4JI8M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji8M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji8M02
2UUCM 1IBLM 1L2DA 4JI3M 4X64M 4PCZA 2F4VM 3GQ3A 1PJIA 3J7AS 4B3TM 4DV6M 1IBKM 4B3RM 3J80S 3U6LA 3A42A 3U6SA 1R2ZA 1IBMM 4X66M 1L2BA 4JI2M 4JV5M 4MB7A 1PM5A 4LFAM 5ITXA 1Z5BA 4NRVA 3SATA 4DUZM 3TWMA 5ITRA 1XMQM 2XZUA 1Q39A 3GQ5A 3GQ4A 1R2YA 4GKJM 2UUBM 1J5EM 3GP1A 4NXNM 2OQ4A 3GPUA 4DUYM 2HHHM 1MU5A 1FJGM 1N33M 5IT9S 4B3MM 4LF9M 4OX9M 1MX0A 4DV0M 3VK7A 5ITYA 3SAWA 5IWAM 1HNZM 3GPPA 3U6OA 5ITTA 3U6QA 3JR4A 4JI7M 1TDZA 3SARA 4LF8M 4JI6M 5FLXS 4G4RA 4X65M 5ITUA 3GPXA 3SAVA 3J81S 3U6MA 1K82A 1L1ZA 2OPFA 3TWLA 5ITXE 4DR5M 5A2QS 2XZFA 1XMOM 1Q3BA 2UU9M 3GO8A 4LF4M 4DV7M 3U6DA 2HKJA 1XNQM 3U6CA 4JI5M 3T1HM 4PDGA 3U6EA 4DR2M 3TWKA 5LMNM 1N32M 4JI0M 1N34M 3T1YM 4K0KM 4DV3M 1KFVA 4YY3M 5LMUM 4LF5M 1XNRM 2F5QA 2UXCM 4YHHM 1L2CA 4JYAM 2Q2EB 4JI1M 2F5OA 1Z59A 1Q3CA 3U6PA 4DR4M 3JAMS 4G4OA 4NRWA 1Z5AA 4JI4M 3A45A 4DV1M 4DV5M 2UXDM 2F5PA 4LFBM 4DR3M 1HR0M 2UXBM 4KHPM 1XC8A 4PD2A 1Z5CA 5BR8M 4ITQA 3GPYA 1NNJA 1TDHA 2ZM6M 4G4NA 4G4QA 1K3WA 4DR6M 4LFCM 3DOAA 4X62M 2F5NA 1N36M 3SAUA 1I94M 1HNXM 2VQEM 3C58A 4CISA 4NXMM 1HNWM 3OTOM 1K3XA 4DR1M 2EA0A 2F5SA 4LF7M 3VK8A 2VQFM 4B3SM 2UUAM 3JR5A 3SBJA 3A46A 4LF6M 4DR7M 3W0FA 1PJJA 4PDIA 4AQYM 5ITQA 2ZBKB 1L1TA 4JI8M 4DV4M 4GKKM 3SASA 4DV2M 2E5LM 1EE8A
chains in the Genus database with same CATH superfamily
2ZAMA 4JI3M 4PCZA 4D80A 2F4VM 1DGGA 2R46A 3GLGB 4P17A 2O25A 3CF6E 4AKGA 1VEGA 1HQCA 1JR3A 2DZLA 1IBKM 1QZMA 2KZUA 1NY6A 3U6LA 3A42A 3FUVA 3HKPA 3LQRA 3FTFA 1X37A 2L2DA 4LJ4A 2L09A 2LH0A 3PNYA 1PM5A 2LWXA 2EJSA 3UJNA 2MR9A 1Z5BA 1R4GA 2CV2A 4NRVA 3IG8A 1IN5A 4D81A 3U61A 1XMQM 4FVMA 3PFIA 1R2YA 2ERCA 2BJWA 2KDLA 2ZANA 4NXNM 1PRBA 1NJFA 5C18A 1MU5A 4GC9A 4B3MM 4OX9M 3AL0C 4DV0M 4TUWA 3M0EA 2KHHA 2YQZA 4M9ZA 4LZJA 1YLAA 3VFDA 4LGYA 1NJGA 3T15A 3UMMA 5H37D 1NHWC 5ITTA 4CHTB 1JB0F 3C3EA 2DZNB 4IBKA 3J2PB 4IBJA 2WSCF 1D0LA 3SAVA 2EUCA 2MROB 2K9DA 3J81S 2OO9A 1L1ZA 3V76A 2DAEA 2R6FA 2XZFA 3I4VA 5FTNA 3M6AA 1Q3BA 4FCWA 1DGFA 4Z6YA 1DV0A 3GLFA 4LF4M 3W0LB 1QQWA 1Y8GA 1XNQM 2ZTDA 2DAMA 4R3DA 5FTMA 5DNYA 4JI5M 1WGNA 1IFYA 1GLNA 3TE6A 1QDRA 1ZV1A 3FTEA 4IBFA 4DV3M 4GHAA 4FD2A 1UFZA 1XNRM 3U5ZA 2F5QA 3RE8A 5EXTA 1TTEA 2KNVA 2H5XA 2C99A 4WP2A 3RGPA 2F5OA 3VKGA 2RKOA 4Y28F 4NC6A 3U6PA 1AIPC 3DA1A 3B89A 4DR4M 4B7FA 4LJ5A 4G4OA 4NRWA 3D8LA 1WJ7A 1YUBA 1NY5A 4DV5M 2LBCA 4AKHA 1J09A 4LFBM 4DR3M 1G71A 4ZPXA 1HR0M 4AKIA 1XC8A 3H4JA 1HT1E 3B9PA 2Z4SA 4ITQA 3GPYA 1NNJA 5E6JA 1QAQA 4DR6M 2GQFA 3HU3A 2KRKA 3HZJA 2DHYA 1IQPA 4I81A 3SAUA 1YE9A 3LW5F 1OIPA 3C58A 3LQQA 1GJTA 2CV0A 5GKNA 4CISA 3PNVA 5EP1A 4DR1M 2DNAA 1R5LA 1G41A 1TF0B 2CP8A 5DFLA 3I01M 1GVNA 3GRUA 4S12A 2JP7A 1GO5A 2L4FA 4P16A 5FSWA 2UUAM 4GH9A 3B7ZA 4MGHA 4KLNA 4PT5A 4L15A 2C9OA 1NNUC 4L78A 3LVWA 1SXJD 4AQYM 4F2LA 4RKUF 2CHQA 4R7GA 3ZH9B 3E46A 3I04M 4OW0A 5FLXS 2QZ4A 2E5LM 2A5YB 2UUCM 4XBOA 4Z8XA 3B74A 4KODA 3HU2A 4L4UA 4QOSA 1VEKA 2V6ZM 2JY8A 2K47A 3DFZA 4XGIA 2LHGA 2LNHC 3GQ3A 4MGKE 5IREB 1NO1A 1OFIA 1GJSA 1IN7A 1TH2A 1JQJC 3D8BA 5EXSA 3U6SA 1R2ZA 2VF8A 1DO0A 4UN2B 3ZCBB 2DXIA 4LY6A 2LVQD 4MGZE 1HJPA 2QP9X 2DAGA 5ITXA 4IBEA 3TWMA 5ITRA 2V1CA 2MJ5B 1Q39A 2DVWB 4IBGA 3GQ5A 4GKJM 1OFHA 4HEOA 2UUBM 2G8LA 3KSXA 3K1JA 3HJ8A 2L7IA 2LVNC 5FTKA 2HCBA 2XFTA 1PGYA 1MX0A 2DWMA 4LF9M 1N33M 5IT9S 4IIWA 1GL7A 3VK7A 1N78A 3TQSA 2EKFA 2KNAA 3SC3A 3LCVB 1LTMA 3CTWB 1C1KA 4JI7M 3KS8A 3HWSA 4LF8M 1JR3E 2XSZD 1DGHA 3L26A 1F4IA 4IBIA 4NL4H 4X65M 3Q8GA 5KPTA 3QYBA 3CF2A 3R9XB 1OAIA 2KEBA 3U61B 1QANA 2ZAOA 2UU9M 2QNJA 3AV0A 3W67A 2Z3XA 2JY7A 5E26A 3L28A 2HKJA 4QNRA 1BVSA 1NV8A 4XK8F 3T1HM 1NV9A 2D7EA 2G3QA 4PDGA 4DR2M 3U6EA 3TWKA 3AFHA 1C7YA 2QCUA 3F92A 1XWIA 2L6OA 2C5RA 3NBXX 1KFVA 4YY3M 5LMUM 1IN4A 4QNMA 2LVOC 1QAMA 1G4AE 2DI0A 3GLGA 3SHFA 2FH0A 2XFSA 2KXEA 1R7RA 3SYLA 1L2CA 2D7HA 4JYAM 4FWDA 4NSOB 2P5TA 1E94E 1NSFA 2DWNA 1IXZA 3U60A 3SYKA 3KOYE 1E9RA 4LJ6A 3SHGB 3HY5A 1LV7A 3IECA 1EIJA 3GLFB 2NQ8C 2DKLA 3K9OA 3SMSA 3GLFE 3WHKA 1FNNA 1Z5CA 4AG5A 5BR8M 3ZC7B 3J27B 1TDHA 1PJSA 2VDBB 1QAOA 1IY1A 3FKEA 4LFCM 1W5TA 3KDSE 3U5ZB 3K92A 2JNHA 2CHGA 4REZA 4AG6A 1VDDA 1V34A 7CATA 1IXRC 2R4JA 5F3WA 4CJ6A 4D82A 3K8ZA 2R4EA 3KOZE 4M0DA 5BPVA 3OTOM 2V1UA 1HNWM 2QQ8A 1VDLA 2EKKA 4LRTA 2XSZA 3HHWA 3KS4A 3VDPA 3GRRA 4IJEA 1T43A 2CHVA 2D7GA 3VK8A 2KRUA 2APLA 2OOBA 2Y0TA 2FS1A 1OQYA 1SXJC 2DAIA 5EP2A 3SBJA 4OVZA 3FYDA 3KP1E 4PDIA 3L29A 5ITQA 2L7HA 2RGHA 2HAKA 2C96A 3DZDA 4AZFA 3SASA 2DENA 3FUUA 4I5SA 3K2LA 2QBYA 4B7HA 4L8RC 2K6BA 3FRIA 1L2DA 2H1RA 1IBLM 1XXHA 1CUKA 4JN6A 3QAUA 2FNAA 3J80S 4MM3B 8CATA 2R45A 2DWZB 2CE7A 1L2BA 4JV5M 1V92A 3SMPA 4B08A 1D0KA 2DWLA 3KFUG 1IN6A 2CFOA 3SATA 1D2NA 5FTLA 3VKHA 2XZUA 3GQ4A 1ZMWA 3GLIA 1OIZA 1ORYB 1J5EM 3GP1A 2HWJA 2RGOA 3GPUA 4KO8A 1G8PA 2GNOA 1G3IA 2K0BX 2AHMA 2R0IA 2BWBA 3KOXE 1QVRA 4ANRA 3SAWA 1KSFX 3HHXA 3ILKA 3VDUA 1V33A 3B7QA 3GPPA 3U6OA 1HNZM 4FWGA 1VEJA 5KPRA 2C9CA 2WZJA 1G59A 2I7NA 3SARA 3KSJA 4WW0A 3FUWA 4I4LA 4G4RA 5EXPA 3HHZA 1OTRA 2M5ZA 3ZQJA 4W5WA 3FTCA 3MK6A 4GMQA 3TPZA 4GRIA 2Z8YM 2QHOB 1K82A 2OPFA 5ITXE 3FRHA 2XEPA 3AKZA 5A2QS 4DR5M 2R18A 3AOGA 4KT0F 2OOAA 2LXEA 1IXSB 1ZAEA 4DV7M 3FE3A 4LJ9A 3U6CA 3LVVA 1I4WA 1ZQ9A 1EFUB 2X8AA 4IBCA 1N32M 4JI0M 2VIIA 5JI2E 5KPZA 1N34M 4LF5M 3GLHA 4YHHM 2CWBA 3GRYA 4JXJA 3T38A 2Q2EB 4GC5A 1L8QA 1E32A 4JI1M 3CF0A 3LMMA 1Z59A 1Q3CA 1OJLA 3JAMS 1MJGM 1Z5AA 2WSFF 3A45A 4DV1M 4L16A 1HT2E 2R62A 3HJQA 2BWEA 1WGLA 3J7BA 4PD2A 4G4NA 2VF7A 3QYEA 1SXJA 2WSEF 3LCUA 3BBZA 2LVPC 1J7KA 4LJAA 4X62M 4HLQA 2CV1A 3AJIB 2JZ1A 3UZUA 4IBDA 3IHPA 1HNXM 3AOEC 3GLGE 4HL4A 2R44A 1ZMUA 3HJSA 4NXMM 3U60B 3WHLA 1K3XA 1GABA 1QZEA 4IBBA 5DYGA 2JWSA 2N35A 2FOIC 4II7A 2QENA 4LF7M 4B3SM 2VQFM 1TGUA 3B7NA 3C3DA 1SG9A 2CEAA 1WHCA 5KQ8A 4LF6M 5KO3A 1MN3A 4MH0E 3W0FA 1T3TA 3KXEC 4JI8M 1HQYE 3NBIA 4L6V6 2XGNA 4NOOB 2O01F 3FTDA 4GITA 4BLCA 4X64M 3QWLA 2CRUA 1DO2A 2MH8A 3BXWA 1PJIA 3UGJA 4FCTA 3J7AS 1UM8A 4F1IA 4B3TM 3GRVA 4DV6M 3FD9A 4B3RM 1E9SA 3L25A 2HL7A 1IBMM 3FUTA 2YNMD 3T6PA 4X66M 4JI2M 2KW0A 3HU1A 2QPAA 4AI6A 4MB7A 3IG5A 2Z4RA 5EJCA 4LCBA 4Q7JA 3KVWA 4LFAM 3K9PA 5FTJA 4LG2A 1TH3A 1VG5A 2YFQA 3VLFB 4OU7A 2O5RA 1Q02A 4G6ZA 4OVZB 4A3VB 2Y21A 4EIWA 4DUZM 2KNZA 1W5SA 3PXGA 2M60A 2OQ4A 4DUYM 2HHHM 2QBYB 2G5GX 3UK6A 1FJGM 4IJFA 2X4AA 4MGYE 3KOWE 3BOSA 2Y0QA 3PVSA 1XXHB 4BB9A 5ITYA 4LJ7A 2LTUA 5IWAM 1XXHE 4CGYB 2X49A 4I8OA 3U6QA 3JR4A 1PJQA 3L2AA 4WURA 4BBAA 1TDZA 1IY0A 4JI6M 3FYCA 4LGMA 2DAKA 1WXQA 2QSFX 5ITUA 3GPXA 4QHSA 2YR0A 1NHGC 2JY6B 5L8RF 3MJ5A 1QUTA 3U6MA 1XHBA 2KA6B 1Z6TA 4G3OA 4RNAA 3TWLA 3Q8XA 2C98A 2ZTCA 5DYIA 3GLIB 1XMOM 3NWLA 4FWHA 4FW9A 2BNKA 3MMPA 3E9SA 3GO8A 1D0MA 2RRUA 3GLIE 3U6DA 2Y20A 5IZ7D 1AUAA 4RF1A 4R71A 2JY5A 2LHCA 3C9PA 4RF0A 5LMNM 4K0KM 3T1YM 2W82A 1DGBA 3A98B 3EIHA 1PJTA 4NSRA 4B7GA 2MGWA 5KQDA 2UXCM 3KP0E 1A5TA 1JR3D 2R65A 3MHVC 4M9SA 4LJ8A 4MGIE 3RFWA 1XB2B 4QHTA 1S3SA 2DZOB 2I7PA 4M9XA 1TH4A 4LZZA 3AOEA 4AW4A 3SFZA 2JZ0A 4JI4M 2BJVA 2UXDM 2F5PA 1QYRA 1T6OA 4M0WA 3RGSA 2L4EA 2UXBM 4KHPM 4GHLA 1P3QQ 1IM2A 1N75A 1OAOC 2LVAA 1GKIA 1VQ1A 2ZM6M 4G4QA 3I51A 1K3WA 2FE8A 2CUZA 5EQTA 3HX3A 3DOAA 3GLHB 1GL6A 3M7GA 4DBGB 5EXXA 2F5NA 1N36M 1KYIA 2JA2A 3GLHE 3W68A 1I94M 2VQEM 1NVMA 1R6BX 3E4RA 3EIEA 3R8FA 1WIVA 3HHYA 3E21A 3L27A 4CIZA 2XLJA 2J7NA 1DGHB 3THGA 2XF3A 3H4MA 5C1BA 2EA0A 1WR1B 2F5SA 2FFJA 3I4YA 4GIPA 4FCVA 2KZSA 2JUJA 2DHRA 4GEWA 1RU3A 1TR8A 3HGIA 2EO2A 5EP4A 2JXNA 3CGWA 5JI3E 3JR5A 1YSYA 2B3TA 3A46A 1IY2A 2J7OA 4DR7M 4QOZC 1PJJA 1QUSA 2Z7JA 3FUXA 1OKSA 2J5YA 1IXSA 1H6UA 5EP3A 3TL4X 2XH9A 1N77A 2ZBKB 1SXJB 1ZMVA 1L1TA 4LRSA 4DV4M 4GKKM 1QDTA 4DV2M 1IN8A 1SXJE 1EE8A 3KW6A
chains in the Genus database with same CATH topology
2ZAMA 4JI3M 4PCZA 4D80A 2F4VM 1DGGA 2R46A 3GLGB 3CF6E 4AKGA 1HQCA 1JR3A 1IBKM 1QZMA 2KZUA 1NY6A 3U6LA 3A42A 3FUVA 3HKPA 3LQRA 3FTFA 1X37A 4LJ4A 2L09A 2LH0A 3PNYA 1PM5A 2LWXA 3UJNA 1Z5BA 2CV2A 4NRVA 3IG8A 1IN5A 4D81A 3U61A 1XMQM 4FVMA 3PFIA 1R2YA 2ERCA 2BJWA 2ZANA 4NXNM 1NJFA 5C18A 1MU5A 4GC9A 4B3MM 4OX9M 3AL0C 4DV0M 4TUWA 3M0EA 2YQZA 4M9ZA 4LZJA 3VFDA 4LGYA 1NJGA 3T15A 3UMMA 5H37D 1NHWC 5ITTA 4CHTB 2DZNB 4IBKA 3J2PB 4IBJA 3SAVA 2EUCA 3J81S 1L1ZA 2XZFA 3I4VA 5FTNA 3M6AA 1Q3BA 4FCWA 1DGFA 4Z6YA 3GLFA 4LF4M 3W0LB 1QQWA 1XNQM 5FTMA 4R3DA 5DNYA 4JI5M 1GLNA 3TE6A 3FTEA 4IBFA 4DV3M 4GHAA 4FD2A 1XNRM 3U5ZA 2F5QA 3RE8A 5EXTA 2C99A 3RGPA 2F5OA 3VKGA 2RKOA 3U6PA 3DA1A 4DR4M 4B7FA 4LJ5A 4G4OA 4NRWA 3D8LA 1YUBA 1NY5A 4DV5M 4AKHA 1J09A 4LFBM 4DR3M 1HR0M 4ZPXA 4AKIA 1XC8A 1HT1E 3B9PA 2Z4SA 4ITQA 3GPYA 1NNJA 5E6JA 1QAQA 4DR6M 3HU3A 2KRKA 1IQPA 4I81A 3SAUA 1YE9A 3C58A 3LQQA 2CV0A 5GKNA 4CISA 3PNVA 5EP1A 4DR1M 1G41A 1GVNA 3GRUA 4S12A 4P16A 5FSWA 2UUAM 4GH9A 4MGHA 4KLNA 4PT5A 4L15A 2C9OA 1NNUC 4L78A 3LVWA 1SXJD 4AQYM 4R7GA 2CHQA 3ZH9B 4OW0A 5FLXS 2QZ4A 2E5LM 2A5YB 2UUCM 4XBOA 4Z8XA 4KODA 3HU2A 4L4UA 4QOSA 2V6ZM 4XGIA 3DFZA 2K47A 3GQ3A 2LNHC 4MGKE 5IREB 1OFIA 1IN7A 1TH2A 1JQJC 3D8BA 5EXSA 3U6SA 1R2ZA 1DO0A 3ZCBB 2DXIA 4LY6A 4MGZE 2QP9X 5ITXA 4IBEA 3TWMA 5ITRA 2V1CA 1Q39A 2DVWB 4IBGA 3GQ5A 4GKJM 1OFHA 2UUBM 2G8LA 3KSXA 3K1JA 3HJ8A 2L7IA 5FTKA 1N33M 2HCBA 2XFTA 2DWMA 1MX0A 4LF9M 5IT9S 4IIWA 1GL7A 3VK7A 1N78A 3TQSA 3SC3A 3CTWB 1C1KA 4JI7M 3KS8A 3HWSA 4LF8M 2XSZD 1DGHA 3L26A 4IBIA 4NL4H 4X65M 5KPTA 3CF2A 3R9XB 2KEBA 3U61B 1QANA 2ZAOA 2UU9M 3AV0A 2Z3XA 5E26A 3L28A 2HKJA 4QNRA 3T1HM 2D7EA 4PDGA 3U6EA 4DR2M 3TWKA 3AFHA 2QCUA 1XWIA 2L6OA 2C5RA 1KFVA 4YY3M 5LMUM 1IN4A 4QNMA 1QAMA 1G4AE 3GLGA 3SHFA 2XFSA 1L2CA 2KXEA 1R7RA 3SYLA 2D7HA 4JYAM 4FWDA 4NSOB 2P5TA 1E94E 1NSFA 2DWNA 1IXZA 3U60A 3SYKA 3KOYE 1E9RA 4LJ6A 3SHGB 1LV7A 3GLFB 2NQ8C 3SMSA 3WHKA 1FNNA 1Z5CA 4AG5A 5BR8M 3ZC7B 3J27B 1TDHA 1QAOA 1IY1A 3FKEA 4LFCM 1W5TA 3KDSE 3U5ZB 3K92A 2CHGA 4REZA 4AG6A 1VDDA 7CATA 1IXRC 2R4JA 5F3WA 4D82A 3K8ZA 2R4EA 3KOZE 4M0DA 5BPVA 3OTOM 2V1UA 1HNWM 4LRTA 2XSZA 3KS4A 3HHWA 3VDPA 3GRRA 4IJEA 2CHVA 2D7GA 3VK8A 2KRUA 2Y0TA 1SXJC 5EP2A 3SBJA 4OVZA 3FYDA 3KP1E 4PDIA 3L29A 5ITQA 2L7HA 2RGHA 2C96A 3DZDA 4AZFA 3SASA 3FUUA 4I5SA 3K2LA 2QBYA 4B7HA 4L8RC 1IBLM 1L2DA 2H1RA 1XXHA 4JN6A 3QAUA 2FNAA 3J80S 4MM3B 8CATA 2R45A 2DWZB 2CE7A 1L2BA 4JV5M 3SMPA 4B08A 2DWLA 3KFUG 1IN6A 2CFOA 3SATA 1D2NA 5FTLA 3VKHA 2XZUA 3GQ4A 3GLIA 1ORYB 1J5EM 3GP1A 2RGOA 3GPUA 4KO8A 1G8PA 1G3IA 2AHMA 3KOXE 1QVRA 3SAWA 1KSFX 3HHXA 3ILKA 3VDUA 3GPPA 3U6OA 1HNZM 4FWGA 5KPRA 2C9CA 1G59A 2I7NA 3SARA 3KSJA 4WW0A 3FUWA 4I4LA 4G4RA 5EXPA 3HHZA 2M5ZA 4W5WA 3FTCA 3MK6A 4GMQA 3TPZA 4GRIA 1K82A 2OPFA 5ITXE 2XEPA 3AKZA 5A2QS 4DR5M 2R18A 3AOGA 2LXEA 1IXSB 1ZAEA 4DV7M 4LJ9A 3U6CA 3LVVA 1I4WA 1ZQ9A 2X8AA 4IBCA 1N32M 4JI0M 2VIIA 5JI2E 5KPZA 1N34M 4LF5M 3GLHA 4YHHM 3GRYA 4JXJA 3T38A 2Q2EB 4GC5A 1L8QA 1E32A 4JI1M 3CF0A 3LMMA 1Z59A 1Q3CA 1OJLA 3JAMS 1Z5AA 3A45A 4DV1M 4L16A 1HT2E 2R62A 3HJQA 3J7BA 4PD2A 4G4NA 1SXJA 1J7KA 4LJAA 4X62M 4HLQA 2CV1A 3AJIB 3UZUA 4IBDA 1HNXM 3AOEC 4HL4A 4NXMM 3HJSA 3U60B 3WHLA 1K3XA 4IBBA 5DYGA 4II7A 2FOIC 4LF7M 2QENA 4B3SM 2VQFM 1TGUA 2CEAA 5KQ8A 4LF6M 5KO3A 4MH0E 3W0FA 1T3TA 3KXEC 4JI8M 1HQYE 3NBIA 2XGNA 4NOOB 3FTDA 4GITA 4BLCA 4X64M 3QWLA 1DO2A 1PJIA 3UGJA 4FCTA 3J7AS 1UM8A 4B3TM 3GRVA 4DV6M 3FD9A 4B3RM 1E9SA 3L25A 2HL7A 1IBMM 3FUTA 2YNMD 4X66M 4JI2M 2KW0A 3HU1A 2QPAA 4AI6A 4MB7A 3IG5A 2Z4RA 5EJCA 4LCBA 3KVWA 4LFAM 5FTJA 4LG2A 1TH3A 3VLFB 2YFQA 4OU7A 4DUZM 2O5RA 4G6ZA 4OVZB 4A3VB 2Y21A 4EIWA 1W5SA 3PXGA 2M60A 2OQ4A 4DUYM 2HHHM 2QBYB 2G5GX 3UK6A 1FJGM 4IJFA 2X4AA 4MGYE 3KOWE 3BOSA 2Y0QA 3PVSA 1XXHB 4BB9A 5ITYA 4LJ7A 5IWAM 4CGYB 2X49A 4I8OA 3U6QA 3JR4A 3L2AA 4WURA 4BBAA 1TDZA 1IY0A 4JI6M 3FYCA 4LGMA 1WXQA 5ITUA 3GPXA 4QHSA 2YR0A 1NHGC 3MJ5A 3U6MA 1XHBA 2KA6B 1Z6TA 4RNAA 3TWLA 3Q8XA 2C98A 5DYIA 3GLIB 1XMOM 3NWLA 4FWHA 4FW9A 2BNKA 3E9SA 3GO8A 3U6DA 2Y20A 5IZ7D 4RF1A 4RF0A 5LMNM 4K0KM 3T1YM 2W82A 1DGBA 3A98B 3EIHA 4NSRA 4B7GA 5KQDA 2UXCM 3KP0E 1JR3D 2R65A 3MHVC 4M9SA 4LJ8A 4MGIE 3RFWA 4QHTA 1S3SA 2DZOB 2I7PA 4M9XA 1TH4A 4LZZA 3AOEA 4AW4A 3SFZA 4JI4M 2BJVA 2UXDM 2F5PA 1QYRA 3RGSA 4M0WA 2UXBM 4KHPM 4GHLA 1IM2A 1N75A 1GKIA 2ZM6M 4G4QA 3I51A 1K3WA 2FE8A 2CUZA 5EQTA 3DOAA 3GLHB 1GL6A 3M7GA 5EXXA 2F5NA 1N36M 1KYIA 2JA2A 1I94M 2VQEM 1NVMA 1R6BX 3E4RA 3EIEA 3R8FA 3HHYA 3L27A 2XLJA 2J7NA 1DGHB 3THGA 2XF3A 3H4MA 5C1BA 2EA0A 2F5SA 2FFJA 3I4YA 4GIPA 4FCVA 2KZSA 2DHRA 3HGIA 2EO2A 5EP4A 5JI3E 3JR5A 1YSYA 3A46A 1IY2A 2J7OA 4DR7M 4QOZC 1PJJA 2Z7JA 3FUXA 5EP3A 3TL4X 1N77A 1H6UA 2XH9A 2ZBKB 1SXJB 1L1TA 4LRSA 4DV4M 4GKKM 4DV2M 1IN8A 1SXJE 1EE8A 3KW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC M;  1IBL M;  1L2D A;  4JI3 M;  4X64 M;  4PCZ A;  2F4V M;  3GQ3 A;  1PJI A;  3J7A S;  4B3T M;  4DV6 M;  1IBK M;  4B3R M;  3J80 S;  3U6L A;  3A42 A;  3U6S A;  1R2Z A;  1IBM M;  4X66 M;  1L2B A;  4JI2 M;  4JV5 M;  4MB7 A;  1PM5 A;  4LFA M;  5ITX A;  1Z5B A;  4NRV A;  3SAT A;  4DUZ M;  3TWM A;  5ITR A;  1XMQ M;  2XZU A;  1Q39 A;  3GQ5 A;  3GQ4 A;  1R2Y A;  4GKJ M;  2UUB M;  1J5E M;  3GP1 A;  4NXN M;  2OQ4 A;  3GPU A;  4DUY M;  2HHH M;  1MU5 A;  1FJG M;  1N33 M;  5IT9 S;  4B3M M;  4LF9 M;  4OX9 M;  1MX0 A;  4DV0 M;  3VK7 A;  5ITY A;  3SAW A;  5IWA M;  1HNZ M;  3GPP A;  3U6O A;  5ITT A;  3U6Q A;  3JR4 A;  4JI7 M;  1TDZ A;  3SAR A;  4LF8 M;  4JI6 M;  5FLX S;  4G4R A;  4X65 M;  5ITU A;  3GPX A;  3SAV A;  3J81 S;  3U6M A;  1K82 A;  1L1Z A;  2OPF A;  3TWL A;  5ITX E;  4DR5 M;  5A2Q S;  2XZF A;  1XMO M;  1Q3B A;  2UU9 M;  3GO8 A;  4LF4 M;  4DV7 M;  3U6D A;  2HKJ A;  1XNQ M;  3U6C A;  4JI5 M;  3T1H M;  4PDG A;  3U6E A;  4DR2 M;  3TWK A;  5LMN M;  1N32 M;  4JI0 M;  1N34 M;  3T1Y M;  4K0K M;  4DV3 M;  1KFV A;  4YY3 M;  5LMU M;  4LF5 M;  1XNR M;  2F5Q A;  2UXC M;  4YHH M;  1L2C A;  4JYA M;  2Q2E B;  4JI1 M;  2F5O A;  1Z59 A;  1Q3C A;  3U6P A;  4DR4 M;  3JAM S;  4G4O A;  4NRW A;  1Z5A A;  4JI4 M;  3A45 A;  4DV1 M;  4DV5 M;  2UXD M;  2F5P A;  4LFB M;  4DR3 M;  1HR0 M;  2UXB M;  4KHP M;  1XC8 A;  4PD2 A;  1Z5C A;  5BR8 M;  4ITQ A;  3GPY A;  1NNJ A;  1TDH A;  2ZM6 M;  4G4N A;  4G4Q A;  1K3W A;  4DR6 M;  4LFC M;  3DOA A;  4X62 M;  2F5N A;  1N36 M;  3SAU A;  1I94 M;  1HNX M;  2VQE M;  3C58 A;  4CIS A;  4NXM M;  1HNW M;  3OTO M;  1K3X A;  4DR1 M;  2EA0 A;  2F5S A;  4LF7 M;  3VK8 A;  2VQF M;  4B3S M;  2UUA M;  3JR5 A;  3SBJ A;  3A46 A;  4LF6 M;  4DR7 M;  3W0F A;  1PJJ A;  4PDI A;  4AQY M;  5ITQ A;  2ZBK B;  1L1T A;  4JI8 M;  4DV4 M;  4GKK M;  3SAS A;  4DV2 M;  2E5L M;  1EE8 A; 
#chains in the Genus database with same CATH topology
 2ZAM A;  4JI3 M;  4PCZ A;  4D80 A;  2F4V M;  1DGG A;  2R46 A;  3GLG B;  4P17 A;  2O25 A;  3CF6 E;  4AKG A;  1VEG A;  1HQC A;  1JR3 A;  2DZL A;  1IBK M;  1QZM A;  2KZU A;  1NY6 A;  3U6L A;  3A42 A;  3FUV A;  3HKP A;  3LQR A;  3FTF A;  1X37 A;  2L2D A;  4LJ4 A;  2L09 A;  2LH0 A;  3PNY A;  1PM5 A;  2LWX A;  2EJS A;  3UJN A;  2MR9 A;  1Z5B A;  1R4G A;  2CV2 A;  4NRV A;  3IG8 A;  1IN5 A;  4D81 A;  3U61 A;  1XMQ M;  4FVM A;  3PFI A;  1R2Y A;  2ERC A;  2BJW A;  2KDL A;  2ZAN A;  4NXN M;  1PRB A;  1NJF A;  5C18 A;  1MU5 A;  4GC9 A;  4B3M M;  4OX9 M;  3AL0 C;  4DV0 M;  4TUW A;  3M0E A;  2KHH A;  2YQZ A;  4M9Z A;  4LZJ A;  1YLA A;  3VFD A;  4LGY A;  1NJG A;  3T15 A;  3UMM A;  5H37 D;  1NHW C;  5ITT A;  4CHT B;  1JB0 F;  3C3E A;  2DZN B;  4IBK A;  3J2P B;  4IBJ A;  2WSC F;  1D0L A;  3SAV A;  2EUC A;  2MRO B;  2K9D A;  3J81 S;  2OO9 A;  1L1Z A;  3V76 A;  2DAE A;  2R6F A;  2XZF A;  3I4V A;  5FTN A;  3M6A A;  1Q3B A;  4FCW A;  1DGF A;  4Z6Y A;  1DV0 A;  3GLF A;  4LF4 M;  3W0L B;  1QQW A;  1Y8G A;  1XNQ M;  2ZTD A;  2DAM A;  4R3D A;  5FTM A;  5DNY A;  4JI5 M;  1WGN A;  1IFY A;  1GLN A;  3TE6 A;  1QDR A;  1ZV1 A;  3FTE A;  4IBF A;  4DV3 M;  4GHA A;  4FD2 A;  1UFZ A;  1XNR M;  3U5Z A;  2F5Q A;  3RE8 A;  5EXT A;  1TTE A;  2KNV A;  2H5X A;  2C99 A;  4WP2 A;  3RGP A;  2F5O A;  3VKG A;  2RKO A;  4Y28 F;  4NC6 A;  3U6P A;  1AIP C;  3DA1 A;  3B89 A;  4DR4 M;  4B7F A;  4LJ5 A;  4G4O A;  4NRW A;  3D8L A;  1WJ7 A;  1YUB A;  1NY5 A;  4DV5 M;  2LBC A;  4AKH A;  1J09 A;  4LFB M;  4DR3 M;  1G71 A;  4ZPX A;  1HR0 M;  4AKI A;  1XC8 A;  3H4J A;  1HT1 E;  3B9P A;  2Z4S A;  4ITQ A;  3GPY A;  1NNJ A;  5E6J A;  1QAQ A;  4DR6 M;  2GQF A;  3HU3 A;  2KRK A;  3HZJ A;  2DHY A;  1IQP A;  4I81 A;  3SAU A;  1YE9 A;  3LW5 F;  1OIP A;  3C58 A;  3LQQ A;  1GJT A;  2CV0 A;  5GKN A;  4CIS A;  3PNV A;  5EP1 A;  4DR1 M;  2DNA A;  1R5L A;  1G41 A;  1TF0 B;  2CP8 A;  5DFL A;  3I01 M;  1GVN A;  3GRU A;  4S12 A;  2JP7 A;  1GO5 A;  2L4F A;  4P16 A;  5FSW A;  2UUA M;  4GH9 A;  3B7Z A;  4MGH A;  4KLN A;  4PT5 A;  4L15 A;  2C9O A;  1NNU C;  4L78 A;  3LVW A;  1SXJ D;  4AQY M;  4F2L A;  4RKU F;  2CHQ A;  4R7G A;  3ZH9 B;  3E46 A;  3I04 M;  4OW0 A;  5FLX S;  2QZ4 A;  2E5L M;  2A5Y B;  2UUC M;  4XBO A;  4Z8X A;  3B74 A;  4KOD A;  3HU2 A;  4L4U A;  4QOS A;  1VEK A;  2V6Z M;  2JY8 A;  2K47 A;  3DFZ A;  4XGI A;  2LHG A;  2LNH C;  3GQ3 A;  4MGK E;  5IRE B;  1NO1 A;  1OFI A;  1GJS A;  1IN7 A;  1TH2 A;  1JQJ C;  3D8B A;  5EXS A;  3U6S A;  1R2Z A;  2VF8 A;  1DO0 A;  4UN2 B;  3ZCB B;  2DXI A;  4LY6 A;  2LVQ D;  4MGZ E;  1HJP A;  2QP9 X;  2DAG A;  5ITX A;  4IBE A;  3TWM A;  5ITR A;  2V1C A;  2MJ5 B;  1Q39 A;  2DVW B;  4IBG A;  3GQ5 A;  4GKJ M;  1OFH A;  4HEO A;  2UUB M;  2G8L A;  3KSX A;  3K1J A;  3HJ8 A;  2L7I A;  2LVN C;  5FTK A;  2HCB A;  2XFT A;  1PGY A;  1MX0 A;  2DWM A;  4LF9 M;  1N33 M;  5IT9 S;  4IIW A;  1GL7 A;  3VK7 A;  1N78 A;  3TQS A;  2EKF A;  2KNA A;  3SC3 A;  3LCV B;  1LTM A;  3CTW B;  1C1K A;  4JI7 M;  3KS8 A;  3HWS A;  4LF8 M;  1JR3 E;  2XSZ D;  1DGH A;  3L26 A;  1F4I A;  4IBI A;  4NL4 H;  4X65 M;  3Q8G A;  5KPT A;  3QYB A;  3CF2 A;  3R9X B;  1OAI A;  2KEB A;  3U61 B;  1QAN A;  2ZAO A;  2UU9 M;  2QNJ A;  3AV0 A;  3W67 A;  2Z3X A;  2JY7 A;  5E26 A;  3L28 A;  2HKJ A;  4QNR A;  1BVS A;  1NV8 A;  4XK8 F;  3T1H M;  1NV9 A;  2D7E A;  2G3Q A;  4PDG A;  4DR2 M;  3U6E A;  3TWK A;  3AFH A;  1C7Y A;  2QCU A;  3F92 A;  1XWI A;  2L6O A;  2C5R A;  3NBX X;  1KFV A;  4YY3 M;  5LMU M;  1IN4 A;  4QNM A;  2LVO C;  1QAM A;  1G4A E;  2DI0 A;  3GLG A;  3SHF A;  2FH0 A;  2XFS A;  2KXE A;  1R7R A;  3SYL A;  1L2C A;  2D7H A;  4JYA M;  4FWD A;  4NSO B;  2P5T A;  1E94 E;  1NSF A;  2DWN A;  1IXZ A;  3U60 A;  3SYK A;  3KOY E;  1E9R A;  4LJ6 A;  3SHG B;  3HY5 A;  1LV7 A;  3IEC A;  1EIJ A;  3GLF B;  2NQ8 C;  2DKL A;  3K9O A;  3SMS A;  3GLF E;  3WHK A;  1FNN A;  1Z5C A;  4AG5 A;  5BR8 M;  3ZC7 B;  3J27 B;  1TDH A;  1PJS A;  2VDB B;  1QAO A;  1IY1 A;  3FKE A;  4LFC M;  1W5T A;  3KDS E;  3U5Z B;  3K92 A;  2JNH A;  2CHG A;  4REZ A;  4AG6 A;  1VDD A;  1V34 A;  7CAT A;  1IXR C;  2R4J A;  5F3W A;  4CJ6 A;  4D82 A;  3K8Z A;  2R4E A;  3KOZ E;  4M0D A;  5BPV A;  3OTO M;  2V1U A;  1HNW M;  2QQ8 A;  1VDL A;  2EKK A;  4LRT A;  2XSZ A;  3HHW A;  3KS4 A;  3VDP A;  3GRR A;  4IJE A;  1T43 A;  2CHV A;  2D7G A;  3VK8 A;  2KRU A;  2APL A;  2OOB A;  2Y0T A;  2FS1 A;  1OQY A;  1SXJ C;  2DAI A;  5EP2 A;  3SBJ A;  4OVZ A;  3FYD A;  3KP1 E;  4PDI A;  3L29 A;  5ITQ A;  2L7H A;  2RGH A;  2HAK A;  2C96 A;  3DZD A;  4AZF A;  3SAS A;  2DEN A;  3FUU A;  4I5S A;  3K2L A;  2QBY A;  4B7H A;  4L8R C;  2K6B A;  3FRI A;  1L2D A;  2H1R A;  1IBL M;  1XXH A;  1CUK A;  4JN6 A;  3QAU A;  2FNA A;  3J80 S;  4MM3 B;  8CAT A;  2R45 A;  2DWZ B;  2CE7 A;  1L2B A;  4JV5 M;  1V92 A;  3SMP A;  4B08 A;  1D0K A;  2DWL A;  3KFU G;  1IN6 A;  2CFO A;  3SAT A;  1D2N A;  5FTL A;  3VKH A;  2XZU A;  3GQ4 A;  1ZMW A;  3GLI A;  1OIZ A;  1ORY B;  1J5E M;  3GP1 A;  2HWJ A;  2RGO A;  3GPU A;  4KO8 A;  1G8P A;  2GNO A;  1G3I A;  2K0B X;  2AHM A;  2R0I A;  2BWB A;  3KOX E;  1QVR A;  4ANR A;  3SAW A;  1KSF X;  3HHX A;  3ILK A;  3VDU A;  1V33 A;  3B7Q A;  3GPP A;  3U6O A;  1HNZ M;  4FWG A;  1VEJ A;  5KPR A;  2C9C A;  2WZJ A;  1G59 A;  2I7N A;  3SAR A;  3KSJ A;  4WW0 A;  3FUW A;  4I4L A;  4G4R A;  5EXP A;  3HHZ A;  1OTR A;  2M5Z A;  3ZQJ A;  4W5W A;  3FTC A;  3MK6 A;  4GMQ A;  3TPZ A;  4GRI A;  2Z8Y M;  2QHO B;  1K82 A;  2OPF A;  5ITX E;  3FRH A;  2XEP A;  3AKZ A;  5A2Q S;  4DR5 M;  2R18 A;  3AOG A;  4KT0 F;  2OOA A;  2LXE A;  1IXS B;  1ZAE A;  4DV7 M;  3FE3 A;  4LJ9 A;  3U6C A;  3LVV A;  1I4W A;  1ZQ9 A;  1EFU B;  2X8A A;  4IBC A;  1N32 M;  4JI0 M;  2VII A;  5JI2 E;  5KPZ A;  1N34 M;  4LF5 M;  3GLH A;  4YHH M;  2CWB A;  3GRY A;  4JXJ A;  3T38 A;  2Q2E B;  4GC5 A;  1L8Q A;  1E32 A;  4JI1 M;  3CF0 A;  3LMM A;  1Z59 A;  1Q3C A;  1OJL A;  3JAM S;  1MJG M;  1Z5A A;  2WSF F;  3A45 A;  4DV1 M;  4L16 A;  1HT2 E;  2R62 A;  3HJQ A;  2BWE A;  1WGL A;  3J7B A;  4PD2 A;  4G4N A;  2VF7 A;  3QYE A;  1SXJ A;  2WSE F;  3LCU A;  3BBZ A;  2LVP C;  1J7K A;  4LJA A;  4X62 M;  4HLQ A;  2CV1 A;  3AJI B;  2JZ1 A;  3UZU A;  4IBD A;  3IHP A;  1HNX M;  3AOE C;  3GLG E;  4HL4 A;  2R44 A;  1ZMU A;  3HJS A;  4NXM M;  3U60 B;  3WHL A;  1K3X A;  1GAB A;  1QZE A;  4IBB A;  5DYG A;  2JWS A;  2N35 A;  2FOI C;  4II7 A;  2QEN A;  4LF7 M;  4B3S M;  2VQF M;  1TGU A;  3B7N A;  3C3D A;  1SG9 A;  2CEA A;  1WHC A;  5KQ8 A;  4LF6 M;  5KO3 A;  1MN3 A;  4MH0 E;  3W0F A;  1T3T A;  3KXE C;  4JI8 M;  1HQY E;  3NBI A;  4L6V 6;  2XGN A;  4NOO B;  2O01 F;  3FTD A;  4GIT A;  4BLC A;  4X64 M;  3QWL A;  2CRU A;  1DO2 A;  2MH8 A;  3BXW A;  1PJI A;  3UGJ A;  4FCT A;  3J7A S;  1UM8 A;  4F1I A;  4B3T M;  3GRV A;  4DV6 M;  3FD9 A;  4B3R M;  1E9S A;  3L25 A;  2HL7 A;  1IBM M;  3FUT A;  2YNM D;  3T6P A;  4X66 M;  4JI2 M;  2KW0 A;  3HU1 A;  2QPA A;  4AI6 A;  4MB7 A;  3IG5 A;  2Z4R A;  5EJC A;  4LCB A;  4Q7J A;  3KVW A;  4LFA M;  3K9P A;  5FTJ A;  4LG2 A;  1TH3 A;  1VG5 A;  2YFQ A;  3VLF B;  4OU7 A;  2O5R A;  1Q02 A;  4G6Z A;  4OVZ B;  4A3V B;  2Y21 A;  4EIW A;  4DUZ M;  2KNZ A;  1W5S A;  3PXG A;  2M60 A;  2OQ4 A;  4DUY M;  2HHH M;  2QBY B;  2G5G X;  3UK6 A;  1FJG M;  4IJF A;  2X4A A;  4MGY E;  3KOW E;  3BOS A;  2Y0Q A;  3PVS A;  1XXH B;  4BB9 A;  5ITY A;  4LJ7 A;  2LTU A;  5IWA M;  1XXH E;  4CGY B;  2X49 A;  4I8O A;  3U6Q A;  3JR4 A;  1PJQ A;  3L2A A;  4WUR A;  4BBA A;  1TDZ A;  1IY0 A;  4JI6 M;  3FYC A;  4LGM A;  2DAK A;  1WXQ A;  2QSF X;  5ITU A;  3GPX A;  4QHS A;  2YR0 A;  1NHG C;  2JY6 B;  5L8R F;  3MJ5 A;  1QUT A;  3U6M A;  1XHB A;  2KA6 B;  1Z6T A;  4G3O A;  4RNA A;  3TWL A;  3Q8X A;  2C98 A;  2ZTC A;  5DYI A;  3GLI B;  1XMO M;  3NWL A;  4FWH A;  4FW9 A;  2BNK A;  3MMP A;  3E9S A;  3GO8 A;  1D0M A;  2RRU A;  3GLI E;  3U6D A;  2Y20 A;  5IZ7 D;  1AUA A;  4RF1 A;  4R71 A;  2JY5 A;  2LHC A;  3C9P A;  4RF0 A;  5LMN M;  4K0K M;  3T1Y M;  2W82 A;  1DGB A;  3A98 B;  3EIH A;  1PJT A;  4NSR A;  4B7G A;  2MGW A;  5KQD A;  2UXC M;  3KP0 E;  1A5T A;  1JR3 D;  2R65 A;  3MHV C;  4M9S A;  4LJ8 A;  4MGI E;  3RFW A;  1XB2 B;  4QHT A;  1S3S A;  2DZO B;  2I7P A;  4M9X A;  1TH4 A;  4LZZ A;  3AOE A;  4AW4 A;  3SFZ A;  2JZ0 A;  4JI4 M;  2BJV A;  2UXD M;  2F5P A;  1QYR A;  1T6O A;  4M0W A;  3RGS A;  2L4E A;  2UXB M;  4KHP M;  4GHL A;  1P3Q Q;  1IM2 A;  1N75 A;  1OAO C;  2LVA A;  1GKI A;  1VQ1 A;  2ZM6 M;  4G4Q A;  3I51 A;  1K3W A;  2FE8 A;  2CUZ A;  5EQT A;  3HX3 A;  3DOA A;  3GLH B;  1GL6 A;  3M7G A;  4DBG B;  5EXX A;  2F5N A;  1N36 M;  1KYI A;  2JA2 A;  3GLH E;  3W68 A;  1I94 M;  2VQE M;  1NVM A;  1R6B X;  3E4R A;  3EIE A;  3R8F A;  1WIV A;  3HHY A;  3E21 A;  3L27 A;  4CIZ A;  2XLJ A;  2J7N A;  1DGH B;  3THG A;  2XF3 A;  3H4M A;  5C1B A;  2EA0 A;  1WR1 B;  2F5S A;  2FFJ A;  3I4Y A;  4GIP A;  4FCV A;  2KZS A;  2JUJ A;  2DHR A;  4GEW A;  1RU3 A;  1TR8 A;  3HGI A;  2EO2 A;  5EP4 A;  2JXN A;  3CGW A;  5JI3 E;  3JR5 A;  1YSY A;  2B3T A;  3A46 A;  1IY2 A;  2J7O A;  4DR7 M;  4QOZ C;  1PJJ A;  1QUS A;  2Z7J A;  3FUX A;  1OKS A;  2J5Y A;  1IXS A;  1H6U A;  5EP3 A;  3TL4 X;  2XH9 A;  1N77 A;  2ZBK B;  1SXJ B;  1ZMV A;  1L1T A;  4LRS A;  4DV4 M;  4GKK M;  1QDT A;  4DV2 M;  1IN8 A;  1SXJ E;  1EE8 A;  3KW6 A; 
#chains in the Genus database with same CATH homology
 2ZAM A;  4JI3 M;  4PCZ A;  4D80 A;  2F4V M;  1DGG A;  2R46 A;  3GLG B;  3CF6 E;  4AKG A;  1HQC A;  1JR3 A;  1IBK M;  1QZM A;  2KZU A;  1NY6 A;  3U6L A;  3A42 A;  3FUV A;  3HKP A;  3LQR A;  3FTF A;  1X37 A;  4LJ4 A;  2L09 A;  2LH0 A;  3PNY A;  1PM5 A;  2LWX A;  3UJN A;  1Z5B A;  2CV2 A;  4NRV A;  3IG8 A;  1IN5 A;  4D81 A;  3U61 A;  1XMQ M;  4FVM A;  3PFI A;  1R2Y A;  2ERC A;  2BJW A;  2ZAN A;  4NXN M;  1NJF A;  5C18 A;  1MU5 A;  4GC9 A;  4B3M M;  4OX9 M;  3AL0 C;  4DV0 M;  4TUW A;  3M0E A;  2YQZ A;  4M9Z A;  4LZJ A;  3VFD A;  4LGY A;  1NJG A;  3T15 A;  3UMM A;  5H37 D;  1NHW C;  5ITT A;  4CHT B;  2DZN B;  4IBK A;  3J2P B;  4IBJ A;  3SAV A;  2EUC A;  3J81 S;  1L1Z A;  2XZF A;  3I4V A;  5FTN A;  3M6A A;  1Q3B A;  4FCW A;  1DGF A;  4Z6Y A;  3GLF A;  4LF4 M;  3W0L B;  1QQW A;  1XNQ M;  5FTM A;  4R3D A;  5DNY A;  4JI5 M;  1GLN A;  3TE6 A;  3FTE A;  4IBF A;  4DV3 M;  4GHA A;  4FD2 A;  1XNR M;  3U5Z A;  2F5Q A;  3RE8 A;  5EXT A;  2C99 A;  3RGP A;  2F5O A;  3VKG A;  2RKO A;  3U6P A;  3DA1 A;  4DR4 M;  4B7F A;  4LJ5 A;  4G4O A;  4NRW A;  3D8L A;  1YUB A;  1NY5 A;  4DV5 M;  4AKH A;  1J09 A;  4LFB M;  4DR3 M;  1HR0 M;  4ZPX A;  4AKI A;  1XC8 A;  1HT1 E;  3B9P A;  2Z4S A;  4ITQ A;  3GPY A;  1NNJ A;  5E6J A;  1QAQ A;  4DR6 M;  3HU3 A;  2KRK A;  1IQP A;  4I81 A;  3SAU A;  1YE9 A;  3C58 A;  3LQQ A;  2CV0 A;  5GKN A;  4CIS A;  3PNV A;  5EP1 A;  4DR1 M;  1G41 A;  1GVN A;  3GRU A;  4S12 A;  4P16 A;  5FSW A;  2UUA M;  4GH9 A;  4MGH A;  4KLN A;  4PT5 A;  4L15 A;  2C9O A;  1NNU C;  4L78 A;  3LVW A;  1SXJ D;  4AQY M;  4R7G A;  2CHQ A;  3ZH9 B;  4OW0 A;  5FLX S;  2QZ4 A;  2E5L M;  2A5Y B;  2UUC M;  4XBO A;  4Z8X A;  4KOD A;  3HU2 A;  4L4U A;  4QOS A;  2V6Z M;  4XGI A;  3DFZ A;  2K47 A;  3GQ3 A;  2LNH C;  4MGK E;  5IRE B;  1OFI A;  1IN7 A;  1TH2 A;  1JQJ C;  3D8B A;  5EXS A;  3U6S A;  1R2Z A;  1DO0 A;  3ZCB B;  2DXI A;  4LY6 A;  4MGZ E;  2QP9 X;  5ITX A;  4IBE A;  3TWM A;  5ITR A;  2V1C A;  1Q39 A;  2DVW B;  4IBG A;  3GQ5 A;  4GKJ M;  1OFH A;  2UUB M;  2G8L A;  3KSX A;  3K1J A;  3HJ8 A;  2L7I A;  5FTK A;  1N33 M;  2HCB A;  2XFT A;  2DWM A;  1MX0 A;  4LF9 M;  5IT9 S;  4IIW A;  1GL7 A;  3VK7 A;  1N78 A;  3TQS A;  3SC3 A;  3CTW B;  1C1K A;  4JI7 M;  3KS8 A;  3HWS A;  4LF8 M;  2XSZ D;  1DGH A;  3L26 A;  4IBI A;  4NL4 H;  4X65 M;  5KPT A;  3CF2 A;  3R9X B;  2KEB A;  3U61 B;  1QAN A;  2ZAO A;  2UU9 M;  3AV0 A;  2Z3X A;  5E26 A;  3L28 A;  2HKJ A;  4QNR A;  3T1H M;  2D7E A;  4PDG A;  3U6E A;  4DR2 M;  3TWK A;  3AFH A;  2QCU A;  1XWI A;  2L6O A;  2C5R A;  1KFV A;  4YY3 M;  5LMU M;  1IN4 A;  4QNM A;  1QAM A;  1G4A E;  3GLG A;  3SHF A;  2XFS A;  1L2C A;  2KXE A;  1R7R A;  3SYL A;  2D7H A;  4JYA M;  4FWD A;  4NSO B;  2P5T A;  1E94 E;  1NSF A;  2DWN A;  1IXZ A;  3U60 A;  3SYK A;  3KOY E;  1E9R A;  4LJ6 A;  3SHG B;  1LV7 A;  3GLF B;  2NQ8 C;  3SMS A;  3WHK A;  1FNN A;  1Z5C A;  4AG5 A;  5BR8 M;  3ZC7 B;  3J27 B;  1TDH A;  1QAO A;  1IY1 A;  3FKE A;  4LFC M;  1W5T A;  3KDS E;  3U5Z B;  3K92 A;  2CHG A;  4REZ A;  4AG6 A;  1VDD A;  7CAT A;  1IXR C;  2R4J A;  5F3W A;  4D82 A;  3K8Z A;  2R4E A;  3KOZ E;  4M0D A;  5BPV A;  3OTO M;  2V1U A;  1HNW M;  4LRT A;  2XSZ A;  3KS4 A;  3HHW A;  3VDP A;  3GRR A;  4IJE A;  2CHV A;  2D7G A;  3VK8 A;  2KRU A;  2Y0T A;  1SXJ C;  5EP2 A;  3SBJ A;  4OVZ A;  3FYD A;  3KP1 E;  4PDI A;  3L29 A;  5ITQ A;  2L7H A;  2RGH A;  2C96 A;  3DZD A;  4AZF A;  3SAS A;  3FUU A;  4I5S A;  3K2L A;  2QBY A;  4B7H A;  4L8R C;  1IBL M;  1L2D A;  2H1R A;  1XXH A;  4JN6 A;  3QAU A;  2FNA A;  3J80 S;  4MM3 B;  8CAT A;  2R45 A;  2DWZ B;  2CE7 A;  1L2B A;  4JV5 M;  3SMP A;  4B08 A;  2DWL A;  3KFU G;  1IN6 A;  2CFO A;  3SAT A;  1D2N A;  5FTL A;  3VKH A;  2XZU A;  3GQ4 A;  3GLI A;  1ORY B;  1J5E M;  3GP1 A;  2RGO A;  3GPU A;  4KO8 A;  1G8P A;  1G3I A;  2AHM A;  3KOX E;  1QVR A;  3SAW A;  1KSF X;  3HHX A;  3ILK A;  3VDU A;  3GPP A;  3U6O A;  1HNZ M;  4FWG A;  5KPR A;  2C9C A;  1G59 A;  2I7N A;  3SAR A;  3KSJ A;  4WW0 A;  3FUW A;  4I4L A;  4G4R A;  5EXP A;  3HHZ A;  2M5Z A;  4W5W A;  3FTC A;  3MK6 A;  4GMQ A;  3TPZ A;  4GRI A;  1K82 A;  2OPF A;  5ITX E;  2XEP A;  3AKZ A;  5A2Q S;  4DR5 M;  2R18 A;  3AOG A;  2LXE A;  1IXS B;  1ZAE A;  4DV7 M;  4LJ9 A;  3U6C A;  3LVV A;  1I4W A;  1ZQ9 A;  2X8A A;  4IBC A;  1N32 M;  4JI0 M;  2VII A;  5JI2 E;  5KPZ A;  1N34 M;  4LF5 M;  3GLH A;  4YHH M;  3GRY A;  4JXJ A;  3T38 A;  2Q2E B;  4GC5 A;  1L8Q A;  1E32 A;  4JI1 M;  3CF0 A;  3LMM A;  1Z59 A;  1Q3C A;  1OJL A;  3JAM S;  1Z5A A;  3A45 A;  4DV1 M;  4L16 A;  1HT2 E;  2R62 A;  3HJQ A;  3J7B A;  4PD2 A;  4G4N A;  1SXJ A;  1J7K A;  4LJA A;  4X62 M;  4HLQ A;  2CV1 A;  3AJI B;  3UZU A;  4IBD A;  1HNX M;  3AOE C;  4HL4 A;  4NXM M;  3HJS A;  3U60 B;  3WHL A;  1K3X A;  4IBB A;  5DYG A;  4II7 A;  2FOI C;  4LF7 M;  2QEN A;  4B3S M;  2VQF M;  1TGU A;  2CEA A;  5KQ8 A;  4LF6 M;  5KO3 A;  4MH0 E;  3W0F A;  1T3T A;  3KXE C;  4JI8 M;  1HQY E;  3NBI A;  2XGN A;  4NOO B;  3FTD A;  4GIT A;  4BLC A;  4X64 M;  3QWL A;  1DO2 A;  1PJI A;  3UGJ A;  4FCT A;  3J7A S;  1UM8 A;  4B3T M;  3GRV A;  4DV6 M;  3FD9 A;  4B3R M;  1E9S A;  3L25 A;  2HL7 A;  1IBM M;  3FUT A;  2YNM D;  4X66 M;  4JI2 M;  2KW0 A;  3HU1 A;  2QPA A;  4AI6 A;  4MB7 A;  3IG5 A;  2Z4R A;  5EJC A;  4LCB A;  3KVW A;  4LFA M;  5FTJ A;  4LG2 A;  1TH3 A;  3VLF B;  2YFQ A;  4OU7 A;  4DUZ M;  2O5R A;  4G6Z A;  4OVZ B;  4A3V B;  2Y21 A;  4EIW A;  1W5S A;  3PXG A;  2M60 A;  2OQ4 A;  4DUY M;  2HHH M;  2QBY B;  2G5G X;  3UK6 A;  1FJG M;  4IJF A;  2X4A A;  4MGY E;  3KOW E;  3BOS A;  2Y0Q A;  3PVS A;  1XXH B;  4BB9 A;  5ITY A;  4LJ7 A;  5IWA M;  4CGY B;  2X49 A;  4I8O A;  3U6Q A;  3JR4 A;  3L2A A;  4WUR A;  4BBA A;  1TDZ A;  1IY0 A;  4JI6 M;  3FYC A;  4LGM A;  1WXQ A;  5ITU A;  3GPX A;  4QHS A;  2YR0 A;  1NHG C;  3MJ5 A;  3U6M A;  1XHB A;  2KA6 B;  1Z6T A;  4RNA A;  3TWL A;  3Q8X A;  2C98 A;  5DYI A;  3GLI B;  1XMO M;  3NWL A;  4FWH A;  4FW9 A;  2BNK A;  3E9S A;  3GO8 A;  3U6D A;  2Y20 A;  5IZ7 D;  4RF1 A;  4RF0 A;  5LMN M;  4K0K M;  3T1Y M;  2W82 A;  1DGB A;  3A98 B;  3EIH A;  4NSR A;  4B7G A;  5KQD A;  2UXC M;  3KP0 E;  1JR3 D;  2R65 A;  3MHV C;  4M9S A;  4LJ8 A;  4MGI E;  3RFW A;  4QHT A;  1S3S A;  2DZO B;  2I7P A;  4M9X A;  1TH4 A;  4LZZ A;  3AOE A;  4AW4 A;  3SFZ A;  4JI4 M;  2BJV A;  2UXD M;  2F5P A;  1QYR A;  3RGS A;  4M0W A;  2UXB M;  4KHP M;  4GHL A;  1IM2 A;  1N75 A;  1GKI A;  2ZM6 M;  4G4Q A;  3I51 A;  1K3W A;  2FE8 A;  2CUZ A;  5EQT A;  3DOA A;  3GLH B;  1GL6 A;  3M7G A;  5EXX A;  2F5N A;  1N36 M;  1KYI A;  2JA2 A;  1I94 M;  2VQE M;  1NVM A;  1R6B X;  3E4R A;  3EIE A;  3R8F A;  3HHY A;  3L27 A;  2XLJ A;  2J7N A;  1DGH B;  3THG A;  2XF3 A;  3H4M A;  5C1B A;  2EA0 A;  2F5S A;  2FFJ A;  3I4Y A;  4GIP A;  4FCV A;  2KZS A;  2DHR A;  3HGI A;  2EO2 A;  5EP4 A;  5JI3 E;  3JR5 A;  1YSY A;  3A46 A;  1IY2 A;  2J7O A;  4DR7 M;  4QOZ C;  1PJJ A;  2Z7J A;  3FUX A;  5EP3 A;  3TL4 X;  1N77 A;  1H6U A;  2XH9 A;  2ZBK B;  1SXJ B;  1L1T A;  4LRS A;  4DV4 M;  4GKK M;  4DV2 M;  1IN8 A;  1SXJ E;  1EE8 A;  3KW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...