA 1WJJA 1CSPA 4LUZA 4PZ7A 3CXCA 2AMCB 1EQRA 5JEAG 5C4XH 4DR4L 1JT8A 2E5LQ 4DK3C 5JJKA 3J80i 1YBYA 4AIMA 4A3JG 5EAYA 4B3TQ 3CAMA 1XMOQ 1I94Q 1NMFA 4IPCA 4R4CA 4BBRG 5E7NA 1E1TA 1VQGA 4IJHA 4OX9L 2IHFA 2IT1A 2IHEA 4DV1L 3HOWG 1NY4A 3KDFA 4OWTB 2H5XA 4EX5A 5M5YH 3ULLA 4JI4Q 4YY3L 1V9PA 2Y0SG 3CCQA 1VQ5A 4LF9Q 3DM3A 4L5SA 2OTLA 4GLVB 3CCJA 1VQBA 5JJLA 4Y7NH 3D31A 4LFAL 4PG3A 3M7NA 3A5ZB 4JV5Q 3W1BA 4BY7H 3I56A 4GN4B 1FGUA 2JE6I 1I6HH 1Y14B 1KD1C 3S1NH 2I5LX 2A1AA 2KCMA 3L0OA 4O2DA 5J3BA 2I0QA 4LF5L 4JBWA 4LUVA 1Z9FA 2WP8J 3F2CA 1WOCA
chains in the Genus database with same CATH superfamily
3AEVA 5J1ZA 2QCPX 5M3FG 1PH4A 1ML0D 2MQHA 1EIGA 2RA4A 4LK1C 4BY1G 3Q0AA 1XJVA 1PH1A 2AHOB 4ILWA 4HN7A 4A3DB 3CPFA 4CKBA 2XWBB 5M5WB 3Q23A 1LM0A 1ZYRC 2C5CA 2EXZA 2H1EA 5KNDA 3F2BA 4DR1Q 1XMQL 1HNWQ 2JA9A 1SR3A 1QZGA 1SFOH 1D5XC 1V1PB 3FVQA 2AUJD 4IUQA 3T13A 2CWPA 3C1FA 2AKWB 1VQLA 5JAVA 2R92H 3A54A 2R7ZG 1ENCA 4L8JA 4JW0A 4DU9A 4A3CH 1Q1BA 4DK6C 1JE5A 3JAMi 2I46A 4BXXH 1JJGA 4A93B 3HKSA 2KHSA 3CCEA 3NWTA 4B3TL 1TWGH 3TMEA 3U9SA 2B2YA 3A0JA 2A5HA 1Q3LA 1CTMA 2KEEA 4K8IA 3OW7A 3M9BA 2L11A 4JI4L 2WIIB 1TWCB 4DR2Q 2NZ1D 4LFAQ 3BS1A 3M4YA 2VNUD 1CZWA 4LF5Q 3ZYYX 4PZ6A 5LMNL 1K0RA 1SE2A 1IYJB 3I4NG 1K28A 4PQXA 3J80L 5IOCA 1AE3A 1PVOA 3J7AF 4BBSG 5CC4A 4UDUC 3GO5A 3FKIB 1HZCA 3R2TA 4JOIC 4ABNA 3E9HA 3BZCA 4KKUA 2ZM6L 3NELA 1H9SB 4RWSC 1X54A 2QILA 1PH6A 1KAWA 5IT9L 2K05A 3HG9A 1IYVA 1WCMB 3DMUA 4A3GG 4OWWB 2CWAA 5AJ3L 3HP3A 2WKDA 4EVOA 4K6LA 5JEAH 3S2DB 5JOBA 1JOOA 4A3LG 4A3JH 3RNUA 2X6LA 1WYDA 4ZUIA 5A2QE 4KHVA 1VQ7A 1EIFA 2VUMB 3PV0A 2PQAB 2QEXA 1SN8A 3W1GA 1NTGA 1D1IA 3RUZA 3ITPA 2UU9L 3KF6A 1STHA 5GAEC 3QIAA 5EKLA 4HJ5A 1PTOF 3ERQA 4ZRZA 5ELBA 3CCMA 1YNJC 2N55A 3CD6A 4XT3B 5LMNQ 2JA7H 3I72A 2FJ2A 1A6XA 1LABA 4H44C 2HCIA 4C56C 4IFDJ 4C3HG 4JCVE 5GADC 4YHHQ 2DUDA 1X65A 4P74A 1X55A 1Y1VG 4IZ8A 3B6YA 1TWAB 1M1KC 2ID0A 4WORA 4K6DA 2DJGC 3UDXA 2MNAA 2ZM6Q 1EOVA 3KLWA 4A3DH 2UXCL 5M5WH 1TWHB 4LF4L 3E3XA 2QW7A 4XQQA 4LF6Q 1QVFA 4JI5L 2QF7A 4IALA 5FLXL 1K8AC 1HFGA 4RHRA 2Q2UA 2XTIA 1BR9A 3DHQA 2MFIA 1IW7D 1KDBA 3H15A 2KCCA 3E0EA 1KNAA 4A93H 1ASZA 2UU9Q 3K57A 2PCFB 4DAYA 3D0FA 2HHHL 1QVCA 4GLXA 1KNEA 3FP9A 1GUOA 4OO1I 1L2FA 1NCVA 1SYFA 2HDLA 5IODA 1TWCH 1GXDC 4KD3A 4QIWE 1UE6A 2CH4A 1A63A 4OHJA 4A3IB 2C35B 1STBA 3STBC 3F1ZA 2UUAL 3TP7A 4A3MB 5JVH3 1TU2B 2E2HB 1TR5A 2OF1A 1MGSA 3DM1A 3FKIH 1JB7A 4F7XA 1AEXA 5HURA 2Z4HA 1SE3A 2ZXOA 3K0YA 2UXCQ 4BS9A 4WRDA 5LL6X 3M85A 3SR1A 1EYAA 1WCMH 5FO7B 1Y8NB 2PI2A 4JI5Q 4IUPA 1DD2A 2L55A 3G48A 3TS2A 3NBHB 2FXQA 1F9RA 4ODGA 3QR8A 3S2DH 4CJ1B 2F1MA 3DWPA 5C44B 3BVMA 4QMGA 1JOQA 4A3KB 5E4XA 1I3QB 2PW7A 1LACA 2IX0A 5IP9H 2K28A 2L15A 2VUMH 3D4DA 2J4XA 1STYA 1QOHA 3M4PA 1WI5A 1LTSD 1A8VA 2HHHQ 2YYZA 1HNXL 4DR5L 1I4PA 1K3RA 1CUKA 3SEBA 4CKCA 2IW3A 4P71A 5DNFA 3VR6A 3J7ZC 5CV8A 4DAMA 2R3ZA 1MHWC 2Z1CA 5FJ8H 1PZID 4F88A 1HNZL 1UWVA 1RTNA 4LJZC 1PH8A 1N34L 3HKZB 1N32L 1LTLA 3CRLC 4DR6L 1X3QA 3Q24A 1HR0W 3KF8A 5IWAL 1TWAH 1YNND 2B29A 2F0TA 4DR3Q 2QGQA 2LKVA 4IFDH 1DJRD 4CDCC 2M9VA 1JWSD 2K50A 2WFWA 1Q90A 4MN3A 4XYOA 4KHPL 1O7IA 1PZKD 3I90A 1IW7C 1YVCA 3S1NB 1A15A 1TWHH 3J7YW 5NUCA 1RCVD 2PYKA 1VQFA 2N3SA 1FL0A 3D4RA 2BOSA 1RIPA 3V2TA 1VQDA 3SK8A 1LT4D 1AW7A 1LUZA 1SMYD 2IWHA 1JCKB 2F4IA 4LNQA 1PFNA 3MC0B 1UUPA 4O0AA 4S3SA 2G9DA 1D8LA 1EZ8A 3KFUA 1OXVA 3BZKA 3CCSA 1SNQA 1FNUA 1H9RA 1CSQA 2NN6H 5IYDH 4Y52H 1IXRA 1UAPA 3PSIA 4DNRB 1LLRD 4C3JG 2K5VA 4DR5Q 4OO1G 4IPDA 1ESFA 2GVBA 4ULLA 2EVBA 1VCIA 3NQIA 4KTAA 2O4XA 1XPUA 4EGVA 3EJIA 1AP0A 1HNZQ 2DY8A 4A3IH 3FDTA 3TS0A 2I5HA 2NVYB 2EYMA 2F0WA 2F0NA 2R6GA 1N34Q 1BCPB 1N32Q 2K4KA 2WKCA 1ICFB 1VQ8A 1U4LA 4DR6Q 3R3OA 3GTLB 1DXMA 4A3MH 4QJFA 2E2HH 1FD7D 2EXDA 2K75A 2HQLA 2E2DC 1PYBA 1XMOL 1WD0A 1VS0A 5IGDA 4POGA 3TSSA 2EYFA 1F2MA 2AWOA 3TZDA 4ME5A 4A3FG 3HOXB 4KHPQ 1L1OA 1UEBA 3T16A 5C3EG 1SROA 1BVSA 3W2DA 1AE2A 3I73A 5GAGC 4C3IG 4GZYC 2R93G 3PUVA 2RVLA 2X6GA 5C44H 3PMFA 1OXTA 3PGZA 1VQKA 4A3KH 2OWOA 1I3QH 1NAPA 2F0HA 3KF6B 1QNKA 5D65A 1LT6D 2B2WC 2RQXA 1BCPD 2D0PA 4KK7A 1PH3A 4ZKBB 3H3VI 2IX3A 2F03A 1FGBD 5DEHA 3PUWA 2ES2A 1B3QA 3C2PA 4K8JA 1YHBA 4C1NK 4HIOA 2SOBA 2VZAA 1S3OA 1Q1EA 4B08A 1Z47A 3GQBA 4GN5A 2PNRC 1JQYD 1YNNC 3TQYA 1L0XB 1WTVA 3K81C 4N8X1 4H02A 4GKKL 3CHBD 1TKWB 2ZT9C 4DR4L 1JT8A 1EY0A 1XMOQ 4IPCA 3MAQA 3HOWG 1VQGA 1LTGD 4XQJA 1NY4A 2V4DA 4L63B 3CCQA 1SMYC 1HHVA 3DM3A 4Q0FA 1I4HA 4L5SA 5ELEA 1VQBA 5FKAC 2HDMA 1SYBA 4PG3A 3A5ZB 3A7AB 2MUYA 3EVQA 2JE6I 1SSOA 3S1NH 2CW0C 1WOCA 1DCZA 4DXFA 2WINB 1DGSA 1D6EC 3CU7A 2EE1A 3P7JA 2WB1G 3S1RB 1TY2A 4BY7G 2AUKA 3HOYB 4I7ZC 5KEEA 1CM9A 3QOJA 4DAYB 1Y1WB 2LMCB 1Z6HA 1B53A 3TZUA 3I4MB 4AYBB 4PMCA 1HZBA 2ICIA 1LYLA 1FNVA 1GKHA 5ELNA 1CQVA 1EQTA 1EZ6A 1WTRA 1B2TA 2XN9C 1JWMD 3AFQA 4DV7L 2F0GA 1GUGA 4GKKQ 1F2ZA 2DNCA 2X69A 1MI2A 1A3TA 2B2YC 4MZ9A 2NVYH 1PYSB 1ZYRD 5CV4A 3KUPA 2RCNA 4DR4Q 3HFZB 1SNPA 2BE5C 4OL7A 3N6RA 4KN4C 3GTLH 3J81L 2BCOA 2XSCA 2KEDA 4RGOS 4R8IA 3D6CA 3TRZA 1F9QA 1HZ9A 2JSOA 3TREA 3HOXH 1PV4A 4P72A 2NVXB 4POFA 2GVAA 4NXNL 2EIFA 5D14A 4CDEC 3D3RA 1X3GA 2TMPA 5D3DA 5IT9E 1BCPC 4KKSA 2EJFC 2MO1A 3FPUB 1HA5A 2KCTA 2PQEA 5CV5A 4HEDA 4A3GH 3GDEA 1D5ZC 4Q5VA 4B3RL 1QCBD 4GS3A 3VYSA 2JA8G 2LXJA 3OPOA 4IUNA 1H9JA 1JB3A 5HY6A 1YZ6A 2CQAA 2WAQB 3EQLC 4OELB 4RGTA 3TDQA 3PO2B 4DV7Q 1VQ9A 1N36L 2F3IA 1V8QA 1VQNA 1LV9A 4A3EB 3PO3G 2G5DA 3KF8B 4X65L 1V1OA 3R8BA 1DOLA 3SK5A 1RTOA 2NTSA 4B9XA 4DUZL 4ZKCB 1EUJA 1TS2A 2UUBL 3GV3A 3DEOA 3OMGA 3K5LA 3AQQA 1UE1A 4J8QA 5EQ0A 2EYPA 2A69D 2NB0A 1GHJA 5DLQE 4NXNQ 3P1HA 4DR2L 3KLRA 1W2BA 1GOZA 3J81c 3JAML 4FF1A 1AZPA 2OCEA 3W3AA 2MP1A 5K36H 5FLXE 2HIXA 1OXXK 4X3SA 3S1RH 3V96A 4X3UA 1WVLA 2ZTDA 1YNJD 1P8LA 5E1FA 1WTWA 3HOYH 4B3RQ 4OONA 1TVXA 3QG1A 1Y1WH 2AWNA 4N8FA 1Q86C 1UE7A 1QZHA 3BDCA 3H0GG 1HTPA 3OTOL 2SNMA 3MFGA 2YTYA 4CJ2C 3K8AA 3Q6SA 3I4MH 3BDLA 1Q82C 5C0XG 1IBML 1EOTA 5FLMG 1Y8OB 4XTCS 4NMZA 1SXTA 2B2UA 4IUVA 4R4QA 1EWIA 2GN5A 2AQ2B 1N36Q 2E74C 1RD9D 4B3ML 2XNAC 1T9HA 4AYBE 4C3JB 2Z6KA 4R4OA 3WWVA 4RG1A 4X65Q 3H91A 1PMRA 4N9TA 1U0LA 4DN4M 3SXHA 2XRSD 2B2VA 2VQFL 4DUZQ 2UUBQ 3LGJA 4EQPA 2N49A 5IGGA 1D7QA 4JVZA 1SLJA 3L7ZC 3WDNA 1GD7A 2NVXH 1SDFA 1A3VA 3A8JE 4MTNA 2NBFA 5LL6S 3SE0A 4PMWA 1PH5A 4OWXB 4A3FB 1E1OA 2OQKA 5FOBB 5ISRA 4KV6A 5IYBG 2JEBI 3U4ZA 1XNQL 1ESRA 4WJ3M 3QO2A 1Q46A 4YHHL 3FEWX 5I4DA 3FRPB 1QJOA 2JP1A 3STBD 3OTOQ 5M3MB 4QCLA 3F2UA 4QUFA 2Z9HA 1IBMQ 1JJ2A 2UUCL 4RAUC 2EPBA 3H94A 3AMUA 5IP7G 1F77A 3G6JB 1SYGA 2R7FA 3TEHB 4LF6L 4B3MQ 3PO2H 3HOVB 2QA4A 3MZ5A 1NR4A 2FINB 3I4OA 3LWUA 2PMZB 4A3EH 2A69C 2JA5B 1J8IA 1A2TA 2WAQE 1IYUA 3KOJA 5H1SE 2VQFQ 1C8CA 2B63G 1N9WA 4A3BG 3PUXA 2UXBL 3UDGA 2KBNA 4CJ0B 4F8MA 5C4ZA 1KABA 4C1NI 3K7UC 5BN5A 2NZHA 2F0MA 3S17B 2CQOA 1H9MA 4FDBA 2PNHA 3BU2A 3DWAA 1B1ZA 1LO5D 5C4XB 1XXGA 4HIDA 1XNQQ 4IURA 4XIGS 1JICA 3DWQA 1IHZA 4LF7L 2F0IA 1CZGA 2A19A 5M9OA 5GAHC 4MTKA 4IO9A 1TS3A 3ONAB 4NPSA 4BY7B 2ZXRA 2UUCQ 3MTSA 4GLAC 3J80c 2JYOA 1DOKA 4KD4A 1ICWA 2EYHA 1C7YA 4NKLA 5IE8A 1KC8C 1CKNA 3MVVA 4L6TB 4TSSA 4YIJA 3NQTA 1QVGA 4C3JH 4R8NA 1VQ6A 4XQNA 5IT9c 2F0QA 3JC66 1IBLL 3RR5A 3RN2A 4CDFC 1BCPF 1E24A 2KA7A 1K0SA 3PCOB 2UXBQ 2OEOA 1KXLA 3OIQA 1K3BC 1OXUA 1D5MC 2A6EC 3CPWA 3VDYA 3N52A 1E0BA 1HPCA 1DONA 3CQZB 2Q2IA 1P16A 2KJXA 2J0TD 1MBYA 4EQNA 4A3FH 4I7AA 3U4VA 3HOZB 2F52A 3WOEA 1G51A 2B39A 2E5LL 1L1OC 5E4WC 4ZK9B 3HOUB 1K8OA 2R92G 4N9PA 4A3CG 2K14A 1OO9B 2K5WA 1BNZA 4RA8A 2ALYB 4LF7Q 1BDOA 4BXXG 3S9WA 4LF9L 4DR3L 5M3MH 3IRBA 2KENA 3CKIB 1CFMA 5I6WA 1S5DD 1S5BD 3LNNA 4JV5L 3HEJA 1PFSA 1QE6A 2JA6B 2NTTA 5KRUA 2PZWA 1KHIA 1Y8PB 1IL8A 1SAPA 4J1MA 4LWCA 2EZVA 3E6ZX 2N8NA 1AH9A 3HOVH 1I4GA 2IJ0A 2K52A 1Q81C 4DXGA 4NP5A 1IBLQ 2JA5H 4P73A 5IYCH 1YJNA 2HD3A 3DXJC 1J5EL 3GTMB 1STNA 2JK8A 3CF5A 2P5ZX 3FHWA 5FLXc 5EPJA 5C5MA 3T51B 4J15A 2RCFA 1KLGD 3F2DA 1VQIA 4TQUS 1HJPA 2RHSB 1X6OA 3NWSA 3Q22A 1K9MC 5FK9C 3RLNA 4BBRB 3AU7A 4DV3L 3S17H 3T4AC 1EEID 1EQQA 1PRTB 1K8MA 1EIYB 2ZJPA 2Y0SB 3OMCA 4LUZA 1G8ZD 3CXCA 2B2TA 2AMCB 1B4OA 1EQRA 5C4XH 5JEAG 2E5LQ 4FF2A 4A3JG 2MGSA 4ZYSA 4V190 4R4CA 3NK9A 5E7NA 3KDFA 4EX5A 1TY0A 3LX0A 4DGZA 4O1NA 3ULLA 1V9PA 3SK4A 5KNCA 4LF9Q 2RDHA 1HUNA 1S4ZA 5M3FB 2OTLA 2EYJA 4GLVB 5IGCA 5JJLA 1HQRD 4BY1B 2ICEC 4JV5Q 4BY7H 3I56A 3VR5A 1FGUA 1O80A 1KD1C 4IQZA 5E3FA 3L0OA 3C46A 4LUVA 2WP8J 4JBMA 3IAYA 1B7YB 4DV4L 4DR7L 2SNSA 3MEFA 3DLLA 1S72A 2F0JA 2B3GA 2JA7G 1GHKA 4OGQC 1K83B 2F0OA 1ILPA 4E6IA 1PZJD 1J5EQ 3CP0A 5T1IA 5EJWA 5G3LF 2R7ZB 2CW0D 1LTID 3J81E 1JOKA 4NB3A 3KLSA 3QB3A 3A8IE 2JJQA 3OIPA 3C1EA 1X3FA 3G6EA 4A3DG 5C5LA 4ZLTF 1SBBB 1ASYA 2VS1A 3CQZH 4DV3Q 3UI2A 1CI3M 4WFN3 4F87A 2K7VA 1QNUA 4BWGB 3M3YB 1J6QA 4M8AA 1EIHA 1I50B 4CBVA 3HOZH 2JXMB 3K6OA 3HOUH 2IX1A 1PDQA 1V43A 4IUUA 4KI0A 3K59A 2IY5B 1EQVA 1PA6A 4IOAA 4UHVA 3I4NB 3GTJB 3EROA 4X66L 4UP9A 1M90C 2XVSA 3F8TA 2KHJA 3I70A 1JMCA 5BR8L 4BBSB 2NN6I 4IOCA 2DJFC 1S5FD 2F0FA 2BE5D 5BN3A 1KLUD 3AFPA 1A0IA 1SJED 3CC4A 2JA6H 1G6ZA 3P75A 4DV4Q 4YCUA 4DR7Q 2VB2X 4V0BA 1HH2P 4DFAA 1NE3A 5I2XA 5HGQA 3OSOA 3MA2B 1PYWD 4A3GB 1KTKA 1G6PA 1FJGL 2R7DA 4HJ8A 2ZJQA 3NXWA 3GTMH 3PF5A 4AH6A 4K2LA 2FFKB 1GUSA 5KIXA 1PLFA 1TIID 2DY7A 3FKIG 2I5MX 3KBXA 4XYQA 1HFNA 3NSWA 2DN8A 1U4MA 3I7FA 3TP5A 5GQOA 3EFXD 2D0OA 1TXYA 2BDOA 2FHTA 3HS0C 4FP5D 4BBRH 1WCMG 1C0AA 4X3KA 1W6KA 4DV2L 1XPOA 3GTGB 3JAME 3RLFA 3V05A 1MD2D 3K5OA 4DPGA 3CRKC 3ER0A 3VA5A 4Z9CB 5IP9G 1CK1A 1LTAD 2M2LA 5I2YA 3E0JA 4X66Q 2Y0SE 2VUMG 4RMFA 2Q2TA 4C3HB 5M3FH 3UDIA 5BR8Q 5C3XA 3HKZE 2VQEL 1CKNB 2LS01 1Y1VB 3PIP3 1PRTC 4BY1H 3MHBA 4DF7A 3RMHA 1BOSA 4K2KA 3MXPA 4JG2A 1HRJA 2EYLA 1R4QB 2KHIA 5FJ8G 1A3UA 1FNWA 5DM73 1EFID 1KL9A 1F9SA 1O78A 2EY5A 2ZTEA 1FJGQ 1GO3E 2O5JC 4A76A 1K83H 2B2UC 1HR0L 2VB3X 4GKJL 1HA6A 2KOLA 1E2ZA 1MSHA 2F0EA 4JC0A 4JI0L 3S1QB 3A8KE 1R4PB 1ZKOA 5FO9B 3CC7A 3NENA 3W5OA 2NUCA 3C3LA 3VR3A 2R7ZH 2Z6KC 5CORA 1EYDA 1B9NA 1EEFD 5C0XI 1E22A 4IFDG 2NZOA 4HSVA 3G7LA 4M1UB 4RH6A 2IL8A 3D8GA 1C9OA 2B2VC 3GV6A 4JI7L 2A8VA 3KJPA 3S2HB 2E75C 3DUZA 1NSNS 1GUNA 4DV2Q 3BVZA 4K5WA 1G91A 4GOPA 3M3YH 1YEZA 1I50H 5EKKA 3PIO3 2UXDL 1X56A 4AQYL 1NNXA 1HQMC 1FR3A 1PHJA 3J80E 1U5KA 1KRTA 3I4NH 3GTJH 4BA1I 5A35A 4HMJA 4APVA 5CYUA 2VQEQ 2NN6G 2HCCA 1UNSA 5IYDG 5LMNW 1LTTD 5KYLA 4JI2L 4BBSH 2A74C 2EOTA 5DM63 2K01A 3AYHB 2Q8IB 2A6HC 5C4JB 4K5VA 4CDDC 3A56A 1STGA 4NDXA 3GTKB 2OXPA 3L3OC 1JE4A 1L0YB 1TS4A 2HQEA 5JPNC 4A3IG 3KYHC 1NBWA 2VW9A 1HR0Q 4LF8L 4GKJQ 4JI0Q 4K0KL 2VY3A 2F3VA 1UE5A 1BBUA 3L2PA 4A3MG 2EY1A 5G3LD 4A3LH 2XIWA 2KQ3A 4RFBA 1DOMA 1C4QA 1U9RA 4DNTB 5L37A 3GTOB 3R93A 3WOFA 2KVMA 1OXSC 4X3TA 1EY7A 3M4OB 3EIVA 1Q7YC 5ELDA 2Z8LA 1QWYA 3CCUA 4JI7Q 1GJXA 2L0CA 1BQQT 2F0VA 3S1MB 1VQAA 2Z0SA 3UE0A 4HJ7A 3P20A 3KDFB 3GTGH 4HCSA 3KLSX 2OQ0A 4AQYQ 2UXDQ 5JJIA 1VQCA 1K8GA 3NHHA 3FMCA 5C44G 1BXTA 1KDCA 2SEBD 1STAA 1SNDA 4A3KG 1X9NA 5IGBA 2NVTB 2J7ZA 4LW1A 1AN8A 4OXPA 1F2YA 4C3HH 1HCZA 2K5NA 4LAAA 4JI2Q 4RGMA 1JORA 3NTHA 5CBAE 1CA5A 1VMCA 2OTJA 2QDBA 3I91A 2WACA 2YU9B 1Y1VH 2YTXA 3H09A 3ULJA 4YCWA 4CKEA 2QEJC 3URYA 1HXYD 1Q8KA 1YIJA 1IL2A 3BZDB 4ME3A 5IGEA 5BN4A 2C9OA 2EQSA 4UPAA 4LF8Q 1SMXA 5M5YB 1EY6A 3OHXC 4K0KQ 4ZCKA 2V1CC 1YITA 1EWCA 1XX8A 1HTLD 3IFTA 1KDAA 3HKZG 2PZTA 4IPGA 3S1QH 1K73C 1MJCA 4Y7NB 4OEMB 4HJAA 3NTIA 2L4NA 3I8ZA 2F0KA 2QDLA 5IIFA 1AZQA 1N33Q 4MNOA 1V1QA 2F0PA 2K5HA 3M4QA 2HUGA 2JEAI 1SNOA 4R1JA 3OYYA 3PUYA 4RHSA 3K7AB 3TP8A 3PF4A 1UEAB 5COYA 2VL6A 4KLKA 1SEBD 1GUTA 1D1KA 4OIJA 1L0WA 3S2HH 2RDFA 2OT2A 2NYZD 2AQ1B 2EJMA 4GNXA 5EPLA 2CHBD 1MIUA 3QJYA 3I4LA 4GN3B 4NW2A 4JI3L 1L1OB 3M7GA 4H0LC 4ZAIA 1ENAA 1XPRA 1SYDA 1FVIA 5EGTA 3NTKA 5CV7A 3S14B 3MEHA 3MXNA 1II3A 4ALPA 4YWLA 2ASBA 2CH4W 1X3EA 1DZ1A 1JWUD 2KECA 2Q2HA 4P75A 5C4JH 2RSNA 4QIWB 4XXEA 1KRSA 2DNEA 4KJNA 3GTKH 2PI2E 1Z7TA 1XWEA 2K33A 3DEPA 2A6ED 5C3EB 4PNYA 3QOLA 2Q8RE 1XTCD 2F0SA 4KKTA 1TT2A 1LTBD 2MHVA 2VXWA 3VYTA 2K6AA 3IL8A 3NP8A 4C3IB 4HCEA 3JAMc 4JBJA 5TSSA 5JJZA 2R93B 4TKOB 1EFWA 4U673 5M5XB 1RJTA 2E2JB 1CT1D 1VQJA 3ERSX 1Y69U 3GTOH 3HOXG 4YWKA 4TVAB 1Q12A 2CKZB 3M4OH 4JK1C 1T5XD 2LXKA 1ZEQX 1BO0A 3TP6A 3MXGA 3MXUA 1PRTF 3S1MH 3BG3A 4IJLA 2BA1A 1XMQQ 5IY0A 4JI3Q 3MFYA 1X3PA 1QG7A 3G4SA 1KIXA 5EPKA 2NVTH 5JVG3 2Z6BA 3I2ZA 1VDZA 2B2TC 4K5XA 4G4KA 1ZXTA 4KN7C 3D6WA 3I55A 1S40A 2ATWA 3NPPA 3HOWB 3SVMA 4RKLA 2YU9H 3EA6A 2EY6A 2EYOA 1WJJA 3X3NA 1CSPA 3SK6A 4PZ7A 3NUCA 4C2MB 4DK3C 4PV1C 4RGNA 4FF4A 3J80i 4AIMA 4B3TQ 4OX9L 2IHFA 1RODA 2IHEA 2IT1A 4DA2A 4DV1L 1WTPA 5M5YH 4JI4Q 4YY3L 1PFBA 3D4WA 3MWYW 2GA4B 4Y7NH 2WB1B 3D31A 3M7NA 3W1BA 4GN4B 1VF5C 2I5LX 2A1AA 4O2DA 5J3BA 4QB4A 4JBWA 1Z9FA 2L9HA 1ILQA 4IPHA 2EY2A 3F2CA 3AB9A 4DAVA 2A73B 4GOPB 3E9IA 5I9PA 4TRDA 1I6HB 3K7AH 2K1BA 5C6AA 5KNBA 4HIMA 4EQOA 1I4XA 2H4OA 4OO1H 1VQHA 3HRZC 4JPBW 3ND8A 2NVQB 5K36G 5C4HA 4K14A 1BBWA 4FXDA 5AJ3Q 3HOYG 1BF4A 1Y1WG 2Z4IA 4X64L 3ND9A 1O7ZA 4LFCL 3S14H 4L5RC 3I4MG 4AYBG 4RCOA 1GM5A 2E8GA 1ENFA 4HJ9A 3T1YL 2K32A 2LY7A 4G7OC 1KAAA 4L5TA 3I3CA 4O42A 4G7HC 1IKLA 2O5IC 1I4RA 5EBCA 1WTHA 1IBKL 3GD7A 4KY7A 5GROA 4OX9Q 2HT1A 4DV1Q 5C3EH 2EDGA 1I4QA 4YY3Q 3CC2A 2L5TA 4JI1L 1WTXA 3K80C 4XDXA 4DV6L 4C3IH 3GTQB 4ZQ3A 3RLOA 2R93H 5M5XH 2E2JH 2LFNA 4L5QA 1D2BA 1O7YA 4KY6A 3S16B 4MIUA 2JA8B 2D5DA 5LMUL 4YWMA 1G291 1XTDA 4DV5L 2MPMA 3NBIA 3Q8DA 1EU3A 4LFBL 1VQEA 4X6AH 2EJGC 4FF3A 4IUTA 2B8GA 3TBIB 4DNIA 3BVGA 1PXUA 3A74A 2AQ3B 3PIPA 4LF4Q 1TWFB 1CA6A 1QUQA 3PO3B 4JOIA 4XT1B 4JI8L 1M8AA 2A68D 2PMZE 1SE4A 2ZXPA 4X64Q 4LFCQ 2BH8A 3A55A 2K5DA 4CHTB 1E3PA 3T1YQ 1ET6A 4A4IA 2F0LA 2DGYA 3HOWH 2FMCA 1E2VA 2E76C 2WAQG 1SJHD 2JQOA 5LHY1 3CCVA 2KCNA 1RKNA 5HGTA 3PO2G 4C2MH 4QQBX 4RCNA 1JJCB 1IBKQ 1PFMA 2N88A 4DK0A 1N8RC 1F2LA 2TSSA 4KY5A 1HZAA 3SGIA 5IGFA 2PPBC 4KHZA 1GVPA 1DYQA 4UP7A 5D3IB 4A3EG 3S15B 4R4TA 1KQSA 3KK7A 4LMQD 4JI1Q 3U50C 3O13A 5CV6A 1LT3D 1S5ED 1RHPA 1VQOA 4DV6Q 2D2CC 2D62A 4BA2I 3J81j 4FXGC 2RDGA 3K5NA 2NWGA 3T53B 5A2QL 3IFDA 4KMUC 5C0XJ 2UUAQ 2ENBA 4DAPA 1DM0B 1B9MA 1O7LA 5AFWA 2L12A 2HIVA 3H0GB 4R4IA 4FYDA 1CHPD 3PIOA 5LMUQ 2K04A 3RZOB 3RN5A 3K0XA 2BDNA 2WB1E 4QF4A 4DV5Q 4GNXB 1I6HH 3A5UA 4LFBQ 1PTOB 4QUCA 1FYCA 3LWEA 2YTVA 1CKOA 1PRTD 3CCLA 1EY8A 3IKJA 4JBKA 4YCVA 1SYCA 1WFQA 4CGYB 4DK1A 2NVQH 3OW2A 3MXNB 1EYGA 4ZUJA 1SNCA 1E7ZA 4JI8Q 4HSPA 1J9OA 2G9HD 1JC7A 4GOPC 3CMEA 1WD1A 4IFDI 1B70B 1EYCA 4PZ8A 3UE1A 4FVMA 4DKAC 3R2IA 1LT5D 1F9PA 2E2IB 4MHEA 2K5QA 1EY9A 3T1HL 1AFPA 3S24A 2XRQD 2D9UA 3U58A 1HNXQ 1YHQA 4X62L 1PTOD 4WJWA 5KYIA 2PW5A 2Q8TA 4PMBA 1H95A 4A93G 2LSSA 4HAEA 4I65A 1V1PA 3GTQH 1CKMA 1BKBA 2M00A 3GP7A 3VYUA 2MO0A 3H3VH 4R9WA 4NXML 3S16H 4IN3A 5IWAQ 2JA8H 2A68C 1EWHA 2N78A 2PO4A 1W6JA 4QL5A 3VYRA 3K5MA 4QGUA 4JYAL 4QY7A 2O2LD 1XYIA 1RL2A 5FO8B 4FNFA 3K58A 2K03A 1YI2A 3PUZA 2F4VL 3CW2C 2MJ8A 1STEA 2A6HD 5ELOA 2XGTA 3VR2A 1A2UA 2ZTCA 1TWFH 5JPMC 1S5CD 2B8FA 3PO3H 5C3WA 3H3VC 3T56B 1U4RA 4DUYL 5M3MG 5K5PA 2B63B 5CR3A 1EL0A 1YJWA 4A3BB 1I6VC 3PQIA 1TQOA 4H13C 3SDZA 3KJOA 1MJEA 1SYEA 4U68A 1R9TB 3BJUA 3EN2A 3T1HQ 1RDPD 3HOVG 2I07B 3EBEA 5CBEE 3BDOA 4X62Q 1YHAA 2CCZA 2JA5G 4DV0L 5IYCG 3S15H 3NEMA 1H9SA 1G2TA 2BA0A 1B50A 3OWFA 3RZDB 2RF4A 3TN2A 1SE8A 3FPPA 3GTPB 1H9KA 1NMGA 1VQ4A 2RBMA 2F0UA 3HGBA 1WTOA 1XNRL 5ELFA 1SRUA 4NXMQ 5I6YA 3H0GH 5F2DA 3RZOH 5C0XH 4HTHA 4JYAQ 3KBGA 5FLMH 2PQAA 3J7A5 1PTOH 1QB5D 3H6MA 4H7BA 5C4XG 2F4VQ 1A62A 1TS5A 3OWEB 1U4PA 2JN4A 1Q8IA 3QWNA 2RKSA 1CHQD 1GUWA 1PH7A 4DUYQ 1ONLA 4FO2A 1VQMA 2F0DA 2PZUA 1RF2D 4HIKA 2XWJB 3HZXA 1SNMA 4GNXC 4A75A 4JI6L 1PTOC 2CFMA 2ZJRA 4WJ4A 1G2SA 1BUVT 1NUCA 4EQ5A 4UAIA 3VA7A 2E2IH 3ZJYC 4UP8A 1PH9A 2FMMA 4OIKA 1SFOB 1B44D 1T5EA 1YJ9A 4DV0Q 4B3SL 2RHQB 3A7LA 1MSGA 1B3AA 1VQPA 4G57A 3UDFA 4HMIA 5CV9A 5IYBH 2R92B 1QILA 3SHLA 2WV6D 3E5SA 3CMAA 3CCRA 1XNRQ 3RD4A 1E2WA 5CMDA 2KUMA 1OTCA 4UY8C 4P2CB 1I5FA 1TWGB 1I94L 3OOCA 1B8AA 1EU4A 2F3WA 1YNXA 1QUQB 5IP7H 1C48A 3HOZG 2L1BA 2IPKD 3VR4A 3G71A 4B9WA 3HOUG 1NJIC 4RKBA 2BH2A 1HUMA 1JR0D 3NE5B 1BBXC 1N33L 5T1GA 3BYTB 5J39A 1CQFA 4JI6Q 1EY5A 1PH2A 2B63H 5I9OA 4A3BH 2QKIC 5EKIA 2JA6G 1ET9A 3X3MA 1IKMA 1R9TH 5ELCA 5JEAJ 4ID6A 3U9OA 1M4VA 2YV5A 4LUOA 3J81i 1HNWL 4DR1L 4B3SQ 5DAUA 5CGKA 2B2WA 1WTQA 1IZ6A 3RZDH 1W3SA 4A3JB 3J7AV 1MKHA 3BYYB 3ULPA 2RSOA 4J6HA 1X32A 3NBHA 2SDFA 3GTPH 5EBDA 4G7ZC 3L9AX 2R61A 5KGUA 4KJOA 4FXKC 5JJKA 1YBYA 5EAYA 3CAMA 1I94Q 1NMFA 4BBRG 1E1TA 1EY4A 1NR2A 4IJHA 3ICEA 4HR7B 4OWTB 2H5XA 2Y0SG 1LTRD 1VQ5A 3CCJA 4LFAL 2JA7B 2CVRA 1Y14B 4LF5L 1VF7A 2KCMA 2I0QA 1VMPA 5J22A
chains in the Genus database with same CATH topology
3AEVA 1B7YB 4DV4L 4DR7L 5M3FG 1DGSA 4GOPB 3E9IA 3MEFA 3DLLA 1PH4A 2MQHA 1S72A 2WB1G 4BY1G 3K7AH 2B3GA 2JA7G 4BY7G 4HIMA 1XJVA 1PH1A 2AHOB 1VQHA 4DAYB 1J5EQ 3CP0A 5K36G 3CPFA 1LM0A 1HNWQ 4DR1Q 1HZBA 3F2BA 1XMQL 1BBWA 1LYLA 2JA9A 1GKHA 1SR3A 5AJ3Q 1QZGA 5ELNA 1SFOH 3HOYG 1Y1WG 4NB3A 2CWPA 2AKWB 2JJQA 4LFCL 1X3FA 4X64L 3G6EA 3S14H 4A3DG 3AFQA 4DV7L 1VQLA 4L5RC 3I4MG 4AYBG 1ASYA 2VS1A 3CQZH 2E8GA 4DV3Q 4HJ9A 1GM5A 2R92H 2R7ZG 3T1YL 4GKKQ 4A3CH 1Q1BA 4L5TA 2NVYH 1PYSB 1J6QA 4MZ9A 4DK6C 1JE5A 3JAMi 4DR4Q 2RCNA 4BXXH 3HFZB 1JJGA 3HOZH 3HKSA 1IBKL 3GD7A 3GTLH 3HOUH 5GROA 4OX9Q 3CCEA 2HT1A 2IX1A 4DV1Q 1V43A 5C3EH 4KI0A 4B3TL 1TWGH 2IY5B 1PA6A 4YY3Q 4IOAA 3A0JA 3CC2A 3TRZA 1HZ9A 4JI1L 3TREA 3HOXH 3M9BA 1PV4A 3K80C 4P72A 4UP9A 4X66L 1M90C 3F8TA 2KHJA 4DV6L 4DR2Q 4JI4L 4POFA 4C3IH 4LFAQ 2GVAA 4NXNL 3RLOA 1JMCA 5BR8L 2EIFA 2NN6I 4IOCA 2VNUD 2R93H 1X3GA 5M5XH 4LF5Q 2E2JH 4PZ6A 5LMNL 1K0RA 3AFPA 1A0IA 3CC4A 4L5QA 1IYJB 3I4NG 2JA6H 2MO1A 4DV4Q 4YCUA 4DR7Q 1HH2P 1AE3A 2KCTA 1NE3A 5LMUL 1PVOA 5HGQA 4BBSG 4YWMA 1G291 3GO5A 1XTDA 4DV5L 4A3GH 3GDEA 3Q8DA 1G6PA 1HZCA 4JOIC 4LFBL 1VQEA 1FJGL 2R7DA 4X6AH 4HJ8A 3E9HA 4B3RL 2ZJQA 3BZCA 3GTMH 2ZM6L 4GS3A 3PF5A 4AH6A 4DNIA 3NELA 2JA8G 1X54A 1PH6A 1KAWA 3A74A 2LXJA 3PIPA 4LF4Q 3FKIG 1QUQA 2I5MX 4A3GG 4JOIA 4OWWB 2CWAA 5HY6A 4JI8L 4IPHA 1YZ6A 2PMZE 5AJ3L 4X64Q 4LFCQ 2BH8A 4DV7Q 3I7FA 1VQ9A 1E3PA 5GQOA 1N36L 2F3IA 4A3LG 3T1YQ 4A3JH 2D0OA 1TXYA 3RNUA 1VQNA 4BBRH 4A4IA 2DGYA 1WCMG 3HOWH 3PO3G 1WYDA 1C0AA 1VQ7A 1EIFA 2WAQG 3KF8B 2JQOA 3CCVA 4DV2L 3PV0A 2PQAB 2QEXA 4X65L 1XPOA 1SN8A 3W1GA 3PO2G 4C2MH 1NTGA 3RLFA 1JJCB 1IBKQ 4QQBX 1N8RC 3SGIA 1HZAA 4DPGA 4KHZA 4DUZL 1GVPA 2UU9L 3KF6A 4UP7A 1EUJA 4A3EG 5GAEC 2UUBL 4R4TA 1KQSA 3ER0A 4JI1Q 3U50C 5IP9G 4HJ5A 3AQQA 1UE1A 4X66Q 2Y0SE 2VUMG 1VQOA 4RMFA 4DV6Q 4BA2I 2D62A 2Q2TA 3J81j 5DLQE 4NXNQ 3CCMA 5M3FH 3UDIA 5BR8Q 3HKZE 2VQEL 3CD6A 4DR2L 1CKNB 4BY1H 5LMNQ 2JA7H 1W2BA 5C0XJ 2UUAQ 3J81c 4JG2A 2HIVA 2OCEA 4R4IA 4IFDJ 3PIOA 5LMUQ 2KHIA 4JCVE 5GADC 2HIXA 5FJ8G 4YHHQ 1OXXK 2DUDA 3K0XA 3RN5A 1X65A 2WB1E 1KL9A 1X55A 1Y1VG 3B6YA 4P74A 3A5UA 2ID0A 4DV5Q 4GNXB 3S1RH 1M1KC 2ZTDA 2ZTEA 1FJGQ 1GO3E 4LFBQ 4A76A 1P8LA 3HOYH 4B3RQ 1K83H 1HR0L 4GKJL 4OONA 1Y1WH 2YTVA 1CKOA 2AWNA 3UDXA 2MNAA 1UE7A 2ZM6Q 1EOVA 4JC0A 1QZHA 3H0GG 4YCVA 3CCLA 4JI0L 1WFQA 3OTOL 3KLWA 4A3DH 2UXCL 2YTYA 2NVQH 3K8AA 3OW2A 3CC7A 3I4MH 3MXNB 5M5WH 3NENA 3W5OA 1Q82C 1EYGA 5C0XG 2R7ZH 1IBML 5FLMG 2Z6KC 1E7ZA 4JI8Q 4XTCS 4LF4L 4LF6Q 5C0XI 1QVFA 1E22A 4R4QA 4JI5L 2NZOA 4IFDG 1EWIA 2GN5A 4GOPC 3CMEA 1N36Q 1K8AC 4IFDI 4B3ML 1B70B 4AYBE 1T9HA 1C9OA 2Z6KA 4PZ8A 2Q2UA 3UE1A 4JI7L 2XTIA 4DKAC 2A8VA 4R4OA 3KJPA 2MFIA 3WWVA 4RG1A 4DV2Q 4X65Q 4GOPA 3M3YH 1YEZA 1U0LA 1I50H 3H15A 3E0EA 2UXDL 3T1HL 1X56A 3S24A 4AQYL 4A93H 2VQFL 4DUZQ 1ASZA 2UU9Q 3U58A 1HNXQ 1PHJA 2UUBQ 3LGJA 3D0FA 1U5KA 2HHHL 1YHQA 4X62L 1QVCA 2N49A 4GLXA 1D7QA 1SLJA 3FP9A 4OO1I 1L2FA 3L7ZC 1KRTA 3GTJH 4BA1I 3I4NH 1GD7A 4APVA 2VQEQ 1TWCH 2NVXH 2NN6G 1H95A 4A93G 5IYDG 4QIWE 5LMNW 2LSSA 4MTNA 1UE6A 4JI2L 4PMWA 1PH5A 3GTQH 1A63A 4BBSH 2C35B 3STBC 3AYHB 4OWXB 1E1OA 2OQKA 3F1ZA 1CKMA 2UUAL 1BKBA 5IYBG 2JEBI 2MO0A 3U4ZA 1XNQL 3H3VH 4NXML 3S16H 5IWAQ 2JA8H 4WJ3M 1Q46A 4A3IG 4YHHL 2N78A 3KYHC 4QL5A 1NBWA 3FKIH 4QGUA 2VW9A 1JB7A 1HR0Q 4LF8L 4QY7A 4JYAL 4GKJQ 1RL2A 4JI0Q 4K0KL 2VY3A 1Q86C 3STBD 3OTOQ 1UE5A 3PUZA 1YI2A 1BBUA 3L2PA 3CW2C 4A3MG 2F4VL 2UXCQ 5ELOA 2XGTA 4A3LH 3M85A 1IBMQ 1JJ2A 2ZTCA 1TWFH 2UUCL 1WCMH 3PO3H 2PI2A 4JI5Q 3G48A 1OXSC 5IP7G 3TS2A 3NBHB 2FXQA 2R7FA 3EIVA 3TEHB 4DUYL 1Q7YC 4LF6L 5M3MG 4B3MQ 3PO2H 3S2DH 2QA4A 3CCUA 4JI7Q 1YJWA 3I4OA 3KJOA 4A3EH 1MJEA 2IX0A 1VQAA 2UXBL 2Z0SA 3UE0A 5IP9H 4HJ7A 2WAQE 2L15A 3KOJA 3KDFB 3BJUA 5H1SE 2VUMH 3GTGH 2UXDQ 3EN2A 2OQ0A 4AQYQ 3T1HQ 4JBKA 2VQFQ 5JJIA 1VQCA 1K8GA 3HOVG 3EBEA 3M4PA 5C44G 1WI5A 2B63G 1A8VA 2HHHQ 1N9WA 4X62Q 4A3BG 1YHAA 4A3KG 3PUXA 2CCZA 2YYZA 3UDGA 1X9NA 2KBNA 4DR5L 4DV0L 5IYCG 1HNXL 2JA5G 3S15H 1K3RA 1CUKA 3NEMA 4LW1A 4OXPA 2BA0A 4P71A 2RF4A 3K7UC 4C3HH 4DAMA 2K5NA 3J7ZC 4JI2Q 2NZHA 2OTJA 1SE8A 5FJ8H 2CQOA 1Y1VH 2YTXA 2PNHA 1NMGA 3BU2A 4FDBA 1HNZL 1VQ4A 1UWVA 3ULJA 4YCWA 1PH8A 1XNRL 4HIDA 1Q8KA 1SRUA 1N34L 1YIJA 4NXMQ 1LTLA 1XNQQ 3H0GH 1IL2A 1N32L 4ME3A 4DR6L 4XIGS 3RZOH 1HR0W 2EQSA 4UPAA 5IWAL 4LF8Q 4JYAQ 1SMXA 1TWAH 3J7A5 5FLMH 2PQAA 2B29A 4DR3Q 2QGQA 3ICEA 4K0KQ 2V1CC 1YITA 4LF7L 2F4VQ 5C4XG 2A19A 4IPGA 5GAHC 1A62A 3HKZG 2K50A 2WFWA 1MJCA 4IO9A 1K73C 3S1QH 1O7IA 4KHPL 4HJAA 4NPSA 2UUCQ 4GLAC 1YVCA 3J80c 4JBMA 1N33Q 1TWHH 4MNOA 1V1QA 1VQFA 1FL0A 2N3SA 2K5HA 3M4QA 4DUYQ 5IE8A 1PH7A 1RIPA 1VQMA 1KC8C 2JEAI 1VQDA 1CKNA 1LUZA 4HIKA 4R1JA 3OYYA 3PUYA 4GNXC 4A75A 4JI6L 1QVGA 3PF4A 4LNQA 4C3JH 2CFMA 2ZJRA 2VL6A 4KLKA 4WJ4A 4O0AA 1L0WA 1VQ6A 1D8LA 5IT9c 3JC66 1IBLL 1OXVA 3BZKA 4EQ5A 3RR5A 3CCSA 3KFUA 3RN2A 3ZJYC 1C7YA 2E2IH 1CSQA 4GNXA 1E24A 4UP8A 1MIUA 4GN3B 5IYDH 4Y52H 3PCOB 1IXRA 4JI3L 1PH9A 3PSIA 2UXBQ 1L1OB 2K5VA 1YJ9A 4DR5Q 4DV0Q 1XPRA 4OO1G 1KXLA 4IPDA 1FVIA 1OXUA 2GVBA 4B3SL 2RHQB 3CPWA 3VDYA 1VCIA 1VQPA 3UDFA 4ALPA 5IYBH 4YWLA 2ASBA 1XPUA 1X3EA 2Q2IA 1P16A 1HNZQ 4A3IH 3TS0A 2I5HA 3CMAA 3CCRA 4A3FH 2R6GA 4P75A 2Q2HA 1XNRQ 5C4JH 3U4VA 1N34Q 2K4KA 1N32Q 2F52A 1VQ8A 1G51A 1KRSA 4DR6Q 2E5LL 3GTKH 1L1OC 2PI2E 4A3MH 1OTCA 2R92G 4QJFA 4UY8C 2E2HH 2EXDA 2K75A 2HQLA 1I5FA 1PYBA 2K14A 1XMOL 1VS0A 1I94L 4POGA 4A3CG 1B8AA 2AWOA 1YNXA 2ALYB 1QUQB 4A3FG 4LF7Q 4BXXG 5IP7H 4LF9L 4DR3L 3HOZG 4KHPQ 1L1OA 5M3MH 4JBJA 3JAMc 3IRBA 3G71A 1UEBA 3HOUG 1NJIC 2KENA 1EFWA 5C3EG 1SROA 2BH2A 1BVSA 4JV5L 1VQJA 1AE2A 1PFSA 3ERSX 1KHIA 3GTOH 3HOXG 4YWKA 1N33L 5GAGC 4TVAB 4LWCA 1Q12A 2CKZB 3M4OH 4JI6Q 2N8NA 1AH9A 1PH2A 2LXKA 3HOVH 2R93G 3PUVA 5C44H 2B63H 1OXTA 2K52A 1Q81C 3PGZA 1VQKA 4A3BH 4A3KH 2OWOA 1I3QH 1IBLQ 2JA6G 2JA5H 3KF6B 4P73A 5IYCH 1YJNA 3S1MH 4IJLA 1J5EL 1R9TH 2BA1A 2JK8A 2D0PA 5JEAJ 5IY0A 1XMQQ 1PH3A 3CF5A 4JI3Q 3H3VI 2YV5A 3FHWA 4LUOA 5FLXc 3J81i 3PUWA 4DR1L 2ES2A 3S2HH 1HNWL 3G4SA 4B3SQ 1KIXA 1YHBA 4HIOA 2NVTH 4J15A 2VZAA 3I2ZA 1S3OA 1Q1EA 3F2DA 1VQIA 1Z47A 4TQUS 1IZ6A 4GN5A 3RZDH 1HJPA 1W3SA 2RHSB 1X6OA 1MKHA 3I55A 1S40A 2ATWA 3TQYA 3ULPA 3RLNA 1K9MC 4DV3L 3S17H 3K81C 2YU9H 4H02A 1EQQA 4GKKL 1EIYB 3GTPH 2ZJPA 1WJJA 1CSPA 4LUZA 4PZ7A 3CXCA 2AMCB 1EQRA 5JEAG 5C4XH 4DR4L 1JT8A 2E5LQ 4DK3C 5JJKA 3J80i 1YBYA 4AIMA 4A3JG 5EAYA 4B3TQ 3CAMA 1XMOQ 1I94Q 1NMFA 4IPCA 4R4CA 4BBRG 5E7NA 1E1TA 1VQGA 4IJHA 4OX9L 2IHFA 2IT1A 2IHEA 4DV1L 3HOWG 1NY4A 3KDFA 4OWTB 2H5XA 4EX5A 5M5YH 3ULLA 4JI4Q 4YY3L 1V9PA 2Y0SG 3CCQA 1VQ5A 4LF9Q 3DM3A 4L5SA 2OTLA 4GLVB 3CCJA 1VQBA 5JJLA 4Y7NH 3D31A 4LFAL 4PG3A 3M7NA 3A5ZB 4JV5Q 3W1BA 4BY7H 3I56A 4GN4B 1FGUA 2JE6I 1I6HH 1Y14B 1KD1C 3S1NH 2I5LX 2A1AA 2KCMA 3L0OA 4O2DA 5J3BA 2I0QA 4LF5L 4JBWA 4LUVA 1Z9FA 2WP8J 3F2CA 1WOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEV A;  1B7Y B;  4DV4 L;  4DR7 L;  5M3F G;  1DGS A;  4GOP B;  3E9I A;  3MEF A;  3DLL A;  1PH4 A;  2MQH A;  1S72 A;  2WB1 G;  4BY1 G;  3K7A H;  2B3G A;  2JA7 G;  4BY7 G;  4HIM A;  1XJV A;  1PH1 A;  2AHO B;  1VQH A;  4DAY B;  1J5E Q;  3CP0 A;  5K36 G;  3CPF A;  1LM0 A;  1HNW Q;  4DR1 Q;  1HZB A;  3F2B A;  1XMQ L;  1BBW A;  1LYL A;  2JA9 A;  1GKH A;  1SR3 A;  5AJ3 Q;  1QZG A;  5ELN A;  1SFO H;  3HOY G;  1Y1W G;  4NB3 A;  2CWP A;  2AKW B;  2JJQ A;  4LFC L;  1X3F A;  4X64 L;  3G6E A;  3S14 H;  4A3D G;  3AFQ A;  4DV7 L;  1VQL A;  4L5R C;  3I4M G;  4AYB G;  1ASY A;  2VS1 A;  3CQZ H;  2E8G A;  4DV3 Q;  4HJ9 A;  1GM5 A;  2R92 H;  2R7Z G;  3T1Y L;  4GKK Q;  4A3C H;  1Q1B A;  4L5T A;  2NVY H;  1PYS B;  1J6Q A;  4MZ9 A;  4DK6 C;  1JE5 A;  3JAM i;  4DR4 Q;  2RCN A;  4BXX H;  3HFZ B;  1JJG A;  3HOZ H;  3HKS A;  1IBK L;  3GD7 A;  3GTL H;  3HOU H;  5GRO A;  4OX9 Q;  3CCE A;  2HT1 A;  2IX1 A;  4DV1 Q;  1V43 A;  5C3E H;  4KI0 A;  4B3T L;  1TWG H;  2IY5 B;  1PA6 A;  4YY3 Q;  4IOA A;  3A0J A;  3CC2 A;  3TRZ A;  1HZ9 A;  4JI1 L;  3TRE A;  3HOX H;  3M9B A;  1PV4 A;  3K80 C;  4P72 A;  4UP9 A;  4X66 L;  1M90 C;  3F8T A;  2KHJ A;  4DV6 L;  4DR2 Q;  4JI4 L;  4POF A;  4C3I H;  4LFA Q;  2GVA A;  4NXN L;  3RLO A;  1JMC A;  5BR8 L;  2EIF A;  2NN6 I;  4IOC A;  2VNU D;  2R93 H;  1X3G A;  5M5X H;  4LF5 Q;  2E2J H;  4PZ6 A;  5LMN L;  1K0R A;  3AFP A;  1A0I A;  3CC4 A;  4L5Q A;  1IYJ B;  3I4N G;  2JA6 H;  2MO1 A;  4DV4 Q;  4YCU A;  4DR7 Q;  1HH2 P;  1AE3 A;  2KCT A;  1NE3 A;  5LMU L;  1PVO A;  5HGQ A;  4BBS G;  4YWM A;  1G29 1;  3GO5 A;  1XTD A;  4DV5 L;  4A3G H;  3GDE A;  3Q8D A;  1G6P A;  1HZC A;  4JOI C;  4LFB L;  1VQE A;  1FJG L;  2R7D A;  4X6A H;  4HJ8 A;  3E9H A;  4B3R L;  2ZJQ A;  3BZC A;  3GTM H;  2ZM6 L;  4GS3 A;  3PF5 A;  4AH6 A;  4DNI A;  3NEL A;  2JA8 G;  1X54 A;  1PH6 A;  1KAW A;  3A74 A;  2LXJ A;  3PIP A;  4LF4 Q;  3FKI G;  1QUQ A;  2I5M X;  4A3G G;  4JOI A;  4OWW B;  2CWA A;  5HY6 A;  4JI8 L;  4IPH A;  1YZ6 A;  2PMZ E;  5AJ3 L;  4X64 Q;  4LFC Q;  2BH8 A;  4DV7 Q;  3I7F A;  1VQ9 A;  1E3P A;  5GQO A;  1N36 L;  2F3I A;  4A3L G;  3T1Y Q;  4A3J H;  2D0O A;  1TXY A;  3RNU A;  1VQN A;  4BBR H;  4A4I A;  2DGY A;  1WCM G;  3HOW H;  3PO3 G;  1WYD A;  1C0A A;  1VQ7 A;  1EIF A;  2WAQ G;  3KF8 B;  2JQO A;  3CCV A;  4DV2 L;  3PV0 A;  2PQA B;  2QEX A;  4X65 L;  1XPO A;  1SN8 A;  3W1G A;  3PO2 G;  4C2M H;  1NTG A;  3RLF A;  1JJC B;  1IBK Q;  4QQB X;  1N8R C;  3SGI A;  1HZA A;  4DPG A;  4KHZ A;  4DUZ L;  1GVP A;  2UU9 L;  3KF6 A;  4UP7 A;  1EUJ A;  4A3E G;  5GAE C;  2UUB L;  4R4T A;  1KQS A;  3ER0 A;  4JI1 Q;  3U50 C;  5IP9 G;  4HJ5 A;  3AQQ A;  1UE1 A;  4X66 Q;  2Y0S E;  2VUM G;  1VQO A;  4RMF A;  4DV6 Q;  4BA2 I;  2D62 A;  2Q2T A;  3J81 j;  5DLQ E;  4NXN Q;  3CCM A;  5M3F H;  3UDI A;  5BR8 Q;  3HKZ E;  2VQE L;  3CD6 A;  4DR2 L;  1CKN B;  4BY1 H;  5LMN Q;  2JA7 H;  1W2B A;  5C0X J;  2UUA Q;  3J81 c;  4JG2 A;  2HIV A;  2OCE A;  4R4I A;  4IFD J;  3PIO A;  5LMU Q;  2KHI A;  4JCV E;  5GAD C;  2HIX A;  5FJ8 G;  4YHH Q;  1OXX K;  2DUD A;  3K0X A;  3RN5 A;  1X65 A;  2WB1 E;  1KL9 A;  1X55 A;  1Y1V G;  3B6Y A;  4P74 A;  3A5U A;  2ID0 A;  4DV5 Q;  4GNX B;  3S1R H;  1M1K C;  2ZTD A;  2ZTE A;  1FJG Q;  1GO3 E;  4LFB Q;  4A76 A;  1P8L A;  3HOY H;  4B3R Q;  1K83 H;  1HR0 L;  4GKJ L;  4OON A;  1Y1W H;  2YTV A;  1CKO A;  2AWN A;  3UDX A;  2MNA A;  1UE7 A;  2ZM6 Q;  1EOV A;  4JC0 A;  1QZH A;  3H0G G;  4YCV A;  3CCL A;  4JI0 L;  1WFQ A;  3OTO L;  3KLW A;  4A3D H;  2UXC L;  2YTY A;  2NVQ H;  3K8A A;  3OW2 A;  3CC7 A;  3I4M H;  3MXN B;  5M5W H;  3NEN A;  3W5O A;  1Q82 C;  1EYG A;  5C0X G;  2R7Z H;  1IBM L;  5FLM G;  2Z6K C;  1E7Z A;  4JI8 Q;  4XTC S;  4LF4 L;  4LF6 Q;  5C0X I;  1QVF A;  1E22 A;  4R4Q A;  4JI5 L;  2NZO A;  4IFD G;  1EWI A;  2GN5 A;  4GOP C;  3CME A;  1N36 Q;  1K8A C;  4IFD I;  4B3M L;  1B70 B;  4AYB E;  1T9H A;  1C9O A;  2Z6K A;  4PZ8 A;  2Q2U A;  3UE1 A;  4JI7 L;  2XTI A;  4DKA C;  2A8V A;  4R4O A;  3KJP A;  2MFI A;  3WWV A;  4RG1 A;  4DV2 Q;  4X65 Q;  4GOP A;  3M3Y H;  1YEZ A;  1U0L A;  1I50 H;  3H15 A;  3E0E A;  2UXD L;  3T1H L;  1X56 A;  3S24 A;  4AQY L;  4A93 H;  2VQF L;  4DUZ Q;  1ASZ A;  2UU9 Q;  3U58 A;  1HNX Q;  1PHJ A;  2UUB Q;  3LGJ A;  3D0F A;  1U5K A;  2HHH L;  1YHQ A;  4X62 L;  1QVC A;  2N49 A;  4GLX A;  1D7Q A;  1SLJ A;  3FP9 A;  4OO1 I;  1L2F A;  3L7Z C;  1KRT A;  3GTJ H;  4BA1 I;  3I4N H;  1GD7 A;  4APV A;  2VQE Q;  1TWC H;  2NVX H;  2NN6 G;  1H95 A;  4A93 G;  5IYD G;  4QIW E;  5LMN W;  2LSS A;  4MTN A;  1UE6 A;  4JI2 L;  4PMW A;  1PH5 A;  3GTQ H;  1A63 A;  4BBS H;  2C35 B;  3STB C;  3AYH B;  4OWX B;  1E1O A;  2OQK A;  3F1Z A;  1CKM A;  2UUA L;  1BKB A;  5IYB G;  2JEB I;  2MO0 A;  3U4Z A;  1XNQ L;  3H3V H;  4NXM L;  3S16 H;  5IWA Q;  2JA8 H;  4WJ3 M;  1Q46 A;  4A3I G;  4YHH L;  2N78 A;  3KYH C;  4QL5 A;  1NBW A;  3FKI H;  4QGU A;  2VW9 A;  1JB7 A;  1HR0 Q;  4LF8 L;  4QY7 A;  4JYA L;  4GKJ Q;  1RL2 A;  4JI0 Q;  4K0K L;  2VY3 A;  1Q86 C;  3STB D;  3OTO Q;  1UE5 A;  3PUZ A;  1YI2 A;  1BBU A;  3L2P A;  3CW2 C;  4A3M G;  2F4V L;  2UXC Q;  5ELO A;  2XGT A;  4A3L H;  3M85 A;  1IBM Q;  1JJ2 A;  2ZTC A;  1TWF H;  2UUC L;  1WCM H;  3PO3 H;  2PI2 A;  4JI5 Q;  3G48 A;  1OXS C;  5IP7 G;  3TS2 A;  3NBH B;  2FXQ A;  2R7F A;  3EIV A;  3TEH B;  4DUY L;  1Q7Y C;  4LF6 L;  5M3M G;  4B3M Q;  3PO2 H;  3S2D H;  2QA4 A;  3CCU A;  4JI7 Q;  1YJW A;  3I4O A;  3KJO A;  4A3E H;  1MJE A;  2IX0 A;  1VQA A;  2UXB L;  2Z0S A;  3UE0 A;  5IP9 H;  4HJ7 A;  2WAQ E;  2L15 A;  3KOJ A;  3KDF B;  3BJU A;  5H1S E;  2VUM H;  3GTG H;  2UXD Q;  3EN2 A;  2OQ0 A;  4AQY Q;  3T1H Q;  4JBK A;  2VQF Q;  5JJI A;  1VQC A;  1K8G A;  3HOV G;  3EBE A;  3M4P A;  5C44 G;  1WI5 A;  2B63 G;  1A8V A;  2HHH Q;  1N9W A;  4X62 Q;  4A3B G;  1YHA A;  4A3K G;  3PUX A;  2CCZ A;  2YYZ A;  3UDG A;  1X9N A;  2KBN A;  4DR5 L;  4DV0 L;  5IYC G;  1HNX L;  2JA5 G;  3S15 H;  1K3R A;  1CUK A;  3NEM A;  4LW1 A;  4OXP A;  2BA0 A;  4P71 A;  2RF4 A;  3K7U C;  4C3H H;  4DAM A;  2K5N A;  3J7Z C;  4JI2 Q;  2NZH A;  2OTJ A;  1SE8 A;  5FJ8 H;  2CQO A;  1Y1V H;  2YTX A;  2PNH A;  1NMG A;  3BU2 A;  4FDB A;  1HNZ L;  1VQ4 A;  1UWV A;  3ULJ A;  4YCW A;  1PH8 A;  1XNR L;  4HID A;  1Q8K A;  1SRU A;  1N34 L;  1YIJ A;  4NXM Q;  1LTL A;  1XNQ Q;  3H0G H;  1IL2 A;  1N32 L;  4ME3 A;  4DR6 L;  4XIG S;  3RZO H;  1HR0 W;  2EQS A;  4UPA A;  5IWA L;  4LF8 Q;  4JYA Q;  1SMX A;  1TWA H;  3J7A 5;  5FLM H;  2PQA A;  2B29 A;  4DR3 Q;  2QGQ A;  3ICE A;  4K0K Q;  2V1C C;  1YIT A;  4LF7 L;  2F4V Q;  5C4X G;  2A19 A;  4IPG A;  5GAH C;  1A62 A;  3HKZ G;  2K50 A;  2WFW A;  1MJC A;  4IO9 A;  1K73 C;  3S1Q H;  1O7I A;  4KHP L;  4HJA A;  4NPS A;  2UUC Q;  4GLA C;  1YVC A;  3J80 c;  4JBM A;  1N33 Q;  1TWH H;  4MNO A;  1V1Q A;  1VQF A;  1FL0 A;  2N3S A;  2K5H A;  3M4Q A;  4DUY Q;  5IE8 A;  1PH7 A;  1RIP A;  1VQM A;  1KC8 C;  2JEA I;  1VQD A;  1CKN A;  1LUZ A;  4HIK A;  4R1J A;  3OYY A;  3PUY A;  4GNX C;  4A75 A;  4JI6 L;  1QVG A;  3PF4 A;  4LNQ A;  4C3J H;  2CFM A;  2ZJR A;  2VL6 A;  4KLK A;  4WJ4 A;  4O0A A;  1L0W A;  1VQ6 A;  1D8L A;  5IT9 c;  3JC6 6;  1IBL L;  1OXV A;  3BZK A;  4EQ5 A;  3RR5 A;  3CCS A;  3KFU A;  3RN2 A;  3ZJY C;  1C7Y A;  2E2I H;  1CSQ A;  4GNX A;  1E24 A;  4UP8 A;  1MIU A;  4GN3 B;  5IYD H;  4Y52 H;  3PCO B;  1IXR A;  4JI3 L;  1PH9 A;  3PSI A;  2UXB Q;  1L1O B;  2K5V A;  1YJ9 A;  4DR5 Q;  4DV0 Q;  1XPR A;  4OO1 G;  1KXL A;  4IPD A;  1FVI A;  1OXU A;  2GVB A;  4B3S L;  2RHQ B;  3CPW A;  3VDY A;  1VCI A;  1VQP A;  3UDF A;  4ALP A;  5IYB H;  4YWL A;  2ASB A;  1XPU A;  1X3E A;  2Q2I A;  1P16 A;  1HNZ Q;  4A3I H;  3TS0 A;  2I5H A;  3CMA A;  3CCR A;  4A3F H;  2R6G A;  4P75 A;  2Q2H A;  1XNR Q;  5C4J H;  3U4V A;  1N34 Q;  2K4K A;  1N32 Q;  2F52 A;  1VQ8 A;  1G51 A;  1KRS A;  4DR6 Q;  2E5L L;  3GTK H;  1L1O C;  2PI2 E;  4A3M H;  1OTC A;  2R92 G;  4QJF A;  4UY8 C;  2E2H H;  2EXD A;  2K75 A;  2HQL A;  1I5F A;  1PYB A;  2K14 A;  1XMO L;  1VS0 A;  1I94 L;  4POG A;  4A3C G;  1B8A A;  2AWO A;  1YNX A;  2ALY B;  1QUQ B;  4A3F G;  4LF7 Q;  4BXX G;  5IP7 H;  4LF9 L;  4DR3 L;  3HOZ G;  4KHP Q;  1L1O A;  5M3M H;  4JBJ A;  3JAM c;  3IRB A;  3G71 A;  1UEB A;  3HOU G;  1NJI C;  2KEN A;  1EFW A;  5C3E G;  1SRO A;  2BH2 A;  1BVS A;  4JV5 L;  1VQJ A;  1AE2 A;  1PFS A;  3ERS X;  1KHI A;  3GTO H;  3HOX G;  4YWK A;  1N33 L;  5GAG C;  4TVA B;  4LWC A;  1Q12 A;  2CKZ B;  3M4O H;  4JI6 Q;  2N8N A;  1AH9 A;  1PH2 A;  2LXK A;  3HOV H;  2R93 G;  3PUV A;  5C44 H;  2B63 H;  1OXT A;  2K52 A;  1Q81 C;  3PGZ A;  1VQK A;  4A3B H;  4A3K H;  2OWO A;  1I3Q H;  1IBL Q;  2JA6 G;  2JA5 H;  3KF6 B;  4P73 A;  5IYC H;  1YJN A;  3S1M H;  4IJL A;  1J5E L;  1R9T H;  2BA1 A;  2JK8 A;  2D0P A;  5JEA J;  5IY0 A;  1XMQ Q;  1PH3 A;  3CF5 A;  4JI3 Q;  3H3V I;  2YV5 A;  3FHW A;  4LUO A;  5FLX c;  3J81 i;  3PUW A;  4DR1 L;  2ES2 A;  3S2H H;  1HNW L;  3G4S A;  4B3S Q;  1KIX A;  1YHB A;  4HIO A;  2NVT H;  4J15 A;  2VZA A;  3I2Z A;  1S3O A;  1Q1E A;  3F2D A;  1VQI A;  1Z47 A;  4TQU S;  1IZ6 A;  4GN5 A;  3RZD H;  1HJP A;  1W3S A;  2RHS B;  1X6O A;  1MKH A;  3I55 A;  1S40 A;  2ATW A;  3TQY A;  3ULP A;  3RLN A;  1K9M C;  4DV3 L;  3S17 H;  3K81 C;  2YU9 H;  4H02 A;  1EQQ A;  4GKK L;  1EIY B;  3GTP H;  2ZJP A;  1WJJ A;  1CSP A;  4LUZ A;  4PZ7 A;  3CXC A;  2AMC B;  1EQR A;  5JEA G;  5C4X H;  4DR4 L;  1JT8 A;  2E5L Q;  4DK3 C;  5JJK A;  3J80 i;  1YBY A;  4AIM A;  4A3J G;  5EAY A;  4B3T Q;  3CAM A;  1XMO Q;  1I94 Q;  1NMF A;  4IPC A;  4R4C A;  4BBR G;  5E7N A;  1E1T A;  1VQG A;  4IJH A;  4OX9 L;  2IHF A;  2IT1 A;  2IHE A;  4DV1 L;  3HOW G;  1NY4 A;  3KDF A;  4OWT B;  2H5X A;  4EX5 A;  5M5Y H;  3ULL A;  4JI4 Q;  4YY3 L;  1V9P A;  2Y0S G;  3CCQ A;  1VQ5 A;  4LF9 Q;  3DM3 A;  4L5S A;  2OTL A;  4GLV B;  3CCJ A;  1VQB A;  5JJL A;  4Y7N H;  3D31 A;  4LFA L;  4PG3 A;  3M7N A;  3A5Z B;  4JV5 Q;  3W1B A;  4BY7 H;  3I56 A;  4GN4 B;  1FGU A;  2JE6 I;  1I6H H;  1Y14 B;  1KD1 C;  3S1N H;  2I5L X;  2A1A A;  2KCM A;  3L0O A;  4O2D A;  5J3B A;  2I0Q A;  4LF5 L;  4JBW A;  4LUV A;  1Z9F A;  2WP8 J;  3F2C A;  1WOC A; 
#chains in the Genus database with same CATH topology
 3AEV A;  5J1Z A;  2QCP X;  5M3F G;  1PH4 A;  1ML0 D;  2MQH A;  1EIG A;  2RA4 A;  4LK1 C;  4BY1 G;  3Q0A A;  1XJV A;  1PH1 A;  2AHO B;  4ILW A;  4HN7 A;  4A3D B;  3CPF A;  4CKB A;  2XWB B;  5M5W B;  3Q23 A;  1LM0 A;  1ZYR C;  2C5C A;  2EXZ A;  2H1E A;  5KND A;  3F2B A;  4DR1 Q;  1XMQ L;  1HNW Q;  2JA9 A;  1SR3 A;  1QZG A;  1SFO H;  1D5X C;  1V1P B;  3FVQ A;  2AUJ D;  4IUQ A;  3T13 A;  2CWP A;  3C1F A;  2AKW B;  1VQL A;  5JAV A;  2R92 H;  3A54 A;  2R7Z G;  1ENC A;  4L8J A;  4JW0 A;  4DU9 A;  4A3C H;  1Q1B A;  4DK6 C;  1JE5 A;  3JAM i;  2I46 A;  4BXX H;  1JJG A;  4A93 B;  3HKS A;  2KHS A;  3CCE A;  3NWT A;  4B3T L;  1TWG H;  3TME A;  3U9S A;  2B2Y A;  3A0J A;  2A5H A;  1Q3L A;  1CTM A;  2KEE A;  4K8I A;  3OW7 A;  3M9B A;  2L11 A;  4JI4 L;  2WII B;  1TWC B;  4DR2 Q;  2NZ1 D;  4LFA Q;  3BS1 A;  3M4Y A;  2VNU D;  1CZW A;  4LF5 Q;  3ZYY X;  4PZ6 A;  5LMN L;  1K0R A;  1SE2 A;  1IYJ B;  3I4N G;  1K28 A;  4PQX A;  3J80 L;  5IOC A;  1AE3 A;  1PVO A;  3J7A F;  4BBS G;  5CC4 A;  4UDU C;  3GO5 A;  3FKI B;  1HZC A;  3R2T A;  4JOI C;  4ABN A;  3E9H A;  3BZC A;  4KKU A;  2ZM6 L;  3NEL A;  1H9S B;  4RWS C;  1X54 A;  2QIL A;  1PH6 A;  1KAW A;  5IT9 L;  2K05 A;  3HG9 A;  1IYV A;  1WCM B;  3DMU A;  4A3G G;  4OWW B;  2CWA A;  5AJ3 L;  3HP3 A;  2WKD A;  4EVO A;  4K6L A;  5JEA H;  3S2D B;  5JOB A;  1JOO A;  4A3L G;  4A3J H;  3RNU A;  2X6L A;  1WYD A;  4ZUI A;  5A2Q E;  4KHV A;  1VQ7 A;  1EIF A;  2VUM B;  3PV0 A;  2PQA B;  2QEX A;  1SN8 A;  3W1G A;  1NTG A;  1D1I A;  3RUZ A;  3ITP A;  2UU9 L;  3KF6 A;  1STH A;  5GAE C;  3QIA A;  5EKL A;  4HJ5 A;  1PTO F;  3ERQ A;  4ZRZ A;  5ELB A;  3CCM A;  1YNJ C;  2N55 A;  3CD6 A;  4XT3 B;  5LMN Q;  2JA7 H;  3I72 A;  2FJ2 A;  1A6X A;  1LAB A;  4H44 C;  2HCI A;  4C56 C;  4IFD J;  4C3H G;  4JCV E;  5GAD C;  4YHH Q;  2DUD A;  1X65 A;  4P74 A;  1X55 A;  1Y1V G;  4IZ8 A;  3B6Y A;  1TWA B;  1M1K C;  2ID0 A;  4WOR A;  4K6D A;  2DJG C;  3UDX A;  2MNA A;  2ZM6 Q;  1EOV A;  3KLW A;  4A3D H;  2UXC L;  5M5W H;  1TWH B;  4LF4 L;  3E3X A;  2QW7 A;  4XQQ A;  4LF6 Q;  1QVF A;  4JI5 L;  2QF7 A;  4IAL A;  5FLX L;  1K8A C;  1HFG A;  4RHR A;  2Q2U A;  2XTI A;  1BR9 A;  3DHQ A;  2MFI A;  1IW7 D;  1KDB A;  3H15 A;  2KCC A;  3E0E A;  1KNA A;  4A93 H;  1ASZ A;  2UU9 Q;  3K57 A;  2PCF B;  4DAY A;  3D0F A;  2HHH L;  1QVC A;  4GLX A;  1KNE A;  3FP9 A;  1GUO A;  4OO1 I;  1L2F A;  1NCV A;  1SYF A;  2HDL A;  5IOD A;  1TWC H;  1GXD C;  4KD3 A;  4QIW E;  1UE6 A;  2CH4 A;  1A63 A;  4OHJ A;  4A3I B;  2C35 B;  1STB A;  3STB C;  3F1Z A;  2UUA L;  3TP7 A;  4A3M B;  5JVH 3;  1TU2 B;  2E2H B;  1TR5 A;  2OF1 A;  1MGS A;  3DM1 A;  3FKI H;  1JB7 A;  4F7X A;  1AEX A;  5HUR A;  2Z4H A;  1SE3 A;  2ZXO A;  3K0Y A;  2UXC Q;  4BS9 A;  4WRD A;  5LL6 X;  3M85 A;  3SR1 A;  1EYA A;  1WCM H;  5FO7 B;  1Y8N B;  2PI2 A;  4JI5 Q;  4IUP A;  1DD2 A;  2L55 A;  3G48 A;  3TS2 A;  3NBH B;  2FXQ A;  1F9R A;  4ODG A;  3QR8 A;  3S2D H;  4CJ1 B;  2F1M A;  3DWP A;  5C44 B;  3BVM A;  4QMG A;  1JOQ A;  4A3K B;  5E4X A;  1I3Q B;  2PW7 A;  1LAC A;  2IX0 A;  5IP9 H;  2K28 A;  2L15 A;  2VUM H;  3D4D A;  2J4X A;  1STY A;  1QOH A;  3M4P A;  1WI5 A;  1LTS D;  1A8V A;  2HHH Q;  2YYZ A;  1HNX L;  4DR5 L;  1I4P A;  1K3R A;  1CUK A;  3SEB A;  4CKC A;  2IW3 A;  4P71 A;  5DNF A;  3VR6 A;  3J7Z C;  5CV8 A;  4DAM A;  2R3Z A;  1MHW C;  2Z1C A;  5FJ8 H;  1PZI D;  4F88 A;  1HNZ L;  1UWV A;  1RTN A;  4LJZ C;  1PH8 A;  1N34 L;  3HKZ B;  1N32 L;  1LTL A;  3CRL C;  4DR6 L;  1X3Q A;  3Q24 A;  1HR0 W;  3KF8 A;  5IWA L;  1TWA H;  1YNN D;  2B29 A;  2F0T A;  4DR3 Q;  2QGQ A;  2LKV A;  4IFD H;  1DJR D;  4CDC C;  2M9V A;  1JWS D;  2K50 A;  2WFW A;  1Q90 A;  4MN3 A;  4XYO A;  4KHP L;  1O7I A;  1PZK D;  3I90 A;  1IW7 C;  1YVC A;  3S1N B;  1A15 A;  1TWH H;  3J7Y W;  5NUC A;  1RCV D;  2PYK A;  1VQF A;  2N3S A;  1FL0 A;  3D4R A;  2BOS A;  1RIP A;  3V2T A;  1VQD A;  3SK8 A;  1LT4 D;  1AW7 A;  1LUZ A;  1SMY D;  2IWH A;  1JCK B;  2F4I A;  4LNQ A;  1PFN A;  3MC0 B;  1UUP A;  4O0A A;  4S3S A;  2G9D A;  1D8L A;  1EZ8 A;  3KFU A;  1OXV A;  3BZK A;  3CCS A;  1SNQ A;  1FNU A;  1H9R A;  1CSQ A;  2NN6 H;  5IYD H;  4Y52 H;  1IXR A;  1UAP A;  3PSI A;  4DNR B;  1LLR D;  4C3J G;  2K5V A;  4DR5 Q;  4OO1 G;  4IPD A;  1ESF A;  2GVB A;  4ULL A;  2EVB A;  1VCI A;  3NQI A;  4KTA A;  2O4X A;  1XPU A;  4EGV A;  3EJI A;  1AP0 A;  1HNZ Q;  2DY8 A;  4A3I H;  3FDT A;  3TS0 A;  2I5H A;  2NVY B;  2EYM A;  2F0W A;  2F0N A;  2R6G A;  1N34 Q;  1BCP B;  1N32 Q;  2K4K A;  2WKC A;  1ICF B;  1VQ8 A;  1U4L A;  4DR6 Q;  3R3O A;  3GTL B;  1DXM A;  4A3M H;  4QJF A;  2E2H H;  1FD7 D;  2EXD A;  2K75 A;  2HQL A;  2E2D C;  1PYB A;  1XMO L;  1WD0 A;  1VS0 A;  5IGD A;  4POG A;  3TSS A;  2EYF A;  1F2M A;  2AWO A;  3TZD A;  4ME5 A;  4A3F G;  3HOX B;  4KHP Q;  1L1O A;  1UEB A;  3T16 A;  5C3E G;  1SRO A;  1BVS A;  3W2D A;  1AE2 A;  3I73 A;  5GAG C;  4C3I G;  4GZY C;  2R93 G;  3PUV A;  2RVL A;  2X6G A;  5C44 H;  3PMF A;  1OXT A;  3PGZ A;  1VQK A;  4A3K H;  2OWO A;  1I3Q H;  1NAP A;  2F0H A;  3KF6 B;  1QNK A;  5D65 A;  1LT6 D;  2B2W C;  2RQX A;  1BCP D;  2D0P A;  4KK7 A;  1PH3 A;  4ZKB B;  3H3V I;  2IX3 A;  2F03 A;  1FGB D;  5DEH A;  3PUW A;  2ES2 A;  1B3Q A;  3C2P A;  4K8J A;  1YHB A;  4C1N K;  4HIO A;  2SOB A;  2VZA A;  1S3O A;  1Q1E A;  4B08 A;  1Z47 A;  3GQB A;  4GN5 A;  2PNR C;  1JQY D;  1YNN C;  3TQY A;  1L0X B;  1WTV A;  3K81 C;  4N8X 1;  4H02 A;  4GKK L;  3CHB D;  1TKW B;  2ZT9 C;  4DR4 L;  1JT8 A;  1EY0 A;  1XMO Q;  4IPC A;  3MAQ A;  3HOW G;  1VQG A;  1LTG D;  4XQJ A;  1NY4 A;  2V4D A;  4L63 B;  3CCQ A;  1SMY C;  1HHV A;  3DM3 A;  4Q0F A;  1I4H A;  4L5S A;  5ELE A;  1VQB A;  5FKA C;  2HDM A;  1SYB A;  4PG3 A;  3A5Z B;  3A7A B;  2MUY A;  3EVQ A;  2JE6 I;  1SSO A;  3S1N H;  2CW0 C;  1WOC A;  1DCZ A;  4DXF A;  2WIN B;  1DGS A;  1D6E C;  3CU7 A;  2EE1 A;  3P7J A;  2WB1 G;  3S1R B;  1TY2 A;  4BY7 G;  2AUK A;  3HOY B;  4I7Z C;  5KEE A;  1CM9 A;  3QOJ A;  4DAY B;  1Y1W B;  2LMC B;  1Z6H A;  1B53 A;  3TZU A;  3I4M B;  4AYB B;  4PMC A;  1HZB A;  2ICI A;  1LYL A;  1FNV A;  1GKH A;  5ELN A;  1CQV A;  1EQT A;  1EZ6 A;  1WTR A;  1B2T A;  2XN9 C;  1JWM D;  3AFQ A;  4DV7 L;  2F0G A;  1GUG A;  4GKK Q;  1F2Z A;  2DNC A;  2X69 A;  1MI2 A;  1A3T A;  2B2Y C;  4MZ9 A;  2NVY H;  1PYS B;  1ZYR D;  5CV4 A;  3KUP A;  2RCN A;  4DR4 Q;  3HFZ B;  1SNP A;  2BE5 C;  4OL7 A;  3N6R A;  4KN4 C;  3GTL H;  3J81 L;  2BCO A;  2XSC A;  2KED A;  4RGO S;  4R8I A;  3D6C A;  3TRZ A;  1F9Q A;  1HZ9 A;  2JSO A;  3TRE A;  3HOX H;  1PV4 A;  4P72 A;  2NVX B;  4POF A;  2GVA A;  4NXN L;  2EIF A;  5D14 A;  4CDE C;  3D3R A;  1X3G A;  2TMP A;  5D3D A;  5IT9 E;  1BCP C;  4KKS A;  2EJF C;  2MO1 A;  3FPU B;  1HA5 A;  2KCT A;  2PQE A;  5CV5 A;  4HED A;  4A3G H;  3GDE A;  1D5Z C;  4Q5V A;  4B3R L;  1QCB D;  4GS3 A;  3VYS A;  2JA8 G;  2LXJ A;  3OPO A;  4IUN A;  1H9J A;  1JB3 A;  5HY6 A;  1YZ6 A;  2CQA A;  2WAQ B;  3EQL C;  4OEL B;  4RGT A;  3TDQ A;  3PO2 B;  4DV7 Q;  1VQ9 A;  1N36 L;  2F3I A;  1V8Q A;  1VQN A;  1LV9 A;  4A3E B;  3PO3 G;  2G5D A;  3KF8 B;  4X65 L;  1V1O A;  3R8B A;  1DOL A;  3SK5 A;  1RTO A;  2NTS A;  4B9X A;  4DUZ L;  4ZKC B;  1EUJ A;  1TS2 A;  2UUB L;  3GV3 A;  3DEO A;  3OMG A;  3K5L A;  3AQQ A;  1UE1 A;  4J8Q A;  5EQ0 A;  2EYP A;  2A69 D;  2NB0 A;  1GHJ A;  5DLQ E;  4NXN Q;  3P1H A;  4DR2 L;  3KLR A;  1W2B A;  1GOZ A;  3J81 c;  3JAM L;  4FF1 A;  1AZP A;  2OCE A;  3W3A A;  2MP1 A;  5K36 H;  5FLX E;  2HIX A;  1OXX K;  4X3S A;  3S1R H;  3V96 A;  4X3U A;  1WVL A;  2ZTD A;  1YNJ D;  1P8L A;  5E1F A;  1WTW A;  3HOY H;  4B3R Q;  4OON A;  1TVX A;  3QG1 A;  1Y1W H;  2AWN A;  4N8F A;  1Q86 C;  1UE7 A;  1QZH A;  3BDC A;  3H0G G;  1HTP A;  3OTO L;  2SNM A;  3MFG A;  2YTY A;  4CJ2 C;  3K8A A;  3Q6S A;  3I4M H;  3BDL A;  1Q82 C;  5C0X G;  1IBM L;  1EOT A;  5FLM G;  1Y8O B;  4XTC S;  4NMZ A;  1SXT A;  2B2U A;  4IUV A;  4R4Q A;  1EWI A;  2GN5 A;  2AQ2 B;  1N36 Q;  2E74 C;  1RD9 D;  4B3M L;  2XNA C;  1T9H A;  4AYB E;  4C3J B;  2Z6K A;  4R4O A;  3WWV A;  4RG1 A;  4X65 Q;  3H91 A;  1PMR A;  4N9T A;  1U0L A;  4DN4 M;  3SXH A;  2XRS D;  2B2V A;  2VQF L;  4DUZ Q;  2UUB Q;  3LGJ A;  4EQP A;  2N49 A;  5IGG A;  1D7Q A;  4JVZ A;  1SLJ A;  3L7Z C;  3WDN A;  1GD7 A;  2NVX H;  1SDF A;  1A3V A;  3A8J E;  4MTN A;  2NBF A;  5LL6 S;  3SE0 A;  4PMW A;  1PH5 A;  4OWX B;  4A3F B;  1E1O A;  2OQK A;  5FOB B;  5ISR A;  4KV6 A;  5IYB G;  2JEB I;  3U4Z A;  1XNQ L;  1ESR A;  4WJ3 M;  3QO2 A;  1Q46 A;  4YHH L;  3FEW X;  5I4D A;  3FRP B;  1QJO A;  2JP1 A;  3STB D;  3OTO Q;  5M3M B;  4QCL A;  3F2U A;  4QUF A;  2Z9H A;  1IBM Q;  1JJ2 A;  2UUC L;  4RAU C;  2EPB A;  3H94 A;  3AMU A;  5IP7 G;  1F77 A;  3G6J B;  1SYG A;  2R7F A;  3TEH B;  4LF6 L;  4B3M Q;  3PO2 H;  3HOV B;  2QA4 A;  3MZ5 A;  1NR4 A;  2FIN B;  3I4O A;  3LWU A;  2PMZ B;  4A3E H;  2A69 C;  2JA5 B;  1J8I A;  1A2T A;  2WAQ E;  1IYU A;  3KOJ A;  5H1S E;  2VQF Q;  1C8C A;  2B63 G;  1N9W A;  4A3B G;  3PUX A;  2UXB L;  3UDG A;  2KBN A;  4CJ0 B;  4F8M A;  5C4Z A;  1KAB A;  4C1N I;  3K7U C;  5BN5 A;  2NZH A;  2F0M A;  3S17 B;  2CQO A;  1H9M A;  4FDB A;  2PNH A;  3BU2 A;  3DWA A;  1B1Z A;  1LO5 D;  5C4X B;  1XXG A;  4HID A;  1XNQ Q;  4IUR A;  4XIG S;  1JIC A;  3DWQ A;  1IHZ A;  4LF7 L;  2F0I A;  1CZG A;  2A19 A;  5M9O A;  5GAH C;  4MTK A;  4IO9 A;  1TS3 A;  3ONA B;  4NPS A;  4BY7 B;  2ZXR A;  2UUC Q;  3MTS A;  4GLA C;  3J80 c;  2JYO A;  1DOK A;  4KD4 A;  1ICW A;  2EYH A;  1C7Y A;  4NKL A;  5IE8 A;  1KC8 C;  1CKN A;  3MVV A;  4L6T B;  4TSS A;  4YIJ A;  3NQT A;  1QVG A;  4C3J H;  4R8N A;  1VQ6 A;  4XQN A;  5IT9 c;  2F0Q A;  3JC6 6;  1IBL L;  3RR5 A;  3RN2 A;  4CDF C;  1BCP F;  1E24 A;  2KA7 A;  1K0S A;  3PCO B;  2UXB Q;  2OEO A;  1KXL A;  3OIQ A;  1K3B C;  1OXU A;  1D5M C;  2A6E C;  3CPW A;  3VDY A;  3N52 A;  1E0B A;  1HPC A;  1DON A;  3CQZ B;  2Q2I A;  1P16 A;  2KJX A;  2J0T D;  1MBY A;  4EQN A;  4A3F H;  4I7A A;  3U4V A;  3HOZ B;  2F52 A;  3WOE A;  1G51 A;  2B39 A;  2E5L L;  1L1O C;  5E4W C;  4ZK9 B;  3HOU B;  1K8O A;  2R92 G;  4N9P A;  4A3C G;  2K14 A;  1OO9 B;  2K5W A;  1BNZ A;  4RA8 A;  2ALY B;  4LF7 Q;  1BDO A;  4BXX G;  3S9W A;  4LF9 L;  4DR3 L;  5M3M H;  3IRB A;  2KEN A;  3CKI B;  1CFM A;  5I6W A;  1S5D D;  1S5B D;  3LNN A;  4JV5 L;  3HEJ A;  1PFS A;  1QE6 A;  2JA6 B;  2NTT A;  5KRU A;  2PZW A;  1KHI A;  1Y8P B;  1IL8 A;  1SAP A;  4J1M A;  4LWC A;  2EZV A;  3E6Z X;  2N8N A;  1AH9 A;  3HOV H;  1I4G A;  2IJ0 A;  2K52 A;  1Q81 C;  4DXG A;  4NP5 A;  1IBL Q;  2JA5 H;  4P73 A;  5IYC H;  1YJN A;  2HD3 A;  3DXJ C;  1J5E L;  3GTM B;  1STN A;  2JK8 A;  3CF5 A;  2P5Z X;  3FHW A;  5FLX c;  5EPJ A;  5C5M A;  3T51 B;  4J15 A;  2RCF A;  1KLG D;  3F2D A;  1VQI A;  4TQU S;  1HJP A;  2RHS B;  1X6O A;  3NWS A;  3Q22 A;  1K9M C;  5FK9 C;  3RLN A;  4BBR B;  3AU7 A;  4DV3 L;  3S17 H;  3T4A C;  1EEI D;  1EQQ A;  1PRT B;  1K8M A;  1EIY B;  2ZJP A;  2Y0S B;  3OMC A;  4LUZ A;  1G8Z D;  3CXC A;  2B2T A;  2AMC B;  1B4O A;  1EQR A;  5C4X H;  5JEA G;  2E5L Q;  4FF2 A;  4A3J G;  2MGS A;  4ZYS A;  4V19 0;  4R4C A;  3NK9 A;  5E7N A;  3KDF A;  4EX5 A;  1TY0 A;  3LX0 A;  4DGZ A;  4O1N A;  3ULL A;  1V9P A;  3SK4 A;  5KNC A;  4LF9 Q;  2RDH A;  1HUN A;  1S4Z A;  5M3F B;  2OTL A;  2EYJ A;  4GLV B;  5IGC A;  5JJL A;  1HQR D;  4BY1 B;  2ICE C;  4JV5 Q;  4BY7 H;  3I56 A;  3VR5 A;  1FGU A;  1O80 A;  1KD1 C;  4IQZ A;  5E3F A;  3L0O A;  3C46 A;  4LUV A;  2WP8 J;  4JBM A;  3IAY A;  1B7Y B;  4DV4 L;  4DR7 L;  2SNS A;  3MEF A;  3DLL A;  1S72 A;  2F0J A;  2B3G A;  2JA7 G;  1GHK A;  4OGQ C;  1K83 B;  2F0O A;  1ILP A;  4E6I A;  1PZJ D;  1J5E Q;  3CP0 A;  5T1I A;  5EJW A;  5G3L F;  2R7Z B;  2CW0 D;  1LTI D;  3J81 E;  1JOK A;  4NB3 A;  3KLS A;  3QB3 A;  3A8I E;  2JJQ A;  3OIP A;  3C1E A;  1X3F A;  3G6E A;  4A3D G;  5C5L A;  4ZLT F;  1SBB B;  1ASY A;  2VS1 A;  3CQZ H;  4DV3 Q;  3UI2 A;  1CI3 M;  4WFN 3;  4F87 A;  2K7V A;  1QNU A;  4BWG B;  3M3Y B;  1J6Q A;  4M8A A;  1EIH A;  1I50 B;  4CBV A;  3HOZ H;  2JXM B;  3K6O A;  3HOU H;  2IX1 A;  1PDQ A;  1V43 A;  4IUU A;  4KI0 A;  3K59 A;  2IY5 B;  1EQV A;  1PA6 A;  4IOA A;  4UHV A;  3I4N B;  3GTJ B;  3ERO A;  4X66 L;  4UP9 A;  1M90 C;  2XVS A;  3F8T A;  2KHJ A;  3I70 A;  1JMC A;  5BR8 L;  4BBS B;  2NN6 I;  4IOC A;  2DJF C;  1S5F D;  2F0F A;  2BE5 D;  5BN3 A;  1KLU D;  3AFP A;  1A0I A;  1SJE D;  3CC4 A;  2JA6 H;  1G6Z A;  3P75 A;  4DV4 Q;  4YCU A;  4DR7 Q;  2VB2 X;  4V0B A;  1HH2 P;  4DFA A;  1NE3 A;  5I2X A;  5HGQ A;  3OSO A;  3MA2 B;  1PYW D;  4A3G B;  1KTK A;  1G6P A;  1FJG L;  2R7D A;  4HJ8 A;  2ZJQ A;  3NXW A;  3GTM H;  3PF5 A;  4AH6 A;  4K2L A;  2FFK B;  1GUS A;  5KIX A;  1PLF A;  1TII D;  2DY7 A;  3FKI G;  2I5M X;  3KBX A;  4XYQ A;  1HFN A;  3NSW A;  2DN8 A;  1U4M A;  3I7F A;  3TP5 A;  5GQO A;  3EFX D;  2D0O A;  1TXY A;  2BDO A;  2FHT A;  3HS0 C;  4FP5 D;  4BBR H;  1WCM G;  1C0A A;  4X3K A;  1W6K A;  4DV2 L;  1XPO A;  3GTG B;  3JAM E;  3RLF A;  3V05 A;  1MD2 D;  3K5O A;  4DPG A;  3CRK C;  3ER0 A;  3VA5 A;  4Z9C B;  5IP9 G;  1CK1 A;  1LTA D;  2M2L A;  5I2Y A;  3E0J A;  4X66 Q;  2Y0S E;  2VUM G;  4RMF A;  2Q2T A;  4C3H B;  5M3F H;  3UDI A;  5BR8 Q;  5C3X A;  3HKZ E;  2VQE L;  1CKN B;  2LS0 1;  1Y1V B;  3PIP 3;  1PRT C;  4BY1 H;  3MHB A;  4DF7 A;  3RMH A;  1BOS A;  4K2K A;  3MXP A;  4JG2 A;  1HRJ A;  2EYL A;  1R4Q B;  2KHI A;  5FJ8 G;  1A3U A;  1FNW A;  5DM7 3;  1EFI D;  1KL9 A;  1F9S A;  1O78 A;  2EY5 A;  2ZTE A;  1FJG Q;  1GO3 E;  2O5J C;  4A76 A;  1K83 H;  2B2U C;  1HR0 L;  2VB3 X;  4GKJ L;  1HA6 A;  2KOL A;  1E2Z A;  1MSH A;  2F0E A;  4JC0 A;  4JI0 L;  3S1Q B;  3A8K E;  1R4P B;  1ZKO A;  5FO9 B;  3CC7 A;  3NEN A;  3W5O A;  2NUC A;  3C3L A;  3VR3 A;  2R7Z H;  2Z6K C;  5COR A;  1EYD A;  1B9N A;  1EEF D;  5C0X I;  1E22 A;  4IFD G;  2NZO A;  4HSV A;  3G7L A;  4M1U B;  4RH6 A;  2IL8 A;  3D8G A;  1C9O A;  2B2V C;  3GV6 A;  4JI7 L;  2A8V A;  3KJP A;  3S2H B;  2E75 C;  3DUZ A;  1NSN S;  1GUN A;  4DV2 Q;  3BVZ A;  4K5W A;  1G91 A;  4GOP A;  3M3Y H;  1YEZ A;  1I50 H;  5EKK A;  3PIO 3;  2UXD L;  1X56 A;  4AQY L;  1NNX A;  1HQM C;  1FR3 A;  1PHJ A;  3J80 E;  1U5K A;  1KRT A;  3I4N H;  3GTJ H;  4BA1 I;  5A35 A;  4HMJ A;  4APV A;  5CYU A;  2VQE Q;  2NN6 G;  2HCC A;  1UNS A;  5IYD G;  5LMN W;  1LTT D;  5KYL A;  4JI2 L;  4BBS H;  2A74 C;  2EOT A;  5DM6 3;  2K01 A;  3AYH B;  2Q8I B;  2A6H C;  5C4J B;  4K5V A;  4CDD C;  3A56 A;  1STG A;  4NDX A;  3GTK B;  2OXP A;  3L3O C;  1JE4 A;  1L0Y B;  1TS4 A;  2HQE A;  5JPN C;  4A3I G;  3KYH C;  1NBW A;  2VW9 A;  1HR0 Q;  4LF8 L;  4GKJ Q;  4JI0 Q;  4K0K L;  2VY3 A;  2F3V A;  1UE5 A;  1BBU A;  3L2P A;  4A3M G;  2EY1 A;  5G3L D;  4A3L H;  2XIW A;  2KQ3 A;  4RFB A;  1DOM A;  1C4Q A;  1U9R A;  4DNT B;  5L37 A;  3GTO B;  3R93 A;  3WOF A;  2KVM A;  1OXS C;  4X3T A;  1EY7 A;  3M4O B;  3EIV A;  1Q7Y C;  5ELD A;  2Z8L A;  1QWY A;  3CCU A;  4JI7 Q;  1GJX A;  2L0C A;  1BQQ T;  2F0V A;  3S1M B;  1VQA A;  2Z0S A;  3UE0 A;  4HJ7 A;  3P20 A;  3KDF B;  3GTG H;  4HCS A;  3KLS X;  2OQ0 A;  4AQY Q;  2UXD Q;  5JJI A;  1VQC A;  1K8G A;  3NHH A;  3FMC A;  5C44 G;  1BXT A;  1KDC A;  2SEB D;  1STA A;  1SND A;  4A3K G;  1X9N A;  5IGB A;  2NVT B;  2J7Z A;  4LW1 A;  1AN8 A;  4OXP A;  1F2Y A;  4C3H H;  1HCZ A;  2K5N A;  4LAA A;  4JI2 Q;  4RGM A;  1JOR A;  3NTH A;  5CBA E;  1CA5 A;  1VMC A;  2OTJ A;  2QDB A;  3I91 A;  2WAC A;  2YU9 B;  1Y1V H;  2YTX A;  3H09 A;  3ULJ A;  4YCW A;  4CKE A;  2QEJ C;  3URY A;  1HXY D;  1Q8K A;  1YIJ A;  1IL2 A;  3BZD B;  4ME3 A;  5IGE A;  5BN4 A;  2C9O A;  2EQS A;  4UPA A;  4LF8 Q;  1SMX A;  5M5Y B;  1EY6 A;  3OHX C;  4K0K Q;  4ZCK A;  2V1C C;  1YIT A;  1EWC A;  1XX8 A;  1HTL D;  3IFT A;  1KDA A;  3HKZ G;  2PZT A;  4IPG A;  3S1Q H;  1K73 C;  1MJC A;  4Y7N B;  4OEM B;  4HJA A;  3NTI A;  2L4N A;  3I8Z A;  2F0K A;  2QDL A;  5IIF A;  1AZQ A;  1N33 Q;  4MNO A;  1V1Q A;  2F0P A;  2K5H A;  3M4Q A;  2HUG A;  2JEA I;  1SNO A;  4R1J A;  3OYY A;  3PUY A;  4RHS A;  3K7A B;  3TP8 A;  3PF4 A;  1UEA B;  5COY A;  2VL6 A;  4KLK A;  1SEB D;  1GUT A;  1D1K A;  4OIJ A;  1L0W A;  3S2H H;  2RDF A;  2OT2 A;  2NYZ D;  2AQ1 B;  2EJM A;  4GNX A;  5EPL A;  2CHB D;  1MIU A;  3QJY A;  3I4L A;  4GN3 B;  4NW2 A;  4JI3 L;  1L1O B;  3M7G A;  4H0L C;  4ZAI A;  1ENA A;  1XPR A;  1SYD A;  1FVI A;  5EGT A;  3NTK A;  5CV7 A;  3S14 B;  3MEH A;  3MXN A;  1II3 A;  4ALP A;  4YWL A;  2ASB A;  2CH4 W;  1X3E A;  1DZ1 A;  1JWU D;  2KEC A;  2Q2H A;  4P75 A;  5C4J H;  2RSN A;  4QIW B;  4XXE A;  1KRS A;  2DNE A;  4KJN A;  3GTK H;  2PI2 E;  1Z7T A;  1XWE A;  2K33 A;  3DEP A;  2A6E D;  5C3E B;  4PNY A;  3QOL A;  2Q8R E;  1XTC D;  2F0S A;  4KKT A;  1TT2 A;  1LTB D;  2MHV A;  2VXW A;  3VYT A;  2K6A A;  3IL8 A;  3NP8 A;  4C3I B;  4HCE A;  3JAM c;  4JBJ A;  5TSS A;  5JJZ A;  2R93 B;  4TKO B;  1EFW A;  4U67 3;  5M5X B;  1RJT A;  2E2J B;  1CT1 D;  1VQJ A;  3ERS X;  1Y69 U;  3GTO H;  3HOX G;  4YWK A;  4TVA B;  1Q12 A;  2CKZ B;  3M4O H;  4JK1 C;  1T5X D;  2LXK A;  1ZEQ X;  1BO0 A;  3TP6 A;  3MXG A;  3MXU A;  1PRT F;  3S1M H;  3BG3 A;  4IJL A;  2BA1 A;  1XMQ Q;  5IY0 A;  4JI3 Q;  3MFY A;  1X3P A;  1QG7 A;  3G4S A;  1KIX A;  5EPK A;  2NVT H;  5JVG 3;  2Z6B A;  3I2Z A;  1VDZ A;  2B2T C;  4K5X A;  4G4K A;  1ZXT A;  4KN7 C;  3D6W A;  3I55 A;  1S40 A;  2ATW A;  3NPP A;  3HOW B;  3SVM A;  4RKL A;  2YU9 H;  3EA6 A;  2EY6 A;  2EYO A;  1WJJ A;  3X3N A;  1CSP A;  3SK6 A;  4PZ7 A;  3NUC A;  4C2M B;  4DK3 C;  4PV1 C;  4RGN A;  4FF4 A;  3J80 i;  4AIM A;  4B3T Q;  4OX9 L;  2IHF A;  1ROD A;  2IHE A;  2IT1 A;  4DA2 A;  4DV1 L;  1WTP A;  5M5Y H;  4JI4 Q;  4YY3 L;  1PFB A;  3D4W A;  3MWY W;  2GA4 B;  4Y7N H;  2WB1 B;  3D31 A;  3M7N A;  3W1B A;  4GN4 B;  1VF5 C;  2I5L X;  2A1A A;  4O2D A;  5J3B A;  4QB4 A;  4JBW A;  1Z9F A;  2L9H A;  1ILQ A;  4IPH A;  2EY2 A;  3F2C A;  3AB9 A;  4DAV A;  2A73 B;  4GOP B;  3E9I A;  5I9P A;  4TRD A;  1I6H B;  3K7A H;  2K1B A;  5C6A A;  5KNB A;  4HIM A;  4EQO A;  1I4X A;  2H4O A;  4OO1 H;  1VQH A;  3HRZ C;  4JPB W;  3ND8 A;  2NVQ B;  5K36 G;  5C4H A;  4K14 A;  1BBW A;  4FXD A;  5AJ3 Q;  3HOY G;  1BF4 A;  1Y1W G;  2Z4I A;  4X64 L;  3ND9 A;  1O7Z A;  4LFC L;  3S14 H;  4L5R C;  3I4M G;  4AYB G;  4RCO A;  1GM5 A;  2E8G A;  1ENF A;  4HJ9 A;  3T1Y L;  2K32 A;  2LY7 A;  4G7O C;  1KAA A;  4L5T A;  3I3C A;  4O42 A;  4G7H C;  1IKL A;  2O5I C;  1I4R A;  5EBC A;  1WTH A;  1IBK L;  3GD7 A;  4KY7 A;  5GRO A;  4OX9 Q;  2HT1 A;  4DV1 Q;  5C3E H;  2EDG A;  1I4Q A;  4YY3 Q;  3CC2 A;  2L5T A;  4JI1 L;  1WTX A;  3K80 C;  4XDX A;  4DV6 L;  4C3I H;  3GTQ B;  4ZQ3 A;  3RLO A;  2R93 H;  5M5X H;  2E2J H;  2LFN A;  4L5Q A;  1D2B A;  1O7Y A;  4KY6 A;  3S16 B;  4MIU A;  2JA8 B;  2D5D A;  5LMU L;  4YWM A;  1G29 1;  1XTD A;  4DV5 L;  2MPM A;  3NBI A;  3Q8D A;  1EU3 A;  4LFB L;  1VQE A;  4X6A H;  2EJG C;  4FF3 A;  4IUT A;  2B8G A;  3TBI B;  4DNI A;  3BVG A;  1PXU A;  3A74 A;  2AQ3 B;  3PIP A;  4LF4 Q;  1TWF B;  1CA6 A;  1QUQ A;  3PO3 B;  4JOI A;  4XT1 B;  4JI8 L;  1M8A A;  2A68 D;  2PMZ E;  1SE4 A;  2ZXP A;  4X64 Q;  4LFC Q;  2BH8 A;  3A55 A;  2K5D A;  4CHT B;  1E3P A;  3T1Y Q;  1ET6 A;  4A4I A;  2F0L A;  2DGY A;  3HOW H;  2FMC A;  1E2V A;  2E76 C;  2WAQ G;  1SJH D;  2JQO A;  5LHY 1;  3CCV A;  2KCN A;  1RKN A;  5HGT A;  3PO2 G;  4C2M H;  4QQB X;  4RCN A;  1JJC B;  1IBK Q;  1PFM A;  2N88 A;  4DK0 A;  1N8R C;  1F2L A;  2TSS A;  4KY5 A;  1HZA A;  3SGI A;  5IGF A;  2PPB C;  4KHZ A;  1GVP A;  1DYQ A;  4UP7 A;  5D3I B;  4A3E G;  3S15 B;  4R4T A;  1KQS A;  3KK7 A;  4LMQ D;  4JI1 Q;  3U50 C;  3O13 A;  5CV6 A;  1LT3 D;  1S5E D;  1RHP A;  1VQO A;  4DV6 Q;  2D2C C;  2D62 A;  4BA2 I;  3J81 j;  4FXG C;  2RDG A;  3K5N A;  2NWG A;  3T53 B;  5A2Q L;  3IFD A;  4KMU C;  5C0X J;  2UUA Q;  2ENB A;  4DAP A;  1DM0 B;  1B9M A;  1O7L A;  5AFW A;  2L12 A;  2HIV A;  3H0G B;  4R4I A;  4FYD A;  1CHP D;  3PIO A;  5LMU Q;  2K04 A;  3RZO B;  3RN5 A;  3K0X A;  2BDN A;  2WB1 E;  4QF4 A;  4DV5 Q;  4GNX B;  1I6H H;  3A5U A;  4LFB Q;  1PTO B;  4QUC A;  1FYC A;  3LWE A;  2YTV A;  1CKO A;  1PRT D;  3CCL A;  1EY8 A;  3IKJ A;  4JBK A;  4YCV A;  1SYC A;  1WFQ A;  4CGY B;  4DK1 A;  2NVQ H;  3OW2 A;  3MXN B;  1EYG A;  4ZUJ A;  1SNC A;  1E7Z A;  4JI8 Q;  4HSP A;  1J9O A;  2G9H D;  1JC7 A;  4GOP C;  3CME A;  1WD1 A;  4IFD I;  1B70 B;  1EYC A;  4PZ8 A;  3UE1 A;  4FVM A;  4DKA C;  3R2I A;  1LT5 D;  1F9P A;  2E2I B;  4MHE A;  2K5Q A;  1EY9 A;  3T1H L;  1AFP A;  3S24 A;  2XRQ D;  2D9U A;  3U58 A;  1HNX Q;  1YHQ A;  4X62 L;  1PTO D;  4WJW A;  5KYI A;  2PW5 A;  2Q8T A;  4PMB A;  1H95 A;  4A93 G;  2LSS A;  4HAE A;  4I65 A;  1V1P A;  3GTQ H;  1CKM A;  1BKB A;  2M00 A;  3GP7 A;  3VYU A;  2MO0 A;  3H3V H;  4R9W A;  4NXM L;  3S16 H;  4IN3 A;  5IWA Q;  2JA8 H;  2A68 C;  1EWH A;  2N78 A;  2PO4 A;  1W6J A;  4QL5 A;  3VYR A;  3K5M A;  4QGU A;  4JYA L;  4QY7 A;  2O2L D;  1XYI A;  1RL2 A;  5FO8 B;  4FNF A;  3K58 A;  2K03 A;  1YI2 A;  3PUZ A;  2F4V L;  3CW2 C;  2MJ8 A;  1STE A;  2A6H D;  5ELO A;  2XGT A;  3VR2 A;  1A2U A;  2ZTC A;  1TWF H;  5JPM C;  1S5C D;  2B8F A;  3PO3 H;  5C3W A;  3H3V C;  3T56 B;  1U4R A;  4DUY L;  5M3M G;  5K5P A;  2B63 B;  5CR3 A;  1EL0 A;  1YJW A;  4A3B B;  1I6V C;  3PQI A;  1TQO A;  4H13 C;  3SDZ A;  3KJO A;  1MJE A;  1SYE A;  4U68 A;  1R9T B;  3BJU A;  3EN2 A;  3T1H Q;  1RDP D;  3HOV G;  2I07 B;  3EBE A;  5CBE E;  3BDO A;  4X62 Q;  1YHA A;  2CCZ A;  2JA5 G;  4DV0 L;  5IYC G;  3S15 H;  3NEM A;  1H9S A;  1G2T A;  2BA0 A;  1B50 A;  3OWF A;  3RZD B;  2RF4 A;  3TN2 A;  1SE8 A;  3FPP A;  3GTP B;  1H9K A;  1NMG A;  1VQ4 A;  2RBM A;  2F0U A;  3HGB A;  1WTO A;  1XNR L;  5ELF A;  1SRU A;  4NXM Q;  5I6Y A;  3H0G H;  5F2D A;  3RZO H;  5C0X H;  4HTH A;  4JYA Q;  3KBG A;  5FLM H;  2PQA A;  3J7A 5;  1PTO H;  1QB5 D;  3H6M A;  4H7B A;  5C4X G;  2F4V Q;  1A62 A;  1TS5 A;  3OWE B;  1U4P A;  2JN4 A;  1Q8I A;  3QWN A;  2RKS A;  1CHQ D;  1GUW A;  1PH7 A;  4DUY Q;  1ONL A;  4FO2 A;  1VQM A;  2F0D A;  2PZU A;  1RF2 D;  4HIK A;  2XWJ B;  3HZX A;  1SNM A;  4GNX C;  4A75 A;  4JI6 L;  1PTO C;  2CFM A;  2ZJR A;  4WJ4 A;  1G2S A;  1BUV T;  1NUC A;  4EQ5 A;  4UAI A;  3VA7 A;  2E2I H;  3ZJY C;  4UP8 A;  1PH9 A;  2FMM A;  4OIK A;  1SFO B;  1B44 D;  1T5E A;  1YJ9 A;  4DV0 Q;  4B3S L;  2RHQ B;  3A7L A;  1MSG A;  1B3A A;  1VQP A;  4G57 A;  3UDF A;  4HMI A;  5CV9 A;  5IYB H;  2R92 B;  1QIL A;  3SHL A;  2WV6 D;  3E5S A;  3CMA A;  3CCR A;  1XNR Q;  3RD4 A;  1E2W A;  5CMD A;  2KUM A;  1OTC A;  4UY8 C;  4P2C B;  1I5F A;  1TWG B;  1I94 L;  3OOC A;  1B8A A;  1EU4 A;  2F3W A;  1YNX A;  1QUQ B;  5IP7 H;  1C48 A;  3HOZ G;  2L1B A;  2IPK D;  3VR4 A;  3G71 A;  4B9W A;  3HOU G;  1NJI C;  4RKB A;  2BH2 A;  1HUM A;  1JR0 D;  3NE5 B;  1BBX C;  1N33 L;  5T1G A;  3BYT B;  5J39 A;  1CQF A;  4JI6 Q;  1EY5 A;  1PH2 A;  2B63 H;  5I9O A;  4A3B H;  2QKI C;  5EKI A;  2JA6 G;  1ET9 A;  3X3M A;  1IKM A;  1R9T H;  5ELC A;  5JEA J;  4ID6 A;  3U9O A;  1M4V A;  2YV5 A;  4LUO A;  3J81 i;  1HNW L;  4DR1 L;  4B3S Q;  5DAU A;  5CGK A;  2B2W A;  1WTQ A;  1IZ6 A;  3RZD H;  1W3S A;  4A3J B;  3J7A V;  1MKH A;  3BYY B;  3ULP A;  2RSO A;  4J6H A;  1X32 A;  3NBH A;  2SDF A;  3GTP H;  5EBD A;  4G7Z C;  3L9A X;  2R61 A;  5KGU A;  4KJO A;  4FXK C;  5JJK A;  1YBY A;  5EAY A;  3CAM A;  1I94 Q;  1NMF A;  4BBR G;  1E1T A;  1EY4 A;  1NR2 A;  4IJH A;  3ICE A;  4HR7 B;  4OWT B;  2H5X A;  2Y0S G;  1LTR D;  1VQ5 A;  3CCJ A;  4LFA L;  2JA7 B;  2CVR A;  1Y14 B;  4LF5 L;  1VF7 A;  2KCM A;  2I0Q A;  1VMP A;  5J22 A; 
#chains in the Genus database with same CATH homology
 3AEV A;  1B7Y B;  4DV4 L;  4DR7 L;  5M3F G;  1DGS A;  4GOP B;  3E9I A;  3MEF A;  3DLL A;  1PH4 A;  2MQH A;  1S72 A;  2WB1 G;  4BY1 G;  3K7A H;  2B3G A;  2JA7 G;  4BY7 G;  4HIM A;  1XJV A;  1PH1 A;  2AHO B;  1VQH A;  4DAY B;  1J5E Q;  3CP0 A;  5K36 G;  3CPF A;  1LM0 A;  1HNW Q;  4DR1 Q;  1HZB A;  3F2B A;  1XMQ L;  1BBW A;  1LYL A;  2JA9 A;  1GKH A;  1SR3 A;  5AJ3 Q;  1QZG A;  5ELN A;  1SFO H;  3HOY G;  1Y1W G;  4NB3 A;  2CWP A;  2AKW B;  2JJQ A;  4LFC L;  1X3F A;  4X64 L;  3G6E A;  3S14 H;  4A3D G;  3AFQ A;  4DV7 L;  1VQL A;  4L5R C;  3I4M G;  4AYB G;  1ASY A;  2VS1 A;  3CQZ H;  2E8G A;  4DV3 Q;  4HJ9 A;  1GM5 A;  2R92 H;  2R7Z G;  3T1Y L;  4GKK Q;  4A3C H;  1Q1B A;  4L5T A;  2NVY H;  1PYS B;  1J6Q A;  4MZ9 A;  4DK6 C;  1JE5 A;  3JAM i;  4DR4 Q;  2RCN A;  4BXX H;  3HFZ B;  1JJG A;  3HOZ H;  3HKS A;  1IBK L;  3GD7 A;  3GTL H;  3HOU H;  5GRO A;  4OX9 Q;  3CCE A;  2HT1 A;  2IX1 A;  4DV1 Q;  1V43 A;  5C3E H;  4KI0 A;  4B3T L;  1TWG H;  2IY5 B;  1PA6 A;  4YY3 Q;  4IOA A;  3A0J A;  3CC2 A;  3TRZ A;  1HZ9 A;  4JI1 L;  3TRE A;  3HOX H;  3M9B A;  1PV4 A;  3K80 C;  4P72 A;  4UP9 A;  4X66 L;  1M90 C;  3F8T A;  2KHJ A;  4DV6 L;  4DR2 Q;  4JI4 L;  4POF A;  4C3I H;  4LFA Q;  2GVA A;  4NXN L;  3RLO A;  1JMC A;  5BR8 L;  2EIF A;  2NN6 I;  4IOC A;  2VNU D;  2R93 H;  1X3G A;  5M5X H;  4LF5 Q;  2E2J H;  4PZ6 A;  5LMN L;  1K0R A;  3AFP A;  1A0I A;  3CC4 A;  4L5Q A;  1IYJ B;  3I4N G;  2JA6 H;  2MO1 A;  4DV4 Q;  4YCU A;  4DR7 Q;  1HH2 P;  1AE3 A;  2KCT A;  1NE3 A;  5LMU L;  1PVO A;  5HGQ A;  4BBS G;  4YWM A;  1G29 1;  3GO5 A;  1XTD A;  4DV5 L;  4A3G H;  3GDE A;  3Q8D A;  1G6P A;  1HZC A;  4JOI C;  4LFB L;  1VQE A;  1FJG L;  2R7D A;  4X6A H;  4HJ8 A;  3E9H A;  4B3R L;  2ZJQ A;  3BZC A;  3GTM H;  2ZM6 L;  4GS3 A;  3PF5 A;  4AH6 A;  4DNI A;  3NEL A;  2JA8 G;  1X54 A;  1PH6 A;  1KAW A;  3A74 A;  2LXJ A;  3PIP A;  4LF4 Q;  3FKI G;  1QUQ A;  2I5M X;  4A3G G;  4JOI A;  4OWW B;  2CWA A;  5HY6 A;  4JI8 L;  4IPH A;  1YZ6 A;  2PMZ E;  5AJ3 L;  4X64 Q;  4LFC Q;  2BH8 A;  4DV7 Q;  3I7F A;  1VQ9 A;  1E3P A;  5GQO A;  1N36 L;  2F3I A;  4A3L G;  3T1Y Q;  4A3J H;  2D0O A;  1TXY A;  3RNU A;  1VQN A;  4BBR H;  4A4I A;  2DGY A;  1WCM G;  3HOW H;  3PO3 G;  1WYD A;  1C0A A;  1VQ7 A;  1EIF A;  2WAQ G;  3KF8 B;  2JQO A;  3CCV A;  4DV2 L;  3PV0 A;  2PQA B;  2QEX A;  4X65 L;  1XPO A;  1SN8 A;  3W1G A;  3PO2 G;  4C2M H;  1NTG A;  3RLF A;  1JJC B;  1IBK Q;  4QQB X;  1N8R C;  3SGI A;  1HZA A;  4DPG A;  4KHZ A;  4DUZ L;  1GVP A;  2UU9 L;  3KF6 A;  4UP7 A;  1EUJ A;  4A3E G;  5GAE C;  2UUB L;  4R4T A;  1KQS A;  3ER0 A;  4JI1 Q;  3U50 C;  5IP9 G;  4HJ5 A;  3AQQ A;  1UE1 A;  4X66 Q;  2Y0S E;  2VUM G;  1VQO A;  4RMF A;  4DV6 Q;  4BA2 I;  2D62 A;  2Q2T A;  3J81 j;  5DLQ E;  4NXN Q;  3CCM A;  5M3F H;  3UDI A;  5BR8 Q;  3HKZ E;  2VQE L;  3CD6 A;  4DR2 L;  1CKN B;  4BY1 H;  5LMN Q;  2JA7 H;  1W2B A;  5C0X J;  2UUA Q;  3J81 c;  4JG2 A;  2HIV A;  2OCE A;  4R4I A;  4IFD J;  3PIO A;  5LMU Q;  2KHI A;  4JCV E;  5GAD C;  2HIX A;  5FJ8 G;  4YHH Q;  1OXX K;  2DUD A;  3K0X A;  3RN5 A;  1X65 A;  2WB1 E;  1KL9 A;  1X55 A;  1Y1V G;  3B6Y A;  4P74 A;  3A5U A;  2ID0 A;  4DV5 Q;  4GNX B;  3S1R H;  1M1K C;  2ZTD A;  2ZTE A;  1FJG Q;  1GO3 E;  4LFB Q;  4A76 A;  1P8L A;  3HOY H;  4B3R Q;  1K83 H;  1HR0 L;  4GKJ L;  4OON A;  1Y1W H;  2YTV A;  1CKO A;  2AWN A;  3UDX A;  2MNA A;  1UE7 A;  2ZM6 Q;  1EOV A;  4JC0 A;  1QZH A;  3H0G G;  4YCV A;  3CCL A;  4JI0 L;  1WFQ A;  3OTO L;  3KLW A;  4A3D H;  2UXC L;  2YTY A;  2NVQ H;  3K8A A;  3OW2 A;  3CC7 A;  3I4M H;  3MXN B;  5M5W H;  3NEN A;  3W5O A;  1Q82 C;  1EYG A;  5C0X G;  2R7Z H;  1IBM L;  5FLM G;  2Z6K C;  1E7Z A;  4JI8 Q;  4XTC S;  4LF4 L;  4LF6 Q;  5C0X I;  1QVF A;  1E22 A;  4R4Q A;  4JI5 L;  2NZO A;  4IFD G;  1EWI A;  2GN5 A;  4GOP C;  3CME A;  1N36 Q;  1K8A C;  4IFD I;  4B3M L;  1B70 B;  4AYB E;  1T9H A;  1C9O A;  2Z6K A;  4PZ8 A;  2Q2U A;  3UE1 A;  4JI7 L;  2XTI A;  4DKA C;  2A8V A;  4R4O A;  3KJP A;  2MFI A;  3WWV A;  4RG1 A;  4DV2 Q;  4X65 Q;  4GOP A;  3M3Y H;  1YEZ A;  1U0L A;  1I50 H;  3H15 A;  3E0E A;  2UXD L;  3T1H L;  1X56 A;  3S24 A;  4AQY L;  4A93 H;  2VQF L;  4DUZ Q;  1ASZ A;  2UU9 Q;  3U58 A;  1HNX Q;  1PHJ A;  2UUB Q;  3LGJ A;  3D0F A;  1U5K A;  2HHH L;  1YHQ A;  4X62 L;  1QVC A;  2N49 A;  4GLX A;  1D7Q A;  1SLJ A;  3FP9 A;  4OO1 I;  1L2F A;  3L7Z C;  1KRT A;  3GTJ H;  4BA1 I;  3I4N H;  1GD7 A;  4APV A;  2VQE Q;  1TWC H;  2NVX H;  2NN6 G;  1H95 A;  4A93 G;  5IYD G;  4QIW E;  5LMN W;  2LSS A;  4MTN A;  1UE6 A;  4JI2 L;  4PMW A;  1PH5 A;  3GTQ H;  1A63 A;  4BBS H;  2C35 B;  3STB C;  3AYH B;  4OWX B;  1E1O A;  2OQK A;  3F1Z A;  1CKM A;  2UUA L;  1BKB A;  5IYB G;  2JEB I;  2MO0 A;  3U4Z A;  1XNQ L;  3H3V H;  4NXM L;  3S16 H;  5IWA Q;  2JA8 H;  4WJ3 M;  1Q46 A;  4A3I G;  4YHH L;  2N78 A;  3KYH C;  4QL5 A;  1NBW A;  3FKI H;  4QGU A;  2VW9 A;  1JB7 A;  1HR0 Q;  4LF8 L;  4QY7 A;  4JYA L;  4GKJ Q;  1RL2 A;  4JI0 Q;  4K0K L;  2VY3 A;  1Q86 C;  3STB D;  3OTO Q;  1UE5 A;  3PUZ A;  1YI2 A;  1BBU A;  3L2P A;  3CW2 C;  4A3M G;  2F4V L;  2UXC Q;  5ELO A;  2XGT A;  4A3L H;  3M85 A;  1IBM Q;  1JJ2 A;  2ZTC A;  1TWF H;  2UUC L;  1WCM H;  3PO3 H;  2PI2 A;  4JI5 Q;  3G48 A;  1OXS C;  5IP7 G;  3TS2 A;  3NBH B;  2FXQ A;  2R7F A;  3EIV A;  3TEH B;  4DUY L;  1Q7Y C;  4LF6 L;  5M3M G;  4B3M Q;  3PO2 H;  3S2D H;  2QA4 A;  3CCU A;  4JI7 Q;  1YJW A;  3I4O A;  3KJO A;  4A3E H;  1MJE A;  2IX0 A;  1VQA A;  2UXB L;  2Z0S A;  3UE0 A;  5IP9 H;  4HJ7 A;  2WAQ E;  2L15 A;  3KOJ A;  3KDF B;  3BJU A;  5H1S E;  2VUM H;  3GTG H;  2UXD Q;  3EN2 A;  2OQ0 A;  4AQY Q;  3T1H Q;  4JBK A;  2VQF Q;  5JJI A;  1VQC A;  1K8G A;  3HOV G;  3EBE A;  3M4P A;  5C44 G;  1WI5 A;  2B63 G;  1A8V A;  2HHH Q;  1N9W A;  4X62 Q;  4A3B G;  1YHA A;  4A3K G;  3PUX A;  2CCZ A;  2YYZ A;  3UDG A;  1X9N A;  2KBN A;  4DR5 L;  4DV0 L;  5IYC G;  1HNX L;  2JA5 G;  3S15 H;  1K3R A;  1CUK A;  3NEM A;  4LW1 A;  4OXP A;  2BA0 A;  4P71 A;  2RF4 A;  3K7U C;  4C3H H;  4DAM A;  2K5N A;  3J7Z C;  4JI2 Q;  2NZH A;  2OTJ A;  1SE8 A;  5FJ8 H;  2CQO A;  1Y1V H;  2YTX A;  2PNH A;  1NMG A;  3BU2 A;  4FDB A;  1HNZ L;  1VQ4 A;  1UWV A;  3ULJ A;  4YCW A;  1PH8 A;  1XNR L;  4HID A;  1Q8K A;  1SRU A;  1N34 L;  1YIJ A;  4NXM Q;  1LTL A;  1XNQ Q;  3H0G H;  1IL2 A;  1N32 L;  4ME3 A;  4DR6 L;  4XIG S;  3RZO H;  1HR0 W;  2EQS A;  4UPA A;  5IWA L;  4LF8 Q;  4JYA Q;  1SMX A;  1TWA H;  3J7A 5;  5FLM H;  2PQA A;  2B29 A;  4DR3 Q;  2QGQ A;  3ICE A;  4K0K Q;  2V1C C;  1YIT A;  4LF7 L;  2F4V Q;  5C4X G;  2A19 A;  4IPG A;  5GAH C;  1A62 A;  3HKZ G;  2K50 A;  2WFW A;  1MJC A;  4IO9 A;  1K73 C;  3S1Q H;  1O7I A;  4KHP L;  4HJA A;  4NPS A;  2UUC Q;  4GLA C;  1YVC A;  3J80 c;  4JBM A;  1N33 Q;  1TWH H;  4MNO A;  1V1Q A;  1VQF A;  1FL0 A;  2N3S A;  2K5H A;  3M4Q A;  4DUY Q;  5IE8 A;  1PH7 A;  1RIP A;  1VQM A;  1KC8 C;  2JEA I;  1VQD A;  1CKN A;  1LUZ A;  4HIK A;  4R1J A;  3OYY A;  3PUY A;  4GNX C;  4A75 A;  4JI6 L;  1QVG A;  3PF4 A;  4LNQ A;  4C3J H;  2CFM A;  2ZJR A;  2VL6 A;  4KLK A;  4WJ4 A;  4O0A A;  1L0W A;  1VQ6 A;  1D8L A;  5IT9 c;  3JC6 6;  1IBL L;  1OXV A;  3BZK A;  4EQ5 A;  3RR5 A;  3CCS A;  3KFU A;  3RN2 A;  3ZJY C;  1C7Y A;  2E2I H;  1CSQ A;  4GNX A;  1E24 A;  4UP8 A;  1MIU A;  4GN3 B;  5IYD H;  4Y52 H;  3PCO B;  1IXR A;  4JI3 L;  1PH9 A;  3PSI A;  2UXB Q;  1L1O B;  2K5V A;  1YJ9 A;  4DR5 Q;  4DV0 Q;  1XPR A;  4OO1 G;  1KXL A;  4IPD A;  1FVI A;  1OXU A;  2GVB A;  4B3S L;  2RHQ B;  3CPW A;  3VDY A;  1VCI A;  1VQP A;  3UDF A;  4ALP A;  5IYB H;  4YWL A;  2ASB A;  1XPU A;  1X3E A;  2Q2I A;  1P16 A;  1HNZ Q;  4A3I H;  3TS0 A;  2I5H A;  3CMA A;  3CCR A;  4A3F H;  2R6G A;  4P75 A;  2Q2H A;  1XNR Q;  5C4J H;  3U4V A;  1N34 Q;  2K4K A;  1N32 Q;  2F52 A;  1VQ8 A;  1G51 A;  1KRS A;  4DR6 Q;  2E5L L;  3GTK H;  1L1O C;  2PI2 E;  4A3M H;  1OTC A;  2R92 G;  4QJF A;  4UY8 C;  2E2H H;  2EXD A;  2K75 A;  2HQL A;  1I5F A;  1PYB A;  2K14 A;  1XMO L;  1VS0 A;  1I94 L;  4POG A;  4A3C G;  1B8A A;  2AWO A;  1YNX A;  2ALY B;  1QUQ B;  4A3F G;  4LF7 Q;  4BXX G;  5IP7 H;  4LF9 L;  4DR3 L;  3HOZ G;  4KHP Q;  1L1O A;  5M3M H;  4JBJ A;  3JAM c;  3IRB A;  3G71 A;  1UEB A;  3HOU G;  1NJI C;  2KEN A;  1EFW A;  5C3E G;  1SRO A;  2BH2 A;  1BVS A;  4JV5 L;  1VQJ A;  1AE2 A;  1PFS A;  3ERS X;  1KHI A;  3GTO H;  3HOX G;  4YWK A;  1N33 L;  5GAG C;  4TVA B;  4LWC A;  1Q12 A;  2CKZ B;  3M4O H;  4JI6 Q;  2N8N A;  1AH9 A;  1PH2 A;  2LXK A;  3HOV H;  2R93 G;  3PUV A;  5C44 H;  2B63 H;  1OXT A;  2K52 A;  1Q81 C;  3PGZ A;  1VQK A;  4A3B H;  4A3K H;  2OWO A;  1I3Q H;  1IBL Q;  2JA6 G;  2JA5 H;  3KF6 B;  4P73 A;  5IYC H;  1YJN A;  3S1M H;  4IJL A;  1J5E L;  1R9T H;  2BA1 A;  2JK8 A;  2D0P A;  5JEA J;  5IY0 A;  1XMQ Q;  1PH3 A;  3CF5 A;  4JI3 Q;  3H3V I;  2YV5 A;  3FHW A;  4LUO A;  5FLX c;  3J81 i;  3PUW A;  4DR1 L;  2ES2 A;  3S2H H;  1HNW L;  3G4S A;  4B3S Q;  1KIX A;  1YHB A;  4HIO A;  2NVT H;  4J15 A;  2VZA A;  3I2Z A;  1S3O A;  1Q1E A;  3F2D A;  1VQI A;  1Z47 A;  4TQU S;  1IZ6 A;  4GN5 A;  3RZD H;  1HJP A;  1W3S A;  2RHS B;  1X6O A;  1MKH A;  3I55 A;  1S40 A;  2ATW A;  3TQY A;  3ULP A;  3RLN A;  1K9M C;  4DV3 L;  3S17 H;  3K81 C;  2YU9 H;  4H02 A;  1EQQ A;  4GKK L;  1EIY B;  3GTP H;  2ZJP A;  1WJJ A;  1CSP A;  4LUZ A;  4PZ7 A;  3CXC A;  2AMC B;  1EQR A;  5JEA G;  5C4X H;  4DR4 L;  1JT8 A;  2E5L Q;  4DK3 C;  5JJK A;  3J80 i;  1YBY A;  4AIM A;  4A3J G;  5EAY A;  4B3T Q;  3CAM A;  1XMO Q;  1I94 Q;  1NMF A;  4IPC A;  4R4C A;  4BBR G;  5E7N A;  1E1T A;  1VQG A;  4IJH A;  4OX9 L;  2IHF A;  2IT1 A;  2IHE A;  4DV1 L;  3HOW G;  1NY4 A;  3KDF A;  4OWT B;  2H5X A;  4EX5 A;  5M5Y H;  3ULL A;  4JI4 Q;  4YY3 L;  1V9P A;  2Y0S G;  3CCQ A;  1VQ5 A;  4LF9 Q;  3DM3 A;  4L5S A;  2OTL A;  4GLV B;  3CCJ A;  1VQB A;  5JJL A;  4Y7N H;  3D31 A;  4LFA L;  4PG3 A;  3M7N A;  3A5Z B;  4JV5 Q;  3W1B A;  4BY7 H;  3I56 A;  4GN4 B;  1FGU A;  2JE6 I;  1I6H H;  1Y14 B;  1KD1 C;  3S1N H;  2I5L X;  2A1A A;  2KCM A;  3L0O A;  4O2D A;  5J3B A;  2I0Q A;  4LF5 L;  4JBW A;  4LUV A;  1Z9F A;  2WP8 J;  3F2C A;  1WOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...