4JI8L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji8L00
3J80i 3S1NH 2JA6H 5IP9G 4DR2Q 4OO1G 4JI3Q 1PYSB 3STBD 1ASZA 4BBSG 2UU9Q 1PH5A 5M3FG 5C4XG 2MO1A 4JI4Q 4A3DG 3KJOA 4DK3C 1SN8A 1VQNA 4KHZA 1TWCH 2HQLA 1FJGL 1FGUA 2JA9A 3OTOL 4DV7L 1YJWA 1TXYA 5ELOA 1U0LA 4LUOA 3CC2A 1XNRL 4DR7Q 1GD7A 2R6GA 3RZOH 4J15A 1QVGA 1S40A 2K5HA 3HOWH 1JMCA 4JYAL 3CCEA 2RHQB 4JI0L 1OXSC 2CFMA 1AH9A 2VUMH 4IFDI 3CPFA 1C0AA 5JJLA 4B3MQ 3AEVA 4ME3A 2DUDA 4DR3L 2JA8H 1JE5A 3PGZA 3KDFB 4UP7A 2N8NA 2UUCQ 4GKKL 1FVIA 2QGQA 2UXBQ 1TWFH 2F52A 3S1RH 2F4VL 3PO2G 4L5QA 3CAMA 1A8VA 5FJ8H 1EUJA 2RHSB 1I3QH 4JI7Q 1N9WA 1K0RA 1HZBA 1G51A 4PZ8A 3TREA 4A3BH 3KOJA 4BXXG 4A3CH 2OQ0A 1OXTA 1PV4A 2VNUD 1EQQA 4DV5Q 4QL5A 4X62Q 1Q82C 4OX9L 1CKNA 2EXDA 2VZAA 3A5ZB 2QA4A 4A3IH 3G48A 2ES2A 3TS2A 4WJ4A 4MZ9A 1RL2A 4GNXB 3S2DH 3ULJA 4DV4L 3ULPA 4DV6Q 4LFCQ 2UXDL 2UUBL 2RCNA 3KF8B 4GLXA 4HIKA 1WJJA 1QVCA 3M85A 1NY4A 1GM5A 4A3FG 3S16H 2K5VA 2NN6G 1X3GA 2JA6G 4LFBL 3OW2A 3H0GH 4JI2L 4MNOA 1PH8A 3M4OH 3K7UC 4JI8L 2OTLA 3GTLH 4YY3L 4LFAL 3BZKA 3D31A 4IJLA 1SE8A 4P71A 4X64Q 1Q8KA 2E5LL 1D8LA 3KJPA 1W2BA 3CMAA 2PI2E 2YTXA 2N78A 1L1OA 4JI1L 4DR1Q 1J5EL 4K0KQ 3GTGH 4IPGA 2A1AA 1X3FA 3W5OA 1YJNA 4BBSH 3HOWG 4P72A 4DUZQ 5M3FH 4IPHA 4L5RC 1XNQL 5ELNA 4DV3Q 4KHPL 1Z47A 1HNXL 2K52A 4MTNA 2HHHL 1VQMA 4JBKA 2D0PA 1IBMQ 2UXCL 1HJPA 2B3GA 1HR0L 1CSQA 3S2HH 3GTJH 3EN2A 2ZTDA 3L7ZC 1IBKQ 3PUZA 4GOPA 1VS0A 1K83H 2IX0A 1TWAH 3RNUA 1N36L 1NMGA 2OWOA 5FJ8G 3M9BA 3ICEA 1GVPA 3IRBA 3MXNB 4O0AA 1HZ9A 2ALYB 3NELA 1VQ8A 1YZ6A 4A3CG 2YV5A 3KF6A 1G291 1K9MC 3MEFA 1BVSA 1N8RC 3PO3H 1CKOA 2CQOA 4LUZA 1E1TA 2RF4A 3T1YQ 3T1HQ 1NTGA 1A62A 4A3IG 1V9PA 4GS3A 3CCJA 4C3HH 4JV5L 4HJ8A 2K14A 1OXVA 2LXKA 2PMZE 2WFWA 5JEAJ 4C3JH 1N33L 2FXQA 1KXLA 3CP0A 1N34L 4DV0Q 4A3LH 4JI6L 1HNWQ 3GTOH 4IFDG 1KHIA 1VQGA 2H5XA 2Q2IA 4BA1I 4LF4Q 2ZM6Q 5IYCG 3NBHB 3U4ZA 3M4QA 1OTCA 4B3SQ 3HOVH 2N49A 3U50C 2K5NA 1X9NA 1Q81C 2ZTCA 4B3RL 3HOYH 5GQOA 4NB3A 3A5UA 3L2PA 4NPSA 2IY5B 4A3FH 2QEXA 1IYJB 4GN5A 3E9IA 1FJGQ 2VQEL 4IOAA 3OTOQ 4DV7Q 3TRZA 2K50A 4RMFA 2K75A 1YHQA 3K81C 5C0XJ 3RLNA 5IYDH 1SLJA 4A75A 1PFSA 1G6PA 2ID0A 4IJHA 3F2DA 4JYAQ 3G71A 4JI0Q 3PCOB 2YTYA 4JI5L 4QQBX 5C4JH 4DR4L 4DR6L 1UE1A 4DR3Q 1HNZL 1PH9A 4LF6L 3BJUA 1I94L 3W1BA 1X56A 4GKKQ 4DAYB 1JJ2A 1KD1C 2UUAQ 3S15H 3KDFA 3A74A 4DV1L 1I6HH 3PUWA 3G6EA 3PO3G 1VQBA 2R7DA 4WJ3M 4RG1A 3HOZH 5GROA 5IWAQ 1LTLA 3FP9A 3UE0A 3E9HA 4R4IA 3HKSA 3RN2A 4JI3L 2I5MX 3Q8DA 4R1JA 1KRSA 2GVBA 3ZJYC 1VQJA 1HZAA 5DLQE 4P74A 3CCQA 2ZJQA 1VQEA 2CWAA 4A76A 4JI4L 3UDXA 1QUQA 3GTKH 1X65A 2VW9A 4A3LG 1XMOL 2GVAA 3I2ZA 1B7YB 3PV0A 4DV4Q 4A3GH 2UXDQ 2UUBQ 4C2MH 1YJ9A 2XGTA 4JBJA 1VQCA 1KRTA 4DR5Q 1VQLA 2NVXH 4B3TQ 4A3KG 2GN5A 3HOVG 4JOIC 5FLMH 3DLLA 3S1QH 4LFBQ 2KCTA 2NVYH 5EAYA 1Q46A 4YWKA 4JI2Q 4A3JG 1K8AC 4JI8Q 1M1KC 1JT8A 3HOYG 3F1ZA 4L5TA 3I56A 1WI5A 3CD6A 2AHOB 1PH4A 1T9HA 1SRUA 3PUXA 2IT1A 4R4OA 1VQ9A 1XMQL 4P75A 2UUCL 3GTQH 4PMWA 4GN3B 1VQ4A 1P8LA 3K80C 4DUYL 1Q86C 5IYCH 5LMNL 2E5LQ 4OO1I 1HH2P 1Z9FA 3KFUA 1SMXA 1J5EQ 3LGJA 4JI1Q 1E22A 1JJCB 4GLAC 5IYDG 1NMFA 1V1QA 4DV2Q 4UP8A 1CKNB 1IZ6A 1B8AA 4R4QA 3UDFA 4LF5L 4DKAC 1XPOA 1XNQQ 3D0FA 5JJKA 4UY8C 1KC8C 4NXML 1HNXQ 2HHHQ 4KHPQ 4GKJQ 2UXCQ 3J81c 5BR8L 4BA2I 4Y52H 1CSPA 2V1CC 2PNHA 3RLOA 5M5XH 4LFCL 5M5YH 1E24A 2CKZB 1IXRA 1HZCA 3FHWA 4GNXC 1XJVA 1MJEA 4LF7L 3CPWA 1S72A 4KLKA 1Y14B 5AJ3L 2VQFL 3I7FA 1X55A 4IO9A 5IYBG 1KL9A 1UEBA 4PZ6A 3HOXG 4JBMA 3HOZG 3HOUH 2E8GA 3K7AH 4JCVE 4C3IH 2A8VA 1I5FA 2MQHA 2WAQE 2EIFA 2ZTEA 2Q2UA 4QIWE 2B29A 4LNQA 2R92H 1K8GA 1VQDA 3B6YA 3H3VI 2LSSA 1C9OA 3CQZH 1YNXA 3E0EA 3J81i 4JV5Q 1L1OB 4X64L 1EQRA 2NZHA 4LF8L 4A3EH 2AWNA 3JAMc 4A3GG 2PQAB 4A4IA 2MNAA 3I4OA 4POFA 1HR0W 1N33Q 2ASBA 1N34Q 1QZGA 5HGQA 4JI6Q 5J3BA 1EWIA 2MO0A 3BU2A 1CKMA 5GAGC 5FLMG 3S24A 1BKBA 4UPAA 1E3PA 4GOPB 3H15A 2WAQG 3JC66 1UE6A 2OCEA 2E2JH 3RN5A 2NVQH 2Q2HA 1DGSA 5H1SE 3CC4A 1EFWA 1Q1BA 4B3RQ 4R4TA 4Y7NH 5C3EH 2B63H 3KLWA 4NXNL 3GD7A 1VCIA 4BY7H 1K3RA 4A3KH 4LF9Q 1YHAA 1YIJA 2VS1A 4IPCA 4A3JH 2VQEQ 4QGUA 1VQ5A 5IT9c 4UP9A 1YEZA 3CC7A 2IHEA 1ASYA 3I4MG 5LMUL 4IOCA 2XTIA 4GLVB 3J80c 1YITA 4POGA 1UWVA 1IBLL 2KHJA 2JEBI 1EOVA 1XPUA 2IX1A 3F2CA 4JI5Q 1CUKA 1R9TH 1XNRQ 1YBYA 4DR4Q 4DR6Q 1YI2A 1VQFA 3CF5A 1HNZQ 2LXJA 1GKHA 4DAMA 4LF6Q 4L5SA 2WP8J 1I94Q 4IFDJ 4YHHL 1M90C 1N32L 2KENA 4DK6C 3S1MH 5GAHC 1VQAA 4JOIA 2L15A 1W3SA 1PH1A 4AH6A 4EX5A 4AQYL 1PA6A 4YCVA 1VQPA 1J6QA 3U4VA 1PH6A 2I0QA 3HFZB 2VUMG 1EIFA 3HOUG 1PH2A 2NVTH 2R92G 1RIPA 4X66L 3PF5A 2YYZA 4DPGA 4TVAB 1WCMH 1Y1WH 2F4VQ 2JQOA 4TQUS 4BY1G 5E7NA 1E1OA 4XTCS 4X65L 4A3MH 1X54A 1UE7A 1PH7A 1A0IA 2OQKA 2F3IA 4A3EG 1NBWA 2KCMA 4BBRH 1MJCA 5HY6A 5IYBH 3HOXH 1K73C 4H02A 3BZCA 4DR2L 3J7ZC 1XMOQ 1PYBA 1WOCA 4QY7A 2BA0A 5C44H 3GO5A 2UU9L 1LYLA 4OX9Q 3CMEA 3S14H 3GTMH 3PIOA 1H95A 2R7ZH 1SR3A 3S17H 1QVFA 4YCUA 5C0XI 2R7FA 2NZOA 3K0XA 1QZHA 3M4PA 4DR7L 5M5WH 4OWXB 5IP7H 1UE5A 4GNXA 5C3EG 2ZJRA 2B63G 1I50H 5FLXc 4BY7G 2ATWA 4HIDA 1XMQQ 2I5HA 3PSIA 2BA1A 2CCZA 2Q2TA 4DUYQ 2ZJPA 5LMNQ 2D62A 2UUAL 4B3ML 4A93H 2AKWB 2K4KA 4P73A 4YY3Q 2E2HH 4LFAQ 1PVOA 2YU9H 1U5KA 3G4SA 2JEAI 1YHBA 3GDEA 5IWAL 4LF5Q 2UXBL 1GO3E 1WFQA 1BBWA 1QUQB 3W1GA 2R93G 1A63A 4NXMQ 1TWHH 2JA5H 4JI7L 3U58A 3CCSA 5GADC 1OXUA 1X6OA 4YCWA 1S3OA 3PF4A 1TWGH 3FKIH 5BR8Q 3I4MH 2OTJA 1Y1VG 4X62L 4DV5L 4AYBE 2JA7G 4LF7Q 4QJFA 3SGIA 2JK8A 1KQSA 5M3MH 1HR0Q 3CCVA 4DR5L 5AJ3Q 1E7ZA 4PG3A 2VQFQ 4B3TL 2KHIA 1NJIC 3UDGA 4APVA 2WB1E 5LMNW 3STBC 1N36Q 1Y1WG 1WCMG 3M7NA 4DV6L 1Q12A 1LM0A 4X6AH 4A3MG 1AE2A 4FDBA 3I55A 3I4NH 1AE3A 3PIPA 4BBRG 1L0WA 3CCLA 3GTPH 3RLFA 2Z6KA 5IE8A 3ERSX 2JJQA 1NE3A 3OYYA 1P16A 2I5LX 2Z0SA 1YVCA 4LWCA 4YWMA 5C44G 3VDYA 4LF8Q 3NENA 4AYBG 2HIVA 5GAEC 1PHJA 2VL6A 2BH2A 1VQ6A 1LUZA 4JBWA 5IP9H 1EYGA 4R4CA 4BY1H 1VQOA 4DV2L 2R7ZG 2MFIA 2Y0SE 2PQAA 5C4XH 3TQYA 2WB1G 4IPDA 4LUVA 5IY0A 4A3DH 3CCUA 3WWVA 4DR1L 5IP7G 4GKJL 4OWWB 4K0KL 2CWPA 1KIXA 1VQKA 5JEAG 2JA8G 1WYDA 3J7A5 2E2IH 3CW2C 4DUZL 4HJ9A 3DM3A 4HIOA 2HT1A 2C35B 4HJAA 4DV3L 3UDIA 1KAWA 2YTVA 4NXNQ 4A93G 1O7IA 2IHFA 4GN4B 3TEHB 4HIMA 2EQSA 3AFQA 1IBML 4YWLA 3L0OA 1VQ7A 1IBKL 3PUVA 1XTDA 2NN6I 3KYHC 1VQHA 3ULLA 2N3SA 3F8TA 3EIVA 3M3YH 4A3BG 4AIMA 2Y0SG 3AQQA 3RR5A 3RZDH 4LW1A 1PH3A 5LMUQ 4EQ5A 3KF6B 3UE1A 3JAMi 1C7YA 3NEMA 3EBEA 2JA5G 1JJGA 1IBLQ 3PO2H 4DNIA 1Q7YC 4HJ5A 1B70B 2AWOA 2Z6KC 1D7QA 3FKIG 1JB7A 2VY3A 3H3VH 1VQIA 3HKZE 3ER0A 1L1OC 1X3EA 4BXXH 3J81j 1V43A 2PI2A 4YHHQ 1SROA 3T1YL 4XIGS 3T1HL 1N32Q 5M3MG 2HIXA 5C0XG 2R93H 4PZ7A 3CXCA 4OONA 4KI0A 3CCMA 4O2DA 5JJIA 4AQYQ 1MIUA 4JC0A 2AMCB 1SFOH 3PUYA 3AFPA 1OXXK 2DGYA 3H0GG 2JE6I 2KBNA 4DV0L 3AYHB 1Q1EA 3F2BA 1Y1VH 4X66Q 3I4NG 1HNWL 4JG2A 4OWTB 3CCRA 4GOPC 1L2FA 1XPRA 3K8AA 2JA7H 3A0JA 1EIYB 3TS0A 1FL0A 4HJ7A 4X65Q 4DV1Q 1BBUA 4ALPA 4LF4L 2BH8A 2ZM6L 4OXPA 1MKHA 1IL2A 4B3SL 4LF9L 3HKZG 2D0OA 5K36G 2A19A
chains in the Genus database with same CATH superfamily
1HA6A 3S1NH 4A93B 1BO0A 5ELDA 1CI3M 1ASZA 4I65A 3GQBA 4OHJA 2MO1A 2EYJA 1VQNA 3SXHA 1FJGL 1IHZA 2XIWA 4DV7L 4L8JA 1TWHB 5ELOA 3HGBA 5CMDA 5I9PA 1S40A 3HOWH 4JYAL 4QF4A 4FF3A 3L9AX 2L4NA 5IGCA 2VXWA 3UI2A 4LJZC 1WVLA 1WTRA 4DR3L 2JA8H 1CA6A 2H1EA 4G7HC 2F0PA 2UXBQ 1BR9A 4J8QA 3S1RH 1MGSA 4L5QA 2F1MA 1EUJA 2RSOA 1G51A 4PZ8A 4RCNA 3TREA 4C3IB 4A3BH 4A3CH 1OXTA 3HKZB 4OIJA 2L5TA 1PV4A 1EQQA 1HQMC 3MXPA 2L11A 1B9NA 5IT9E 5D3DA 2VZAA 3A5ZB 3TS2A 2GA4B 1A6XA 4WJ4A 1FGBD 1VMCA 1ICWA 3ULJA 4DV4L 3DWPA 4LFCQ 2UUBL 5LHY1 5C0XH 1CQFA 1NY4A 4ZAIA 3OW2A 3H0GH 4JI2L 4MNOA 3HEJA 4YY3L 3FPUB 4IJLA 5C3EB 3M3YB 5I2YA 4X64Q 1FYCA 2KQ3A 2F0HA 1ZXTA 2K32A 3CMAA 1IYVA 2QDBA 4IPGA 4BBSH 4DUZQ 2B2VA 5M3FH 1PXUA 1Z47A 4OEMB 1HJPA 5ELBA 3EN2A 5EBCA 5IOCA 4GOPA 1K83H 4XT3B 3TP5A 2EJFC 1BNZA 2NUCA 1HTPA 1TY0A 1ENFA 4IUQA 5FOBB 3M9BA 1K28A 1SJHD 1F2LA 2XVSA 3IRBA 3T51B 1K8OA 3FRPB 3VYTA 1N8RC 1CKOA 3VYSA 1TS5A 1TVXA 2RF4A 3T1HQ 1DOLA 3NE5B 2PO4A 2RDHA 2PMZE 2WFWA 1N33L 1KXLA 3CP0A 1EU3A 3RZOB 2Q2IA 2ZM6Q 3U4ZA 5F2DA 1PFMA 1OTCA 1NAPA 2N49A 3I73A 2K5NA 2ZTCA 1L0YB 3HOYH 3NUCA 3A5UA 3SHLA 3Q6SA 3E9IA 1SE3A 3R3OA 4IOAA 1LV9A 1YHQA 3K81C 4Z9CB 4H13C 1G6PA 4IJHA 3E3XA 4X3SA 4JI5L 1Q90A 4HCSA 4H0LC 3VR3A 1G91A 1PH9A 4LF6L 3BJUA 3JAME 1KD1C 2OEOA 5M3MB 3S15H 5D14A 4DV1L 3NWSA 3PUWA 1I4PA 3HOZH 4R4IA 3RN2A 1SYGA 2EYPA 5I6WA 4FXGC 1HZAA 5DLQE 3CCQA 1VQEA 1GHJA 1X65A 2F0UA 3OPOA 4A3GH 3TP8A 2UXDQ 1YJ9A 4JBJA 1JQYD 1Z6HA 4KJNA 2KCTA 4A3JG 3W3AA 1GUTA 1KDAA 4JI8Q 1M1KC 1S5DD 1T9HA 3PUXA 3OIQA 4R4OA 1TS2A 3GTQH 4PMWA 1XX8A 1P8LA 3K80C 4DUYL 1Q86C 2E5LQ 4OO1I 1BCPF 1HH2P 1D2BA 4DNRB 1AZPA 2QF7A 1J5EQ 3LGJA 4FVMA 1B8AA 3NTKA 4R4QA 5T1GA 3D0FA 2ZXPA 4UY8C 4KHPQ 1U4LA 2BDNA 1G6ZA 5K5PA 4BS9A 3BDOA 4CDEC 1BXTA 1CSPA 5M5YH 4LFCL 1IXRA 3I8ZA 2Z4IA 3IKJA 1Y14B 3K57A 3BYYB 4IO9A 1C8CA 2VUMH 2CVRA 4PNYA 2MQHA 4OIKA 3DHQA 4IN3A 4XT1B 4QIWE 2B29A 4NMZA 3T13A 2Q2UA 1K8GA 1EU4A 1VQDA 3E6ZX 1SXTA 5KNDA 3E0EA 4X64L 1EQRA 2SDFA 3JAMc 3S1NB 2CH4W 2PQAB 4HMIA 1HR0W 3SK6A 2F0EA 2K05A 3FEWX 3JC66 4ME5A 2E2JH 2CQAA 2Q2HA 3H6MA 1LACA 1KABA 5JPNC 1TS4A 1K0SA 4NXNL 4BY7H 5FK9C 1K3RA 2F0JA 1QNKA 2VS1A 4IPCA 4UP9A 1I6HB 3CC7A 2IHEA 1ASYA 4IOCA 2XTIA 4POGA 1ILPA 2ZXOA 5IIFA 1XPUA 3PIP3 3V96A 2NB0A 1XNRQ 1HNZQ 1I94Q 5IGGA 3MFYA 2QKIC 1EZ8A 4AH6A 4EX5A 1ENAA 4ZYSA 3U4VA 3HFZB 1EIFA 1PH2A 2R92G 1RIPA 2YYZA 1WCMH 4Q5VA 2F4VQ 4TQUS 1SEBD 1NSNS 4QIWB 5E7NA 5C5MA 4A3MH 3VA5A 3MEHA 4JI4Q 3P7JA 1MSHA 2KCMA 3HOXH 1B53A 3LX0A 4DXGA 4DR2L 3J7ZC 1EEFD 3NXWA 1XMOQ 1PYBA 2BA0A 3T16A 1FNWA 1RTOA 3BYTB 1NR2A 4JK1C 3OW7A 2OF1A 2O2LD 2NZOA 2WKCA 1D5ZC 4OWXB 1U9RA 2ATWA 2WKDA 3KF8A 2Q2TA 1B1ZA 3Q24A 4H44C 4A93H 4B3ML 2F0OA 2K4KA 1SYFA 2HCIA 5EPJA 1YHBA 3GDEA 3K7AB 4CDFC 1EIHA 1HQRD 2R93G 1TWHH 2F03A 3CQZB 3U58A 1SYDA 1ZEQX 4CJ1B 1X6OA 1JE4A 1HUMA 4X62L 2X6LA 1HR0Q 2K5QA 5AJ3Q 3UDGA 1Y8PB 4DV6L 1Q12A 2EPBA 2NVQB 3I55A 2ENBA 4BBRG 3PIO3 4Y7NB 3A55A 2Z6KA 3ERSX 3M7GA 3OYYA 1NE3A 1T5XD 5BN3A 4A3KB 1STGA 4LF8Q 1JOQA 2BH2A 2VL6A 4R4CA 2G9HD 3V05A 3HOYB 2R7ZG 1EL0A 1ICFB 1SMYD 1H9KA 2PQAA 3TQYA 4LUVA 5IY0A 1EIGA 4NKLA 5IP7G 4K0KL 2K6AA 4DV3L 1KAWA 1O7IA 4GN4B 4HIMA 1C48A 2EQSA 3AFQA 5IT9L 1IBKL 3PUVA 3N6RA 2O5IC 1U4PA 3NBHA 1GUOA 2EY5A 1SYBA 2N3SA 3M3YH 3EIVA 4DFAA 1I4HA 4RAUC 1B4OA 1ILQA 3HS0C 5LMUQ 3KF6B 3UE1A 3EBEA 2JA5G 4HAEA 4RGOS 4HJ5A 4RGNA 1B70B 2Z6KC 2DJGC 2F4IA 4BBRB 2IJ0A 2XWBB 3MXUA 3T1YL 2PI2A 4YHHQ 1SROA 2EYLA 1N32Q 2B2YA 2HIXA 2IW3A 5JAVA 3ERQA 4OONA 4KI0A 4JC0A 3PUYA 3AFPA 3S17B 2KBNA 1XYIA 4A3GB 1Q1EA 4HCEA 3F2BA 3K8AA 3A0JA 1EIYB 2ZT9C 1FL0A 4HJ7A 1BBUA 2BH8A 4LK1C 1LT6D 3E5SA 3F2UA 4WJ3M 2D0OA 1E2ZA 5DAUA 3CF5A 1UEAB 1CFMA 3SVMA 4OO1G 2PQEA 3I91A 1NNXA 4N8FA 4H7BA 4A3DG 3KJOA 1SN8A 4DA2A 2HQLA 2JA9A 3OTOL 2JA5B 1U0LA 4LUOA 1XNRL 1G2SA 3RZOH 4J15A 1AN8A 3H09A 2B8GA 2K04A 1JMCA 2B2YC 3CCEA 1O78A 4S3SA 1JC7A 1EY9A 2Q8TA 1C0AA 5JJLA 3AEVA 1JE5A 3T56B 3Q22A 4FYDA 5C4HA 4GKKL 2TSSA 2F4VL 3PO2G 2QEJC 1QILA 1A8VA 1TS3A 2RHSB 4QUFA 4JI7Q 1B3QA 1N9WA 1K0RA 1X3QA 2A5HA 2SNMA 4DV5Q 4QL5A 4BY1B 2B39A 3K59A 3AMUA 2B2UA 2A6EC 1EFID 1RL2A 4A3DB 2KCNA 3S2DH 2FMCA 3ULPA 1W6KA 2E2IB 4HIKA 1QVCA 4CHTB 4A3FG 3S16H 2K5VA 2NN6G 5E4XA 5J39A 2JA6G 4LFBL 1S5BD 2OTLA 1STBA 2K5DA 3BZKA 3JAML 1SE8A 4BY7B 1Q8KA 3KBXA 1D8LA 2RCFA 3KJPA 3PO2B 2N78A 1L1OA 1UUPA 4RH6A 2ZXRA 4IPHA 3OHXC 1MHWC 5ELNA 4KKSA 4C1NK 2HHHL 2K52A 1PRTF 4K6LA 2NZ1D 4IUPA 1Y69U 1VQMA 4JBKA 2B2UC 1F2YA 2B3GA 1HR0L 3L7ZC 3PUZA 2IX0A 1IW7D 2EZVA 1EY0A 1NMGA 3ND8A 2OWOA 4IZ8A 1Y1VB 3NTHA 1QB5D 2JA7B 1MBYA 4K14A 3MXNB 4O0AA 5EKKA 3NELA 3MAQA 2YV5A 3KF6A 1G291 2NYZD 1K9MC 4XQQA 2CQOA 4LUZA 2JA6B 1H9RA 1G2TA 2F0TA 1SJED 4CKEA 2ICEC 4DN4M 4A3IG 3CCJA 2K14A 1OXVA 5JEAJ 1Y8NB 4RKBA 2LS01 1N34L 4AYBB 3DEOA 1HNWQ 3PMFA 3GTOH 1E0BA 4IFDG 2H5XA 4BA1I 4LF4Q 5IYCG 3IFDA 3ONAB 1Y8OB 3H91A 2A69D 3KLSX 1X9NA 4X3UA 4B3RL 5COYA 4R8IA 2K33A 2IY5B 1GUSA 4I7ZC 3H94A 1I3QB 2EOTA 4RCOA 3RLNA 2CW0D 2O4XA 1PFSA 1STEA 2XRQD 3F2DA 3G71A 5KNBA 4JI0Q 1MD2D 2Q8IB 4DR6L 1UE1A 4A3IB 3RMHA 3KLRA 3W1BA 4DAYB 1YNJD 3P75A 3A74A 1I6HH 2Z6BA 4G7ZC 3TP7A 3PO3G 1SSOA 3C46A 5GROA 5IWAQ 3M4OB 4OELB 4G57A 4R1JA 3Q8DA 3GTLB 1KRSA 2GVBA 5I2XA 1VQJA 1FD7D 4C3JG 1QUQA 3BDCA 5NUCA 2VW9A 1JOKA 4A3LG 3GP7A 1ZYRD 1B7YB 3PV0A 2L0CA 3EFXD 4DR5Q 1KRTA 1PTOH 3HOVG 4LMQD 3S1QH 3I70A 3MTSA 5EAYA 1Q46A 1DONA 1PZJD 1WI5A 4XYOA 2F3VA 1PYWD 2IT1A 4FF4A 4P75A 4GN3B 1NUCA 2E76C 5BN4A 4N9PA 4JI1Q 1E22A 5IYDG 4UP8A 1CKNB 4LF5L 3D8GA 4ID6A 3PO3B 1EWCA 5A35A 1XNQQ 1QCBD 3SR1A 1HNXQ 4GKJQ 1CM9A 2UXCQ 3QIAA 3QO2A 5BR8L 4C3JB 1RTNA 2V1CC 1EYAA 2PNHA 2R3ZA 3VR6A 5L37A 4KLKA 2VQFL 1X55A 4RGMA 1CHQD 1UEBA 4M1UB 3K7AH 2A8VA 1I5FA 2F3WA 2EIFA 1J9OA 2R92H 1DOMA 3RD4A 3D4DA 3B6YA 2DY7A 1EY4A 3CQZH 1BBXC 1JOOA 1YNXA 4JV5Q 3J81i 3Q0AA 4V190 2BE5D 3K58A 1HXYD 3I4OA 4F8MA 4POFA 4EQPA 1PTOD 3FVQA 2B2TA 5HGQA 4JI6Q 3DWQA 1FNVA 3N52A 5GAGC 1WD1A 1F9QA 4UPAA 5CBAE 1E3PA 3OWEB 1STAA 1AEXA 1UE6A 2LY7A 2NVQH 3SEBA 1Q1BA 4XDXA 4Y7NH 3KLWA 4DF7A 4A3KH 4LF9Q 1KNEA 1YHAA 1SE2A 2EYMA 2VQEQ 5IT9c 3D4WA 3I4MG 4HSVA 1SNQA 2BOSA 2KHJA 3NQIA 2DNCA 2JEBI 3R2TA 5KRUA 4O42A 1II3A 4DR4Q 3GTKB 1VQFA 2LXJA 1GKHA 1PFBA 2NTTA 4DAMA 1XXGA 2Q8RE 2B2TC 5FKAC 5GAHC 1VQAA 1W3SA 2KCCA 1DCZA 4YCVA 2L55A 2I0QA 1H9SB 3HOUG 3S2DB 4DAYA 1A2UA 4X66L 1SMYC 2NVYB 3G6JB 4F7XA 4K5VA 2RKSA 4X65L 3DEPA 1X54A 2ICIA 1PA6A 3S16B 2LMCB 4BBRH 5IYBH 2PW5A 1AW7A 2BCOA 4H02A 1JR0D 1H9MA 1WOCA 4QY7A 3GO5A 2AQ3B 3PIOA 4FF1A 3IFTA 4ZQ3A 2R7ZH 2NWGA 1H95A 1SR3A 1RJTA 1QVFA 4YCUA 2PMZB 5DNFA 3S17H 5D65A 1DJRD 3OMGA 5IP7H 1UE5A 2HDMA 3MVVA 2ZJRA 2B63G 2XWJB 3OIPA 1XMQQ 5FO7B 3PSIA 5M5XB 3R8BA 1YNND 2ZJPA 5LMNQ 2D62A 2FINB 2E2HH 4LFAQ 4DK0A 1PVOA 2F0IA 2HCCA 3G4SA 3DUZA 5IWAL 2UXBL 1WFQA 3BZDB 1CK1A 2XSCA 4IUVA 3W1GA 5KIXA 1A63A 4NXMQ 3HRZC 2JA5H 1PZKD 1KNAA 1EY7A 1OXUA 1CQVA 3PF4A 1TWGH 3A56A 4CKCA 4LF7Q 3SGIA 1A3VA 2E2DC 1GUGA 4DR5L 3WOFA 1E7ZA 4APVA 2WB1E 1N36Q 1Y1WG 1O80A 4U673 1AE2A 2A68D 3GTOB 1AE3A 2F0QA 1L0WA 2EVBA 1HCZA 2B63B 5DM73 3RLFA 1LABA 2Z0SA 1YVCA 1WTPA 2L1BA 3NENA 1FNUA 2HIVA 5TSSA 4A3JB 3K5MA 4BY1H 4OO1H 4FNFA 2Y0SE 2WB1G 4IPDA 4A3DH 3SDZA 4GKJL 3NK9A 2CWPA 1J8IA 1VQKA 2JA8G 1WYDA 4ZKBB 2E2IH 3CW2C 4DUZL 3DM3A 2HT1A 2C35B 4K2KA 4ABNA 1S4ZA 3TEHB 3I4LA 3MC0B 4YWLA 3L0OA 2DN8A 5CYUA 1XTDA 2NN6I 1TKWB 4A3BG 1LTID 2Y0SG 3AQQA 1PH3A 3QR8A 2IWHA 1Y1WB 3NEMA 2KA7A 3VA7A 1IBLQ 3PO2H 2EJGC 2I07B 1D7QA 4ZK9B 1JB7A 3ER0A 1ONLA 3J81j 1V43A 1EY8A 3T1HL 5KYLA 5C0XG 1SE4A 2IPKD 3S14B 3GTMB 3QG1A 4AQYQ 2AMCB 2DGYA 3H0GG 1SNOA 1Y1VH 4OWTB 2EY1A 3W2DA 5M5WB 1XPRA 2JA7H 3J81E 1PTOB 1I50B 2ZM6L 1PFNA 1IL2A 4O1NA 4YIJA 4LF9L 3S1QB 1GUNA 3EROA 3J80i 2JA6H 5IP9G 1B2TA 4JI3Q 4BBSG 1V1PB 2YU9B 2UU9Q 5C4XG 3S9WA 1CZGA 5M3FG 1KLGD 1U4RA 3NP8A 4DK3C 2AQ1B 2Y0SB 4KHZA 4ODGA 4KD4A 4WFN3 1IW7C 2K7VA 1B50A 2I46A 2N55A 5FLXL 3CC2A 4DR7Q 1F2MA 1GD7A 2R6GA 4R8NA 3GV6A 3EJIA 2HD3A 2K5WA 4PMBA 4E6IA 2K5HA 4KJOA 1OXSC 2CFMA 4IUNA 4IFDI 1DZ1A 3CPFA 4HR7B 1WTOA 2DUDA 5JEAH 1A2TA 2D5DA 3BVZA 3PGZA 4UP7A 4G7OC 2F52A 2J0TD 3CAMA 1I3QH 4V0BA 3GTPB 2R92B 3MHBA 2VNUD 4NDXA 3J7YW 2EXDA 2F0SA 2JSOA 3P20A 4A3IH 2A69C 5C4XB 1O7ZA 1IKMA 1IYUA 4GNXB 4FXKC 2UXDL 3CRKC 4GLXA 1I4GA 4RWSC 3M85A 1F2ZA 1T5EA 3M4OH 1PH8A 1C4QA 3K7UC 4JI8L 4ZCKA 3R93A 2CW0C 3GTLH 4LFAL 1JORA 5HGTA 3NSWA 3EQLC 1TIID 1NR4A 3BG3A 4P71A 1AFPA 3RZDB 2E5LL 3A54A 1SAPA 1KTKA 3OWFA 1J5EL 4DR1Q 3NPPA 1YNJC 1WTQA 4DAVA 4KHPL 4MTNA 2D0PA 1IBMQ 4OGQC 2R93B 1CSQA 2N88A 3IL8A 4B08A 4RA8A 4CBVA 4LAAA 1VS0A 2OXPA 3RNUA 1N36L 4JPBW 3CRLC 5FJ8G 3T53B 4HTHA 3ICEA 1GVPA 1HZ9A 1ZYRC 2ALYB 1PDQA 4G4KA 4NP5A 1VQ8A 2SNSA 3MEFA 4CDCC 1AP0A 3PO3H 2PCFB 2A73B 2WV6D 1EQVA 1NTGA 1A62A 2R61A 1V9PA 4GS3A 4HJ8A 2IX3A 3EA6A 4UAIA 3K6OA 2LXKA 4C3JH 2FXQA 4DV0Q 1HPCA 4A3LH 2K1BA 1RHPA 1GJXA 3A8IE 1BQQT 1KHIA 2R7ZB 2Z8LA 3DMUA 3M4QA 4B3SQ 3HOVH 2M9VA 1A3TA 1JWMD 2G5DA 4RHSA 5GQOA 4NB3A 5EJWA 4PV1C 4NPSA 4PQXA 3KUPA 2EDGA 1TWFB 4GN5A 1JICA 1V1PA 5CGKA 1B3AA 1FJGQ 4F88A 2TMPA 4DV7Q 1DXMA 2K50A 1HTLD 3TRZA 2E2HB 2K75A 2F0LA 5G3LD 5IYDH 4CDDC 1SLJA 2ID0A 4KV6A 4JYAQ 3KBGA 1KAAA 2HUGA 3PCOB 5ELCA 3V2TA 1I4XA 4DR3Q 1HNZL 1U4MA 1TWGB 1I94L 1CA5A 1RKNA 5CV5A 1X56A 5KGUA 1JJ2A 1BF4A 2UUAQ 2BE5C 1EWHA 3I90A 3FDTA 1VQBA 1VF7A 4RHRA 4RG1A 1PTOC 2FFKB 1GXDC 1LTLA 3J7AF 3FP9A 5IGEA 3E9HA 4JI3L 2I5MX 4C3HG 2J7ZA 1JCKB 3ZJYC 2CHBD 4JI4L 2ZJQA 2CWAA 4A76A 3UDXA 3GTKH 1ENCA 2F0NA 2KOLA 1XMOL 2GVAA 3I2ZA 4DV4Q 1I6VC 3GTGB 2A6HD 2J4XA 2UUBQ 5I9OA 4EQNA 1VQCA 1VQLA 1K8MA 1O7LA 3J80E 1VF5C 2HDLA 4JOIC 3ZYYX 3DLLA 1MI2A 2NVYH 4JI2Q 1K8AC 3S2HB 5KEEA 3GTJB 2MHVA 2WACA 3CD6A 3SK4A 2AHOB 1SRUA 3CU7A 2NTSA 1VQ9A 1NCVA 5CBEE 2XN9C 3CKIB 1Z9FA 1SMXA 3QOJA 2Z1CA 1NMFA 3DXJC 4QB4A 1HA5A 1XTCD 3E0JA 1XPOA 4I7AA 4L63B 1KC8C 1LTTD 4C56C 3HP3A 5LL6X 4C3HB 2M2LA 1SYCA 1QE6A 3TDQA 1PRTD 4BA2I 1ZKOA 5M5XH 3RLOA 4QCLA 1E24A 3FHWA 4GNXC 3LNNA 3TMEA 1S72A 1GHKA 5AJ3L 3HOXG 2KECA 3C1FA 4JBMA 3HOUH 4JCVE 2ZTEA 4LNQA 1DYQA 3H3VI 2LSSA 4CJ2C 5FLXE 1STNA 4FP5D 4A3FB 2NZHA 4LF8L 1E2WA 4A4IA 2MNAA 1LTRD 1N33Q 2ASBA 1HFNA 1QG7A 2JXMB 3MA2B 4K2LA 4NW2A 1YNNC 2OT2A 1L0XB 3OSOA 5FLMG 1BKBA 4GOPB 3H15A 1Q8IA 3RN5A 5C4JB 3AU7A 1DGSA 5H1SE 3CC4A 1TU2B 1GOZA 2B63H 1VCIA 2QCPX 4A3JH 4DGZA 1YEZA 2FHTA 5LMUL 4GLVB 3HZXA 3J80c 1YITA 2IX1A 4JI5Q 1STHA 1CUKA 1YBYA 1JWUD 3D3RA 2A68C 4LF6Q 4L5SA 2WP8J 4IFDJ 3LWEA 4YHHL 1N32L 4PMCA 1JB3A 2PNRC 1XWEA 1VMPA 4C2MB 4C1NI 1PH1A 1GUWA 1JT8A 1VQPA 1J6QA 2MPMA 4C3IG 3PF5A 3G7LA 3QWNA 1Y1WH 2JQOA 2RDFA 1E1OA 1LT4D 1UE7A 1PH7A 1A0IA 2F3IA 2EXZA 2OQKA 4A3EG 1K73C 5HY6A 3TZUA 3BZCA 4OX9Q 1LYLA 1O7YA 3S14H 3GTMH 1S5FD 1H9JA 4XYQA 5C0XI 5IODA 5I4DA 1DD2A 3K0XA 1QZHA 3M4PA 5M5WH 3TN2A 5C3EG 1I50H 5FLXc 1BDOA 2I5HA 2BA1A 4DUYQ 2UUAL 1RODA 1PLFA 4DNTB 5ISRA 2NBFA 4B9WA 2YU9H 1U5KA 3SK5A 2FMMA 4K8IA 3A8KE 1GO3E 2LFNA 1D5MC 3J81L 2PW7A 4CKBA 4L6TB 4JI7L 2EYOA 3CCSA 4KKTA 1I4RA 1F9PA 2KVMA 4A3EB 3X3MA 2JYOA 2OTJA 4DV5L 2H4OA 1KQSA 3CCVA 4DU9A 2F0DA 4PG3A 2DJFC 2KHIA 1NJIC 5LMNW 2DNEA 3M7NA 1LM0A 1TY2A 3A7AB 3BVGA 4MIUA 4ZRZA 3MFGA 1ET6A 3A8JE 2X69A 3PIPA 3CCLA 3K5LA 3GTPH 1BOSA 5IE8A 3HOVB 1FR3A 2JJQA 2PYKA 1P16A 1A3UA 4LWCA 5C44G 3MXNA 1VQ6A 1LUZA 4JBWA 5IP9H 1Q3LA 2F0GA 1VQOA 2MFIA 5C4XH 3BVMA 3KLSA 3CCUA 4OWWB 1KIXA 1R9TB 3J7A5 2MUYA 3NBIA 3IAYA 5J1ZA 2YTVA 4NXNQ 3S1MB 1D1KA 1EY6A 2F0WA 2QW7A 4U68A 3F8TA 2G9DA 3TBIB 1PRTB 2NVTB 3RR5A 1D6EC 4LW1A 4RGTA 2D9UA 3RZDH 4EQ5A 5JJZA 2A74C 1JJGA 1CHPD 2X6GA 4R9WA 5JOBA 4DNIA 1Q7YC 3FKIG 2VY3A 1VQIA 4CJ0B 1PTOF 1X3EA 3D6WA 1QNUA 5C44B 1Z7TA 5M3MG 2L9HA 4XQNA 5BN5A 2R93H 4PZ7A 2B2VC 3OOCA 5CR3A 5CV8A 1MIUA 2KUMA 2RSNA 1SFOH 3AYHB 3I4NG 1HNWL 2A6ED 3CCRA 4GOPC 1PZID 3TS0A 2WINB 5A2QE 4ALPA 4LF4L 1LT3D 4OXPA 3M4YA 5K36G 1B44D 1F77A 4DR2Q 4ZLTF 1PYSB 3STBD 1PH5A 1CTMA 1I4QA 5JVH3 3VYRA 4Q0FA 1TWCH 5CV7A 1FGUA 1V8QA 1YJWA 1TXYA 1S5ED 1QVGA 3FKIB 3I4MB 2AQ2B 3J7AV 2F0KA 2RHQB 4JI0L 1AH9A 3HG9A 4B3MQ 1RCVD 4ME3A 4K8JA 3KDFB 2N8NA 3P1HA 2UUCQ 3FMCA 1FVIA 2QGQA 1TWFH 5CV6A 1EEID 5FJ8H 3I4NB 1JWSD 1BCPD 5HURA 1HZBA 3HOUB 3WOEA 4BXXG 3KOJA 2OQ0A 1LLRD 4X62Q 1HHVA 1Q82C 4OX9L 1CKNA 5IGFA 2QA4A 2ES2A 3G48A 1D1IA 4MZ9A 2EJMA 4DV6Q 2Z9HA 2RCNA 3KF8B 1WJJA 1GM5A 4JVZA 4KHVA 1RF2D 4KMUC 1X3GA 4ZUJA 2KEDA 4IUUA 1TT2A 4X3KA 3D31A 1UAPA 1LT5D 1W2BA 3OMCA 2AUJD 2PI2E 2YTXA 4JI1L 4K0KQ 4J1MA 3GTGH 3W5OA 2A1AA 1X3FA 1YJNA 4HEDA 3HOWG 4OL7A 4P72A 2JP1A 4L5RC 1XNQL 4DV3Q 4DK1A 1HNXL 2RDGA 4KN4C 2UXCL 3S2HH 3GTJH 3DWAA 2ZTDA 1IBKQ 2EE1A 3TP6A 1TWAH 5EQ0A 5JVG3 5EKLA 4EQOA 1YZ6A 3J80L 4A3CG 1EY5A 1WTHA 2A6HC 1BVSA 3K0YA 4ULLA 5C4ZA 1E1TA 3T1YQ 3C1EA 4JV5L 4C3HH 3SE0A 1R4QB 1STYA 1WD0A 2XNAC 4X3TA 4JI6L 1F9SA 4JW0A 4KTAA 2Z4HA 1WTXA 3C3LA 1VQGA 2FJ2A 4QUCA 3HOWB 2E74C 3NBHB 2EYFA 5T1IA 2HQEA 2WB1B 3A7LA 3U50C 4GZYC 1HUNA 1H9SA 1LO5D 1Q81C 1EYDA 2JA8B 2DY8A 4RKLA 3L2PA 1TR5A 4A3FH 2QEXA 1IYJB 2NN6H 3S1RB 4K5WA 2WIIB 1PRTC 2VQEL 2JN4A 3OTOQ 3AB9A 2AUKA 4RMFA 3QB3A 4RFBA 1OO9B 5C0XJ 4A3BB 1BUVT 4A75A 5E3FA 3VR4A 3RUZA 2YTYA 3QOLA 1S5CD 4QQBX 3TSSA 5C4JH 3GV3A 4DR4L 4GKKQ 1X3PA 4ILWA 2O5JC 2QDLA 5EBDA 3KDFA 4MN3A 3U9OA 2XRSD 3G6EA 2R7DA 3H0GB 3UE0A 5E4WC 4B9XA 3HKSA 3EVQA 4P74A 3I3CA 1AZQA 2VB2X 2MP1A 4C2MH 4P2CB 2XGTA 4DAPA 4BBSB 5EKIA 1WTVA 5C5LA 2RQXA 5M3FB 2NVXH 2EYHA 4B3TQ 4A3KG 2GN5A 5ELEA 5FLMH 2QILA 4LFBQ 2KEEA 4YWKA 3NHHA 3HOYG 3F1ZA 4L5TA 3I56A 3BS1A 1PH4A 1K83B 3O13A 1XMQL 4IFDH 4IALA 4KY6A 2UUCL 1VQ4A 1EOTA 3DM1A 5IYCH 5LMNL 4EVOA 3KFUA 1A15A 1ESFA 1JJCB 4GLAC 1SYEA 4KKUA 1V1QA 4DV2Q 3MXGA 1IZ6A 3UDFA 3VR2A 5C6AA 4HN7A 4DKAC 2RVLA 5JJKA 4NXML 2C9OA 2HHHQ 1DOKA 4MHEA 1E2VA 4N9TA 2CH4A 3URYA 3J81c 3C2PA 4FXDA 1BCPB 1ESRA 4KD3A 4Y52H 3L3OC 1SDFA 3QJYA 4LF7L 2CKZB 1HZCA 1MJEA 1XJVA 2MGSA 3CPWA 5KNCA 3I7FA 5IYBG 1SFOB 1KL9A 4PZ6A 3MZ5A 3HOZG 3VYUA 2E8GA 4UHVA 3NTIA 4C3IH 2WAQE 3FPPA 5AFWA 3BDLA 1M4VA 4WRDA 1C9OA 5LL6S 2B2WA 1L1OB 1B9MA 1KDCA 5EPKA 2F0VA 1HFGA 2AWNA 4EGVA 2BDOA 4IUTA 4XQJA 3K5NA 4A3EH 4KY7A 5M9OA 4A3GG 1EZ6A 1N34Q 4K6DA 1QZGA 1IL8A 4CGYB 5J3BA 1EWIA 2MO0A 1W6JA 3BU2A 1CKMA 5EGTA 5I6YA 3S24A 1ET9A 1TWCB 2WAQG 3U9SA 5KYIA 1DM0B 3H3VC 4N8X1 3T4AC 5C3XA 5CV4A 2OCEA 3Q23A 4DXFA 2V4DA 4HSPA 5DM63 1EFWA 4B3RQ 4R4TA 2RA4A 5C3EH 3GD7A 1YIJA 1UNSA 3S15B 4QGUA 1VQ5A 4WORA 2SEBD 2PZUA 5CC4A 4TRDA 3HOZB 1SBBB 1UWVA 2SOBA 1IBLL 2B2WC 1HRJA 1EOVA 3TZDA 3F2CA 4M8AA 1R9TH 4DR6Q 1YI2A 5J22A 3K5OA 1SNPA 1M90C 2KENA 2K01A 4DK6C 3S1MH 2F0FA 3ITPA 5JPMC 4JOIA 2L15A 1D5XC 2F0MA 4AQYL 1PH6A 1QJOA 2VUMG 2NVTH 1VDZA 3VR5A 4DPGA 4TVAB 2WAQB 5CORA 2EY6A 4BY1G 1EYCA 4XTCS 3I72A 3MWYW 1NBWA 3GTQB 1MJCA 1QWYA 2VB3X 1LTBD 5G3LF 2M00A 5C44H 3WDNA 4XXEA 2UU9L 3CMEA 4KK7A 4ZKCB 5EPLA 2K28A 1M8AA 1V1OA 2R7FA 4K5XA 4DR7L 2EY2A 5FO8B 1PMRA 4GNXA 1RDPD 4BY7G 4HIDA 3NWTA 5M5YB 4IQZA 2CCZA 3D4RA 3CHBD 2AKWB 4P73A 4YY3Q 4FO2A 3ND9A 1TWAB 2JEAI 1IKLA 2VUMB 4KN7C 4LF5Q 3NQTA 1BBWA 1QUQB 5A2QL 2L12A 5GADC 1SNCA 4YCWA 1S3OA 1CT1D 3FKIH 5BR8Q 3I4MH 1Y1VG 1CZWA 4AYBE 2JA7G 4QJFA 2JK8A 5M3MH 2IL8A 2VQFQ 4B3TL 2PZTA 3STBC 1WCMG 1R4PB 2E2JB 4X6AH 4J6HA 4A3MG 4FDBA 3I4NH 5ELFA 5C3WA 3D6CA 2PZWA 2C5CA 2I5LX 3VDYA 4YWMA 5K36H 5GAEC 4AYBG 1PHJA 5DEHA 3X3NA 1WTWA 1EYGA 5E1FA 4DV2L 1EQTA 1MSGA 4TSSA 1KDBA 5D3IB 4HMJA 1X32A 4ZUIA 3R2IA 3WWVA 4DR1L 4QMGA 2B8FA 5IGBA 5JEAG 4HJ9A 4HIOA 4HJAA 3UDIA 4UDUC 5CV9A 4A93G 2IHFA 1IBML 1BCPC 1LTSD 2MJ8A 1LTAD 1VQ7A 4IURA 1SNDA 2LKVA 3KYHC 1VQHA 3ULLA 4AIMA 3LWUA 1TQOA 4BWGB 5FO9B 4F87A 3JAMi 1C7YA 1G8ZD 1WCMB 2K03A 1F9RA 2KHSA 1K3BC 4TKOB 2PPBC 4A3MB 2AWOA 3H3VH 3HOXB 3HKZE 1L1OC 2E75C 4BXXH 1LTGD 3KK7A 2KJXA 4XIGS 2RBMA 2P5ZX 2D2CC 3CXCA 3CCMA 4O2DA 5JJIA 3PQIA 1KLUD 1OXXK 5IGDA 2JE6I 4DV0L 4MTKA 4X66Q 4JG2A 1L2FA 4FF2A 4KY5A 1QOHA 1ML0D 4X65Q 4DV1Q 1RD9D 2NVXB 1SNMA 4WJWA 1MKHA 3SK8A 4B3SL 3HKZG 2A19A
chains in the Genus database with same CATH topology
3J80i 3S1NH 2JA6H 5IP9G 4DR2Q 4OO1G 4JI3Q 1PYSB 3STBD 1ASZA 4BBSG 2UU9Q 1PH5A 5M3FG 5C4XG 2MO1A 4JI4Q 4A3DG 3KJOA 4DK3C 1SN8A 1VQNA 4KHZA 1TWCH 2HQLA 1FJGL 1FGUA 2JA9A 3OTOL 4DV7L 1YJWA 1TXYA 5ELOA 1U0LA 4LUOA 3CC2A 1XNRL 4DR7Q 1GD7A 2R6GA 3RZOH 4J15A 1QVGA 1S40A 2K5HA 3HOWH 1JMCA 4JYAL 3CCEA 2RHQB 4JI0L 1OXSC 2CFMA 1AH9A 2VUMH 4IFDI 3CPFA 1C0AA 5JJLA 4B3MQ 3AEVA 4ME3A 2DUDA 4DR3L 2JA8H 1JE5A 3PGZA 3KDFB 4UP7A 2N8NA 2UUCQ 4GKKL 1FVIA 2QGQA 2UXBQ 1TWFH 2F52A 3S1RH 2F4VL 3PO2G 4L5QA 3CAMA 1A8VA 5FJ8H 1EUJA 2RHSB 1I3QH 4JI7Q 1N9WA 1K0RA 1HZBA 1G51A 4PZ8A 3TREA 4A3BH 3KOJA 4BXXG 4A3CH 2OQ0A 1OXTA 1PV4A 2VNUD 1EQQA 4DV5Q 4QL5A 4X62Q 1Q82C 4OX9L 1CKNA 2EXDA 2VZAA 3A5ZB 2QA4A 4A3IH 3G48A 2ES2A 3TS2A 4WJ4A 4MZ9A 1RL2A 4GNXB 3S2DH 3ULJA 4DV4L 3ULPA 4DV6Q 4LFCQ 2UXDL 2UUBL 2RCNA 3KF8B 4GLXA 4HIKA 1WJJA 1QVCA 3M85A 1NY4A 1GM5A 4A3FG 3S16H 2K5VA 2NN6G 1X3GA 2JA6G 4LFBL 3OW2A 3H0GH 4JI2L 4MNOA 1PH8A 3M4OH 3K7UC 4JI8L 2OTLA 3GTLH 4YY3L 4LFAL 3BZKA 3D31A 4IJLA 1SE8A 4P71A 4X64Q 1Q8KA 2E5LL 1D8LA 3KJPA 1W2BA 3CMAA 2PI2E 2YTXA 2N78A 1L1OA 4JI1L 4DR1Q 1J5EL 4K0KQ 3GTGH 4IPGA 2A1AA 1X3FA 3W5OA 1YJNA 4BBSH 3HOWG 4P72A 4DUZQ 5M3FH 4IPHA 4L5RC 1XNQL 5ELNA 4DV3Q 4KHPL 1Z47A 1HNXL 2K52A 4MTNA 2HHHL 1VQMA 4JBKA 2D0PA 1IBMQ 2UXCL 1HJPA 2B3GA 1HR0L 1CSQA 3S2HH 3GTJH 3EN2A 2ZTDA 3L7ZC 1IBKQ 3PUZA 4GOPA 1VS0A 1K83H 2IX0A 1TWAH 3RNUA 1N36L 1NMGA 2OWOA 5FJ8G 3M9BA 3ICEA 1GVPA 3IRBA 3MXNB 4O0AA 1HZ9A 2ALYB 3NELA 1VQ8A 1YZ6A 4A3CG 2YV5A 3KF6A 1G291 1K9MC 3MEFA 1BVSA 1N8RC 3PO3H 1CKOA 2CQOA 4LUZA 1E1TA 2RF4A 3T1YQ 3T1HQ 1NTGA 1A62A 4A3IG 1V9PA 4GS3A 3CCJA 4C3HH 4JV5L 4HJ8A 2K14A 1OXVA 2LXKA 2PMZE 2WFWA 5JEAJ 4C3JH 1N33L 2FXQA 1KXLA 3CP0A 1N34L 4DV0Q 4A3LH 4JI6L 1HNWQ 3GTOH 4IFDG 1KHIA 1VQGA 2H5XA 2Q2IA 4BA1I 4LF4Q 2ZM6Q 5IYCG 3NBHB 3U4ZA 3M4QA 1OTCA 4B3SQ 3HOVH 2N49A 3U50C 2K5NA 1X9NA 1Q81C 2ZTCA 4B3RL 3HOYH 5GQOA 4NB3A 3A5UA 3L2PA 4NPSA 2IY5B 4A3FH 2QEXA 1IYJB 4GN5A 3E9IA 1FJGQ 2VQEL 4IOAA 3OTOQ 4DV7Q 3TRZA 2K50A 4RMFA 2K75A 1YHQA 3K81C 5C0XJ 3RLNA 5IYDH 1SLJA 4A75A 1PFSA 1G6PA 2ID0A 4IJHA 3F2DA 4JYAQ 3G71A 4JI0Q 3PCOB 2YTYA 4JI5L 4QQBX 5C4JH 4DR4L 4DR6L 1UE1A 4DR3Q 1HNZL 1PH9A 4LF6L 3BJUA 1I94L 3W1BA 1X56A 4GKKQ 4DAYB 1JJ2A 1KD1C 2UUAQ 3S15H 3KDFA 3A74A 4DV1L 1I6HH 3PUWA 3G6EA 3PO3G 1VQBA 2R7DA 4WJ3M 4RG1A 3HOZH 5GROA 5IWAQ 1LTLA 3FP9A 3UE0A 3E9HA 4R4IA 3HKSA 3RN2A 4JI3L 2I5MX 3Q8DA 4R1JA 1KRSA 2GVBA 3ZJYC 1VQJA 1HZAA 5DLQE 4P74A 3CCQA 2ZJQA 1VQEA 2CWAA 4A76A 4JI4L 3UDXA 1QUQA 3GTKH 1X65A 2VW9A 4A3LG 1XMOL 2GVAA 3I2ZA 1B7YB 3PV0A 4DV4Q 4A3GH 2UXDQ 2UUBQ 4C2MH 1YJ9A 2XGTA 4JBJA 1VQCA 1KRTA 4DR5Q 1VQLA 2NVXH 4B3TQ 4A3KG 2GN5A 3HOVG 4JOIC 5FLMH 3DLLA 3S1QH 4LFBQ 2KCTA 2NVYH 5EAYA 1Q46A 4YWKA 4JI2Q 4A3JG 1K8AC 4JI8Q 1M1KC 1JT8A 3HOYG 3F1ZA 4L5TA 3I56A 1WI5A 3CD6A 2AHOB 1PH4A 1T9HA 1SRUA 3PUXA 2IT1A 4R4OA 1VQ9A 1XMQL 4P75A 2UUCL 3GTQH 4PMWA 4GN3B 1VQ4A 1P8LA 3K80C 4DUYL 1Q86C 5IYCH 5LMNL 2E5LQ 4OO1I 1HH2P 1Z9FA 3KFUA 1SMXA 1J5EQ 3LGJA 4JI1Q 1E22A 1JJCB 4GLAC 5IYDG 1NMFA 1V1QA 4DV2Q 4UP8A 1CKNB 1IZ6A 1B8AA 4R4QA 3UDFA 4LF5L 4DKAC 1XPOA 1XNQQ 3D0FA 5JJKA 4UY8C 1KC8C 4NXML 1HNXQ 2HHHQ 4KHPQ 4GKJQ 2UXCQ 3J81c 5BR8L 4BA2I 4Y52H 1CSPA 2V1CC 2PNHA 3RLOA 5M5XH 4LFCL 5M5YH 1E24A 2CKZB 1IXRA 1HZCA 3FHWA 4GNXC 1XJVA 1MJEA 4LF7L 3CPWA 1S72A 4KLKA 1Y14B 5AJ3L 2VQFL 3I7FA 1X55A 4IO9A 5IYBG 1KL9A 1UEBA 4PZ6A 3HOXG 4JBMA 3HOZG 3HOUH 2E8GA 3K7AH 4JCVE 4C3IH 2A8VA 1I5FA 2MQHA 2WAQE 2EIFA 2ZTEA 2Q2UA 4QIWE 2B29A 4LNQA 2R92H 1K8GA 1VQDA 3B6YA 3H3VI 2LSSA 1C9OA 3CQZH 1YNXA 3E0EA 3J81i 4JV5Q 1L1OB 4X64L 1EQRA 2NZHA 4LF8L 4A3EH 2AWNA 3JAMc 4A3GG 2PQAB 4A4IA 2MNAA 3I4OA 4POFA 1HR0W 1N33Q 2ASBA 1N34Q 1QZGA 5HGQA 4JI6Q 5J3BA 1EWIA 2MO0A 3BU2A 1CKMA 5GAGC 5FLMG 3S24A 1BKBA 4UPAA 1E3PA 4GOPB 3H15A 2WAQG 3JC66 1UE6A 2OCEA 2E2JH 3RN5A 2NVQH 2Q2HA 1DGSA 5H1SE 3CC4A 1EFWA 1Q1BA 4B3RQ 4R4TA 4Y7NH 5C3EH 2B63H 3KLWA 4NXNL 3GD7A 1VCIA 4BY7H 1K3RA 4A3KH 4LF9Q 1YHAA 1YIJA 2VS1A 4IPCA 4A3JH 2VQEQ 4QGUA 1VQ5A 5IT9c 4UP9A 1YEZA 3CC7A 2IHEA 1ASYA 3I4MG 5LMUL 4IOCA 2XTIA 4GLVB 3J80c 1YITA 4POGA 1UWVA 1IBLL 2KHJA 2JEBI 1EOVA 1XPUA 2IX1A 3F2CA 4JI5Q 1CUKA 1R9TH 1XNRQ 1YBYA 4DR4Q 4DR6Q 1YI2A 1VQFA 3CF5A 1HNZQ 2LXJA 1GKHA 4DAMA 4LF6Q 4L5SA 2WP8J 1I94Q 4IFDJ 4YHHL 1M90C 1N32L 2KENA 4DK6C 3S1MH 5GAHC 1VQAA 4JOIA 2L15A 1W3SA 1PH1A 4AH6A 4EX5A 4AQYL 1PA6A 4YCVA 1VQPA 1J6QA 3U4VA 1PH6A 2I0QA 3HFZB 2VUMG 1EIFA 3HOUG 1PH2A 2NVTH 2R92G 1RIPA 4X66L 3PF5A 2YYZA 4DPGA 4TVAB 1WCMH 1Y1WH 2F4VQ 2JQOA 4TQUS 4BY1G 5E7NA 1E1OA 4XTCS 4X65L 4A3MH 1X54A 1UE7A 1PH7A 1A0IA 2OQKA 2F3IA 4A3EG 1NBWA 2KCMA 4BBRH 1MJCA 5HY6A 5IYBH 3HOXH 1K73C 4H02A 3BZCA 4DR2L 3J7ZC 1XMOQ 1PYBA 1WOCA 4QY7A 2BA0A 5C44H 3GO5A 2UU9L 1LYLA 4OX9Q 3CMEA 3S14H 3GTMH 3PIOA 1H95A 2R7ZH 1SR3A 3S17H 1QVFA 4YCUA 5C0XI 2R7FA 2NZOA 3K0XA 1QZHA 3M4PA 4DR7L 5M5WH 4OWXB 5IP7H 1UE5A 4GNXA 5C3EG 2ZJRA 2B63G 1I50H 5FLXc 4BY7G 2ATWA 4HIDA 1XMQQ 2I5HA 3PSIA 2BA1A 2CCZA 2Q2TA 4DUYQ 2ZJPA 5LMNQ 2D62A 2UUAL 4B3ML 4A93H 2AKWB 2K4KA 4P73A 4YY3Q 2E2HH 4LFAQ 1PVOA 2YU9H 1U5KA 3G4SA 2JEAI 1YHBA 3GDEA 5IWAL 4LF5Q 2UXBL 1GO3E 1WFQA 1BBWA 1QUQB 3W1GA 2R93G 1A63A 4NXMQ 1TWHH 2JA5H 4JI7L 3U58A 3CCSA 5GADC 1OXUA 1X6OA 4YCWA 1S3OA 3PF4A 1TWGH 3FKIH 5BR8Q 3I4MH 2OTJA 1Y1VG 4X62L 4DV5L 4AYBE 2JA7G 4LF7Q 4QJFA 3SGIA 2JK8A 1KQSA 5M3MH 1HR0Q 3CCVA 4DR5L 5AJ3Q 1E7ZA 4PG3A 2VQFQ 4B3TL 2KHIA 1NJIC 3UDGA 4APVA 2WB1E 5LMNW 3STBC 1N36Q 1Y1WG 1WCMG 3M7NA 4DV6L 1Q12A 1LM0A 4X6AH 4A3MG 1AE2A 4FDBA 3I55A 3I4NH 1AE3A 3PIPA 4BBRG 1L0WA 3CCLA 3GTPH 3RLFA 2Z6KA 5IE8A 3ERSX 2JJQA 1NE3A 3OYYA 1P16A 2I5LX 2Z0SA 1YVCA 4LWCA 4YWMA 5C44G 3VDYA 4LF8Q 3NENA 4AYBG 2HIVA 5GAEC 1PHJA 2VL6A 2BH2A 1VQ6A 1LUZA 4JBWA 5IP9H 1EYGA 4R4CA 4BY1H 1VQOA 4DV2L 2R7ZG 2MFIA 2Y0SE 2PQAA 5C4XH 3TQYA 2WB1G 4IPDA 4LUVA 5IY0A 4A3DH 3CCUA 3WWVA 4DR1L 5IP7G 4GKJL 4OWWB 4K0KL 2CWPA 1KIXA 1VQKA 5JEAG 2JA8G 1WYDA 3J7A5 2E2IH 3CW2C 4DUZL 4HJ9A 3DM3A 4HIOA 2HT1A 2C35B 4HJAA 4DV3L 3UDIA 1KAWA 2YTVA 4NXNQ 4A93G 1O7IA 2IHFA 4GN4B 3TEHB 4HIMA 2EQSA 3AFQA 1IBML 4YWLA 3L0OA 1VQ7A 1IBKL 3PUVA 1XTDA 2NN6I 3KYHC 1VQHA 3ULLA 2N3SA 3F8TA 3EIVA 3M3YH 4A3BG 4AIMA 2Y0SG 3AQQA 3RR5A 3RZDH 4LW1A 1PH3A 5LMUQ 4EQ5A 3KF6B 3UE1A 3JAMi 1C7YA 3NEMA 3EBEA 2JA5G 1JJGA 1IBLQ 3PO2H 4DNIA 1Q7YC 4HJ5A 1B70B 2AWOA 2Z6KC 1D7QA 3FKIG 1JB7A 2VY3A 3H3VH 1VQIA 3HKZE 3ER0A 1L1OC 1X3EA 4BXXH 3J81j 1V43A 2PI2A 4YHHQ 1SROA 3T1YL 4XIGS 3T1HL 1N32Q 5M3MG 2HIXA 5C0XG 2R93H 4PZ7A 3CXCA 4OONA 4KI0A 3CCMA 4O2DA 5JJIA 4AQYQ 1MIUA 4JC0A 2AMCB 1SFOH 3PUYA 3AFPA 1OXXK 2DGYA 3H0GG 2JE6I 2KBNA 4DV0L 3AYHB 1Q1EA 3F2BA 1Y1VH 4X66Q 3I4NG 1HNWL 4JG2A 4OWTB 3CCRA 4GOPC 1L2FA 1XPRA 3K8AA 2JA7H 3A0JA 1EIYB 3TS0A 1FL0A 4HJ7A 4X65Q 4DV1Q 1BBUA 4ALPA 4LF4L 2BH8A 2ZM6L 4OXPA 1MKHA 1IL2A 4B3SL 4LF9L 3HKZG 2D0OA 5K36G 2A19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 i;  3S1N H;  2JA6 H;  5IP9 G;  4DR2 Q;  4OO1 G;  4JI3 Q;  1PYS B;  3STB D;  1ASZ A;  4BBS G;  2UU9 Q;  1PH5 A;  5M3F G;  5C4X G;  2MO1 A;  4JI4 Q;  4A3D G;  3KJO A;  4DK3 C;  1SN8 A;  1VQN A;  4KHZ A;  1TWC H;  2HQL A;  1FJG L;  1FGU A;  2JA9 A;  3OTO L;  4DV7 L;  1YJW A;  1TXY A;  5ELO A;  1U0L A;  4LUO A;  3CC2 A;  1XNR L;  4DR7 Q;  1GD7 A;  2R6G A;  3RZO H;  4J15 A;  1QVG A;  1S40 A;  2K5H A;  3HOW H;  1JMC A;  4JYA L;  3CCE A;  2RHQ B;  4JI0 L;  1OXS C;  2CFM A;  1AH9 A;  2VUM H;  4IFD I;  3CPF A;  1C0A A;  5JJL A;  4B3M Q;  3AEV A;  4ME3 A;  2DUD A;  4DR3 L;  2JA8 H;  1JE5 A;  3PGZ A;  3KDF B;  4UP7 A;  2N8N A;  2UUC Q;  4GKK L;  1FVI A;  2QGQ A;  2UXB Q;  1TWF H;  2F52 A;  3S1R H;  2F4V L;  3PO2 G;  4L5Q A;  3CAM A;  1A8V A;  5FJ8 H;  1EUJ A;  2RHS B;  1I3Q H;  4JI7 Q;  1N9W A;  1K0R A;  1HZB A;  1G51 A;  4PZ8 A;  3TRE A;  4A3B H;  3KOJ A;  4BXX G;  4A3C H;  2OQ0 A;  1OXT A;  1PV4 A;  2VNU D;  1EQQ A;  4DV5 Q;  4QL5 A;  4X62 Q;  1Q82 C;  4OX9 L;  1CKN A;  2EXD A;  2VZA A;  3A5Z B;  2QA4 A;  4A3I H;  3G48 A;  2ES2 A;  3TS2 A;  4WJ4 A;  4MZ9 A;  1RL2 A;  4GNX B;  3S2D H;  3ULJ A;  4DV4 L;  3ULP A;  4DV6 Q;  4LFC Q;  2UXD L;  2UUB L;  2RCN A;  3KF8 B;  4GLX A;  4HIK A;  1WJJ A;  1QVC A;  3M85 A;  1NY4 A;  1GM5 A;  4A3F G;  3S16 H;  2K5V A;  2NN6 G;  1X3G A;  2JA6 G;  4LFB L;  3OW2 A;  3H0G H;  4JI2 L;  4MNO A;  1PH8 A;  3M4O H;  3K7U C;  4JI8 L;  2OTL A;  3GTL H;  4YY3 L;  4LFA L;  3BZK A;  3D31 A;  4IJL A;  1SE8 A;  4P71 A;  4X64 Q;  1Q8K A;  2E5L L;  1D8L A;  3KJP A;  1W2B A;  3CMA A;  2PI2 E;  2YTX A;  2N78 A;  1L1O A;  4JI1 L;  4DR1 Q;  1J5E L;  4K0K Q;  3GTG H;  4IPG A;  2A1A A;  1X3F A;  3W5O A;  1YJN A;  4BBS H;  3HOW G;  4P72 A;  4DUZ Q;  5M3F H;  4IPH A;  4L5R C;  1XNQ L;  5ELN A;  4DV3 Q;  4KHP L;  1Z47 A;  1HNX L;  2K52 A;  4MTN A;  2HHH L;  1VQM A;  4JBK A;  2D0P A;  1IBM Q;  2UXC L;  1HJP A;  2B3G A;  1HR0 L;  1CSQ A;  3S2H H;  3GTJ H;  3EN2 A;  2ZTD A;  3L7Z C;  1IBK Q;  3PUZ A;  4GOP A;  1VS0 A;  1K83 H;  2IX0 A;  1TWA H;  3RNU A;  1N36 L;  1NMG A;  2OWO A;  5FJ8 G;  3M9B A;  3ICE A;  1GVP A;  3IRB A;  3MXN B;  4O0A A;  1HZ9 A;  2ALY B;  3NEL A;  1VQ8 A;  1YZ6 A;  4A3C G;  2YV5 A;  3KF6 A;  1G29 1;  1K9M C;  3MEF A;  1BVS A;  1N8R C;  3PO3 H;  1CKO A;  2CQO A;  4LUZ A;  1E1T A;  2RF4 A;  3T1Y Q;  3T1H Q;  1NTG A;  1A62 A;  4A3I G;  1V9P A;  4GS3 A;  3CCJ A;  4C3H H;  4JV5 L;  4HJ8 A;  2K14 A;  1OXV A;  2LXK A;  2PMZ E;  2WFW A;  5JEA J;  4C3J H;  1N33 L;  2FXQ A;  1KXL A;  3CP0 A;  1N34 L;  4DV0 Q;  4A3L H;  4JI6 L;  1HNW Q;  3GTO H;  4IFD G;  1KHI A;  1VQG A;  2H5X A;  2Q2I A;  4BA1 I;  4LF4 Q;  2ZM6 Q;  5IYC G;  3NBH B;  3U4Z A;  3M4Q A;  1OTC A;  4B3S Q;  3HOV H;  2N49 A;  3U50 C;  2K5N A;  1X9N A;  1Q81 C;  2ZTC A;  4B3R L;  3HOY H;  5GQO A;  4NB3 A;  3A5U A;  3L2P A;  4NPS A;  2IY5 B;  4A3F H;  2QEX A;  1IYJ B;  4GN5 A;  3E9I A;  1FJG Q;  2VQE L;  4IOA A;  3OTO Q;  4DV7 Q;  3TRZ A;  2K50 A;  4RMF A;  2K75 A;  1YHQ A;  3K81 C;  5C0X J;  3RLN A;  5IYD H;  1SLJ A;  4A75 A;  1PFS A;  1G6P A;  2ID0 A;  4IJH A;  3F2D A;  4JYA Q;  3G71 A;  4JI0 Q;  3PCO B;  2YTY A;  4JI5 L;  4QQB X;  5C4J H;  4DR4 L;  4DR6 L;  1UE1 A;  4DR3 Q;  1HNZ L;  1PH9 A;  4LF6 L;  3BJU A;  1I94 L;  3W1B A;  1X56 A;  4GKK Q;  4DAY B;  1JJ2 A;  1KD1 C;  2UUA Q;  3S15 H;  3KDF A;  3A74 A;  4DV1 L;  1I6H H;  3PUW A;  3G6E A;  3PO3 G;  1VQB A;  2R7D A;  4WJ3 M;  4RG1 A;  3HOZ H;  5GRO A;  5IWA Q;  1LTL A;  3FP9 A;  3UE0 A;  3E9H A;  4R4I A;  3HKS A;  3RN2 A;  4JI3 L;  2I5M X;  3Q8D A;  4R1J A;  1KRS A;  2GVB A;  3ZJY C;  1VQJ A;  1HZA A;  5DLQ E;  4P74 A;  3CCQ A;  2ZJQ A;  1VQE A;  2CWA A;  4A76 A;  4JI4 L;  3UDX A;  1QUQ A;  3GTK H;  1X65 A;  2VW9 A;  4A3L G;  1XMO L;  2GVA A;  3I2Z A;  1B7Y B;  3PV0 A;  4DV4 Q;  4A3G H;  2UXD Q;  2UUB Q;  4C2M H;  1YJ9 A;  2XGT A;  4JBJ A;  1VQC A;  1KRT A;  4DR5 Q;  1VQL A;  2NVX H;  4B3T Q;  4A3K G;  2GN5 A;  3HOV G;  4JOI C;  5FLM H;  3DLL A;  3S1Q H;  4LFB Q;  2KCT A;  2NVY H;  5EAY A;  1Q46 A;  4YWK A;  4JI2 Q;  4A3J G;  1K8A C;  4JI8 Q;  1M1K C;  1JT8 A;  3HOY G;  3F1Z A;  4L5T A;  3I56 A;  1WI5 A;  3CD6 A;  2AHO B;  1PH4 A;  1T9H A;  1SRU A;  3PUX A;  2IT1 A;  4R4O A;  1VQ9 A;  1XMQ L;  4P75 A;  2UUC L;  3GTQ H;  4PMW A;  4GN3 B;  1VQ4 A;  1P8L A;  3K80 C;  4DUY L;  1Q86 C;  5IYC H;  5LMN L;  2E5L Q;  4OO1 I;  1HH2 P;  1Z9F A;  3KFU A;  1SMX A;  1J5E Q;  3LGJ A;  4JI1 Q;  1E22 A;  1JJC B;  4GLA C;  5IYD G;  1NMF A;  1V1Q A;  4DV2 Q;  4UP8 A;  1CKN B;  1IZ6 A;  1B8A A;  4R4Q A;  3UDF A;  4LF5 L;  4DKA C;  1XPO A;  1XNQ Q;  3D0F A;  5JJK A;  4UY8 C;  1KC8 C;  4NXM L;  1HNX Q;  2HHH Q;  4KHP Q;  4GKJ Q;  2UXC Q;  3J81 c;  5BR8 L;  4BA2 I;  4Y52 H;  1CSP A;  2V1C C;  2PNH A;  3RLO A;  5M5X H;  4LFC L;  5M5Y H;  1E24 A;  2CKZ B;  1IXR A;  1HZC A;  3FHW A;  4GNX C;  1XJV A;  1MJE A;  4LF7 L;  3CPW A;  1S72 A;  4KLK A;  1Y14 B;  5AJ3 L;  2VQF L;  3I7F A;  1X55 A;  4IO9 A;  5IYB G;  1KL9 A;  1UEB A;  4PZ6 A;  3HOX G;  4JBM A;  3HOZ G;  3HOU H;  2E8G A;  3K7A H;  4JCV E;  4C3I H;  2A8V A;  1I5F A;  2MQH A;  2WAQ E;  2EIF A;  2ZTE A;  2Q2U A;  4QIW E;  2B29 A;  4LNQ A;  2R92 H;  1K8G A;  1VQD A;  3B6Y A;  3H3V I;  2LSS A;  1C9O A;  3CQZ H;  1YNX A;  3E0E A;  3J81 i;  4JV5 Q;  1L1O B;  4X64 L;  1EQR A;  2NZH A;  4LF8 L;  4A3E H;  2AWN A;  3JAM c;  4A3G G;  2PQA B;  4A4I A;  2MNA A;  3I4O A;  4POF A;  1HR0 W;  1N33 Q;  2ASB A;  1N34 Q;  1QZG A;  5HGQ A;  4JI6 Q;  5J3B A;  1EWI A;  2MO0 A;  3BU2 A;  1CKM A;  5GAG C;  5FLM G;  3S24 A;  1BKB A;  4UPA A;  1E3P A;  4GOP B;  3H15 A;  2WAQ G;  3JC6 6;  1UE6 A;  2OCE A;  2E2J H;  3RN5 A;  2NVQ H;  2Q2H A;  1DGS A;  5H1S E;  3CC4 A;  1EFW A;  1Q1B A;  4B3R Q;  4R4T A;  4Y7N H;  5C3E H;  2B63 H;  3KLW A;  4NXN L;  3GD7 A;  1VCI A;  4BY7 H;  1K3R A;  4A3K H;  4LF9 Q;  1YHA A;  1YIJ A;  2VS1 A;  4IPC A;  4A3J H;  2VQE Q;  4QGU A;  1VQ5 A;  5IT9 c;  4UP9 A;  1YEZ A;  3CC7 A;  2IHE A;  1ASY A;  3I4M G;  5LMU L;  4IOC A;  2XTI A;  4GLV B;  3J80 c;  1YIT A;  4POG A;  1UWV A;  1IBL L;  2KHJ A;  2JEB I;  1EOV A;  1XPU A;  2IX1 A;  3F2C A;  4JI5 Q;  1CUK A;  1R9T H;  1XNR Q;  1YBY A;  4DR4 Q;  4DR6 Q;  1YI2 A;  1VQF A;  3CF5 A;  1HNZ Q;  2LXJ A;  1GKH A;  4DAM A;  4LF6 Q;  4L5S A;  2WP8 J;  1I94 Q;  4IFD J;  4YHH L;  1M90 C;  1N32 L;  2KEN A;  4DK6 C;  3S1M H;  5GAH C;  1VQA A;  4JOI A;  2L15 A;  1W3S A;  1PH1 A;  4AH6 A;  4EX5 A;  4AQY L;  1PA6 A;  4YCV A;  1VQP A;  1J6Q A;  3U4V A;  1PH6 A;  2I0Q A;  3HFZ B;  2VUM G;  1EIF A;  3HOU G;  1PH2 A;  2NVT H;  2R92 G;  1RIP A;  4X66 L;  3PF5 A;  2YYZ A;  4DPG A;  4TVA B;  1WCM H;  1Y1W H;  2F4V Q;  2JQO A;  4TQU S;  4BY1 G;  5E7N A;  1E1O A;  4XTC S;  4X65 L;  4A3M H;  1X54 A;  1UE7 A;  1PH7 A;  1A0I A;  2OQK A;  2F3I A;  4A3E G;  1NBW A;  2KCM A;  4BBR H;  1MJC A;  5HY6 A;  5IYB H;  3HOX H;  1K73 C;  4H02 A;  3BZC A;  4DR2 L;  3J7Z C;  1XMO Q;  1PYB A;  1WOC A;  4QY7 A;  2BA0 A;  5C44 H;  3GO5 A;  2UU9 L;  1LYL A;  4OX9 Q;  3CME A;  3S14 H;  3GTM H;  3PIO A;  1H95 A;  2R7Z H;  1SR3 A;  3S17 H;  1QVF A;  4YCU A;  5C0X I;  2R7F A;  2NZO A;  3K0X A;  1QZH A;  3M4P A;  4DR7 L;  5M5W H;  4OWX B;  5IP7 H;  1UE5 A;  4GNX A;  5C3E G;  2ZJR A;  2B63 G;  1I50 H;  5FLX c;  4BY7 G;  2ATW A;  4HID A;  1XMQ Q;  2I5H A;  3PSI A;  2BA1 A;  2CCZ A;  2Q2T A;  4DUY Q;  2ZJP A;  5LMN Q;  2D62 A;  2UUA L;  4B3M L;  4A93 H;  2AKW B;  2K4K A;  4P73 A;  4YY3 Q;  2E2H H;  4LFA Q;  1PVO A;  2YU9 H;  1U5K A;  3G4S A;  2JEA I;  1YHB A;  3GDE A;  5IWA L;  4LF5 Q;  2UXB L;  1GO3 E;  1WFQ A;  1BBW A;  1QUQ B;  3W1G A;  2R93 G;  1A63 A;  4NXM Q;  1TWH H;  2JA5 H;  4JI7 L;  3U58 A;  3CCS A;  5GAD C;  1OXU A;  1X6O A;  4YCW A;  1S3O A;  3PF4 A;  1TWG H;  3FKI H;  5BR8 Q;  3I4M H;  2OTJ A;  1Y1V G;  4X62 L;  4DV5 L;  4AYB E;  2JA7 G;  4LF7 Q;  4QJF A;  3SGI A;  2JK8 A;  1KQS A;  5M3M H;  1HR0 Q;  3CCV A;  4DR5 L;  5AJ3 Q;  1E7Z A;  4PG3 A;  2VQF Q;  4B3T L;  2KHI A;  1NJI C;  3UDG A;  4APV A;  2WB1 E;  5LMN W;  3STB C;  1N36 Q;  1Y1W G;  1WCM G;  3M7N A;  4DV6 L;  1Q12 A;  1LM0 A;  4X6A H;  4A3M G;  1AE2 A;  4FDB A;  3I55 A;  3I4N H;  1AE3 A;  3PIP A;  4BBR G;  1L0W A;  3CCL A;  3GTP H;  3RLF A;  2Z6K A;  5IE8 A;  3ERS X;  2JJQ A;  1NE3 A;  3OYY A;  1P16 A;  2I5L X;  2Z0S A;  1YVC A;  4LWC A;  4YWM A;  5C44 G;  3VDY A;  4LF8 Q;  3NEN A;  4AYB G;  2HIV A;  5GAE C;  1PHJ A;  2VL6 A;  2BH2 A;  1VQ6 A;  1LUZ A;  4JBW A;  5IP9 H;  1EYG A;  4R4C A;  4BY1 H;  1VQO A;  4DV2 L;  2R7Z G;  2MFI A;  2Y0S E;  2PQA A;  5C4X H;  3TQY A;  2WB1 G;  4IPD A;  4LUV A;  5IY0 A;  4A3D H;  3CCU A;  3WWV A;  4DR1 L;  5IP7 G;  4GKJ L;  4OWW B;  4K0K L;  2CWP A;  1KIX A;  1VQK A;  5JEA G;  2JA8 G;  1WYD A;  3J7A 5;  2E2I H;  3CW2 C;  4DUZ L;  4HJ9 A;  3DM3 A;  4HIO A;  2HT1 A;  2C35 B;  4HJA A;  4DV3 L;  3UDI A;  1KAW A;  2YTV A;  4NXN Q;  4A93 G;  1O7I A;  2IHF A;  4GN4 B;  3TEH B;  4HIM A;  2EQS A;  3AFQ A;  1IBM L;  4YWL A;  3L0O A;  1VQ7 A;  1IBK L;  3PUV A;  1XTD A;  2NN6 I;  3KYH C;  1VQH A;  3ULL A;  2N3S A;  3F8T A;  3EIV A;  3M3Y H;  4A3B G;  4AIM A;  2Y0S G;  3AQQ A;  3RR5 A;  3RZD H;  4LW1 A;  1PH3 A;  5LMU Q;  4EQ5 A;  3KF6 B;  3UE1 A;  3JAM i;  1C7Y A;  3NEM A;  3EBE A;  2JA5 G;  1JJG A;  1IBL Q;  3PO2 H;  4DNI A;  1Q7Y C;  4HJ5 A;  1B70 B;  2AWO A;  2Z6K C;  1D7Q A;  3FKI G;  1JB7 A;  2VY3 A;  3H3V H;  1VQI A;  3HKZ E;  3ER0 A;  1L1O C;  1X3E A;  4BXX H;  3J81 j;  1V43 A;  2PI2 A;  4YHH Q;  1SRO A;  3T1Y L;  4XIG S;  3T1H L;  1N32 Q;  5M3M G;  2HIX A;  5C0X G;  2R93 H;  4PZ7 A;  3CXC A;  4OON A;  4KI0 A;  3CCM A;  4O2D A;  5JJI A;  4AQY Q;  1MIU A;  4JC0 A;  2AMC B;  1SFO H;  3PUY A;  3AFP A;  1OXX K;  2DGY A;  3H0G G;  2JE6 I;  2KBN A;  4DV0 L;  3AYH B;  1Q1E A;  3F2B A;  1Y1V H;  4X66 Q;  3I4N G;  1HNW L;  4JG2 A;  4OWT B;  3CCR A;  4GOP C;  1L2F A;  1XPR A;  3K8A A;  2JA7 H;  3A0J A;  1EIY B;  3TS0 A;  1FL0 A;  4HJ7 A;  4X65 Q;  4DV1 Q;  1BBU A;  4ALP A;  4LF4 L;  2BH8 A;  2ZM6 L;  4OXP A;  1MKH A;  1IL2 A;  4B3S L;  4LF9 L;  3HKZ G;  2D0O A;  5K36 G;  2A19 A; 
#chains in the Genus database with same CATH topology
 1HA6 A;  3S1N H;  4A93 B;  1BO0 A;  5ELD A;  1CI3 M;  1ASZ A;  4I65 A;  3GQB A;  4OHJ A;  2MO1 A;  2EYJ A;  1VQN A;  3SXH A;  1FJG L;  1IHZ A;  2XIW A;  4DV7 L;  4L8J A;  1TWH B;  5ELO A;  3HGB A;  5CMD A;  5I9P A;  1S40 A;  3HOW H;  4JYA L;  4QF4 A;  4FF3 A;  3L9A X;  2L4N A;  5IGC A;  2VXW A;  3UI2 A;  4LJZ C;  1WVL A;  1WTR A;  4DR3 L;  2JA8 H;  1CA6 A;  2H1E A;  4G7H C;  2F0P A;  2UXB Q;  1BR9 A;  4J8Q A;  3S1R H;  1MGS A;  4L5Q A;  2F1M A;  1EUJ A;  2RSO A;  1G51 A;  4PZ8 A;  4RCN A;  3TRE A;  4C3I B;  4A3B H;  4A3C H;  1OXT A;  3HKZ B;  4OIJ A;  2L5T A;  1PV4 A;  1EQQ A;  1HQM C;  3MXP A;  2L11 A;  1B9N A;  5IT9 E;  5D3D A;  2VZA A;  3A5Z B;  3TS2 A;  2GA4 B;  1A6X A;  4WJ4 A;  1FGB D;  1VMC A;  1ICW A;  3ULJ A;  4DV4 L;  3DWP A;  4LFC Q;  2UUB L;  5LHY 1;  5C0X H;  1CQF A;  1NY4 A;  4ZAI A;  3OW2 A;  3H0G H;  4JI2 L;  4MNO A;  3HEJ A;  4YY3 L;  3FPU B;  4IJL A;  5C3E B;  3M3Y B;  5I2Y A;  4X64 Q;  1FYC A;  2KQ3 A;  2F0H A;  1ZXT A;  2K32 A;  3CMA A;  1IYV A;  2QDB A;  4IPG A;  4BBS H;  4DUZ Q;  2B2V A;  5M3F H;  1PXU A;  1Z47 A;  4OEM B;  1HJP A;  5ELB A;  3EN2 A;  5EBC A;  5IOC A;  4GOP A;  1K83 H;  4XT3 B;  3TP5 A;  2EJF C;  1BNZ A;  2NUC A;  1HTP A;  1TY0 A;  1ENF A;  4IUQ A;  5FOB B;  3M9B A;  1K28 A;  1SJH D;  1F2L A;  2XVS A;  3IRB A;  3T51 B;  1K8O A;  3FRP B;  3VYT A;  1N8R C;  1CKO A;  3VYS A;  1TS5 A;  1TVX A;  2RF4 A;  3T1H Q;  1DOL A;  3NE5 B;  2PO4 A;  2RDH A;  2PMZ E;  2WFW A;  1N33 L;  1KXL A;  3CP0 A;  1EU3 A;  3RZO B;  2Q2I A;  2ZM6 Q;  3U4Z A;  5F2D A;  1PFM A;  1OTC A;  1NAP A;  2N49 A;  3I73 A;  2K5N A;  2ZTC A;  1L0Y B;  3HOY H;  3NUC A;  3A5U A;  3SHL A;  3Q6S A;  3E9I A;  1SE3 A;  3R3O A;  4IOA A;  1LV9 A;  1YHQ A;  3K81 C;  4Z9C B;  4H13 C;  1G6P A;  4IJH A;  3E3X A;  4X3S A;  4JI5 L;  1Q90 A;  4HCS A;  4H0L C;  3VR3 A;  1G91 A;  1PH9 A;  4LF6 L;  3BJU A;  3JAM E;  1KD1 C;  2OEO A;  5M3M B;  3S15 H;  5D14 A;  4DV1 L;  3NWS A;  3PUW A;  1I4P A;  3HOZ H;  4R4I A;  3RN2 A;  1SYG A;  2EYP A;  5I6W A;  4FXG C;  1HZA A;  5DLQ E;  3CCQ A;  1VQE A;  1GHJ A;  1X65 A;  2F0U A;  3OPO A;  4A3G H;  3TP8 A;  2UXD Q;  1YJ9 A;  4JBJ A;  1JQY D;  1Z6H A;  4KJN A;  2KCT A;  4A3J G;  3W3A A;  1GUT A;  1KDA A;  4JI8 Q;  1M1K C;  1S5D D;  1T9H A;  3PUX A;  3OIQ A;  4R4O A;  1TS2 A;  3GTQ H;  4PMW A;  1XX8 A;  1P8L A;  3K80 C;  4DUY L;  1Q86 C;  2E5L Q;  4OO1 I;  1BCP F;  1HH2 P;  1D2B A;  4DNR B;  1AZP A;  2QF7 A;  1J5E Q;  3LGJ A;  4FVM A;  1B8A A;  3NTK A;  4R4Q A;  5T1G A;  3D0F A;  2ZXP A;  4UY8 C;  4KHP Q;  1U4L A;  2BDN A;  1G6Z A;  5K5P A;  4BS9 A;  3BDO A;  4CDE C;  1BXT A;  1CSP A;  5M5Y H;  4LFC L;  1IXR A;  3I8Z A;  2Z4I A;  3IKJ A;  1Y14 B;  3K57 A;  3BYY B;  4IO9 A;  1C8C A;  2VUM H;  2CVR A;  4PNY A;  2MQH A;  4OIK A;  3DHQ A;  4IN3 A;  4XT1 B;  4QIW E;  2B29 A;  4NMZ A;  3T13 A;  2Q2U A;  1K8G A;  1EU4 A;  1VQD A;  3E6Z X;  1SXT A;  5KND A;  3E0E A;  4X64 L;  1EQR A;  2SDF A;  3JAM c;  3S1N B;  2CH4 W;  2PQA B;  4HMI A;  1HR0 W;  3SK6 A;  2F0E A;  2K05 A;  3FEW X;  3JC6 6;  4ME5 A;  2E2J H;  2CQA A;  2Q2H A;  3H6M A;  1LAC A;  1KAB A;  5JPN C;  1TS4 A;  1K0S A;  4NXN L;  4BY7 H;  5FK9 C;  1K3R A;  2F0J A;  1QNK A;  2VS1 A;  4IPC A;  4UP9 A;  1I6H B;  3CC7 A;  2IHE A;  1ASY A;  4IOC A;  2XTI A;  4POG A;  1ILP A;  2ZXO A;  5IIF A;  1XPU A;  3PIP 3;  3V96 A;  2NB0 A;  1XNR Q;  1HNZ Q;  1I94 Q;  5IGG A;  3MFY A;  2QKI C;  1EZ8 A;  4AH6 A;  4EX5 A;  1ENA A;  4ZYS A;  3U4V A;  3HFZ B;  1EIF A;  1PH2 A;  2R92 G;  1RIP A;  2YYZ A;  1WCM H;  4Q5V A;  2F4V Q;  4TQU S;  1SEB D;  1NSN S;  4QIW B;  5E7N A;  5C5M A;  4A3M H;  3VA5 A;  3MEH A;  4JI4 Q;  3P7J A;  1MSH A;  2KCM A;  3HOX H;  1B53 A;  3LX0 A;  4DXG A;  4DR2 L;  3J7Z C;  1EEF D;  3NXW A;  1XMO Q;  1PYB A;  2BA0 A;  3T16 A;  1FNW A;  1RTO A;  3BYT B;  1NR2 A;  4JK1 C;  3OW7 A;  2OF1 A;  2O2L D;  2NZO A;  2WKC A;  1D5Z C;  4OWX B;  1U9R A;  2ATW A;  2WKD A;  3KF8 A;  2Q2T A;  1B1Z A;  3Q24 A;  4H44 C;  4A93 H;  4B3M L;  2F0O A;  2K4K A;  1SYF A;  2HCI A;  5EPJ A;  1YHB A;  3GDE A;  3K7A B;  4CDF C;  1EIH A;  1HQR D;  2R93 G;  1TWH H;  2F03 A;  3CQZ B;  3U58 A;  1SYD A;  1ZEQ X;  4CJ1 B;  1X6O A;  1JE4 A;  1HUM A;  4X62 L;  2X6L A;  1HR0 Q;  2K5Q A;  5AJ3 Q;  3UDG A;  1Y8P B;  4DV6 L;  1Q12 A;  2EPB A;  2NVQ B;  3I55 A;  2ENB A;  4BBR G;  3PIO 3;  4Y7N B;  3A55 A;  2Z6K A;  3ERS X;  3M7G A;  3OYY A;  1NE3 A;  1T5X D;  5BN3 A;  4A3K B;  1STG A;  4LF8 Q;  1JOQ A;  2BH2 A;  2VL6 A;  4R4C A;  2G9H D;  3V05 A;  3HOY B;  2R7Z G;  1EL0 A;  1ICF B;  1SMY D;  1H9K A;  2PQA A;  3TQY A;  4LUV A;  5IY0 A;  1EIG A;  4NKL A;  5IP7 G;  4K0K L;  2K6A A;  4DV3 L;  1KAW A;  1O7I A;  4GN4 B;  4HIM A;  1C48 A;  2EQS A;  3AFQ A;  5IT9 L;  1IBK L;  3PUV A;  3N6R A;  2O5I C;  1U4P A;  3NBH A;  1GUO A;  2EY5 A;  1SYB A;  2N3S A;  3M3Y H;  3EIV A;  4DFA A;  1I4H A;  4RAU C;  1B4O A;  1ILQ A;  3HS0 C;  5LMU Q;  3KF6 B;  3UE1 A;  3EBE A;  2JA5 G;  4HAE A;  4RGO S;  4HJ5 A;  4RGN A;  1B70 B;  2Z6K C;  2DJG C;  2F4I A;  4BBR B;  2IJ0 A;  2XWB B;  3MXU A;  3T1Y L;  2PI2 A;  4YHH Q;  1SRO A;  2EYL A;  1N32 Q;  2B2Y A;  2HIX A;  2IW3 A;  5JAV A;  3ERQ A;  4OON A;  4KI0 A;  4JC0 A;  3PUY A;  3AFP A;  3S17 B;  2KBN A;  1XYI A;  4A3G B;  1Q1E A;  4HCE A;  3F2B A;  3K8A A;  3A0J A;  1EIY B;  2ZT9 C;  1FL0 A;  4HJ7 A;  1BBU A;  2BH8 A;  4LK1 C;  1LT6 D;  3E5S A;  3F2U A;  4WJ3 M;  2D0O A;  1E2Z A;  5DAU A;  3CF5 A;  1UEA B;  1CFM A;  3SVM A;  4OO1 G;  2PQE A;  3I91 A;  1NNX A;  4N8F A;  4H7B A;  4A3D G;  3KJO A;  1SN8 A;  4DA2 A;  2HQL A;  2JA9 A;  3OTO L;  2JA5 B;  1U0L A;  4LUO A;  1XNR L;  1G2S A;  3RZO H;  4J15 A;  1AN8 A;  3H09 A;  2B8G A;  2K04 A;  1JMC A;  2B2Y C;  3CCE A;  1O78 A;  4S3S A;  1JC7 A;  1EY9 A;  2Q8T A;  1C0A A;  5JJL A;  3AEV A;  1JE5 A;  3T56 B;  3Q22 A;  4FYD A;  5C4H A;  4GKK L;  2TSS A;  2F4V L;  3PO2 G;  2QEJ C;  1QIL A;  1A8V A;  1TS3 A;  2RHS B;  4QUF A;  4JI7 Q;  1B3Q A;  1N9W A;  1K0R A;  1X3Q A;  2A5H A;  2SNM A;  4DV5 Q;  4QL5 A;  4BY1 B;  2B39 A;  3K59 A;  3AMU A;  2B2U A;  2A6E C;  1EFI D;  1RL2 A;  4A3D B;  2KCN A;  3S2D H;  2FMC A;  3ULP A;  1W6K A;  2E2I B;  4HIK A;  1QVC A;  4CHT B;  4A3F G;  3S16 H;  2K5V A;  2NN6 G;  5E4X A;  5J39 A;  2JA6 G;  4LFB L;  1S5B D;  2OTL A;  1STB A;  2K5D A;  3BZK A;  3JAM L;  1SE8 A;  4BY7 B;  1Q8K A;  3KBX A;  1D8L A;  2RCF A;  3KJP A;  3PO2 B;  2N78 A;  1L1O A;  1UUP A;  4RH6 A;  2ZXR A;  4IPH A;  3OHX C;  1MHW C;  5ELN A;  4KKS A;  4C1N K;  2HHH L;  2K52 A;  1PRT F;  4K6L A;  2NZ1 D;  4IUP A;  1Y69 U;  1VQM A;  4JBK A;  2B2U C;  1F2Y A;  2B3G A;  1HR0 L;  3L7Z C;  3PUZ A;  2IX0 A;  1IW7 D;  2EZV A;  1EY0 A;  1NMG A;  3ND8 A;  2OWO A;  4IZ8 A;  1Y1V B;  3NTH A;  1QB5 D;  2JA7 B;  1MBY A;  4K14 A;  3MXN B;  4O0A A;  5EKK A;  3NEL A;  3MAQ A;  2YV5 A;  3KF6 A;  1G29 1;  2NYZ D;  1K9M C;  4XQQ A;  2CQO A;  4LUZ A;  2JA6 B;  1H9R A;  1G2T A;  2F0T A;  1SJE D;  4CKE A;  2ICE C;  4DN4 M;  4A3I G;  3CCJ A;  2K14 A;  1OXV A;  5JEA J;  1Y8N B;  4RKB A;  2LS0 1;  1N34 L;  4AYB B;  3DEO A;  1HNW Q;  3PMF A;  3GTO H;  1E0B A;  4IFD G;  2H5X A;  4BA1 I;  4LF4 Q;  5IYC G;  3IFD A;  3ONA B;  1Y8O B;  3H91 A;  2A69 D;  3KLS X;  1X9N A;  4X3U A;  4B3R L;  5COY A;  4R8I A;  2K33 A;  2IY5 B;  1GUS A;  4I7Z C;  3H94 A;  1I3Q B;  2EOT A;  4RCO A;  3RLN A;  2CW0 D;  2O4X A;  1PFS A;  1STE A;  2XRQ D;  3F2D A;  3G71 A;  5KNB A;  4JI0 Q;  1MD2 D;  2Q8I B;  4DR6 L;  1UE1 A;  4A3I B;  3RMH A;  3KLR A;  3W1B A;  4DAY B;  1YNJ D;  3P75 A;  3A74 A;  1I6H H;  2Z6B A;  4G7Z C;  3TP7 A;  3PO3 G;  1SSO A;  3C46 A;  5GRO A;  5IWA Q;  3M4O B;  4OEL B;  4G57 A;  4R1J A;  3Q8D A;  3GTL B;  1KRS A;  2GVB A;  5I2X A;  1VQJ A;  1FD7 D;  4C3J G;  1QUQ A;  3BDC A;  5NUC A;  2VW9 A;  1JOK A;  4A3L G;  3GP7 A;  1ZYR D;  1B7Y B;  3PV0 A;  2L0C A;  3EFX D;  4DR5 Q;  1KRT A;  1PTO H;  3HOV G;  4LMQ D;  3S1Q H;  3I70 A;  3MTS A;  5EAY A;  1Q46 A;  1DON A;  1PZJ D;  1WI5 A;  4XYO A;  2F3V A;  1PYW D;  2IT1 A;  4FF4 A;  4P75 A;  4GN3 B;  1NUC A;  2E76 C;  5BN4 A;  4N9P A;  4JI1 Q;  1E22 A;  5IYD G;  4UP8 A;  1CKN B;  4LF5 L;  3D8G A;  4ID6 A;  3PO3 B;  1EWC A;  5A35 A;  1XNQ Q;  1QCB D;  3SR1 A;  1HNX Q;  4GKJ Q;  1CM9 A;  2UXC Q;  3QIA A;  3QO2 A;  5BR8 L;  4C3J B;  1RTN A;  2V1C C;  1EYA A;  2PNH A;  2R3Z A;  3VR6 A;  5L37 A;  4KLK A;  2VQF L;  1X55 A;  4RGM A;  1CHQ D;  1UEB A;  4M1U B;  3K7A H;  2A8V A;  1I5F A;  2F3W A;  2EIF A;  1J9O A;  2R92 H;  1DOM A;  3RD4 A;  3D4D A;  3B6Y A;  2DY7 A;  1EY4 A;  3CQZ H;  1BBX C;  1JOO A;  1YNX A;  4JV5 Q;  3J81 i;  3Q0A A;  4V19 0;  2BE5 D;  3K58 A;  1HXY D;  3I4O A;  4F8M A;  4POF A;  4EQP A;  1PTO D;  3FVQ A;  2B2T A;  5HGQ A;  4JI6 Q;  3DWQ A;  1FNV A;  3N52 A;  5GAG C;  1WD1 A;  1F9Q A;  4UPA A;  5CBA E;  1E3P A;  3OWE B;  1STA A;  1AEX A;  1UE6 A;  2LY7 A;  2NVQ H;  3SEB A;  1Q1B A;  4XDX A;  4Y7N H;  3KLW A;  4DF7 A;  4A3K H;  4LF9 Q;  1KNE A;  1YHA A;  1SE2 A;  2EYM A;  2VQE Q;  5IT9 c;  3D4W A;  3I4M G;  4HSV A;  1SNQ A;  2BOS A;  2KHJ A;  3NQI A;  2DNC A;  2JEB I;  3R2T A;  5KRU A;  4O42 A;  1II3 A;  4DR4 Q;  3GTK B;  1VQF A;  2LXJ A;  1GKH A;  1PFB A;  2NTT A;  4DAM A;  1XXG A;  2Q8R E;  2B2T C;  5FKA C;  5GAH C;  1VQA A;  1W3S A;  2KCC A;  1DCZ A;  4YCV A;  2L55 A;  2I0Q A;  1H9S B;  3HOU G;  3S2D B;  4DAY A;  1A2U A;  4X66 L;  1SMY C;  2NVY B;  3G6J B;  4F7X A;  4K5V A;  2RKS A;  4X65 L;  3DEP A;  1X54 A;  2ICI A;  1PA6 A;  3S16 B;  2LMC B;  4BBR H;  5IYB H;  2PW5 A;  1AW7 A;  2BCO A;  4H02 A;  1JR0 D;  1H9M A;  1WOC A;  4QY7 A;  3GO5 A;  2AQ3 B;  3PIO A;  4FF1 A;  3IFT A;  4ZQ3 A;  2R7Z H;  2NWG A;  1H95 A;  1SR3 A;  1RJT A;  1QVF A;  4YCU A;  2PMZ B;  5DNF A;  3S17 H;  5D65 A;  1DJR D;  3OMG A;  5IP7 H;  1UE5 A;  2HDM A;  3MVV A;  2ZJR A;  2B63 G;  2XWJ B;  3OIP A;  1XMQ Q;  5FO7 B;  3PSI A;  5M5X B;  3R8B A;  1YNN D;  2ZJP A;  5LMN Q;  2D62 A;  2FIN B;  2E2H H;  4LFA Q;  4DK0 A;  1PVO A;  2F0I A;  2HCC A;  3G4S A;  3DUZ A;  5IWA L;  2UXB L;  1WFQ A;  3BZD B;  1CK1 A;  2XSC A;  4IUV A;  3W1G A;  5KIX A;  1A63 A;  4NXM Q;  3HRZ C;  2JA5 H;  1PZK D;  1KNA A;  1EY7 A;  1OXU A;  1CQV A;  3PF4 A;  1TWG H;  3A56 A;  4CKC A;  4LF7 Q;  3SGI A;  1A3V A;  2E2D C;  1GUG A;  4DR5 L;  3WOF A;  1E7Z A;  4APV A;  2WB1 E;  1N36 Q;  1Y1W G;  1O80 A;  4U67 3;  1AE2 A;  2A68 D;  3GTO B;  1AE3 A;  2F0Q A;  1L0W A;  2EVB A;  1HCZ A;  2B63 B;  5DM7 3;  3RLF A;  1LAB A;  2Z0S A;  1YVC A;  1WTP A;  2L1B A;  3NEN A;  1FNU A;  2HIV A;  5TSS A;  4A3J B;  3K5M A;  4BY1 H;  4OO1 H;  4FNF A;  2Y0S E;  2WB1 G;  4IPD A;  4A3D H;  3SDZ A;  4GKJ L;  3NK9 A;  2CWP A;  1J8I A;  1VQK A;  2JA8 G;  1WYD A;  4ZKB B;  2E2I H;  3CW2 C;  4DUZ L;  3DM3 A;  2HT1 A;  2C35 B;  4K2K A;  4ABN A;  1S4Z A;  3TEH B;  3I4L A;  3MC0 B;  4YWL A;  3L0O A;  2DN8 A;  5CYU A;  1XTD A;  2NN6 I;  1TKW B;  4A3B G;  1LTI D;  2Y0S G;  3AQQ A;  1PH3 A;  3QR8 A;  2IWH A;  1Y1W B;  3NEM A;  2KA7 A;  3VA7 A;  1IBL Q;  3PO2 H;  2EJG C;  2I07 B;  1D7Q A;  4ZK9 B;  1JB7 A;  3ER0 A;  1ONL A;  3J81 j;  1V43 A;  1EY8 A;  3T1H L;  5KYL A;  5C0X G;  1SE4 A;  2IPK D;  3S14 B;  3GTM B;  3QG1 A;  4AQY Q;  2AMC B;  2DGY A;  3H0G G;  1SNO A;  1Y1V H;  4OWT B;  2EY1 A;  3W2D A;  5M5W B;  1XPR A;  2JA7 H;  3J81 E;  1PTO B;  1I50 B;  2ZM6 L;  1PFN A;  1IL2 A;  4O1N A;  4YIJ A;  4LF9 L;  3S1Q B;  1GUN A;  3ERO A;  3J80 i;  2JA6 H;  5IP9 G;  1B2T A;  4JI3 Q;  4BBS G;  1V1P B;  2YU9 B;  2UU9 Q;  5C4X G;  3S9W A;  1CZG A;  5M3F G;  1KLG D;  1U4R A;  3NP8 A;  4DK3 C;  2AQ1 B;  2Y0S B;  4KHZ A;  4ODG A;  4KD4 A;  4WFN 3;  1IW7 C;  2K7V A;  1B50 A;  2I46 A;  2N55 A;  5FLX L;  3CC2 A;  4DR7 Q;  1F2M A;  1GD7 A;  2R6G A;  4R8N A;  3GV6 A;  3EJI A;  2HD3 A;  2K5W A;  4PMB A;  4E6I A;  2K5H A;  4KJO A;  1OXS C;  2CFM A;  4IUN A;  4IFD I;  1DZ1 A;  3CPF A;  4HR7 B;  1WTO A;  2DUD A;  5JEA H;  1A2T A;  2D5D A;  3BVZ A;  3PGZ A;  4UP7 A;  4G7O C;  2F52 A;  2J0T D;  3CAM A;  1I3Q H;  4V0B A;  3GTP B;  2R92 B;  3MHB A;  2VNU D;  4NDX A;  3J7Y W;  2EXD A;  2F0S A;  2JSO A;  3P20 A;  4A3I H;  2A69 C;  5C4X B;  1O7Z A;  1IKM A;  1IYU A;  4GNX B;  4FXK C;  2UXD L;  3CRK C;  4GLX A;  1I4G A;  4RWS C;  3M85 A;  1F2Z A;  1T5E A;  3M4O H;  1PH8 A;  1C4Q A;  3K7U C;  4JI8 L;  4ZCK A;  3R93 A;  2CW0 C;  3GTL H;  4LFA L;  1JOR A;  5HGT A;  3NSW A;  3EQL C;  1TII D;  1NR4 A;  3BG3 A;  4P71 A;  1AFP A;  3RZD B;  2E5L L;  3A54 A;  1SAP A;  1KTK A;  3OWF A;  1J5E L;  4DR1 Q;  3NPP A;  1YNJ C;  1WTQ A;  4DAV A;  4KHP L;  4MTN A;  2D0P A;  1IBM Q;  4OGQ C;  2R93 B;  1CSQ A;  2N88 A;  3IL8 A;  4B08 A;  4RA8 A;  4CBV A;  4LAA A;  1VS0 A;  2OXP A;  3RNU A;  1N36 L;  4JPB W;  3CRL C;  5FJ8 G;  3T53 B;  4HTH A;  3ICE A;  1GVP A;  1HZ9 A;  1ZYR C;  2ALY B;  1PDQ A;  4G4K A;  4NP5 A;  1VQ8 A;  2SNS A;  3MEF A;  4CDC C;  1AP0 A;  3PO3 H;  2PCF B;  2A73 B;  2WV6 D;  1EQV A;  1NTG A;  1A62 A;  2R61 A;  1V9P A;  4GS3 A;  4HJ8 A;  2IX3 A;  3EA6 A;  4UAI A;  3K6O A;  2LXK A;  4C3J H;  2FXQ A;  4DV0 Q;  1HPC A;  4A3L H;  2K1B A;  1RHP A;  1GJX A;  3A8I E;  1BQQ T;  1KHI A;  2R7Z B;  2Z8L A;  3DMU A;  3M4Q A;  4B3S Q;  3HOV H;  2M9V A;  1A3T A;  1JWM D;  2G5D A;  4RHS A;  5GQO A;  4NB3 A;  5EJW A;  4PV1 C;  4NPS A;  4PQX A;  3KUP A;  2EDG A;  1TWF B;  4GN5 A;  1JIC A;  1V1P A;  5CGK A;  1B3A A;  1FJG Q;  4F88 A;  2TMP A;  4DV7 Q;  1DXM A;  2K50 A;  1HTL D;  3TRZ A;  2E2H B;  2K75 A;  2F0L A;  5G3L D;  5IYD H;  4CDD C;  1SLJ A;  2ID0 A;  4KV6 A;  4JYA Q;  3KBG A;  1KAA A;  2HUG A;  3PCO B;  5ELC A;  3V2T A;  1I4X A;  4DR3 Q;  1HNZ L;  1U4M A;  1TWG B;  1I94 L;  1CA5 A;  1RKN A;  5CV5 A;  1X56 A;  5KGU A;  1JJ2 A;  1BF4 A;  2UUA Q;  2BE5 C;  1EWH A;  3I90 A;  3FDT A;  1VQB A;  1VF7 A;  4RHR A;  4RG1 A;  1PTO C;  2FFK B;  1GXD C;  1LTL A;  3J7A F;  3FP9 A;  5IGE A;  3E9H A;  4JI3 L;  2I5M X;  4C3H G;  2J7Z A;  1JCK B;  3ZJY C;  2CHB D;  4JI4 L;  2ZJQ A;  2CWA A;  4A76 A;  3UDX A;  3GTK H;  1ENC A;  2F0N A;  2KOL A;  1XMO L;  2GVA A;  3I2Z A;  4DV4 Q;  1I6V C;  3GTG B;  2A6H D;  2J4X A;  2UUB Q;  5I9O A;  4EQN A;  1VQC A;  1VQL A;  1K8M A;  1O7L A;  3J80 E;  1VF5 C;  2HDL A;  4JOI C;  3ZYY X;  3DLL A;  1MI2 A;  2NVY H;  4JI2 Q;  1K8A C;  3S2H B;  5KEE A;  3GTJ B;  2MHV A;  2WAC A;  3CD6 A;  3SK4 A;  2AHO B;  1SRU A;  3CU7 A;  2NTS A;  1VQ9 A;  1NCV A;  5CBE E;  2XN9 C;  3CKI B;  1Z9F A;  1SMX A;  3QOJ A;  2Z1C A;  1NMF A;  3DXJ C;  4QB4 A;  1HA5 A;  1XTC D;  3E0J A;  1XPO A;  4I7A A;  4L63 B;  1KC8 C;  1LTT D;  4C56 C;  3HP3 A;  5LL6 X;  4C3H B;  2M2L A;  1SYC A;  1QE6 A;  3TDQ A;  1PRT D;  4BA2 I;  1ZKO A;  5M5X H;  3RLO A;  4QCL A;  1E24 A;  3FHW A;  4GNX C;  3LNN A;  3TME A;  1S72 A;  1GHK A;  5AJ3 L;  3HOX G;  2KEC A;  3C1F A;  4JBM A;  3HOU H;  4JCV E;  2ZTE A;  4LNQ A;  1DYQ A;  3H3V I;  2LSS A;  4CJ2 C;  5FLX E;  1STN A;  4FP5 D;  4A3F B;  2NZH A;  4LF8 L;  1E2W A;  4A4I A;  2MNA A;  1LTR D;  1N33 Q;  2ASB A;  1HFN A;  1QG7 A;  2JXM B;  3MA2 B;  4K2L A;  4NW2 A;  1YNN C;  2OT2 A;  1L0X B;  3OSO A;  5FLM G;  1BKB A;  4GOP B;  3H15 A;  1Q8I A;  3RN5 A;  5C4J B;  3AU7 A;  1DGS A;  5H1S E;  3CC4 A;  1TU2 B;  1GOZ A;  2B63 H;  1VCI A;  2QCP X;  4A3J H;  4DGZ A;  1YEZ A;  2FHT A;  5LMU L;  4GLV B;  3HZX A;  3J80 c;  1YIT A;  2IX1 A;  4JI5 Q;  1STH A;  1CUK A;  1YBY A;  1JWU D;  3D3R A;  2A68 C;  4LF6 Q;  4L5S A;  2WP8 J;  4IFD J;  3LWE A;  4YHH L;  1N32 L;  4PMC A;  1JB3 A;  2PNR C;  1XWE A;  1VMP A;  4C2M B;  4C1N I;  1PH1 A;  1GUW A;  1JT8 A;  1VQP A;  1J6Q A;  2MPM A;  4C3I G;  3PF5 A;  3G7L A;  3QWN A;  1Y1W H;  2JQO A;  2RDF A;  1E1O A;  1LT4 D;  1UE7 A;  1PH7 A;  1A0I A;  2F3I A;  2EXZ A;  2OQK A;  4A3E G;  1K73 C;  5HY6 A;  3TZU A;  3BZC A;  4OX9 Q;  1LYL A;  1O7Y A;  3S14 H;  3GTM H;  1S5F D;  1H9J A;  4XYQ A;  5C0X I;  5IOD A;  5I4D A;  1DD2 A;  3K0X A;  1QZH A;  3M4P A;  5M5W H;  3TN2 A;  5C3E G;  1I50 H;  5FLX c;  1BDO A;  2I5H A;  2BA1 A;  4DUY Q;  2UUA L;  1ROD A;  1PLF A;  4DNT B;  5ISR A;  2NBF A;  4B9W A;  2YU9 H;  1U5K A;  3SK5 A;  2FMM A;  4K8I A;  3A8K E;  1GO3 E;  2LFN A;  1D5M C;  3J81 L;  2PW7 A;  4CKB A;  4L6T B;  4JI7 L;  2EYO A;  3CCS A;  4KKT A;  1I4R A;  1F9P A;  2KVM A;  4A3E B;  3X3M A;  2JYO A;  2OTJ A;  4DV5 L;  2H4O A;  1KQS A;  3CCV A;  4DU9 A;  2F0D A;  4PG3 A;  2DJF C;  2KHI A;  1NJI C;  5LMN W;  2DNE A;  3M7N A;  1LM0 A;  1TY2 A;  3A7A B;  3BVG A;  4MIU A;  4ZRZ A;  3MFG A;  1ET6 A;  3A8J E;  2X69 A;  3PIP A;  3CCL A;  3K5L A;  3GTP H;  1BOS A;  5IE8 A;  3HOV B;  1FR3 A;  2JJQ A;  2PYK A;  1P16 A;  1A3U A;  4LWC A;  5C44 G;  3MXN A;  1VQ6 A;  1LUZ A;  4JBW A;  5IP9 H;  1Q3L A;  2F0G A;  1VQO A;  2MFI A;  5C4X H;  3BVM A;  3KLS A;  3CCU A;  4OWW B;  1KIX A;  1R9T B;  3J7A 5;  2MUY A;  3NBI A;  3IAY A;  5J1Z A;  2YTV A;  4NXN Q;  3S1M B;  1D1K A;  1EY6 A;  2F0W A;  2QW7 A;  4U68 A;  3F8T A;  2G9D A;  3TBI B;  1PRT B;  2NVT B;  3RR5 A;  1D6E C;  4LW1 A;  4RGT A;  2D9U A;  3RZD H;  4EQ5 A;  5JJZ A;  2A74 C;  1JJG A;  1CHP D;  2X6G A;  4R9W A;  5JOB A;  4DNI A;  1Q7Y C;  3FKI G;  2VY3 A;  1VQI A;  4CJ0 B;  1PTO F;  1X3E A;  3D6W A;  1QNU A;  5C44 B;  1Z7T A;  5M3M G;  2L9H A;  4XQN A;  5BN5 A;  2R93 H;  4PZ7 A;  2B2V C;  3OOC A;  5CR3 A;  5CV8 A;  1MIU A;  2KUM A;  2RSN A;  1SFO H;  3AYH B;  3I4N G;  1HNW L;  2A6E D;  3CCR A;  4GOP C;  1PZI D;  3TS0 A;  2WIN B;  5A2Q E;  4ALP A;  4LF4 L;  1LT3 D;  4OXP A;  3M4Y A;  5K36 G;  1B44 D;  1F77 A;  4DR2 Q;  4ZLT F;  1PYS B;  3STB D;  1PH5 A;  1CTM A;  1I4Q A;  5JVH 3;  3VYR A;  4Q0F A;  1TWC H;  5CV7 A;  1FGU A;  1V8Q A;  1YJW A;  1TXY A;  1S5E D;  1QVG A;  3FKI B;  3I4M B;  2AQ2 B;  3J7A V;  2F0K A;  2RHQ B;  4JI0 L;  1AH9 A;  3HG9 A;  4B3M Q;  1RCV D;  4ME3 A;  4K8J A;  3KDF B;  2N8N A;  3P1H A;  2UUC Q;  3FMC A;  1FVI A;  2QGQ A;  1TWF H;  5CV6 A;  1EEI D;  5FJ8 H;  3I4N B;  1JWS D;  1BCP D;  5HUR A;  1HZB A;  3HOU B;  3WOE A;  4BXX G;  3KOJ A;  2OQ0 A;  1LLR D;  4X62 Q;  1HHV A;  1Q82 C;  4OX9 L;  1CKN A;  5IGF A;  2QA4 A;  2ES2 A;  3G48 A;  1D1I A;  4MZ9 A;  2EJM A;  4DV6 Q;  2Z9H A;  2RCN A;  3KF8 B;  1WJJ A;  1GM5 A;  4JVZ A;  4KHV A;  1RF2 D;  4KMU C;  1X3G A;  4ZUJ A;  2KED A;  4IUU A;  1TT2 A;  4X3K A;  3D31 A;  1UAP A;  1LT5 D;  1W2B A;  3OMC A;  2AUJ D;  2PI2 E;  2YTX A;  4JI1 L;  4K0K Q;  4J1M A;  3GTG H;  3W5O A;  2A1A A;  1X3F A;  1YJN A;  4HED A;  3HOW G;  4OL7 A;  4P72 A;  2JP1 A;  4L5R C;  1XNQ L;  4DV3 Q;  4DK1 A;  1HNX L;  2RDG A;  4KN4 C;  2UXC L;  3S2H H;  3GTJ H;  3DWA A;  2ZTD A;  1IBK Q;  2EE1 A;  3TP6 A;  1TWA H;  5EQ0 A;  5JVG 3;  5EKL A;  4EQO A;  1YZ6 A;  3J80 L;  4A3C G;  1EY5 A;  1WTH A;  2A6H C;  1BVS A;  3K0Y A;  4ULL A;  5C4Z A;  1E1T A;  3T1Y Q;  3C1E A;  4JV5 L;  4C3H H;  3SE0 A;  1R4Q B;  1STY A;  1WD0 A;  2XNA C;  4X3T A;  4JI6 L;  1F9S A;  4JW0 A;  4KTA A;  2Z4H A;  1WTX A;  3C3L A;  1VQG A;  2FJ2 A;  4QUC A;  3HOW B;  2E74 C;  3NBH B;  2EYF A;  5T1I A;  2HQE A;  2WB1 B;  3A7L A;  3U50 C;  4GZY C;  1HUN A;  1H9S A;  1LO5 D;  1Q81 C;  1EYD A;  2JA8 B;  2DY8 A;  4RKL A;  3L2P A;  1TR5 A;  4A3F H;  2QEX A;  1IYJ B;  2NN6 H;  3S1R B;  4K5W A;  2WII B;  1PRT C;  2VQE L;  2JN4 A;  3OTO Q;  3AB9 A;  2AUK A;  4RMF A;  3QB3 A;  4RFB A;  1OO9 B;  5C0X J;  4A3B B;  1BUV T;  4A75 A;  5E3F A;  3VR4 A;  3RUZ A;  2YTY A;  3QOL A;  1S5C D;  4QQB X;  3TSS A;  5C4J H;  3GV3 A;  4DR4 L;  4GKK Q;  1X3P A;  4ILW A;  2O5J C;  2QDL A;  5EBD A;  3KDF A;  4MN3 A;  3U9O A;  2XRS D;  3G6E A;  2R7D A;  3H0G B;  3UE0 A;  5E4W C;  4B9X A;  3HKS A;  3EVQ A;  4P74 A;  3I3C A;  1AZQ A;  2VB2 X;  2MP1 A;  4C2M H;  4P2C B;  2XGT A;  4DAP A;  4BBS B;  5EKI A;  1WTV A;  5C5L A;  2RQX A;  5M3F B;  2NVX H;  2EYH A;  4B3T Q;  4A3K G;  2GN5 A;  5ELE A;  5FLM H;  2QIL A;  4LFB Q;  2KEE A;  4YWK A;  3NHH A;  3HOY G;  3F1Z A;  4L5T A;  3I56 A;  3BS1 A;  1PH4 A;  1K83 B;  3O13 A;  1XMQ L;  4IFD H;  4IAL A;  4KY6 A;  2UUC L;  1VQ4 A;  1EOT A;  3DM1 A;  5IYC H;  5LMN L;  4EVO A;  3KFU A;  1A15 A;  1ESF A;  1JJC B;  4GLA C;  1SYE A;  4KKU A;  1V1Q A;  4DV2 Q;  3MXG A;  1IZ6 A;  3UDF A;  3VR2 A;  5C6A A;  4HN7 A;  4DKA C;  2RVL A;  5JJK A;  4NXM L;  2C9O A;  2HHH Q;  1DOK A;  4MHE A;  1E2V A;  4N9T A;  2CH4 A;  3URY A;  3J81 c;  3C2P A;  4FXD A;  1BCP B;  1ESR A;  4KD3 A;  4Y52 H;  3L3O C;  1SDF A;  3QJY A;  4LF7 L;  2CKZ B;  1HZC A;  1MJE A;  1XJV A;  2MGS A;  3CPW A;  5KNC A;  3I7F A;  5IYB G;  1SFO B;  1KL9 A;  4PZ6 A;  3MZ5 A;  3HOZ G;  3VYU A;  2E8G A;  4UHV A;  3NTI A;  4C3I H;  2WAQ E;  3FPP A;  5AFW A;  3BDL A;  1M4V A;  4WRD A;  1C9O A;  5LL6 S;  2B2W A;  1L1O B;  1B9M A;  1KDC A;  5EPK A;  2F0V A;  1HFG A;  2AWN A;  4EGV A;  2BDO A;  4IUT A;  4XQJ A;  3K5N A;  4A3E H;  4KY7 A;  5M9O A;  4A3G G;  1EZ6 A;  1N34 Q;  4K6D A;  1QZG A;  1IL8 A;  4CGY B;  5J3B A;  1EWI A;  2MO0 A;  1W6J A;  3BU2 A;  1CKM A;  5EGT A;  5I6Y A;  3S24 A;  1ET9 A;  1TWC B;  2WAQ G;  3U9S A;  5KYI A;  1DM0 B;  3H3V C;  4N8X 1;  3T4A C;  5C3X A;  5CV4 A;  2OCE A;  3Q23 A;  4DXF A;  2V4D A;  4HSP A;  5DM6 3;  1EFW A;  4B3R Q;  4R4T A;  2RA4 A;  5C3E H;  3GD7 A;  1YIJ A;  1UNS A;  3S15 B;  4QGU A;  1VQ5 A;  4WOR A;  2SEB D;  2PZU A;  5CC4 A;  4TRD A;  3HOZ B;  1SBB B;  1UWV A;  2SOB A;  1IBL L;  2B2W C;  1HRJ A;  1EOV A;  3TZD A;  3F2C A;  4M8A A;  1R9T H;  4DR6 Q;  1YI2 A;  5J22 A;  3K5O A;  1SNP A;  1M90 C;  2KEN A;  2K01 A;  4DK6 C;  3S1M H;  2F0F A;  3ITP A;  5JPM C;  4JOI A;  2L15 A;  1D5X C;  2F0M A;  4AQY L;  1PH6 A;  1QJO A;  2VUM G;  2NVT H;  1VDZ A;  3VR5 A;  4DPG A;  4TVA B;  2WAQ B;  5COR A;  2EY6 A;  4BY1 G;  1EYC A;  4XTC S;  3I72 A;  3MWY W;  1NBW A;  3GTQ B;  1MJC A;  1QWY A;  2VB3 X;  1LTB D;  5G3L F;  2M00 A;  5C44 H;  3WDN A;  4XXE A;  2UU9 L;  3CME A;  4KK7 A;  4ZKC B;  5EPL A;  2K28 A;  1M8A A;  1V1O A;  2R7F A;  4K5X A;  4DR7 L;  2EY2 A;  5FO8 B;  1PMR A;  4GNX A;  1RDP D;  4BY7 G;  4HID A;  3NWT A;  5M5Y B;  4IQZ A;  2CCZ A;  3D4R A;  3CHB D;  2AKW B;  4P73 A;  4YY3 Q;  4FO2 A;  3ND9 A;  1TWA B;  2JEA I;  1IKL A;  2VUM B;  4KN7 C;  4LF5 Q;  3NQT A;  1BBW A;  1QUQ B;  5A2Q L;  2L12 A;  5GAD C;  1SNC A;  4YCW A;  1S3O A;  1CT1 D;  3FKI H;  5BR8 Q;  3I4M H;  1Y1V G;  1CZW A;  4AYB E;  2JA7 G;  4QJF A;  2JK8 A;  5M3M H;  2IL8 A;  2VQF Q;  4B3T L;  2PZT A;  3STB C;  1WCM G;  1R4P B;  2E2J B;  4X6A H;  4J6H A;  4A3M G;  4FDB A;  3I4N H;  5ELF A;  5C3W A;  3D6C A;  2PZW A;  2C5C A;  2I5L X;  3VDY A;  4YWM A;  5K36 H;  5GAE C;  4AYB G;  1PHJ A;  5DEH A;  3X3N A;  1WTW A;  1EYG A;  5E1F A;  4DV2 L;  1EQT A;  1MSG A;  4TSS A;  1KDB A;  5D3I B;  4HMJ A;  1X32 A;  4ZUI A;  3R2I A;  3WWV A;  4DR1 L;  4QMG A;  2B8F A;  5IGB A;  5JEA G;  4HJ9 A;  4HIO A;  4HJA A;  3UDI A;  4UDU C;  5CV9 A;  4A93 G;  2IHF A;  1IBM L;  1BCP C;  1LTS D;  2MJ8 A;  1LTA D;  1VQ7 A;  4IUR A;  1SND A;  2LKV A;  3KYH C;  1VQH A;  3ULL A;  4AIM A;  3LWU A;  1TQO A;  4BWG B;  5FO9 B;  4F87 A;  3JAM i;  1C7Y A;  1G8Z D;  1WCM B;  2K03 A;  1F9R A;  2KHS A;  1K3B C;  4TKO B;  2PPB C;  4A3M B;  2AWO A;  3H3V H;  3HOX B;  3HKZ E;  1L1O C;  2E75 C;  4BXX H;  1LTG D;  3KK7 A;  2KJX A;  4XIG S;  2RBM A;  2P5Z X;  2D2C C;  3CXC A;  3CCM A;  4O2D A;  5JJI A;  3PQI A;  1KLU D;  1OXX K;  5IGD A;  2JE6 I;  4DV0 L;  4MTK A;  4X66 Q;  4JG2 A;  1L2F A;  4FF2 A;  4KY5 A;  1QOH A;  1ML0 D;  4X65 Q;  4DV1 Q;  1RD9 D;  2NVX B;  1SNM A;  4WJW A;  1MKH A;  3SK8 A;  4B3S L;  3HKZ G;  2A19 A; 
#chains in the Genus database with same CATH homology
 3J80 i;  3S1N H;  2JA6 H;  5IP9 G;  4DR2 Q;  4OO1 G;  4JI3 Q;  1PYS B;  3STB D;  1ASZ A;  4BBS G;  2UU9 Q;  1PH5 A;  5M3F G;  5C4X G;  2MO1 A;  4JI4 Q;  4A3D G;  3KJO A;  4DK3 C;  1SN8 A;  1VQN A;  4KHZ A;  1TWC H;  2HQL A;  1FJG L;  1FGU A;  2JA9 A;  3OTO L;  4DV7 L;  1YJW A;  1TXY A;  5ELO A;  1U0L A;  4LUO A;  3CC2 A;  1XNR L;  4DR7 Q;  1GD7 A;  2R6G A;  3RZO H;  4J15 A;  1QVG A;  1S40 A;  2K5H A;  3HOW H;  1JMC A;  4JYA L;  3CCE A;  2RHQ B;  4JI0 L;  1OXS C;  2CFM A;  1AH9 A;  2VUM H;  4IFD I;  3CPF A;  1C0A A;  5JJL A;  4B3M Q;  3AEV A;  4ME3 A;  2DUD A;  4DR3 L;  2JA8 H;  1JE5 A;  3PGZ A;  3KDF B;  4UP7 A;  2N8N A;  2UUC Q;  4GKK L;  1FVI A;  2QGQ A;  2UXB Q;  1TWF H;  2F52 A;  3S1R H;  2F4V L;  3PO2 G;  4L5Q A;  3CAM A;  1A8V A;  5FJ8 H;  1EUJ A;  2RHS B;  1I3Q H;  4JI7 Q;  1N9W A;  1K0R A;  1HZB A;  1G51 A;  4PZ8 A;  3TRE A;  4A3B H;  3KOJ A;  4BXX G;  4A3C H;  2OQ0 A;  1OXT A;  1PV4 A;  2VNU D;  1EQQ A;  4DV5 Q;  4QL5 A;  4X62 Q;  1Q82 C;  4OX9 L;  1CKN A;  2EXD A;  2VZA A;  3A5Z B;  2QA4 A;  4A3I H;  3G48 A;  2ES2 A;  3TS2 A;  4WJ4 A;  4MZ9 A;  1RL2 A;  4GNX B;  3S2D H;  3ULJ A;  4DV4 L;  3ULP A;  4DV6 Q;  4LFC Q;  2UXD L;  2UUB L;  2RCN A;  3KF8 B;  4GLX A;  4HIK A;  1WJJ A;  1QVC A;  3M85 A;  1NY4 A;  1GM5 A;  4A3F G;  3S16 H;  2K5V A;  2NN6 G;  1X3G A;  2JA6 G;  4LFB L;  3OW2 A;  3H0G H;  4JI2 L;  4MNO A;  1PH8 A;  3M4O H;  3K7U C;  4JI8 L;  2OTL A;  3GTL H;  4YY3 L;  4LFA L;  3BZK A;  3D31 A;  4IJL A;  1SE8 A;  4P71 A;  4X64 Q;  1Q8K A;  2E5L L;  1D8L A;  3KJP A;  1W2B A;  3CMA A;  2PI2 E;  2YTX A;  2N78 A;  1L1O A;  4JI1 L;  4DR1 Q;  1J5E L;  4K0K Q;  3GTG H;  4IPG A;  2A1A A;  1X3F A;  3W5O A;  1YJN A;  4BBS H;  3HOW G;  4P72 A;  4DUZ Q;  5M3F H;  4IPH A;  4L5R C;  1XNQ L;  5ELN A;  4DV3 Q;  4KHP L;  1Z47 A;  1HNX L;  2K52 A;  4MTN A;  2HHH L;  1VQM A;  4JBK A;  2D0P A;  1IBM Q;  2UXC L;  1HJP A;  2B3G A;  1HR0 L;  1CSQ A;  3S2H H;  3GTJ H;  3EN2 A;  2ZTD A;  3L7Z C;  1IBK Q;  3PUZ A;  4GOP A;  1VS0 A;  1K83 H;  2IX0 A;  1TWA H;  3RNU A;  1N36 L;  1NMG A;  2OWO A;  5FJ8 G;  3M9B A;  3ICE A;  1GVP A;  3IRB A;  3MXN B;  4O0A A;  1HZ9 A;  2ALY B;  3NEL A;  1VQ8 A;  1YZ6 A;  4A3C G;  2YV5 A;  3KF6 A;  1G29 1;  1K9M C;  3MEF A;  1BVS A;  1N8R C;  3PO3 H;  1CKO A;  2CQO A;  4LUZ A;  1E1T A;  2RF4 A;  3T1Y Q;  3T1H Q;  1NTG A;  1A62 A;  4A3I G;  1V9P A;  4GS3 A;  3CCJ A;  4C3H H;  4JV5 L;  4HJ8 A;  2K14 A;  1OXV A;  2LXK A;  2PMZ E;  2WFW A;  5JEA J;  4C3J H;  1N33 L;  2FXQ A;  1KXL A;  3CP0 A;  1N34 L;  4DV0 Q;  4A3L H;  4JI6 L;  1HNW Q;  3GTO H;  4IFD G;  1KHI A;  1VQG A;  2H5X A;  2Q2I A;  4BA1 I;  4LF4 Q;  2ZM6 Q;  5IYC G;  3NBH B;  3U4Z A;  3M4Q A;  1OTC A;  4B3S Q;  3HOV H;  2N49 A;  3U50 C;  2K5N A;  1X9N A;  1Q81 C;  2ZTC A;  4B3R L;  3HOY H;  5GQO A;  4NB3 A;  3A5U A;  3L2P A;  4NPS A;  2IY5 B;  4A3F H;  2QEX A;  1IYJ B;  4GN5 A;  3E9I A;  1FJG Q;  2VQE L;  4IOA A;  3OTO Q;  4DV7 Q;  3TRZ A;  2K50 A;  4RMF A;  2K75 A;  1YHQ A;  3K81 C;  5C0X J;  3RLN A;  5IYD H;  1SLJ A;  4A75 A;  1PFS A;  1G6P A;  2ID0 A;  4IJH A;  3F2D A;  4JYA Q;  3G71 A;  4JI0 Q;  3PCO B;  2YTY A;  4JI5 L;  4QQB X;  5C4J H;  4DR4 L;  4DR6 L;  1UE1 A;  4DR3 Q;  1HNZ L;  1PH9 A;  4LF6 L;  3BJU A;  1I94 L;  3W1B A;  1X56 A;  4GKK Q;  4DAY B;  1JJ2 A;  1KD1 C;  2UUA Q;  3S15 H;  3KDF A;  3A74 A;  4DV1 L;  1I6H H;  3PUW A;  3G6E A;  3PO3 G;  1VQB A;  2R7D A;  4WJ3 M;  4RG1 A;  3HOZ H;  5GRO A;  5IWA Q;  1LTL A;  3FP9 A;  3UE0 A;  3E9H A;  4R4I A;  3HKS A;  3RN2 A;  4JI3 L;  2I5M X;  3Q8D A;  4R1J A;  1KRS A;  2GVB A;  3ZJY C;  1VQJ A;  1HZA A;  5DLQ E;  4P74 A;  3CCQ A;  2ZJQ A;  1VQE A;  2CWA A;  4A76 A;  4JI4 L;  3UDX A;  1QUQ A;  3GTK H;  1X65 A;  2VW9 A;  4A3L G;  1XMO L;  2GVA A;  3I2Z A;  1B7Y B;  3PV0 A;  4DV4 Q;  4A3G H;  2UXD Q;  2UUB Q;  4C2M H;  1YJ9 A;  2XGT A;  4JBJ A;  1VQC A;  1KRT A;  4DR5 Q;  1VQL A;  2NVX H;  4B3T Q;  4A3K G;  2GN5 A;  3HOV G;  4JOI C;  5FLM H;  3DLL A;  3S1Q H;  4LFB Q;  2KCT A;  2NVY H;  5EAY A;  1Q46 A;  4YWK A;  4JI2 Q;  4A3J G;  1K8A C;  4JI8 Q;  1M1K C;  1JT8 A;  3HOY G;  3F1Z A;  4L5T A;  3I56 A;  1WI5 A;  3CD6 A;  2AHO B;  1PH4 A;  1T9H A;  1SRU A;  3PUX A;  2IT1 A;  4R4O A;  1VQ9 A;  1XMQ L;  4P75 A;  2UUC L;  3GTQ H;  4PMW A;  4GN3 B;  1VQ4 A;  1P8L A;  3K80 C;  4DUY L;  1Q86 C;  5IYC H;  5LMN L;  2E5L Q;  4OO1 I;  1HH2 P;  1Z9F A;  3KFU A;  1SMX A;  1J5E Q;  3LGJ A;  4JI1 Q;  1E22 A;  1JJC B;  4GLA C;  5IYD G;  1NMF A;  1V1Q A;  4DV2 Q;  4UP8 A;  1CKN B;  1IZ6 A;  1B8A A;  4R4Q A;  3UDF A;  4LF5 L;  4DKA C;  1XPO A;  1XNQ Q;  3D0F A;  5JJK A;  4UY8 C;  1KC8 C;  4NXM L;  1HNX Q;  2HHH Q;  4KHP Q;  4GKJ Q;  2UXC Q;  3J81 c;  5BR8 L;  4BA2 I;  4Y52 H;  1CSP A;  2V1C C;  2PNH A;  3RLO A;  5M5X H;  4LFC L;  5M5Y H;  1E24 A;  2CKZ B;  1IXR A;  1HZC A;  3FHW A;  4GNX C;  1XJV A;  1MJE A;  4LF7 L;  3CPW A;  1S72 A;  4KLK A;  1Y14 B;  5AJ3 L;  2VQF L;  3I7F A;  1X55 A;  4IO9 A;  5IYB G;  1KL9 A;  1UEB A;  4PZ6 A;  3HOX G;  4JBM A;  3HOZ G;  3HOU H;  2E8G A;  3K7A H;  4JCV E;  4C3I H;  2A8V A;  1I5F A;  2MQH A;  2WAQ E;  2EIF A;  2ZTE A;  2Q2U A;  4QIW E;  2B29 A;  4LNQ A;  2R92 H;  1K8G A;  1VQD A;  3B6Y A;  3H3V I;  2LSS A;  1C9O A;  3CQZ H;  1YNX A;  3E0E A;  3J81 i;  4JV5 Q;  1L1O B;  4X64 L;  1EQR A;  2NZH A;  4LF8 L;  4A3E H;  2AWN A;  3JAM c;  4A3G G;  2PQA B;  4A4I A;  2MNA A;  3I4O A;  4POF A;  1HR0 W;  1N33 Q;  2ASB A;  1N34 Q;  1QZG A;  5HGQ A;  4JI6 Q;  5J3B A;  1EWI A;  2MO0 A;  3BU2 A;  1CKM A;  5GAG C;  5FLM G;  3S24 A;  1BKB A;  4UPA A;  1E3P A;  4GOP B;  3H15 A;  2WAQ G;  3JC6 6;  1UE6 A;  2OCE A;  2E2J H;  3RN5 A;  2NVQ H;  2Q2H A;  1DGS A;  5H1S E;  3CC4 A;  1EFW A;  1Q1B A;  4B3R Q;  4R4T A;  4Y7N H;  5C3E H;  2B63 H;  3KLW A;  4NXN L;  3GD7 A;  1VCI A;  4BY7 H;  1K3R A;  4A3K H;  4LF9 Q;  1YHA A;  1YIJ A;  2VS1 A;  4IPC A;  4A3J H;  2VQE Q;  4QGU A;  1VQ5 A;  5IT9 c;  4UP9 A;  1YEZ A;  3CC7 A;  2IHE A;  1ASY A;  3I4M G;  5LMU L;  4IOC A;  2XTI A;  4GLV B;  3J80 c;  1YIT A;  4POG A;  1UWV A;  1IBL L;  2KHJ A;  2JEB I;  1EOV A;  1XPU A;  2IX1 A;  3F2C A;  4JI5 Q;  1CUK A;  1R9T H;  1XNR Q;  1YBY A;  4DR4 Q;  4DR6 Q;  1YI2 A;  1VQF A;  3CF5 A;  1HNZ Q;  2LXJ A;  1GKH A;  4DAM A;  4LF6 Q;  4L5S A;  2WP8 J;  1I94 Q;  4IFD J;  4YHH L;  1M90 C;  1N32 L;  2KEN A;  4DK6 C;  3S1M H;  5GAH C;  1VQA A;  4JOI A;  2L15 A;  1W3S A;  1PH1 A;  4AH6 A;  4EX5 A;  4AQY L;  1PA6 A;  4YCV A;  1VQP A;  1J6Q A;  3U4V A;  1PH6 A;  2I0Q A;  3HFZ B;  2VUM G;  1EIF A;  3HOU G;  1PH2 A;  2NVT H;  2R92 G;  1RIP A;  4X66 L;  3PF5 A;  2YYZ A;  4DPG A;  4TVA B;  1WCM H;  1Y1W H;  2F4V Q;  2JQO A;  4TQU S;  4BY1 G;  5E7N A;  1E1O A;  4XTC S;  4X65 L;  4A3M H;  1X54 A;  1UE7 A;  1PH7 A;  1A0I A;  2OQK A;  2F3I A;  4A3E G;  1NBW A;  2KCM A;  4BBR H;  1MJC A;  5HY6 A;  5IYB H;  3HOX H;  1K73 C;  4H02 A;  3BZC A;  4DR2 L;  3J7Z C;  1XMO Q;  1PYB A;  1WOC A;  4QY7 A;  2BA0 A;  5C44 H;  3GO5 A;  2UU9 L;  1LYL A;  4OX9 Q;  3CME A;  3S14 H;  3GTM H;  3PIO A;  1H95 A;  2R7Z H;  1SR3 A;  3S17 H;  1QVF A;  4YCU A;  5C0X I;  2R7F A;  2NZO A;  3K0X A;  1QZH A;  3M4P A;  4DR7 L;  5M5W H;  4OWX B;  5IP7 H;  1UE5 A;  4GNX A;  5C3E G;  2ZJR A;  2B63 G;  1I50 H;  5FLX c;  4BY7 G;  2ATW A;  4HID A;  1XMQ Q;  2I5H A;  3PSI A;  2BA1 A;  2CCZ A;  2Q2T A;  4DUY Q;  2ZJP A;  5LMN Q;  2D62 A;  2UUA L;  4B3M L;  4A93 H;  2AKW B;  2K4K A;  4P73 A;  4YY3 Q;  2E2H H;  4LFA Q;  1PVO A;  2YU9 H;  1U5K A;  3G4S A;  2JEA I;  1YHB A;  3GDE A;  5IWA L;  4LF5 Q;  2UXB L;  1GO3 E;  1WFQ A;  1BBW A;  1QUQ B;  3W1G A;  2R93 G;  1A63 A;  4NXM Q;  1TWH H;  2JA5 H;  4JI7 L;  3U58 A;  3CCS A;  5GAD C;  1OXU A;  1X6O A;  4YCW A;  1S3O A;  3PF4 A;  1TWG H;  3FKI H;  5BR8 Q;  3I4M H;  2OTJ A;  1Y1V G;  4X62 L;  4DV5 L;  4AYB E;  2JA7 G;  4LF7 Q;  4QJF A;  3SGI A;  2JK8 A;  1KQS A;  5M3M H;  1HR0 Q;  3CCV A;  4DR5 L;  5AJ3 Q;  1E7Z A;  4PG3 A;  2VQF Q;  4B3T L;  2KHI A;  1NJI C;  3UDG A;  4APV A;  2WB1 E;  5LMN W;  3STB C;  1N36 Q;  1Y1W G;  1WCM G;  3M7N A;  4DV6 L;  1Q12 A;  1LM0 A;  4X6A H;  4A3M G;  1AE2 A;  4FDB A;  3I55 A;  3I4N H;  1AE3 A;  3PIP A;  4BBR G;  1L0W A;  3CCL A;  3GTP H;  3RLF A;  2Z6K A;  5IE8 A;  3ERS X;  2JJQ A;  1NE3 A;  3OYY A;  1P16 A;  2I5L X;  2Z0S A;  1YVC A;  4LWC A;  4YWM A;  5C44 G;  3VDY A;  4LF8 Q;  3NEN A;  4AYB G;  2HIV A;  5GAE C;  1PHJ A;  2VL6 A;  2BH2 A;  1VQ6 A;  1LUZ A;  4JBW A;  5IP9 H;  1EYG A;  4R4C A;  4BY1 H;  1VQO A;  4DV2 L;  2R7Z G;  2MFI A;  2Y0S E;  2PQA A;  5C4X H;  3TQY A;  2WB1 G;  4IPD A;  4LUV A;  5IY0 A;  4A3D H;  3CCU A;  3WWV A;  4DR1 L;  5IP7 G;  4GKJ L;  4OWW B;  4K0K L;  2CWP A;  1KIX A;  1VQK A;  5JEA G;  2JA8 G;  1WYD A;  3J7A 5;  2E2I H;  3CW2 C;  4DUZ L;  4HJ9 A;  3DM3 A;  4HIO A;  2HT1 A;  2C35 B;  4HJA A;  4DV3 L;  3UDI A;  1KAW A;  2YTV A;  4NXN Q;  4A93 G;  1O7I A;  2IHF A;  4GN4 B;  3TEH B;  4HIM A;  2EQS A;  3AFQ A;  1IBM L;  4YWL A;  3L0O A;  1VQ7 A;  1IBK L;  3PUV A;  1XTD A;  2NN6 I;  3KYH C;  1VQH A;  3ULL A;  2N3S A;  3F8T A;  3EIV A;  3M3Y H;  4A3B G;  4AIM A;  2Y0S G;  3AQQ A;  3RR5 A;  3RZD H;  4LW1 A;  1PH3 A;  5LMU Q;  4EQ5 A;  3KF6 B;  3UE1 A;  3JAM i;  1C7Y A;  3NEM A;  3EBE A;  2JA5 G;  1JJG A;  1IBL Q;  3PO2 H;  4DNI A;  1Q7Y C;  4HJ5 A;  1B70 B;  2AWO A;  2Z6K C;  1D7Q A;  3FKI G;  1JB7 A;  2VY3 A;  3H3V H;  1VQI A;  3HKZ E;  3ER0 A;  1L1O C;  1X3E A;  4BXX H;  3J81 j;  1V43 A;  2PI2 A;  4YHH Q;  1SRO A;  3T1Y L;  4XIG S;  3T1H L;  1N32 Q;  5M3M G;  2HIX A;  5C0X G;  2R93 H;  4PZ7 A;  3CXC A;  4OON A;  4KI0 A;  3CCM A;  4O2D A;  5JJI A;  4AQY Q;  1MIU A;  4JC0 A;  2AMC B;  1SFO H;  3PUY A;  3AFP A;  1OXX K;  2DGY A;  3H0G G;  2JE6 I;  2KBN A;  4DV0 L;  3AYH B;  1Q1E A;  3F2B A;  1Y1V H;  4X66 Q;  3I4N G;  1HNW L;  4JG2 A;  4OWT B;  3CCR A;  4GOP C;  1L2F A;  1XPR A;  3K8A A;  2JA7 H;  3A0J A;  1EIY B;  3TS0 A;  1FL0 A;  4HJ7 A;  4X65 Q;  4DV1 Q;  1BBU A;  4ALP A;  4LF4 L;  2BH8 A;  2ZM6 L;  4OXP A;  1MKH A;  1IL2 A;  4B3S L;  4LF9 L;  3HKZ G;  2D0O A;  5K36 G;  2A19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...