4JIRA

Crystal structure of aldose reductase (akr1b1) complexed with nadp+ and epalrestat
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Inhibitor selectivity between aldo-keto reductase superfamily members AKR1B10 and AKR1B1: Role of Trp112 (Trp111).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2013-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jirA00
4XZLX 3R94A 3V0UA 1LQAA 2PDYA 2P5NA 2IKHA 2PD9A 3MC5A 1QRQA 5AZ1A 4DZ5A 1RY8A 4H7CA 4PUWA 2FVLA 4LAZA 1UR3M 1HW6A 1FRBA 1AZ2A 3V0SA 2ACSA 4R9OA 3GHUA 3H7RA 3WBWA 3M4HA 2C91A 3FX4A 2VDGA 1EKOA 1RY0A 4PRTA 2PZNA 2HVOA 5HNTA 4JQ4A 1VBJA 4JQ1A 3P2VA 1Q13A 3UFYA 3C3UA 1YNQA 1ZSXA 2IPFA 3LNMA 4PRRA 4WEVX 2ACQA 2ISFA 1XF0A 5M2FX 1T41A 4JQ3A 4JIHA 3M64A 3T42A 3N2TA 4ICCX 3UZWA 4L1XA 3KRBA 4RPQA 4WRHA 4Q7BA 3V35A 4GABA 2DUXA 2NVCA 1Z8AA 3GHTA 1ZUAX 4YVXA 3F7JA 4ZFCA 3S3GA 2INZA 4XVEA 2BP1A 3V0TA 1S1RA 1S2CA 4YVVA 3ONCA 1IHIA 1PZ1A 4FAMA 1AH0A 2PDUA 2DUZA 3WCZA 4MHBA 2AGTA 1PWMA 3LBOA 5DANA 4LBSA 3DN5A 4ASTA 1Z89A 1VP5A 2IS7A 3CAQA 4GIEA 5HNUA 2FGBA 4FA3A 3LUTA 3RX2A 3O3RA 4XZMX 5C7HA 2PDNA 2FZDA 2PDQA 2PDJA 1XGDA 5JH2A 2F2KA 2PDHA 5LIXX 2PF8A 2PDKA 3UG8A 2WZMA 1A80A 5AZ0A 2IQ0A 3G1RA 3R58A 2HEJA 5KETA 1PYFA 3N6QA 2J8TA 4PR4A 2IKGA 4LB4A 4HBKA 2IPWA 2IPGA 4JTDA 3RX4A 5HA7A 3ERPA 4JIRA 3CV6A 2HVNA 4WDTA 5LIUX 3COTA 3LEPA 2PD5A 3NTYA 4JQ2A 3CMFA 2PDMA 4WDWA 2PDPA 1GVEA 4DBUA 1C9WA 5LIKX 4F40A 4L1WA 1X96A 2DV0A 3LQGA 1IEIA 4H8NA 4XAPA 3MB9A 3LZ3A 1PZ0A 4XO7A 4WDXA 2IKJA 2PDWA 1X97A 3H4GA 3GHSA 3QKZA 4Q3MA 1YNPA 2NVDA 3H7UA 2QXWA 4JQAA 4XVDA 2F38A 2IQDA 2PDFA 3M0IA 4I5XA 3LQLA 3UP8A 2IKIA 4LAUA 1AH4A 4LBRA 4YVPA 4GQ0A 4DBWA 1ZGDA 3UZXA 1MRQA 4IJCA 1XJBA 3LD5A 2PDLA 4JTRA 4G5DA 4WGHA 2HV5A 4FZIA 3RX3A 2CLPA 1MI3A 3CASA 4XZIA 3GHRA 4OTKA 4IJRA 2A79A 4LB3A 3BURA 3B3DA 3UGRA 4JTAA 3EB3A 1EL3A 2PEVA 3UYIA 2FZ9A 2HDJA 1RALA 2FZBA 3R43A 3V36A 2HE8A 1K8CA 4JTQA 1J96A 1MZRA 2PDIA 4JIIX 4PMJA 4XZHA 3LN3A 2PFHA 1AH3A 3BV7A 1T40A 3Q65A 2I17A 3CAVA 4AUBA 3LENA 1QWKA 2INEA 3R7MA 2HE5A 3D3FA 1Z9AA 2WZTA 3G5EA 3EAUA 3WBXA 4GACA 3O0KA 4XO6A 1S2AA 3BCJA 4QBXA 1LWIA 2BGQA 2ACRA 2I16A 1YE4A 3DOPA 1PWLA 3UZZA 3R6IA 4EXAA 2PDBA 4FALA 2R9RA 3WBYA 4GQGA 1AFSA 2BGSA 4JTCA 2ACUA 2ALRA 4GA8A 1EXBA 1Z3NA 4PUUA 3VXGA 4IGSA 3Q67A 1JEZA 1ADSA 1ZQ5A 5LIYX 1OG6A 3WG6A 4HMNA 4YS1A 1X98A 3EB4A 1SM9A 4QX4A 1HQTA 1Q5MA 2PDGA 4QXIA 1AZ1A 1M9HA 1US0A 3R8GA 2PDXA 4NKCA 4WDUA 3UZYA 1R38A 1S1PA 2IPJA 2PDCA 3UWEA 3ONBA 2R24A 3LZ5A 1YE6A 3GUGA 5LIWX 3FJNA 4YU1A 5JH1A 3CV7A 2FZ8A 3R8HA 4XZNX 4DBSA 4EXBA 1EF3A 4GCAA 3U2CA 3BUVA 4QR6A 4XK2A
chains in the Genus database with same CATH superfamily
1JUKA 1ME7A 4D6EA 3HGJA 2WMGA 2PODA 2IKHA 1FXPA 3CGTA 2MUCA 2RHGA 3GH7A 2E8YA 5I3DA 4MUPA 3CQJA 5C54A 5A2BA 4LVAA 4QSFA 1AUSL 3GHUA 2Y6ZA 1J0JA 1TV4A 4WSJA 3TVAA 4LV9A 2VRQA 5HNTA 1XWYA 4PZVA 2A7NA 1RVGA 1LT8A 1IWBA 1UYQA 2HTMA 3OVQA 3BE7A 1EJVC 5BWFA 4GFIA 1UR0A 2QVHA 4PUDA 4NZ5A 2ZRZA 1JXKA 2PSNA 3A64A 4NI8A 1Q13A 1U1HA 1Q66A 3SCPA 3AS3A 1BXBA 4GXMA 4DJEA 2NV2A 4EIVA 3IJLA 3UETA 2J7EA 2WNNA 2REQA 2OKOA 3KRZA 1VHNA 4F0LA 4HB7A 4S3BA 4L1GA 3TFXA 3OP2A 3PUDA 4J3SA 1VZWA 3TTQA 2DVXA 4RE4A 3CTTA 4DQWA 4H8VA 3CUGA 4ZFCA 4FOKA 3OQ8A 3RHGA 2WVUA 4EPEC 2E3ZA 2VGIA 1Q63A 1C93A 1YW1A 3OHIA 4J27A 1SZEA 5D05A 2G97A 4MHBA 3VIOA 3PB0A 4A8LA 3CO8A 3HG4A 3SJ3A 4N9BA 2GVJA 1WXZA 3T0BA 2Z27A 3QOMA 3WKZA 4PCNA 2V63A 5LNSA 4WD0A 3GFZA 1JPKA 2BDQA 1EJXC 3ABOA 4FA3A 6CGTA 2XH0A 2XH4A 3HGRA 5C7HA 2OQLA 5FD0A 1XD0A 1GVIA 1EA9C 3W23A 2PDJA 1LBFA 1PDYA 3FA3A 5JH2A 4PGLA 4HNNA 1AJ2A 3TAOA 3M16A 2NLYA 1CGYA 1AVAA 4N02A 1OF8A 2EKCA 3IUHA 4QCFA 1I9CB 3S47A 4M7SA 2Z4GA 2QDGA 3WLHA 5FA5A 1Z42A 4NZJA 3EX6A 3FLUA 2WJDA 3P6LA 4PTNA 3WD3A 5A6SA 1E1FA 3SCOA 3QV7A 1DTUA 3COTA 3B8TA 1T99A 3PSWA 2PWHA 4I90A 3VNIA 1KR1A 3R13A 3HU7A 4E2DA 3K8MA 3T1GA 2QMJA 1OFQA 1K6AA 2Y8KA 1UP2A 3H7VA 1DL3A 4KCWA 1SR0A 2H8ZA 2Q71A 4XAPA 4EOUA 1WUEA 3UNDA 3TSDA 3S9YA 1ZCOA 2VJXA 1F73A 2HBVA 1JF5A 2HPIA 2VFIA 4J9JA 2QXWA 1HT6A 2C0HA 4LXFA 3VKDA 2D20A 4HPGA 1ZJIA 2OYKA 4AFYA 2ZX8A 1FHLA 4LY8A 1A49A 4MM1A 3HQ1A 4DBWA 1Y65A 2PWFA 4C91A 3EB2A 3LD5A 1LZOA 2QCLA 2QIWA 2PWDA 2QW5A 3PZUA 4PL2A 2XH7A 5F4WA 4A05A 3UT0A 4QM1A 2J88A 2WANA 3S2CA 2ZX9A 3T78A 3GHRA 4TV5A 1F9CA 4IJRA 1NP0A 1H11A 1VBGA 3C56A 3T07A 3BURA 1JCJA 3VCNA 2AOSA 3G0XA 5ABEA 4WUIA 4KQNA 3CIWA 3KX6A 4IICA 7REQA 1WDSA 3CMJA 3TEVA 2CKSA 4XB3A 1F3TA 3S2MA 3R43A 1QDSA 1YX1A 1LRQA 4UTTC 4LJ3A 3APTA 3MT1A 4XIMA 4F9DA 4DWSC 2I57A 1RBOB 1FCQA 4NSBA 3SAZA 2CEQA 1GYNA 3MO7A 1UP0A 4K1WA 4E0CA 4HOZA 4OVXA 1HKIA 1JNDA 1P0NA 1QPQA 4IIHA 5M3WA 3L4TA 4FP1A 2YZRA 1CXFA 2EG6A 1SJAA 3AC0A 4MJMA 1S2AA 3PPFA 1QJWA 1LWIA 3P14A 4MZ1A 4XBKA 4EWND 1P7TB 1AQMA 3O07A 3GWQA 4F66A 4JN6A 2E8ZA 4GA8A 2VOTA 3QBUA 5HQLA 4DBEA 5I00A 4H00A 5H8UA 4AEOA 3Q4DA 4N6EA 4LS0A 3BV4A 4YTQA 4X22A 3WQGA 2QDDA 1MO0A 4WK9A 1Q5MA 1VFOA 1E1CB 2RJGA 1XIFA 1P5BA 5GJNA 3STPA 3QC3A 3UXLA 3UZYA 2G8ZA 5JBFA 4GE8A 2QT3A 4U5KA 1ITUA 4ATDA 1K3UA 1WKYA 1V6WA 3GU2A 1HKVA 3SFWA 3R10A 3LLFA 4RLIA 5HMFA 4K2SA 1CXEA 3U2EA 2R14A 3QLDA 2C7FA 3AJ7A 1H0IA 4FXSA 3VE9A 3BZGA 1LLZA 4Q4SA 1PZ3A 4GZEA 4ACZA 2OLAA 3MKVA 2V2CA 3CZJA 2E09A 3LTSA 3B8IA 3ZJ7A 5L9FA 4LUYA 1LQAA 5HR6A 5DCDA 1O68A 3ITVA 4C6OA 1RD5A 3BDKA 4OECA 3WLSA 5JMUA 3AHZA 1L6YA 1RD6A 3DU0A 3RPTA 4LAZA 2YCLB 1UR3M 2DIJA 4RX0A 2POZA 1HW6A 2R1PA 2QDHA 2E1WA 3S5ZA 3DECA 3ARWA 5C5YA 3LTYA 4R9OA 2HMCA 4GVGA 1W3HA 3W1UA 1W6TA 4ZOEA 4P7RA 3B03A 3I6RA 4W88A 1HL9A 4D2JA 3C61A 2UV8G 2VQTA 1S5VA 2E9LA 2WLYA 1B1YA 2TMDA 2GFTA 5LHFA 3F4VA 3IJ8A 4NZ4A 1ZZMA 2EHHA 4Y9OA 4ICNA 3TOPA 4K8GA 3G3DA 1LL7A 1XF0A 4JNMA 3QY8A 1J01A 5DMMA 1E55A 1LUCB 2QV5A 4OJYA 2GVGA 4W7VA 4EXQA 5E09A 5HJYA 3VPLA 3HG2A 4IIEA 3SO7A 3ALGA 3WLMA 4GPNA 3DI0A 3A47A 1W3TA 5GNXA 2H9AB 1QHZA 1BQGA 3T40A 2EG7A 1OC5A 1S1RA 1OT1A 1VPQA 4GWEA 5C0QA 1OFDA 3H55A 3WCZA 8XIAA 3JVAA 2WZHA 1Q2SA 2XHYA 4OT7A 3VKCA 5A94A 1CI1A 1Z69A 4XISA 1GOOA 3EOSA 3LOTA 5GPRA 1HUVA 3HGOA 5C9ZA 4A2RA 1KFLA 1TJPA 4RDYA 4OBRA 2P0IA 3IV3A 4DN1A 4Z42C 2GQ3A 3C4UA 4JCLA 3GNRA 4UFKA 2PDQA 2EF9A 4B5VA 3WDRA 3QV8A 1TELA 2D73A 1IE7C 2ZXQA 2HK1A 1ITQA 3RNDA 5AY7A 4PSPA 3VIHA 4KEVA 1ITCA 4AZ5A 1A80A 3P8IA 1REQB 2X1TA 2RDTA 3TTOA 5CSRA 1V03A 2QJIA 2VEIA 4B5NA 5JU6A 1C92A 2P3EA 1LF1A 4Q4KA 3GXDA 4YTUA 4X60A 3CYJA 4A8IA 3RCMA 2FDSA 3BJTA 1E0WA 4GHRA 1FY6A 2G3IA 2HVNA 3IUDA 4K8EA 1EHNA 1O4UA 3QYQA 3R8RA 4LYQA 4PMUA 3O2LA 2J25A 1LOSA 4KEUA 4M82A 3UWZA 1XGEA 4HU0A 3SY1A 1IIHA 4H04A 5G2IA 4YHGA 3O16A 3UW6A 3K1DA 1YLVA 4IFKB 2OX1A 4FR1A 3EKZA 4DBDA 2FQIA 4C6JA 3VE7A 1F5ZA 1JQVA 4MB3A 2QDEA 7TAAA 3KFTA 4UQCA 4EANA 4V28A 1B57A 2YL9A 4E6MA 1EO7A 3AXIA 2WC4A 3QW4B 2Z2AA 2GUYA 2YR1A 5HPCA 2GK1A 1OEPA 3R2GA 4YXGA 2GPTA 3VOJA 4GGHA 3SRDA 5CC3A 1G9HA 1O66A 3PZTA 1XGZA 3MKCA 4AZIA 1TRDA 1S2UA 4GBDA 5K4XA 4HTYA 3P61A 1ZL1A 4X0NA 2CLPA 3CLMA 5FJTA 3T55A 1KFCA 3LGDA 3MP4A 4MADA 4C60A 1EZWA 1VFHA 3F2DA 4M6PA 2QPSA 3ZSTA 4JTJA 1UR9A 3WMBA 3SIMA 5HUOA 3SCUA 1OFBA 4PODA 1W3JA 2Z2UA 1YPFA 2O92A 2ON3A 2EXOA 2XGZA 3RO8A 3D47A 1NELA 4MY9A 1YNYA 2PGFA 3LN3A 2B7OA 4FPSA 3ARQA 3TA6A 1R2RA 3NQ7A 2YCEA 4BI7A 1Z9AA 3BSGA 2GQ9A 3K8KA 4CN6A 2Q8LA 4NF7A 4RNIA 4JNZA 5LNWA 2E6YA 4W8AA 4XO6A 1PHWA 3QM3A 3GVQA 1EEPA 3UBPC 2QIIA 4RCXA 5CPOA 5A6JA 3O6YX 3O6AA 3GDMA 1K77A 4QAIA 1A3XA 1GPFA 1TMQA 3PZGA 5C2GA 4WOZA 2ACUA 3E1F1 1T7LA 4FOUA 3A3WA 2FJUB 3D3AA 2NQLA 4GZ7A 4CQ9A 1XW8A 1MWOA 2MNRA 3KM8A 1QK2A 3BANA 2X1UA 2YYUA 1WB0A 3GY1A 1PZ2A 3GS6A 3BGAA 4S3FA 3ZR4A 3W1LA 2PAJA 4QXIA 1VR6A 3BXWA 1TPFA 1PE1A 3KVMA 4MYAA 1C90A 3GU1A 1YXCA 1E56A 3QGAC 1VFFA 4LF1A 1JCYA 4WR3A 3UJ2A 4C90A 3FV9A 2E5BA 3ATYA 1DJHA 3TN5A 2I14A 4YPJA 1UQYA 4ZODA 1GVYA 1R87A 1WDWA 3FJNA 3P5YA 5DBTA 3DFSA 1GJPA 3UXAA 1X39A 4C6MA 3G1FA 3R25A 4D72A 1E6RA 1JQXA 2O4MA 1EF3A 4GLEA 3TWBA 4B2DA 3EX2A 2D3NA 3WNNA 1FDYA 2Z1VA 2ZX6A 3BC9A 1GVOA 1EJUC 3M44A 1SZFA 2QUNA 1L8PA 1RCQA 3VNMA 4I5UA 1H50A 4UR8A 3STGA 3B40A 1J79A 2CLFA 3JU2A 2FB3A 1GGOA 4A3RA 3DH7A 1WA3A 3NWRA 4DVOA 1KCLA 2F6KA 1NWSA 4P8VA 2A3AA 3TLLA 2AGKA 4O54A 4Q8PA 4LYRA 4FNUA 2ISSA 1W8GA 4DXKA 2BXVA 1GORA 4HK7A 1ZSXA 2PC8A 4CNPA 4WEVX 1MW3A 3UA3A 1O1ZA 4X0VA 3GDRA 5M2FX 1CGVA 4MTVA 3VKAA 1OX4A 1V6XA 3IJ7A 3U4FA 3CHVA 3G18A 4S3AA 3V18A 3N4EA 4LT9A 2AL1A 1S38A 2NT0A 4MPKA 5KZMA 3LMZA 4LFYA 1XG4A 1VCFA 1Z8AA 2V3FA 7TIMA 1OWQA 3LU2A 2NX3A 1UD8A 3WJSA 3FFSA 4D6FA 1VCVA 1GQJA 3IGUA 5A8GA 1PZ1A 1K9EA 4PTVA 2PDUA 1VFUA 3NL3A 3MHFA 3FIGA 2YCKX 2PI6A 3RJYA 4EVZA 4HA0A 4QG6A 4PFMA 5ABTA 4GIEA 4GOAA 3GR8A 1TREA 3BZJA 3L2IA 2QS8A 4OBTA 2F2HA 4B3ZA 4I6KA 3F2CA 4HNOA 3IAQA 4YNGA 2F2KA 4R7JA 4FXRA 1R7OA 8A3HA 4FR6A 3UXIA 3AIWA 2Q8ZA 2WZMA 2HNEA 1B90A 1OYCA 2W63A 3TYUA 5AZ0A 3ENLA 3H12A 4LRTA 4LVBA 4TU1A 4XZWA 2OSWA 2QCHA 3P0WA 3W4RA 7REQB 1TA3A 1GNXA 1QUMA 4TXEA 1AA1B 3OLIA 2XWEA 4FLSA 4HOWA 2VC7A 5LNVA 4I3GA 3WBEA 1V3KA 3PPGA 3W24A 1VYPX 1C29A 1CWYA 4QGCA 1FCBA 3NTYA 3GLCA 2YDRA 1ZLPA 4Z2KA 1MNZA 1K7EA 1WO2A 1HX0A 5FF4A 2VD8A 3R11A 4QDPA 3MANA 5L6UA 2YA1A 3KRUA 2DSZA 1TJ1A 3PUGA 3ITCA 4MVAA 4RE2A 4HZ7A 5EMKA 4FXJA 1XLAA 1BVWA 1VJZA 2CBUA 5F1UA 1VRDA 4K39A 1RR2A 1RPXA 1XLCA 2WSYA 1FCUA 1YADA 2CNCA 3A3HA 1DJNA 2QF8A 3TROA 1J10A 4XVDA 2Z6JA 2IQDA 1A5AA 4KCUA 5I3FA 4DYEA 3ZJKA 2FZNA 3AIQA 4GQ0A 4PSRA 1TTQA 3I68A 3DZ1A 4WF7A 1EUAA 1BYDA 2ZZ4A 4GI4A 3KCJA 3T0DA 1LG1A 2Z26A 4CN1A 1PIGA 4QG9A 1XYLA 1ISWA 1HF6A 3QHMA 1S5NA 4RDWA 4PN2A 1AD4A 1H63A 1O5QA 1G67A 3RF9A 2WLZA 1JI1A 3L9CA 4MDPA 2D2GA 3A4AA 1CDGA 5CZ0A 4H9UA 1QNQA 3W38A 1LRTA 4ACZB 3W71A 2YZ5A 1H1YA 3Q58A 4BS0A 4DJDD 3ISIX 4HN8A 1BRLA 2OXNA 1W8SA 3NIYA 2E0PA 2VTFA 3VCRA 1SJCA 2HSAA 1QPOA 2G3MA 1UJPA 2OSYA 2VEPA 3ABXA 3IGHX 3N34A 1QWGA 4NXKA 1CPUA 3OJGA 5IBXC 5MHBA 1H2JA 3F5LA 1R3QA 3BCJA 3EMZA 3ZT6A 2BY0A 1GVRA 4KIEA 4GKTA 1KTBA 3NM1A 3TQKA 3K13A 1WZKA 1I60A 2PZ0A 4O1BA 1RJQA 1DP0A 5DY2A 2WNWA 3CHEA 4V2XA 2CWNA 3HMJG 3PZMA 4KRUA 3B0YA 1RSCA 1K9FA 3NZPA 5CSYA 1X98A 2J78A 1FKWA 5DO8A 5EPDA 3Q2DA 3QMSA 4Z2LA 1CBGA 2Z6IA 3QHOA 2OT0A 2WWCA 1AZ1A 1HO4A 3MMUA 3MV01 5G2WA 3TWAA 1NH6A 3L5AA 3ZLHA 3T4WA 3KHDA 5AHEA 3O7UA 3PBUA 3TJIA 3AOFA 2XIIA 3VM7A 2ZXAA 2V2DA 4TUFA 3RN6A 1VC4A 4TVCA 2PWVA 4UZUA 2JKPA 1EJ7L 4XZNX 2AQVA 4UMBA 1D3HA 5AC5A 1QCWA 3P82A 3BUVA 3BSHA 3GR4A 1ICPA 4M8UA 3EOUA 4YHEA 4ILSA 3ICJA 3SGUA 3KBJA 4OUEA 5EU9A 1V3MA 3W81A 1BGGA 4GH3A 1UB3A 4DZ5A 1EQCA 1IR2A 4QHRA 4CN4A 2HISA 4CD5A 2ATSA 2VL4A 4ZE4A 3OTRA 4GNJA 2RUSA 2HBXA 2I9UA 1YDOA 1C7SA 4L4LA 4RR4A 2ACSA 5HK4A 4CQ8A 3WBWA 4AEEA 2GUBA 4AZ7A 4RNFA 1UIPA 2YXGA 4OE7A 3NDOA 3A4JA 4IPNB 4E3VA 4Q33A 3SN0A 4C1NA 1J12A 3N73A 1VBJA 1JDEA 4PB5A 2QR6A 4JQ1A 4DZAA 1BYCA 3GH4A 3GNXA 4ZCWA 1DWAM 3GDKA 2J27A 2G3NA 1L2QA 1SZGA 3ZO9A 2HJPA 4S38A 3C2VA 3UJEA 3UR7A 2X16A 3WYZA 4GK8A 1S2CA 1M04A 1B3YA 3I4KA 4QS5A 3VABA 1XQLA 2DUZA 2GQAA 1UWSA 4V1XA 2PBOA 3MBDA 3LPPA 3B8UA 4V33A 3WJXA 4W89A 1RXOB 3L4XA 1PKLA 3AIEA 2C19A 3DKLA 4MWAD 1QPNA 4AWEA 1UC5A 2GK1B 3VUSA 2WQPA 3B0VC 3F2BA 1MQQA 3B9EA 3L65A 4RPPA 4K36A 4PMXA 1W9DM 2X40A 2A3EA 1R9YA 4AHQA 1ZBCA 3L0NA 1XGDA 3CWNA 3SQMA 1OHLA 3SCWA 3KUMA 1NF0A 1S2TA 2A6LA 2XISA 5AHNA 2OGJA 2WM1A 3SECA 1TE1A 4KGJA 1IEWA 3II1A 3RM4A 3RDKA 3A22A 1IF2A 4NNCA 1EX1A 4L56A 3E0WA 2Y5JA 3ANUA 4K37A 4Z2IA 1JXJA 2AMXA 4XSMA 4QEHA 1R5YA 2B7QA 3KL0A 2V67A 4WDTA 3HFYA 1XC4A 4D6GA 1PXGA 2F6XA 2XSBA 1QI4A 5IHSA 3E0LA 1B31A 1GVEA 1V0LA 3AMLA 1TJ2A 1C9WA 1GVSA 3AHYA 3ARYA 1O95A 3W82A 3JZEA 4S3CA 1LM1A 2BY1A 4C5ZA 1B3OA 3MY9A 2F6UA 2OVLA 3VGBA 3QJAA 3OPSA 1GTHA 5FJRA 1VBRA 2W3ZA 4WDXA 2PLKA 4BZYA 5CGMA 1F6YA 2INFA 4GNKB 5HWMA 3B8DA 3TW6A 4ZZ9A 3IVTA 1ONRA 1PX3A 3HQOA 3PTQA 4FMVA 5AFDA 3CZGA 3M0IA 2WB5A 3TR9A 1TPH1 2XVNA 4DX3A 4EF9A 4AY7A 1R46A 4AXKA 3CT2A 4JN8A 1TWDA 3WEOA 2HV5A 1GW1A 2VZUA 1DJIA 3QR0A 5KINA 4HZ8A 5FAGA 1MI3A 1JRCA 2QAPA 4BEQA 4O0ZA 1I0DA 2NXGA 1RLCL 4Q4PA 2ZX5A 3CZEA 3DXIA 1UQZA 3TDFA 1DWGM 1IEQA 5LA1A 2O7QA 1WKEA 3O8AA 1XLIA 3UYIA 4A29A 4GY0A 5I2UA 3ZLFA 3OZMA 1ONEA 3T0TA 4MNJA 4O17A 3CU2A 4KFOA 3M0LA 4S2BA 3VNKA 5GVJA 1XDMA 2XVGA 4WOQA 1BF6A 3CUXA 1LQ2A 3GXMA 3W1XA 4GYPA 4J40A 4XSLA 1H1ZA 2PC4A 2GVLA 3FA4A 1T40A 1W1IE 2DZUA 4UOJA 1TG7A 1UW9A 3C2OA 1HL2A 1H1NA 1H62A 5D2YA 3KXQA 2A21A 2OB3A 3BW2A 1V93A 1QWKA 3UG4A 3PBMA 3M41A 4YCPA 1TTJA 1XFBA 3NO3A 3IACA 4WKAA 2GGEA 3UY7A 1KRMA 3ZLGA 1GOWA 1VFLA 3RLHA 2ZUWA 1O12A 3K5XA 1VRXA 2DZSA 1E3ZA 3XINA 1ESWA 2XVKA 5EFDA 4ZEPA 3R6IA 4JTGA 3SCTA 1XH0A 2BOGX 2CKRA 1VF8A 5I0DA 3S46A 5A1AA 4WXZA 1EJSC 4J2MA 4QCEA 2CPUA 4DHGA 2J7GA 3OZPA 4H1ZA 4LUSA 1H7OA 1KBJA 4NJIA 2QLYA 3BLFA 2D3LA 5H2ZA 1OX4B 1F8MA 3VNDA 1BWLA 2WSQA 4H2HA 4IT1A 3OW1A 3EB4A 2QCEA 4JIPA 3AXHA 4PCSA 4XWUA 3WQWA 4DJDA 3GFXA 5CKSA 1ZRQA 4AMCA 1ONXA 2GUUA 1IGSA 3C0LA 2PDXA 2Z29A 3WY1A 1G6CA 5A6BA 3DFYA 3MS8A 1M65A 3E0VA 1QW8A 1JG9A 4CNSA 3USZA 1T8XA 1EC9A 4M19A 2R91A 2DSUA 1UCWA 3FHQA 2PDCA 3BLIA 6A3HA 4P8UA 1HJSA 3GQYA 1UR8A 4JAWA 1ZJAA 1NFBA 2VP8A 3ARVA 1GHRA 4ZQPA 1VLWA 1UR2A 1XUUA 5D38A 3EXRA 3OA3A 4H41A 1VBHA 2ZE0A 3G1YA 5IRPA 3R89A 5A5WA 4BY3A 5GNYA 2WPBA 2PDYA 4MNLA 3U5UA 4HPNA 5EB8A 5J8LA 1TB3A 1NEYA 3MC5A 1K4HA 3SCRA 4O1DA 1JYXA 3TYEA 4JIEA 5AKQA 3JZUA 4PUWA 1EF2A 2WW5A 1RV8A 2E68A 4IISA 4ZE5A 3ZWTA 4DM1A 4NRRA 6XIAA 1K8XA 1UROA 5KMYA 1AK5A 1IWPA 5C55A 1WZLA 4PBGA 2VDIA 3UVAA 1UWTA 1TA3B 5CJMA 2HRWA 1F05A 4RW3A 3S1VA 1HKMA 4IIFA 1XDLA 1FWTA 5HDRA 3NDYA 2W91A 3GYCA 3A4XA 5DFAA 4POCA 5JBEA 4F3HA 4N9CA 3G77A 4HKPA 4JYDA 3FK4A 4AISA 1DJZA 1ME9A 1YNQA 3VD4A 5CAHA 4ZSUA 4I9TA 1YTEA 4Z2HA 2X1RA 1PKYA 1GYLA 1Q7QA 3DC0A 2FPTA 3T42A 4ZQRA 1GVFA 1RA5A 3WH8A 1TVNA 1SFSA 2O9RA 1UPPA 3LCWA 4S23A 2VC9A 2J75A 4INFA 6ALDA 2PTXA 3QR1A 4U4MA 1UHVA 4B9ZA 3W75A 3CUZA 1E4MM 3W7HA 1PVNA 4LX4A 5KEZA 2XWDA 3LXAA 5M1TA 1IXQA 3VIPA 1OCNA 4O0QA 4UUIA 3N2CA 1EGVA 2O9OA 1SUXA 3B06A 2A3LA 3GXPA 3BW3A 3OEXA 5FESA 4RUBA 3ZYZA 2IS7A 2EPNA 2XDFA 1B3XA 3KDOA 1GYMA 4DPPA 5H6HA 3KBVA 4S1FA 3QQWA 1V6UA 1EEXA 3H21A 2ODOA 3B8VA 3DFOA 2ZUTA 2PDHA 2BS9A 4WSHA 2PF8A 2AKMA 3GD6A 3WD2A 3IRDA 1XLMA 3KWXA 5HWJA 2BV9A 2O9PA 4YL2A 4C6FA 5BROA 3G1RA 3P0XA 2VEFA 5CGQA 2ZKMX 4P61A 2O0TA 3QGKC 2C14A 4NXSA 4AD0A 1IR1A 1OYAA 4NJJA 4QLLA 4PR4A 1GOXA 3CQHA 1GONA 1JCMP 4FNTA 4IPPA 3CXOA 1UC4A 3L4ZA 1M5WA 1A5SA 3NPVA 1AMYA 2J77A 3KBSA 2G3JA 4JN7A 3QW3A 1CGUA 1CLVA 3GYEA 1BRLB 1KGXA 4AC1X 1HTIA 3N13A 4US6A 1A5MC 5I7GA 1EP1A 2VGGA 1SO6A 3S1UA 4MWAA 2OU4A 1KCKA 3WH9A 3WNMA 4L1WA 2BVWA 3G24A 5DMLA 1S39A 1IT0A 2WHLA 4BHYA 4XAFA 2ISVA 3N1AA 1E0XA 2QEZA 1R30A 4CCEA 1Q6QA 4M5PA 2X41A 4EKJA 1W5QA 2VCCA 4BEUA 4XTDA 4GRSA 2PP0A 1UD4A 3SRKA 4FNRA 4LANA 4J3UA 1V8EA 4JFUA 4X2RA 1POJA 1VJIA 3RMEA 3TIMA 2JGYA 2PDLA 3RLUA 4Q32A 3TJXA 3T2QA 4G56A 3DFNA 1W17A 3L4VA 3FJ4A 1PDZA 1PYMA 3NZ1A 4F0KA 3ARUA 3NEVA 5CGTA 4YJ5A 2O56A 4KBXA 1YXYA 3A5VA 3QN3A 4JX6A 2NX9A 4ZENA 1M3UA 4UQEA 3SDOA 1R47A 2Y8VA 1TPWA 3RU6A 5LA0A 2OQHA 2WSPA 4Z2GA 1XBVA 4RV8A 3DAQA 1H3GA 3UEQA 4DWDA 4F2TA 3KOYA 1J18A 2QPXA 1J96A 3T6CA 4XZHA 1FBAA 3M0ZA 1RQBA 5EYWA 4ECLA 3URNA 2I56A 3OGSA 3BWWA 4Q4OA 2R8WA 4AC7C 5CPTA 1VFSA 4MB5A 5BRQA 2VMFA 3PAOA 1TUXA 4ICMA 3EPNA 2W92A 4F0SA 3QPYA 5DMNA 1UUQA 1Y5WA 2YBUA 5I3GA 1ODUA 3DG7A 4D8AA 2WZIA 3MVIA 1AJ0A 1W32A 2UY4A 1DIOA 1EPVA 3VU2A 3TR2A 3KE0A 5JQ9A 2R9RA 4LSBA 1K9TA 1DYSA 3IV8A 3THAA 4PE8A 4UTWC 4RZ4A 2NLIA 2Z7KA 4WY0F 1T5AA 1IZKA 3MHGA 3TCSA 3BAYA 1XQKA 2VR5A 3GXFA 3T0AA 5E6YA 1QO5A 1OB0A 1VEMA 1UKSA 1NM9A 1K03A 4RNJA 4GUIA 3CAWA 4UQ9A 4HMEA 3GRIA 4LGXA 1QMLA 1BYAA 3AROA 4X9SA 3W7QA 1GKQA 2BX7A 2HWGA 5E0FA 3PPCA 2AQOA 1A5KC 4JEQA 2RDWA 3BGJA 4XUGA 2ALDA 4GCXA 4JHOA 1S1PA 1V3IA 5HAOA 3EPMA 1VYRA 2GDVA 5HANA 5T8GA 1QNPA 4Y9PA 3ITLA 3W7JA 3TZNA 2XSAA 2D2JA 1UWAA 1RQEA 4OHQA 2F84A 1E1EA 4HSNA 3VIMA 3FOKA 1X8FA 1M7PA 3Q94A 5T26A 2P50A 1D3GA 4ML9A 3SCNA 1FFQA 3PG8A 1JVNA 4AD1A 4GCAA 4MFEA 3QQ0A 5FJPA 4P7LA 4FHAA 1FP8A 2GSEA 2QF7A 3C8NA 3PZQA 4L9YA 1V0KA 2E77A 3W2JA 2P53A 4GI6A 2RJHA 3AMGA 4O1EA 2W9MA 5H91A 1F07A 1PCWA 4QE1A 3T81A 1DJYA 4WX2A 2BXYA 2J7FA 4W93A 3LHZA 4IPLA 4WLCA 3CQIA 4R3UA 1KXVA 3QGVA 1VEPA 1QAPA 3FX4A 2P10A 3V7PA 3VAVA 3GNNA 4XKMA 1YTKA 4C6IA 3CS2A 5G4HC 2CLIA 1RBAA 2NV1A 4FNPA 1TFVA 5HUPA 4UNLA 2OMAA 1HJVA 2RKXA 4C65A 4O8AA 3BO9A 1JL8A 1I1WA 4DLMA 1BF2A 3T2PA 3U7VA 2CLLA 3CL6A 1BHGA 4MG4A 4NAEA 3GKFA 1ENUA 3HPFA 3ECQA 4LPCA 3RILA 4U10A 3QV6A 1YDNA 5RUBA 2CIPA 3ITTA 5H8MA 1QR7A 4WGXA 1PSCA 4B3KA 3OB8A 3R0DA 3GTNA 3W2NA 3LS9A 4LUTA 4UTJA 1PO9A 3TJ4A 5FF3A 4CNOA 3IARA 1XG3A 3BJFA 3S2JA 3KAOA 3TYZA 5DANA 2DT3A 3UERA 3BLLA 2PURA 1BWKA 3TP4A 1Q7MA 1A5NC 2E25A 1TJRA 5CSUA 3WQFA 1ADOA 3LUTA 2Q02A 3WLPA 3LSCA 3EDEA 4UTIA 5E1QA 4R88A 5EMLA 2GVYA 3I3DA 4KWWA 3ZJ8A 3WO8A 3FN9A 2G41A 4Y7EA 3B0UX 4CD4A 3THUA 3C52A 3D6NA 3H2MA 1PEZA 4HP5A 3VOFA 1W3IA 1HJUA 2CU0A 4CCDA 3CQ0A 1ICSA 4MKVA 4DF2A 3B9NA 3BSMA 1SYTA 4H9YA 1W9XA 5G2HA 1E0UA 4LB4A 1MQRA 2IPGA 3RX4A 5E93A 3LHVA 4UXDA 2RDXA 1EBGA 4HVXA 3TMQA 5LIUX 3IVUA 4AX6A 4J4KA 1UWUA 3W87A 3OBKA 4OV9A 5C9RA 4IGNA 3L4WA 1HGYA 2YLAA 4B5TA 2BY2A 3NCOA 1V02A 4R5EA 3VYLA 2DV0A 1B0IA 3TW7A 3EZ4A 1FQ0A 4C6DA 3AICA 3L4YA 4WSKA 1XDJA 5ECUA 3WQOA 1Q6OA 1FDJA 5DT7A 2PMQA 3UESA 3P74A 3GHSA 1TV5A 3QKZA 2ZADA 4LUSB 5U4NA 4JQAA 4E2OA 1WP6A 1AODA 2JEPA 3FJ6A 3JRKA 1DHKA 4HMCA 3AISA 2B31A 3UZXA 1MRQA 4H01A 3FSUA 4YYFA 2ZA1A 2HXUA 4FZIA 2RH9A 3WL1A 4IUGA 3KOXA 3F4CA 1FWFC 3QR3A 4XZIA 2VFDA 5AHFA 4DNHA 2D2OA 4IQJA 2ZZ6A 3EA3A 3VI2A 4JKLA 3WUEA 3WJZA 1UD3A 1QOPA 4RE3A 4MJ4A 1EL3A 3S1GA 1PKNA 3PG9A 4QNEA 1YPXA 1Q8JA 2XFRA 3KVKA 1XCXA 4EPKA 3S4TA 3NQ6A 3PFMA 4QQ3A 3TU9A 4UFLA 4Y9MA 3PZIA 1UJQA 3NYZA 4NX5A 1J5TA 2YCJA 3LTPA 4XIAA 1AQHA 1DIKA 4XD5A 5TBOA 2QCFA 1JYNA 4D71A 3UG5A 1WE5A 1TPC1 1YBQA 1WKFA 3RCNA 4WKFA 1OD0A 5KITA 1XPYA 4GINA 1LQ0A 4JYEA 1XPGA 2FJKA 4RZBA 2EBNA 4Y96A 3D3FA 2A85A 1XCFA 3UU0A 1CXLA 4PB4A 3LRKA 3VDCA 4BQ3A 1UMLA 1RPKA 4BWLC 3PF3A 4OGZA 3N18A 3VD7A 3L21A 2ACRA 1FA2A 1ZJBA 4JY9A 4MMWA 1O5KA 3V3WA 4FALA 4ATWA 3WBYA 1EO5A 3IJQA 1UASA 3GIQA 4Q7NA 3NDZA 3GH5A 3C86A 5K4ZA 2QJJA 2EGZA 4BQ4A 1OGBA 2WJFA 1Z3NA 5BOFA 5G5IA 1JEZA 1ADSA 4ERIA 4CD8A 1XXXA 4LC8A 4XD3A 4I9MA 2XZ9A 3URBA 1NWTA 1XLJA 2ZVRA 1B3ZA 2CXGA 3VNLA 2TYSA 5C71A 2BXZA 3WQPA 2H90A 5CQ1A 3UWEA 3ZR5A 1NFGA 2WWDA 1NARA 1UH4A 2J8FA 4CNTA 3PAJA 3SN4A 3DDMA 3WK2A 3BG3A 1GOMA 3DCPA 4MNKA 5JXQA 1LL6A 4J3ZA 3QY7A 4Q4MA 2FZ8A 4IIBA 2EEXA 3N11A 2FYMA 3PM6A 1X1ZA 4GVHA 4BA0A 1J0HA 4DM2A 4NASA 3T9PA 1H7WA 2A7PA 4GIYA 3UR2A 4DRSA 3S1WA 2I5QA 3EA2A 2PD9A 1MRAA 3MQTA 2P88A 2DFAA 1CGWA 5HBFA 1XISA 4UTKA 1V6TA 1LTDA 3SUVA 4IQLA 1A5CA 3GW3A 2DH3A 4AWTA 1ISXA 3NO5A 1P6CA 4Z1AA 2AKZA 4UCGA 1DIEA 4MAVA 2OKTA 4JEJA 1RY0A 2D1ZA 4PRTA 3E74A 1GQKA 3G1AA 3OVGA 2DGAA 1BLIA 2VC6A 4YWIA 4ZQOA 5BOOA 3M0XA 4L80A 3VMNA 3SADA 4WQ6A 3UFYA 3C3UA 1XHGA 3LB0A 3F4WA 1KTCA 4Y6GA 5FEXA 1Z7AA 3ZVHA 2Z24A 4MWAB 3A23A 4JFTA 4XZ9A 3U0HA 2H9AA 1E6QM 4ZR8A 3LNPA 1JAKA 2ZTJA 5D2WA 5KSWA 1KGUA 2V82A 3L0KA 3OU8A 1ZUAX 4F48A 4HNLA 3S3GA 2HXTA 4MFDA 1NTHA 1KM1A 3ZQ9A 5JIWA 1IHIA 3OG3A 3HA1A 1PHQA 2HNHA 2A4AA 4JICA 1BD0A 3RRXA 2B7PA 3FNDA 4DNMA 2XIOA 4JIQA 2UBPC 2WMKA 3UPBA 1MZHA 1M01A 8XIMA 4PUJA 5BMWA 3FEMA 1DOSA 3NL2A 3VOIA 3GE7A 4YTTA 5A6AA 3F5KA 2FZDA 3HV8A 2B7NA 3NZGA 4GD0A 4BF5A 3CMGA 1F76A 1JNEA 3S6TA 1OGGA 3MI2A 3RPDA 3LMYA 4EK7A 2J7BA 1FWIC 2ZWYA 1BAGA 3WQCA 1OVDA 4P7OA 3K46A 1TPUA 4M0XA 3IK4A 3WH5A 1A4MA 3KS5A 3L0GA 3W1TA 3F5JA 1P1MA 2FZMA 4N4PA 4AIOA 1WXYA 4RDVA 4DF1A 5AYXA 2PWEA 4P2VA 3FVMA 3SIZA 2W61A 1TZ7A 3URAA 3N9RA 1RP8A 1OCQA 2DDXA 4WVXA 3NQAA 1NQ6A 4WJEA 1QTWA 1QPRA 1GOQA 4O13A 5LIKX 5MKGA 3QOKA 3VIKA 2VVSA 4FLOA 3LQGA 3P8JA 3W00A 3MBFA 1J11A 2OLHA 2AL2A 3OVRA 2VELA 3NEHA 2GGJA 1EDTA 1UZHA 1IYXA 2IQTA 3RXZA 1RHCA 1EP3A 1UZDA 3OZYA 1XRFA 3VKKA 2QMKA 4LUIA 3VGGA 5DMYA 1XLGA 4NZ3A 1AQ0A 2F38A 4NAFA 2CLOA 3WQ8A 2J7CA 1LP6A 4YVPA 1SSGA 1V0NA 3AHTA 3ARSA 4M1BA 3AFBA 4HJFA 2C13A 2WBGA 4ZA0A 1BFNA 3NG3A 3NQFA 1RVKA 3WD0A 3SRFA 2DQWA 2RDUA 5EMYA 1QBBA 1PIIA 3FYYA 5HNNA 4AY1A 3MCMA 5BNKA 2A5HA 3PC0A 4UBPC 4IXHA 1V5XA 4B9YA 2DT2A 2Y85A 4DY1A 3OO2A 4M7TA 5DCBA 3W7CA 3M1ZA 1XKYA 2FMNA 3VZZA 5C9XA 1AD1A 4HHPA 3BAKA 3TONA 1XV8A 1KXTA 3TYDA 1QT1A 2YFNA 4ADTA 4LQ1A 3H23A 3WJWA 1U83A 4REQA 4ENLA 2BTMA 4QLKA 2ADAA 3ABRA 4FOJA 2E40A 4XTIA 4LVGA 3SQSA 4QS6A 5CPQA 4OIFA 2HE5A 5CEWA 3W37A 2PP1A 4MAZA 1E70M 3CH0A 1G01A 2QNEA 2OWCA 3WBXA 4GACA 1KM0A 3TLQA 2YXXA 3M0MA 3B4YA 5E6ZA 3S83A 3I6EA 2OO0A 2DZVA 1VS1A 2I16A 1XLHA 1TV8A 3CL7A 3CYVA 2WCAA 3WEMA 3N6JA 1OCBA 2VURA 2Y0FA 1OINA 3G6LA 1Z48A 3W0KA 3RR4A 2YOCA 1RCOB 2E6AA 4NYUA 1XS2A 1G4TA 4TX8A 4N2YA 1R8LA 4GX8A 1D7FA 2HQAA 1KQYA 4MNMA 4QIUA 5BXTA 3BOFA 4PUMA 5DN1A 3WG6A 2TODA 4RXGA 3TFCA 4QX4A 1W31A 3EWZA 4Q8TA 1TV3A 4NAEB 1OABA 2YDSA 2Y7GA 1XIDA 3GM8A 5C8BB 7A3HA 1A50A 2X2YA 2QPUA 3BK0A 1RZMA 1ISYA 4U2YA 4LNCA 1O94A 1F3XA 4I6VA 1UKPA 1TX0A 3WK1A 3QFEA 2IPJA 4LUTB 4LYPA 1YE6A 1W2VA 2EPLX 1DJXA 4UNIA 9XIMA 1HN1A 3CZ8A 2CXEA 3IJDA 3CHFA 5I78A 1JR1A 1UD5A 5JH1A 1FDZA 1ZB5A 1TV7A 4LU0A 5CC5A 2XYLA 4QR6A 1DWFM 2DU2A 1FH9A 3Q37A 1O6IA 4H6KA 1RUSA 1SPQA 3IJIA 2QQ6A 1H60A 3EOLA 3S5YA 2FHFA 1AL7A 1W5PA 5HR7A 4S3GA 1XSJA 2I5GA 2NXIA 3VGHA 4Q6XA 1AJZA 4JTSA 4E5TA 1HVXA 2QUTA 3L67A 3WX7A 4GBUA 4CCCA 2ZUUA 4DIAA 2YDAA 4UQDA 4IGMA 3I4EA 4MLJA 1W5NA 2F61A 4K6AA 1OX6A 1R3YA 3MI3A 3GK0A 3LK6A 3G8EA 4CNUA 3V5FA 4DJFC 3DHFA 4GXWA 4JR5A 1C7TA 2VDHA 3PN8A 4JL1A 2OR2A 4O10A 2PZNA 1Y5XA 3FKKA 4JQ4A 3W7OA 1WDDA 3NPWA 1E6XM 3P3BA 4C6NA 3HQPA 3TCEA 4EWJA 3GIPA 3FYPA 1AQFA 3EOEA 3DBPA 4DWSD 4JTLA 1PUDA 2QGYA 1BTMA 4LRSA 3MUXA 2VR4A 3E5BA 4TR9A 2ZDRA 3GW0A 4DB7A 3LNMA 3M0JA 1EBHA 2D24A 1WDQA 3NNTA 4IGHA 2ACQA 3SUTA 1KFJA 3VCCA 1EIBA 3C0QA 1NP2A 4RKAA 3SB0A 1TPDA 2WNZA 3ELFA 2WJZA 4X63A 4FNSA 4NILA 4L1XA 3AHXA 1OC7A 4HQVA 4WRHA 9RUBA 2NWSA 1ZPTA 1A0EA 2J8GA 4GABA 4PCFA 2NVCA 2D0HA 3P84A 4NRSA 2CHRA 4GUFA 4H2CA 1H7RA 1ZBKA 4UR9A 4IP5A 5FACA 2OODA 2W0UA 3W22A 4BQ5A 4A35A 3ZR6A 3LHYA 1A0DA 3GDLA 4GJ1A 5I79A 1SMDA 4M6UA 3LBCA 2DPEA 1M41A 3G2GA 1FWGC 2CHNA 2OOGA 4I9AA 4IQDA 1GHSA 1ZHAA 1FP9A 4AB4A 1JDDA 4ASTA 3DBNA 3MVTA 4KIRA 3EWWA 3LCGA 1CGTA 4PMZA 3PB2A 4FF7A 5DBUA 3R79A 1V6VA 1DE6A 1I2RA 4LAKA 3B4UA 2W5FA 5HJLA 2CLHA 2WKJA 2PRLA 4M51A 3MTWA 1E9LA 1UA7A 3WEZA 1BVNP 1T0OA 3AZRA 2PDKA 3UG8A 1XIJA 4I8YA 4PH6A 5CJNA 1GEQA 3AZSA 3UR8A 4L4MA 1YTDA 5EMJA 2IKGA 3IK2A 3CAKA 3KOWA 5HA7A 4ROQA 3UZ5A 1R3RA 3ABZA 5CPNA 1Y0EA 1YBQB 3PBVA 4I7WA 2DZBA 1FKXA 3TTSA 3TQPA 3VNYA 2EG8A 1XYAA 1XH1A 2YCIX 3TQVA 2VNCA 1E9YB 3L68A 3KBMA 3IS4A 1EXPA 2Z1WA 2CBJA 5D8ZA 2YBTA 3H2NA 3HURA 4WY0A 1VBUA 2DP3A 1CYGA 4JBRA 4KT2A 3NPUA 5DELA 2HS6A 4A3UA 4MKNA 1F4HA 2ZOXA 3HPSA 3MDUA 5EA9A 2VZSA 4LVDA 3MUZ1 3UJRA 6ENLA 1JDAA 2OSXA 1CLKA 1BSIA 1MSSA 2VFHA 3CUIA 2ZC1A 3GAKA 1D3CA 5GNZA 3H8AA 2HS8A 4A21A 4FX6M 3CTLA 1US3A 4DELA 1H4PA 3VUPA 1LBLA 1E3XA 3B97A 4IJBA 2Z00A 3WLOA 1H7NA 1OY0A 1ZBWA 5GJPA 1KV5A 3RX3A 4H9TA 1KGWA 3WLJA 2VQUA 4GVIA 1WBHA 2WC3A 1BKSA 4PEEA 2X8RA 1MXGA 2PS2A 1BSLA 3HBLA 3W1PA 1U33A 3QPZA 3DERA 3QXBA 1Q6DA 3HF3A 3W88A 2A0NA 4JDBA 2G37A 2P0OA 3E49A 2Y62A 3ZZ1A 3EB3A 1TPVA 3PBYA 4A6GA 1NOFA 4U3CA 1MW1A 1FWJC 1O1HA 4BFAA 4Z0SA 3NYDA 2EKGA 1RALA 1W9VA 3OLEA 5FJIA 1W5MA 1AG1O 2HE8A 1ZP4A 1K8CA 1TJ0A 4TTGA 3EWXA 4H9ZA 1XBYA 5BXPA 2G3FA 3MJYA 4PUEA 2QCMA 4C7DA 4C6LA 3BLEA 2OT1A 4EX4A 2G4FA 2SFPA 1E6NA 2INEA 5DQPA 3R7MA 3DENA 3TAKA 3WQEA 4ZTXA 2V69A 1KB3A 3LHUA 1HJQA 1QNSA 1DXFA 1XBZA 2WYSA 2ZIDA 2EJAA 1VAHA 1J6OA 4IX0A 1PWLA 2ZZ5A 1HG3A 1E73M 1I2QA 4OU1A 4KWOA 2Z1SA 3P81A 2OCZA 4JTCA 1Q6LA 3DC8A 3PJUA 2XIBA 3WH6A 2PCEA 2BVTA 1QXLA 3DYMA 3GVRA 4CUCA 3W7MA 3BAWA 3VINA 2W4XA 2RGLA 1U2YA 2WMFA 4UFJA 4O28A 3TNOA 4CU6A 4ES4A 3ZVHB 3W7EA 1D9EA 1MUMA 3OOQA 1TX2A 1RAKA 3MV11 3TN3A 2ZE3A 2WV8A 3N12A 1BVZA 1KM5A 3QMRA 3FXGA 1HL8A 4WDUA 1NOUA 3AWOA 3AXMA 1MQPA 3QHNA 4D6CA 2I1OA 2VUNA 3G1SA 3WUGA 4HHLA 1O60A 1KFBA 1R38A 2FHBA 5A6TC 5HWNA 4I7VA 3D0CA 2G0WA 4CEUC 5K7JA 3A5FA 3IIPA 3M47A 1EWEA 2UY2A 4J2PA 3ATZA 3DFQA 3W83A 1GG0A 3W1QA 3NL6A 3KL5A 2ZZ3A 3O0FA 5LA2A 2VRJA 3CLWA 1V6YA 1FWHC 3U2CA 3GG8A 4R7OA 4S3KA 2F9RA 1EZ2A 4O1FA 1GVQA 1M68A 3W29A 4M1RA 4KCTA 4K68A 2Y70A 3GDBA 3WSUA 2Z7GA 3WQVA 1J5SA 2YJQA 1EPXA 2NW0A 3BPWA 1XCWA 1KM3A 5D9MA 4B4FA 3PK7A 1W2PA 4G2DA 2ANUA 1XC6A 3WDJA 1L6FA 4CCZA 1SZRA 3F4NA 3DKJA 4PUNA 1XLKA 3NA8A 3AJXA 3BMVA 3GIYA 1EKOA 3DEQA 3B05A 3PJTA 1B5TA 1W37A 2XH2A 3UQNA 3UCCA 2O4QA 3R12A 2DZPA 4Y9AA 3VOHA 1PCKA 3HPZA 3KCOA 2DW6A 4AZ6A 5HXMA 2OGYA 1W1TA 5TIMA 3DFPA 1MXDA 4FIQA 1BXNA 1GZJA 2DSKA 2WO5A 4HSHA 5MKGB 4I8DA 3HGSA 4EACA 3LCHA 4JFVA 3W01A 4AIEA 1V51A 2OTDA 4AEFA 3GG1A 3KRBA 5LNUA 3W76A 4AWUA 4Q7BA 2AL2B 4PBFA 1SFLA 2DUXA 1UIOA 3E6EA 4ZB5A 4G1KA 7XIMA 1DXEA 4XVEA 3MCNA 3CIXA 4ZQCA 3VILA 1B3WA 4Z2JA 3H54A 4JTKA 4QJ1A 3EMCA 1WZAA 1I8JA 3M7SA 2X0SA 3E2QA 4HU3A 3ZJ6A 1PTAA 4W4QA 4DUXA 4NAFB 4AW7A 3CZLA 4JXCA 4O12A 1MDRA 4IL0A 4IH3A 3LM3A 2UY3A 3DN5A 3NQGA 4DJED 3CUHA 1YHTA 1TSIA 4BKNA 4PTMA 4MGGA 4QISA 1TV2A 4KEMA 2EPOA 4S3DA 1E51A 4PRWA 4U3AA 4UTTA 2PDNA 3AMCA 2J24A 1R9XA 4DWSA 1D8CA 5DRCA 3M07A 5EBAA 1JUBA 3KVLA 5ENLA 4DI8A 4ZXOA 3WLIA 4O1AA 4QITA 1Q85A 3W7LA 5T9BG 3BLPX 3VGFA 3R58A 2QCGA 2OJPA 3R0UA 3NQDA 3IWPA 3NURA 5KETA 1XYBA 2BFGA 2J8TA 1SU5A 4NNBA 3T7VA 5I77A 4D1JA 3TV8A 4JTIA 1Y7VA 4HBKA 1GPWA 2ABAA 5MF5A 4JIRA 5AB3A 4WHBA 5D8WA 4REQB 3LERA 4Q8UA 3HN3A 2X7WA 4PTWA 1UWQA 3UNTA 3QVQA 4KFNA 4OQVA 3N29A 2PDPA 2XVLA 5H1WA 3N3MA 2ZZ1A 1PX8A 1IEVA 4V15A 3ZM8A 5EGRA 2VKZG 1KW1A 1FFRA 1X96A 3TW9A 1UH2A 1C91A 2WVSA 1M6JA 4R9XA 1JJKA 1MEHA 2PCQA 4O11A 3KL3A 5C6MA 4L6HA 2JFEX 1XIMA 4GVFA 4S39A 3RJXA 1XLBA 1WPCA 3VDGA 3CM4A 4K7VA 2ISDA 3N4AA 4LAMA 4DYJA 2OG9A 3H7UA 3WLKX 1L6WA 3V5OA 3H2CA 3SRHA 4HT3A 4DJEC 2GGIA 2CW6A 4QNWA 1B4EA 4Q7IA 4LAUA 3CUJA 2FH6A 1KBIA 1V08A 2VXNA 1UPMB 4NX0A 5E9XA 4HK5A 4G6CA 4GX9A 1I1XA 1THFD 2CZFA 2JE8A 5I5RA 3ARTA 1AW2A 3SSJA 4E38A 1EYEA 2PRMA 4AZBA 3WLNA 2VEKA 5DT5A 3W27A 1WNOA 3BGGA 2KAUC 3VKBA 3B0XA 3WENA 3LLXA 3WK0A 1EJWC 2NUWA 3TNBA 4AVFA 3AYTA 1QHPA 3WFZA 4P7NA 1H61A 2NZLA 1SVDA 2E5DA 1VHCA 2FZ9A 4HA3A 3CZKA 1XLEA 2XUCA 2BG5A 5IHRA 2E9BA 5HQMA 4N4QA 3V36A 3TSMA 1N55A 5AHMA 1F4AA 1DVJA 3MMWA 1JPIA 5A95A 2G4JA 1EFZA 3DX5A 4KRZA 1Y5VA 3E02A 3LXCA 1NFPA 1WDRA 1T8QA 1GT8A 2R82A 2O9TA 1ISVA 4AD2A 3JUGA 2QAFA 3CAVA 1YEYA 1B3VA 1LT7A 2POTA 3I3BA 3WMLA 2F7FA 3WJYA 4PULA 1X7FA 1KCZA 5D4YA 1H49A 1A53A 3AUOA 3QKEA 1E5JA 1H5YA 2V30A 5TAOA 4GC3A 4Z08A 4O4VA 2VRKA 2VZTA 3HFTA 5M03A 4TQTA 1FHDA 1IXOA 3PJWA 4ZQNA 2WKGA 3VFCA 2CLEA 1YKWA 4IL2A 1LBMA 5LSMA 2ZTKA 1G4PA 4UCFA 3QSRA 1OFOA 1W3LA 3GX9A 4CEXC 1R3WA 2PGRA 1XM3A 4L6OA 1V0MA 4UMAA 3ZS4A 2NV9A 4QRNA 1CXIA 4KH2A 3FAWA 2ZUMA 3ARRA 3N25A 4TVUA 4QDWA 1QK0A 1MUCA 1S2VA 2WMIB 1U5HA 2D23A 4TOQA 4AVOA 1R7AA 4J5NA 4NQ1A 1BWVA 4UQBA 4GQRA 4XBJA 3LY0A 4QJ3B 1SFTA 1M9HA 4LS2A 5BYWA 5C2CA 2I7GA 4US5D 3S0CA 4OZOA 1XR2A 3PUOA 2QVNA 2VX4A 3U57A 3CPRA 3GNDA 3PTMA 3V16A 4AY8A 4ZSTA 3ONBA 2R24A 1W1PA 4CVUA 3O6DA 4UMCA 2NQ9A 1KM6A 2V5DA 4Q8OA 1PS9A 1SJBA 1UUMA 1VJSA 3VIIA 3ARXA 1CENA 3KS6A 2J6VA 1TWZA 3M0KA 2QCCA 5I3KA 1H41A 1TZ9A 4FO4A 2W6RA 3RFAA 2DSWA 3W2LA 2TSYA 2DZWA 1A5LC 2MANA 1P0BA 1W0MA 1A0CA 1UKQA 3E38A 3HOJA 3EX4A 1GZGA 3SUUA 3CBWA 4H8HA 5AZ1A 5LGXA 1KBKA 6TIMA 1LLOA 2ZDSA 3N9SA 2I9EA 4JOMA 1FRBA 2DEPA 2ZX7A 2ZICA 2VX5A 2VFGA 2J13A 2BMBA 1HXJA 1GW9A 4PA8A 2NXHA 4R34A 2BOFX 2VDGA 2RAGA 3H6OA 1TE6A 1EDGA 1ZTVA 1I2PA 2DZAA 4MB1A 2Y61A 4AVNA 3JS3A 5C2XA 1J93A 1FTXA 5FL1A 1CTNA 2E6FA 3P2VA 5BOEA 3AI0A 4B91A 3N19B 4PRRA 1R9ZA 5G4EA 2XFWA 4DEFA 3K1GA 3AYVA 2Z0IA 1R0MA 4JQ3A 2Y7FA 3CV1A 2XM2A 3FW6A 3T8LA 3M64A 1TCMA 1P1XA 4WY0B 3UGVA 5AC6A 3I6TA 3M9YA 3V1HA 1N7KA 2GJXA 3SN1A 2CZDA 3EDDA 2PF0A 1TWSA 3FSTA 2WHMA 4QFUA 1FWCC 1SMAA 1YRRA 2RGMA 1VEOA 4ML4A 5EMMA 1W9BM 1XSKA 3E5PA 3E2SA 3KVJA 4IXXA 3PPHA 1HKKA 1OK6A 3HJZA 4JFWA 4GO8A 4S3JA 3I65A 1XH2A 4R27A 3JR2A 2CLKA 2R1KA 4XD4A 2E67A 2GJPA 3CAQA 4ZO7A 2JKAA 1G5AA 3GG7A 4TX6A 5AC7A 3EWBX 3IIZA 1I45A 4F0HA 3REQB 2QGHA 1OIFA 1W91A 4UNKA 3A4WA 4HYWA 2VR2A 1OSEA 1Z32X 4PMOA 5ABGA 3TC3A 1UMYA 4FX7A 1V79A 5FIPA 3SW6A 2VM8A 5CXPA 3FA5A 2C0AA 3IIOA 1ZALA 1L6GA 5AYZA 4GJIA 4LH8A 3A13A 4FLQA 4ZOCA 5CH9A 3GBDA 5HOSA 5G1MA 1PYFA 3TKFA 3N6QA 3M0HA 4LS1A 3VOGA 1C8YA 5C70A 4HOXA 4FNQA 3KCLA 3SJNA 3UWQA 3IJ6A 2JKEA 5D09A 3P62A 4WZHA 4AF0B 1Y8BA 1G0CA 4P7QA 3AYSA 2PD5A 3PZOA 3AZTA 4XBSA 4LCSA 4ATLA 1OD8A 4NZ1A 2OEMA 2HVMA 2FDMA 1DKWA 5A2CA 5HPOA 4AX7A 2P8BA 1TYGA 2PWUA 3NVTA 1F6KA 3K2GA 4KGLA 3GKAA 2YLLA 4XO7A 3R5EA 3VM5A 2PDWA 4AHPA 3LI1A 1C8VA 4I5RA 3ES8A 3BMXA 4ERAA 1U30A 3CJPA 5D32A 1JZ8A 1J0ZA 4UTMA 4C6KA 4UZSA 5REQA 2BHZA 4LF2A 3BICA 5IDZA 1UG6A 3F1QA 3WDIA 2JEQA 4IJCA 1KD0A 4JTRA 3VIJA 2GOUA 4OOUA 5EKYA 4TMBA 2ASHA 1K4GA 2QULA 4IWWA 4Y90A 1PV8A 2QHAA 1ISZA 3TE9A 1OK4A 4GUHA 4FEZA 3PBWA 3QC0A 2A79A 4UFMA 3CPGA 3MKKA 4H6EA 3EKLA 3WBAA 1HP5A 3GTHA 1OBAA 1LG2A 2XU2A 3DFHA 1EUNA 5FI8A 1JDFA 1UWRA 4H8UA 5DX7A 2FFIA 3BQ6A 2BSLA 3N6HA 2HDJA 2FIQA 2XGBA 3VGEA 1K6WA 3NO1A 4W7WA 3I10A 4HZMA 2V8ZA 4QE4A 4X9YA 1M7JA 3NAVA 4IQEA 3BV7A 1JGIA 5CLWA 1K8YA 2J6XA 4GI9A 3CB3A 4Q8MA 4PEKA 4L9ZA 2WZTA 3THCA 3RIKA 2FFCA 2VO5A 5C9UA 1P0EA 2VCAA 4DAFA 3L7RA 5CPMA 2V3GA 3N2OA 3S8HA 3GTIA 3GBEA 1MXSA 3CT7A 1FVPA 5B7YA 3S6DA 4Q8VA 2ONEA 3LCLA 2GSJA 5GJMA 3P93A 3NQVA 1EXBA 2XGIA 1EH9A 1ALDA 2V81A 3T08A 4IFOA 2FTYA 2PTWA 5PTDA 3EEZA 3LGGA 1ZQ5A 1PL9A 3FDKA 3G0SA 5AN7A 5TQLA 2VX7A 3TX9A 1OQFA 3UF9A 2Q3OA 2CWXA 3T05A 2DW7A 4JKKA 3MWAA 3R4IA 1F8IA 3XIMA 4GQQA 3EGJA 5F1VA 5BRPA 4S2CA 5AOUA 3RLGA 1EGZA 3PTKA 4O1CA 3WF4A 1MW2A 3GNPA 1W56A 4TMCA 1ADDA 1DORA 4F4RA 3GXIA 3FHAA 3C0JA 5D33A 3H4WA 4U31A 1OCJA 3VIFA 1ZBVA 4YU1A 3EDJA 4W87A 4OKDA 3I7SA 3U4AA 1A3HA 3C8FA 4HCHA 4OV4A 4UTLA 4H9MA 1DBTA 3R94A 3RYSA 3WLLA 4DWSB 2ZUVA 1B30A 1EX5A 3CQKA 3PFRA 4PC8A 2DH2A 2V2HA 2X09A 5K3VA 3LYEA 2J79A 4H9VA 3GU9A 3RO6A 4D6DA 4AZHA 3PUEA 3TXVA 3MHUA 4ADSA 3H7RA 3IJ9A 3M4HA 1T96A 5HNRA 1WZMA 1UZ4A 4GG9A 1LROA 4US5A 4NL1A 2HVOA 3TXZA 4LALA 2QCNA 3MP5A 3H26A 3NQBA 3WL0A 4YWSA 3RCYA 4BI5A 1JULA 1E4IA 1YPIA 5E70A 3O6CA 4B2DD 1WQ5A 2IPFA 2ZRYA 3T8QA 5C7VA 2V38A 1EP2A 2ISFA 3N4FA 3WFAA 3BARA 1E72M 3ZVIA 1I2NA 1WYIA 1S5WA 2JF7A 3LPOA 3UZWA 3UYCA 1GG1A 3H53A 4JZ5A 3GR7A 4AHOA 4R7WA 1KCXA 3ABSA 1E6PA 1A47A 4ADUA 4YVXA 5I3HA 2J7HA 2INZA 3U7BA 2BP1A 1TMLA 1FWDC 3WK3A 3L5LA 1CB2A 3K4DA 5FEPA 4GYFA 3CK5A 1KTNA 2YL8A 2AGTA 3BLDA 3OHMB 4M81A 1U22A 3QRHA 2HZGA 4JHZA 1QVBA 4HNUA 5GQBA 1Z89A 3L12A 5FJUA 2NQZA 5F2IA 4RXFA 4YN5A 1E4LA 4H6QA 4W5ZA 1NAL1 2GDQA 5BRBA 1MDLA 2A1YA 3N9KA 5IFTA 3INPA 4JY8A 3VD5A 4IZGA 3CUFA 1SW0A 3KW3A 2C1HA 1MFVA 3AAMA 5CZKA 2FLIA 3N2BA 1KXQA 1XI3A 3ABQA 1PTDA 4QTGA 3M6YA 1HJXA 1MMFA 2NUYA 3SI9A 4PUKA 2CCRA 3T2OA 1RQHA 3TTEA 5IBXA 2UWFA 1W54A 3LLDA 3P80A 4LW7A 5JVLA 1Q7ZA 5LNRA 3EOOA 3UR5A 1F3WA 3DUGA 4TVDA 2Y7DA 3ARPA 3CV6A 3PZVA 3TN6A 4IMCA 1JCTA 4E8GA 2ZUSA 3A24A 4KWUA 4JDYA 4KRTA 3LCIA 1DXIA 1MVYA 2IXVA 4H6RA 3HM7A 3NQ8A 4F40A 1J8VA 1EQPA 2WQDA 2OLSA 1O7AA 5A8QA 3GVWA 3BL3A 4UC5A 3ALFA 1UH3A 1LJYA 3AHVA 1X6LA 2IKJA 1TQXA 1J6PA 4E2VA 4H3DA 5FAJA 5AYBA 1JFXA 1TWIA 3CB8A 2OZ0A 3ID7A 1D7KA 4X61A 3CHCA 1KRCC 4XQ6A 5HMEA 3UP8A 2IKIA 1A5OC 4E4FA 1BG4A 1DHPA 2BVDA 1KO0A 2PGEA 1FH8A 1W1B1 5CG7A 3EA1A 2XIJA 4G5DA 5A3HA 5A8PA 1E5NA 2YFOA 3GUWA 3MI6A 1OJXA 4AAJA 2GDUA 3DGBA 2GOKA 3GTFA 4OTKA 3VO0A 3GZ3A 1DQXA 3GZAA 2A6NA 3EWUA 4UTFA 4ZGYA 4AD3A 3A6OA 2Y1HA 3L5MA 2Y24A 1KR0A 4MUZA 5IM51 4PL1A 1VPXA 1M1BA 3WLRA 1C9DA 1FH7A 1DEDA 4GIAA 5AHLA 3UWVA 5JUVA 1X6NA 2E1DA 1FWAC 2AAAA 2GYIA 1Q2RA 1YQ2A 2ZRVA 2OZTA 1L6SA 1XINA 1NF7A 1A4LA 3W2MA 3AO0A 3WLTA 4C1KA 4MPQA 4E2BA 2Z25A 1XIHA 1JDCA 1DIDA 3TMLA 2ZCGA 3VMPA 3G1HA 3NVDA 5D2VA 1QOXA 1RJRA 1DWIM 4UIOA 1OFRA 3HG5A 1FHVA 5AVNA 3A12A 1ODZA 1XIGA 1KQZA 2BWGA 1J0IA 5IOBA 1ECEA 4PMQA 2BGSA 4Z0JA 3GSMA 1NU5A 3GFYA 1IGWA 1TRIA 4RDZA 3DHUA 1HNYA 1KRAC 4LWWA 4G7EA 2ZRWA 2Q09A 2QUUA 4WJXA 3EKGA 3IPWA 4UTHA 4QQUA 2VFEA 1T6MA 1IIGA 1E6ZA 3STCA 1DJWA 5U7SA 4YS1A 4JYFA 3GVGA 3E0IA 4O19A 2FMOA 3XISA 1G1YA 2QJMA 1BQCA 2GJXB 3QTGA 2IW0A 3IIVA 3ITXA 4D6IA 2WBKA 4NU7A 1NQKA 1TPEA 2B81A 2YGYA 2V5KA 3HQNA 5IXEA 4KWVA 5D2TA 1XRSA 1TTIA 3LCXA 4MWAE 1I0BA 2CITA 4NUWA 1CXHA 4Z17A 1ZFJA 4PTDA 3FCPA 4JHMA 1OM0A 2NQ5A 4O53A 2A3BA 4ONVA 3RM9A 1ZU8A 1FCVA 1MEWA 3LM7A 5BU9A 1WBJA 4JTEA 3WLQA 3WNKA 1TWWA 2CZEA 2PE4A 3VZYA 3RU8X 4XK2A 3W7RA 3QFWA 4HGXA 2V0TA 3H4XA 3W07A 2WJEA 3GG0A 5TD4A 2DSVA 3B9OA 1LWJA 4H7CA 4BR1A 2FVLA 1VGAA 4TV6A 4ZO8A 1ML1A 1NSJA 2BZNA 3GTXA 5AVHA 3PP7A 2ATMA 4CGTA 3H22A 4NYYA 2G50A 4AWSA 2YW3A 1SZNA 3C6CA 1KLYA 3W6YA 1LCOA 3AUJA 5BZAA 1KFEA 1JYWA 1KXHA 5XINA 2O7SA 4A4AA 1EDQA 1W5OA 2BHYA 1KKOA 3E0FA 4E3TA 3WN6A 4XX6A 1N8IA 2ICSA 3LBMA 2HROA 3GXTA 3ZSSA 1L0PA 1SO4A 2WVVA 2J47A 3MUAA 5CBJA 3ZT7A 4AYGA 3MPGA 5AC8A 5D37A 1T41A 3UVIA 1EWDA 2DQXA 4LY4A 4ICCX 2REQB 1E71M 1IEXA 1IXPA 3AIBA 1E0TA 4FSAA 3V1PA 2VOMA 3U3HA 4UWMA 3GHTA 1XIEA 1BPLB 1YMYA 2G95A 2IXUA 4GISA 3B8WA 3V0TA 3RGTA 3H2EA 5EMUA 2D22A 3MSGA 4NJHA 3P7YA 1SW3A 2FB2A 2JIWA 3OLGA 2YX0A 1HFBA 2R1NA 1PTGA 4WXYA 4YCOA 3WDHA 4MB4A 5REQB 3T0CA 3PWGA 2VENA 3MMTA 2Y5SA 1XX1A 1C3FA 3RM8A 2FGBA 3W7PA 4O15A 2JF6A 4XZMX 1PIFA 1J2WA 3FAXA 1EHAA 2VFFA 3AXKA 3GXNA 4C6EA 2X1IA 4RW5A 2Z1BA 3S42A 1X6UA 3IGSA 1LLWA 3KZSA 3VOCA 3TQ0A 4M56A 1ZNNA 2HCVA 2VYOA 3HTWA 5XIMA 3IIXA 2IQ0A 5FL0A 3O63A 2E28A 2C1IA 1NY1A 1YDVA 3L23A 5IDIA 4HD5A 1WDPA 5CCZA 1VPYA 2ZVIA 3QMTA 4GH1A 4Q8NA 2DJLA 3RUBL 4MKSA 2ZQ0A 2J62A 2FTPA 3VNZA 3MCOA 3DI1A 4D6HA 1JZ3A 4HZ6A 5D9NA 3LEPA 4WJ8A 2OFJA 3DFTA 2QUMA 3AMKA 3BQ5A 3TTYA 1ZAJA 4HIBA 6XIMA 1P0KA 1YYAA 1P43A 2W67A 4IUOA 3ZT5A 5CPSA 1FWRA 2GJNA 5BW6A 5ABFA 1N2VA 2DT0A 3LZ3A 2QZRA 2GGGA 1A5UA 3A21A 4GC4A 3PZNA 4QJ4B 2WAGA 4NNAA 3KBNA 4CQAA 1X97A 1GTEA 3H4GA 3RRAA 3E2RA 4NG3A 2NVDA 1Q4WA 5LZLA 3S5SA 1SO3A 4O52A 1Q6RA 4ZTYA 5B80A 1BXCA 3HPAA 3LQLA 4XV0A 3W1NA 3S9ZA 3AWNA 1FX6A 5BMXA 1AH4A 1C8QA 3AIUA 3RAOA 5D2XA 4R33A 1ZCCA 2CLMA 1HGWA 1JPHA 5CJ5A 4W85A 2W62A 4LVFA 5EL1A 2V3DA 1F74A 3N17A 1WOBA 3HIJA 5F4SA 3VX1A 5KZ6A 5A8OA 4A22A 2VI0A 4Q8WA 5A69A 1UBPC 3WMCA 3QLLA 1QI3A 4QSHA 1JZ2A 1TR1A 1U1JA 4MOZA 1ZY9A 4GXPA 3G22A 4HTBA 3SY8A 4TX9A 1UA3A 3THDA 4XUYA 7PTDA 5D9PA 2WSKA 3NQ2A 4NIRA 4UQAA 1D8WA 2YPIA 2Y2WA 3DGRA 2V3EA 5FCZA 4B4HA 5J5DA 1DQUA 4JIIX 4L5ZA 1Q8AA 1JYVA 4MJZA 3KP1A 4AMAA 3Q65A 3IUIA 4L64A 2I17A 2VEGA 4ZB2A 2XSXA 4AUBA 1R2TA 1S3TC 1WAUA 2VUYA 3POCA 2VGBA 2C15A 2B4GA 1EC8A 2C6QA 1WAWA 1X38A 2DIEA 2CETA 3O0KA 3CC1A 5C9WA 3N15A 4UFHA 4J1OA 3UWYA 1G7VA 3PSVA 5HATA 2C71A 3MU7A 5F4XA 1UR1A 2OEJA 4GQGA 2YIHA 4LEFA 4UOQA 2X0HA 3WQ6A 1KWGA 1M7OA 2VHLA 5K2ZA 3LV6A 1K7FA 4C7GA 2PLCA 3GDTA 4IMAA 4W7UA 4IGSA 1TMHA 3URQA 3AALA 5E9AA 4HNVA 3CEUA 1P6WA 1MFUA 2KX9A 4DI9A 4W86A 2PRHA 3GO2A 4L61A 4DO5A 2BGNE 3EDKA 1XIBA 3N04A 3M0VA 4LC6A 2OQYA 3U2ZA 1ICQA 2PLMA 2O55A 5EBUA 3BAIA 4LEQA 1KV8A 4N9DA 3TN4A 4M6VA 1UOKA 1V02E 3IGXA 5DRIA 3TC6A 3GUGA 4R85A 1DQWA 1UD2A 3VNJA 2GJLA 4B5XA 1X8CA 2PTZA 4IPIA 3CV7A 4HMDA 4U33A 4KS0A 4DUVA 3NQMA 3W7NA 2WPGA 3NSNA 1X7IA 3O9NA 3PTDA 4HJWA 3OLDA 2YB4A 4C1LA 5A6BD 1KFWA 3P5ZA 3QTPA 3NR0A 2NVAA 1I4NA 3IEBA 3UCQA 3PBGA 5FJJA 1QW9A 3T44A 4HPXA 5FEZA 3UD6A 1WX0A 1KLZA 3KTXA 1OT2A 3CPUA 2C91A 4FX8A 3SR7A 1B4KA 4GYPC 2PTYA 3FKRA 3M5XA 3KOZA 1D2KA 3QYSA 3M46A 2DIKA 2EO7A 3ME3A 2VX6A 2C8NA 3FY1A 1IZCA 4JX4A 4C7FA 4BK9A 5HMDA 1EOMA 3C0SA 4F0MA 1Q45A 3R1ZA 4H83A 2NQHA 2H3BA 1Q6CA 3GC2A 3MSDA 4DO4A 2CESA 2Y5EA 3N2TA 3KHJA 2OZ8A 4J3VA 3NGJA 5LXXA 2XN1A 3A3XA 2ZFAA 2Z1XA 4J3TA 1QFEA 2V68A 3W7DA 1ME8A 3UJFA 3N2XA 4TTUA 2ZZ2A 1E43A 2EQDA 4PMDA 1XLLA 4N9EA 5CG0A 4IG2A 4QLJA 3SM0A 4CVWA 4ZL1A 4NZFA 1JRBA 1N8FA 3APGA 1OIMA 2VZOA 2DZTA 2Q3RA 4IIDA 4DJDC 5AECA 3BLOA 1IT7A 1CX9A 2BNJA 4GKLA 4L6DA 3RX2A 4JTTA 6REQA 3MDWA 4MF4A 1R85A 3TUUA 3AS0A 3VVGA 3KTCA 4HU8A 1G7UA 1U1UA 1ZP3A 1YDYA 3HO8A 1KC7A 3W9ZA 4D9PA 1OZQA 2EPHA 4BJHA 1HZYA 5CZTA 4ORIA 3WELA 3SURA 3LV5A 2LLEA 4E8DA 4QROA 1X1OA 1TR9A 2HEJA 2WHJA 1DJGA 3DYOA 4YYCA 4IM4A 2CHOA 4EP8C 3K4AA 3WFLA 1QO2A 2C1GA 1IZJA 3CHDA 3VGDA 4KERA 4GZIA 1PKMA 3ANYA 2V6AA 3PWAA 5D30A 3GAYA 3W1AA 4OUIA 5M5DA 4IMEA 1DJQA 3M0YA 5EFFA 2ZWZA 4UTWA 1JI2A 3NM3A 3CMFA 4FIRA 4XKYA 2ZBTA 3H70A 3NXLA 3TOYA 3O05A 5D04C 1H7XA 4PTXA 4QDMA 2BVYA 2VEMA 3FGCA 4HSOA 4ZB0A 1ECQA 8CGTA 1WCGA 1DE5A 4QJ5B 1CZ1A 3LRMA 2X2GA 2XJ7A 3RG6A 3L4UA 5I03A 1GCYA 3E96A 1S5TA 4O0KA 2QKFA 2YDQA 4DXVA 5J5RA 1JD9A 4Q3MA 2ZC8A 1M53A 4MZ8A 4G7EB 5K9XA 4HYRA 4RNHA 2VD9A 2BOEX 5I09A 3FEQA 4JL2A 1P48A 4PCPA 3W85A 3WF2A 3EXSA 3MUY1 4AD5A 1QOQA 2C18A 1CNVA 3WNOA 3UWWA 4ZO9A 4WGHA 5I07A 3BOXA 4D8ZA 2G5WA 5KZDA 3SEPA 3U2OA 3OG2A 3CASA 1JCNA 2J66A 3W72A 4LB3A 2E9MA 1ZS2A 1JZ4A 3B3DA 2Y4SA 4PMVA 5A6MA 3H2AA 1US2A 2WK2A 2YBVA 3NUKA 3VDAA 4OFCA 1E9ZB 4AIUA 1BEUA 3PANA 1H51A 1QI2A 3L2MA 4U28A 1LOQA 2NX1A 3S2NA 3NZQA 4DZIA 1V4YA 4BQ2A 4DXXA 1MYRA 4N6FA 4ZXLA 4DLFA 1UWIA 1AH3A 5HINA 5LHEA 4JGDA 3NL5A 4DYKA 3STFA 3B04A 3EX1A 4H7ZA 3PNUA 3ZMRA 1W9PA 3M7WA 4MYXA 2EPMX 3S9IA 5E0CA 1QASA 4IX2A 4UR7A 2XFYA 2R1MA 2X05A 4C5YA 4OOZA 1BTCA 4IHCA 1JZ6A 4CQBA 3MO4A 3QPEA 1QU4A 1LOLA 3E9AA 4GJJA 1P4CA 2Z1KA 3O06A 2AQWA 4LUJA 2NUXA 3WDQA 1N8WA 1AW1A 4U5IA 3OODA 4FS9A 4DF0A 1F2JA 1TKKA 1V3HA 2AAMA 4N42A 5FSEC 1Q6FA 2DVTA 1YXDA 3EXTA 3F4DA 4TO8A 3VZXA 1TIWA 4JX5A 1B9ZA 4B92A 1XRVA 4C6QA 5FEWA 3UXDA 2WVVB 3ZWSA 3S1XA 3Q67A 3AS1A 4MWAC 3GVVA 2GQ8A 1F7BA 5LIYX 1S5MA 2YL5A 4HMNA 1WV2A 4Y9NA 1KA9F 3KRSA 2PDGA 4UB9A 3VDBA 3RITA 1ITXA 4B5WA 4FF5A 1PBGA 1JPDX 3K8LA 4NKCA 5I3JA 1HIZA 3MYOA 5F7UA 1TO3A 2C79A 5DCEA 3ARZA 2CFFA 2J74A 3LZ5A 1R2SA 3PWIA 2F8QA 2V5JA 5DF0A 2FPYA 4LYKA 4F9JA 5F2GA 3OIXA 4L4PA 3LPFA 4V27A 2NWRA 3OBEA 2CYGA 1OX5A 2HPMA 4K7YA 1W9UA 1JF6A 2FTWA 2WMJA 5I06A 3DIPA 1K8ZA 2DJXA 3WQ5A 4UTUA 2EAWA 3BAJA 1GZ1A 5LGZA 4J3WA 3IAPA 3V0UA 1F6PA 3WQ4A 1NWUA 3NQCA 3R0KA 2BLEA 5CC7A 8TIMA 2VGFA 1RY8A 4YTRA 4GUGA 3C2EA 2L5HA 1UP3A 3I3EA 4NZCA 5KTLA 3RR1A 4G8TA 3J7HA 4EPDC 5T91A 3ORWA 1R3VA 5AYYA 5IFPA 1IT8A 4NJGA 2KZHA 2P8CA 5DEZA 4Z1DA 1SW7A 4GO9A 3CWOX 1OYBA 2YA0A 1PAMA 3LA4A 4FXFA 3U6WA 1XRTA 2NSXA 2V5BA 2RFGA 5I24A 3AMDA 4YIWA 1TVLA 3WH7A 1KFKA 2VWTA 2BODX 2FGZA 3TSBA 1E40A 3WUFA 5ABFB 3W3OA 4PBEA 4RPQA 1S2WA 1G69A 3M43A 4BCEA 2ESCA 3LGEA 2Y89A 3BCFA 3S5OA 1BG9A 4YVVA 3USBA 4Q8QA 4WCJA 3TA9A 3MA8A 4G7FA 4N7QA 3PJXA 4FAMA 1AH0A 2FVMA 2GZXA 3G1DA 3P60A 4URIA 4HCDA 4Y8FA 4RV3A 5FF2A 4CD7A 4A8NA 1KNWA 2OEKA 4LBSA 3AIRA 2WSRA 4ZMGA 4LTSA 1E15A 3ES7A 3DHPA 4E8CA 4PMNA 1NOWA 4O50A 3HB9A 3M5VA 1XYCA 1MUWA 1JUEA 5JBDA 3I7QA 4V1YA 3LPGA 4IMDA 4F8XA 1Q3NA 3NXFA 1I6NA 4XAZA 4O18A 1U5VA 4O14A 1V3JA 3N2MA 2ZRXA 1PJ9A 4LOCA 3STEA 5LIXX 1NDVA 4W8LA 4MDOA 1X1NA 1W1VA 5DY3A 3OGVA 3QZAA 3GNOA 4JTHA 1OG0A 5D03A 1HO1A 4BWLA 3EWDA 2CERA 3UPMA 4Y2WA 4UOZA 2I5IA 2JALA 1V77A 5KZEA 2D0FA 2IPWA 4JTDA 3MSYA 2BHUA 2NSOA 5G1YA 4JTFA 3EYPA 4KCVA 1RLDA 2A3HA 4CLMA 2FH8A 3KDNA 2FHCA 3KZPA 1W3NA 5EY5A 4IFRA 1H7PA 3KWSA 4M6QA 3W1MA 2UZ9A 3K30A 4C6BA 3P67A 6TAAA 2ZXBA 3UJSA 4PMRA 1PPIA 4CD6A 1VCGA 4MY8A 4NJKA 2QYGA 2PB1A 4P8XA 1L8NA 1I75A 2WKLA 2CBVA 4GI8A 2OZ3A 3MB9A 4E4UA 5ECVA 4K8HA 4EE9A 4DJFD 2C3ZA 3HPXA 1VB9A 4G1NA 4A2SA 3NJ3A 2GVEA 3PS7A 3KP0A 3UA4A 3G3MA 1OGSA 5D9OA 1H0GA 2FKPA 3ZFHA 4HPJA 7ENLA 3FS2A 1R86A 1FWWA 1KM4A 3C3NA 3LDVA 4MJ2A 1CXKA 4ROPA 3W2UA 4LBRA 3W7GA 2QJHA 3MUIA 1R3SA 4GNVA 2VZVA 3KOFA 1XJBA 4O16A 1SQ7A 3TJLA 4QP0A 3C2FA 9CGTA 1XSIA 3S6OA 5HULA 3SBFA 4FI4A 5FF7A 4MSSA 1K1DA 3MJMA 4EF8A 4E4PA 3W1RA 1S3HA 1LL4A 3AU2A 3RMJA 2P3ZA 2PWGA 1GK8A 1SO5A 1KBBA 2E4TA 2PEVA 4BF9A 3EWCA 4RJEA 4IP4A 4JPGA 3UY8A 4NY2A 5HMSA 1EC7A 2YXOA 3MW7A 3NSXA 1VQTA 1WXJA 2EPKX 1JZ7A 1G4SA 3NSMA 2JQXA 3VD3A 4PMJA 4ERGA 4Q6JA 4B3LA 2W66A 4WKHA 1MEIA 1HVQA 2WXDM 3AIVA 3LI0A 3U5YA 3VKJA 1H5VA 4P5UA 3RPMA 1BKHA 4B90A 3EAUA 5CC6A 5HQEA 2VT0A 4XZBA 5K9CA 2GL5A 4RK8A 2CZVA 1IWAA 4GYKA 4Q4RA 5LKYA 5E0KA 4H4IA 3BAXA 2H6RA 1FXQA 4CU7A 2PDBA 1RK5A 1VLIA 3MP3A 5J04A 4A8RA 3A9BA 5F2LA 5FOOA 2VWSA 1W1A1 3DESA 4DO7A 4O8RA 3V5CA 1KWKA 3VIGA 4F79A 4M3PA 3CV2A 3GB6A 4S3EA 2WMIA 3MMDA 1ZENA 5DLCA 1GKRA 1O5RA 2JK2A 2PPGA 4DUWA 3BG9A 4KF1A 1DV7A 2PA6A 5AC4A 1SM9A 3CO4A 4QG8A 4KFPA 4NVTA 2DUAA 4HYVA 1W3KA 1OC6A 1HP4A 1AW5A 4JTUA 3C2RA 1VFTA 4RE0A 3A9IA 3OVPA 1IXNA 3CL8A 1DWJM 4IF2A 3NFUA 4G9PA 4GZJA 3TYCA 5BXRA 1CB7B 3B0PA 4N0RA 4A3HA 1DWHM 2OOFA 4GYJA 4IG2B 3WDPP 3VK5A 1CCWB 3U8GA 1HKWA 2GJRA 2PUZA 3OYZA 5D02A 8RUCA 2V9DA 5CPLA 2Y63A 1VENA 3VD9A 1YIXA 3W86A 3G6MA 4Z1CA 1KRBC 3R8HA 5I3IA 3PNZA 1XD1A 6REQB 3WF1A