4JI8M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji8M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji8M02
2HKJA 5ITQA 4DR1M 4JI1M 5IWAM 3J81S 5ITXA 4PD2A 3VK7A 4OX9M 5ITTA 3U6SA 4B3RM 1IBMM 4NXMM 4GKJM 5ITRA 3GPPA 3GQ3A 3SAUA 3SATA 4AQYM 3SAWA 4PDIA 3DOAA 4DV6M 4G4NA 5BR8M 4K0KM 1L2DA 2OQ4A 3SAVA 4JI3M 2OPFA 4YHHM 4B3MM 1Q3CA 3T1YM 1R2YA 1HR0M 3TWLA 4G4OA 1XMOM 3U6OA 1TDHA 4NRVA 4JI4M 4LF7M 3TWMA 1MX0A 4DV2M 1HNXM 4LF8M 4JV5M 4PDGA 3C58A 2VQEM 3SARA 1I94M 5A2QS 1N32M 1N34M 2Q2EB 3JR5A 1PJJA 1TDZA 3U6LA 4B3SM 1J5EM 1EE8A 2F5QA 4MB7A 2UUBM 3J80S 3A46A 4DR7M 4LFAM 2F5PA 3GPXA 4JI8M 4LF6M 3U6MA 4G4QA 3SBJA 3VK8A 4JI7M 1N36M 1Z59A 1XC8A 2F5OA 1K3XA 3SASA 1KFVA 4DR5M 4JI0M 4NXNM 3J7AS 1HNWM 4X65M 1XNRM 1IBLM 2UU9M 4JI6M 2UXBM 5LMUM 3JAMS 2F5SA 4YY3M 1HNZM 2UXDM 5ITXE 2EA0A 1L2BA 1L1TA 1Q3BA 3GO8A 2ZBKB 4DR4M 1Z5AA 4X66M 1XNQM 2UUAM 4LFBM 3JR4A 5FLXS 1K3WA 4DV7M 3GPYA 3T1HM 2F4VM 2VQFM 4DUZM 4CISA 4LF5M 2XZFA 1IBKM 2XZUA 1PM5A 3A42A 3GPUA 1FJGM 2UXCM 3U6QA 4JI2M 4DV3M 1NNJA 1Z5CA 3U6DA 3U6CA 3GQ5A 4B3TM 4DUYM 2E5LM 1L1ZA 1Q39A 2ZM6M 2HHHM 4G4RA 4DR3M 4KHPM 5ITUA 4ITQA 1R2ZA 4DR6M 4DV4M 1PJIA 4JI5M 4DR2M 4GKKM 1N33M 5IT9S 3TWKA 3A45A 3OTOM 4X64M 4LF9M 4JYAM 4DV0M 3W0FA 1L2CA 1MU5A 4X62M 2UUCM 1XMQM 5ITYA 4DV5M 3GP1A 4NRWA 4DV1M 4PCZA 5LMNM 4LFCM 2F5NA 3U6EA 1K82A 1Z5BA 3U6PA 3GQ4A 4LF4M
chains in the Genus database with same CATH superfamily
2Z3XA 4LJ6A 4DR1M 4MH0E 1YUBA 3J81S 4FCWA 2MR9A 5ITXA 4PD2A 3VK7A 2CHGA 3TPZA 4Q7JA 5ITTA 8CATA 1ZQ9A 1NSFA 2VF8A 4FCVA 4LJ4A 2UUCM 1R5LA 4PT5A 2R46A 3WHKA 1E94E 3GPPA 1JR3A 2LVNC 3HHZA 3SATA 1GJSA 2N35A 4AZFA 4AKHA 3UZUA 1WXQA 2ZANA 2YR0A 2OPFA 2KNAA 2G8LA 4FCTA 4YHHM 1IN5A 2C9CA 4IJFA 4S12A 3SYLA 4ANRA 1IN7A 1HR0M 2A5YB 3TQSA 4LZZA 2D7EA 2XFTA 3U5ZA 3A98B 4JI4M 2C9OA 1HQCA 2LXEA 2K0BX 4QHSA 3R8FA 1HNXM 1OAIA 2RGOA 3MK6A 4CGYB 2LVQD 4F2LA 3J27B 1I94M 5A2QS 1YSYA 1GJTA 1QAQA 3LVWA 4D82A 2X49A 3ILKA 3U6LA 2G3QA 4LJ7A 1EE8A 4QOSA 5IZ7D 4DBGB 1G59A 1MJGM 2F5QA 1G4AE 2JZ1A 3H4MA 4MB7A 2UUBM 5EP1A 1ZV1A 3PFIA 4OVZA 4LFAM 3SBJA 4JI7M 4IBJA 5E6JA 3J7BA 1BVSA 1Z59A 2DZNB 4LCBA 4M9ZA 3J7AS 3M0EA 1IY0A 1G41A 1NV8A 2JY5A 2WSCF 2XEPA 4HL4A 4NXNM 3SHFA 1HNWM 1XNRM 2C98A 1DV0A 4RF1A 4II7A 2DXIA 2MGWA 1DGHB 4MGZE 1OQYA 3MJ5A 4MGKE 4FD2A 1P3QQ 4AG6A 2UXDM 5ITXE 2BNKA 2M5ZA 4KLNA 2EA0A 1XWIA 2QNJA 3FUXA 1TH4A 3C3EA 3GO8A 3RFWA 2Y0QA 2JWSA 2KW0A 2LWXA 4LZJA 3GLFB 4X66M 2Z8YM 1JR3E 2GNOA 3THGA 3V76A 2UUAM 4LFBM 1XXHB 1GL7A 5FLXS 3CTWB 2VIIA 1K3WA 1G71A 3KSXA 5KPRA 4AW4A 3Q8XA 3QWLA 2CE7A 1SXJD 4MGIE 2HAKA 4CHTB 4KO8A 3HJSA 3GLIE 1PM5A 1RU3A 1VG5A 1G3IA 3E9SA 1Z5CA 2ZTDA 2LHCA 3GQ5A 3U6DA 3U6CA 1DO2A 1HJPA 2DKLA 2EJSA 1IXSA 1PJTA 4P17A 2LH0A 1R7RA 2E5LM 3KP1E 1Q39A 3K9OA 2OOBA 3M7GA 1D0MA 4HEOA 2ZM6M 1MN3A 1V33A 4IBEA 3FUUA 4IBIA 1JQJC 1QAMA 3LVVA 4DV4M 4NOOB 3KOYE 3NWLA 3QAUA 1N33M 3FD9A 4KODA 1YLAA 2YNMD 3M6AA 4FW9A 1N78A 4LF9M 1DO0A 1GVNA 3I01M 3W0FA 2KZUA 1NJFA 1SG9A 1PJQA 2QCUA 4M9XA 3GLHE 3BBZA 3GRRA 4X62M 5ITYA 1XMQM 3GP1A 4NRWA 2JY8A 3VFDA 3T6PA 3U6EA 3E46A 3HHWA 3HZJA 3B89A 3HY5A 4L16A 1KSFX 3U5ZB 3KVWA 1TDHA 4NSOB 5ITQA 5IWAM 4RNAA 3DA1A 4B3RM 4QNRA 1I4WA 3GRYA 3KOXE 5ITRA 2KDLA 4GKJM 3UK6A 5C1BA 1QUTA 3GQ3A 2ZAMA 3SAUA 5EXXA 2DAEA 2CEAA 2H5XA 3F92A 2XGNA 4KT0F 4AG5A 3SAWA 3DOAA 1CUKA 2XSZA 4K0KM 2QSFX 2RGHA 3GLGA 3KSJA 4IBBA 3T1YM 1YE9A 4FWHA 1R2YA 1Z6TA 3H4JA 4REZA 5EP3A 3TWLA 2KEBA 3KOZE 1Q02A 3VLFB 2FS1A 2J5YA 3GRUA 1W5SA 4G4OA 1FNNA 4LJAA 3ZQJA 4MGYE 4NRVA 4LF7M 2JY6B 4FVMA 2X4AA 4PDGA 3KS8A 1HT2E 1PGYA 2JY7A 2HWJA 3I4YA 2DWNA 3SARA 1QVRA 4M9SA 1PJJA 2EKFA 2K6BA 2KA6B 3KP0E 4L8RC 2NQ8C 1J5EM 2DI0A 1IFYA 1IY1A 2L09A 4DR7M 4B7HA 2DHRA 3B9PA 4Z8XA 1IY2A 3K9PA 5DYIA 2EUCA 3I4VA 1NJGA 2FE8A 3NBIA 2XLJA 2BWEA 2QP9X 3AKZA 3SASA 5KO3A 4X65M 2KZSA 3LMMA 4LG2A 3HU3A 2QHOB 1UFZA 2MROB 2UU9M 2MJ5B 1OFHA 2R18A 4LGMA 2UXBM 5LMUM 2V1UA 3JAMS 2F5SA 1IXSB 1D0LA 2CP8A 3EIEA 1OIPA 2O25A 3DFZA 1J7KA 1NHGC 1Q3BA 3VDUA 2KNVA 1DGBA 2QBYB 5H37D 1IM2A 3AJIB 1XNQM 1TR8A 3GRVA 1D2NA 3LCVB 3I04M 3RGSA 3FRIA 4IBDA 2CWBA 3GLFE 2LVAA 2R4EA 1KYIA 3KFUG 1VQ1A 3AV0A 2F4VM 1NY6A 1XXHE 4FWDA 2VQFM 4DUZM 2DZOB 2OO9A 1JR3D 4CIZA 1GABA 1NY5A 1VDDA 2CRUA 2J7NA 3GPUA 3CF0A 1FJGM 1TTEA 2I7NA 3DZDA 3RE8A 3UMMA 4JI2M 2DWZB 3KDSE 1F4IA 2R44A 3UJNA 3E4RA 4OW0A 4B3TM 1QQWA 1OAOC 2C99A 1OKSA 5EJCA 1ORYB 2DVWB 4D81A 2FFJA 4NC6A 2DNAA 1VEJA 2VDBB 1SXJA 2JXNA 3L28A 4R71A 4DR3M 4RKUF 4GC9A 2L2DA 3TL4X 1R2ZA 2WSFF 1PJSA 2W82A 4JYAM 2Z4SA 4DV0M 3HJQA 1R6BX 3GLGB 1GLNA 2EO2A 2M60A 1HQYE 3PVSA 2DHYA 4R3DA 3SMSA 5C18A 4DV5M 4NSRA 4IJEA 3W0LB 1SXJC 4BBAA 2H1RA 3U6PA 2BWBA 2LNHC 3FTDA 3GQ4A 2B3TA 2HKJA 4JI1M 2YFQA 2R62A 2D7GA 1ZMVA 2V1CA 4JXJA 2ZAOA 1C1KA 2AHMA 4BLCA 2O01F 5DNYA 3IECA 2FOIC 3IG5A 4AQYM 3AOEA 2KHHA 2L7HA 4W5WA 2DZLA 4DV6M 4G4NA 1QDTA 2L4FA 3KS4A 3NBXX 1L2DA 3E21A 2P5TA 1IXZA 2OQ4A 3VKGA 3L29A 3QYBA 3W68A 2XH9A 3D8LA 1TGUA 2CHQA 1IN6A 2DENA 2L7IA 3FYDA 3UGJA 5FTNA 2DAIA 3U6OA 3AOEC 5DYGA 3U61A 1GO5A 3FKEA 3TWMA 4DV2M 3AOGA 2WZJA 1IN8A 1JB0F 1N75A 2HL7A 3QYEA 4WP2A 4G6ZA 2K9DA 1NO1A 5DFLA 1IXRC 3PNYA 1N32M 1N34M 3JR5A 3MMPA 3B7ZA 4B3SM 3LQRA 1OFIA 1J09A 5KPTA 1TF0B 2ERCA 3PXGA 2Z7JA 2JA2A 1TH3A 3ZC7B 2QPAA 4OVZB 3GPXA 3IHPA 1T3TA 1VDLA 5E26A 3IG8A 2F5OA 2O5RA 3FUVA 4JI0M 2R45A 4XGIA 1QYRA 4GIPA 3W67A 4F1IA 2L4EA 4JI6M 2DWLA 2KRKA 1IQPA 3SHGB 2LHGA 1A5TA 4L15A 4LRSA 1E32A 4YY3M 1HNZM 1OTRA 4FWGA 4EIWA 1L2BA 3HJ8A 4L6V6 2WSEF 4GMQA 4LJ9A 4IBFA 4LGYA 3JR4A 3WHLA 1OJLA 4I81A 3KXEC 3MHVC 1T43A 4GH9A 3T1HM 3GPYA 2D7HA 2L6OA 4LF5M 2FNAA 2DAKA 4NL4H 2XZFA 4LJ8A 2XZUA 2KRUA 2K47A 4I5SA 4Z6YA 1N77A 2UXCM 4MM3B 2XSZD 2CUZA 1LV7A 4G3OA 2DAMA 4WURA 1WGLA 1XHBA 1QZEA 1ZAEA 1L8QA 1DGFA 2R65A 5JI2E 3Q8GA 4DUYM 2XFSA 4CJ6A 4GC5A 3FTCA 3R9XB 3RGPA 5FTLA 5EXSA 3LW5F 1W5TA 2OOAA 2HHHM 5EP2A 3HU2A 1D0KA 1T6OA 2RRUA 3B7NA 2X8AA 2R6FA 4ITQA 1WGNA 1PJIA 4JI5M 3FUWA 3C3DA 2R4JA 4DR2M 5IT9S 3TWKA 3HHYA 3A45A 3ZCBB 3OTOM 3BXWA 5KPZA 3KW6A 2Y0TA 3GLIA 3L27A 4BB9A 2I7PA 2FH0A 2LVPC 3GLGE 5LMNM 2CHVA 3U60A 3AL0C 2ZTCA 4GITA 2C5RA 1Z5BA 2MH8A 2QZ4A 3U61B 2HCBA 4LF4M 4TUWA 3HWSA 5FTKA 1GKIA 4Y28F 4OX9M 4IBKA 5L8RF 3U6SA 1IBMM 1NV9A 1XB2B 4AKIA 4NXMM 4RF0A 4QHTA 2CV1A 3HGIA 4B7FA 4GRIA 1LTMA 2QQ8A 4PDIA 3K8ZA 3GLHA 2KXEA 1EFUB 2R0IA 5BR8M 3SAVA 4JI3M 1NHWC 2VF7A 3L25A 3CF6E 1QAOA 4QNMA 4M0WA 2J7OA 1HT1E 4B3MM 1Q3CA 1E9RA 1GL6A 1WIVA 3AFHA 3FRHA 1NVMA 5F3WA 3BOSA 1XMOM 4GEWA 3SMPA 1ZMWA 2BJVA 1MX0A 1OIZA 2G5GX 4LF8M 5FTMA 4D80A 4JV5M 2CV0A 1QANA 1DGGA 3C58A 2VQEM 3SFZA 1WJ7A 1V34A 2Q2EB 4OU7A 1C7YA 4M0DA 3FTFA 3K2LA 3PNVA 4IBGA 1TDZA 3SC3A 4XBOA 2CFOA 4P16A 3D8BA 4I4LA 3J80S 3A46A 3ZH9B 4JI8M 1IN4A 2F5PA 3FUTA 4LF6M 2QENA 3U6MA 1G8PA 3HHXA 3HX3A 4G4QA 3VK8A 4L78A 1N36M 1XC8A 2APLA 1K3XA 1KFVA 4DR5M 1WR1B 1R4GA 3FTEA 1IBLM 1UM8A 1E9SA 1AUAA 3LCUA 4L4UA 3FYCA 3SYKA 4IBCA 2CV2A 3VKHA 1EIJA 4MGHA 3HU1A 1TH2A 3L26A 3L2AA 1L1TA 2LTUA 5EXPA 2QBYA 1VEKA 2ZBKB 4DR4M 1Z5AA 1SXJE 5EXTA 4LJ5A 2C96A 5GKNA 3T15A 4AI6A 3FE3A 1NNUC 4GHAA 1PRBA 3B74A 4DV7M 1AIPC 3GLIB 2JP7A 4R7GA 3CGWA 4CISA 4LRTA 4XK8F 2JUJA 2EKKA 5EP4A 1IBKM 3U60B 1H6UA 4IIWA 2JZ0A 3A42A 2Y20A 1QDRA 1QZMA 3U6QA 2LBCA 1ZMUA 2KNZA 2YQZA 3T38A 2DAGA 4B08A 5KQDA 4DV3M 1NNJA 3J2PB 3K92A 4JN6A 3TE6A 1DGHA 3B7QA 5FTJA 2DWMA 5EQTA 7CATA 1V92A 1L1ZA 4AKGA 5FSWA 3LQQA 4G4RA 4QOZC 1SXJB 4KHPM 2JNHA 4HLQA 5BPVA 5ITUA 1S3SA 4WW0A 4A3VB 3K1JA 3GLFA 4DR6M 2BJWA 4GKKM 4GHLA 4B7GA 3GLHB 1XXHA 2V6ZM 3EIHA 3KOWE 4X64M 1Y8GA 1L2CA 1MU5A 2Z4RA 3CF2A 2XF3A 1X37A 1VEGA 4UN2B 2GQFA 5JI3E 4DV1M 4LY6A 4I8OA 3HKPA 4PCZA 1QUSA 4LFCM 2F5NA 5KQ8A 2Y21A 3C9PA 1K82A 3VDPA 4ZPXA 2RKOA 1WHCA 5IREB 3I51A 2LVOC
chains in the Genus database with same CATH topology
2Z3XA 4LJ6A 4DR1M 4MH0E 1YUBA 3J81S 4FCWA 5ITXA 4PD2A 3VK7A 2CHGA 3TPZA 5ITTA 8CATA 1ZQ9A 1NSFA 4FCVA 4LJ4A 4PT5A 2R46A 3WHKA 1E94E 3GPPA 1JR3A 3HHZA 3SATA 4AZFA 4AKHA 3UZUA 1WXQA 2ZANA 2YR0A 2OPFA 2G8LA 4FCTA 4YHHM 1IN5A 2C9CA 4IJFA 4S12A 3SYLA 1IN7A 1HR0M 2A5YB 3TQSA 4LZZA 2D7EA 2XFTA 3U5ZA 3A98B 4JI4M 2C9OA 1HQCA 2LXEA 4QHSA 3R8FA 1HNXM 2RGOA 3MK6A 4CGYB 3J27B 1I94M 5A2QS 1YSYA 1QAQA 4D82A 3LVWA 2X49A 3ILKA 3U6LA 4LJ7A 1EE8A 4QOSA 5IZ7D 1G59A 2F5QA 1G4AE 4MB7A 3H4MA 2UUBM 5EP1A 4OVZA 3PFIA 4LFAM 3SBJA 4JI7M 4IBJA 5E6JA 3J7BA 1Z59A 2DZNB 4LCBA 4M9ZA 3J7AS 3M0EA 1IY0A 1G41A 4HL4A 2XEPA 4NXNM 1HNWM 3SHFA 1XNRM 2C98A 4RF1A 4II7A 2DXIA 1DGHB 4MGZE 3MJ5A 4MGKE 4FD2A 4AG6A 2UXDM 5ITXE 2BNKA 2M5ZA 4KLNA 2EA0A 1XWIA 3FUXA 1TH4A 3GO8A 3RFWA 2Y0QA 2KW0A 2LWXA 4LZJA 3GLFB 4X66M 2UUAM 4LFBM 3THGA 1XXHB 1GL7A 5FLXS 3CTWB 2VIIA 1K3WA 3KSXA 5KPRA 4AW4A 3Q8XA 3QWLA 2CE7A 1SXJD 4MGIE 4CHTB 4KO8A 3HJSA 1PM5A 1G3IA 3E9SA 1Z5CA 3U6DA 3U6CA 3GQ5A 1DO2A 2LH0A 1R7RA 2E5LM 3KP1E 1Q39A 3M7GA 2ZM6M 4IBEA 3FUUA 4IBIA 1JQJC 1QAMA 3LVVA 4DV4M 4NOOB 3KOYE 3NWLA 3QAUA 1N33M 3FD9A 4KODA 1N78A 2YNMD 3M6AA 4FW9A 4LF9M 1DO0A 1GVNA 3W0FA 2KZUA 1NJFA 2QCUA 4M9XA 4X62M 2UUCM 3GRRA 1XMQM 5ITYA 3GP1A 4NRWA 3VFDA 3U6EA 3HHWA 4L16A 1KSFX 3U5ZB 3KVWA 1TDHA 4NSOB 5ITQA 5IWAM 4RNAA 3DA1A 4B3RM 4QNRA 1I4WA 3GRYA 3KOXE 5ITRA 4GKJM 3UK6A 5C1BA 3GQ3A 3SAUA 2ZAMA 5EXXA 4AG5A 2CEAA 2XGNA 3SAWA 3DOAA 2XSZA 4K0KM 2RGHA 3GLGA 3KSJA 4IBBA 3T1YM 1YE9A 4FWHA 1R2YA 1Z6TA 4REZA 5EP3A 3TWLA 2KEBA 3KOZE 4G4OA 3VLFB 3GRUA 1W5SA 1FNNA 4LJAA 4MGYE 4NRVA 4LF7M 4FVMA 2X4AA 4PDGA 3KS8A 1HT2E 3I4YA 2DWNA 3SARA 1QVRA 4M9SA 1PJJA 2KA6B 3KP0E 4L8RC 2NQ8C 1J5EM 1IY1A 2L09A 4DR7M 4B7HA 2DHRA 3B9PA 4Z8XA 1IY2A 5DYIA 2EUCA 3I4VA 1NJGA 2FE8A 3NBIA 2XLJA 2QP9X 3SASA 3AKZA 5KO3A 4X65M 2KZSA 3LMMA 4LG2A 3HU3A 2UU9M 1OFHA 2R18A 4LGMA 2UXBM 5LMUM 2V1UA 3JAMS 2F5SA 1IXSB 3EIEA 3DFZA 1J7KA 1NHGC 1Q3BA 3VDUA 1DGBA 2QBYB 5H37D 1IM2A 3AJIB 1XNQM 3GRVA 1D2NA 3RGSA 4IBDA 2R4EA 1KYIA 3KFUG 3AV0A 2F4VM 1NY6A 4FWDA 2VQFM 4DUZM 2DZOB 1JR3D 1NY5A 1VDDA 2J7NA 3GPUA 3CF0A 1FJGM 3DZDA 2I7NA 3RE8A 3UMMA 4JI2M 2DWZB 3KDSE 3UJNA 3E4RA 4OW0A 4B3TM 1QQWA 2C99A 5EJCA 1ORYB 2DVWB 4D81A 2FFJA 1SXJA 3L28A 4DR3M 4GC9A 3TL4X 1R2ZA 2W82A 4JYAM 2Z4SA 4DV0M 3HJQA 1R6BX 3GLGB 1GLNA 2EO2A 2M60A 1HQYE 3PVSA 4R3DA 3SMSA 5C18A 4DV5M 4NSRA 4IJEA 3W0LB 1SXJC 4BBAA 2H1RA 3U6PA 2LNHC 3FTDA 3GQ4A 2HKJA 4JI1M 2YFQA 2R62A 2D7GA 4JXJA 2V1CA 2ZAOA 1C1KA 2AHMA 4BLCA 5DNYA 2FOIC 3IG5A 4AQYM 3AOEA 2L7HA 4W5WA 4DV6M 4G4NA 3KS4A 1L2DA 2P5TA 1IXZA 2OQ4A 3VKGA 3L29A 2XH9A 3D8LA 1TGUA 2CHQA 1IN6A 2L7IA 3FYDA 3UGJA 5FTNA 3U6OA 3AOEC 5DYGA 3U61A 3FKEA 3TWMA 4DV2M 3AOGA 1IN8A 1N75A 2HL7A 4G6ZA 1IXRC 3PNYA 1N32M 1N34M 3JR5A 4B3SM 3LQRA 1OFIA 1J09A 5KPTA 2ERCA 3PXGA 2Z7JA 2JA2A 1TH3A 3ZC7B 2QPAA 4OVZB 3GPXA 1T3TA 5E26A 3IG8A 2F5OA 2O5RA 3FUVA 4JI0M 2R45A 4XGIA 1QYRA 4GIPA 4JI6M 2DWLA 2KRKA 1IQPA 3SHGB 4L15A 4LRSA 1E32A 4YY3M 1HNZM 4FWGA 4EIWA 1L2BA 3HJ8A 4GMQA 4LJ9A 4IBFA 4LGYA 3JR4A 3WHLA 1OJLA 4I81A 3KXEC 3MHVC 4GH9A 3T1HM 3GPYA 2D7HA 2L6OA 4LF5M 2FNAA 4NL4H 2XZFA 4LJ8A 2XZUA 2KRUA 2K47A 4I5SA 4Z6YA 1N77A 2UXCM 4MM3B 2XSZD 2CUZA 1LV7A 4WURA 1XHBA 1ZAEA 2R65A 1L8QA 1DGFA 5JI2E 4DUYM 2XFSA 4GC5A 3FTCA 3R9XB 3RGPA 5FTLA 5EXSA 2HHHM 1W5TA 5EP2A 3HU2A 4ITQA 2X8AA 1PJIA 4JI5M 3FUWA 4DR2M 2R4JA 5IT9S 3TWKA 3HHYA 3A45A 3ZCBB 3OTOM 5KPZA 3KW6A 2Y0TA 3GLIA 3L27A 4BB9A 2I7PA 5LMNM 2CHVA 3U60A 3AL0C 4GITA 2C5RA 1Z5BA 2QZ4A 3U61B 2HCBA 4LF4M 4TUWA 3HWSA 5FTKA 1GKIA 4OX9M 4IBKA 3U6SA 1IBMM 4AKIA 4NXMM 4RF0A 4QHTA 2CV1A 3HGIA 4B7FA 4GRIA 4PDIA 3K8ZA 3GLHA 2KXEA 5BR8M 3SAVA 4JI3M 1NHWC 3L25A 3CF6E 1QAOA 4QNMA 4M0WA 2J7OA 1HT1E 4B3MM 1Q3CA 1E9RA 1GL6A 3AFHA 1NVMA 5F3WA 3BOSA 1XMOM 3SMPA 2BJVA 1MX0A 2G5GX 4LF8M 5FTMA 4D80A 4JV5M 2CV0A 1QANA 1DGGA 3C58A 2VQEM 3SFZA 2Q2EB 4OU7A 4M0DA 3FTFA 3K2LA 3PNVA 4IBGA 1TDZA 3SC3A 4XBOA 2CFOA 4P16A 3D8BA 4I4LA 3J80S 3A46A 3ZH9B 4JI8M 1IN4A 2F5PA 3FUTA 4LF6M 2QENA 3U6MA 1G8PA 3HHXA 4G4QA 3VK8A 4L78A 1N36M 1XC8A 1K3XA 1KFVA 4DR5M 3FTEA 1IBLM 1UM8A 1E9SA 4L4UA 3FYCA 3SYKA 4IBCA 2CV2A 3VKHA 4MGHA 3HU1A 1TH2A 3L26A 3L2AA 1L1TA 5EXPA 2QBYA 2ZBKB 4DR4M 1Z5AA 1SXJE 5EXTA 4LJ5A 2C96A 5GKNA 3T15A 4AI6A 1NNUC 4GHAA 4DV7M 3GLIB 4R7GA 4CISA 4LRTA 5EP4A 1IBKM 3U60B 1H6UA 4IIWA 3A42A 2Y20A 1QZMA 3U6QA 3T38A 2YQZA 4B08A 5KQDA 4DV3M 1NNJA 3J2PB 3K92A 4JN6A 3TE6A 1DGHA 5FTJA 2DWMA 5EQTA 7CATA 1L1ZA 4AKGA 5FSWA 3LQQA 4G4RA 4QOZC 1SXJB 4KHPM 5BPVA 4HLQA 5ITUA 1S3SA 4WW0A 4A3VB 3K1JA 3GLFA 4DR6M 2BJWA 4GKKM 4GHLA 4B7GA 3GLHB 1XXHA 2V6ZM 3EIHA 3KOWE 4X64M 1L2CA 1MU5A 2Z4RA 3CF2A 2XF3A 1X37A 5JI3E 4DV1M 4LY6A 4I8OA 3HKPA 4PCZA 4LFCM 2F5NA 5KQ8A 2Y21A 1K82A 3VDPA 4ZPXA 2RKOA 5IREB 3I51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKJ A;  5ITQ A;  4DR1 M;  4JI1 M;  5IWA M;  3J81 S;  5ITX A;  4PD2 A;  3VK7 A;  4OX9 M;  5ITT A;  3U6S A;  4B3R M;  1IBM M;  4NXM M;  4GKJ M;  5ITR A;  3GPP A;  3GQ3 A;  3SAU A;  3SAT A;  4AQY M;  3SAW A;  4PDI A;  3DOA A;  4DV6 M;  4G4N A;  5BR8 M;  4K0K M;  1L2D A;  2OQ4 A;  3SAV A;  4JI3 M;  2OPF A;  4YHH M;  4B3M M;  1Q3C A;  3T1Y M;  1R2Y A;  1HR0 M;  3TWL A;  4G4O A;  1XMO M;  3U6O A;  1TDH A;  4NRV A;  4JI4 M;  4LF7 M;  3TWM A;  1MX0 A;  4DV2 M;  1HNX M;  4LF8 M;  4JV5 M;  4PDG A;  3C58 A;  2VQE M;  3SAR A;  1I94 M;  5A2Q S;  1N32 M;  1N34 M;  2Q2E B;  3JR5 A;  1PJJ A;  1TDZ A;  3U6L A;  4B3S M;  1J5E M;  1EE8 A;  2F5Q A;  4MB7 A;  2UUB M;  3J80 S;  3A46 A;  4DR7 M;  4LFA M;  2F5P A;  3GPX A;  4JI8 M;  4LF6 M;  3U6M A;  4G4Q A;  3SBJ A;  3VK8 A;  4JI7 M;  1N36 M;  1Z59 A;  1XC8 A;  2F5O A;  1K3X A;  3SAS A;  1KFV A;  4DR5 M;  4JI0 M;  4NXN M;  3J7A S;  1HNW M;  4X65 M;  1XNR M;  1IBL M;  2UU9 M;  4JI6 M;  2UXB M;  5LMU M;  3JAM S;  2F5S A;  4YY3 M;  1HNZ M;  2UXD M;  5ITX E;  2EA0 A;  1L2B A;  1L1T A;  1Q3B A;  3GO8 A;  2ZBK B;  4DR4 M;  1Z5A A;  4X66 M;  1XNQ M;  2UUA M;  4LFB M;  3JR4 A;  5FLX S;  1K3W A;  4DV7 M;  3GPY A;  3T1H M;  2F4V M;  2VQF M;  4DUZ M;  4CIS A;  4LF5 M;  2XZF A;  1IBK M;  2XZU A;  1PM5 A;  3A42 A;  3GPU A;  1FJG M;  2UXC M;  3U6Q A;  4JI2 M;  4DV3 M;  1NNJ A;  1Z5C A;  3U6D A;  3U6C A;  3GQ5 A;  4B3T M;  4DUY M;  2E5L M;  1L1Z A;  1Q39 A;  2ZM6 M;  2HHH M;  4G4R A;  4DR3 M;  4KHP M;  5ITU A;  4ITQ A;  1R2Z A;  4DR6 M;  4DV4 M;  1PJI A;  4JI5 M;  4DR2 M;  4GKK M;  1N33 M;  5IT9 S;  3TWK A;  3A45 A;  3OTO M;  4X64 M;  4LF9 M;  4JYA M;  4DV0 M;  3W0F A;  1L2C A;  1MU5 A;  4X62 M;  2UUC M;  1XMQ M;  5ITY A;  4DV5 M;  3GP1 A;  4NRW A;  4DV1 M;  4PCZ A;  5LMN M;  4LFC M;  2F5N A;  3U6E A;  1K82 A;  1Z5B A;  3U6P A;  3GQ4 A;  4LF4 M; 
#chains in the Genus database with same CATH topology
 2Z3X A;  4LJ6 A;  4DR1 M;  4MH0 E;  1YUB A;  3J81 S;  4FCW A;  2MR9 A;  5ITX A;  4PD2 A;  3VK7 A;  2CHG A;  3TPZ A;  4Q7J A;  5ITT A;  8CAT A;  1ZQ9 A;  1NSF A;  2VF8 A;  4FCV A;  4LJ4 A;  2UUC M;  1R5L A;  4PT5 A;  2R46 A;  3WHK A;  1E94 E;  3GPP A;  1JR3 A;  2LVN C;  3HHZ A;  3SAT A;  1GJS A;  2N35 A;  4AZF A;  4AKH A;  3UZU A;  1WXQ A;  2ZAN A;  2YR0 A;  2OPF A;  2KNA A;  2G8L A;  4FCT A;  4YHH M;  1IN5 A;  2C9C A;  4IJF A;  4S12 A;  3SYL A;  4ANR A;  1IN7 A;  1HR0 M;  2A5Y B;  3TQS A;  4LZZ A;  2D7E A;  2XFT A;  3U5Z A;  3A98 B;  4JI4 M;  2C9O A;  1HQC A;  2LXE A;  2K0B X;  4QHS A;  3R8F A;  1HNX M;  1OAI A;  2RGO A;  3MK6 A;  4CGY B;  2LVQ D;  4F2L A;  3J27 B;  1I94 M;  5A2Q S;  1YSY A;  1GJT A;  1QAQ A;  3LVW A;  4D82 A;  2X49 A;  3ILK A;  3U6L A;  2G3Q A;  4LJ7 A;  1EE8 A;  4QOS A;  5IZ7 D;  4DBG B;  1G59 A;  1MJG M;  2F5Q A;  1G4A E;  2JZ1 A;  3H4M A;  4MB7 A;  2UUB M;  5EP1 A;  1ZV1 A;  3PFI A;  4OVZ A;  4LFA M;  3SBJ A;  4JI7 M;  4IBJ A;  5E6J A;  3J7B A;  1BVS A;  1Z59 A;  2DZN B;  4LCB A;  4M9Z A;  3J7A S;  3M0E A;  1IY0 A;  1G41 A;  1NV8 A;  2JY5 A;  2WSC F;  2XEP A;  4HL4 A;  4NXN M;  3SHF A;  1HNW M;  1XNR M;  2C98 A;  1DV0 A;  4RF1 A;  4II7 A;  2DXI A;  2MGW A;  1DGH B;  4MGZ E;  1OQY A;  3MJ5 A;  4MGK E;  4FD2 A;  1P3Q Q;  4AG6 A;  2UXD M;  5ITX E;  2BNK A;  2M5Z A;  4KLN A;  2EA0 A;  1XWI A;  2QNJ A;  3FUX A;  1TH4 A;  3C3E A;  3GO8 A;  3RFW A;  2Y0Q A;  2JWS A;  2KW0 A;  2LWX A;  4LZJ A;  3GLF B;  4X66 M;  2Z8Y M;  1JR3 E;  2GNO A;  3THG A;  3V76 A;  2UUA M;  4LFB M;  1XXH B;  1GL7 A;  5FLX S;  3CTW B;  2VII A;  1K3W A;  1G71 A;  3KSX A;  5KPR A;  4AW4 A;  3Q8X A;  3QWL A;  2CE7 A;  1SXJ D;  4MGI E;  2HAK A;  4CHT B;  4KO8 A;  3HJS A;  3GLI E;  1PM5 A;  1RU3 A;  1VG5 A;  1G3I A;  3E9S A;  1Z5C A;  2ZTD A;  2LHC A;  3GQ5 A;  3U6D A;  3U6C A;  1DO2 A;  1HJP A;  2DKL A;  2EJS A;  1IXS A;  1PJT A;  4P17 A;  2LH0 A;  1R7R A;  2E5L M;  3KP1 E;  1Q39 A;  3K9O A;  2OOB A;  3M7G A;  1D0M A;  4HEO A;  2ZM6 M;  1MN3 A;  1V33 A;  4IBE A;  3FUU A;  4IBI A;  1JQJ C;  1QAM A;  3LVV A;  4DV4 M;  4NOO B;  3KOY E;  3NWL A;  3QAU A;  1N33 M;  3FD9 A;  4KOD A;  1YLA A;  2YNM D;  3M6A A;  4FW9 A;  1N78 A;  4LF9 M;  1DO0 A;  1GVN A;  3I01 M;  3W0F A;  2KZU A;  1NJF A;  1SG9 A;  1PJQ A;  2QCU A;  4M9X A;  3GLH E;  3BBZ A;  3GRR A;  4X62 M;  5ITY A;  1XMQ M;  3GP1 A;  4NRW A;  2JY8 A;  3VFD A;  3T6P A;  3U6E A;  3E46 A;  3HHW A;  3HZJ A;  3B89 A;  3HY5 A;  4L16 A;  1KSF X;  3U5Z B;  3KVW A;  1TDH A;  4NSO B;  5ITQ A;  5IWA M;  4RNA A;  3DA1 A;  4B3R M;  4QNR A;  1I4W A;  3GRY A;  3KOX E;  5ITR A;  2KDL A;  4GKJ M;  3UK6 A;  5C1B A;  1QUT A;  3GQ3 A;  2ZAM A;  3SAU A;  5EXX A;  2DAE A;  2CEA A;  2H5X A;  3F92 A;  2XGN A;  4KT0 F;  4AG5 A;  3SAW A;  3DOA A;  1CUK A;  2XSZ A;  4K0K M;  2QSF X;  2RGH A;  3GLG A;  3KSJ A;  4IBB A;  3T1Y M;  1YE9 A;  4FWH A;  1R2Y A;  1Z6T A;  3H4J A;  4REZ A;  5EP3 A;  3TWL A;  2KEB A;  3KOZ E;  1Q02 A;  3VLF B;  2FS1 A;  2J5Y A;  3GRU A;  1W5S A;  4G4O A;  1FNN A;  4LJA A;  3ZQJ A;  4MGY E;  4NRV A;  4LF7 M;  2JY6 B;  4FVM A;  2X4A A;  4PDG A;  3KS8 A;  1HT2 E;  1PGY A;  2JY7 A;  2HWJ A;  3I4Y A;  2DWN A;  3SAR A;  1QVR A;  4M9S A;  1PJJ A;  2EKF A;  2K6B A;  2KA6 B;  3KP0 E;  4L8R C;  2NQ8 C;  1J5E M;  2DI0 A;  1IFY A;  1IY1 A;  2L09 A;  4DR7 M;  4B7H A;  2DHR A;  3B9P A;  4Z8X A;  1IY2 A;  3K9P A;  5DYI A;  2EUC A;  3I4V A;  1NJG A;  2FE8 A;  3NBI A;  2XLJ A;  2BWE A;  2QP9 X;  3AKZ A;  3SAS A;  5KO3 A;  4X65 M;  2KZS A;  3LMM A;  4LG2 A;  3HU3 A;  2QHO B;  1UFZ A;  2MRO B;  2UU9 M;  2MJ5 B;  1OFH A;  2R18 A;  4LGM A;  2UXB M;  5LMU M;  2V1U A;  3JAM S;  2F5S A;  1IXS B;  1D0L A;  2CP8 A;  3EIE A;  1OIP A;  2O25 A;  3DFZ A;  1J7K A;  1NHG C;  1Q3B A;  3VDU A;  2KNV A;  1DGB A;  2QBY B;  5H37 D;  1IM2 A;  3AJI B;  1XNQ M;  1TR8 A;  3GRV A;  1D2N A;  3LCV B;  3I04 M;  3RGS A;  3FRI A;  4IBD A;  2CWB A;  3GLF E;  2LVA A;  2R4E A;  1KYI A;  3KFU G;  1VQ1 A;  3AV0 A;  2F4V M;  1NY6 A;  1XXH E;  4FWD A;  2VQF M;  4DUZ M;  2DZO B;  2OO9 A;  1JR3 D;  4CIZ A;  1GAB A;  1NY5 A;  1VDD A;  2CRU A;  2J7N A;  3GPU A;  3CF0 A;  1FJG M;  1TTE A;  2I7N A;  3DZD A;  3RE8 A;  3UMM A;  4JI2 M;  2DWZ B;  3KDS E;  1F4I A;  2R44 A;  3UJN A;  3E4R A;  4OW0 A;  4B3T M;  1QQW A;  1OAO C;  2C99 A;  1OKS A;  5EJC A;  1ORY B;  2DVW B;  4D81 A;  2FFJ A;  4NC6 A;  2DNA A;  1VEJ A;  2VDB B;  1SXJ A;  2JXN A;  3L28 A;  4R71 A;  4DR3 M;  4RKU F;  4GC9 A;  2L2D A;  3TL4 X;  1R2Z A;  2WSF F;  1PJS A;  2W82 A;  4JYA M;  2Z4S A;  4DV0 M;  3HJQ A;  1R6B X;  3GLG B;  1GLN A;  2EO2 A;  2M60 A;  1HQY E;  3PVS A;  2DHY A;  4R3D A;  3SMS A;  5C18 A;  4DV5 M;  4NSR A;  4IJE A;  3W0L B;  1SXJ C;  4BBA A;  2H1R A;  3U6P A;  2BWB A;  2LNH C;  3FTD A;  3GQ4 A;  2B3T A;  2HKJ A;  4JI1 M;  2YFQ A;  2R62 A;  2D7G A;  1ZMV A;  2V1C A;  4JXJ A;  2ZAO A;  1C1K A;  2AHM A;  4BLC A;  2O01 F;  5DNY A;  3IEC A;  2FOI C;  3IG5 A;  4AQY M;  3AOE A;  2KHH A;  2L7H A;  4W5W A;  2DZL A;  4DV6 M;  4G4N A;  1QDT A;  2L4F A;  3KS4 A;  3NBX X;  1L2D A;  3E21 A;  2P5T A;  1IXZ A;  2OQ4 A;  3VKG A;  3L29 A;  3QYB A;  3W68 A;  2XH9 A;  3D8L A;  1TGU A;  2CHQ A;  1IN6 A;  2DEN A;  2L7I A;  3FYD A;  3UGJ A;  5FTN A;  2DAI A;  3U6O A;  3AOE C;  5DYG A;  3U61 A;  1GO5 A;  3FKE A;  3TWM A;  4DV2 M;  3AOG A;  2WZJ A;  1IN8 A;  1JB0 F;  1N75 A;  2HL7 A;  3QYE A;  4WP2 A;  4G6Z A;  2K9D A;  1NO1 A;  5DFL A;  1IXR C;  3PNY A;  1N32 M;  1N34 M;  3JR5 A;  3MMP A;  3B7Z A;  4B3S M;  3LQR A;  1OFI A;  1J09 A;  5KPT A;  1TF0 B;  2ERC A;  3PXG A;  2Z7J A;  2JA2 A;  1TH3 A;  3ZC7 B;  2QPA A;  4OVZ B;  3GPX A;  3IHP A;  1T3T A;  1VDL A;  5E26 A;  3IG8 A;  2F5O A;  2O5R A;  3FUV A;  4JI0 M;  2R45 A;  4XGI A;  1QYR A;  4GIP A;  3W67 A;  4F1I A;  2L4E A;  4JI6 M;  2DWL A;  2KRK A;  1IQP A;  3SHG B;  2LHG A;  1A5T A;  4L15 A;  4LRS A;  1E32 A;  4YY3 M;  1HNZ M;  1OTR A;  4FWG A;  4EIW A;  1L2B A;  3HJ8 A;  4L6V 6;  2WSE F;  4GMQ A;  4LJ9 A;  4IBF A;  4LGY A;  3JR4 A;  3WHL A;  1OJL A;  4I81 A;  3KXE C;  3MHV C;  1T43 A;  4GH9 A;  3T1H M;  3GPY A;  2D7H A;  2L6O A;  4LF5 M;  2FNA A;  2DAK A;  4NL4 H;  2XZF A;  4LJ8 A;  2XZU A;  2KRU A;  2K47 A;  4I5S A;  4Z6Y A;  1N77 A;  2UXC M;  4MM3 B;  2XSZ D;  2CUZ A;  1LV7 A;  4G3O A;  2DAM A;  4WUR A;  1WGL A;  1XHB A;  1QZE A;  1ZAE A;  1L8Q A;  1DGF A;  2R65 A;  5JI2 E;  3Q8G A;  4DUY M;  2XFS A;  4CJ6 A;  4GC5 A;  3FTC A;  3R9X B;  3RGP A;  5FTL A;  5EXS A;  3LW5 F;  1W5T A;  2OOA A;  2HHH M;  5EP2 A;  3HU2 A;  1D0K A;  1T6O A;  2RRU A;  3B7N A;  2X8A A;  2R6F A;  4ITQ A;  1WGN A;  1PJI A;  4JI5 M;  3FUW A;  3C3D A;  2R4J A;  4DR2 M;  5IT9 S;  3TWK A;  3HHY A;  3A45 A;  3ZCB B;  3OTO M;  3BXW A;  5KPZ A;  3KW6 A;  2Y0T A;  3GLI A;  3L27 A;  4BB9 A;  2I7P A;  2FH0 A;  2LVP C;  3GLG E;  5LMN M;  2CHV A;  3U60 A;  3AL0 C;  2ZTC A;  4GIT A;  2C5R A;  1Z5B A;  2MH8 A;  2QZ4 A;  3U61 B;  2HCB A;  4LF4 M;  4TUW A;  3HWS A;  5FTK A;  1GKI A;  4Y28 F;  4OX9 M;  4IBK A;  5L8R F;  3U6S A;  1IBM M;  1NV9 A;  1XB2 B;  4AKI A;  4NXM M;  4RF0 A;  4QHT A;  2CV1 A;  3HGI A;  4B7F A;  4GRI A;  1LTM A;  2QQ8 A;  4PDI A;  3K8Z A;  3GLH A;  2KXE A;  1EFU B;  2R0I A;  5BR8 M;  3SAV A;  4JI3 M;  1NHW C;  2VF7 A;  3L25 A;  3CF6 E;  1QAO A;  4QNM A;  4M0W A;  2J7O A;  1HT1 E;  4B3M M;  1Q3C A;  1E9R A;  1GL6 A;  1WIV A;  3AFH A;  3FRH A;  1NVM A;  5F3W A;  3BOS A;  1XMO M;  4GEW A;  3SMP A;  1ZMW A;  2BJV A;  1MX0 A;  1OIZ A;  2G5G X;  4LF8 M;  5FTM A;  4D80 A;  4JV5 M;  2CV0 A;  1QAN A;  1DGG A;  3C58 A;  2VQE M;  3SFZ A;  1WJ7 A;  1V34 A;  2Q2E B;  4OU7 A;  1C7Y A;  4M0D A;  3FTF A;  3K2L A;  3PNV A;  4IBG A;  1TDZ A;  3SC3 A;  4XBO A;  2CFO A;  4P16 A;  3D8B A;  4I4L A;  3J80 S;  3A46 A;  3ZH9 B;  4JI8 M;  1IN4 A;  2F5P A;  3FUT A;  4LF6 M;  2QEN A;  3U6M A;  1G8P A;  3HHX A;  3HX3 A;  4G4Q A;  3VK8 A;  4L78 A;  1N36 M;  1XC8 A;  2APL A;  1K3X A;  1KFV A;  4DR5 M;  1WR1 B;  1R4G A;  3FTE A;  1IBL M;  1UM8 A;  1E9S A;  1AUA A;  3LCU A;  4L4U A;  3FYC A;  3SYK A;  4IBC A;  2CV2 A;  3VKH A;  1EIJ A;  4MGH A;  3HU1 A;  1TH2 A;  3L26 A;  3L2A A;  1L1T A;  2LTU A;  5EXP A;  2QBY A;  1VEK A;  2ZBK B;  4DR4 M;  1Z5A A;  1SXJ E;  5EXT A;  4LJ5 A;  2C96 A;  5GKN A;  3T15 A;  4AI6 A;  3FE3 A;  1NNU C;  4GHA A;  1PRB A;  3B74 A;  4DV7 M;  1AIP C;  3GLI B;  2JP7 A;  4R7G A;  3CGW A;  4CIS A;  4LRT A;  4XK8 F;  2JUJ A;  2EKK A;  5EP4 A;  1IBK M;  3U60 B;  1H6U A;  4IIW A;  2JZ0 A;  3A42 A;  2Y20 A;  1QDR A;  1QZM A;  3U6Q A;  2LBC A;  1ZMU A;  2KNZ A;  2YQZ A;  3T38 A;  2DAG A;  4B08 A;  5KQD A;  4DV3 M;  1NNJ A;  3J2P B;  3K92 A;  4JN6 A;  3TE6 A;  1DGH A;  3B7Q A;  5FTJ A;  2DWM A;  5EQT A;  7CAT A;  1V92 A;  1L1Z A;  4AKG A;  5FSW A;  3LQQ A;  4G4R A;  4QOZ C;  1SXJ B;  4KHP M;  2JNH A;  4HLQ A;  5BPV A;  5ITU A;  1S3S A;  4WW0 A;  4A3V B;  3K1J A;  3GLF A;  4DR6 M;  2BJW A;  4GKK M;  4GHL A;  4B7G A;  3GLH B;  1XXH A;  2V6Z M;  3EIH A;  3KOW E;  4X64 M;  1Y8G A;  1L2C A;  1MU5 A;  2Z4R A;  3CF2 A;  2XF3 A;  1X37 A;  1VEG A;  4UN2 B;  2GQF A;  5JI3 E;  4DV1 M;  4LY6 A;  4I8O A;  3HKP A;  4PCZ A;  1QUS A;  4LFC M;  2F5N A;  5KQ8 A;  2Y21 A;  3C9P A;  1K82 A;  3VDP A;  4ZPX A;  2RKO A;  1WHC A;  5IRE B;  3I51 A;  2LVO C; 
#chains in the Genus database with same CATH homology
 2Z3X A;  4LJ6 A;  4DR1 M;  4MH0 E;  1YUB A;  3J81 S;  4FCW A;  5ITX A;  4PD2 A;  3VK7 A;  2CHG A;  3TPZ A;  5ITT A;  8CAT A;  1ZQ9 A;  1NSF A;  4FCV A;  4LJ4 A;  4PT5 A;  2R46 A;  3WHK A;  1E94 E;  3GPP A;  1JR3 A;  3HHZ A;  3SAT A;  4AZF A;  4AKH A;  3UZU A;  1WXQ A;  2ZAN A;  2YR0 A;  2OPF A;  2G8L A;  4FCT A;  4YHH M;  1IN5 A;  2C9C A;  4IJF A;  4S12 A;  3SYL A;  1IN7 A;  1HR0 M;  2A5Y B;  3TQS A;  4LZZ A;  2D7E A;  2XFT A;  3U5Z A;  3A98 B;  4JI4 M;  2C9O A;  1HQC A;  2LXE A;  4QHS A;  3R8F A;  1HNX M;  2RGO A;  3MK6 A;  4CGY B;  3J27 B;  1I94 M;  5A2Q S;  1YSY A;  1QAQ A;  4D82 A;  3LVW A;  2X49 A;  3ILK A;  3U6L A;  4LJ7 A;  1EE8 A;  4QOS A;  5IZ7 D;  1G59 A;  2F5Q A;  1G4A E;  4MB7 A;  3H4M A;  2UUB M;  5EP1 A;  4OVZ A;  3PFI A;  4LFA M;  3SBJ A;  4JI7 M;  4IBJ A;  5E6J A;  3J7B A;  1Z59 A;  2DZN B;  4LCB A;  4M9Z A;  3J7A S;  3M0E A;  1IY0 A;  1G41 A;  4HL4 A;  2XEP A;  4NXN M;  1HNW M;  3SHF A;  1XNR M;  2C98 A;  4RF1 A;  4II7 A;  2DXI A;  1DGH B;  4MGZ E;  3MJ5 A;  4MGK E;  4FD2 A;  4AG6 A;  2UXD M;  5ITX E;  2BNK A;  2M5Z A;  4KLN A;  2EA0 A;  1XWI A;  3FUX A;  1TH4 A;  3GO8 A;  3RFW A;  2Y0Q A;  2KW0 A;  2LWX A;  4LZJ A;  3GLF B;  4X66 M;  2UUA M;  4LFB M;  3THG A;  1XXH B;  1GL7 A;  5FLX S;  3CTW B;  2VII A;  1K3W A;  3KSX A;  5KPR A;  4AW4 A;  3Q8X A;  3QWL A;  2CE7 A;  1SXJ D;  4MGI E;  4CHT B;  4KO8 A;  3HJS A;  1PM5 A;  1G3I A;  3E9S A;  1Z5C A;  3U6D A;  3U6C A;  3GQ5 A;  1DO2 A;  2LH0 A;  1R7R A;  2E5L M;  3KP1 E;  1Q39 A;  3M7G A;  2ZM6 M;  4IBE A;  3FUU A;  4IBI A;  1JQJ C;  1QAM A;  3LVV A;  4DV4 M;  4NOO B;  3KOY E;  3NWL A;  3QAU A;  1N33 M;  3FD9 A;  4KOD A;  1N78 A;  2YNM D;  3M6A A;  4FW9 A;  4LF9 M;  1DO0 A;  1GVN A;  3W0F A;  2KZU A;  1NJF A;  2QCU A;  4M9X A;  4X62 M;  2UUC M;  3GRR A;  1XMQ M;  5ITY A;  3GP1 A;  4NRW A;  3VFD A;  3U6E A;  3HHW A;  4L16 A;  1KSF X;  3U5Z B;  3KVW A;  1TDH A;  4NSO B;  5ITQ A;  5IWA M;  4RNA A;  3DA1 A;  4B3R M;  4QNR A;  1I4W A;  3GRY A;  3KOX E;  5ITR A;  4GKJ M;  3UK6 A;  5C1B A;  3GQ3 A;  3SAU A;  2ZAM A;  5EXX A;  4AG5 A;  2CEA A;  2XGN A;  3SAW A;  3DOA A;  2XSZ A;  4K0K M;  2RGH A;  3GLG A;  3KSJ A;  4IBB A;  3T1Y M;  1YE9 A;  4FWH A;  1R2Y A;  1Z6T A;  4REZ A;  5EP3 A;  3TWL A;  2KEB A;  3KOZ E;  4G4O A;  3VLF B;  3GRU A;  1W5S A;  1FNN A;  4LJA A;  4MGY E;  4NRV A;  4LF7 M;  4FVM A;  2X4A A;  4PDG A;  3KS8 A;  1HT2 E;  3I4Y A;  2DWN A;  3SAR A;  1QVR A;  4M9S A;  1PJJ A;  2KA6 B;  3KP0 E;  4L8R C;  2NQ8 C;  1J5E M;  1IY1 A;  2L09 A;  4DR7 M;  4B7H A;  2DHR A;  3B9P A;  4Z8X A;  1IY2 A;  5DYI A;  2EUC A;  3I4V A;  1NJG A;  2FE8 A;  3NBI A;  2XLJ A;  2QP9 X;  3SAS A;  3AKZ A;  5KO3 A;  4X65 M;  2KZS A;  3LMM A;  4LG2 A;  3HU3 A;  2UU9 M;  1OFH A;  2R18 A;  4LGM A;  2UXB M;  5LMU M;  2V1U A;  3JAM S;  2F5S A;  1IXS B;  3EIE A;  3DFZ A;  1J7K A;  1NHG C;  1Q3B A;  3VDU A;  1DGB A;  2QBY B;  5H37 D;  1IM2 A;  3AJI B;  1XNQ M;  3GRV A;  1D2N A;  3RGS A;  4IBD A;  2R4E A;  1KYI A;  3KFU G;  3AV0 A;  2F4V M;  1NY6 A;  4FWD A;  2VQF M;  4DUZ M;  2DZO B;  1JR3 D;  1NY5 A;  1VDD A;  2J7N A;  3GPU A;  3CF0 A;  1FJG M;  3DZD A;  2I7N A;  3RE8 A;  3UMM A;  4JI2 M;  2DWZ B;  3KDS E;  3UJN A;  3E4R A;  4OW0 A;  4B3T M;  1QQW A;  2C99 A;  5EJC A;  1ORY B;  2DVW B;  4D81 A;  2FFJ A;  1SXJ A;  3L28 A;  4DR3 M;  4GC9 A;  3TL4 X;  1R2Z A;  2W82 A;  4JYA M;  2Z4S A;  4DV0 M;  3HJQ A;  1R6B X;  3GLG B;  1GLN A;  2EO2 A;  2M60 A;  1HQY E;  3PVS A;  4R3D A;  3SMS A;  5C18 A;  4DV5 M;  4NSR A;  4IJE A;  3W0L B;  1SXJ C;  4BBA A;  2H1R A;  3U6P A;  2LNH C;  3FTD A;  3GQ4 A;  2HKJ A;  4JI1 M;  2YFQ A;  2R62 A;  2D7G A;  4JXJ A;  2V1C A;  2ZAO A;  1C1K A;  2AHM A;  4BLC A;  5DNY A;  2FOI C;  3IG5 A;  4AQY M;  3AOE A;  2L7H A;  4W5W A;  4DV6 M;  4G4N A;  3KS4 A;  1L2D A;  2P5T A;  1IXZ A;  2OQ4 A;  3VKG A;  3L29 A;  2XH9 A;  3D8L A;  1TGU A;  2CHQ A;  1IN6 A;  2L7I A;  3FYD A;  3UGJ A;  5FTN A;  3U6O A;  3AOE C;  5DYG A;  3U61 A;  3FKE A;  3TWM A;  4DV2 M;  3AOG A;  1IN8 A;  1N75 A;  2HL7 A;  4G6Z A;  1IXR C;  3PNY A;  1N32 M;  1N34 M;  3JR5 A;  4B3S M;  3LQR A;  1OFI A;  1J09 A;  5KPT A;  2ERC A;  3PXG A;  2Z7J A;  2JA2 A;  1TH3 A;  3ZC7 B;  2QPA A;  4OVZ B;  3GPX A;  1T3T A;  5E26 A;  3IG8 A;  2F5O A;  2O5R A;  3FUV A;  4JI0 M;  2R45 A;  4XGI A;  1QYR A;  4GIP A;  4JI6 M;  2DWL A;  2KRK A;  1IQP A;  3SHG B;  4L15 A;  4LRS A;  1E32 A;  4YY3 M;  1HNZ M;  4FWG A;  4EIW A;  1L2B A;  3HJ8 A;  4GMQ A;  4LJ9 A;  4IBF A;  4LGY A;  3JR4 A;  3WHL A;  1OJL A;  4I81 A;  3KXE C;  3MHV C;  4GH9 A;  3T1H M;  3GPY A;  2D7H A;  2L6O A;  4LF5 M;  2FNA A;  4NL4 H;  2XZF A;  4LJ8 A;  2XZU A;  2KRU A;  2K47 A;  4I5S A;  4Z6Y A;  1N77 A;  2UXC M;  4MM3 B;  2XSZ D;  2CUZ A;  1LV7 A;  4WUR A;  1XHB A;  1ZAE A;  2R65 A;  1L8Q A;  1DGF A;  5JI2 E;  4DUY M;  2XFS A;  4GC5 A;  3FTC A;  3R9X B;  3RGP A;  5FTL A;  5EXS A;  2HHH M;  1W5T A;  5EP2 A;  3HU2 A;  4ITQ A;  2X8A A;  1PJI A;  4JI5 M;  3FUW A;  4DR2 M;  2R4J A;  5IT9 S;  3TWK A;  3HHY A;  3A45 A;  3ZCB B;  3OTO M;  5KPZ A;  3KW6 A;  2Y0T A;  3GLI A;  3L27 A;  4BB9 A;  2I7P A;  5LMN M;  2CHV A;  3U60 A;  3AL0 C;  4GIT A;  2C5R A;  1Z5B A;  2QZ4 A;  3U61 B;  2HCB A;  4LF4 M;  4TUW A;  3HWS A;  5FTK A;  1GKI A;  4OX9 M;  4IBK A;  3U6S A;  1IBM M;  4AKI A;  4NXM M;  4RF0 A;  4QHT A;  2CV1 A;  3HGI A;  4B7F A;  4GRI A;  4PDI A;  3K8Z A;  3GLH A;  2KXE A;  5BR8 M;  3SAV A;  4JI3 M;  1NHW C;  3L25 A;  3CF6 E;  1QAO A;  4QNM A;  4M0W A;  2J7O A;  1HT1 E;  4B3M M;  1Q3C A;  1E9R A;  1GL6 A;  3AFH A;  1NVM A;  5F3W A;  3BOS A;  1XMO M;  3SMP A;  2BJV A;  1MX0 A;  2G5G X;  4LF8 M;  5FTM A;  4D80 A;  4JV5 M;  2CV0 A;  1QAN A;  1DGG A;  3C58 A;  2VQE M;  3SFZ A;  2Q2E B;  4OU7 A;  4M0D A;  3FTF A;  3K2L A;  3PNV A;  4IBG A;  1TDZ A;  3SC3 A;  4XBO A;  2CFO A;  4P16 A;  3D8B A;  4I4L A;  3J80 S;  3A46 A;  3ZH9 B;  4JI8 M;  1IN4 A;  2F5P A;  3FUT A;  4LF6 M;  2QEN A;  3U6M A;  1G8P A;  3HHX A;  4G4Q A;  3VK8 A;  4L78 A;  1N36 M;  1XC8 A;  1K3X A;  1KFV A;  4DR5 M;  3FTE A;  1IBL M;  1UM8 A;  1E9S A;  4L4U A;  3FYC A;  3SYK A;  4IBC A;  2CV2 A;  3VKH A;  4MGH A;  3HU1 A;  1TH2 A;  3L26 A;  3L2A A;  1L1T A;  5EXP A;  2QBY A;  2ZBK B;  4DR4 M;  1Z5A A;  1SXJ E;  5EXT A;  4LJ5 A;  2C96 A;  5GKN A;  3T15 A;  4AI6 A;  1NNU C;  4GHA A;  4DV7 M;  3GLI B;  4R7G A;  4CIS A;  4LRT A;  5EP4 A;  1IBK M;  3U60 B;  1H6U A;  4IIW A;  3A42 A;  2Y20 A;  1QZM A;  3U6Q A;  3T38 A;  2YQZ A;  4B08 A;  5KQD A;  4DV3 M;  1NNJ A;  3J2P B;  3K92 A;  4JN6 A;  3TE6 A;  1DGH A;  5FTJ A;  2DWM A;  5EQT A;  7CAT A;  1L1Z A;  4AKG A;  5FSW A;  3LQQ A;  4G4R A;  4QOZ C;  1SXJ B;  4KHP M;  5BPV A;  4HLQ A;  5ITU A;  1S3S A;  4WW0 A;  4A3V B;  3K1J A;  3GLF A;  4DR6 M;  2BJW A;  4GKK M;  4GHL A;  4B7G A;  3GLH B;  1XXH A;  2V6Z M;  3EIH A;  3KOW E;  4X64 M;  1L2C A;  1MU5 A;  2Z4R A;  3CF2 A;  2XF3 A;  1X37 A;  5JI3 E;  4DV1 M;  4LY6 A;  4I8O A;  3HKP A;  4PCZ A;  4LFC M;  2F5N A;  5KQ8 A;  2Y21 A;  1K82 A;  3VDP A;  4ZPX A;  2RKO A;  5IRE B;  3I51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...