4JIRA

Crystal structure of aldose reductase (akr1b1) complexed with nadp+ and epalrestat
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
316
structure length
316
Chain Sequence
b'MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Inhibitor selectivity between aldo-keto reductase superfamily members AKR1B10 and AKR1B1: Role of Trp112 (Trp111).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2013-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jirA00
2P5NA 1T40A 3V0UA 5KETA 3LBOA 3UGRA 2PDFA 1Z3NA 3UZXA 5AZ0A 4XZHA 1C9WA 3R94A 3CMFA 2BGQA 3LQGA 4QBXA 5LIXX 2HE8A 2IKHA 4XVDA 2IKJA 3N2TA 2PDXA 2FZDA 4HBKA 3D3FA 1EKOA 4MHBA 4XZMX 1AH3A 3M4HA 3T42A 3R8HA 1QRQA 4JTCA 3KRBA 1Z8AA 2PDIA 4XVEA 1US0A 4YS1A 5HA7A 2PDGA 3LEPA 5LIKX 4LAZA 5LIYX 4YVPA 4JQ3A 4YVXA 3LZ5A 4WRHA 3BUVA 3UZYA 4PUWA 2BP1A 4LBRA 4WDXA 4GA8A 4PR4A 1XGDA 4HMNA 3LQLA 4ICCX 4Q7BA 1QWKA 3CV7A 1PWMA 4XO6A 3G1RA 3WBWA 2IS7A 5C7HA 4RPQA 4YU1A 2PFHA 3BCJA 3RX2A 2NVCA 2PF8A 4XZIA 3R58A 1S1RA 3EAUA 1GVEA 3EB4A 2FZBA 5JH1A 3U2CA 1YE4A 1YNQA 1JEZA 1S2CA 2ACSA 2HE5A 1J96A 2PD5A 3GHRA 4F40A 2A79A 4QX4A 4JQ2A 2IQDA 2J8TA 4JQAA 3R7MA 2INEA 3P2VA 3CASA 2R9RA 3CAQA 1EXBA 3MC5A 4PUUA 1AZ1A 1RY8A 1SM9A 3UYIA 1OG6A 2INZA 1K8CA 2IPJA 4NKCA 4GIEA 4EXAA 3B3DA 5HNTA 4XK2A 4L1WA 1RALA 2HVOA 4WDWA 1XF0A 4FA3A 4WDTA 2PDNA 3GUGA 2I17A 1A80A 4JQ4A 2PDYA 4PRTA 3LN3A 4LBSA 3UFYA 4JTAA 1PZ0A 4EXBA 3Q65A 3S3GA 4WGHA 5LIUX 3V0TA 2FVLA 1HW6A 2DUZA 4DBUA 2IPGA 4G5DA 4DZ5A 3BV7A 1EL3A 4AUBA 4DBWA 2WZMA 4R9OA 3M0IA 4GABA 3H7RA 3V0SA 1S2AA 1Z89A 2HV5A 3ONBA 4GACA 1EF3A 3R43A 1YNPA 2PDPA 2PDJA 3LD5A 1AH0A 3GHSA 3LNMA 2FZ9A 5DANA 4XAPA 3UP8A 1FRBA 1AH4A 4JTRA 2FGBA 2PZNA 4FZIA 2AGTA 1X97A 1PZ1A 1PYFA 4IJRA 1Z9AA 4LB4A 1IHIA 1R38A 1LWIA 1LQAA 4GCAA 1S1PA 3H4GA 2PDCA 3WBXA 3EB3A 3LENA 3LZ3A 4PRRA 2ACUA 2C91A 3RX4A 3DN5A 3V36A 4FALA 1YE6A 5JH2A 1T41A 2ALRA 3G5EA 2IQ0A 1MZRA 4LAUA 4DBSA 3C3UA 4YVVA 2F2KA 2IKGA 3UZZA 2R24A 1XJBA 4JIIX 4IGSA 4GQ0A 2ACRA 4Q3MA 3CV6A 4IJCA 1MI3A 4JIHA 4QXIA 1AZ2A 2PDQA 2PEVA 3ERPA 2DV0A 2QXWA 2DUXA 3GHTA 2VDGA 3RX3A 3COTA 2F38A 3O0KA 2HVNA 4PMJA 4JIRA 3GHUA 2PD9A 1AFSA 3O3RA 4XZLX 3WCZA 2BGSA 2NVDA 5LIWX 2PDBA 1UR3M 5AZ1A 3UG8A 2HEJA 4I5XA 1IEIA 3FJNA 1HQTA 3UWEA 4XZNX 4WEVX 4JQ1A 1ZGDA 4OTKA 1ZSXA 2PDUA 3F7JA 2IKIA 3Q67A 1ZUAX 2PDLA 2CLPA 3VXGA 3FX4A 1Q13A 1VBJA 4L1XA 2PDKA 3ONCA 3LUTA 3R6IA 4GQGA 1VP5A 2ISFA 2PDHA 4FAMA 1Q5MA 1PWLA 4ZFCA 3V35A 4JTQA 5HNUA 2ACQA 2PDMA 3DOPA 3QKZA 3H7UA 3R8GA 4QR6A 4XO7A 2FZ8A 4JTDA 2HDJA 3M64A 1M9HA 2PDWA 2I16A 3UZWA 3CAVA 1X96A 4WDUA 3N6QA 2IPWA 3WG6A 4H7CA 4ASTA 1RY0A 5M2FX 1X98A 3WBYA 2WZTA 2IPFA 3NTYA 1ZQ5A 3BURA 1ADSA 4LB3A 3MB9A 4H8NA 1MRQA
chains in the Genus database with same CATH superfamily
4ZQCA 5KETA 2C16A 1EX1A 4IMEA 5LNWA 3MYOA 3ZR6A 4BF7A 2W62A 4Y8FA 3LQGA 4DNHA 1JPHA 4FP1A 1XSIA 4RUBA 1F3WA 4UXDA 2G95A 2PWEA 5EFDA 1SJAA 5JBFA 1TB3A 3W85A 5BXRA 3NZQA 4L4PA 1OZMA 3SN0A 2CHNA 1HXJA 3EDFA 5FEWA 1SZFA 4B91A 3SZ8A 1JNDA 2GZXA 3CH9A 4AW7A 3T78A 3KP0A 4NX5A 3RM9A 1L6YA 3QZEA 4TX8A 3EPOA 3ABOA 1GG1A 4Q4MA 2ZZ6A 2GGGA 2ZX5A 1G7UA 5IHRA 3BAXA 3ENLA 4K8GA 2OZ8A 1GVRA 4JIQA 5IXEA 2I5IA 2IMRA 3TONA 1L6GA 1QOQA 4Q4OA 3SCOA 4P7NA 3MT1A 4FHAA 1XIGA 1LUCB 2QVHA 5I02A 5AYZA 4Q8OA 3VKAA 1Y7VA 1J0KA 1BWKA 2R8WA 2JE8A 1WAWA 2B31A 5CZSA 2X0SA 3GAKA 4H6KA 4WK9A 3HOJA 4S3GA 4RPQA 1Q65A 1CB2A 1XC6A 4CU7A 2OT0A 1E4IA 3WD3A 4KCTA 4GHRA 2CZVA 1QR7A 4PMYA 1U1HA 5TF0A 1F74A 4NJHA 1KGXA 4AX7A 4PUNA 5C2XA 3EPNA 1Q7MA 1J6PA 1V4YA 3L4WA 4CVUA 3U2CA 4JTIA 1O5XA 3LOTA 4D6JA 1DIKA 2QKFA 1DJIA 1J96A 1R9YA 2HCVA 3I7QA 4FNQA 1V6VA 4YMZA 4H8VA 4E5TA 5D9OA 3TQ0A 4BFAA 2IQDA 1GOMA 2YX0A 1VPXA 1UMYA 1OFOA 1ZBCA 4AD2A 1FX6A 1WE5A 5ABFB 3PBVA 3UYIA 1NAL1 2O0TA 3W1QA 4ZCWA 5D8ZA 1E6QM 4EXQA 2IPJA 2D2GA 4LVAA 1BWVA 2CLOA 1Q7QA 4ZENA 4LS2A 1FKXA 9XIAA 2HVOA 2XN2A 2FZMA 3NEVA 3HG4A 1XRSA 1KFWA 2YL5A 1PIGA 1WQ5A 3WJZA 1YADA 1S2UA 4POCA 1ITQA 1DQWA 1QPRA 5CC7A 1PTDA 3WEZA 3DXIA 2YDSA 4M5PA 3DU0A 5GJNA 1JYNA 1T99A 1CLVA 2PTWA 4G7EA 5DMYA 3UR8A 3G2GA 1EA0A 4RE0A 3IS4A 4AXNA 2EPMX 3CLWA 5E5CA 2VFHA 3WBEA 1OINA 3IIXA 1YQ2A 3ITYA 1L8PA 1LWHA 3CQKA 4MFEA 4J3UA 1YNPA 3TXVA 1REQB 4FI4A 4QG8A 4Q22A 2QJNA 1DPMA 3FLUA 2FHBA 1JUEA 4S1FA 3S2NA 3DYOA 3O16A 3OYZA 2PTXA 5HJXA 2OOFA 3ZFHA 1N82A 4LSBA 4GYFA 3O15A 1JD9A 4K8EA 4XAYA 1N55A 3ES8A 1JDAA 4NNBA 1IHIA 4IJBA 4RDZA 1HJWA 4C6QA 1XP3A 4LUIA 3WBXA 3EB3A 1OFQA 1KFJA 4E6MA 4XB3A 3WQGA 1VBRA 4D1IA 5JBEA 2V2DA 4PEKA 1JZ3A 3WFAA 4Y9NA 2XFYA 3QMSA 1VB9A 4LAUA 4UFLA 2J77A 1MQPA 2C0AA 2YXXA 2ZZ3A 2GVGA 3C0LA 4N02A 2ZRWA 4XD4A 3QMRA 1GJWA 3M43A 1W17A 1JGMA 1QBBA 4B5UA 1KBLA 4GQ0A 3S83A 3OW1A 4DM1A 3L5MA 2BODX 2EG7A 1GQJA 4A3UA 1WPCA 1D9EA 1V03A 2IXVA 3RX3A 2HVNA 4JHZA 1NIUA 3QKEA 4U5KA 4WZHA 4C5YA 1UR4A 3CEPA 1GJUA 3S2MA 5BNKA 1GGOA 1J11A 3W75A 4D1JA 3JRKA 3IJ8A 1DE5A 5I23A 3V1PA 1PDZA 3CQJA 3TC3A 1TA3A 1RCXB 3ARVA 3AHZA 3N9RA 2ZXDA 1SO3A 3V16A 4QAIA 4ZSTA 1P0EA 2ZWZA 2DDXA 4FF7A 2WWDA 5M03A 4J40A 3FX4A 3B4UA 5KZMA 4MNLA 4L1XA 3N14A 2YB1A 1Q4NX 4Z0JA 3HQPA 3VD5A 3PNUA 3LXAA 1W56A 4D2JA 1PWLA 1EUAA 3LGEA 3ZM8A 3MSRA 4HA0A 1QPOA 1ME7A 3PBMA 4ZZ9A 1A3XA 1EYEA 5D9NA 3AYRA 3GVQA 4GLEA 2RGMA 4MPQA 4IMCA 3IIOA 3GAYA 4JTDA 3M64A 1GWJA 1VQTA 1BG4A 3NGFA 3UXAA 2ZWYA 4KBXA 2IQTA 3E5PA 5FF4A 1X96A 2D23A 1O5KA 4HNNA 4H7CA 3ITTA 3NAVA 4BQ2A 3WDIA 3P8IA 1M53A 3UETA 1HVQA 1HX0A 4LRTA 4X63A 1UCWA 2E1WA 4DZHA 5A3HA 5D9PA 3OG2A 3TVAA 1EP1A 1W5MA 4FLQA 1NOWA 1VFUA 3G8RA 4C6IA 4ML4A 4OT7A 1FHUA 3VKJA 4BEUA 4HN8A 1MDRA 5HMDA 3GYCA 1W5PA 2DY3A 3CMFA 2Q01A 3W1AA 5C6MA 2E6YA 2ZXQA 1Q6OA 3OLDA 1L6WA 3AIQA 3WNLA 2XJ7A 2A7NA 1GQLA 1LT8A 3WL0A 5C2CA 4C65A 2FTWA 3V5FA 1ZBWA 4JS3A 3AXHA 2Z1WA 3UBPC 4NJGA 4M6PA 4AD1A 3SRHA 2XIJA 3QR3A 1AG1O 1E0VA 2QUMA 3OVQA 5A8GA 1W9VA 4JICA 3VD7A 1U5VA 4NJIA 3M0VA 3CQHA 3R4IA 1J0YA 4F2TA 3TU9A 4LBRA 5KINA 3OHIA 3EKGA 4Y7EA 5F4XA 2NUYA 1C9DA 3R12A 3LRKA 4PGLA 4WDXA 1XQLA 2EBNA 3RAOA 3AHYA 2GOKA 4DWDA 4U3AA 1BGAA 3MP4A 4H04A 3A4XA 4LS1A 3BARA 3WQ5A 3EWZA 4HCHA 3M7SA 1PWMA 4KWSA 3I6TA 3AJ7A 3U2OA 5C7HA 1O68A 4N4QA 5DCEA 1I2PA 3H26A 3VCRA 4ZOEA 4W85A 3TK7A 3MWCA 5BMXA 5DN1A 1YEYA 1KV5A 3EAUA 1EOKA 1IEWA 2NWRA 4FS9A 2BFGA 3W88A 3WLJA 1J0IA 2PWVA 1YNQA 1EC9A 4AEFA 1CZ1A 3T40A 3L4VA 1TTQA 2OZTA 3TYCA 2A3CA 3TSDA 1V6TA 4LVGA 3GU2A 1QK0A 1R3WA 3CZKA 4TIMA 3PZMA 1XM3A 3GXPA 4O14A 5FEZA 4DAFA 1LRTA 1K3UA 4F79A 4TX6A 1MQRA 2WKGA 1QI4A 4GZEA 5E9XA 4FOUA 3C3NA 4EXAA 1IGWA 3APGA 5T91A 2JKAA 3BAYA 1D8WA 1DQXA 1TPH1 3P3BA 1AVAA 4Q4SA 1DV7A 4HYWA 4D6GA 2NLIA 2DZAA 5E0KA 5BMWA 1RA0A 1N2VA 5CPMA 4V33A 3N6JA 3W7RA 1QI3A 4PRTA 1ZAIA 1ISVA 4JTAA 3BOLA 4N4PA 1R30A 3S3GA 1EYWA 2PTZA 3TW7A 3ZJ6A 2F61A 1H1NA 1G67A 1RZMA 3B9DA 4BS0A 2IPGA 3I3EA 4AHQA 5A2AA 5HXMA 1KGWA 2GVJA 4DBWA 2Y7FA 2HTMA 5EPDA 1BKHA 2WPGA 3W25A 4XAZA 4QCFA 3URBA 5FSEC 4IUGA 3L7RA 3WELA 5A8OA 3MDUA 3LD5A 3E2RA 4LF1A 4IIDA 1BWLA 2FDMA 3OEXA 3QGKC 2FZ9A 3CUHA 3S2JA 5DANA 1UH3A 3CL7A 2NQLA 4MLJA 2J47A 1WUEA 3GNRA 1OZQA 1A49A 1QOXA 2X1UA 3GDTA 1FWSA 4HJFA 3OQ8A 1KCKA 3LHTA 2WKJA 1LWIA 5EFFA 3TA9A 4B9YA 3DBPA 4B90A 1V77A 3QRHA 3PPFA 2Q3OA 3A9IA 4J3SA 4I9AA 1UW9A 3UJSA 3Q2DA 3AXMA 3BW2A 4TV5A 3KTSA 4HA4A 3C3UA 3EEZA 4D6CA 5H91A 5MHBA 2FMNA 2HJPA 3TQVA 4PTWA 1R47A 3VC6A 1XJBA 4JL2A 3VD4A 3IUHA 4NJKA 4MY9A 3EGJA 4LANA 3GTNA 4GI8A 3QH2A 4JIHA 2G37A 3OPSA 1LZOA 3WL1A 1BVNP 2VDGA 1P4CA 2WSRA 3GHUA 3RCNA 2GGEA 2BBFA 3B8DA 1TCMA 2GJPA 4H6QA 3UG4A 3OO2A 3G24A 4TVUA 3TMLA 3GH4A 5XIMA 2EKCA 4YJ5A 3T4WA 3S5ZA 3ZS4A 3ZWSA 4AZIA 4AISA 4LGXA 2YCLA 1T8XA 1F3TA 4IICA 3G1DA 3W82A 5C9UA 1G4TA 3BQ6A 3PFRA 4Q4RA 1HQTA 3UWEA 2W4XA 4JQ1A 2JKPA 4UQCA 3WK2A 3NUKA 2HS6A 4CNOA 1B3YA 1OHLA 3UXKA 5B7YA 1EJXC 3PY2A 2NXIA 1GQKA 2DUAA 4N6EA 3S1WA 2ZUUA 1CIUA 1OD8A 2ZX8A 1NU5A 2E6AA 4ZXLA 3KE0A 3VZZA 1MXSA 3I4EA 1Q8JA 1UWUA 2E0PA 3EOOA 2XGZA 1Z7AA 3P74A 1HFBA 3OZOA 1XUZA 3W6YA 1K77A 3DFOA 2DP3A 3IJ6A 3T7VA 1M9HA 1JFXA 6ALDA 3RO6A 3UQNA 5JIWA 3BG5A 8XIMA 4YIWA 3MUCA 2VHLA 3S6TA 4MYAA 2IPWA 2RDTA 1RLDA 4EPDC 4DXKA 1V02A 3VNKA 2WSQA 4QE1A 3KOYA 1B5TA 3WN6A 5HNNA 3IJDA 5FL1A 4HIBA 3LBOA 4FLSA 4R3UA 2O4QA 1JD7A 4D6HA 1TUFA 3VIFA 3PJUA 2EF9A 2PTYA 3DFSA 4LAMA 1W3TA 4I6KA 1XLCA 1LYXA 5EMMA 3PUDA 5H8MA 2UY2A 5PTDA 1XIBA 1PKLA 3GC2A 3THCA 4GXMA 1FFRA 4P8UA 5A6SA 1ZJHA 3JS3A 1V6WA 1X1OA 3VGEA 3AIUA 2ZA1A 3L67A 2E09A 1FCBA 2NUXA 4ML9A 4HU8A 2HXTA 2PDGA 5CPTA 3KX6A 4J4KA 1B4KA 1WUFA 2ZC1A 2GQ8A 4UTIA 4Z1YA 3IJIA 1JG9A 1WDPA 3B8IA 2Q09A 2WC4A 3S46A 1J0JA 1KTCA 1QO5A 4HZ8A 4IL0A 1SFLA 3SY5A 1ZFJA 3PUGA 2O7SA 1U83A 1UKQA 3PM6A 4QEEA 2AAMA 4OVXA 3CZLA 2UY3A 3JU2A 4ZMGA 3DG6A 3N13A 1I2NA 4ZB5A 1QK2A 1VFFA 2V30A 3BCDA 3A24A 1I0BA 1RVGA 2WO5A 4CD5A 4AWUA 2C1HA 1IT7A 1HN1A 1ZPTA 2TYSA 2PTDA 5D32A 3NO1A 2BOFX 1BTCA 3KFTA 5I3IA 3FEMA 3UR5A 1W0MA 4JL1A 2PF8A 3S5SA 4FNSA 2ESCA 3R10A 1PE1A 4TU1A 3KRUA 3W9ZA 1KRBC 2P76A 2PURA 3SCTA 4V27A 4C6KA 5MKGB 4LOCA 5EGRA 5HDRA 4YN5A 2I9EA 4ES4A 3RU8X 1YE4A 3G1SA 3TXZA 4GUJA 2GOUA 1EJWC 3GHRA 3U4FA 4PBEA 2ZE0A 4ZQMA 3BG3A 3W7NA 4I9TA 1F3EA 1XLJA 5A2BA 5JVLA 2CU0A 1UR1A 4PC8A 4HZMA 5BXSA 4HNTA 1H41A 3QR0A 3AC0A 2VOTA 3TYAA 3LB0A 4PBGA 1UD4A 3GNXA 5A1AA 1QHOA 3HGJA 3UVAA 2QIIA 3WDQA 1YDOA 3A3HA 1SO6A 3B0VC 4HTBA 3NQDA 3H54A 2G8ZA 6REQA 4ZGYA 4BJHA 8XIAA 5GNZA 3LGGA 2DW6A 3LA4A 4Q8PA 5A5WA 2C3ZA 3KBMA 1N7KA 2QW5A 3W72A 3AU6A 2JKEA 2EG8A 4AIUA 3TZNA 1DOSA 5FKYA 4U2YA 3DX5A 2VZVA 4AXKA 1HW6A 3ISIX 3RM4A 4GKTA 1XBYA 2V0TA 1WP6A 2EG6A 5M1TA 5E70A 1M7OA 1X38A 1JYWA 1P0KA 1ZTVA 1OY0A 3KL0A 1XD0A 3LCFA 3RCYA 5A6LA 2I9UA 3CNYA 4IIGA 4G1KA 5IDIA 4JGDA 1BSLA 2WVUA 2WAGA 1MEHA 4EF8A 5T26A 1THFD 3YPIA 2XM1A 4FZIA 1NJJA 1GOXA 6TAAA 5GQBA 5JIPA 3UXLA 4OIFA 4TQTA 4JYEA 5FSDC 3C52A 1CBGA 5AC4A 1JCTA 4A8IA 3AHVA 1XV8A 2VC5A 3AIWA 4HA3A 3N19B 4O28A 4TVDA 1JCLA 1QW8A 1TMQA 3LENA 2HVMA 3KL5A 3H70A 3GW0A 1UA7A 3QEZA 3PBGA 1G01A 5A6TC 1K02A 4XIAA 1UR0A 4E4UA 4AD0A 1H1YA 4IGHA 4TTUA 5EBAA 4MB1A 3BAJA 1M68A 3B8VA 3UZZA 3WMBA 4JIEA 2VX5A 1QVBA 4P7RA 4JIIX 4PULA 1IQ8A 5LA0A 1BGGA 1TR9A 3DHFA 3SSZA 5E1QA 2QCLA 4FEZA 2QDDA 3AROA 3P61A 2ZUSA 1PL9A 1NTHA 3S6OA 5IHSA 3A4AA 1KCXA 4RV3A 3IGSA 2X09A 4XX6A 3PZUA 3T1GA 1E70M 1A5OC 4PMJA 4NJJA 3E2SA 1M7JA 4M7TA 4B5SA 3K1GA 4JKMA 2Y4SA 4K37A 3GM8A 1B31A 7TIMA 1LG2A 3MHUA 1DIDA 4WJ8A 3BZGA 5JMUA 1JULA 3WCZA 1OX6A 5A6BD 4ZEPA 3G1VA 5AKQA 4I5XA 5K9CA 1KM2A 3FYPA 3CUIA 2DZWA 2HISA 4JYDA 2OVLA 4MTVA 2AKMA 3LHWA 2R1KA 4OTKA 1Z6KA 3KRSA 1F6YA 3FGCB 3A21A 4C6JA 3TLQA 4RKAA 3K8LA 1EFZA 1F6KA 1TPC1 3L4TA 1JZ2A 4EP8C 5HANA 4M24A 2YA1A 3UWVA 2AKZA 4E38A 1JF5A 2ISFA 3GB6A 4ZFCA 4BR1A 1FWFC 2WC7A 4WKAA 4WSHA 3ZLFA 3R0DA 2FQIA 4Q33A 1UPMB 4AHPA 2BY2A 3OVPA 2ZZ2A 1KC7A 5I6SA 4JX5A 2ABAA 3UZWA 1KRAC 1XIHA 3FFSA 4IGNA 1EOMA 4O1EA 4E4PA 3GBDA 5B80A 4J1OA 4NZ5A 4X22A 2AOSA 4WF7A 3WD2A 1ADOA 3EDJA 1MRQA 3GIPA 1DHKA 1KNWA 4LUTB 1OX5A 1S5TA 4AWTA 3W70A 2GDUA 2GUUA 1LJYA 2OELA 2VUNA 2VCAA 2E77A 1JCJA 4HT3A 3FN9A 3F2BA 1KLZA 2QS8A 4N7QA 2B7PA 5T8GA 1GONA 3HIJA 2PLCA 3MJYA 3KCOA 2CXGA 3G3DA 3E0LA 4AAJA 3R8HA 1TPEA 2OQYA 4UQBA 2PDIA 1W3JA 3OA3A 3EWYA 3LCXA 1TX0A 3S8HA 5D2WA 4L4MA 2Y8UA 3VD3A 4AHOA 2J6XA 5LHEA 4RXGA 2JIWA 2BOEX 2CW6A 3TJXA 1WDRA 3KHJA 4QSFA 3E38A 3SN4A 1FFQA 1P7TA 1DYSA 3WKZA 1UD6A 3DYPA 3PPHA 2YOCA 1VF8A 1UWIA 2ZUVA 2YCKX 2ZQ0A 3AU2A 5EMYA 2DQXA 3SCPA 1MUWA 4Z2JA 3KTXA 2VI0A 5C71A 1PX3A 2YXOA 1Q8AA 1XGEA 3W84A 3CV7A 4MKVA 1RP8A 2GWNA 2WVVB 2V5LA 1QNSA 2W79A 4EACA 1XYMA 1B0IA 2QAFA 3A3XA 4O8AA 4E2OA 3USBA 2Q8LA 5HJLA 4YNGA 2ONEA 1EWEA 4QP0A 1KM4A 4HGXA 4PFMA 4Z2IA 2VR4A 3ITLA 1NDWA 2O7QA 5J04A 3UJRA 1DQUA 1L0PA 2YCEA 2VFEA 3CB8A 5CGQA 4C7FA 5FEPA 4M81A 1QW7A 2BS9A 4M0XA 1W2PA 3KZPA 2YDQA 1GEHA 4UFKA 3UJ2A 1Y5VA 3WSUA 2F6KA 2J8TA 4HNVA 4PSPA 4ATWA 3CLMA 2R94A 3P2VA 1DORA 2PZ0A 1FWNA 2EJAA 2OYLA 1WKYA 1HL8A 1B9ZA 4LU0A 1O1HA 3MC5A 3AXXA 3GR7A 1SM9A 4L9XA 3EX6A 3LX9A 2W6RA 4UCGA 5AHFA 1FDYA 2O56A 1D7KA 2VL4A 4GO9A 1S5VA 5H6HA 3TR2A 2ZDRA 3VABA 3S1XA 2YFNA 4PUDA 4DO7A 1KB3A 1V3KA 4NY2A 1A5MC 1SMAA 4URIA 2TODA 2HZGA 4J3ZA 4NQ1A 2WMHA 2QCCA 1OWQA 3MBFA 1D8CA 4O54A 4IFRA 5LHFA 1UBSA 3SB0A 2A1YA 3Q65A 4YHGA 3KWXA 3MMWA 3W7CA 1S2TA 2IUZA 4QE4A 2ZTJA 1K9DA 3UG3A 1KKRA 1HVXA 3RO8A 5JXQA 4HMCA 2YBVA 3NM1A 3PR2A 1KXVA 4RZBA 3BLDA 3GFZA 1R3RA 5CXPA 1PCKA 2GUBA 1JCNA 3U5YA 3VA8A 2QUNA 1HNYA 2YL8A 2Q3RA 3SIZA 2WJDA 3TJ4A 2P88A 2BVDA 3GVRA 4LVBA 4LAOA 1K70A 3A13A 4TTGA 1HL2A 4GUHA 1QT1A 1FXPA 3Q4DA 5HOSA 3MV11 2XFFA 3FSTA 1ISXA 3P5ZA 3KBSA 1OFEA 1XDMA 3WNKA 5LNUA 1PYFA 3G1FA 3SEPA 1C8XA 2WNQA 1UD5A 4FX6M 3SAZA 3T2OA 3H2AA 4JD4A 3CMGA 1FTXA 2VFDA 1IEQA 1TTJA 4DLMA 1HP5A 4P2VA 3CV1A 1FP9A 4HNOA 3B9OA 1QHZA 3AIBA 2TPSA 1SFSA 5EL1A 2PU1A 3QSRA 4GQRA 1OFBA 1C8VA 2CYGA 4ICNA 1XDJA 3W6LA 2VR2A 1LRNA 1VBUA 2FB3A 2WMGA 4M1RA 1H7OA 7PTDA 1ICSA 2OT1A 1J5SA 4QFUA 5ENLA 3TEVA 3QC0A 4DN1A 1KWKA 2PWDA 4KIEA 4L6HA 2PGFA 3UPMA 3H2EA 1G7VA 4LC6A 3AZSA 1X1ZA 3FDGA 4V1YA 3S5OA 3DESA 3N4AA 1XG3A 3MJMA 3N2BA 2GVEA 3T2QA 1PPIA 1OFRA 2A6NA 2YYUA 1ICPA 1BF6A 3ID7A 3SN1A 3T44A 1OX4A 3MUAA 1IT8A 5TIMA 2BGSA 4GFIA 1EWDA 1Q7ZA 1XH2A 3EMQA 1IYXA 1EIBA 3WDJA 3W7OA 1QXLA 2V3DA 5A8MA 4E8GA 1KW1A 4WX2A 1QCWA 4GVGA 1KXTA 3FS2A 2Y62A 4J27A 4A21A 2CFFA 1ADDA 3WF2A 3SUWA 3O1NA 4A8LA 1WO2A 1HO4A 4OFCA 4B5NA 1W1VA 1ZUAX 1FWRA 2J9ZA 4NYUA 1OCNA 2PUZA 1YBQA 5D03A 4GVFA 3R6IA 1Q6FA 4QNEA 4GQGA 4ZQOA 1GW1A 2JALA 2CLKA 3QV7A 5FF7A 3DC8A 4CQ9A 1X8FA 2OPJA 4MWAD 2VTFA 5A6KA 4HPHA 3ABRA 2GSHA 4GQQA 1NM9A 2OGYA 5DMNA 3GO2A 4XO7A 3OQEA 1Q3NA 2YBTA 4FNPA 2Y7GA 3M0HA 2PDWA 3GYEA 3E0IA 3CAVA 1TWDA 1QMLA 2BV9A 3FA4A 4V2XA 1LRQA 4R5EA 1QJWA 3EBVA 3L0GA 3W53A 4REQB 3ARTA 1S3TC 5HUPA 4KFOA 4H2CA 2QCGA 3EKLA 3EA2A 2J7GA 1T40A 3V0UA 4GVIA 1X6LA 1W3NA 2V3EA 4GINA 2VEIA 1E9ZB 1C92A 2O4MA 3SM0A 4Y9PA 2DH2A 2XWEA 2FB2A 1LROA 2ZC8A 1M41A 4D8LA 1GK8A 4FSAA 4UFJA 1E4LA 1H7NA 1FOBA 3NPWA 2POTA 4M29A 1QRQA 1L2QA 1HTIA 1W3HA 4ZTYA 1XFBA 1HKMA 3PNZA 3IACA 3RLGA 5C9RA 1JZ6A 3GVWA 2F6XA 1ECEA 3NVDA 5REQB 3LZ5A 2DJXA 1NWSA 3BUVA 4EIVA 1AQMA 5FACA 1TTIA 1R0MA 1KFKA 5D2XA 1TV5A 1NOFA 3CQ0A 3OOQA 4S2CA 1TV2A 3AO0A 2V9DA 2J7FA 3MY9A 3LQLA 3KBWA 4GH3A 4AB4A 1GYNA 3VUPA 3WQOA 1H3GA 1U33A 3VIPA 2JBMA 2ZA2A 4ILSA 1DWAM 1V0KA 2RUSA 3VOJA 2CKRA 5HPCA 2GQ9A 2AL1A 1UQYA 3B04A 4G56A 3T8QA 8CGTA 2FIQA 2PWUA 2PSNA 3UEQA 1GOOA 3O07A 3T0TA 3IARA 3DZ1A 1G9HA 2J7CA 2PC4A 5CBIA 5HBFA 3NQGA 2ZCGA 3W3OA 2ZRZA 1S1RA 3T8LA 1XHGA 2O92A 4DX3A 4ATLA 3N2CA 3NZ1A 2ZUMA 3WD1A 3TAOA 2X40A 1RUSA 2YYTA 3G1HA 3K2GA 3OIXA 4J3WA 3R11A 2Y24A 3MUXA 3SADA 3LCIA 2EO7A 4X2RA 5DT7A 2F84A 2R9RA 1M03A 2QULA 4IPPA 4KRZA 3U7VA 5FESA 3MA8A 1YLVA 1GG0A 1EXBA 3KBNA 4LFYA 3JZUA 3WK0A 3ITVA 4ZQPA 4HD5A 4C6NA 4GX8A 1N8WA 4IQLA 4NKCA 4DJDA 3RJYA 4QGCA 3QHOA 2E28A 4UIOA 3UWZA 2ZE3A 3S9IA 1DVJA 2QQ6A 3DFTA 1XGZA 2NSXA 4G8TA 3G22A 1VYPX 2XZ9A 4Q8WA 3DHPA 3LN3A 3W7MA 3UFYA 4DM2A 4CN6A 1CLKA 4XKYB 4HOZA 1KWGA 1VJSA 4H6RA 1OGGA 4MY1A 3PANA 5LIUX 2FVLA 4AMCA 3L5LA 3MZ2A 1IV8A 1C8QA 2CCRA 3U7BA 3CHDA 1U2YA 2BHZA 2Z7KA 3VOGA 1Z41A 4BF9A 4IP4A 4B3ZA 3VFCA 1XIIA 3RNDA 3ZJ7A 3MZNA 1WDDA 4DJEA 4GYPC 4J28A 3B4YA 1M5WA 2XHYA 4YLWA 3L4ZA 3LM7A 3WQ6A 5LGZA 3M16A 2DZPA 2E9MA 2X7VA 3C0JA 1D7FA 1SFJA 5AN7A 4BQ4A 2YFOA 1TQJA 4LCRA 3DDMA 3F5LA 1TE1A 1UWTA 2QDHA 1G0CA 3KRZA 5G2HA 1MW0A 1E5JA 2AGTA 3OG3A 4KWWA 1W5NA 2ZBTA 3BLOA 4NASA 4I5UA 4W7WA 4AD4A 3QLDA 3CIWA 3HURA 2Q6ZA 1J79A 4QDMA 1KFEA 4J5NA 2WQPA 1GKQA 3KEHA 3RX4A 3DN5A 1ZJBA 1DTNA 1AMYA 4AIBA 4AY1A 2H3DA 4QM1A 2QUUA 3HA1A 1EB3A 3OBKA 4A29A 5IRPA 3W28A 3WDPP 1XLDA 1FWBC 1CGTA 4IGSA 3OJGA 4XG1A 5FI8A 4FXRA 3H55A 3BOXA 5EA9A 5I3KA 4QXIA 1AZ2A 4YTTA 1UZDA 2HK0A 2FVMA 3ZVHB 2QJGA 4Y90A 4X60A 1XYFA 2QCDB 3BZJA 1TWWA 4PODA 2VRJA 2QPXA 3SI9A 4ROPA 3UW6A 5I03A 3F1QA 4BI5A 1Z42A 2ZZ7A 1P5BA 3AUJA 4HPXA 4L9YA 3EOLA 2WQDA 1IZCA 2WSKA 5D09A 1TELA 2UV8G 4LCSA 4V15A 3BL3A 4WUIA 2C14A 3WEOA 4MLRA 4Z2HA 2G3IA 3WLOA 1A0DA 2REQA 3QHNA 1OABA 3FYOA 1BPLB 4HSOA 4W8LA 2WLZA 2EPKX 3S5NA 4MNKA 3OU8A 3LCWA 3R79A 2DPEA 4KESA 5A8PA 4H01A 2VELA 3R0KA 1G4SA 4W7VA 4MNMA 1ZZMA 4DWSA 2XWDA 3LUTA 2FTYA 2IW0A 1IR1A 4O18A 3W7QA 3S42A 4RNJA 1WKDA 2NQ9A 1TVPA 1MZHA 3ARWA 3RLVA 1E6NA 3IGHX 1WXJA 2OEMA 5FL0A 2ZRYA 4MZ8A 5CC3A 1FKWA 3BLKA 4BWLA 4CD8A 2Y5SA 5IBXC 2RKXA 2Z1VA 4XWUA 4C5ZA 1E6XM 4GY7A 4NG3A 3MO7A 3BWWA 4RV8A 1ZQ5A 1MXDA 1SPQA 3W2JA 3TYEA 3MB9A 4H8NA 1R3YA 2BASA 1IWBA 4QLKA 4LUSB 1EZWA 3P84A 3DG3A 1YXYA 3FVMA 1R2SA 4MNJA 4GRSA 3T9PA 3RR4A 3UWYA 4IM4A 5CCZA 4GQBA 3N2TA 4PH6A 1KKOA 1C7TA 1UBPC 3CV2A 4MUPA 4HKPA 4KRTA 5ABTA 2DFAA 3W01A 2ASHA 3PULA 3T81A 3CAWA 1DJNA 2E5DA 2ATSA 2OZ0A 1US0A 4DF0A 5C54A 4PB4A 1TREA 2HBVA 5I09A 3QTPA 1B54A 3VPLA 4IFKB 4HQVA 3EDKA 4MWAE 4F0MA 4GUFA 3GNOA 1ZHAA 2OXNA 5D37A 3NO3A 3GC5A 5D8WA 1E6ZA 4JKKA 3WY1A 4UMCA 2GK1B 4DYJA 3WQPA 4HMNA 3VX0A 2PRMA 1V6XA 1NQ6A 2WV8A 2DSKA 4FOJA 4L65A 2D0GA 1RP9A 1ZJAA 2YLLA 2PGWA 1QWKA 2QV5A 3LXCA 1RQHA 2BY0A 1GOQA 4JDYA 2ZA3A 1K4GA 2PFHA 1IWAA 3QPEA 2B7QA 4FR1A 3U3HA 4QG9A 3VVGA 3EXSA 2J13A 1YXCA 2R1NA 3NZRA 3DC0A 1SR9A 3C86A 4XZIA 1TE6A 4JTEA 5CGMA 1VBHA 4B15A 1FWTA 4ZE4A 5GNYA 3WJYA 3M0XA 3C2YA 4XKYA 4IXXA 5I00A 1W8SA 3LSBA 4US5D 1CENA 4PBFA 5ABEA 2QUVA 1W1PA 2P3ZA 4DUWA 3TYBA 4KEZA 1YPXA 1KFCA 1SW0A 1VEMA 4F0KA 4A3HA 2ZX9A 1IEVA 2VC9A 2V81A 3W1PA 2ZVIA 3DGBA 2ZDSA 2G96A 3SECA 2XSXA 1BQGA 5I5RA 1TWIA 1JZ4A 4ZO9A 2VR5A 4QDWA 1ESWA 4JEQA 3QPZA 5D9MA 1K4HA 1XG4A 1LOQA 5DF0A 2V2HA 1OGBA 3IUDA 1ODUA 3FVDA 1GQIA 3GC4A 4RE3A 3GDMA 3M5XA 1OFPA 2DQWA 2GGHA 3BMVA 3N4EA 1KQYA 4NAEA 3WLLA 3P81A 1FHVA 1EL3A 4Z1CA 3MHGA 4G2DA 3I4KA 1TJ2A 4IZGA 4HK7A 1HJVA 5FD0A 2Q02A 3EWXA 1M01A 1NDVA 3TYDA 3BJSA 4F48A 2HV5A 4GACA 4EKJA 1JF6A 1HKKA 1KV8A 4S3JA 4AVNA 3DUGA 1M3UA 3UY8A 4L5ZA 3EWWA 1E1CB 2FDSA 3NO5A 3PN8A 2EPLX 1PJ9A 4Q8TA 1BRLA 3ZVHA 4M51A 5JUVA 2NX9A 4PCNA 4OJYA 2C18A 4U28A 3ZR4A 1RPKA 3I10A 2OWWA 1VR6A 2BY3A 2JK2A 4LB4A 3LMYA 3OLGA 5I0DA 4FXFA 2VENA 3WBAA 3A64A 4QDPA 2X30A 4JTLA 3MCMA 2RJHA 2VDHA 3H12A 3UXDA 3CTLA 3VC5A 1TPVA 2OGJA 1FXQA 5ABHA 1JUBA 4UOJA 3E02A 1PEZA 1XLEA 1HZYA 2I5GA 1T8QA 2QYGA 1ZU8A 3ARRA 4DBSA 3GTXA 3M0ZA 1G69A 4I7VA 2CLLA 2XH2A 4I90A 1O7AA 1I2QA 3NL3A 1QNRA 3BSHA 4Q3MA 3DFYA 4ENLA 3M9YA 2FPVA 2ZX6A 5K9XA 3B0YA 4AYGA 2QXWA 2E68A 3GHTA 3H23A 3FAXA 3RCMA 3WNOA 1MDLA 1NFBA 3PWIA 4GH1A 1DJHA 1LL6A 3ZYZA 2Q8XA 4LEQA 3POHA 1JCMP 5BW6A 2PD9A 1UUQA 3GZAA 4DO4A 4S2BA 1OIFA 4KRUA 4QISA 4XTDA 2JEQA 2PI6A 4UTTA 4HSHA 2RAGA 4F2BA 1XLMA 4E3TA 1F76A 2QR6A 3KVJA 2FGLA 1CGWA 2O9OA 1DHPA 4OBRA 2PDUA 3UA4A 5D02A 4NL1A 1SVDA 3C2RA 3LTSA 2WPBA 3AXIA 2XINA 4NNCA 1EPVA 1RSCA 3CWOX 2VFIA 1JI1A 4AEOA 3PBYA 2WMIA 3SJNA 2BXYA 4N6FA 3ONCA 3VX1A 3GKFA 1VP5A 5BXPA 3H8AA 3K30A 1YNYA 2G4FA 1V0NA 1WOAA 3UY7A 3QR1A 4A8RA 3CWHA 4R88A 2EAWA 4LV4A 2G41A 1E3XA 4Q4QA 3W1RA 4UFIA 3F4NA 1MYRA 1CB7B 4IPNB 4QQUA 2CWNA 1R3VA 2JEPA 2WMFA 3IK2A 1W3KA 4JEJA 5DBUA 3WBYA 3K1DA 5HPOA 2IPFA 3BMXA 2PWGA 3N18A 4HK5A 5GNXA 4L4OA 3CPUA 1A4MA 4O52A 3G18A 3K13A 3UWUA 4M7SA 4YWSA 1B3ZA 2EPHA 3ZZ1A 1DJXA 2D2HA 4LV9A 5E09A 5GVJA 2GVYA 5K9DA 5CH9A 3IJLA 2DSZA 1TVLA 4CQCA 1LM1A 2YCJA 4MZ1A 3M0MA 5A69A 6PTDA 3WQVA 3M0JA 2PPGA 2G3NA 2PB1A 4IFOA 4WOZA 2X2YA 1GVIA 1UROA 4KEMA 4N42A 3POCA 3NIYA 3F2DA 2P50A 3LEPA 2HRWA 1Y8BA 4OV9A 2V68A 1ISWA 3KHDA 4IHCA 4RZ4A 2Y5EA 5H2ZA 2DIKA 2PLJA 3WYZA 2FMOA 3VNMA 3MCNA 3GE7A 4S3DA 4GA8A 4R53A 1UB3A 3W27A 4RZ6A 2CHRA 4HN4A 1Y5WA 3AS2A 3W74A 3RPDA 1RJRA 4IGMA 4AF0A 4FR6A 5CG0A 3AMLA 2WZIA 4AC1X 3WBWA 1VPQA 4S23A 1R85A 2E40A 3T0BA 4LWWA 1UR2A 1GW9A 2QHAA 4O17A 4UQ9A 5D4YA 3RRXA 3W2UA 4XD6A 1SZRA 3B8TA 3SCVA 3IWPA 1P0DA 3EWDA 4CCCA 1TV3A 2HK1A 3M1ZA 2OLAA 3SY1A 1V0MA 4NILA 1RA5A 4H7VA 2XZ7A 3ZVIA 3CASA 3WNMA 3RGTA 3ZLHA 3U4AA 2AL2B 1BLIA 5CJNA 1K7FA 4HSNA 3LHUA 1Q6DA 1RV8A 5I78A 4EAMA 4X3ZA 4ERGA 3CBWA 3B3DA 2YW4A 3AMDA 4B3LA 2VQTA 2PP0A 1UYQA 1SSGA 4LPCA 3ATZA 3APYA 1A80A 4LNYA 1M6JA 2PDYA 4QS5A 2J9YA 3EZ4A 4DB7A 4C1NA 3IJ7A 1B3VA 3OVRA 1XWYA 4B92A 3V0TA 5G1YA 4NUWA 1OF6A 2MANA 1ZL1A 3WLKX 3REQA 3AI0A 1LP6A 7REQA 1LORA 1UZ4A 3DGRA 5K7JA 4NI3A 1F4HA 1TKKA 1V6YA 3GG0A 2ZUWA 5HWMA 2PC8A 3QV9A 1ITXA 3WLNA 4AVOA 3M0YA 9RUBA 3BOFA 4NX0A 4C6DA 3B06A 5A6AA 4MAZA 1AH0A 3LNMA 1BHGA 3CT7A 4DI9A 3OGRA 1GNXA 3WF0A 4XAPA 1NF0A 4BZYA 2ODOA 1UHVA 1JDEA 5AYIA 5G2IA 1BKSA 5AECA 1PHQA 4R9XA 3VAVA 3W81A 2ZXAA 3WJWA 5F7UA 2GSEA 4DUVA 4X2PA 1ELSA 3LV5A 2CIPA 2GL5A 5A6BA 4Q8VA 2UY5A 3P0WA 1T41A 2ALRA 4BF5A 4S3BA 1WNOA 3V3WA 2GQAA 3A47A 2DIEA 4PTXA 2PS2A 5CSUA 1MUCA 3FYYA 4XBKA 1V3MA 1JDFA 4NXSA 2ISWA 1TV4A 3NNTA 2NUWA 1DXIA 3SJ3A 3KCLA 4W5ZA 2PDQA 4DJFA 1SUXA 3PWGA 4UUIA 3OHMB 3FJ4A 3W2MA 2ZTKA 1XBZA 3W1NA 1OIMA 3VINA 3WMLA 1GOKA 5CLTA 1QW9A 4Q32A 2OU4A 1DWFM 3G1YA 3M5ZA 1TZZA 3BGJA 1W1IE 2BB0A 2FH6A 4QJ1A 3SCNA 4L7ZA 4N2YA 1WKEA 2OKOA 3STPA 3RIKA 3FEQA 3BQ5A 3N9SA 2HEJA 1H0GA 1IEIA 5L6UA 4AIEA 3NPUA 4FNRA 4DF1A 3ABZA 1BVZA 4M56A 3TLLA 3PTKA 3EB2A 4WLCA 2E5BA 4RW3A 4A8NA 1KBIA 3LLDA 1ODZA 3EOUA 5GPRA 3NDZA 1LLWA 2ZRXA 1ITCA 1WXZA 2F8QA 1IXOA 3AJXA 4XKMA 4MWAB 1A5KC 1DKWA 1K7XA 1XW8A 1FWDC 2CITA 5L9FA 4UNLA 2GJLA 3DFNA 3ZIZA 4AX6A 2QVNA 5FAJA 1BD0A 3WK3A 3E1F1 4ATDA 5TAOA 3D46A 3QVQA 4EX4A 3L65A 4P5UA 1FCVA 2GDVA 2RDWA 3VDGA 3C0SA 4BI7A 1XSKA 1ZRQA 1DIOA 2P8CA 2VEPA 3W6MA 1CGVA 1ADSA 4IP5A 1W1TA 1P1XA 2XFRA 2XIBA 2VX6A 1VHCA 3MPGA 2RHGA 4ICMA 3RILA 1LWJA 1HIZA 3AYTA 1VC4A 1C9WA 2H9AB 1TR1A 2G3MA 2KAUC 2NV1A 2BGQA 3BLIA 1KLYA 3W73A 2IKHA 3HV8A 4XVDA 2P53A 2QGHA 2B4GA 1RBAA 2VCCA 3RHGA 2PDXA 3MKCA 1AJ0A 3ZOAA 4FB7A 4YWIA 3GTHA 4K68A 1ZP4A 3M4HA 4H9UA 4FX7A 4P8WA 2Y6ZA 3IAPA 4JXCA 3GW3A 1IXPA 4JTSA 3BLEA 3QHMA 2E9LA 4HYVA 3M07A 3EA1A 1S5WA 4OOUA 1O4UA 2HNEA 2WKLA 1I1WA 4MF4A 2YKKA 4JQ3A 1GVQA 5AC8A 3THUA 2DSVA 6ENLA 4AH7A 1YPIA 3EDEA 4UTMA 2PE4A 1PTAA 3H4WA 3BE7A 1E0WA 3PZGA 3QPYA 4QHRA 2CBVA 3LHVA 4EWND 1M1BA 2VWSA 2A3BA 3W2NA 1W31A 3RJXA 2DT2A 2FPYA 5EMLA 5DXXA 5RUBA 1PHWA 9CGTA 1O94A 3TFCA 4Z1AA 3AFBA 2NXGA 2Z7GA 3L9CA 2Y70A 4AZCB 4XO6A 4E2VA 2C7FA 3S1VA 3PSVA 4JFTA 1BYAA 2IS7A 4K8HA 4DO5A 3MTWA 5C70A 1LG1A 5AC7A 1B57A 1XCXA 1FHDA 1CTNA 3BCJA 3VGBA 2A85A 1QO2A 1W54A 1QU4A 2VC6A 4O53A 2PRHA 3JVAA 3LYEA 2IXUA 5IFTA 4FIRA 4D6DA 4DI8A 2GJNA 3PSWA 1XCFA 3MU7A 4X9SA 3VIKA 3VCNA 2O9TA 4LS0A 4AMAA 1DL3A 3GD6A 4KETA 1RH9A 4PB5A 1UC4A 1H11A 3R7MA 3CZEA 3B8UA 1R8LA 3EX4A 3SIMA 1AJ2A 3V75A 1LLZA 3CAQA 3CHFA 2YZRA 1K8CA 4TMBA 1WDSA 1UJPA 3NR0A 4PB3A 4O1DA 2V2CA 2J27A 3TSBA 4C6PA 4RNIA 3WLMA 3NYZA 3TSMA 4J3XA 3STCA 3C0QA 3MVIA 2OWCA 2VNCA 1XRFA 4CQDA 1C90A 4US6A 4MVAA 4NVTA 4ZO7A 5HWNA 2BNJA 4O0QA 1TFVA 3NQ8A 2VMFA 4BWLC 3EOEA 2D0HA 3HO8A 3QQWA 2GJXA 2XG9A 2I7GA 1O95A 1DJZA 3IVTA 4DZ5A 4MZYA 1UD3A 3M5VA 4ACZA 3SRFA 1XL9A 3K46A 2O9RA 3WD4A 1VD6A 1MW1A 4GKLA 1EF3A 3A9BA 3MMUA 8A3HA 3MSDA 4NAFB 5LA2A 3E3HA 1SMDA 5CZ0A 1ME8A 3SQMA 2Z24A 5LA1A 3UP8A 1JRCA 1FRBA 2J9XA 4JCMA 1H5VA 2CNCA 1RVKA 1AH4A 2D2JA 3B0XA 2QIWA 3DYMA 2PZNA 3BTNA 1RBOB 5FA5A 4CUCA 1OYAA 3NURA 1KM6A 1G6CA 4IG2B 2XM2A 2DZSA 5G4WA 2WWCA 1CEOA 1NH6A 4WIWA 4D6EA 3LZ3A 5FJRA 4MWAC 1YE6A 3QM3A 2NQHA 3EOSA 3KDNA 2XDFA 2PP3A 1MRAA 2HSAA 2F2KA 4Y9MA 2GDQA 4PFHA 3VTRA 4FPSA 4IMGA 4TX9A 3SFKA 1HP4A 1PB0A 5BOOA 4S3EA 1KFLA 2ISSA 3CK5A 2XH4A 4NRRA 4XAGA 4MJ2A 1MI3A 1M7PA 3PZVA 3BDKA 1A3HA 3HN3A 4JTUA 3KBVA 1K03A 4KWVA 3MUZ1 3GFYA 4A6GA 1C29A 2VQUA 2CLEA 1LUCA 4TO8A 4S3CA 5G5IA 3XINA 1CGUA 1V3HA 2ALDA 4MJMA 1NY1A 3FDKA 5D38A 4XD3A 4UTFA 3VNYA 3U2EA 4HHPA 4CNPA 4AWSA 1HF6A 2VRQA 3B0UX 4LC8A 3FJNA 1S38A 3NSXA 2A6LA 1M04A 3W1UA 1W1YA 3TWAA 3U2ZA 3NOYA 2GGJA 3B9NA 3OA5A 2WSPA 2W27A 3NXLA 1OJXA 2NV2A 3W7GA 5CBBA 3ZQ9A 4N9CA 4RJEA 3VIOA 5A94A 1LL4A 4IUOA 2W61A 3L0KA 2QJIA 1JCXA 4Q7NA 3PF3A 5ABFA 1UD2A 3TTOA 3W1TA 4MUZA 3QYSA 2CETA 3KTCA 3QKZA 1ZAHA 4WJEA 2C8NA 1AL8A 5BYWA 4UTWA 3VI2A 3H4XA 4GFSA 1LOLA 5C8BB 1KM3A 2ZZ4A 3OBAA 3NSMA 2F9RA 4GY1A 5F1UA 2NW0A 2VYOA 1BYCA 3A12A 4HTYA 2AQOA 3WG6A 1W3LA 1ZP3A 2CWXA 5JBDA 1W9PA 2VOMA 4AZ5A 4FLRA 2WZHA 3FV9A 1ZS2A 4J3TA 4W86A 4WY0B 1KRMA 1UR8A 1L8NA 3LNPA 4LTSA 3MUY1 1XICA 4GUGA 3ZJKA 3VUSA 4LYPA 4H6EA 1JDCA 3VE7A 4GBUA 3RG6A 1EF2A 1EQCA 3W24A 1J5TA 1FWEC 3TN5A 2FKPA 3MBDA 4ERAA 1F6PA 4JBRA 3R94A 3GH7A 4NZ1A 3SRKA 1S3HA 1UA3A 2OOGA 3SQSA 3TYUA 4QBXA 3GK0A 4PCTA 3SUSA 3XIMA 2CEQA 1J6OA 1B30A 1K6AA 1REQA 4O12A 3KOFA 4S38A 3GXNA 2J7HA 4GXPA 1EP3A 1O6IA 1FP8A 3W23A 1JUKA 1WDWA 1WA3A 3T42A 4F2UA 1PX4A 4GXWA 4JN8A 2BHUA 2WB5A 3E6EA 1EXPA 5KZEA 4HPGA 2GWGA 3NQCA 1UWAA 1A5NC 3CM4A 4OQVA 2P1FA 5H1WA 4CQBA 3TJLA 4NRSA 4PUWA 3TN6A 3RLUA 2BP1A 3H2OA 1V08A 4CU8A 1TWZA 4FXJA 2BHYA 1ZBKA 2V5KA 4LXFA 2OSWA 2NQZA 3EYPA 3JW7A 1XLIA 4BA0A 2PAJA 3ZT7A 3OZPA 3UT0A 3MP3A 4H9YA 2VGBA 2Z2AA 1R9XA 3VGFA 4HU4A 2FFCA 3DIPA 3ITXA 3O2LA 3MW7A 4M6VA 1KBJA 2OX1A 4GD0A 2Z6IA 4KH2A 2OKTA 1OC5A 4ZBCA 2FH8A 4TVCA 4YHEA 5C7VA 4AG0A 3I3BA 4CQAA 4EWJA 3TJIA 1WB0A 2JF7A 2ZICA 5KITA 1GVEA 1P6WA 1CXKA 1I45A 5M3WA 3QZ6A 4UTTC 3WH5A 3NM3A 3VDBA 1K9TA 1XFCA 1KM0A 4JZ5A 4ORIA 2VGIA 3AS1A 1DJQA 2CESA 2TRSA 3O9NA 3WQDA 4NZJA 3UJEA 1UOKA 4XUGA 1VEPA 3NEHA 2W67A 2QT3A 4PUUA 5F2MA 4OUEA 3R5EA 3CEUA 3AHTA 1UOZA 3T2PA 4JFSA 1R2RA 4OZOA 2DVXA 4CD7A 2DU2A 4XK2A 8RUCA 4E0CA 3C2FA 3MMDA 4M1BA 3W38A 3LPFA 3THAA 1MQQA 3MI2A 5AHLA 1F9CA 4W88A 2XVPA 3IANA 1QI5A 4X0VA 1XLFA 1A5BA 1LL7A 1IWPA 1CXFA 4LBSA 4E2BA 3BG9A 1RCQA 3P7YA 1S46A 4IG2A 3ITGA 4R27A 3T07A 3ECQA 2DUZA 3HF3A 4NHVA 4IPIA 4C6BA 3WFZA 1RQEA 4G5DA 3VIMA 3E0FA 3WUBA 4AD5A 1UKPA 4KCUA 1QPNA 3SCUA 2Z26A 4MY8A 1QFEA 3W76A 3W22A 2WJZA 3BK0A 3PZNA 4NF7A 1XYAA 4OBTA 3GHSA 4AEEA 1QOPA 3MO4A 3K5XA 3LDVA 1UJQA 2Z1KA 3KS6A 3GKAA 4FOKA 3FKRA 4AZHA 2OMAA 3H21A 3C2EA 4P7QA 4TOQA 2ZIDA 1ZNNA 3CU2A 4MDOA 3T0CA 3CZ8A 5AOUA 4ZO8A 1J0HA 3A3WA 5F2LA 3BICA 4GCAA 4RZ5A 1F8MA 6CGTA 4H9ZA 3ZXWA 3WJXA 2EXOA 3E49A 2PCQA 1HJUA 4CNUA 2V3GA 7A3HA 4NU7A 1OC7A 3ITCA 1I2OA 4U3CA 3VNZA 3H24A 1NWUA 6XIAA 3B9EA 4QJ4B 5HQEA 1R7AA 1KQZA 2XH7A 3EX1A 2DT1A 3GY1A 1EGVA 2ABBA 2NT0A 4G9PA 1XDLA 4GI9A 1W6TA 3T0DA 3PTQA 4PUKA 1FWHC 4K7VA 3WO8A 5BRPA 3VE9A 4H00A 4UZUA 5DQPA 3WDHA 3KM8A 4JCLA 2F38A 3O6DA 1WZKA 3RU6A 5FJUA 2WC3A 3WLTA 4A3QA 5EB8A 2Z1XA 4KERA 3TA6A 1KBKA 1SU5A 4E4FA 2G3JA 1EJUC 4D8AA 4XZLX 1EX5A 4IPJA 1R2TA 3PBUA 3W02A 5FF0A 3IIVA 3C56A 2XISA 1W1ZA 4ALDA 4DLFA 1P6BA 2I1OA 3L23A 1J4EA 1X1NA 4JTJA 2CZDA 4WEVX 1CGXA 2J79A 4G1NA 3SRDA 4FK9A 4JTKA 4HZ7A 1O12A 4WSJA 3LMZA 3RLHA 4Q6JA 1XLKA 1XQKA 3UCDA 5H8PA 1FCUA 3AZRA 1HO1A 2FYMA 4YYFA 3RMJA 1MWOA 5FJTA 4AVFA 1T6MA 1H2JA 4H83A 1VRDA 1BSIA 3HBLA 3QFWA 2OYKA 2G50A 1Z69A 1BFNA 3MANA 1RCOB 2CZFA 5CBJA 3O05A 5AY7A 4RX0A 2DSWA 3AYSA 3NA8A 4JTQA 3BO9A 3H2FA 3Q94A 4O1BA 1E56A 2B0MA 1EA9C 2HPIA 5CZJA 4G7EB 1HKJA 3VOCA 2I16A 3ITOA 3PZIA 1TMLA 2E25A 3DHDA 2YPIA 1DIEA 3Q58A 4DZIA 4WDUA 2DSUA 3N6QA 3NQAA 5J8LA 1DJGA 4RDVA 4HP5A 3DI1A 1F8IA 4ZQNA 3KVMA 1H63A 5G4EA 3QN3A 1CPUA 5F2GA 1H5YA 1PBGA 3BURA 3NL5A 1DJYA 3S9ZA 3VGGA 3QMTA 3T09A 5FJPA 1PVNA 5AZ0A 3FCPA 1TUXA 4PUEA 4XV0A 1JQVA 1CNVA 4LF2A 2R91A 3DKLA 2MUCA 3ARUA 2BMBA 3MSYA 2J8GA 3F4VA 2VO5A 2Z27A 1V3IA 3D3FA 4R7WA 4MHBA 2PGRA 3T6CA 1YDVA 3DFQA 3KW3A 2DVUA 4AY8A 2OTDA 4KFNA 3H7VA 4S3KA 5AYXA 5LSMA 3ARXA 4Q4KA 5AHIA 4QIUA 1GKPA 3UZYA 3CO8A 3MQTA 1D3CA 4Q8QA 4ACYA 3DKJA 4PEEA 1A50A 1L2UA 2KZHA 1L6SA 4OE7A 3GR4A 3F4DA 4LYRA 5DMLA 1XGDA 4Z0SA 2WNWA 3OTRA 2H6RA 4GZ7A 4RPPA 1NQKA 4AQLA 3L12A 5CPNA 1YDNA 4ICCX 3H2MA 5IFPA 2CHOA 2ZFAA 1J9YA 3NZPA 4J3VA 4GYKA 3FA3A 2OCZA 3B9AA 1OB0A 3QLLA 3VM5A 3MUIA 4HJWA 4I9MA 1A53A 1SYTA 1P0BA 1TA3B 2W66A 3BW3A 2ICSA 4CEXC 2XU2A 3DFHA 4MDPA 3G1XA 1KR1A 5JH1A 4JNYA 2CPUA 5LXEA 3EKZA 2C6QA 5I3DA 4BY3A 3PVFA 2Y7EA 1V3JA 3ANVA 3ARPA 4L1GA 3MS8A 1XIFA 4C6OA 3WENA 3QQ1A 1GOWA 3M5YA 3RRAA 1P48A 1QASA 1ZENA 2VVSA 1LQ2A 1VLIA 4CQ8A 2WBGA 4J2MA 3USZA 1PSCA 4M8UA 1WV2A 1TJRA 5I3FA 4AZ6A 3OP2A 3KVKA 1A5AA 3SR7A 1NF7A 1K8ZA 4XIMA 4HK6A 3AIVA 3F4CA 1A0EA 5GJMA 4ZO6A 1UWSA 2GQ3A 2CKSA 4WVXA 3WEMA 3PZOA 1J0ZA 2HBXA 3WF1A 5E93A 1EJ7L 4K1GA 4IF2A 4WJXA 1PZ0A 2W63A 4EXBA 2X41A 1S2VA 5HQMA 3CUZA 1VFTA 3CPRA 1G94A 1S39A 3FJ6A 4HMEA 1EP2A 4H4IA 4GVHA 1BQCA 2GFTA 3EEGA 4PMOA 4Q8UA 3PZQA 4ZQRA 4NSBA 1QPKA 1OYCA 4U10A 1XLLA 3V0SA 1LCOA 3EMCA 3SGGA 1HGYA 3GRIA 2F6UA 2R14A 1C8YA 3FK4A 1W9DM 2VX7A 4IX0A 3CUFA 4GNJA 2BWGA 4GWEA 4ONVA 2YCIX 5C2GA 1EBHA 5FJIA 1US2A 1A3WA 2YIHA 4UR7A 3QOKA 2G5WA 4JTRA 5TQLA 4L4LA 4O0ZA 4Z08A 1FH8A 5CPQA 3G0SA 5ECVA 2XVGA 1U5HA 2I5QA 1R38A 3P62A 3E96A 1F4AA 4XSMA 3QGVA 1OQFA 2C19A 4YL2A 5HNRA 1LBFA 2NX3A 1W1B1 2VEGA 3K4DA 5JH2A 3AOFA 4L61A 5I06A 2P0OA 3VGDA 1DP0A 4JTHA 2WCSA 1I9CB 4YTSA 3VMOA 2W9MA 4GNVA 4W9TA 3LBMA 3HGSA 3PJTA 5F4WA 4ZB2A 4GYJA 1GYLA 2NZLA 1R3TA 4M82A 3BSGA 3UU0A 4XBJA 1EO7A 2OWXA 4UMBA 1F73A 2VFFA 2WXDM 4KT2A 1XLAA 5I3JA 4I8YA 4I7UA 1CXHA 3QQ0A 4QCEA 2ZUNA 1B3OA 1XRVA 4DPPA 3COTA 2GSJA 2V5CA 3TP4A 2OQHA 5FAGA 1E0UA 3KL3A 4X0NA 4JFVA 3PZ9A 3NQ7A 3WQEA 1Q4WA 2ZRVA 1UP2A 1R3SA 4TV6A 2QMJA 5LIWX 4Q4PA 4EE9A 1U22A 1E4NA 1DWGM 1O5QA 3TDFA 1I60A 3IVUA 3W7PA 2E6FA 1UIPA 1H0IA 1EEXA 1VYRA 3PPCA 3OGVA 2UWFA 1AQHA 4DYEA 3O63A 1JIBA 3NZGA 4DBEA 5MKGA 3VD9A 3NL2A 4LQ1A 1QNOA 4C91A 3HU7A 1WZAA 3WMSA 4DJDD 1B90A 1UG6A 3ALGA 4RDWA 3L21A 3KS5A 1TPB1 4CCDA 3EDDA 4MSSA 3CZJA 4JHMA 2E1DA 3WH9A 4MAVA 1WZMA 3MI6A 1XYLA 4O10A 1Z48A 3UVIA 3FNDA 3G6MA 3ZO9A 5DX7A 3A4JA 4C6EA 1C3FA 4FMVA 3CL6A 1YRRA 2CBUA 1S2WA 1GHSA 1TJ0A 3WMCA 1ONWA 2HROA 4NZCA 4DJED 2D3LA 4FNUA 1BAGA 3FAWA 5EYWA 1MUMA 1EEPA 1W32A 4MG4A 2PWFA 3N2OA 4O1FA 3N29A 3CUGA 4GIRA 1CI1A 3IV8A 4GIYA 3BANA 4HU3A 4O11A 2J4GA 3MKKA 3S2CA 5CEWA 1E9YB 5JU6A 3DBNA 3IJ9A 4GO8A 2X05A 3AYVA 1PIIA 2CBIA 1EDQA 1Z32X 4GBDA 3AICA 3CT2A 1RQBA 1KD0A 3SUVA 3TMQA 5LIXX 1GVOA 2HE8A 1CXEA 2EHHA 2EKGA 2VRKA 3K8MA 2FZDA 4KQNA 3BAKA 1EKOA 5D33A 4C1LA 3IGUA 3GX9A 2A3AA 4H41A 3W7DA 4IX2A 4JNMA 2D0FA 1HT6A 1GJPA 3URAA 4XZBA 2WHJA 4O50A 1XS2A 5LIYX 4HPJA 4YVXA 1E15A 1AJZA 3N17A 2VXNA 1NVMA 1T7LA 1VJZA 3WLHA 1TQXA 1FQ0A 2A3EA 3WQWA 2H90A 2Z6JA 2OO0A 3C8FA 2J7DA 3E2QA 1R46A 3UERA 4DVOA 5C9WA 5CJ5A 2QMKA 4RK8A 4F8XA 3CS2A 1GYMA 2D22A 1TCDA 2YCLB 3CHVA 1ZY9A 4A3YA 5J5RA 2CC0A 3A5FA 3W7JA 3AZTA 4C6LA 3MVTA 3STEA 4WQ6A 4Z2LA 2V67A 1VFOA 2WCAA 3EWUA 2ZYFA 4QG6A 3N12A 2OEKA 3R58A 4IMAA 3B8SA 1KXHA 2BY1A 4C60A 1WKFA 2VD8A 4W7UA 1ZAJA 3KWSA 4B2DD 3VNLA 2ACSA 2PD5A 3BV4A 2WHMA 1J01A 4JQ2A 3KDOA 1TPUA 5DEZA 3L4YA 2ISVA 3VDAA 3GFXA 4DWSD 3TX9A 5U4NA 3HTWA 1UH2A 1EUNA 1OG6A 1KM5A 1TO3A 2BGNE 3FGCA 4XISA 5CQ1A 5AYYA 3W2LA 4N0RA 3GXDA 4M3PA 4ROQA 2WZEA 1PYMA 4L1WA 3K4WA 3NJ3A 3O7UA 4MOZA 3CWNA 1XI3A 2EPNA 2JFEX 4GI6A 4PE8A 3LHYA 1JL8A 3HQOA 2Z4GA 4W89A 2XUCA 3S47A 1AUSL 1X8CA 2BVTA 4UTWC 3WF4A 3W7LA 4Y2WA 2POZA 1J8VA 5HMSA 5AFDA 4GZJA 1F2JA 3GUWA 1ONEA 3NXFA 5C0QA 1A5UA 4NI8A 4DBUA 1OCBA 1H61A 3TQPA 3GDBA 4AUBA 2WZMA 4R9OA 4K36A 2Y88A 1G4PA 4UTKA 4MJ4A 4E3VA 3WK1A 2DVTA 2VJXA 3PJWA 4CD6A 4LAKA 5D2YA 1E9LA 4O1AA 1V79A 2OSXA 4HNUA 1P6CA 1TRDA 1V7AA 3L68A 3MV01 4XUYA 3UR7A 2PDJA 1LOSA 3AWNA 5I3HA 3THDA 1BYDA 7XIMA 4LUTA 1VH7A 5BOFA 1O5RA 4NZ3A 3OZMA 2W91A 4GE8A 5HAOA 4WSKA 3E2VA 1FBAA 4P7LA 2AMXA 1KM1A 4YYCA 5D05A 2CZEA 2PF0A 4XZ9A 4S3AA 1VJIA 3W1XA 4OWGA 1TIMA 3EPMA 4Q7IA 3BMWA 1W9UA 2YSWA 2PDCA 1HL9A 1Q45A 2OLHA 3WF3A 3LHZA 3WQCA 3PUEA 1NEYA 3SO7A 1QHPA 4FALA 3VOHA 3CH0A 3RN6A 5I79A 2HMCA 2DZUA 1BXCA 2X2GA 5CAKA 1B4EA 4KGJA 4N9BA 4PMVA 2WJEA 1YIXA 3PZTA 3PG8A 1R6WA 4I8DA 3QW3A 1MW3A 1FWJC 5DRCA 4YPJA 4LY4A 3N15A 4PN2A 2ATMA 4PL1A 4W8AA 2J75A 2OB3A 3NQ2A 3GTIA 4P8VA 4WY0F 3VK5A 2Y5JA 2DUXA 3A23A 4RE2A 3OZYA 2QUTA 3O0KA 3EX3A 1FWWA 1JI2A 1V93A 3KLLA 4HCLA 3TE9A 3ALFA 3QV8A 1CXIA 2WVVA 4ZFMA 1GHRA 3HV9A 4HA1A 1EQPA 3CIVA 1LQ0A 3CO4A 2FGZA 3MWAA 2A5HA 2E6DA 1PX8A 1PTGA 5CPSA 4IIHA 1K8XA 1AQFA 4LY8A 3LV6A 1UQZA 3CXOA 4FO4A 3E9AA 2OODA 4A4AA 3MI3A 4K1WA 3MMTA 4UTJA 3WNNA 5CC6A 3C8NA 1GPWA 1KTNA 3QGAC 2J7EA 1OVDA 2OG9A 4YXGA 3S4TA 1SJCA 3H22A 1AW5A 1CECA 1IE7C 2KX9A 4L64A 1P1MA 4AWEA 1MNSA 1VRXA 4GIAA 1QTWA 5BZAA 1Q13A 1KTBA 3CC1A 4XZWA 6REQB 3U0HA 2FTPA 3C5QA 2PDKA 1TMHA 4ZL1A 3KP1A 3TKFA 1FCQA 2PDHA 3HMCA 4RDYA 1PZ2A 3V35A 5HR7A 3L2LA 4AC7C 1RAKA 1MEWA 2DEPA 4CGTA 3V4BA 4J35A 4GJIA 1PCWA 1YTDA 3LBCA 3ARYA 3OYXA 3S9YA 4MMWA 1E71M 4B16A 3LRLA 2HQAA 1H7WA 3W4RA 4ZOAA 2FHCA 1R86A 3TCSA 3MSGA 7ODCA 3TIMA 1XISA 2V5DA 3W37A 1GKRA 3I3DA 3TCEA 3CZGA 1GZ1A 1UWQA 4ECLA 2FLIA 3UA3A 3GDRA 1U1JA 3L4UA 1QBAA 2XSBA 3NTYA 5XIAA 4PMQA 3NDOA 2CLMA 2P5NA 1MFUA 2L5HA 4I6VA 3F4WA 1C91A 1A5LC 4DQWA 1Z3NA 4LNCA 3BW4A 5DCBA 1I8JA 3FHAA 2AGKA 4PMZA 3CL8A 4J9JA 1YX1A 5FCZA 3GBEA 2RH9A 1OK4A 1AW2A 4ZOBA 2E9BA 5H8UA 4K39A 4KF1A 2D69A 2QDGA 3NL6A 4K7YA 4XZMX 5CSSA 1OFDA 4E2DA 4IH3A 1XC4A 2WM0A 2AQVA 3AS3A 3A4WA 4LX4A 3QFEA 1LLOA 3CUJA 1EHNA 1OEPA 4QITA 5HMEA 1V51A 3LTPA 5LXXA 4M6QA 1GQNA 4MB3A 3ZT6A 3VKDA 4A22A 4C7GA 4AFYA 4O13A 1WBHA 3I6EA 4HOXA 4NIRA 1LTDA 1RPXA 3N2MA 1UKOA 3B0PA 3L2MA 2NT1A 4LT9A 3TFXA 2H8ZA 3I6RA 4PR4A 1VAHA 2G3FA 3CIXA 1B9BA 3CHEA 3P82A 1RJPA 3RF9A 3V1HA 2WVTA 4QEHA 4ZA0A 2AMGA 4Q7BA 1IR2A 2Y1HA 3NFUA 4RW5A 1XUUA 3OB8A 1FWGC 2Z25A 3VILA 3G1RA 1GOIA 4PTMA 3S0CA 7TAAA 1V8EA 1RBLA 3V7PA 4WOQA 3RX2A 4JAWA 4R85A 3IIZA 5KEZA 4PMXA 4ZOCA 3BLLA 2OSYA 1U30A 2XVKA 4IL2A 1BYBA 5G2WA 1POJA 1JVNA 4MADA 4Y9OA 4ADSA 3CTTA 1EPXA 1B1YA 1E72M 3ARQA 3L0NA 3ES7A 3XISA 5DO8A 3ZJ8A 2FZBA 2XIQA 4GYPA 3KLKA 3M6DA 4UOZA 1A47A 4A05A 4F40A 4Q6XA 1KCLA 4QX4A 6TIMA 1CWYA 5CC5A 4PA8A 5KZDA 3S6DA 3VFLA 2VD9A 3SQLA 4JPGA 3KZSA 4IIFA 4FF5A 3O6AA 4B9ZA 1I4NA 3FHQA 4L56A 3RPMA 5LZLA 3DERA 2HPMA 3N25A 2Z2BA 4OKDA 3WLQA 3GNPA 1FDJA 3K4AA 3J7HA 2ISDA 4PSRA 1ZCCA 5E0FA 4E8DA 3D0CA 3CHCA 1FDZA 4AY7A 4FA3A 3WH8A 3VNDA 2BDQA 2C0HA 5HWJA 2QLYA 2W3ZA 4QE5A 3W07A 4OHQA 1NFPA 4XD5A 5SWUA 3LLFA 2E8ZA 3M7WA 4HPNA 3OGSA 3EWBX 3IJQA 1CXLA 2VM8A 3BH4A 3BPWA 5TNVA 3VIHA 1EC7A 3BV7A 2W0UA 4IWWA 1IXQA 3P14A 1PUDA 3GQYA 3D3AA 2VKZG 1DTUA 3TQKA 4I3GA 2A2IA 1Z89A 1UC5A 3M44A 3RFAA 4REQA 5DT5A 5LKYA 1R5YA 1FH7A 3BSMA 1EBGA 5T9CE 2WM1A 5M5DA 4JKLA 4ORMA 4PUJA 2WYSA 1PZ3A 3B05A 1TTPA 4G6CA 5CPOA 3AHXA 3UWWA 2Y89A 3QC3A 3ZSTA 1XLHA 4QLJA 4BQ3A 3VNIA 2OR2A 1X97A 1Z9AA 4HYRA 3OODA 5K3VA 1Y0EA 1I0DA 3H2NA 3W7IA 1XIJA 4JFWA 1P7TB 5EMUA 5EY5A 1ISYA 2V38A 1NARA 4A3RA 2R1LA 4L9ZA 2I57A 4HNLA 1JGIA 1J2BA 4YVVA 4GOAA 3R2GA 5A8NA 2VP8A 4EOUA 4IQEA 4CU6A 1TVNA 2E4TA 2IKGA 3WUEA 5MF5A 5REQA 1UZHA 3GU9A 4GK8A 4F66A 1EJVC 3F2CA 3UXIA 3D5HA 3UG5A 1PKYA 3GIYA 2WJFA 4AD3A 1BF2A 4GZIA 1VENA 2BLEA 1ICQA 2O55A 3V5OA 1MEIA 2FFIA 1Y65A 1AQ0A 4ZE5A 3N9KA 2UBPC 1GZJA 5FF2A 4DYKA 3QSTA 5IBXA 1A0CA 2VZOA 1JR1A 4B4FA 2PU0A 5CAHA 5I24A 2VC7A 5EMKA 2RDXA 2YA0A 1P0NA 1OF8A 4MB4A 2Y85A 4B5VA 1G5AA 4DNMA 1DBTA 5ABGA 4QROA 1SZNA 4IMDA 1I6NA 3TWBA 4PMDA 2IKIA 3KVLA 3Q67A 3CGTA 4EK7A 2X1TA 4KEVA 4Z2KA 3DCPA 1TIWA 1L9WA 4UNKA 4HB7A 2VZSA 4UMAA 4ADTA 3KXQA 2VZTA 1EGZA 4H19A 4FAMA 3T4CA 2NV9A 1PO9A 4LBUA 1MVYA 1FWAC 1LF1A 3R8RA 1D3HA 1RK5A 3H7UA 4QRNA 1O1ZA 3LG3A 5CZTA 3C2VA 4UZSA 4H7ZA 1VFLA 1EJTC 4MPKA 2O9PA 3AXKA 3JZEA 3M41A 1ZJIA 3AWOA 4UCFA 4HHHA 1HJQA 1IEXA 4C90A 1NELA 2BOGX 4QAWA 3VU2A 5AHNA 3UYCA 2WOQA 5LYRA 4ASTA 3G6LA 2FJKA 4INFA 2QCEA 1JDDA 3M6YA 4F4RA 1ZLPA 4LB3A 1POKA 5HQLA 2G4JA 1XCWA 3W87A 2QCNA 3P67A 2UY4A 2WK2A 2NSOA 1X39A 2BG5A 3U48A 3SGZA 3UZXA 1GCYA 5BWFA 5CSRA 3U6WA 3M0LA 2W92A 3GZ3A 4LUJA 5AVHA 2JF6A 3RK8A 4QLLA 4HBKA 1RR2A 3WLRA 1AH3A 4PMNA 4W8BA 4OGZA 1TPDA 2D1ZA 2Y8KA 2QPUA 4QSHA 3WH6A 3NQMA 4I5RA 2TMDA 4XVEA 1CLXA 4YS1A 5IOBA 5LIKX 3TROA 2DORA 2J88A 1FUYA 3HGRA 4MKNA 2QAPA 3E74A 1QNVA 3HPZA 4Y6GA 4MKSA 5D2VA 4C6MA 1JXKA 4F9JA 2Q8ZA 1DWIM 3GG7A 3N3MA 1VGAA 3PFMA 3U5UA 4Z42C 3SCSA 3MYPA 4DJFD 1JZ8A 3VMNA 3W71A 4Y8EA 4LALA 2XTKA 3HPAA 1JFHA 4KMQA 2FJUB 4P8XA 3WH7A 3NPVA 2JGYA 2P0IA 1UIOA 3LM3A 1JYVA 1JRBA 3P8JA 1OX4B 2A3LA 3M47A 1J2WA 2P10A 1UUOA 1FWCC 5IDZA 2VURA 5K2ZA 3NDYA 3VZYA 1EDGA 4U33A 2QCDA 1NFGA 4UTUA 3IVSA 5E6ZA 4K2SA 3Q37A 3EB4A 2A3HA 2Y2WA 5F1VA 1VIZA 1E73M 4Q8MA 1ZALA 3QZAA 3EXTA 3OLIA 3GXTA 3AMKA 1YBQB 2QPSA 3DENA 4K38A 2BTMA 4JX4A 4DPQA 1AL7A 5EU9A 3AAMA 2OO6A 1J18A 1Q6CA 4H8UA 2CLIA 1AZ1A 2TSYA 5TBOA 3PG9A 2YXGA 4KCVA 3D6NA 2AAAA 4GIEA 4KFPA 1TV7A 4HHLA 4DXVA 1UR9A 2Y8VA 2ZZ1A 5HNTA 1MFVA 1XR2A 2FHFA 1DWHM 1EJSC 1D3GA 4LJ3A 3S5YA 3RYSA 2BZNA 1XF0A 3HFYA 3FJLA 5A95A 4JYFA 3ZLGA 4O8RA 2R1PA 4UWMA 3W29A 3UNDA 3TN3A 4CLMA 3KUMA 4S39A 3D47A 2J8FA 4UFHA 1UZ1A 2WCGA 2Z0IA 1QPQA 3VKCA 4MJZA 2QJMA 3NSNA 2A7RA 1VFHA 4IP7A 4GABA 1MXGA 3EMZA 2CXEA 1WYIA 3LCLA 2Z28A 3VCCA 4RNFA 2NQ5A 1LBLA 3WUGA 3S1GA 1OM0A 5KSWA 4YCOA 1I75A 3W83A 3NQEA 1E43A 1EC8A 3GU1A 4JFUA 2EGZA 4LUSA 5T9BG 2D3NA 1Q6GA 3BLPX 2FZNA 1K9FA 3GH5A 4A35A 3M0KA 5CGTA 4R7OA 4DF2A 1PDYA 3DAQA 4H9XA 4TMCA 3DEQA 5I77A 4CD4A 2QV4A 2DT0A 1NOUA 2VUYA 1W1A1 1S1PA 4NP7A 3ELFA 1YHTA 2F2HA 3N73A 2C91A 4DIAA 3SCWA 3GVVA 4RCXA 1W2VA 4IOTA 2QF7A 1BXBA 2YDAA 4NXKA 3G5EA 1S5MA 4GISA 1MZRA 4IT1A 1JYXA 2NWSA 3R0UA 4DEFA 5C9ZA 3W1LA 4PCFA 2Z1BA 3NGJA 3PBWA 2X42A 1ISZA 4PTVA 4IFKA 4PCPA 3HZ3A 3FXGA 2Y61A 3IV3A 3I68A 1A5CA 1CYGA 3CJPA 1QNPA 2J7BA 3HFTA 3N34A 2V63A 3IAQA 3IUIA 4PCSA 2PEVA 2DV0A 3MHFA 4B4HA 2DH3A 2GK1A 3I7SA 1UWRA 4O15A 5HULA 2RFGA 4D72A 4UQEA 3TTQA 1VCFA 2NVAA 3IIPA 1NSJA 3CYVA 1AFSA 4L6DA 4WCJA 5BOEA 2ZVRA 4W5UA 1W5OA 2YB4A 2EEXA 4C7DA 3QF0A 4YTUA 1UR3M 1WX0A 3P93A 4JTGA 5AZ1A 3UG8A 5CKSA 3ZWTA 4D71A 1JPKA 3AIRA 1E0XA 1ZGDA 3EX2A 3E0WA 2PA6A 3NPXA 3G1AA 3TOPA 1TZ9A 1TYGA 4CKQA 4NYYA 1GZGA 1W3IA 1D2KA 1K7EA 1NWTA 1JQXA 4WKFA 2YW3A 7ENLA 3NVTA 1XYBA 2JGQA 5C55A 5AHEA 3WLSA 1GORA 2B81A 3B97A 3RDKA 1E55A 4Z2GA 2XVLA 5B7ZA 2QJHA 2QJJA 2FZ8A 4F0LA 4LYQA 3LPOA 1HUVA 1NDZA 2NLYA 5FF3A 2J6VA 2VEFA 3UPWA 3STFA 1H51A 1X6UA 3U8GA 3VIGA 1PXGA 1GEQA 5M2FX 2RGLA 1JPIA 5E6YA 4DUOA 4LUYA 4QNWA 4PUMA 4B5TA 4LH8A 1WXYA 3G3MA 2E3ZA 4QJ3B 3B8WA 1N8FA 2GYIA 1W8GA 4FNTA 4WXZA 1IT0A 2WHLA 3N04A 4V28A 3UGRA 3TH6A 4N9EA 1XPGA 3W7EA 4H3DA 4CN1A 5JQ9A 3Q45A 1AODA 3V5CA 4MM1A 2V8ZA 3A22A 1SW3A 1XH0A 3H2CA 2IKJA 3PTDA 4HMDA 3CYJA 3NOEA 1O60A 2XH0A 2E5CA 4KWOA 5FJOA 4EPEC 1LBMA 4JR5A 1JPMA 1E1CA 4R33A 4R34A 1E51A 3GIQA 3WQ8A 1UMLA 4JTCA 3TOYA 3KRBA 1Z8AA 3SUTA 4D8ZA 3R1ZA 1QNQA 3LPPA 5HINA 3W26A 2ZXBA 2C15A 5BWAA 3DI0A 4GJJA 2X7WA 4GJ1A 2XPKA 1ML1A 3TTYA 3WFLA 2EPOA 1A5SA 5HMFA 3N4FA 2EJ1A 2HS8A 1CW2A 1EZ2A 2FVKA 3WD0A 1IIHA 4O57A 2Z29A 4Z17A 3ARSA 4M19A 2B7NA 1XIDA 3HQ1A 4H2HA 4UBPC 4KKXA 4MIMA 3R13A 4KCWA 4JTTA 4RNHA 2WSYA 3RR1A 1XKYA 4DBDA 3C61A 3ANUA 3L5AA 3TTSA 3QXBA 1XX1A 1K6WA 2NVCA 1HKWA 1ONRA 1VBGA 3WJSA 4TXEA 2REQB 4W93A 4D6FA 5DBTA 4UTHA 3FIGA 2W5FA 1OCQA 3GG1A 4PMRA 3F03K 4D6IA 4Z1DA 4OBSA 4DELA 1JAKA 2R1MA 1DEDA 2DT3A 5D30A 3T55A 1H7RA 1XINA 1XLBA 3C2OA 1PAMA 1JXJA 4DWSB 2X1RA 5I7GA 2J66A 4PL2A 3ZT5A 4C6CA 4U5IA 1W37A 1NDYA 5DELA 4JY8A 1UKTA 1RALA 4XQ6A 1V3LA 4GY0A 4AYSA 1H62A 2PGEA 2RDUA 3PJXA 3GUGA 2I56A 2H3BA 4F0RA 3SCRA 3GTFA 1YKWA 1QDSA 1US3A 2VWTA 2CLFA 4JN6A 1M65A 1R3QA 2WW5A 1C7SA 2WMJA 2XYLA 1WZLA 3NG3A 2YLAA 1OK6A 3M46A 5F2IA 3WNPA 4OUIA 2OEJA 3F5JA 1KFBA 3LTYA 1H4PA 5BCAA 5DCDA 4PYSA 1XBVA 1S2AA 3P6LA 3INPA 3ONBA 4O0KA 1YTKA 3CUXA 2XSAA 3R43A 2PDPA 1BXNA 1GT8A 2DGAA 3LSCA 2YA2A 3ABQA 2H8XA 3NQBA 4KS0A 2OJPA 4H9MA 1V7YA 3OLEA 2DW7A 4F0HA 3IPWA 4G7FA 5HR6A 1QI2A 1HGWA 4K6AA 1MSSA 4MYXA 2OYMA 4RLIA 2DZTA 2FGBA 1QATA 2G97A 2XIMA 4DJDC 1SZEA 2ZADA 3EWCA 1MMFA 1V0LA 3ABSA 4RR4A 2VGFA 4ZR8A 3VKBA 1C93A 3LI1A 1QI0A 4BKNA 4OECA 4PRRA 4P61A 3T0AA 4KWUA 3VOIA 2IQ0A 1H50A 4GMEA 1DJWA 3HGOA 1KGUA 5EBUA 1MO0A 2A7PA 4HOWA 4F0SA 2Z1SA 4X61A 4O4WA 1EHAA 1TPFA 2ZOXA 5CPLA 3LS9A 2VEKA 3CV6A 3PAOA 4DJEC 3IGXA 3BC9A 3ERPA 3IRSA 1YYAA 3GR8A 3SFWA 5G4HC 3A6OA 3II1A 5FIPA 3BCFA 3IK4A 3PHAA 3QY6A 4B5WA 1E6SM 3TC6A 2YL6A 3VMPA 1ENUA 1GVYA 2Z00A 1VIWA 1RJQA 4H1ZA 4KGLA 3O6YX 3CQIA 5TD4A 2NVDA 3W7HA 3WQFA 4LEFA 4O19A 1KCZA 2PDBA 1NWRA 3PK7A 4H8HA 3QW4B 1PIFA 2GLKA 1JAEA 2NX1A 1B3XA 2P3EA 3SURA 3ATYA 4XZNX 3HPSA 4ZVJA 1CT5A 4ZODA 1GVSA 3P80A 3K8KA 1VYSX 3BGGA 3F7JA 3PS7A 3GVGA 4WGXA 3TV8A 3BVJA 1CGYA 4BI6A 2RJGA 1F5ZA 4AIOA 5AC6A 1UKSA 4LYKA 4GCXA 4J2PA 2J25A 2AL2A 1PKNA 2D73A 4JTFA 3PPGA 2INFA 1HG3A 3ZMRA 4GPNA 3L4XA 2PWHA 5DLCA 3DOPA 1U1UA 2V3FA 2GUYA 4QR6A 3VIIA 1VFMA 2PBGA 4UB9A 4YCPA 7CGTA 4GC4A 3RITA 4NAEB 4LRSA 1H7PA 3LLXA 1H7XA 3DHUA 1HKVA 3SY8A 1V6UA 1TPWA 3AIEA 1GTEA 3GDLA 4CNTA 3C4UA 1OSEA 5CZKA 1X98A 2WANA 1VCVA 4V1XA 3N3TA 2ZX7A 4TR9A 1ZCOA 1XYZA 3ZR5A 1XXXA 1E0TA 5DMMA 1OCJA 3N11A 1OADA 1EJRC 3UZJA 2PDFA 4Z1BA 1BRLB 2ON3A 4XZHA 5HJYA 3GLCA 3QYQA 3AMGA 4ZTXA 3W0KA 1ZB5A 1YPFA 4UR8A 1EGMA 1X6NA 2WVSA 4W84A 1AA1B 5HUOA 1Q6LA 1BEUA 4DWSC 5AB3A 1XRTA 3SDOA 4BQ5A 1E40A 1TZ7A 1KA9F 1PS9A 3ORWA 3GG8A 1TJPA 2EQDA 3E5BA