4JIRA

Crystal structure of aldose reductase (akr1b1) complexed with nadp+ and epalrestat
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor selectivity between aldo-keto reductase superfamily members AKR1B10 and AKR1B1: Role of Trp112 (Trp111).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
total genus 109
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2013-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jirA00
3LBOA 4GABA 4QR6A 2DUZA 2DUXA 2J8TA 1UR3M 1YE6A 4LB3A 4NKCA 4WEVX 3UP8A 4ZFCA 4AUBA 2HVOA 3VXGA 4FA3A 3EB3A 2FZDA 1PWMA 2QXWA 3CMFA 4RPQA 2WZTA 4HBKA 2HVNA 3COTA 4JQ3A 4LAZA 4PRRA 2PDLA 1X96A 4JTCA 2PFHA 3Q67A 4JIIX 4L1WA 3M0IA 4ASTA 2WZMA 2ACSA 2IPJA 2VDGA 2INZA 2PD5A 4H7CA 4GCAA 1XF0A 4XK2A 1SM9A 4YVXA 3LN3A 2ACRA 3KRBA 1ZGDA 4JTQA 4FALA 1IEIA 3CV7A 3GHSA 4YVVA 1A80A 3V0UA 2PDUA 2PDXA 2NVDA 3FJNA 1MZRA 3DN5A 2R9RA 3WG6A 2CLPA 3RX4A 4LBSA 4GA8A 4QXIA 3O3RA 4XVEA 2IPWA 3M64A 1Q5MA 4XVDA 1EKOA 2BP1A 2IQDA 3QKZA 1J96A 3UFYA 4IGSA 5JH1A 3R8GA 4LB4A 1LQAA 2HDJA 3RX3A 4XZNX 3M4HA 2PDYA 2HV5A 4PMJA 2I16A 2PF8A 2R24A 4YS1A 2PDFA 5KETA 4H8NA 3BUVA 4JQ2A 2FZ9A 3C3UA 2P5NA 4WDWA 3F7JA 1Q13A 2BGSA 5M2FX 1ADSA 5LIKX 1Z89A 3WBWA 1AH3A 1AZ2A 3CAQA 4EXAA 2ACUA 3D3FA 1PZ1A 3UZXA 4JQ1A 4JQ4A 3LEPA 5DANA 2IQ0A 2PDBA 5HNTA 3R6IA 3LUTA 4ICCX 4WDUA 1HQTA 2PDMA 5HA7A 2NVCA 3WCZA 4JTDA 3DOPA 3CV6A 4Q7BA 2IKIA 2PDCA 4G5DA 4DBWA 4FAMA 5AZ0A 4DBUA 1X98A 4PR4A 3RX2A 3GHUA 1AH0A 4HMNA 1AFSA 1MI3A 1YNQA 1S2AA 1PZ0A 3G1RA 1IHIA 4LBRA 2ISFA 5JH2A 1ZQ5A 1EL3A 3BURA 3LZ5A 5LIWX 3R94A 3S3GA 1YE4A 3V35A 4DZ5A 1PYFA 2DV0A 2HEJA 3LENA 1S2CA 3UZWA 3EB4A 2PZNA 3UYIA 4WDXA 2PDHA 1ZSXA 3NTYA 1JEZA 3Q65A 5LIXX 4JIHA 1PWLA 3BCJA 1VBJA 1QWKA 3EAUA 1VP5A 1HW6A 2IS7A 1XGDA 2HE5A 2BGQA 1Z3NA 3H7RA 4OTKA 2C91A 3UZZA 1FRBA 4R9OA 4YVPA 3WBYA 4GIEA 2PEVA 3G5EA 4PUWA 3V36A 1Z9AA 4YU1A 4GACA 2FVLA 3FX4A 2PDWA 2FZ8A 3UG8A 1MRQA 3N6QA 2A79A 4PRTA 2F2KA 2FGBA 2IKHA 1US0A 4FZIA 4JIRA 4XZLX 1RALA 3ONBA 3P2VA 1S1RA 1RY0A 3UZYA 3GHTA 4MHBA 3LQGA 1LWIA 3B3DA 1QRQA 1Z8AA 4GQ0A 3R58A 5C7HA 1GVEA 2INEA 4XO7A 4QBXA 1EXBA 3MB9A 4EXBA 1YNPA 3R7MA 4Q3MA 4XO6A 4XZMX 2PDJA 2FZBA 1XJBA 1T41A 4PUUA 3CASA 1S1PA 3R8HA 4DBSA 1X97A 2I17A 4XZIA 1RY8A 2IKJA 4L1XA 1AZ1A 3GHRA 5LIYX 3MC5A 4WDTA 2PDKA 3H4GA 2HE8A 2IPFA 3U2CA 1R38A 4I5XA 5HNUA 2PD9A 4XZHA 1AH4A 1ZUAX 1K8CA 4IJRA 4IJCA 2IKGA 2ACQA 4JTRA 2PDIA 5AZ1A 2PDGA 2IPGA 2AGTA 3LQLA 1T40A 3WBXA 3LZ3A 3UWEA 4QX4A 3ERPA 3UGRA 3V0TA 1OG6A 3O0KA 3T42A 4JTAA 2ALRA 3LD5A 3R43A 2PDNA 4XAPA 5LIUX 3N2TA 3ONCA 4GQGA 1M9HA 4WRHA 2PDPA 1C9WA 4WGHA 3H7UA 2F38A 3LNMA 4LAUA 2PDQA 4F40A 1EF3A 3CAVA 3BV7A 3GUGA 4JQAA 3V0SA
chains in the Genus database with same CATH superfamily
3HPZA 4PUNA 4UMAA 1XINA 1GW1A 1BFNA 4FXJA 4ZVJA 1RBLA 3BDKA 4AZ6A 4AUBA 2PB1A 4HN4A 3UD6A 3WD3A 1UBSA 4RPQA 1UB3A 3ZLHA 1W9XA 3NL5A 4E0CA 2PLKA 2VD9A 3MUAA 4MZ1A 5CZTA 1TB3A 3TV8A 1CBGA 2PDLA 5HDRA 3IVTA 4HTYA 4RZ5A 1LP6A 1FWSA 1RUSA 4F2UA 1M53A 3CPUA 2Z1WA 3GR7A 2VDGA 3AYVA 2INZA 2ZXBA 4KRTA 4XK2A 4JN7A 1QNSA 3LSCA 3A3XA 1VLIA 3N2OA 3AS2A 1SO4A 3MTWA 2RUSA 3AIEA 4IIFA 2A5HA 1TCDA 3BZJA 3M16A 1GVFA 3S8HA 1Z7AA 2VD8A 3H24A 1FWDC 4IFKB 2VDHA 3QY8A 4RDWA 5C0QA 3EPNA 3ISIX 4M6QA 2CXEA 1NQKA 2ZADA 3L4VA 4N9CA 4K3ZA 2OYKA 5C2XA 3P8JA 3ZSTA 1HO4A 4CCDA 4PRWA 3PBUA 1VYSX 4IPNB 1J9YA 2ICSA 4RE3A 4XBJA 3ABSA 1V3MA 3KX6A 3SSJA 4P2VA 5KETA 2WKGA 3W6YA 3PWGA 4QROA 1OYCA 2P76A 5LHFA 4PB4A 1CI1A 4UNIA 1EHAA 2QUMA 4H9ZA 3OLEA 1W3TA 2GUUA 3G0SA 2VGBA 4UFIA 3BAJA 3BCFA 3ZVIA 4K8HA 3KHJA 2PU1A 3T2PA 4H6QA 4O28A 3NQBA 1XRSA 3TTEA 1PIGA 1YBQA 2VM8A 1P4CA 3VOFA 1QOXA 3VILA 4C6OA 3DFSA 2CLMA 3ZT6A 1H7RA 3R25A 2FVMA 4LALA 3GS6A 4J4KA 2ODOA 5C5YA 1GW9A 3R6IA 3KVMA 4R53A 1HQTA 2RGLA 2EPLX 5A8GA 2FDSA 5CC5A 1UUQA 4C65A 1HJXA 4DBWA 1U33A 4AWTA 4AY1A 5LA0A 3KOFA 1MQRA 1GQNA 3S47A 2CWNA 4P5UA 4PSPA 1RCOB 4X0VA 4EE9A 5JVLA 3KCOA 4Q4SA 4HU0A 4O4WA 3THUA 3B0UX 4OBSA 2QZRA 3SCRA 1XH1A 3ZFHA 1K7FA 2DSUA 3W1NA 1PYFA 2QUTA 2GFTA 2J9ZA 4N9BA 4PMYA 3CH9A 4NY2A 3EB4A 3O07A 1Q6GA 3C2OA 1UWUA 3WNLA 2Q01A 1VRXA 2OLAA 3WJXA 2AMGA 1Q8JA 1UP3A 4JIHA 4C6IA 4GKTA 1UIOA 3W7MA 1JAKA 5DRIA 4GY1A 3UF9A 3BL3A 4DF2A 1ALDA 3W02A 5HR6A 1HF6A 1YDNA 2J7DA 1TWSA 2FHFA 1V6VA 1JF6A 8TIMA 5AOUA 4M1RA 3PVFA 3BQ5A 2ZX8A 2J74A 1EBGA 4UZUA 4U28A 1V7AA 2V63A 3WBYA 2OOGA 2VZUA 3T07A 1ZPTA 3W1QA 4CD7A 4DRSA 3H4XA 5D9OA 5REQA 1W6TA 4F0LA 2QCMA 1IWPA 4DXVA 5G5IA 2I5QA 3WQWA 3FX4A 4D6GA 2PTXA 4WLCA 3OZOA 5CQ1A 4UTWC 3R89A 2EBNA 3CNYA 5HPOA 2NUWA 2V3EA 3GC5A 2BGNE 1ZHAA 4MB4A 2NV2A 1VGAA 1UOKA 4RV3A 4FNRA 1H1ZA 3OGVA 1VCFA 1TMHA 4KWOA 1E56A 4HA1A 3ALFA 3ARVA 3QC3A 1QPKA 4GLEA 2XM1A 2QCFA 2PZ0A 1WV2A 3BLEA 3H2AA 3G0XA 4QRNA 1GVEA 2WO5A 2WHMA 2J88A 1EXBA 3H54A 1LTDA 1QU4A 3VTRA 1EA0A 3CEPA 3WNOA 4DUXA 1BG4A 1Z6KA 2WQPA 2PP1A 2R6OA 1T8XA 1A4MA 4MM1A 4WSJA 1UWSA 3W7DA 1ISWA 2ZE0A 3R0UA 4ZXLA 3GFYA 1A0EA 2VO5A 3I4KA 4H01A 4RZ4A 3IJDA 4UFHA 2V68A 1UZ1A 4OU1A 1AJ2A 2J8FA 3NAVA 4MUZA 3W25A 5CSSA 1B57A 1EYWA 4HHHA 3BW4A 4US5A 2BV9A 1ISXA 1B2YA 4IM4A 4H6KA 3A3WA 3NQCA 1SMDA 1HL8A 3MU7A 5A6TC 3MSGA 5D02A 4D72A 3M1ZA 4Z0JA 3ORWA 4YTUA 4YL2A 3KEHA 1H1YA 5FAGA 1ECEA 4E38A 3QR0A 3HGSA 4DM2A 3TN3A 1FHLA 3CWHA 1XG4A 3GDMA 4KETA 4O16A 3N2TA 2ISSA 3EXRA 1RQHA 3TSDA 4Z2LA 3E74A 3LMZA 1C9WA 4WGHA 1IXNA 4HU4A 2VWTA 4L6HA 2D24A 1FP8A 3C4UA 5GJNA 2FKPA 5AC5A 3BGJA 2WMIA 2CIPA 3C0LA 3CAWA 1EZWA 4HHMA 1F5ZA 3S5OA 3PB2A 3EXSA 5A6KA 3MUCA 5AC4A 4WSKA 2ZFAA 1JFHA 3CZGA 3G2GA 1EUAA 5A2CA 4TMCA 4HNVA 3EOLA 1R7OA 3GLCA 3P8IA 2DSKA 4F0SA 2WZTA 1T6MA 2E4TA 2PCQA 4DJDC 2JQXA 4X2PA 1W9DM 3VGBA 3GM8A 3W1XA 1UWRA 4WKHA 3L4XA 1SR0A 3BVJA 1BVZA 2HSAA 4L1WA 5BXRA 2V8ZA 2O0TA 4CQDA 2EKGA 2QQ6A 3BXWA 3DGRA 4EPKA 1KWKA 4LNCA 2GGHA 2IW0A 1VFOA 4FALA 2V5LA 2P8BA 2QCNA 5I06A 5HAOA 4OOUA 3VNDA 4UZSA 1XSIA 2A6LA 1GZGA 1CW2A 2X1RA 4B5WA 3URAA 2CNCA 1HKMA 2J75A 3QQ0A 4UTUA 2WCGA 4GX9A 1UWAA 2V5CA 3G3MA 4I8DA 2QJJA 3NPVA 4MPQA 3TCSA 1P6WA 3GVQA 3O7UA 4IOTA 4IGSA 4H7VA 3GZAA 4J7RA 1DJQA 3EPOA 4DX3A 3QRHA 3K46A 1HFBA 1R6WA 5EFFA 3EWYA 2YDAA 3TKFA 2VRJA 1JD9A 4WCJA 5DBTA 4I9MA 1A47A 1DBTA 1UKOA 3NQGA 1QK2A 1TWZA 2YA0A 2OTDA 4AIBA 3NO3A 4OBTA 1Z89A 2PWDA 1YHTA 4OIFA 3W72A 4AFYA 3SFWA 2ACUA 3S42A 3W7OA 4DQWA 3OA3A 2GYIA 5HUPA 1YBQB 4ZTXA 2JEQA 4TTUA 4B5XA 1L6WA 2YL8A 3C5QA 1JFXA 1V03A 3TNOA 1YEYA 3P81A 3PZGA 1K8ZA 3WQ5A 2I7GA 4I7VA 3PAJA 2Y4SA 4PMDA 4NVTA 1GVYA 4A8IA 5FJOA 1NP2A 1MFUA 2GLKA 4AC7C 1UR4A 1ZQ5A 6PTDA 1F07A 3C86A 1ML1A 1OCQA 1LLOA 3K30A 3FS2A 4U4MA 1EC8A 1E1EA 1G7UA 3M5YA 3MV11 4QG6A 4ZTYA 5AYIA 1ISVA 1C92A 3BSMA 1M3UA 2WLYA 4O12A 3QYQA 4NRRA 3H21A 2GJLA 1XGEA 1OFQA 1OC7A 2UY3A 2VOMA 1F8IA 3QF0A 4D6EA 3I6RA 4CNUA 1C7SA 3W85A 3WFAA 4C90A 4IF2A 1VYRA 2QUVA 3ZXWA 3RILA 4KF1A 4OTKA 1XIJA 4R34A 2PRHA 4GIEA 4C60A 3F4VA 3TR9A 3N6JA 4RNHA 3QPZA 2BWGA 1Y8BA 3LGDA 3FDGA 3UCQA 3WNKA 4IIEA 1VPXA 4CCCA 4TX9A 4AVFA 2OO6A 3KDOA 2D1ZA 2PWHA 4H7ZA 2VCCA 4RL3A 2F2KA 1F6YA 4MB5A 2NVAA 1OYAA 3QEZA 1OIFA 4FOUA 3MI2A 4LS2A 3B8UA 3WDQA 3GU9A 4DAFA 1DJGA 3T2OA 4MKNA 7TIMA 4Z0SA 1MEIA 3G1AA 1VFFA 4FB7A 4M51A 1BVWA 1BKHA 1GEHA 4KEVA 3MCOA 5CCZA 2TODA 1E9YB 2DT0A 1O5QA 3LTYA 1B9ZA 2YDRA 1XYCA 5H1WA 4M6VA 5I09A 3NZPA 1S5MA 3EWWA 1BWLA 1YNPA 4Q3MA 3PTDA 3QV7A 4MWAC 1YLVA 3UYCA 3VKAA 3BOLA 3NQ8A 4LF1A 1U2YA 2QUNA 3CQJA 1JNEA 1X97A 3H2CA 3WK1A 4LAOA 1UROA 1W3LA 3IVUA 1CGWA 4A4AA 1IEXA 2GZXA 2DZXA 3MUXA 4ZFMA 3IK2A 1BXBA 1U5VA 3B9NA 1RHCA 5D2XA 3M6DA 4GNKB 1X7FA 4O18A 1TTIA 1AQFA 1OD8A 4CVUA 1BXNA 3J7HA 4B15A 3I7SA 4UQDA 3R8RA 2AQWA 3V7PA 3LQLA 1CTNA 4W9TA 2AL1A 2WJDA 5AFDA 1XSJA 3LRKA 2V5JA 1TIWA 2J24A 3SURA 3MJMA 1W2PA 2Q8LA 3VIHA 1VEOA 2ZUSA 3QTGA 3L4UA 1AL8A 5DT5A 3E0LA 3NQFA 3THCA 4FK9A 1EZ2A 4EX4A 1J10A 5AKQA 2PDQA 2ZBTA 4XX6A 4F40A 1S2UA 3C2VA 5BU9A 5CPSA 4AD1A 4QLKA 3BGGA 3WQCA 3SDOA 4AB4A 1QNQA 1G94A 3WF3A 3AXIA 2DJLA 3T05A 1BRLB 4Z1YA 3B9DA 1TVPA 4K39A 3UERA 5LKYA 2BHUA 3I7QA 8XIAA 4DYEA 2QIWA 3MCNA 3R79A 4TX8A 4L5ZA 3VM7A 1TZ7A 3TN5A 3W84A 4UMBA 3N9RA 1X96A 1H49A 5MF5A 1EBHA 4M82A 2IPJA 3R0DA 1PV8A 3APTA 2NSXA 5C6MA 2Y0FA 3OBKA 1REQA 1XF0A 3TDFA 5CJ5A 5J04A 3ID7A 3KFTA 1ZALA 4NAFA 4O8RA 1MZRA 2D0HA 2VFIA 4ICMA 3E3HA 4UTMA 1UPPA 1R2TA 4NJKA 5C7VA 2QPUA 4F66A 1QBAA 4HNLA 3N4EA 3AU6A 2VQUA 3RNDA 3N29A 4AXNA 3R8GA 1E4LA 1OX4B 1LQAA 4C1NA 2A7NA 3LM7A 2YFOA 2C71A 1TPWA 2GVEA 1E15A 2VQTA 4Z42C 3ABZA 4HMDA 2ZVIA 1FDYA 3PNZA 1L6FA 4QQUA 4LYKA 4DJDA 1IZKA 1QW9A 5LA1A 3UU0A 1NWTA 4MWAB 3MHGA 3LDVA 5BOFA 1AZ2A 2WCSA 3PJUA 2D22A 2MANA 1GORA 2BOEX 1ZCCA 3KXQA 4AZGA 1OF6A 1UH3A 2XTKA 4QNWA 3REQB 4DBDA 3IJ6A 4PBEA 3WZ0E 3BMXA 5HNTA 1NOWA 2P53A 4S23A 2C14A 1VLWA 1H50A 4LC6A 3M5VA 1W3JA 5CZJA 2OEMA 4JD4A 4RE2A 4MUPA 4QM1A 1IT0A 3VKJA 4DZHA 4RNFA 4MY9A 1DL3A 1WDPA 1XGZA 1I9CB 1SYTA 4DBUA 3IIPA 3TSBA 4B3ZA 4KEUA 4X0NA 4BA0A 2Y7GA 4HMNA 2WAGA 4E8GA 1Q4NX 3P6LA 1XQLA 4J3ZA 2HXTA 1DPMA 3EZ4A 4DYKA 3MKCA 5RUBA 1IYXA 1MQPA 1B3XA 2WM0A 1XBZA 1UZDA 2EPHA 3MBFA 4FXSA 3B8VA 3ES7A 3AO0A 1LORA 4HPJA 4U2YA 3LHZA 4P8XA 3LHWA 5C70A 3QOKA 3NDYA 3TMQA 5K4XA 3D3AA 4O1EA 3NTYA 1JEZA 4XKYA 1JZ8A 3TQ0A 1CLVA 1RLCL 3AALA 5AVHA 1RV8A 5E0FA 4HA4A 1DQXA 1ENUA 2C79A 4OECA 3S9YA 3CLMA 4K37A 4ML9A 3UXLA 1S3HA 3IANA 3L68A 2XFFA 5E09A 1D3HA 3W7KA 4MPKA 3S1VA 3VMNA 3EMZA 4BEQA 3KL5A 1ZS2A 3WNNA 4B91A 5DO8A 4YN5A 4YVPA 2FGLA 2XZ7A 3FEMA 4CD6A 4TOQA 2XGIA 4L9ZA 1TZ9A 1V7YA 1Y5VA 3WSUA 3TIMA 1H3GA 2C19A 2P8CA 5C8BB 4NYYA 2DY3A 3GG7A 4GI4A 3CUJA 1RPXA 2EAWA 3VI2A 2VWSA 2Z27A 5E5CA 3URQA 2FGBA 2DQWA 1XFCA 1EDQA 4U5KA 1PPIA 3ITYA 3WLJA 3WL1A 4DO6A 3P62A 1MRAA 1B0IA 3EWXA 2NQ5A 1RALA 2QMJA 3HQNA 1QI5A 3LHUA 1RY0A 4GO8A 3GXIA 3OZMA 3B3DA 2GGGA 1M7OA 2O9OA 3I65A 3LV6A 3PWIA 1JYNA 3R58A 1E6NA 5DEZA 3WD2A 4JTKA 3CUHA 3T44A 4Q4RA 3THAA 3VU2A 4K1GA 3SCUA 4K7YA 2QDHA 2EEXA 5I3KA 5A6JA 3WQ4A 2BODX 3LXAA 3MSYA 1DKWA 1CIUA 1B90A 1Q65A 3KWXA 3H2OA 2WC7A 5ABFB 3UZJA 4MDPA 2OWCA 4LY8A 4KCWA 4UR7A 5E6ZA 1ZNNA 4ROQA 2VR5A 3L66A 2E28A 1RY8A 2X1SA 4OZOA 1AZ1A 1VB9A 4YCPA 3C2EA 2F8QA 1JNDA 2XHYA 2QDEA 4HCDA 1C8QA 1TWDA 4JHZA 3NURA 3K8MA 4JNYA 1R86A 2GK1B 3TC3A 1QCWA 1E6XM 3RO6A 1R3RA 4DZIA 4FLSA 1IE7C 3ARPA 4CNTA 2PDGA 3D46A 2B7OA 2AGTA 2UY4A 1CGXA 3UJFA 1QVBA 2FFCA 3VPLA 1YDOA 3TQPA 2VL4A 2WOQA 4E2OA 3L2MA 4GX8A 1PCKA 1P0NA 4ZE5A 3T42A 5KINA 4JTAA 1OX5A 1SQ7A 3AI0A 2WC3A 1MO0A 2YXOA 1AJZA 3VUPA 1WAWA 1JPIA 1K6WA 4WZHA 1YW1A 3LGEA 1AD4A 3HMJG 4GQGA 1FWCC 2PI6A 2PTYA 5I03A 3SRKA 1FHVA 3WELA 4JYDA 3WLOA 3W1TA 5CGQA 3M0KA 2PLCA 3NYDA 4JCLA 4Y9MA 3C2YA 3W2MA 1LROA 1HP5A 4NKCA 1XWYA 5I02A 4ZGYA 3N13A 3EDFA 3CS2A 3V1HA 4J3UA 1BF6A 2HVOA 2PCEA 3L5MA 3GWQA 3NOYA 1C29A 5G2WA 4CQAA 4HBKA 3VIOA 1E1FA 3UVIA 2GDQA 1CGUA 3QPEA 5DY3A 1DJNA 3LLDA 4O19A 1N8IA 1A5AA 2GPTA 5CBJA 1OX4A 1CNVA 3W2NA 1M7PA 5FACA 3TLLA 2V5BA 4RDYA 2PD5A 3TU9A 2EKCA 2QHAA 1GOXA 1EB3A 2ZRVA 4WXZA 2V5DA 3QHMA 4NUWA 2BG5A 3IAPA 2OPJA 5AECA 4B5UA 7CGTA 3S5ZA 4EVZA 1CXEA 4LJ3A 1NFBA 1E3ZA 4O1FA 1TJ1A 4XSLA 3UNTA 2GVLA 1E0VA 4UTIA 1Q4WA 3H2EA 2ADAA 3FV9A 1JD7A 3G22A 2PMQA 2Q8ZA 5JH1A 3BQ6A 1LOQA 3G1YA 3VIGA 3VNZA 1UKTA 3GX9A 3OB8A 3TAKA 3CJPA 4L80A 2I16A 3QN3A 3HG3A 1EC7A 1JUEA 1TE1A 3TXVA 2AKMA 3P82A 2E3ZA 2V82A 4KESA 1TQXA 3LCGA 2E1DA 3S0CA 2BASA 2GQ9A 2XM2A 1PZ2A 3ZSSA 1Y7VA 4PMQA 3P3BA 5HMFA 3B9AA 2VC6A 2YZ5A 2UV8G 1WXJA 2Y63A 4HVXA 3S1WA 3CAQA 1C8VA 3HFYA 1XUUA 5MHBA 3BTNA 5D2TA 4EXAA 1S2WA 3V18A 4UFJA 3L2IA 1CXKA 5DANA 3AWOA 3NM1A 1TSIA 4PL2A 1GZ1A 1CXHA 1FWHC 1K6AA 1OFRA 4I9AA 5H91A 3LHVA 1B4KA 4FSAA 4FX6M 3T1GA 1QNVA 3L9CA 4L4PA 1BQGA 1LDCA 1BSIA 2F6XA 4JDBA 2XN2A 4Q7BA 4ZOBA 5CAHA 4OKDA 4D6CA 3EA1A 1PTAA 3RAOA 1TA3B 1X98A 4PR4A 2H8XA 1KTBA 1WYIA 4O1DA 5IFPA 2OYMA 1PZ0A 3A9BA 4QIUA 1V8EA 1H1NA 1UR8A 3NZGA 6ENLA 1HX0A 4PUJA 2X16A 3CAKA 3PZIA 4QJ4B 5FF4A 1W31A 2FH6A 2P88A 3CH0A 1FXPA 2DV0A 1XS2A 1SJCA 2Z1SA 3OLDA 4GZEA 4RCXA 3ZMRA 2J47A 3T7VA 3M46A 3GR8A 2ISWA 1FH7A 1RJRA 2OGJA 4RNJA 4QISA 3Q65A 4BS0A 3KRZA 2OODA 3KRSA 5AYXA 2WHKA 1X6NA 1RVKA 2QCGA 2WXDM 4A22A 3B9OA 3EWDA 2GWNA 3AHVA 1TPB1 1YDYA 1YIXA 1V02A 2WM1A 4GY7A 4MAVA 3EKZA 2J79A 3RM8A 5LSMA 1IT8A 4FPSA 4AVOA 1UCWA 2FLIA 4P8VA 4PUMA 4W8BA 1RP8A 4O1BA 3KE0A 3KOXA 4N02A 4H9UA 4AHQA 3LERA 4QTGA 5KEZA 2V2DA 3W7LA 1G4SA 1US2A 3NO1A 3CB3A 3Q94A 1R2RA 2GJRA 3N6QA 3VCRA 1XKYA 4FZIA 1OWQA 1XYZA 5J5DA 1CDGA 1P0BA 3HG5A 2BOGX 4GKLA 3GHTA 1TX0A 3PY2A 4MHBA 4JTJA 4DJDD 3LK6A 3DG3A 1B5TA 1H5YA 3ARTA 1W1ZA 5LA2A 2CZDA 1LRQA 4IPLA 4ERIA 1GPWA 4KGJA 1AW5A 3NZRA 3CUFA 2A3AA 4PCNA 4E8CA 4L9YA 3L67A 4Q8QA 1OFOA 1I4NA 3LCHA 1C3FA 4EXBA 1W9VA 2F6UA 3R7MA 2A3HA 2HISA 4F9JA 4L4MA 3UVAA 1F8MA 3N4FA 1TV5A 1WDRA 3BW2A 1TV4A 4GC3A 4JY8A 2GOKA 2HE8A 3CUZA 4QJ5B 4QEEA 1EJRC 5HNUA 1J0JA 3H2NA 1PX3A 2C7FA 3AJXA 3ARQA 3IRDA 1JDDA 1K8CA 3MSRA 3O6CA 3B8SA 3M5ZA 1YXYA 4GWEA 3WF0A 2ACQA 5D9MA 1IZCA 2UZ9A 3T08A 3ZS4A 2NLIA 1XM3A 1FWAC 2Z28A 2B0MA 2X8RA 3IV3A 4ENLA 1KQYA 5U4NA 1ZBCA 1I2PA 3TJIA 5EPDA 1XL9A 1WE5A 4Q4OA 4EIVA 4XIMA 1G69A 3R43A 1PIIA 1ZAJA 2BY2A 1Q6OA 4A8LA 5FJJA 2B7PA 3SIMA 1L2UA 5IM51 4JL2A 1GTHA 1AQ0A 2CHRA 3PUOA 4KWWA 1JJKA 3QY7A 4BQ3A 4RK8A 2XIOA 2EPOA 3NPXA 3CTLA 4URIA 1EF3A 5IRPA 2XIJA 1W8SA 2F9RA 3OZPA 1XRTA 4MWAA 1GOKA 3U4AA 3G1HA 4LB3A 4XAGA 1BXCA 2R1MA 4HHPA 1EPVA 3L2LA 4X61A 1UC4A 3ECQA 1FWWA 1RD6A 3KTSA 5CH9A 5D30A 1E72M 3TNBA 1GNXA 4DELA 4LAZA 4PMXA 3DFQA 5CSUA 1Q6FA 4AZCA 4JNZA 4UNLA 4OJYA 1E73M 5LHEA 3LX9A 2H9AB 2BMBA 3S6TA 2CBUA 1HGYA 3P93A 3A3HA 3W1LA 2FDMA 3N18A 2XSXA 1OT1A 3RU6A 3KRBA 4QS5A 1V3JA 4YHEA 4J2MA 5D04C 1SVDA 4GMEA 4LV4A 3URBA 4AIEA 3QV8A 4O1AA 3MT1A 4NHVA 4ZEPA 1HN1A 2CFFA 2J6VA 3VABA 4DY1A 1ZU8A 2A7RA 1B30A 1EOKA 2GWGA 1Z42A 3CGTA 3DI1A 2X05A 1SW7A 3MA8A 1EH9A 1REQB 1YTKA 5CXPA 1PEZA 1G67A 2G4JA 1E0TA 1EJTC 3CZ8A 3WQVA 2CZEA 3GC2A 4U5IA 2OZ3A 4EWJA 4AEFA 3NSMA 3RO8A 3DDMA 3GVVA 4UQAA 4Q33A 1KFJA 4LAMA 1IV8A 4IIHA 1GJUA 3VD4A 4UTTA 4PEKA 3TEVA 1R3VA 5I3JA 3AS0A 3L0KA 3Q45A 1H7NA 5LGZA 2QCCA 1UYQA 2YCIX 2G3NA 2VR4A 3WQDA 3M0MA 3BK0A 3C3UA 1E9LA 5D4YA 3ZYZA 3UG4A 3EEZA 2V2CA 1RQBA 5HQLA 2V69A 1J0HA 3JU2A 4N6EA 4ZB5A 4HNUA 2QULA 3L21A 5FSDC 5AC7A 2QKFA 4U2ZA 1DXIA 5A6BA 4C7GA 1D8CA 1SPQA 1IR2A 2YZRA 2WPGA 2Q3OA 3POCA 3DYOA 4H9YA 1F74A 4AZCB 1XC4A 1VS1A 1DJWA 2YGYA 3V5OA 3VO0A 2UY5A 3GUWA 4MMWA 1FBAA 4LXFA 4IPPA 1TV7A 3W4RA 3PS7A 3VNLA 5F7UA 2VJXA 4JN6A 2OYLA 1I0BA 1M6JA 1TRIA 1EA9C 3DC8A 4NIRA 1UD5A 1R3SA 3UGVA 3FXGA 3SCPA 3WFZA 3G1RA 1H51A 2VYOA 3QFEA 5JU6A 1POKA 3ARZA 3R0KA 2WNNA 3MS8A 4LRSA 1ZLPA 4IGNA 6A3HA 3LZ5A 3AJ7A 3FXYA 3IJ8A 2WMGA 5F2GA 3C0JA 1H11A 3K4WA 2C0HA 5AHFA 1GKPA 2A1YA 4QHRA 2G4FA 3N2BA 3M0YA 2V30A 3SCSA 1EF2A 3LENA 3P61A 1W3KA 2GJNA 2R14A 1J0KA 3ZJ6A 1PO9A 3HURA 5AC6A 4A8NA 3HV9A 4H8UA 5IOBA 4KCVA 2WQDA 4NL1A 1M1BA 3KBVA 5CPMA 2Y5SA 2WKLA 3V1PA 4Z17A 2IXVA 4Z08A 1JG9A 1H7WA 4LSBA 1VP5A 5DRCA 4H4IA 2NUYA 2OGYA 3GR4A 2POZA 4H9TA 2R1LA 3GXDA 4MNLA 3EMCA 4Q8NA 1UR2A 3EWCA 3VIPA 2C1HA 2ZZ4A 2PEVA 4HPHA 3GSMA 4C6DA 2JGYA 1W0MA 1N8FA 4U3AA 2XVGA 4JTIA 5HJXA 4Y8FA 1HJSA 2GUBA 3EMQA 3W7JA 1JGIA 5FEPA 4NZ4A 5A1AA 4K8EA 1L6GA 3FGCB 3LBMA 2O92A 4MIMA 1JCLA 1ZAHA 4GBUA 4TMBA 2XSAA 3RPDA 3FDKA 2GJXA 5K9CA 1BWKA 3V5CA 4KERA 3S1UA 2DVXA 5A8MA 3HGJA 1IXOA 3CYJA 3U5YA 3EOUA 1LZOA 2R8WA 1E6PA 1LWIA 4REQB 1M65A 5FAJA 4AD2A 2PWGA 1S39A 5D05A 1I75A 3XISA 1XLMA 1RK6A 1XG3A 4ATLA 4PZVA 4GO9A 5HINA 1M7JA 3EDJA 1PKMA 3GTFA 4IQJA 4DI9A 1ODZA 4Z2IA 2JALA 4WD0A 3PZQA 1KO0A 3T8QA 4XZMX 2QGYA 3A4XA 4MY1A 3TONA 1D9EA 4HSNA 1DWAM 3OW1A 2CXGA 5ABHA 2WSKA 4YPJA 4D71A 3OP2A 4WDTA 1AVAA 3U2CA 3RDKA 4HYRA 2PP3A 4I5XA 1MUCA 3RF9A 3WENA 4E6MA 3H23A 1NFPA 3WQFA 3SFKA 3KZSA 1RH9A 4D2JA 4YMZA 1VKFA 1FCUA 4MYAA 3EGJA 1K7EA 5B7ZA 2DEPA 1KW1A 3JZEA 2I1OA 1DJHA 2VVNA 3ZJKA 3FCPA 4MYXA 5HNRA 2ZRWA 3ZT5A 2NLYA 2XFRA 5C9RA 3UGRA 1VYPX 3U2OA 4XBKA 3CZEA 1LT8A 4KWVA 4LVAA 5GJPA 4TX6A 1W56A 3N73A 2VZSA 2BFGA 4JBRA 4ZODA 1F73A 2PWVA 5EBUA 5A6LA 4O54A 3GIPA 3H55A 3W7QA 3HOJA 3H6OA 1XLKA 3ITOA 5BXPA 1VQTA 2XDFA 4HNOA 1GQKA 3M5XA 4DJFC 2EQDA 2PLJA 4WEVX 4FO4A 2HXUA 4I9TA 4LS1A 2V3DA 1QBBA 4NJJA 3RU8X 2F2HA 3S1GA 1DQUA 5AY7A 6XIMA 4JTSA 3M44A 2WC4A 1X8FA 4CGTA 3ARWA 1E51A 5EGRA 3GYCA 4EF8A 1LRTA 3XINA 4W7UA 3W53A 1NQ6A 4W87A 4DJFA 1OABA 2ABAA 2V81A 1W1VA 2WSRA 3EWBX 4DIAA 4AWSA 3N2XA 4CQCA 5GJMA 3TC6A 3KL3A 5FF2A 1R9XA 4GJIA 3TK7A 2HVMA 1N82A 1K8XA 4MSSA 1FDJA 4RJEA 1I2NA 3GNNA 3MZNA 1WA3A 3VKKA 3UW6A 2XZ9A 4KIRA 4LU0A 2YXXA 4GH3A 4JIQA 1JUKA 3GBDA 3GC4A 1ZL1A 3STCA 2NVDA 3LA4A 1KFEA 2VZTA 1FCBA 3S4TA 3MMTA 2WNWA 5DXYA 1JDCA 2Y61A 1ZBKA 4BZYA 3LI1A 4Y90A 1J5SA 3UBPC 4KW2A 1EKOA 3TJ4A 4PCSA 1OFDA 3BLDA 4LC8A 1QNRA 2DZBA 2WLZA 3NOEA 1UQYA 3E0IA 2XSBA 1TUXA 3VAVA 3TA9A 3TLQA 5LZLA 4JPGA 1KKOA 3NWRA 1JYVA 2JKPA 1F3EA 3LM3A 3UA3A 5CG7A 3QOMA 4AZIA 2W27A 3ANVA 3GIQA 1Z32X 3O06A 2VFFA 3SO7A 4WF7A 1G9HA 4G7EB 4JFWA 5I78A 2Y7EA 3S9ZA 1QHZA 2VUYA 3LPGA 4DLMA 2OEKA 2Z00A 3UJ2A 4NI3A 3AUJA 3OVGA 3P5ZA 5IHSA 3CIWA 3VKDA 3KP0A 3QZEA 2Z1VA 1DWGM 1E70M 4GVGA 5HMDA 4C6LA 1QMLA 3TYAA 1TTJA 1ME8A 1ZAIA 1N2VA 2ZRZA 2Z6JA 3G3DA 5CPQA 4I90A 2CKSA 3P0WA 4AWEA 1W3HA 3ITLA 4LGXA 2IXUA 4XSMA 2YOCA 4GQBA 5FIPA 3VOJA 3KBMA 5TAOA 3G0UA 2BXYA 1Q6CA 1YNQA 3IGXA 3PJXA 2TSYA 1GJPA 4AHPA 1N55A 2ISFA 4J3SA 5D8ZA 1T96A 4AVNA 2BY1A 3N19B 1EGMA 3SN4A 2HQAA 1XIGA 5C9XA 1EC9A 2RDXA 2W0UA 2RJHA 1OGBA 3UG5A 1TO3A 1V0NA 3U2ZA 2PZNA 3ABOA 2DH2A 2PDHA 2JKEA 4PC8A 2XPKA 4BJHA 3QZ6A 4BQ4A 3TOYA 3AIQA 4LUTA 3A5VA 2GL5A 2FQIA 3AMGA 4M80A 3PZOA 1OM0A 1QOQA 4ZB0A 4IX2A 1EQPA 3FGCA 4YXGA 3D5HA 4QDMA 3AHZA 5CZSA 3GNOA 4GI6A 1XLFA 3CL8A 4ORIA 1D8WA 9XIMA 1Z3NA 3I3DA 3PJTA 4NU7A 3AQUA 4G7FA 1J0YA 5BWAA 1TCMA 1YQ2A 4Q8WA 4JAWA 2Z2AA 5D37A 5CZKA 4DWSB 5HQEA 5DCDA 3H53A 1D7KA 3FJ6A 7ENLA 5XINA 3C2FA 4JKKA 4QGCA 1XV8A 1E6QM 1ECQA 3VOCA 4L4LA 1FHDA 3VX0A 3E38A 2Q6ZA 2QT3A 3P2VA 1XKJA 3E1F1 3DU0A 1VC4A 1WUFA 5BOEA 4FX7A 1HL2A 4PULA 4KCUA 2EPKX 4ZSUA 3KLKA 4AD0A 1VEMA 4BHYA 3S2LA 1RK5A 3HM7A 3O6DA 3QC0A 3WH9A 4WKAA 2ZXQA 3LSBA 4BQ5A 1QPRA 5HK4A 1JCNA 3WJWA 4Y9NA 2PE4A 1TPDA 2QW5A 4D9PA 4QEHA 3MMUA 4MJZA 1ONEA 1XJBA 1J93A 4NG3A 2PTWA 1S1PA 2FJUB 2E67A 2ZTKA 1GT8A 1CXIA 3B8WA 1LUCB 3K4DA 3B8TA 4HB7A 1LUCA 2X2GA 1XCFA 2GOUA 3DC0A 3HPSA 2YDSA 4WQ6A 2DT1A 1LM1A 1ICSA 1CB2A 4CKQA 4O11A 2YR1A 4MG4A 1JDAA 5AZ1A 4ADUA 5C55A 4NAEB 2CKRA 3T4WA 2QV5A 4C1LA 3ERPA 2RGMA 1OG6A 3LRMA 3FVMA 4AWUA 3RCNA 3PG9A 5ENLA 3O9NA 4NZ3A 2Z2BA 4EAYA 1MZHA 1NDYA 4ADSA 3MSDA 4CD5A 4CN1A 4L6DA 1GOIA 3GXMA 3ZIZA 4HSOA 2VELA 2P3ZA 3CC1A 3KBWA 1V0KA 4DF0A 2I56A 2E09A 4S3KA 4IQDA 5EMLA 1OJXA 3N9KA 4POCA 4L7ZA 4U10A 6XIAA 1JULA 3OU8A 2NSOA 3MUZ1 3B9EA 2DUZA 3SN0A 4JOMA 1QHPA 4JTHA 2DZUA 4UOJA 3DXIA 3MP4A 1FKXA 3T0CA 3BCDA 3NVTA 2Z7KA 4R9XA 3ARXA 3UCDA 4AH7A 1KGUA 1PAMA 3OQ8A 1W5OA 4OUIA 4JQ3A 1IXQA 1A49A 3DKLA 1JRCA 3TQVA 1F3TA 3BANA 3OVQA 4Q8OA 4HOZA 3L0NA 3QPYA 1NF0A 1PHWA 2XISA 3DG6A 1OY0A 4QS6A 5CBBA 1UC5A 1YTEA 3B97A 2WKJA 3HV8A 4OE7A 3ZT7A 2ACRA 3W1RA 3WH8A 1F7BA 1NM9A 4UB9A 3TW9A 1XLBA 3QSRA 1VCGA 1LBFA 1Z69A 3UXAA 4ACZA 1W1IE 5FESA 1PE1A 2VX6A 4ZCWA 4H04A 1TV8A 2A3CA 4YIWA 4LBSA 4QXIA 3RIKA 4AYGA 2IUZA 1CX9A 1PXGA 1GJWA 1H09A 1NH6A 4DF1A 3UCCA 2DPEA 2C15A 2Y1HA 5D8WA 4G1NA 2HZGA 3FFSA 3IAQA 3EPMA 3OJGA 3OYXA 4QG8A 3WD1A 4G2DA 4IGHA 3IJLA 2ZX5A 1XLDA 6TIMA 1TPFA 5GNZA 3UR7A 3VCCA 3KAOA 1RXOB 4NAFB 4NXSA 1UOZA 1SUXA 2D73A 1H0GA 3E02A 2BGSA 5M2FX 4R7JA 3WJZA 3VC5A 4DBEA 1JI2A 1U1HA 2ISDA 1ZB5A 3BICA 4W4QA 3W2JA 3B8IA 1ZZMA 1JR1A 1P6CA 3BAIA 4IT1A 3WF2A 1IEWA 3OIXA 4K2SA 4FR1A 2XIQA 2YFNA 4KEZA 1A4LA 2XVNA 2R1NA 3ITCA 1E55A 2G8ZA 3WLMA 1I8JA 2PDMA 1DJYA 4P7NA 1E1CA 2GQAA 1EFZA 1XDMA 5FJRA 3CV6A 4QJ3B 3WEZA 3E96A 4W93A 5CJMA 1JVNA 5G4EA 2X2YA 4K1WA 1KM0A 2WYSA 4DO4A 3IK4A 1TMQA 4DWSD 4Y9PA 1BVNP 1CWYA 3Q37A 4KBXA 3LLFA 1BYDA 1MI3A 3LHYA 1LWJA 4X60A 3ENLA 4ES4A 1KM6A 2W63A 5FL1A 1YPIA 1Z48A 3DG7A 4HMCA 4M81A 2PGRA 3VOGA 3ANUA 3PNUA 2QJMA 3UR2A 1OFPA 1IR1A 4YWIA 4FNPA 4MTVA 4E2BA 1ZSXA 4AF0A 3OGSA 2G0WA 3SCWA 4LYQA 4JX4A 3T78A 3QLLA 4HOWA 3IJ7A 2NX9A 3C0SA 3G1VA 3CIXA 2WZHA 1E4IA 1LLWA 2ZIDA 1HW6A 2IS7A 3QLDA 3PFMA 5E0CA 1OFEA 4YLWA 2BGQA 2Z7GA 2CLLA 4O10A 1EIBA 4UC5A 3UWZA 1CPUA 4B5SA 4O14A 4WOQA 1KR1A 5A8PA 4MB1A 1TV3A 4PUWA 4D6JA 4NX0A 2XIMA 4ZOEA 3S9IA 1P7TB 4NF7A 1FUYA 4S3FA 4TTGA 4QG9A 4HU8A 1W17A 5HPCA 1R5YA 4V27A 2CHOA 4AF0B 2YJQA 4HJFA 1HJWA 3NG3A 1AW1A 1TMLA 2P0OA 1UKSA 5G1TA 1BYBA 2J7CA 1G4EA 2VFDA 2VEKA 4JTFA 1UR0A 4F0MA 1G0CA 2ONEA 3DYMA 3N25A 2QDGA 4V28A 3W73A 5A5WA 2ZWYA 2XH4A 4PFMA 3VD7A 1X1OA 4GY0A 3BPWA 1X6LA 1L2QA 1O6IA 3NQVA 1IGWA 5D2YA 5IBXA 1KCZA 2P0IA 1HL9A 1EIXA 4S38A 2B31A 2AQOA 3JVAA 1YX1A 2INEA 2X0YA 3CQ0A 3TC7A 3OZYA 5FI8A 3UETA 3BLFA 2OWWA 1K4HA 3BH4A 3S5NA 4YHGA 4H1ZA 2X42A 1W1B1 2NT0A 4GJ1A 4V1YA 3FAWA 2XVPA 3P74A 2A3LA 5T26A 1ICPA 2C1IA 1MFVA 6TAAA 4Z1BA 4QCFA 1SZNA 3W26A 5JBDA 3MQTA 1E9ZB 1UH4A 4IPJA 2ZRYA 2ZWZA 1VBGA 1NWSA 1AH4A 4QLJA 3B0VC 1ZUAX 2F7FA 3E2RA 2YDQA 1HKWA 1NELA 3Q58A 4IJCA 5C2GA 4Z1DA 2FH8A 1ADDA 4JTRA 2C16A 1BPLB 4HZ7A 1A50A 2W4XA 5HATA 2BHYA 2DIKA 1R46A 3NQ7A 1BYCA 1WOBA 2ASHA 2C1GA 3LZ3A 2QCEA 2D2OA 3H2MA 4Z2HA 3NZ1A 3NR0A 3W82A 1KM4A 3W6LA 4PTVA 4A3UA 4MLRA 4S2BA 2H8ZA 3OVRA 3A9IA 4BWLA 3GBEA 1M9HA 1V0LA 1XI3A 4GIRA 4Z1CA 2PDPA 2E6YA 4C5ZA 3GXTA 3WO8A 3VFCA 1R85A 2CBIA 2WV8A 3CL6A 5CAKA 3EX1A 1I0DA 2ZUWA 2NQJA 3O05A 1LL4A 3GAKA 3BW3A 4MAZA 1K02A 1WKEA 1JQXA 4PODA 3O63A 5HNNA 2VT0A 1VH7A 1V3HA 1AODA 1FWBC 4IL0A 2DUXA 1LQ2A 2RDWA 1VPQA 5CPLA 5JXQA 3AXKA 2V3FA 3GU2A 4UXDA 1M41A 4A3RA 3S2MA 5EYWA 3JW7A 1KFKA 1JDEA 3R12A 2PU0A 5XIAA 2ZZ1A 2CLHA 4Y2WA 3TH6A 2HPIA 3PC0A 4B9YA 3IRSA 2ZA2A 3M7WA 3T55A 1VENA 2D3LA 4JTCA 4F9DA 4CN4A 3FSTA 3M0IA 1ZBWA 5M1TA 5HBFA 1TFVA 4V2XA 4LAKA 1V6XA 2YL6A 4TR9A 1SM9A 4J3TA 4YVXA 1KFLA 5C9UA 3LG3A 4CQ9A 2Z2UA 4J28A 1JI1A 2J77A 3MW7A 4OWGA 3VMPA 2FFIA 3WH7A 1UKQA 1I1WA 1QO2A 4S1FA 3TOPA 3HG4A 1TJRA 1KM1A 4A6GA 4NAEA 5D32A 3AMLA 3FVDA 3LPFA 3KDNA 3DN5A 2O4QA 4JKMA 3V16A 1RJQA 3KW3A 3ABRA 1XHGA 2MUCA 5A8OA 4RDVA 3MWCA 1V02E 2OKTA 5AC8A 3M64A 4XVDA 3REQA 3URNA 4L4OA 3SGZA 3QKZA 1KRMA 3UFYA 1HJVA 5I24A 2DGAA 4U3CA 2E68A 4HA0A 1S46A 2PODA 4Y9OA 2HDJA 4PCTA 3CUGA 4GQRA 3WJYA 4RW3A 4NP7A 3VDHA 3GTIA 4LUYA 4LF2A 4PUKA 3WUEA 1R3YA 1VJZA 1XCWA 2BZNA 3BUVA 3SJNA 3BJSA 2FZ9A 5I6SA 2P5NA 5F4XA 3F7JA 1U5HA 1GOWA 3M47A 1JXJA 1S5VA 2GVGA 4DWDA 2NQZA 4GINA 4TIMA 1JCYA 1QR7A 5I3DA 5J5RA 4KPLA 1RA5A 3M41A 3M0LA 2RDUA 1SW3A 4E2DA 1V5XA 3IJ9A 1HKJA 2VGFA 2R1KA 5K9XA 1HIZA 2NVCA 3PSWA 3U48A 3W1MA 3AOFA 2VFHA 4ATWA 3NZQA 3MV01 1BWVA 1AMKA 2PDCA 3SUSA 1OFAA 3SY1A 4AX6A 3NPWA 7A3HA 1KTCA 1OK4A 4DVOA 3GHUA 2ZOXA 2G95A 3N14A 1M01A 3HGRA 1R0MA 3WKZA 4XTIA 1TJ0A 4J3XA 4AG0A 3CT2A 2EG6A 4C6NA 3USBA 1A5SA 1W5PA 3W83A 3UZ5A 2J9XA 3PZTA 5LNVA 1IF2A 4MWAD 5D9NA 4B9ZA 1RBAA 1SO5A 4INFA 4HCLA 2A2IA 5G1MA 3CQKA 1TJPA 1PHQA 2EGZA 2V5KA 2ZX9A 2R82A 2VX5A 3B0XA 3F5JA 4K6AA 2GGJA 3MY9A 3CXOA 5BMXA 1OK6A 4AIUA 1SZFA 1WB0A 2H3BA 5D38A 1V6YA 4DUOA 4CN6A 3H8AA 1UASA 1SZEA 1LT7A 3T40A 1KLYA 4R9OA 3W01A 1G01A 8A3HA 4X63A 4WUIA 2E7FA 1PTGA 1TZZA 1FXQA 4WVXA 1CXFA 1Z9AA 2X7WA 4A3QA 1QPQA 3OO2A 3SW6A 4CU7A 2OB3A 3BG3A 5DY2A 2B4GA 1MDLA 2GVYA 3HZ3A 2EJ1A 3DHUA 4GZ7A 4EAMA 1EOMA 2VEGA 4IL2A 1XIMA 2OMAA 1OCJA 3W7GA 1MXDA 3GKAA 3MVTA 4MNJA 2CW6A 5I79A 4LPCA 3UZYA 1G4PA 4P8UA 2RFGA 4IWWA 3HQPA 3QQWA 1IEQA 2DUAA 1ZJBA 2QCHA 3ZOAA 1QRQA 4G9PA 1GVIA 3VMOA 2XH0A 4BWLC 4TV5A 3EDEA 3LYEA 1UP0A 2DIEA 2DT3A 1U22A 2JGQA 1R3WA 4EKJA 4JIEA 2PWUA 1UPMB 1EP1A 4NYUA 3GVGA 1F3XA 3RCYA 4IXHA 1KGWA 1N8WA 1E6RA 1H63A 2DW6A 4D6FA 1VRDA 1QXLA 4XD6A 1BYAA 5C9ZA 2CYGA 3WLSA 1M68A 3MJYA 3M07A 3FHAA 4JNMA 1M7XA 3DFPA 3R8HA 4B3KA 2NQ9A 2CZVA 4C6KA 1W3NA 3RMEA 3DESA 2PGFA 4YYFA 2J8GA 1OINA 1TPC1 3OPSA 2I14A 2VHLA 3IPWA 3DFTA 2EO7A 1RCQA 3IJQA 4WJ8A 1P0KA 2VGGA 3S6DA 5ECUA 3WUGA 3G6MA 2ZA3A 4JFTA 1J0IA 3GO2A 2J78A 3W2LA 1FFRA 3D47A 4S3BA 3SIZA 3NL2A 3HN3A 3C3NA 3PB0A 1O5XA 2AMXA 3BZGA 4XAPA 4IMDA 5LIUX 4Q8UA 3TZFA 4PA8A 1NY1A 1F05A 1AA1B 3O6AA 5HR7A 5EU9A 1NEYA 1SU5A 3AZSA 3IJIA 3RJYA 3LNMA 4JHMA 2P50A 3UA4A 1OIMA 1AQHA 1S2VA 3BLLA 1Q7QA 4HD5A 3AS1A 1J0ZA 1UZHA 3ABXA 4Q8VA 3UP8A 4DNMA 4ZO9A 4AISA 2Z0IA 4LEQA 4ZO7A 2WWCA 3A5FA 3SJ3A 3P0XA 2B7QA 3CWNA 1T8QA 4LANA 2CZ5A 4ZQCA 1YNYA 1W5MA 1E6ZA 2D2GA 4D6IA 3COTA 3W2KA 4PRRA 1I2OA 1IIHA 3W24A 3EKGA 1W3IA 3VA8A 3PFRA 2VGIA 3IACA 3EWZA 1DV7A 2Z1XA 4GCAA 3NXFA 3CO4A 4AD4A 1ZJIA 4HQVA 4EOUA 4NZJA 2AOSA 2OEJA 3GG8A 5JBFA 4MB3A 3VGEA 1ZY9A 3V0UA 3VGFA 1SO6A 3F2DA 1W9UA 4NASA 5C2CA 1RJPA 3CHEA 2O9PA 1P7TA 2AAMA 3QMRA 3O3RA 3ZLGA 4IH3A 3DX5A 1ZJAA 4E4UA 3E5BA 1XDJA 4TVDA 1W5NA 3VOIA 3AAMA 3TTQA 4UTHA 3M0XA 1WX0A 5A8NA 3M4HA 4HA3A 3FA4A 4B16A 1V3IA 1S3TC 2O56A 4ZO8A 4F0RA 4CQ8A 3AISA 4WX2A 2Y5JA 3R11A 1DYSA 3BG9A 4GNVA 4KT2A 1GOQA 4DJEC 3JR2A 5E70A 2ZXDA 2DZPA 4OFCA 1QNPA 2FTPA 4Q22A 2WHJA 3E12A 3W22A 1NP0A 3GTXA 1CXLA 3UZXA 3NXLA 4JQ4A 4IUGA 2CU0A 5C54A 3LHTA 3WK0A 2ZUMA 4K7VA 1ITQA 3NL6A 4MJ4A 5AN7A 3PBGA 4UCFA 4HT3A 2D20A 2PUZA 4JTDA 1EX1A 3SSZA 1D2KA 2F6KA 4TQTA 1OHLA 4MY8A 4GYKA 2JE8A 2JKAA 3VDCA 4QP0A 3WK2A 1J01A 2HCVA 5BROA 2XN0A 5AZ0A 3DH7A 4LVDA 1NTHA 3SR7A 3WF4A 5CBIA 4B2DA 1K4GA 5M03A 4UCGA 4GVIA 4TV6A 1A53A 1A5KC 4C1KA 4FNTA 4NNCA 4BK9A 1MUWA 3QSTA 4RLIA 2OO0A 3CHFA 3TZNA 3B4UA 1IGSA 4HPXA 3S3GA 1AD1A 4DLFA 4B5VA 4ERGA 4QAWA 2YL5A 2YCJA 3PPCA 2VC9A 2Z4GA 1WKFA 1VHCA 1VCVA 3H26A 4ZA0A 2WZEA 3ZR4A 1R30A 1Q8AA 2YBTA 2NXHA 2C0AA 3SCTA 4NNAA 5J8LA 3WD4A 3WLPA 3BCJA 3QXBA 3ARRA 3C8FA 2DH3A 4Z1AA 3MCMA 4G6CA 1ISZA 3NYZA 3PWAA 3UG3A 4Y7EA 3RCMA 1QT1A 3H7RA 4BKNA 2VXNA 3N17A 3WQOA 1JZ4A 1DWFM 3KS5A 1BD0A 3WX7A 3BARA 4ATDA 3RGTA 1EXPA 1XPGA 2JFEX 4GACA 3WQ8A 1Q7ZA 3NQ2A 4MVAA 4XB3A 1KBLA 3SY8A 3W1AA 2Z25A 1K70A 2QDDA 2G3MA 5PTDA 1FFQA 2IKHA 1LCOA 4L56A 3LXCA 3V4BA 3B06A 3TYCA 4N42A 5CGTA 3ONBA 3CYVA 2ATMA 4WIWA 2NT1A 4GIAA 1PVNA 1A5NC 1QWGA 3QYSA 4FX8A 2W61A 3FIGA 4I8YA 5E1QA 4Q8TA 3TVAA 4DUWA 4E4FA 5DT7A 1D3CA 3C8NA 3II1A 3NM3A 2QPXA 1FWJC 1GHRA 2Y8VA 2XGBA 4QLLA 3GDKA 1OB0A 4LVFA 3SGUA 4XKMA 1YRRA 2XN1A 3GDRA 1J6OA 3ARUA 3A21A 1KXTA 3CZLA 1XLCA 5MKGA 4HK5A 3W7NA 3VD3A 4HYVA 4NZFA 4JFSA 2XH7A 1T41A 1VJIA 1JCMP 1R9ZA 3OA5A 3LTPA 1TG7A 2ZKMX 1FDZA 3H4GA 5JBEA 2TRSA 2ZZ2A 1Q6DA 5EMMA 1DORA 4H83A 4S2CA 1H4PA 3QY6A 2VC7A 3HB9A 2VCBA 2CBJA 3WFLA 4JICA 2QVNA 3KOZA 4JX5A 4UTWA 4B90A 3BE7A 1BRLA 3JRKA 2Y2WA 3OQEA 5CJNA 4U33A 1T0OA 3PPHA 4HNTA 2OZTA 5EFDA 1FWGC 2G37A 1K1DA 4L9XA 4QX4A 4J2PA 3IVSA 3EDKA 2QUUA 1V77A 1EJWC 3TN4A 3AYSA 1U30A 3PUGA 2A3EA 5TQLA 3VGDA 2BVYA 5CLTA 1K7XA 1WPCA 1VFLA 5AYZA 3WNMA 3NUKA 1E43A 1K9DA 3EBVA 4FXFA 4D8AA 1QW7A 5FEXA 3BJTA 2CETA 3LI0A 2F38A 3ES8A 4C6JA 1SMAA 1WAUA 5I7GA 1MEWA 3CAVA 4FP1A 1MQQA 4V33A 3BV7A 1S2TA 4O8AA 3B05A 5DN1A 2CLKA 3LBOA 2OSYA 4GABA 3EOSA 3UESA 2QAFA 6CGTA 3QGVA 4JCMA 4ORMA 2G96A 3G77A 5G4WA 3A13A 4JDYA 1XIEA 3PTQA 1W9BM 1XQKA 4RE4A 3JS3A 1H7PA 2YLLA 3FY1A 4HPGA 1W5QA 3AROA 2Y6ZA 3A6OA 4PTMA 1RZMA 4OOZA 1J4EA 2W62A 5DXXA 1X1ZA 3EOEA 1PKNA 3O8AA 4JIIX 3ZM8A 2E6AA 4ZQPA 2ACSA 2V3GA 4DXXA 3ZR5A 2ZE3A 3R13A 4IFRA 3PBWA 5CZ0A 1KNWA 3N1AA 1OX6A 2R94A 4V15A 4AC1X 1FX6A 1PS9A 4HGXA 3CV7A 2NQLA 4UFMA 4YVVA 3FLUA 1A80A 4FNQA 1FWIC 1GQJA 3U3HA 3HG2A 3WMCA 3FJNA 4NILA 3E2SA 2NV1A 3RX4A 1S5TA 3EOOA 3ATYA 2BHZA 5ABGA 1XXXA 2VR2A 4DHGA 4W5UA 1OZQA 1J96A 4A29A 4IMEA 1GUVA 2ANUA 3NIYA 1TJ2A 4QCEA 4LB4A 2FTWA 6ALDA 1QK0A 4ZOAA 1I6NA 2R24A 3HA1A 1E0XA 5GNXA 3PBMA 1F4HA 2ZC1A 1OEPA 4OHQA 4US5D 4JQ2A 3GNRA 2FZMA 1DHPA 1YYAA 3M0ZA 3W23A 1RA0A 2CWXA 5LIKX 1YPXA 1DIOA 4P7QA 4WJEA 3IWPA 2OOFA 1X1NA 5JUVA 3GNXA 2VI0A 1R8LA 3T09A 4LVBA 4MZ8A 4DPQA 4FF5A 3U7VA 2J7GA 3M6YA 3YPIA 4QE4A 2Z24A 5HA7A 3K2GA 1WUEA 3DOPA 3HPXA 1TVLA 3TAOA 3GZ3A 1WXZA 1KXVA 2FJKA 3N2CA 4ZQMA 1V4YA 1UD4A 3EEGA 2JK2A 4NX5A 3HTWA 3G1FA 3K1GA 3FN9A 4ACYA 2CC0A 2YKKA 3BLOA 1HP4A 1FCVA 5JH2A 8CGTA 5GPRA 1GKQA 5LIWX 3PR2A 4I5UA 4PBFA 2ZUUA 2AQVA 4M29A 5CC6A 3R10A 1DHKA 4MF4A 3CWOX 3C6CA 3RR4A 4UWMA 5TIMA 3MMWA 2GSHA 3DERA 4UTFA 1MSSA 2BTMA 3DCPA 5E6YA 2NWSA 1DJZA 4R85A 2JF6A 3NGFA 1BTMA 3DHFA 4PTNA 3QH2A 1VFMA 5IDIA 1KFWA 1HVQA 2TMDA 4K8GA 1VBJA 3THQA 2ON3A 4NJIA 3PUEA 1GQLA 1O5RA 3SAZA 4JTUA 3WQ6A 3EX3A 1XIDA 2HE5A 5L6UA 4HZ8A 4XQ6A 1NAL1 1CECA 3TE9A 1Y5WA 3IGHX 4XZWA 1B3VA 4ZB2A 3LCIA 3UPBA 2O7QA 1EO5A 5I07A 2WNZA 4YU1A 4WHBA 1FTXA 3CU2A 3UY8A 3N34A 2FVLA 3AWNA 1KBIA 1XLAA 1TA3A 1UBPC 2QV4A 2VX7A 4PH6A 1GGOA 1MW3A 3FK4A 2GSEA 3T0DA 2P1FA 1XFBA 3C56A 1MVYA 1GONA 3WLIA 3F03K 1VFUA 1LYXA 4XZLX 5AHIA 3U0HA 1SFTA 1U83A 4W8AA 3IV8A 2XJ7A 1V6TA 1S1RA 3OLIA 4OV9A 3LXBA 3FAXA 3SUTA 2A21A 4Y8EA 1EEXA 2QCLA 5F2MA 3WDPP 3NL3A 5BMWA 1GVSA 1HKIA 1S5NA 1TIMA 3W7RA 3CHDA 1GCYA 4PB3A 5D2VA 1U5JA 3WDHA 2PBOA 3ZVHB 3KBNA 1XC6A 4OBRA 4A2SA 1H5VA 2FZBA 4FIQA 3TYEA 3T81A 2WPBA 4M5PA 4A2RA 4ZQRA 1SR9A 1TTPA 4EF9A 2GDVA 2QMKA 1YDVA 5I0DA 4MOZA 5K3VA 3UXKA 4ERAA 3B40A 1LOLA 5EMUA 2FHBA 4DNHA 1X7IA 2E9LA 1IEVA 5T8GA 1OQFA 3THDA 1W2VA 5IFTA 4XBSA 3IEBA 2Y70A 4DJED 3GKFA 1BKSA 4GUIA 4D8LA 5JIWA 4KIEA 3VCNA 4EPEC 4KWSA 1TREA 3H4WA 1EGZA 1HVXA 3DKJA 4X2RA 1G6CA 3CO8A 3B04A 1XIFA 3IUDA 4XV0A 4PMUA 3UR8A 3SRHA 4A8RA 4X22A 3WH6A 2PDNA 4S3GA 3SBFA 3FJLA 2X7VA 1QASA 1ITCA 3DZ1A 1KFBA 3ONCA 3ZZ1A 3GVRA 4PTXA 1W1PA 4AZ7A 2GSJA 2FIQA 4FF7A 3RLUA 5LXEA 3MHFA 4JEQA 3GXPA 4Q4MA 4H3DA 4PE8A 5H2ZA 2RH9A 1EJUC 1J79A 3KVLA 3VE9A 2PURA 3W07A 4CNNA 4F2BA 2L5HA 2Y7DA 2CPUA 4C6QA 5KMYA 3SEPA 4Q7NA 4ZFCA 4X9SA 5E93A 2NV9A 1PBGA 4JTTA 5A6MA 1B54A 1UR9A 4F8XA 3QZAA 2WMHA 5F2LA 3PBVA 1G7VA 4F4RA 1E5NA 2VEPA 3AZRA 1KWGA 2CERA 1ZP4A 4Q4KA 4WY0B 3APYA 2ZDRA 4DB7A 2HPMA 2Z1KA 2FB2A 1UD6A 1TR1A 4AEOA 1A5BA 1GYMA 4S3JA 3SCVA 4ZR8A 2ZX6A 4OGZA 2DVTA 4JTLA 5LGXA 3BAXA 3ITXA 3DEQA 1GWJA 3SCQA 3S83A 2YCLB 4ECLA 3CPGA 4IISA 3A4AA 3WY1A 1EEPA 4ACZB 2RDTA 3AXXA 4XD5A 1HTIA 2PDXA 2ZICA 3H7VA 1TRDA 4CLMA 2A0NA 3WMBA 1J12A 4LS0A 3WG6A 1FKWA 3WEMA 4NRSA 4GA8A 3VIMA 2PC4A 4JS3A 4XVEA 1Q5MA 4D6HA 2IQDA 4W7VA 2YB1A 4Q6XA 2Y8KA 4JY9A 2QJIA 3S2NA 4RV8A 1LRNA 2G50A 1DXEA 3CV1A 1K9TA 4IMCA 1NJJA 3G1DA 2O55A 3RX3A 2A7PA 1MXSA 1DTUA 2PF8A 3AIRA 3ZQ9A 3U8GA 3WDRA 5ABFA 3I68A 1JQVA 2X1IA 3TTYA 3B0YA 3U5UA 3AYTA 3IGSA 1K9EA 1KM5A 4RXGA 3F2CA 1O66A 3VDAA 2VENA 2BB0A 3CUIA 3I3EA 3L5AA 1QFEA 1BGAA 3P60A 3N3MA 2OLSA 1JPMA 3D3FA 1Q6EA 1SZGA 3VIFA 3AHYA 4FS9A 4HN8A 1MEHA 2Z29A 5A69A 2W79A 5A3HA 3M0JA 1SJAA 2OELA 2V6AA 4D1IA 1EJXC 2DQXA 2WSPA 3VIIA 3WLQA 4H6RA 4DI8A 2IKIA 5H8MA 4ML4A 3HU7A 5M5DA 3APGA 4UFLA 1GVQA 1QPNA 1YXDA 4DM1A 1ONXA 3A64A 1Z41A 1KRBC 2PTZA 3N2MA 1QI4A 2GQ3A 1QUMA 1L6SA 2FB3A 2BX7A 1OADA 5B7YA 1EL3A 1MUMA 4IMFA 1XD0A 3TYUA 4J9JA 4QE1A 1XH0A 1VZWA 3EXTA 2NZLA 3IGUA 1ZJHA 4F48A 3SUWA 2HEJA 4JX6A 3W00A 4NZCA 3FKRA 1E6SM 2J13A 2OG9A 4A3YA 2VRQA 5KZMA 2HNEA 3U2EA 3WLTA 4AD3A 2FYMA 4GBDA 1ISYA 1MDRA 3T0BA 3SRFA 3A22A 4PFHA 1AK5A 4XISA 3ZJ8A 4CEXC 1LG1A 2TPSA 1PTDA 2XVKA 1XCXA 1WBHA 1E0UA 3XIMA 1TR9A 5HMEA 4GISA 3OLGA 4KWUA 1XIIA 1E5JA 3L4ZA 1LF1A 3G5EA 3HFTA 4KRUA 4IP5A 2PC8A 2QVHA 3CLWA 2OZ0A 1F61A 4HK7A 4J3WA 3MDUA 3W74A 2QNEA 1W54A 3NPUA 4QAIA 4IZGA 2A79A 1US0A 4EPDC 2X0HA 1WP6A 3USZA 1UR1A 3LLXA 4XZBA 5KZEA 3LCXA 4M19A 4IIGA 1TPVA 3PP7A 4R5EA 2YB4A 1NDWA 4US6A 2XUCA 1X38A 4GYJA 2FHCA 1SZRA 1GG0A 3G8EA 3L65A 4BEUA 1K77A 1WDQA 1JF5A 3U57A 3BO9A 2OT1A 3GG1A 4IFKA 2HJPA 3H70A 3L0GA 2Q3RA 2JF7A 2EXOA 4ZL1A 2GUYA 2Y7FA 3FA5A 1FP9A 2AAAA 4NZ1A 1ZENA 1RPKA 2C13A 3N6HA 1NARA 2BY3A 1NWRA 4M56A 1V08A 3DFHA 2D23A 3V5FA 4XTDA 1R47A 4Q7IA 1NF7A 5A6BD 4EWND 1MMFA 1QHOA 4C6FA 3GW0A 4L1XA 2EHHA 1YADA 2WBKA 4I7WA 1UUMA 1I60A 1UZ4A 2P10A 1EWDA 4JZ5A 2QJNA 2HS8A 5BXTA 5K9DA 4YNGA 2FPTA 2PD9A 4XZHA 5DMNA 3S1XA 1QAPA 4H8HA 4H19A 2BY0A 4FNUA 1XR2A 3QGAC 3WQEA 3I6TA 5BCAA 1XRVA 3LGGA 4W8LA 1RSCA 3WBXA 4GVHA 1W9PA 4XZ9A 4JR5A 4W85A 4CNSA 2PAJA 1FH8A 1PJ9A 4HKPA 5BRBA 1KR0A 4PMRA 2CLIA 1V3KA 3FJ4A 4JXCA 5BW6A 3P84A 3OHIA 4S3EA 1JZ2A 3GH5A 3KS6A 2REQA 4ZMGA 3KTXA 1NVMA 3W7CA 2WBGA 5CPTA 2Q71A 5T91A 2XIBA 4QR6A 1FQ0A 1CB7B 4MNMA 2ZA1A 1A0CA 1JCTA 1K3UA 4G8TA 3SCOA 4N4PA 3NQ6A 1WO2A 1IQ8A 2XIIA 1A3XA 5F4WA 3CMJA 1UUOA 3QBUA 3VXGA 3KM8A 5REQB 1WZKA 1WBJA 1K9FA 1J18A 1MW2A 5FJTA 4EXQA 2CZFA 3PANA 3BGAA 3W7PA 4HTBA 2GDUA 2WWDA 3KUMA 9RUBA 4GPNA 3W38A 5HWJA 4NI8A 2G3JA 2E8YA 3M0VA 2OXNA 2QLYA 3HJZA 2AL2B 4E3TA 2W6RA 5CSRA 2WZIA 3RFAA 5EMKA 1HO1A 3LN3A 5B80A 1HJQA 3GDTA 1A5CA 1OSEA 1IEIA 4FNSA 2ZTJA 1A5LC 4DYJA 1R3QA 3ZVHA 2Z6IA 1XBVA 1VBHA 3SY5A 2Q02A 2FMOA 3ITVA 1UQZA 4O0ZA 4CU6A 3TJLA 1A3WA 2FPVA 1BQCA 2PS2A 4GYPA 2JIEA 3TWBA 4R3UA 2P3EA 4CNOA 4DEFA 2BOFX 3P14A 1WKYA 4ZE4A 4YTQA 3W28A 1LL7A 3CQIA 1C8XA 3UEQA 4GXMA 2J6XA 4H9VA 3N3TA 3N15A 2EG7A 1KD0A 4XZNX 4C6PA 3RUBL 4FOKA 4C6BA 3TQKA 2ZZ3A 1BGGA 3VNKA 3IIVA 4HOXA 3QHNA 3V75A 1CT5A 4MKVA 3HJEA 2F61A 5EBAA 2QIIA 4LVGA 5DLCA 1U1UA 5D2WA 3WK3A 2G5WA 3KP1A 3UWUA 5HMSA 3BAWA 3I10A 5DX7A 2ATSA 3W7IA 3PK7A 2DT2A 3TXZA 2EG8A 1EP2A 4IP7A 3PZNA 2X0SA 3WBWA 5XIMA 3BLIA 3DBNA 5DFAA 1B1YA 4PEEA 5HWMA 3F1QA 1P1MA 2R91A 2REQB 2TYSA 2E77A 2NW0A 1Y5XA 3C2RA 2WMFA 2OSXA 5FEWA 3IUIA 2I9EA 1JPHA 4W86A 3VX1A 1GVRA 2OFJA 2W66A 2E5CA 2D2JA 2OWXA 4JFUA 3BMWA 1M03A 4M0XA 4ZO6A 1IT7A 3AHXA 1DWJM 1PZ3A 4G5DA 3ZO9A 1XLHA 4DO5A 4FAMA 4GXPA 3GK0A 1HZYA 4Z2JA 1KXQA 1V6UA 3QTPA 1ZFJA 3G1SA 3GD6A 1V93A 2FMNA 3OVPA 4FHAA 2ZUNA 5G2HA 1RBOB 4PMZA 4UR9A 1JIBA 3GRIA 3WQPA 3WLNA 1P48A 2DSWA 3L4YA 5K4ZA 3I3BA 4PSRA 4LUSA 3UWQA 2C6QA 4OT7A 4DZ5A 4H9XA 2Y8UA 2H3DA 1EJ7L 5T9BG 3CV2A 2VURA 4AY7A 4L61A 3DHPA 4IIDA 2OR2A 1UJPA 2Z26A 5LNUA 4RW5A 3QR3A 1PWLA 1LLZA 5AVNA 3NDZA 2Y5EA 3A47A 4AQLA 3RMJA 3MMDA 5C9WA 3PZUA 1JDFA 3W70A 3EAUA 3KLLA 2EF9A 3MBDA 4LEFA 1R9YA 3DHDA 2XU2A 2FVKA 4ADTA 3RYSA 2XWDA 3WNPA 3UWWA 4J5NA 4RZ6A 1SSDA 4JL1A 1F6KA 2WHLA 3VUSA 3W1UA 1PCWA 3W75A 2J9YA 5EA9A 3LU2A 4XAZA 3PF3A 1PX8A 3F4DA 4DXKA 2GJXB 3RRAA 3UG8A 1KCXA 4GE8A 1AUSL 2GJPA 1RR2A 3L5LA 4HU3A 3JZUA 4GVFA 3FYYA 2Y62A 3MDWA 5BRPA 1XX1A 3T2QA 1XLIA 4AAJA 4BI5A 5GNYA 1QTWA 1HUVA 5DCEA 2Y24A 3BV4A 5HJYA 2UBPC 1EJSC 4I7UA 4X9YA 3FYPA 3DFNA 5FSEC 3OTRA 2O9RA 1DWIM 3Q2DA 4M1BA 2PRMA 1X8CA 3SQMA 3RXZA 3UR5A 1FOBA 1XPYA 5AB3A 5C7HA 2PP0A 3RR1A 4M3PA 1CZ1A 4LNYA 5U7SA 1GZJA 1F3WA 1TELA 1O1ZA 2ZVRA 3WBAA 1Q66A 3FNDA 3STGA 3GW3A 2JEPA 2C18A 2DJXA 3NVDA 2PDJA 3WJSA 4IP4A 3W71A 3T0TA 2BLEA 2OT0A 1EDTA 1DIEA 3LY0A 4MADA 2WVVB 4G1KA 3NFUA 4D8ZA 2PDKA 3MKVA 2FZNA 2BXVA 2HMCA 5I23A 3W2UA 2VOTA 2YL9A 1H7OA 4IGMA 3QHOA 1BLIA 4IJRA 3K4AA 2DDXA 1C93A 4F79A 4MJ2A 3GE7A 4DZAA 4LW7A 1KXHA 4OQVA 3MZ2A 2OCZA 3TN6A 2WVTA 3LCFA 3W88A 4FXRA 3RK8A 4RPPA 1C91A 4O1CA 3PTMA 3LD5A 1GVOA 3SUVA 3MKKA 1KV8A 4X3ZA 1L9WA 4PGLA 1O94A 1X39A 5LNSA 3QJAA 1KM3A 4B5NA 4PYSA 4WRHA 1AMYA 4IUOA 5ABTA 3H7UA 3ZR6A 4IQLA 1UA3A 1CYGA 2DVUA 1O7AA 3GUGA 1F9CA 3O1NA 1OGGA 1KV5A 4JQAA 1UHVA 5G1YA 3BAYA 5AHLA 5FF7A 3HQOA 3VDGA 4PUDA 1P0EA 1JGMA 3C52A 3GAYA 3SUUA 5LXXA 1IZJA 2DORA 1XIBA 1EX5A 4MLJA 4FR6A 3RLVA 3PTKA 4DWSA 3CMFA 3RJXA 4J1OA 1E1CB 1TKKA 2X30A 2HVNA 4N0RA 2WVUA 4IMGA 4GYFA 5BU6A 1UD2A 3INPA 1N7KA 4F3HA 2V0TA 1T99A 4R33A 3ZWSA 1XDLA 5IDZA 2YXGA 4IFOA 3O6YX 1R2SA 3B4YA 1EPXA 4PN2A 3MWAA 3KL0A 1EYEA 1JXKA 4NJHA 5BWFA 1Q6RA 3SQLA 4BF7A 4BQ2A 3P7YA 4C6EA 3GHSA 4HZMA 4HHLA 1CENA 5K7JA 4IG2B 3SCNA 1KGXA 4MGGA 1UA7A 2DZTA 3C0QA 4J35A 2QPSA 3PJWA 4AXKA 1XLJA 3FHQA 3WD0A 4H2HA 3M7SA 2EPMX 2BP1A 2KZHA 2WVVA 1O60A 2YA1A 3K1DA 1ME7A 2CLEA 3PPFA 3ATZA 2CLOA 1NFGA 4C6CA 2I5GA 3LRLA 5FL0A 1Q7MA 3SB0A 3VGHA 3QGKC 1UH2A 2HV5A 4YS1A 3PZ9A 3M0HA 1ESWA 4F0KA 2YW3A 4H8NA 3E0WA 5EB8A 3UNDA 5HUOA 1VPYA 2BSLA 2ZRUA 2ZXAA 4EANA 1LL6A 1LG2A 4UFKA 3W7HA 2J4GA 3S6OA 1QATA 1XYMA 3RRXA 5KITA 3VE7A 4C1NB 2Q8XA 5HQMA 5CLWA 1XIHA 4R88A 2GQ8A 3LEPA 4O57A 4BFAA 2PWEA 1ELSA 4BI6A 1SW0A 3WCZA 4WKFA 4E3VA 3KCJA 5A8QA 5DQPA 3S5YA 1KKRA 3R5EA 2XWEA 3TR2A 1JYWA 4I3GA 2VX4A 1H0IA 1VBRA 2CBVA 1AH0A 1OBAA 4BCEA 4GZIA 3TW7A 1S2AA 2YPIA 1IHIA 1OF8A 1UKPA 2DZWA 1L8PA 2MNRA 2QS8A 1S38A 7TAAA 5I5RA 1P6BA 4GUJA 5TNVA 2DZVA 4KCTA 1BTCA 3R94A 1TX2A 3TTOA 1FWRA 2BVTA 1KTNA 3WUBA 2J27A 2J7FA 4UQEA 5TD4A 3SM0A 4JN8A 4B4FA 3VNYA 2HBVA 3M9YA 4O0QA 3UYIA 4CUCA 3D0CA 4F2TA 4XWUA 5C71A 1TV2A 4CVWA 5AHMA 1FVPA 1VFTA 5DF0A 5D9PA 4WGXA 1WZAA 1I2RA 4UTLA 1O68A 1D3GA 1WDDA 5E0KA 1M5WA 2ZUTA 4MFDA 5L9FA 4V1XA 1ONRA 5JIPA 2C91A 4HP5A 1XLEA 3A4WA 1L8NA 1ITXA 2VCAA 1KBBA 3N11A 3V36A 5G2IA 4O52A 4HIBA 2LLEA 4AHOA 4KEMA 2IQTA 2FZ8A 5D03A 3NQMA 1ZRQA 4PRTA 5HWNA 4PCFA 4B4HA 4N6FA 4ROPA 4P7LA 1DP0A 5TBOA 4RE0A 2GK1A 3AHTA 3GH7A 3O2LA 3QW3A 2W92A 4O53A 4C7DA 1UMYA 2OVLA 3PBYA 4C5YA 1DE5A 5A2BA 1KFCA 4C6MA 1AL7A 3D6NA 3EB2A 4G56A 1I45A 1Z8AA 4H00A 3MYOA 1H2JA 3W27A 1MYRA 4ILSA 4M8UA 3DENA 3E49A 1QI2A 4GQ0A 3W37A 1MW1A 1I1XA 1VIZA 2DZAA 2A3BA 5G4HC 4QBXA 2E5DA 3AMCA 4WXYA 3HPAA 4UQCA 3SECA 3MP3A 3WH5A 1PKLA 3RPTA 3MB9A 1HNYA 1OGSA 4XO6A 3CL7A 4PUEA 3N9SA 5KZ6A 1OZMA 2YSWA 3VOHA 2QF7A 4NJGA 3S2CA 4YTTA 3UPWA 1VFSA 1H41A 2IKJA 3MP5A 4GUFA 2FPYA 4Y6GA 1KM2A 1A5MC 4H41A 1I2QA 4O17A 1H7XA 2ZZ6A 1PX4A 4DUVA 4J40A 5IXEA 3PHAA 3RITA 1UWTA 2X1UA 3NGJA 4O13A 5H6HA 2VMFA 2FGZA 5A95A 2IKGA 1OC5A 4LCQA 2ZUVA 2PDIA 4J27A 2IPGA 3CUXA 2PSNA 7PTDA 4P8WA 3CK5A 1XLLA 2OU4A 5KSWA 4GNJA 4GG9A 4BI7A 1UJQA 2JIWA 2UY2A 1JRBA 1JCXA 3L4WA 3NQEA 8XIMA 5D09A 3P80A 5E9AA 4QSHA 3S2JA 1SJBA 3NA8A 1DWHM 3W76A 3OODA 5IHRA 3V3WA 2ZZ7A 4F0HA 1R87A 4YTSA 3E6EA 2YX0A 3BJFA 3KVKA 3NEVA 3VFLA 2D0GA 1SGJA 2V67A 2WANA 2WSQA 1QDSA 4YYCA 1GPFA 3PSVA 3K13A 1V0MA 4KS0A 4WOZA 4GFIA 4LX4A 4S3CA 3BLPX 5DMLA 5DMMA 4REQA 1Q6LA 4AIOA 4QDWA 3WYZA 1IIGA 1XUZA 4JTGA 4JGDA 2J8TA 1TWIA 4MDOA 4TVUA 2YBUA 4UNKA 1YKWA 3CHVA 3ARYA 3OIHA 5FOOA 1W37A 2FZDA 1RAKA 1SSGA 1GYLA 1HG3A 4OUEA 4LTSA 4KFNA 3QM3A 1G1YA 2X41A 2E9MA 3OHMB 1KLZA 1QNOA 1XBYA 3EX6A 1A5OC 2PFHA 2PF0A 2WZMA 3WDIA 5FJUA 3PN8A 4B92A 4NZ5A 2VEIA 1UD3A 1SJDA 2XINA 4G7EA 2YW4A 3W9ZA 3TYDA 1L0PA 3AZTA 1R3TA 3WN6A 2BVDA 5M17A 1VAHA 3SZ8A 4AMCA 5CEWA 4FEZA 5FD0A 1VF8A 4AZ5A 4GHRA 1P1XA 1V6WA 2CLPA 3KBSA 5GQBA 2DZSA 4W84A 5HXMA 2J66A 4M7SA 2W3ZA 1DEDA 3RHGA 2IPWA 2ZQ0A 4GRSA 3FKKA 1F76A 1EHNA 4TO8A 3WEOA 2RJGA 5E9XA 4ZSTA 3G6LA 3GXFA 3G18A 4LCRA 2PDYA 4L64A 2WJEA 2ALDA 3CZJA 1PIFA 3NQDA 1W1YA 3VINA 1DJXA 2PDFA 4HCHA 2VEFA 4U31A 4N9DA 4RDZA 2HROA 4KFOA 2QCDA 3O15A 2E6FA 3UWYA 3VM5A 1Q13A 1IWAA 3BC9A 3AU2A 4E5TA 1NDVA 1VD6A 3FA3A 3A12A 3ELFA 1ODUA 4W88A 3AICA 3AMKA 1NSJA 1HXJA 4IXXA 4K38A 1DOSA 5I77A 5LNWA 4GI8A 4FLOA 2NX1A 2W5FA 3M43A 2Y85A 4H6EA 1KBKA 4GQQA 3VZZA 4AEEA 2CEQA 1CCWB 1PKYA 2PDBA 3OYZA 3E2VA 4ICCX 1K8YA 5FCZA 5FA5A 3UQNA 1SFSA 2QYGA 4UQ9A 4RKAA 4RNIA 2BVWA 4Q6JA 3E9AA 1YMYA 2OQHA 3TYBA 2E25A 4CCZA 4GD0A 3E2QA 1O1HA 2RKXA 5JMUA 4FOJA 1QO5A 4UOZA 5CPNA 2J7HA 1AJ0A 1C9DA 5EY5A 4DN1A 1NU5A 1LBLA 4KFPA 3IIZA 3DUGA 3PZMA 2HK1A 4GUHA 3BAKA 2B7NA 3NSXA 4W7WA 1DXFA 3STFA 1E4MM 1Q3NA 4YCOA 2YCEA 1TWWA 3TJXA 3BURA 2HS6A 4M6UA 1CLKA 4PB5A 3EA2A 1TTQA 5GVJA 4XIAA 3BWWA 3K5XA 2PWFA 5AHNA 1PB0A 3UXDA 3ANYA 2W9MA 4DJFD 5CC3A 3IIXA 1UWQA 3VGGA 3STEA 4WDXA 3ARSA 1GOOA 4CQBA 2GGEA 3QVQA 4ALDA 1OD0A 4WJXA 2CCRA 1RCXB 3KWSA 4IX0A 3PM6A 1WNOA 3CEUA 1BF2A 3W6MA 1K03A 1SFJA 5BYWA 1E40A 5I3IA 3N12A 1XGDA 4P7RA 1B3ZA 1WCGA 5JQ9A 1CGVA 3TP4A 1BAGA 1TPH1 1XLGA 3CZKA 4EPBC 2WNQA 4AX7A 5F1VA 2QF8A 3I4EA 3MANA 7XIMA 5DCBA 2GGIA 3R1ZA 4DJEA 1V79A 4IMAA 3OBAA 4ZOCA 2OX4A 2PDWA 5BZAA 4DPPA 1MRQA 2QCDB 1Q2RA 4YTRA 1WDSA 4XG1A 4AD5A 1JZ6A 3FYOA 1YPFA 4Q8PA 4TU1A 3UXIA 5SWUA 2C8NA 1H62A 1KRAC 1GK8A 1J6PA 5HULA 1HT6A 4HYWA 3UPMA 3WBEA 7ODCA 2VDIA 3LQGA 2E0PA 1YXCA 4CEUC 5CPOA 2V9DA 3OGRA 4GCXA 3VZXA 4ONVA 4PL1A 3KVJA 4A05A 1DIDA 4QITA 1EUNA 3OG2A 4GUGA 3CM4A 1KRCC 1ZP3A 3G8RA 3PPGA 3WLRA 3ICJA 3WDJA 3UWVA 1VIWA 2VZVA 4A35A 3KBJA 3WQGA 2VFEA 1JPKA 4EACA 2OLHA 4KH2A 3EDDA 3LOTA 5BOOA 2POTA 4HSHA 1TUFA 4UIOA 1E9IA 4GXWA 3RM9A 3VC6A 4OV4A 3H2FA 3QV6A 4IQEA 4PUUA 3AS3A 3WMSA 3QV9A 3TYZA 3NDOA 1W8GA 1NOFA 4QE5A 2NXIA 3CPRA 1LWHA 5DMYA 1FA2A 1TPEA 3TFXA 3R2GA 3UT0A 1SFLA 2HTMA 1POJA 2E8ZA 2E9BA 3G1XA 2VZOA 4MKSA 1Z44A 2I57A 1P5BA 5HJLA 1OG0A 3WL0A 3FOKA 1D7FA 4S3AA 1CLXA 1B4EA 4LUTB 2YCLA 4PTDA 5EMJA 1XSKA 2PTDA 2QJHA 5CGMA 2BXZA 3TROA 4LCSA 3AIWA 2D0FA 3FW6A 3ALGA 4HNCA 1IXPA 4JIPA 2ZX7A 3GB6A 5ABEA 3W1PA 2YBVA 4IJBA 1KQZA 2WMJA 4WY0A 4UR8A 1OT2A 4BF5A 9CGTA 1IWBA 4LAUA 1KB3A 4P61A 2J7BA 3UJRA 3EKLA 1GG1A 3HMCA 4P7OA 1Q63A 3BSHA 3VYLA 1UR3M 1YE6A 4Z2KA 2A6NA 3TCEA 3L23A 4TXEA 3F2BA 3CIVA 5AYYA 2INFA 1R7AA 1XP3A 4FA3A 5CC7A 3SN1A 3E0FA 1J2BA 2WW5A 1PWMA 4JYFA 4BY3A 4NXKA 1W1TA 3N4AA 3HF3A 3VKBA 3VIJA 4RXFA 1GEQA 1CGYA 1XD1A 2IMRA 3RLGA 1VHNA 3IARA 3U6WA 2O4MA 2J7EA 3F4CA 5LNRA 3WLLA 4KQNA 4A21A 3VNIA