4JJAA

Crystal structure of a duf1343 family protein (bf0379) from bacteroides fragilis nctc 9343 at 1.30 a resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
368
structure length
353
Chain Sequence
SDVIIGAEQTKAYFPILKNKRIAIFSNHTGMVGNKHLLDILLENNFNVVAIFSPEHGFRGNTIDSKTGVPILSLKPSEASMKKFDILIVDIQDVGLRFYTYYISMVRLMDACAEYDRKILILDRPNPNGHYVDGPILDMKYKSGVGGLPIPIVHGMTLGELALMVNGERWLPSSRICDVTVIPCKNYTHQTMYRLPIPPSPNLPNMKAIYLYPSICLFEGTPVSLGRGTTLPFQVYGHPNMTGYNYNFTPRSIPGAKNPPQLNKLCHGVNLSNLSDEEIWKKGINLDYLIDAYHNLNMGDRFFRPFFELLVGTDYVRKMIEGGKSADEIKARWKRDVERFKIQRKPYLLYQDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 109
structure length 353
sequence length 368
ec nomenclature
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07075 DUF1343 Protein of unknown function (DUF1343)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jjaA00
4JJAA 4K05A
chains in the Genus database with same CATH superfamily
4MRNA 4XDHA 3AR5A 4P98A 1XD2B 2P9FA 3EG9B 3JD3A 1I3KA 1TQ8A 4E7PA 5KQSA 2PZBA 3LFUA 2EQAA 3EFHA 4TM7A 1ZX1A 1L4GA 1NSTA 4UUPA 2VUHB 4CDGA 3WGZA 4EKEA 2NVOA 3C6QA 3EA5A 1BVUA 3PP8A 1JW9B 1RHUA 1EBFA 1R3UA 4JN6B 2H65A 4AJEA 5A1TA 1SVOA 1OWNA 1VE6A 2K87A 3EZGA 1SXJC 4NABA 2JIOA 5D00A 3UM9A 4TXLA 4EF4A 1F17A 2Y1XA 3MPUA 3LT2A 4EGSA 2O5CA 4EY7A 1U90A 5FT9A 3MOSA 1P3DA 4X8MA 2AN1A 4LCBA 3PUXA 4QYXA 4J0KA 4X71A 4WKPA 5F5LA 4UQLA 5JNUA 3O83A 4PZYA 3QVMA 2UYYA 3HCNA 4HQ0A 1VMKA 2QXTA 4LN1A 1O7JA 4PV7A 4I9GA 4WRRA 5J5VA 2O5VA 4RQBA 2NU9A 3WMXA 3OE7D 3E58A 4BQOA 4E70A 5KNDH 1PQWA 1W96A 5CIQA 4BV9A 3PA6A 5A71A 4X3OA 1ENZA 3CPHA 3A3PA 4Z0NA 4YUZA 4TV9B 2FPSA 4LTMA 1ZGBA 3L0PA 5DU2A 3VR4D 3U7QB 3A4IA 3DMHA 3HXTA 5D3MA 1OC4A 3PVCA 4KYIB 4Y2HA 2GEBA 2CZCA 2HL6A 5GPBA 4FN5A 3BHNA 3C1AA 1U31A 2VDPB 1A7UA 3R3SA 4RK4A 3H97A 4C0LA 1XMJA 3IMFA 2F1KA 3PU6A 4F9TA 3Q2OA 3EQ2A 4Q4AB 4QXOA 1SD1A 4GE0A 4Z3KA 4GX2A 3I37X 2N0SA 2GEVA 4ETNA 3ILHA 3EXFA 4P4SB 3QHPA 3QFCA 5CH5A 2BHRA 4URHA 5G4LA 2BBTA 4DIFA 3VU3A 1UBSB 5COAA 5C5EA 1T5DX 1N9ZA 2R62A 4X20A 2ZUTA 4AJ2A 4RV9A 4CF3A 4Z54A 2C0QA 3OX4A 5KJ1A 1MA3A 2FG6C 1OFTA 3J81k 4NAHA 1G16A 3T1TA 1TIPA 3OP1A 4LDZA 2HPAA 2ZJ4A 4DDKA 4P82A 1YB4A 5K3CA 3WLQA 5IRCD 2BGWA 1WXDA 1ZCAA 2JLAA 3MINA 4IH9A 4F8YA 3IP3A 5JLJA 1Q6ZA 3DXFA 1DKNA 1NN0A 2W2XA 2LD4A 2RCNA 4P32A 1OX5A 2Q29A 1TMKA 4YJGA 4EJ6A 2EZUA 1PQPA 3ND9A 4ZVKA 3T7AA 4OG2A 2DPYA 4FMCF 5E4YA 1W4AA 3RAJA 5KCZA 1VCNA 5K6AA 2FWMX 4NCJA 4WFJA 5LQSA 1IJFA 3UBMA 3NYWA 3EGVA 1SC3A 4ZV9A 1UPUA 1VJ5A 1JNYA 2FPUA 2EBWA 1PI3A 1B14A 3K30A 4OJMX 1K92A 1U1GA 4RFLA 1QRUA 2NO1A 2BMEA 1AK1A 2AOUA 3ZGLA 2I6QA 2V0NA 3PQFA 5I48A 1Y98A 2W2OA 5HF8A 2XTNA 5JCZA 3AILA 4M0PA 1BCRB 1W1IA 2ZOSA 3C7CB 5I5EA 3RUPA 3PQDA 1AJEA 2CLCX 2WYUA 2Q4EA 3ZGXA 1KBZA 2EXXA 2VBFA 5EFOA 5BYAA 2GCNA 1H05A 1U5BB 1DJOA 1FJHA 1MT0A 2OAEA 1A5TA 1JSCA 5FBZA 3E61A 2IBMA 1U9JA 1PVVA 3D6JA 3FJ1A 1FDWA 1TQ2A 5ESWA 4OFBA 4XDZA 3RGGA 2AN9A 1JLLB 2HKIA 5D6NA 2XE6A 4OYHA 1SG9A 2FPGB 3L0DA 3OO0A 3OIYA 1SWVA 3JZIA 1QANA 3MTJA 4XGNA 2W2VA 5A5VA 4WJZA 3K53A 5LBTA 3HJTA 3OT4A 1YL7A 1X6VA 2ZRAA 3IERA 1EEXB 3BQ9A 3FJYA 1E1QD 3FTQA 3IDFA 4U2CA 3HO8A 1DKMA 2OSVA 2JHFA 3O2SB 3PICA 3TTSA 3OPYB 1OROA 2YY6A 5HP4A 3AETA 3RUEA 1RQNA 4U9IS 4FQ5A 5C8DA 3DS8A 3R9KA 4EKIA 1TJYA 5KAMA 1GSAA 1J2JA 3IMCA 3FFBA 3QW2A 1A04A 2FHSA 1ORWA 4D0LB 5FBVB 4JKYA 1E8MA 1P2UA 2PAAA 5FJJA 3SSMA 3S2UA 2ZPAA 2DGDA 3HNRA 3Q88A 3W4JA 2J1LA 2OSBA 2ZR7A 4NEQA 3WYCA 1PZXA 3D8BA 4C22A 4E2WA 4ENSA 3PFFA 4UZEA 3CG4A 3WGKA 3KEOA 1DL5A 2CLHB 5DNWA 5B1DA 2UXBB 3IEUA 4M76B 5TNXA 2D8MA 1YZHA 2EDCA 3NOOA 4JI6B 5AFSA 3N39C 2VRWA 4A36A 2GSWA 2ZYHA 2CXSA 1R12A 3O1HB 1DC7A 1GPWB 5EP4A 4NESA 3ZEIA 2PTGA 1KJZA 3PGKA 1ZBQA 3DAOA 4AJNA 1RLOA 4KVGA 3PI7A 3Q40A 1JLSA 1QPBA 3G79A 1BFDA 1RM4A 2W8BA 1V3TA 1ND5A 1LBHA 2KBFA 1XTJA 2WVHA 3A32A 1HFWA 2MMCA 4CT4B 2BCJQ 4ZO4A 5ES4B 1EX7A 3CH5A 3HA3A 4N6OA 1KBQA 4HDNA 1X7ZB 4J76A 4L9AA 4ES6A 5IJ9A 1DRVA 3H5WA 2VR1A 5F33A 1S3SA 2GYVA 1Y8RB 1QH1B 1DCMA 1M34A 1XTZA 3SFVA 2ZQ5A 2YMQA 4YTEA 521PA 1LLDA 1KYZA 1NFRA 5BSGA 1R4MA 1CDZA 2W6QA 1V26A 1WSDA 2CHEA 4RZUA 1ES9A 4TT3A 5KPDA 4CM9A 3GP8A 1I4LD 1Y89A 3AHDA 3R5TA 1PL7A 4YN3A 1DX4A 2J0SA 3OSZA 3EEOA 4A8JC 4I55A 4DFDA 2DH5A 5DLDA 3FZNA 2QPTA 4P5DA 3KQHA 3RRYA 1IRIA 1T0BA 4C04A 2G04A 1FXWF 1WXIA 5BN3B 1YCHA 4L6AA 3VFDA 3FW1A 4QQKA 2QT9A 2OO5A 2QMQA 4LRUA 5A3VA 2VF8A 2ZSKA 4M8IA 1P1HA 1GP2A 1Z2NX 3FWZA 4PYKA 2Q4BA 3ITNA 3N8KA 4EO9A 2EERA 1G4UR 3H3JA 3HB7A 3JCZA 3KPJA 4YRIA 4YCMA 3HNOA 3HZHA 5FPTA 2FR8A 3E35A 3GGDA 5AR1A 2NAPA 5BURA 1JEYB 5JZOA 2A94A 4JOSA 4CLEA 1RFLA 2QYHA 3CZAA 5ADWA 2ZIEA 3U13A 2YZGA 4E5DA 1ZCJA 1CFJA 1Q17A 2AMVA 1LI4A 4XIFA 1WUKS 3D2CA 4IIJB 4LJSA 2EJVA 4D6YA 2ZI4A 2OBXA 3HI4A 1Q84A 1WJGA 1F12A 1Z2CA 4TWBA 3L0OA 4MLZA 3EG5A 3LQ1A 3OTWA 5D3KA 1YBFA 1L5HB 3WJAA 4NCHA 1K7CA 2I1VB 4RQTA 5HTOA 2FPOA 3PS9A 4S1VA 3H4VA 2AFHA 3JYPA 3GT7A 4NFLA 2IS6A 5TDHA 1UZAA 1P17A 5DT2A 1XVLA 5KYGA 1QF9A 4BWYA 1QE5A 4WKCA 3SC2A 2WUDA 1QRSA 3JY6A 2YV3A 4O2AB 1HMPA 2L82A 4G8JA 3ZY2A 1OLOA 5BT9A 1KQOA 4C4SA 2BI8A 1VMDA 5CT5A 4NG4A 4II2A 2C5SA 3W79A 4R9UC 5AT1A 4W5RA 1IHYA 2DPMA 4F85A 2FB9A 4OHCA 3T0GA 4E12A 1C8KA 3M2PA 4I2VA 1RS0A 1SCNE 2E18A 2QMZA 3IVRA 3QKSB 3O93A 4HZIA 4JLBA 4OXRA 5K0FA 1SHUX 3BFJA 4UC0A 1JECA 1C0IA 1DG9A 1N1MA 1KMIY 2Y1OA 4IHJF 1RABA 4TMFA 1LC3A 1KKLA 3HUUA 3QFRA 3FGNA 4ZARA 2IY8A 4D9KA 5LQKA 4R1SA 1UBTS 5F1PA 1T2EA 4MV6A 1TA4A 2FJUA 5CX1B 3VNRA 1M6YA 2VHCA 1JFTA 1E94E 1U80A 3B2NA 3HCCA 1X1QA 1GO2A 1GGKA 1H6AA 2CXUA 2IYQA 3GLRA 4PANA 3VV2A 2LWIA 3M6AA 3DVAA 3LE8A 3RV3A 3PYMA 1G55A 3WGOA 5A3JA 3EIEA 4DMLA 2YZKA 5BN5A 5FBLB 5EEGA 2IS1A 2BSAA 4KE7A 4BQEA 1R9MA 3NX4A 5DULA 1FBTA 1Q7RA 4MQBA 4KL8S 3HJNA 2PGIA 3CW2A 4QUBA 4WASA 2PKRA 3L1JA 4JLAA 2RJOA 4V0OA 1X3LA 1VLVA 3N28A 1QBKC 3RWOA 2QZPA 1WOYA 1DC8A 4BKRA 5DV9A 5CYOA 2F8MA 2X0EA 1GL6A 1HDGO 4P86A 2LRHA 4JC5A 3R2JA 1KEUA 1X86B 5EN4A 3TCXB 5CB6A 3CKMA 3HCFA 5LMCA 5FLXA 1OU0A 2FEOA 4V0NA 4BV2A 1GPJA 3GFVA 2YHBA 5KDLA 1XPUA 1FL9A 3H4MA 3EMBA 1KK2A 4ZVUA 1TDJA 4RD3A 3AVWA 4R0VA 3TSAA 4MUYA 1JQJC 4G09A 2FW8A 4W7IA 5BOSA 3HKCB 4P84A 1A88A 2JLWA 4DF3A 3J7AC 3ADKA 4XR9A 3DQPA 1Z9BA 3B8EA 4EJ2A 1E1CB 3A2LA 1UK6A 1T3GA 3FKQA 4XIGS 3ND5A 3DYIA 3MBOA 4LOKA 1O03A 2JZNA 2XMBA 1ZH4A 2I8CA 1VLLA 2HYDA 2ODNA 3QZUA 4G1BA 4EENA 4ZCMA 3GDWA 3DEZA 4Q48A 3X1XA 2XF2A 1C3VA 2W8ZA 2HCTA 2HSJA 3KLBA 4QBFA 2IOFK 3PRYA 1P0PA 3QPDA 1J90A 1J70A 1WOMA 2FZVA 2IEBA 2DFTA 3CBQA 5CB4A 3OO1A 1JBQA 4YAEA 2GYWA 4YRBA 4LV5B 3VPDA 1NNI1 2APJA 3DL4A 4ZZ2A 4WCVA 2O8BA 1H42A 4ANFA 4TQGA 4HK4A 4MUGA 3A6JA 1TZBA 1CDDA 1E7RA 5J2TA 3WMEA 3L7BA 3B6EA 4DMRA 5DLYA 2OCGA 5TT0A 4A8JA 3VKFA 5KYXA 4XCQA 3ORYA 2YY7A 1JXMA 3QE2A 4QA9A 3U80A 2X2PA 3EXEB 1C8BA 2D74A 3B7WA 2ODTX 4YGYA 1J9EA 1SWWA 5CNJA 3MM4A 2J3EA 5JC8A 1QJ4A 2HV8A 4LYEA 4F4HA 3VSEA 1OTYA 3RLFA 5C9ZA 2B25A 3LFTA 5ITVA 1ZM3A 1Y5NA 3MT0A 3ZTWA 1VJTA 1NDQA 2B7BA 1XRNA 4M6WB 3ZY3A 5K3OA 3G2PA 4IICA 2WHXA 3K0BA 1BE1A 4CTNA 3WP1B 4CCYA 2AMJA 3TNLA 4J0GA 1XGKA 4L16A 3UENA 3X44A 5AVUA 2ZTSA 3HYRA 5ITWA 1QDEA 1N2OA 5EWJB 3R74A 1NHWA 1NN5A 4R2MA 3MB5A 4S1TA 3W3AA 4ZI2A 4NNOA 5AVYA 2DEUA 2WD9A 3ER8A 4AYWA 2F1HA 3L79A 2R8ZA 4HN2A 3IKLA 2DR0A 1J06A 1Z8FA 2J87A 3LP6A 4TQUS 3GVIA 3SS9X 1GA4A 5DTMA 1RCTE 1UFQA 1TVKA 1QRTA 4G8DA 2QB5A 3I0ZA 4YECA 1W5SA 4AP6A 1D2NA 3NHSA 3CLSD 4MW4A 3SF8A 3PUVA 3P94A 3MWDB 2CL7X 3S70A 2HLDD 2JIZD 4K9MA 3O03A 4QARA 5JMPA 3JALA 5TMDA 3U37A 4GL2A 1FPMA 1L4UA 1W76A 2VDMB 1GNSA 2FSIA 1J25A 3QF4A 4RETA 5BW6B 2YNMD 2X0JA 2AFVA 2Y66A 3ZZMA 3JQ8B 4ZU1X 3VTFA 5BYJA 1XZKA 2EKBA 2GJSA 1CSEE 4Q19A 1NUAA 3DEAA 4ZA2A 3VYVA 2XSZA 4IOMA 2C57A 2ZANA 3ROFA 4RTKA 5J4YA 1WLSA 4BO8A 1UPTA 1PR9A 2QM7A 2LIPA 4YA6A 4JJIA 4AMBA 4HNAA 1AQ6A 5JY1A 3ZGNA 3KOZA 2NAFA 1N7IA 1XNHA 2EFYA 1VDZA 3A05A 3CEJA 3KAQA 4YDSA 3ZWPA 1TT7A 3GBSA 1MH9A 2KX7A 1GSOA 1A7KA 2PKWA 2IEZA 2QXYA 2BH2A 2XECA 4P7GA 1ESZA 1YONA 3NATA 5EINA 2AUTA 3WDMA 4Z1MD 3OOSA 4IDPA 5F7OA 3TUZC 4ALMA 5EHXA 4IAOA 1GRVA 4IIFA 4P4GA 4KH1A 4DILA 4YAGA 3A06A 3V97A 4EY8A 2PZJA 5DHFA 1OH7A 2VXBA 1VKJA 1E9AA 3GLQA 1Z5WA 3BEOA 4O1HA 4U7GA 2Q0QA 5CCDA 1KRXA 3YASA 2ZBGA 2AE1A 4GGMX 3SOZA 2GDJA 4IVNA 1Z73A 3H6KA 3L0BA 1XQWA 1FF9A 1IHPA 3WNBA 2CUNA 3PXXA 5DTIA 1PFKA 5C1PA 5TGTA 5FWAA 3UW3A 4N5NA 5FWXB 5L7TA 4D43A 3QLJA 3AY7A 4U5QA 3VMMA 4DNQA 2P9ZA 1DV1A 3B12A 4Q7JB 3DHVA 2AXEA 2YC2C 4IMRA 4JWKA 2QG4A 1TXGA 1FFHA 2WIKA 3AQ4A 1H93A 3PKJA 5LMZA 3GEDA 4MQ6A 1T29A 2GK6A 3LY9A 2SECE 4GZLA 3CWCA 4O3MA 2PRYA 4BXOA 4NZMA 4LW8A 3FNBA 4L4RA 1GTRA 1RBQA 5K0NA 2C4NA 3W9UA 4M1MA 4CIDA 1JT2A 1JHAA 1TCAA 4BRUA 1VKZA 5CLGA 4O0MA 2XI4A 3LZDA 2FDXA 2I65A 2JZOA 2VSNA 1DSSG 3GLGE 4TZKA 3GVXA 3CH6A 3ESYA 5DX1A 5CFNA 1BX0A 1CUJA 1NJ8A 2PK3A 2P8SA 1A8UA 8ATCA 2AE2A 1V7PC 2XUAA 1RWQA 4V03A 5A5EA 5IUNC 2C92A 4BLUA 1RKBA 1G8FA 3AUXA 4BLQA 2DR3A 3FSRA 3ZUPA 5I8PA 2HIHA 3PQ5A 5CG1A 3B5IA 1Z6AA 3VYUB 1JSXA 4E5NA 1LU9A 5DASA 4J3FA 4XM0A 2WA1A 2ZJ2A 2PN1A 3WK7A 4RA9A 5L3QB 4DV0B 5IBRA 3I5AA 2BTQA 2QAGC 3KBBA 3I2IA 2IWRA 5K1ZA 3VJKA 1RP7A 1P1IA 2O8EA 5A3QA 3G2JA 4WNYA 1KO8A 1W9MA 2BF4A 1PUXA 3E1GA 5BWOA 5IDXA 4C4RA 3OOYA 3I8SA 5F5XA 5AK3A 4XJSA 1M66A 1KEPA 4W7HA 2XD4A 5E4FA 2CLFB 3HR4A 1FU8A 1A71A 3GJ7A 1C8LA 1Y5IA 1JL3A 2Y77A 4WEOA 2BMAA 1U99A 3A4TA 4R7GA 3FCOA 4KX5A 1MAWA 2V4UA 3KKNA 1DC6A 4GP7A 4HPJB 2NQTA 4QFMA 1A9XA 1RIIA 4X95A 4FHGA 3WGUA 3FA2A 3PFHA 1MO3A 1OQAA 2P90A 2XB8A 1HYEA 2PE5A 4WLOA 1N2BA 5E0OA 4TYQA 3ZXXA 5B6IA 1Q7GA 4KN9S 4EB6B 4HGRA 1A96A 3GAMA 3B82A 4IIVA 2PQ6A 3E05A 4MYCA 3ILYA 4RZ2A 3WBKA 2IYOA 2J9RA 1XO1A 4GPD1 1NJ1A 2ZZKA 3DYBA 4CNBA 4D5EA 4HLCA 4R81A 4HAWA 4DS3A 1TKBA 3IR5A 5GJVC 1S2NA 3DDSA 4OH1A 4TTSA 2VHYA 1YZUA 3HYTA 4I99A 1MJGM 2VP6A 4NCIA 3VU9B 3KSDO 3PWZA 1F2UA 2DM6A 4R8RA 1PYGA 5LUAA 2VK8A 3KJNA 5EWMA 2VQ6A 3KLOA 3FDFA 1DEAA 5CMLA 1BKSB 4G4GA 1R0BA 2ZI7A 3QHQA 4OGLA 4XB2A 2ZI6A 1RAAA 2RHGB 2ZLBA 4ARZA 5AJXA 2A6PA 2AQHA 1P4RA 2JVKA 3ITDA 2XUOA 3A3KA 4HAZA 4KXQA 1UJCA 1USKA 2P67A 2JCGA 1FMJA 2H18A 2GK3A 2P1DA 3H5VA 3B1ZA 1A9YA 1FSGA 1L5QA 1NLZA 1HEYA 1DO0A 1EDBA 5G53C 1Y80A 1PN3A 4QYIB 4U6NA 2FZWA 3A2NA 5H1YA 3ILXA 4K1LA 4H2DA 3U5TA 1CBUA 2O2GA 4NSNA 5CCXA 2A9KA 1OHHA 1C3EA 1X1BA 2YCBA 3IVAA 5FD8A 3SZOA 1J09A 1O0SA 1Y6JA 4L5IA 4MPRA 1CRPA 1RHQA 3I04A 2Y1EA 2ZS9A 3IJRA 4HEA1 4MI3A 1SBQA 2DVMA 4NBVA 5LA6F 4BJ6A 1G60A 1P91A 3V1NA 3KG2A 4FYWA 4ZPJA 3TTTA 1DT5A 2OQ2A 2QGZA 1RC8A 5I47A 1WLYA 2BDTA 2HDWA 2QRNA 3LW8A 3KAPA 2O3JA 4MZDA 1WCIA 4G84A 3KQOA 1FU4A 4Y7DA 5HKKD 1H5UA 3ZZ1A 1NYQA 2ERCA 2Z6VA 4MJ3A 1ZL0A 3EARA 4TKUA 5CCBA 1P2SA 4WBSA 3BS4A 2R7KA 2R96A 2XQKA 4BNUA 2GTHA 3OZ7A 4PIMA 5JAMA 5DGIA 1E6MA 3GUZA 3H17A 4HDMA 2QUIA 3NHMA 2DFVA 1JB9A 1XD2A 1Z7WA 2POQX 3B9RA 3HJAA 3KXIA 2A4KA 1E9RA 3R3YA 2Y1KA 3HEBA 4K9DA 4Q01A 4C7KA 5KIAA 3OLXA 1CZLA 4A26A 3VH3A 5K6RA 1U5AA 3NDPA 3NNNA 1EVYA 2D2EA 3OLZA 5I7RA 3IEPA 5ALNA 2IZ7A 3MUEA 4QECA 4FXPA 5C80A 5E8RA 5D51S 4RY2A 4TL6A 5AOAA 4MQ5A 1AO3A 3FAKA 2GGSA 5HQTA 1B74A 3Q5GA 4RHCA 5BRNA 3OM9A 1TIBA 3AVUA 2X0NA 1YGPA 3GJ0A 3ABIA 1Q20A 1W1UA 3IUYA 3LKBA 3LM8A 3OA0A 3PUZA 2R86A 2I1QA 2ZWIA 1HR0B 4QRIA 3RQSA 2ZQYA 3RFCA 2YIJA 1SIWA 3BQMB 3GR6A 2ZRPA 1V1RB 2IU3A 4RY0A 1DO2A 4F9GA 2VTKA 1XA4A 1F8GA 1QHHB 5H16A 1JJBA 4LJAA 1M10A 1WDKA 4XZ3A 1TOAA 3RVKA 3V1TC 3JPYA 4AULA 4XJXA 2PT6A 4RAQA 1A50B 2BUBA 3LTEA 4FYXA 3L7YA 1Y3FE 4X6LA 1H2FA 1OB2A 4L07A 2EG5A 4LY3A 4NE7A 1HDIA 2W48A 2RAPA 3BFPA 3DLAA 1NX6A 3K0SA 3V8QA 2FJ0A 3GHYA 1XZ8A 2OLKA 1OA0A 2MR5A 1RCUA 1NYTA 4EJSB 1AU9A 4N3NA 2NZWA 3QA9A 4QTUB 4RVHA 5B7GA 2PL3A 1ELOA 3HDQA 5FNVB 3ER6A 5JCOC 3FYTA 4HGPA 3WAGA 3C5VA 2VS1A 4KTTE 3TQSA 1U3CA 1HH4A 1C7EA 1JIIA 3C5CA 3PCTA 1QDLB 3F6RA 3PPWA 1GQRA 2PUGA 3LVQE 4M7PA 2I4MA 5B5SA 4GYKA 1ZIYA 1BXKA 1N8KA 4KFTA 2E4UA 3DDOA 3X1DA 1KJ8A 4DDUA 1K2VN 5AK4A 4AECA 1LTQA 1GZVA 4HZUB 1DQYA 1VA5A 1DINA 4LHVA 1N5IA 4RKWA 5ALTA 5CFOA 5KVSA 5HZMA 4KRGA 5G0VA 3KNZA 3I9NA 4UREA 4X84A 1DTWA 3GIWA 2X6QA 4ITVA 5EP2A 2NIPA 3FUCA 3QMVA 5FL3A 3EQ6A 2VTVA 1GL7A 3BH0A 2DU8A 5DLPA 2FX2A 4M89A 4RL4A 3OZRA 3ZVMA 2DB3A 4M0FA 4EGCB 1G8AA 3E8XA 4P6VF 3I64A 1YBVA 1TUEA 3CUTA 3EQ9A 1PO7A 1YZKA 2WT8A 3KXLA 3NHWA 2BC9A 3C3BA 4L08A 1I6KA 2GN0A 4NHOA 3EASA 3CRZA 3G68A 4TKZA 2QRHA 4M1WA 1VHQA 1EK6A 4LBYA 2WHRA 1XL1A 1WNFA 4JYPA 4EPRA 5JAPA 1WU7A 2HYIC 3HA5A 1Y37A 4XQEA 4ARAA 5LVAA 1E2LA 3QXSA 3P71T 5JI3E 1I13A 2YZMA 4LSZA 2IYNA 2PMBA 1YNOA 4QTYA 1ODLA 3BIWA 3VDMA 2X4GA 1CUBA 4RVDA 4YDRA 5FFFA 3AESA 3DL0A 3JD1A 4EG7A 2AEMA 1POWA 3PDJA 3V2IA 4ADSG 2HMTA 3HS3A 3P4YA 3A1EA 5D1NA 1Z38A 4GDFA 2QI9C 5CTAA 1QVZA 1Z28A 4IIUA 1MFPA 4U7PB 4ZYXA 2F3SA 3D6NB 3QE4A 4RGYA 4MW0A 1YU9A 4L22A 1XZEA 4WNAB 2IZ6A 2P9TA 2J85A 3LLVA 3WICA 3KRTA 1QBGA 4J16A 4R40A 2ZE7A 1BW9B 1SC6A 1GQQA 1O96A 2GPSA 3DHYA 4K6GA 3N0WA 3F6SA 5AQEA 4Y2VA 2Z57A 3IP9A 1JLLA 5FTNA 3UMGA 1UAGA 1AZWA 1TCUA 4HKTA 5HWSA 2OV6A 4J1TC 3C8UA 3P2IA 3UXMA 2D7CA 4FFWA 4JR1A 4MR7A 1LRLA 1QG4A 3AVOA 1EXMA 3KKLA 4MEBA 2AG5A 2DC1A 1RRGA 4TRJA 4KQCA 1X7XB 2JFNA 3WKAA 3KWMA 1E89A 3DGFC 3IODA 1XZQA 4PINA 1FFYA 2VJMB 1I3CA 4TLDA 3IVMA 4M0EA 5LD2C 3IIMA 3JQ9A 2C4VA 4KFSA 2Q6TA 5DMHA 3R7SA 4W5OA 2RH9B 1L4YA 1XWFA 1ZCFA 1ZKMA 3TMYA 1KU0A 1Z12A 2P9QA 3C8MA 5KNBD 1Z08A 1RXUA 2Z30A 3IV7A 1E59A 1X70A 2ZS7A 3O3NB 1S3FA 3CPEA 3WIBA 4EI2A 1Y8QB 1UBCA 4AKEA 1X0XA 1XU4A 5DF1A 4DIKA 3I2HA 1Q50A 16PKA 3RM3A 2C4WA 1G98A 2W42A 5K51A 3SIXA 1A97A 4PGGA 2HJ9A 4TZTA 4HWTA 5FBHA 2DLCX 3PHHA 2IL1A 1Y4SA 2GO7A 5DISB 3WRXC 3DOFA 2QT1A 3ZIUA 5BSVA 3RPEA 1HQYE 1KZYC 2PFGA 3CGGA 4YP9A 2QSUA 1ZNZA 1BDJA 2AK2A 2BBOA 1MU0A 2OXFA 3E7WA 2BGMA 4A92A 5IUKC 4EUEA 5CFLA 5IAAA 1CR6A 2R1UA 1A4UA 4JQCA 2VPIA 3AH8A 2PXAA 3SZRA 2J33A 1RNLA 3UPDA 1YR7A 2ZTUA 1PVOA 1ZAKA 2DFPA 2JW5A 3MWYW 5FI3A 1FRFS 5IWCA 2JAOA 3CH7A 1EX6A 2RK3A 2EKLA 5KTOA 1W36B 4Z3OA 4JUIA 4ER6A 2QLMA 1M1NB 2O23A 3ETDA 1L3CA 3G49A 4I66A 2ETXA 3LT4A 4G67A 1Q0TA 3U3MA 3P26A 5LR6A 5IP5A 4WOPA 2Q0HA 4PSAA 1QH1A 3PTZA 3W8DA 4A1OA 1ACJA 4B2PA 5BRJA 5LBIA 5LM3A 1M2HA 1U7XA 1L3IA 2P2YA 4INOA 4NENA 2CXQA 5JWRA 4HNTA 4BLOA 4KBGA 1IEXA 5F1OA 2A78A 4DM4A 4EIWA 2GJKA 4TXNA 4UVIA 2DUJA 3C6BA 4DTCA 1LPBB 4PNHA 2ZTHA 3DTVD 1JBEA 4V0LA 4CIXA 3X1ZA 5HGJA 4ARBA 1CQZA 4LSGA 3I53A 4QDZA 5LP6A 1YKFA 1ULUA 2X1HA 3Q8WA 1XHLA 5BPHA 3KQNA 4DLLA 2JIMA 2F1OA 3LBHA 3U3JA 3OMXA 1T1SA 1T4GA 1HZZA 1B3BA 1F4LA 1XV5A 4Q9IA 5L3SA 2JIQA 1TECE 1KVQA 3BXGA 1SKAA 1WMFA 1QFJA 1NUHA 2QRJA 3DCIA 2A5FA 3OLVA 4PAGA 1MRSA 2RC6A 3AJ9A 3KZOA 4ZDWA 4AU1A 4D79A 4NYMQ 3OCXA 2QTAA 4FR5A 5KKAA 4AJLA 4RK7A 2OK7A 2OR3A 4KAXA 5ULLA 1BMQA 2O6LA 3DXZA 3CEHA 3V80A 4IIBA 4DG8A 3K73O 5KNLA 2Q3LA 3U9TA 4FS8A 1J23A 1MZPA 1W85B 4XIJA 5PGMA 3VYSB 4EVRA 3UA3A 3EVZA 4LWZA 2Y9MB 1MB0A 3CMCO 4H7EA 1R4ZA 4CGYA 4ESOA 1RLJA 5DE3A 2FWNA 4JVSB 5JQGA 4BVJA 4R3WA 3ZHVA 1UQTA 1VM6A 3F73A 3W3ZB 2G6TA 3HSYA 3RI3A 5K9ZA 4DMHA 4A0SA 1GDDA 4CWAA 1GM5A 4F4IA 1Z0SA 3R3VA 5DWDA 4LA4A 1U8CB 4H6VA 1AHPA 3AJDA 1U0GA 3QBEA 3U4AA 3V7UA 2COEA 5I8WA 4O4HA 4RJLA 1BMDA 1SURA 1O6BA 2OV3A 2Q5OA 3HUEA 4PS0A 4AIIA 4US1R 5HRAA 1HURA 1G1AA 2YMMA 4HXYA 1UBFA 2WQ6A 2WWGA 1WVIA 4RTPA 1JHXA 4G2TA 4ZQGA 4D5GA 2D8AA 5EMHA 3ZV5A 2AUNA 2VAMA 1X94A 4JCOA 2OG2A 3DE4X 2MDTA 1Z74A 1W4RA 4I9FA 1M7GA 1F20A 2WJ4A 3H0KA 1R8YA 5MHTA 5G2OA 1K6JA 4B3XA 5HOQA 2O6HA 2JFBA 4TSKA 2RB5A 4MV3A 3THWA 3GJQA 4XAQA 3AOGA 4JNCA 1YJQA 3IPAA 3E5NA 4DLZA 3HV0A 3TZQA 3DCJA 5BYKA 3H1PA 1DC5A 2FP4B 5CX1A 1T0IA 3NH9A 1Q7CA 2Q4RA 3KQTA 4GXTA 4MVWA 1JVBA 3BMCA 3MILA 3CUWA 4KIFA 3V8PA 3BE4A 1LPOA 1JH9A 5IVKA 5IH3A 5CFRA 1TQDA 3ID6C 2A0FA 3FDZB 4L0QA 3LCCA 5HZKA 1W46A 4JEIA 1QB8A 4LUCA 4QUGA 4UULA 4XCVA 1D6JA 1G5TA 2C04A 2CVPA 3QH4A 4FNGA 3ZS9A 5U1PA 3V4FA 3K1AB 2I6FA 1WDLA 1V11B 4H6XA 2WF9A 2HA3A 3A1VA 3MCAA 5IH7A 4NNJA 5DCYA 5AI8A 1HZJA 3G82C 1S1CA 3B2EA 1YR2A 4PZPA 3B13B 2G40A 4UZFA 2YRXA 2CL0X 2PEYA 4QDXA 5EE9A 2R84A 5AW6A 2OGUA 1NQXA 1I1OA 3OZAA 4RHEA 1OJLA 4OEHA 1Q0SA 2CHVA 3N2KA 3QJYA 1CQIA 4HHEA 1WBJB 5KOHB 3KYDA 3B78A 3FBGA 4YBZA 5EKXA 2MSWA 3CG0A 3L49A 1G8HA 5ALXA 4KPEC 3K70C 4FZRA 4D8TA 1ABBA 3I01A 3PEYA 3ONWA 1WD7A 2JDID 1P1KA 1ZRMA 3OE7A 3HKCA 1TU4A 4K7JA 4OFXA 1KY4A 1UC4B 1JEJA 3QI7A 3VC2A 1RZ3A 4YALA 3C8DA 2BUAA 1T1IA 1T4CA 1HSOA 1SKQA 1UAYA 3A9SA 1U6JA 3WB1A 1ZFNA 2Y93A 5ALGA 4HY3A 1V8ZA 4J0CA 4D98A 4CQMD 1DPGA 3F0TA 4RJTA 3VR4A 5DXFA 4YMHA 3WL8A 2EGHA 2DKNA 1UKVY 4HQNA 3UCXA 1GTZA 1NGSA 3T5DA 1V7CA 3GUYA 3FJOA 2O1EA 3LLUA 3QX7A 4JP8A 4DLVA 2ZI3A 5AKIA 4EG5A 3WYAA 4YPFA 2PUEA 1TGVA 1ZMBA 4IR7A 2AK3A 2I3GA 4HD8A 4E51A 1G3RA 1ZU5A 1W0JD 5DHAA 3TNJA 1NUUA 2I7VA 1OILA 2O50A 3AWIA 4YJ3F 3ZGYA 2WILA 1C7ZA 4BIMA 4DKJA 1OH8A 5EC8A 1AD2A 1Z45A 3D8SA 2A9VA 4FOLA 1KTIA 1TQ4A 4NK4A 3T5AA 3PZRA 1OXKB 4RNCA 4ZQIA 2Z9DA 3T5MA 2NU6B 2JK1A 4NXNB 1R18A 1JQEA 4NS4A 4BV3A 4BEWA 1WVGA 4Y2GA 1GFIA 5FOWA 3SP1A 2OEPA 2IUYA 3QXGA 3R4CA 3KJHA 4RJ2A 1DZIA 2IHYA 5I7OA 1Z6XA 3CF4G 1N92A 4ND6A 3WIDA 1A8HA 1BHJA 4YJ2A 4MQEA 3SCZA 3MF4A 2OXEA 4FJ0A 3SX0A 1XXHB 1P61B 1IM8A 3IQWA 1LKZA 4WLEA 3RFTA 1HT1E 3UN1A 4MQMA 4G1FA 1JU4A 2ZUVA 4M6WA 3I5YA 4DEYA 3AX6A 4W4TA 1PHRA 2IHVA 4GM1A 5HIMA 4ERXA 4UM9B 4EGJA 1O6GA 3HDVA 5E1OA 2RHBA 4NYJR 3DOHA 3O8QA 5E6UA 3TIGA 2VXCA 4W1SA 3TFOA 1GZ7A 3VDQA 4OLAA 3QUAA 2GS9A 2RSLA 2WJ6A 1SAYA 1D8AA 5E3IA 2BM8A 1WTCA 2MINA 4FYPA 2ZUFA 2FRDC 2V3VA 3KZXA 3IR7A 4YLEA 4CG0A 2UYHA 2HA2A 2PGLA 3GOHA 3NGXA 4R31A 3OUZA 3EZFA 3PJGA 4IDCA 1L7MA 2YWRA 4L75A 3ROEA 4DCSA 3GA0A 3WC4A 3L4JA 2ODAA 3ESBA 1J00A 2AB0A 4DHEA 3CZQA 3OQMA 2EFGA 3LCVB 5FOXA 1JIKA 3MWDA 1E8NA 2J3IA 2QTTA 3ROMA 1E0DA 4AC9A 4CMEA 1JG4A 3CIOA 3GYGA 3GLFA 3IJEB 4HGYA 4YS6A 4O1MA 1YL5A 4ECAA 1ZLXA 2F2TA 5JEDA 5JVDB 2HU8A 1MC8A 1V8BA 5AVWA 5JDIA 1L8XA 2OGSA 3MRXA 3JQ6A 2JBHA 5DXAA 3GXOA 4W7SA 5CT4A 2V03A 3ZYZA 5K3SA 1JDJA 3A1CA 5BNZA 1NWHA 1FYWA 3PHBE 2PBLA 3AP1A 3EY4A 4LRWA 4PZUA 4ZEOA 5AW3A 1AHHA 2VDJA 1XA3A 2VEDA 1QS0B 5IHXA 2BFBB 1NV8A 3LXUX 1ZXBA 4JB2A 1HEUA 4NMHA 3RS0A 3SYRA 4A82A 1E1QA 3GEIA 2YICA 2GZHA 4JC0A 2FZEA 4EHDA 1XEFA 2VDWA 2OESA 1WZNA 3GMDA 2XYGA 1H4TA 3ORQA 4OHUA 3OFND 1G7CA 421PA 4ZREA 2DLNA 4JAVC 1E1LA 3JVDA 1K98A 2QWXA 2UZ3A 4QL3A 1CWUA 1QTQA 2BGRA 1J0BA 2PXXA 4OXYA 3JR3A 4MGIR 3GLGB 3S7TA 1D6SA 1LUAA 4ZYTA 2C07A 3EAFA 3DPUA 5K4AA 2A9PA 2PX2A 3VPAA 1YQQA 2XOKD 3I05A 3WZ2A 5JHGB 3ASUA 3N8DA 5FAKA 4J75A 4MV7A 1UKCA 3C8HA 1PDWA 3FHOA 4FD3A 4D1YA 2MYNA 1H2RS 3ZDBA 1O58A 1EWTA 4B6OA 3L0ZA 3ZW9A 5FWXA 3FPEA 1CERA 2ON6A 4UARA 3OHSX 3LYHA 1R0CA 3FNGA 4IV5A 4NDZA 3W9YA 1KEEB 5LFAA 2IOYA 3HGQA 3OZVA 2WC1A 3KT6A 1G2QA 3EIHA 4OU5A 1IVYA 2B94A 1PEYA 2H8KA 4IOKA 3LIPA 3PQ8A 1EDEA 4EB3A 5JALA 2KLHA 3CZCA 1FFBA 4LVOA 2IYTA 2WV9A 3M6LA 4FU0A 4OQ4A 3DULA 4QVIA 2JD0A 4KUEA 4AZ0B 5CBPA 2O3RA 3Q3VA 3MJ4A 3Q3IA 1KC3A 2QDKA 4PLZA 4V3CA 3HWWA 4PTZA 3IR6A 4XD7D 2NVBA 1KJNA 4AJOA 2QENA 1R9NA 1J2TA 3BCHA 1SUCA 2B1GA 3FZEA 3IP8A 4BEVA 4F38A 5FUMA 2CCKA 1MJNA 3NBFA 4GKJB 3LK7A 4ZT3A 3IPRA 1AUXA 3KT3A 3LC1O 5ILGA 4RXMA 2XVZA 2FGJA 2IELA 4JLOA 4QJIA 3GC6A 4C07A 4FX5A 4GT1A 3TGWA 1U3WA 2QR2A 4QFBA 4Q4DA 4ZQHA 3THSA 4OHWA 4KQ2A 1OZ0A 4I36A 1E1YA 1VE3A 1KPHA 2P5SA 4NH4A 2IHKA 4F1KA 2FVYA 2PLRA 4L76A 5HR5A 3BHMA 1XQ1A 3QUTA 2XW6A 1OI2A 1U28A 2BZ0A 1GU0A 1VIAA 3KUDA 2Q6IA 3JQ7A 3KEFA 1P45A 1J21A 3CF0A 3K0EA 4INAA 3KB8A 4O08A 4UCXA 2FMTA 1MIOB 1U8YA 3EFBA 2YMPA 3AWDA 2LPMA 1VKRA 2ZFUA 1QCZA 2ZKIA 3O3CA 1SZDA 2I2FA 5KQGA 2ET6A 2HRRA 3QY0A 4ZK6A 4RVNA 1B43A 1WXHA 3AUTA 1OFUA 2CHQA 3KV1A 1S2DA 2ZIWB 3C24A 5CLLA 2IV3A 4F86A 1ZVKA 2BEKA 2IX3A 4HR7A 4EYQA 4XYEA 1JVSA 1BE8A 3H9GA 5EP1A 5B7PA 5BSEA 1SVWA 2XMCA 1D1PA 1Q83A 1EJ2A 1YVRA 3HU5A 4LWPA 5JJBA 1NMXA 3R8CA 5IKPA 1PG5A 4G5XA 5EP3A 2AQKA 4X3PA 4EITA 3JQBA 4PGFA 5JDCA 4BQFA 4NU5A 5EJGA 3CURA 5I9BA 2FU5C 3PDUA 4JBIA 3AFNA 3LQFA 4LXHA 4INPA 4IXNA 4MWBA 4U1RA 2HFKA 3QLUA 3IP6A 2CF5A 3B1JA 4DIDA 1EP9A 4RDCA 4Q3CA 2ZI5A 2ZYVX 4UMFA 4QKQA 5I4KA 2RG1A 2EZ4A 2PGOA 3O2NA 2JNWA 1K88A 5EFZA 3WOVA 4BVFA 1QWSA 1U3GA 3MT8A 2H5JA 4JLNA 3EVTA 1IM5A 4E5UA 3B9QA 3LF1A 5FPSA 4DLPA 5DEIA 3A31A 3JQFA 3LPDA 4PZZA 4GLBA 2IY7A 5I7SA 2XZLA 3QYAA 3BD7A 4I3HA 1U2EA 1D07A 1FP4A 1ZIXA 4GI1A 3VU9A 3A37A 4KWCA 2EDAA 4GUAA 4Z9BA 5EGSA 1EPUA 1W5FA 4I55F 4IDOA 4X92A 4E07A 3LKVA 2PL9A 3U61B 4F21A 1S8OA 2PNFA 3TSOA 4C7OB 5BO5A 3N8NA 3OIWA 2FZLA 4XQCA 4B44A 3RRZA 1F1BA 1RIFA 2RH8A 3BWCA 4F1WA 3QV2A 5HIJA 3M4JA 3CF2A 2DQ4A 3F8TA 4PFQA 4S0XA 2X58A 1FVHA 3HJHA 1ZGHA 2QSZA 3HWSA 3U44A 2PKQO 2R65A 2EF0A 2Z3WA 3F9IA 4KV9A 4BX9A 3I61A 4JI7B 4XJVA 2D0DA 2BW0A 3IEXA 2Q9UA 3I9FA 4C6SA 3HSKA 1YZNA 4J0EA 4W8HA 1XKXA 2OZPA 2GLTA 3COWA 1RYBA 3ZQKA 4LOHA 2CWWA 3G8CA 3OI7A 3FPAA 3X2EA 1G0NA 2QMYA 2XHEA 3HA2A 2X2EA 2GM4A 3DUFB 3IIEA 3VNUA 3ED1A 2CGEA 5SZKB 3A28A 5AH0A 3TOXA 2ZVDA 2J41A 4H1UA 4J3JA 5JZ9A 1ZM2A 3LPNA 4CW7A 1BOOA 2HSGA 3PNKA 5JEEA 2IGTA 2GRJA 2PWAA 2DWPA 2Q3EA 3ZDFA 9ABPA 3AL0C 1XZPA 3G9UA 2JGNA 3IHWA 1OY1A 3PFCA 4JU9A 5C51B 3ORFA 1SCDA 2ID8A 2PLFA 3DE3X 3LDUA 5FOTA 5GJCA 1W2HA 2QRZA 2JRCA 1R0RE 2ZTVA 5IX8A 1VKOA 5FHRA 4GOLD 2JVIA 3D0KA 2HSEA 3GO4A 1COWD 1F6BA 3WHIA 1N77A 2JH3A 2I29A 2P4UA 1GRNA 3ZDZB 3QKTA 1CEQA 2NPFA 5T8KA 4D4HA 4AJPA 4K05A 1TKCA 2ACVA 1THZA 1W2WB 1JDSA 3CKKA 2PKQP 3Q5DA 2LZ0A 1AVTA 3I1IA 1AN9A 4QYSA 3PDHA 1DRJA 4YJFB 3U4GA 3O4FA 2H2FA 2OLEA 2XA1A 1B73A 6Q21A 1O94D 4XKJA 1QP8A 1U4NA 1T6BY 4KDCA 3KCNA 3U39A 4CQMB 4DVJA 1EXNA 4LYGA 2RGEA 4IF4A 2DPLA 3QJ5A 4G97A 1SUWA 4K2AA 1H0SA 3R75A 1C9JA 1GGVA 1RCFA 3DCNA 2OZKA 4HQOA 2F4NA 3H1EA 1LI7A 2BEJA 2VAPA 4U2DA 3RO7A 1QHGA 5I9NA 2ENWA 2K7ZA 1N78A 1NPTO 2NUBA 2QYTA 4E13A 4NCKA 1IZZA 3MCVA 4GNKA 1SBZA 3IIIA 1LDBA 1M1YA 4NYIQ 4BNMA 1UBJS 3L8MA 3VV3A 1V1RA 2YXNA 5AW2A 4P0PB 2EGUA 3LGXA 1EGAA 3RUIA 1JQ5A 4D7AA 2HQBA 3TOZA 2W83A 3BMXA 3FYUB 2J9GA 3AC0A 3GV0A 3V1YA 4OBWA 4MB2A 3ZVRA 4RKRA 4BNJA 4DCUA 4X6UA 4IUYA 2P4HX 1XLTA 3QU2A 2P30A 3WDLA 2QG6A 1X7WA 3T06B 3WDSA 3BX1A 2FG5A 2V58A 3GCZA 2AZMA 4DAEA 2DFKB 1PZGA 2FN8A 3VR3D 4CMBA 1P1FA 5IABA 4TROA 1BIFA 4K40A 2ZJ1A 1Z4KA 3MS2A 4RTMA 4KDFA 2Y1LA 5FL7D 5B53A 1HNNA 2XZPA 1ZI6A 3A4LA 2RH4A 4MINA 1AKMA 1OGJA 2HQRA 2IT1A 5KNDD 1BA2A 2AN4A 1RRVA 4D9CA 5LU8A 2FHPA 3PC2A 2C03A 4KRXA 3LYUA 5IM4A 4WUTA 3QELA 1Z2EA 3VAZA 5FWNA 3UGJA 1EVJA 2VZEA 3AF0A 1SUAA 3K4QA 3CC8A 2ZRIA 5K5EA 4BMZA 1HC7A 3ASZA 3W5SA 4IYJA 4YCSA 2B92A 1H1DA 1QR6A 1T3LA 1E6EA 1ZOLA 3NOVA 5HJ5A 4LF5B 3KL4A 2D13A 2YJGA 1V6SA 2FKAA 3PEFA 5ALKA 1XMOB 2QMUA 4GS5A 4FSXA 3BFXA 2HLDA 1C9MA 1Z7GA 2JIZA 1IUKA 1A9TA 2J6HA 3GNLA 2GBPA 5TV2A 3TE6A 4TKVB 4F46A 1G19A 1JWBB 2FE4A 2G6BA 3L7IA 4EOGA 2C3PA 1EAMA 2YNMA 5CB4F 1T91A 1XZMA 2YZ7A 4ND4A 3HH8A 3NGLA 3EDRA 4GX0A 4OA8A 4YRQA 3M3PA 4ZAFA 4A1FA 4C4OA 4YRJA 1LEHA 3KVRA 1QJCA 1BX1A 3L7OA 2SBTA 4HGZA 4OHBA 2X42A 5J2TF 1DWPA 2V7EA 3I32A 3E0QA 1WS6A 3MWKA 3QSYA 3BFKA 1ILEA 2M6SA 4PC1A 4ZCSA 3RREA 1EFVB 3WGHA 4KGXA 3PT5A 4HZGA 4Q47A 2PCLA 4A0QA 5L9AA 3EPKA 1UR5A 1GN8A 1EESA 4RY9A 4JP3A 4F92B 4EF6A 2VH2A 4YHBA 2BOVA 4KFUA 3JD2A 4LHZA 4Z1MA 4X8HA 3R4VA 3G89A 3WGNA 1CRWG 2PUTA 2ZAIA 2O52A 1TU3A 1CETA 4FCWA 5JDIC 1VIMA 2WHEA 2ZYTX 4IVPA 3KJQA 5F7XA 1K8RA 2FI1A 3NTXA 2BELA 2VK4A 2WT4A 1X2BA 1TAHA 2RHRA 1U1EA 1J0CA 3CLTD 4KRYA 4WNAA 4MYDA 2JC3A 3C5EA 5DK4A 4EKYA 5EA2A 3SEQA 2PBZA 3CO0S 3QWAA 3R0VA 2GUWA 4LMRA 4ETWA 1E0KA 2TS1A 3NJ8A 3QPBA 5EKSA 2L19A 5DI9A 5FA6A 3WLNA 4F06A 4F97A 4MKZA 4DLTA 1OAOA 3M1IA 2V1UA 5LKAA 3O73A 3U40A 2XIQA 4XVQA 1PV2A 4AJ1A 4DCJA 1I2BA 1NI4B 2DQSA 2XQJA 1NVWQ 4ZOLB 1ZSYA 1P33A 1JDUA 1I1HA 3O2QB 3X43A 4ZZIA 5EKTA 1ENYA 1BOFA 5GONF 5IVDA 4BDSA 1LBSA 2NXNA 4C06A 1KY2A 2CUZA 2OZEA 2QR5A 2WFMA 4KSBA 2VJLA 2QI9F 1DAGA 1VHDA 2ZSUA 4Q03A 3L6CA 3OIFA 3OT1A 4Q12A 4EUHA 3BG5A 3K2BA 2EC5A 4BUJA 1BVYF 2N3ZA 1I1QB 2C0CA 2UYOA 3PL5A 1TB4A 1GLGA 4OATA 5FKJA 1FB5A 3FNQA 4RADA 3ZBTA 3EH1A 3FTCA 3LSTA 1NP6A 4DQKA 4IS2A 1Y3DE 2WAXA 1CLUA 4UTZA 4UUNA 4Y98A 2GAJA 2WJIA 1LS6A 5BMVB 4IF6A 4M9XA 5GAJA 1DCKA 5JV5A 2V4MA 1E9VA 1FQJA 3LUCA 4MW6A 1AGPA 3IXQA 4Q93A 2B3TA 2F17A 4DWWA 2H48A 3H16A 4IVRA 2IHZA 3B1KA 4MW2A 5J63A 3SIRA 3SXUB 3TM5A 2XGMA 1BDBA 2BKUA 1T8SA 1QFMA 1TK2A 4F5ZA 2MSCB 3EC7A 4IBOA 4BJ1A 2GEUA 4WBNB 4E88A 3LVRE 4JUCA 2ID9A 1JHPA 1HUQA 2ZKLA 1E1RD 4TUYB 4ZEXA 3TLYA 5HF6A 2V9ZA 2XZTA 3VU1A 1SK8A 4P4TA 1NX9A 5D7NA 3RS8A 1CIVA 3I4LA 4Z2AA 1D1TA 4N3BA 1QONA 3GG9A 1HDOA 3K7EA 3OQIB 1ZIPA 2P6NA 3GUCA 4OQXA 1L3BA 3B1WA 1P2TA 2NU8A 1JYEA 3OZXA 3ZY4A 4DTIA 3K0HA 3R6GA 4K03A 3DE7X 2JIBA 3T5BA 1W9HA 2QD2A 2WIFA 2CJWA 1U7OA 5GVSA 4IDBA 5AHOA 3OTQA 1WZEA 2J0QA 2G3YA 2EKPA 2WFAA 2ZROA 3CXUA 2E4VA 2W58A 3COZA 1V48A 3GRZA 1U3DA 3F4BA 4OV6B 1KBOA 4N18A 4OAOA 4YRAA 4P36A 3CZMA 4BS9A 1P29A 2OBLA 1OVMA 1GRQA 2FLVA 2VPXA 3EAGA 4J43A 3U48A 4EPXA 1FFAA 3AUUA 3L92A 4P0TA 5A4FS 1NP3A 2PRJA 3D3WB 4I08A 3CJTA 1RYYA 3BQNB 2WKSA 3FVWA 1CRQA 2W0SA 4X93A 4TV8B 1WUJS 2OC9A 1P9WA 2X4IA 1M6HA 3GZ4A 1K5HA 1NOJA 3PSAA 1ICEA 1T4DA 1EKXA 1XNGA 2I1LA 4HVAA 3P97A 5DM60 4L0MA 4E1AA 3IEVA 1H6CA 3AUKA 3S8YA 1XVVA 1BXZA 1ODSA 1ZJ6A 2Z2YA 3BSSA 3PLNA 1W85A 1L5KA 1UC5B 4MWZA 1N0WA 5B6PA 2C4UA 3OUTA 3P52A 4Q34A 4UBIA 3SXPA 4GP6A 1PR0A 1O95C 2P11A 4Z0HO 2Y1GA 1O4VA 4EMTA 3LX8A 1PK7A 2C5AA 1N32B 3PD0A 3K0KA 3RAPR 4WKGA 2B30A 1AGRA 2I9PA 5F3WB 1RTKA 4R1OA 4TS4A 1Q3HA 1MB9A 1A5BB 3OZWA 3R5HA 3O8DA 3E22B 4JVNA 3MPOA 4RQUA 4AMYA 2REXB 3EF0A 3KZNA 1KIAA 4I1YA 3B6MA 4PZLA 4AJ9A 1A9ZA 2GXSA 4O5OA 1NNEA 2BGJA 3OFKA 2R97A 1E5LA 1X19A 1E6WA 3VI4B 4FM9A 3THYA 4BZZA 3JS5A 8ABPA 1YZLA 2HEGA 3JZMA 4ZI7B 3O8CA 1FX0A 2WYHA 2GO1A 3N74A 4FE7A 1Z5NA 3U1VA 3ZCTA 3PLAE 3ADBA 3A1NA 4AS3A 1FQKA 4E32A 2G83A 1T2VA 2MJLA 2WD7A 2XY4A 2YWGA 3IUMA 1WHTB 3JRWA 4FFOA 1OYYA 1D6NA 5TQ0B 1N4DA 3NV7A 3D8UA 4MVJM 1NR7A 4PFKA 3P2MA 5T64A 4URVR 4KFCA 4ODIA 1TM1E 4UM7A 1WX1A 5HKKA 1XNJA 5JS6A 2CEKA 2C2HA 4JYMA 3CR3C 4BEBA 4M1EA 4ZVLA 1JEOA 2YJ3A 3H2GA 3M5WA 1U8XX 3MGKA 3NM6B 4MUKA 2A5YB 5G3YA 4HBGA 1ZNQO 1ZR2A 2B1IA 3BVPA 3JV7A 3SJZA 1KEWA 2W43A 2VHWA 1SNYA 3LT5A 4HS9A 3BDIA 1Y7PA 2PXHA 4IZ6A 3W7AA 2KM1A 3U5ZB 2RAVA 2O2XA 5FTWA 3VHXA 3FDZA 4KGZA 5AIBA 4ARCA 2V9CA 3L8HA 4EPYA 3KK0A 1WBDA 2W2QA 1Y1SA 4DLNA 3K1AA 3QVTA 5JXIA 1V11A 2P9GA 3SWWA 3EC1A 4IWNA 4OXKA 4G5HA 2VZ0A 1QIHA 4ZHSA 4GI7A 2ZRBA 1G63A 2GCEA 4LJ6A 2BMWA 1NG1A 3JWGA 4WZAA 5C1DA 3V9PA 3GH1A 3LBAA 3A9RA 2IBSA 1SOAA 2Z58A 3BZBA 3GQVA 1X80B 5FBWB 3ZQUA 3EUWA 2CDRA 1JLHA 5JW6A 2OAGA 3CLRD 1FA9A 3E9CA 3EGIA 1X1RA 3G0IA 2VYFA 4BNZA 3WOHA 2HWUA 5HKBA 1PJLA 2PMCA 2WNSA 3E9EA 5UKDA 4KR7A 4P08A 2BMDA 4LYYA 4JOBA 1JZSA 3DO8A 3TM4A 1ZONA 3CNHA 4PLVA 1PTJA 4DLAA 1BS1A 1DO8A 4KACA 4C89A 1IBMB 2PUDA 3RJ5A 2CMDA 1YRYE 5G1PA 4ALKA 2UZ4A 1EJ0A 3B3GA 2YV2A 2A5GA 1E1DA 4QZVA 2A1IA 2HDOA 3L9XA 2P3SA 3K1TA 4HOYA 1G20B 2XQVA 4IRXA 2PL1A 5C5IA 4CT0A 4IW3B 1JJFA 1PWYE 3LO5A 4MRMA 1T8YA 3SF0A 1OBFO 2RGNA 3I76A 4XEHA 5AM5A 1GPBA 2WYVA 3L7KA 1BDIA 4B0PA 1U2ZA 1WZ2A 1YL6A 4HNGA 4NR0A 5ICEA 5I7UA 2FRXA 3NFRA 3WK6A 2YV5A 3T3OA 5IS2A 3HC7A 3OCVA 2P4EA 3TLCA 1RJWA 2VWQA 4W63A 1PFUA 4XB1A 4BB5A 3CX6A 3ZZ0A 5JWOA 1GITA 1PK8A 2B83A 3QBVA 3OCUA 4QHYA 1L5OA 1KP3A 2FWBA 3OTIA 4Q4LA 2AG0A 1QIKA 4GPBA 1E2JA 1HL7A 2PO5A 1T5TA 2IIBA 4HL6A 4PLFA 2JJ2D 3HUFA 3FPJA 2LW7A 1NNLA 1R64A 1RAGA 3NRBA 3C3MA 1E3MA 1JKFA 3K9NA 4FMCB 1X9GA 3IAM6 3UHJA 2HXSA 1PUIA 1O5OA 5FRDA 3WYNA 1TFUA 2R7NA 3R77A 4LQLA 1SXJE 3UAVA 1EWYA 4TYPA 1I3LA 1KTVA 1KZGB 1QNFA 1TU0A 2M32A 1KQ3A 2ZUUA 3ROPA 5LOVA 1GTSA 1TT5B 2JI6A 4EUFA 5AKZA 4C0JA 4IIYA 3K9HA 4PXAA 4AFNA 3C16C 4L3VA 1AC5A 4LRSB 1QGYA 4ZDIA 5BV1A 3I3OA 3U9LA 3FHJA 4X7BA 1XJQA 2QTWB 1MXHA 3EGEA 5LYJF 3VZPA 4IJ5A 4Z7OB 2RE8A 3HP1A 1WMSA 4YV2A 3FDJA 1MW9X 2CY0A 1N8NA 1CQJA 1J0EA 4PPFA 4F56A 5FORA 4EMUA 2XNSA 5B7QA 1U0LA 2FGKA 3QE9Y 3TR6A 4CIYA 1IK4A 1L5YA 1JB1A 2AMYA 2G63A 3P27A 1M0EA 1V71A 1VHJA 2VG8A 3OOWA 2ZBQA 3F5MA 4WCFB 3PPYA 2GD1O 3U7GA 1OE0A 4QOGA 3PQ6A 1TD1A 3BSWA 3BH6A 4FGJA 5DOZA 5DCWA 3UJHA 3EFOB 3AM5A 3KSUA 2O4CA 1S7CA 3HJCA 2XMDA 1G2PA 3QVKA 4X6YA 2YXPX 4JMLA 4W6QA 4YR7A 2G82A 1QE3A 3P9CA 5LQJA 2H16A 4NL4H 4ND3A 3V32A 4US0R 3V4SA 4DY4A 3COVA 3BH7A 1M72A 1ZN8A 2CMFA 1Y3BE 1PR3A 2R44A 3P96A 2H2DA 4XSGA 4CCWA 2BFBA 3B6JA 3NYIA 3ZNNA 2ORYA 3K0FB 1BX3A 4CU5A 3KKOA 4RU1A 3UAGA 4E5PA 4YV7A 4A91A 4LWQA 5CURA 1L8AA 1ULAA 1I2DA 4NJMA 1APBA 2FFQA 1RPAA 3BF8A 2H92A 4N5HX 4C4AA 4EG8A 4HV4A 4YRKA 2FPPB 1A8PA 2JGMA 3MJFA 4HNSA 2EWWA 4MOWA 3T3EA 3W2EA 1DIHA 4IJKA 3O8RA 1IDOA 2CNDA 5KNBA 3GLGA 2ZGVA 4DUGD 3O6VA 4WBXC 3DQQA 3HSSA 1H1LA 4I1OA 4S3MA 3G6WA 3Q72A 2C4MA 2VK2A 3F8WA 5EESA 4D0RA 2QVCA 1JG1A 2IZOA 3BL5A 1AUVA 3IMGA 5JI2E 1FDUA 1K5DA 4UEQA 1E3LA 2P7HA 1DHRA 4I5DA 2PIDA 4M98A 3WGYA 1CG6A 4ZCIA 2EKDA 3ADDA 1KVSA 2OHIA 4AF7A 1JDZA 1MX9A 2VF2A 2DPGA 3OLQA 1XPOA 3X2FA 2XUJA 4NMXB 3UA4A 1KEEA 4D26A 3A6FA 2WJHA 3L0SA 1NBWB 5HILA 1TW3A 2Y67A 1E2FA 2HBYA 1WMEA 5EE1A 3TAHA 1MVNA 4Q7KA 4CZ2A 4D4GA 4P0QB 1LWOA 2HJWA 4S35A 4ZKDA 3PJRA 1ODCA 2ID4A 2XYQA 3LHSA 3U17A 3V6LA 3ZE8A 4K9PA 1ZOOA 2WVJA 1XCPA 4B40A 1QUEA 1R74A 2PZMA 5BVHB 1PFYA 4UXIA 2ACKA 4B3JA 2W2PA 4FMDF 1AMNA 1CJUC 5ALOA 3TMAA 3G2NA 2WM9B 4LRQA 2C1EA 5AVQA 1L4HA 1XRMA 4X8LA 2BMFA 3DC7A 3BMOA 3TFQA 1PU2A 4TVOA 5AUPB 2BBSA 2VOEA 2X14A 2XA9A 4YRPA 3K2QA 4LXGA 2HY7A 1V9LA 3Q2IA 3QKRA 3FVTA 4JH0A 4B2LA 1DOAA 3ONDA 3WI7A 1CJMA 4A2WA 1OUMA 3GMSA 1UMCB 2PPVA 3DTVA 4WK4B 3CVOA 1IATA 1YACA 2XNDD 4BMDA 1XCJA 3Q2KA 2BFFB 2J0EA 1N0UA 2NZUG 3TW8A 1S0UA 1V3VA 2D2XA 2PJDA 4Q4HA 3KKKA 3B1YA 4HBZA 1HL3A 5CHEA 3O7WA 2XYPA 1RM5A 4MKXA 2CT8A 1WZIA 2WAMA 5K0BA 1O89A 3SMQA 1GT6A 2AI2A 2L18A 2IK8A 2PZAA 3ANLA 3EE6A 4GOKA 1Q2XA 2ZW9A 1CB0A 4HDQB 4M87A 3N1UA 3WMFA 3V33A 4ZYUA 3USCS 4EPVA 4ZEVA 5A4MS 3E4CA 3C4JA 4JV5B 1HTWA 3KHUA 4LF8B 1RLMA 1IJBA 4NVRA 1DKLA 1VCHA 3WISA 3L40A 3BRSA 2ZAYA 3CWZA 4BFWA 1XVTA 2CWDA 4ND5A 4M1KA 4B48A 4LY0A 3BHJA 5EAIA 5CEEA 2FA9A 5M29A 2IXDA 4FK8A 2H4ZA 2GD0A 4UE2A 1S3IA 1E92A 5FULA 3UPTA 4KLCA 4Y9TA 3I4CA 1TZJA 2YXEA 4Q00A 4ND2A 2NO6A 1HFJA 3W1VA 2I22A 3OJXA 2WJ3A 1GZUA 2QPAA 2PGJA 5G3ZA 1QIJA 2BE7A 4BZPA 3LL7A 1MJ5A 3D4NA 3LQ2A 3NVMB 1TTTA 5DBGA 2ZYRA 3Q12A 3LUJA 1KI6A 4HLDA 1V43A 1R6VA 5IAOA 4U3JB 1Y82A 1Y3IA 4OREX 2IHTA 1OXSC 4QWMA 4YH1A 1RQPA 3PNVA 3FGZA 5KTNA 2H4WA 1ODKA 4IHJB 4GSKA 4Q9KA 4DMKA 4EDFA 1ULSA 3KU4A 4JIMA 4HJRA 4RE5A 1VE5A 2QIPA 4J7UA 3M82A 3RK1A 3GX1A 2R8BA 3G1TA 3UZUA 4PYNA 4YPVA 4N49A 2VT2A 4CF5A 5CDSA 4A6EA 3TJZA 5LP6F 2J3KA 3WWCA 1OH5A 1PJTA 3WFZA 4Z3DA 2C5HA 1IM2A 5A05A 5DGXA 1BDHA 2FWRA 1T15A 5A9TA 1WEHA 4KZKA 4QASA 4AKIA 3HXPA 4HRVA 4OHXA 3PNYA 1YFZA 3M5CA 1CUXA 1C3JA 3KXPA 1Z29A 3N7AA 5DT9A 2V5AA 1Z56C 1R4NA 4CR7A 3RIYA 3W9SA 3PG5A 4C7VA 1ZK0A 2W6OA 5EJ9A 4B6GA 2AC7A 2ECFA 5BQ3A 4ONEA 1I0ZA 4PYOA 3W7VA 1QF7A 2ZIAA 3N70A 4NOJA 2V96A 1EXVA 1YC2A 4ZVRA 1CLEA 1UK7A 2Z8YA 3VKVA 2PH7A 4HYTA 3NANA 3ZCXA 4F8JA 1E9EA 1XROA 2O2IA 1LGYA 1RW4A 2YJZA 4GG1A 3TL2A 3WFIA 1E9BA 4XSHA 3NWBA 3UAWA 2X4LA 3FM9A 5B1SA 1XNRB 1UCFA 2ZVPX 5FTJA 3FROA 2ZYUX 4RKEA 4LMAA 3B8HA 4O4HF 4PG7A 1KPIA 4KE8A 3GDFA 1W5TA 5I4BA 5GV8A 3EZ6A 3LOPA 1EZZA 4ZRMA 1HQDA 1P4GA 4QOSA 4DB4A 1FFGA 4H77A 2C2ZA 5DN9A 5IT0A 1MNAA 2JDIA 4PQGA 3TVTA 3UKOA 5E1BA 2X8AA 1XLUA 4JOCA 3EMKA 1W0CA 4OI1A 4ZU6X 1JSZA 1VLJA 1SHLA 3JW8A 1FLNA 3HM9A 1Z62A 4YJFA 4I1IA 3H11B 1TYCA 2R00C 3CEMA 1UEIA 4WK6A 1KARA 4G3XA 1UBOS 4CQMA 4DXHA 4NAVA 2QP9X 5A7GA 5EIFA 4M88A 3EJ6A 1CEXA 1TVMA 2ROQA 2YWFA 3NEYA 2QTVB 4DSAA 4ZDKA 3UHOA 2LDBA 5HG0A 2P9HA 4XSVA 1M76A 3O7MA 2HJVA 4PLTA 1WU8A 4U39A 1W0JA 3S29A 5CD1A 4H1TA 2O2CA 1W1WA 5FI5A 3HPRA 3RSCA 4EUNA 3HHPA 4ZEMA 4OQPA 3LTNC 1NJ5A 1XOIA 4H1HA 1HG0A 4MI9A 4P33A 1D09A 2A33A 4FTWA 2KI5A 1HV8A 2AOWA 1N9GA 3EVGA 3LPLA 1P7ZA 1YRWA 4CHGA 2WZQA 3MELA 4TLCA 3DMFA 2YYZA 3U1TA 1D2RA 3WNQA 5J23A 2YX1A 3HKDB 2QLJA 1P81A 3BTUA 4RLFA 4U2EA 3R7AA 3UC5A 5GTDA 1X8XA 3E3LA 1UZUA 4JK3A 3NHRA 2X41A 1SXJD 3VR6A 1U3VA 5K45A 4JGGA 1X3SA 1U2RA 2NUPA 2L69A 4MWGA 2ADMA 5E38A 3WQHA 2QBYA 4HF7A 2QEQA 1Y8AA 4MROA 2AG6A 4AY5A 4UEKA 1V8OA 2AZDA 1TVCA 5AK5A 2BDEA 1VSBA 1ODIA 4XQ9A 4YC7A 2Q0XA 1DI0A 3SJAA 4COKA 2HF9A 1E2EA 2I6UA 2NSDA 3OPVA 3CSSA 3HY6A 2G5PA 3QHAA 1SQSA 3HB1A 1E60A 2JAXA 1VIYA 4IJ6A 1QK5A 3MMNA 1MEJA 4L4XA 3WWDA 2RDMA 3B1XA 4M9UA 4NH0A 3V4OA 3WGVA 1Q1NA 2W6MA 4IRUB 3W78A 2HH9A 5ARBA 1I2ZA 3ULKA 3MAGA 4DR2B 1MGOA 3QG5A 5AHXA 4ZPXA 3DEHA 3SSOA 3D3QA 4LNUB 4YMWA 1S3GA 4M4SA 2OFXA 3DTNA 1H65A 4IMPA 4L27A 3V2UA 1G18A 3RWBA 2UDPA 2VA8A 2O2SA 1WDWB 4ZT5A 2RB4A 1PQYA 3RROA 4BECA 1FW8A 2WDPA 3IDQA 3T94A 1NIJA 2V55B 4D44A 3NHJA 4NIMA 1NE7A 3G0HA 1HKHA 3AEUA 3U60B 1NUTA 4QJ5A 8LDHA 1ECJA 2QTBA 4X9XA 4HTAA 2AA3A 4EX7A 2FE1A 3HKEA 4HO1X 5I5GA 4X1IA 1EFVA 4Q7LA 3LY7A 1A7AA 1R1DA 4OI4A 5JNWA 1FSSA 1EIWA 3QMWA 2E5LB 3BE8A 3P9KA 1YB7A 3WLSA 4YJ2F 1HYQA 2Q45A 1I0LA 1ZD1A 3QXJA 4KPUB 1XRLA 4LHWA 3ACBA 3OFNA 4MUAA 3RYIB 3KSBC 4CEHB 4BNTA 3BMQA 3TB6A 2J5QA 1DBRA 4HTFA 1A2OA 1EVZA 3ZGZA 5EJ5A 5K0TA 2F43B 2O14A 4DC9A 9ATCA 2J4CA 2C20A 2XOKA 3AFGA 3H83A 3BBLA 3Q15C 4TMXA 2AR9A 1TYZA 2TMKA 3OJFA 4PO1A 5HJ7A 1E62A 4LZJA 1JUDA 1DCTA 3RVJA 1Y4DE 2ATVA 3NM5A 3PHJA 3SBDA 2QUKA 4UMDA 3LXXA 4OY3A 5FB3A 2IXFA 4RA6B 4YPOA 4ZYLA 2NMVA 3AEKA 1VPLA 4O59O 2C2KA 3RBAA 1I5OA 3MJRA 5TPWB 3WLIA 5EKDA 1A1VA 2Y99A 1G3UA 3AP3A 4HEQA 4ED9A 5AM4A 2B7CA 3EN0A 5EZYA 1TJ5A 2V1XA 3MJHA 4RF4A 1X0VA 1NVFA 3GLKA 3R5KA 4L85A 4NHEA 1ZOPA 4F71A 3PXGA 2X40A 4TTTS 4FP9A 4WW0A 2P0EA 1JJ7A 2M6RA 5IARA 3DNMA 3RH0A 1YDWA 4RANA 5C7OO 2YINC 1NSFA 5J3JA 2XXJA 2NUTA 2FPMA 1M54A 1TJPB 4PGMA 3TZEA 2SCUB 1KYWA 2N42A 4BFXA 1OFVA 1CRZA 4RACA 3N58A 2W2TA 5LDHA 2UZAA 2MSKA 1FDOA 4XD7A 1JR3E 3AKYA 4R1PA 3ISJA 2WYIA 1Z0KA 4Q16A 1IEQA 4I7EA 4W9NA 1ZG3A 1GLVA 3CSUA 1U4SA 2AD1A 3DPSA 3G23A 4P38A 3TDNA 2GA9A 3LCRA 3TRJA 1XCLA 1TUGA 3CRRA 3GY0A 1T6XA 1INLA 1GD1O 3SYKA 4CKBB 4EA7A 2BEUA 2AC2A 3FLAA 4DUPA 1KMCA 2NV2B 4P3YA 4B82A 3C3WA 3RUHA 4D80A 2VDUE 3O4JA 3SXUA 5BW4A 1MDFA 5CH3A 3UW1A 4R16A 4LAFA 2VQEB 4YUYA 3GHHA 4GMFA 3RRFA 4ECEA 2DQYA 3DB2A 3F5SA 1G4HA 1QVWA 3JQPA 3LWZA 1NBHA 1Y63A 1A2KC 4TS9A 4D8XA 4X90A 4ZMRA 2DPXA 4MO2A 4WOKA 4ZZ0A 4V1CB 1B0PA 1ZNYA 4BCDA 2G07A 4FFNA 4W99A 5A4IS 2HHAA 1TUBB 1XA0A 3UT5B 2DUMA 4RABA 4NBRA 1KVRA 1P18A 1IIRA 1JSLA 4JBXA 5HFJA 1N3IA 1YS7A 1DFIA 3MJSA 1CDOA 1D3AA 1L7VC 1MOZA 3II6X 3P7MA 4PONA 2Z8YM 4R83A 4ZOAA 1H8HD 1TD9A 4JFAA 4E31A 2PS3A 5DW3A 2X8LA 4LZWA 1W44A 2DECA 2AZTA 1XJCA 4Q37A 3BJZA 1T36A 4I1UA 1ZJ5A 4DR6B 2IEAA 3N0RA 4N01A 5DBFA 4X62B 1Z0FA 4GZMA 4BYGA 5FADA 4GRAA 2G25A 2PH3A 2Q2VA 1GYPA 4BRWA 3H0EA 1CIJA 2OXRA 4PF1A 3SHVA 1I32A 1HDCA 2GZDA 2OTCA 2VSQA 4II3A 2WR8A 3G1WA 4WKNA 4G0MA 5DNDA 1A7JA 2P77A 4EYGA 4IJQA 4EY5A 1VPWA 2ALJA 2G77B 3G0GA 3H1AA 3R0XA 4WA8A 3PFWO 3I12A 1WCYA 4NFHA 4WUVA 3VTZA 5A1JA 5BR8B 2XNHA 3D3WA 3ZBQA 3RSFA 2I66A 3O94A 2QP3A 5EXXA 3QLTA 7YASA 4HWKA 4OKIA 2G4VA 3IULA 5HGXA 1R2QA 2IUUA 4FEGA 5F21A 1YXMA 2VJDA 2C97A 4GPTA 5HE8A 4B4KA 4ZZ3A 1YJBA 2J9ZB 2FMHA 5FLYA 2O54A 5JZBA 4FE3A 1L5FA 2OL4A 2BHNA 4JQOA 3OZUA 4OM8A 5KQPA 1MO2A 3O90A 5EXPA 2NNLD 1K7EB 3UGTA 1E2IA 1V8DA 4D9FA 1IIBA 4X24A 1CY8A 1T26A 4J1SA 3MZ0A 4RMNA 5ALVA 3RTCA 1ECFA 1KYXA 1Q1ZA 2CYBA 1GSHA 1ECGA 3MNFA 1ZK1A 4KQXA 4ZQCB 2PUAA 1TZCA 2PMWB 1CS4C 1CE8A 3M6WA 4KQ9A 5IJ0A 5TGZA 2CNKA 3P9IA 5LA6B 3ACDA 3ZCSA 4C2AA 4FQ8A 4PQEA 4X8OA 5A0TA 5FWYB 4AJKA 3KEMA 4NV1A 3ECCA 4R6XA 2P6MA 4KH0A 3HL0A 3KOUA 4GZ5A 4BASA 4I5FA 2X5OA 1NY6A 4QHSA 5JANA 4M7WA 4BP8A 4CKWB 4HUQA 1I7PA 1VYHA 4JKOA 5L3VA 2AEJA 5ALWA 3JAKB 4BRSA 1BCSB 2GKGA 5LDGA 1GR1A 1XVIA 2RHOA 3CMMA 3AKDA 1UJNA 1BWQA 1RACA 1SUSA 1N8SA 3A9CA 3CX4A 1UKAA 3FXAA 2VZ9A 4KMRA 2I0FA 2SNIE 4L9SA 1E1KA 1COWA 1OXVA 3BE6A 3K9GA 3A6GA 1US8A 4N5MA 4AG3A 1X13A 2WDZA 3IE1A 2HCBA 1QWOA 2J8ZA 2AJ8A 1WA5A 2FAXA 1GZSA 1ZA2A 1VJCA 3A6DA 4X0EA 4ZYYA 5IUJC 5L40A 4ARIA 5EIOA 4RPGA 8AT1A 1XPRA 1MZVA 1Z25A 5JBNA 4FJ1A 4R5MA 2EP7A 2REOA 3BL8A 4L78A 4WLVA 3HZZA 3RRXA 1V9CA 1O94A 3LI2A 2F67A 2YY5A 4DLWA 5T4HA 1BKDR 3F1LA 3MJEA 3ZGVA 4LPSA 3EEBA 1FMLA 3CU5A 2O0JA 3QYJA 4B17A 4F2HA 1NVXQ 1XDSA 3LOQA 4MMZB 1QCYA 3KD2A 2WMNB 4Y2XA 2B61A 6ABPA 1XN1A 1CRLA 3MXTA 1EWQA 1GFZA 4GSYA 3KR9A 4FHZA 4JC8A 5SYMA 3WJ7A 1LB1B 2I6SA 5K8UA 2VDKB 2O8VA 2Q1YA 4EG4A 2D1TA 4CEIB 2C3OA 2F7SA 5A4AA 4YP6A 3G8AA 2ZRNA 1A9QA 3UJCA 1E2UA 1HNXB 2ILTA 1VMAA 3ZXSA 3ND8A 4BNFA 1H2HA 4IILA 4J0IA 4BFLA 3D8TA 4GVXA 4B09A 3BD8A 3G2OA 4D9EA 1M8GA 3UGKA 3T3NA 3L1UA 3U19A 5EXEA 2FOXA 4OLFA 4X1YB 4DCCA 1E9FA 3T1OA 1NTRA 3EVEA 3HDHA 1MIHA 2C8LA 2ZJ3A 3KQPA 2BRUA 2G09A 1WTAA 1GXSA 1SKYB 3D3NA 1T2UA 1SXJB 2XAUA 3D43A 1G9XA 3DBHA 4KXVA 3VR3A 4INJA 2E1RA 2XWBF 2O57A 3PYLA 5C52B 4IRMA 4JVLA 3ICEA 2ZJFA 5FL7A 1QP4A 1C3OB 3ZEAA 1T5HX 3D0QA 5KNDA 2B7LA 4MGYR 4U00A 3BDVA 4E5VA 2XWSA 4H7IA 3PNQA 3K9LA 4UBKA 1XZAA 4UPVA 5JZSA 3UNXA 7AT1A 2O5EA 3WWYA 1YB2A 5ECGC 3WZLA 4YVFA 5C5CA 4TOIA 2M1ZA 5FP0A 2OGZA 2X3FA 3PDIA 5CNIA 2ECKA 4EA9A 4JXKA 1FRVA 5A6SB 1U0TA 1DQZA 1M6NA 4JLVA 4OAQA 5SZJA 2TSYB 4BMPB 1W7AA 4ZCTA 1B8VA 2LBPA 2HPHA 1WM1A 1RHRA 3QVSA 4QVGA 2A7XA 3PEVA 1J1IA 5SZIA 4NLLA 1K7FB 1ZK3A 1YJXA 4QRDA 4X1KB 1AKNA 4TX1A 5JUWA 3KSMA 3RC8A 2C54A 5K0SA 2G9UA 2DMRA 3IO3A 4FDUA 4U9HS 5H4GA 4RW0A 2Z9BA 4UNQA 1PJZA 2QSJA 1C30A 2HJSA 3HBAA 4X97A 4BGIA 5BY2A 1OW3B 1LBEA 4C78A 1G1MA 3F7NA 4I81A 3UT6A 4P92A 3TAXA 1NW9B 1KA9H 4J6FA 3OHPA 2L0XA 4PPYA 5AJHA 5INTA 3CW9A 4PNEA 3PXDA 3FNIA 3PPIA 4JUFA 3R6LA 1E9SA 2AOVA 4N5DA 3GEEA 4IKEA 2D0OB 1JA9A 2VT7A 1E66A 4IQ0A 1WUTA 2HOQA 4OD0A 4U7JA 3ZV6A 4DGSA 4CKYA 1ZMRA 1C3XA 2NU7B 4DMFA 1HYBA 5T57A 2BFPA 3GFFA 3LLMA 2SKCA 1GAEO 3E1KA 1ESDA 1QC5A 3PR3A 5KWIA 2CHGA 1E3WA 4LJ4A 5DM2A 3X1KA 4AXBA 2XBMA 4QGAA 1JR6A 3FPSA 5DTEA 4MVJF 1QO9A 3NR2A 1Q2UA 3JD0A 4EFKA 1AQLA 5IM4F 2A0UA 4KNYA 5TC4A 5FEUA 4FPXA 3D7RA 3T1NA 1YULA 3KT8A 3L06A 3F5DA 4EQ6A 1CPYA 3NDJA 3M9WA 3MHPA 2ZT8A 4IFBA 3WZMA 4Z2YA 3AVQA 4ENTA 4LC9A 5E1MA 4EGAA 4DR5B 2P5TB 4U5XA 2NM0A 3ZH2A 4PG8A 2VTBA 3RCBA 4RBNA 2ORVA 2YS7A 4C3UA 3KEGA 3SZGA 3RSLA 4AY4A 3WE7A 4DLXA 4B4VA 1BS9A 1P77A 2ZEJA 5JJ5A 1CF4A 1WG8A 4DR3B 4ENRA 2WZDA 2ZWPA 1IOLA 1RD4A 4JXZA 2P5YA 2WUEA 3CVUA 1M75A 5ILOA 1M0TA 1CY0A 2C84A 2OMEA 2AZ4A 3L4BC 3U4DA 5KSYA 2MIIA 2XCRB 3F3SA 4CEJB 3DBLA 1A9PA 2BJVA 2GOYA 2HTEA 4HN9A 3S3TA 1OTHA 1EFAA 4GGPA 1MMFB 1VA4A 1SCQA 2Z04A 2QF7A 5E6RB 1T1GA 1JR3D 1OYOA 1W4LA 4DRYA 1SD2A 2IWHA 3FI0A 2REBA 3OF2A 5A4KA 4ZJUA 2D1QA 2HAEA 1AM4D 3AF6A 2CKDA 2DHDA 5FFMA 4DWOA 1HTBA 1NUPA 2Y8EA 3N07A 4XX0A 4AQDA 1SCUA 3S55A 4GF5A 4AT1A 3EGDA 3VZSA 2NYRA 4ZT7A 2YXBA 1G6HA 2QTRA 3QM1A 2CFTA 2B8EA 2C8JA 4HH3C 4DHWA 4PIVA 5IAEA 5LQRA 1OWOA 1QHFA 2Y6VA 1AK9A 5ENZA 1MQ8B 5H7XA 3DHWC 2D3TA 4Y30A 2IE8A 1JKJB 1RC1A 4CMGA 4EKNB 3F9CA 4G4IA 4KUHA 2GCGA 5AKLA 1E1RA 5A5FA 5J43A 1JEAA 1GT91 1MXFA 2GDZA 1LNZA 4CLOB 2AYXA 3L8YA 1YHNA 1FS6A 1P72A 3D6HA 4XVHA 1JJAA 1QQTA 3I45A 3DT8A 3LZ6A 3ZHTA 5AUNB 2P27A 3NUZA 4C87A 4W6ZA 2FLKA 3GCGA 2HQOA 2W7TA 4B7XA 1T34A 1E1NA 1AHIA 3QVGB 4N0QA 4DCVA 1CEEA 3AEYA 1ISHA 1D7AA 3Q4GA 4BRZA 3T3GA 4DBVO 4Z4HA 4YT8A 1Z4JA 4MW1A 1LH0A 3AL2A 3RTGA 2A3NA 3TOCA 4CKXA 4XW2A 2V74B 4GKAA 3HMKA 2QMEA 4LTNA 4Y6QA 2OV4A 1Q0HA 3KAKA 4LRXA 1GFSA 1UMCA 1Z15A 3I52A 4X1OA 2OXIA 1XCBA 3G2KA 5H0IA 3U7JA 3IRUA 3BAZA 3AIMA 2FFAA 4E09A 3BXPA 3M7IA 2DOKA 2XVMA 2J3LA 2EQBA 1VKNA 4RGVA 3MQFA 4JJ4A 2P2GA 2YHIB 1O77A 3TQOA 1E3SA 1FP1D 1SVSA 4UNRA 2BYTA 2NLOA 4EG0A 1RZUA 13PKA 2R60A 4DY6A 2P9BA 5CBKA 5JSFA 3UIEA 5KYWB 1MO5A 1NW8A 1XRRA 3QFHA 4JVOA 4A8JB 2GYUA 3WYEA 1Z8HA 1XD8A 2JCXA 5CLIA 4EBBA 2VBIA 3L01A 4HDKB 3K8ZA 4D96A 4HRXA 5FUBA 3LRXA 5DM4A 3C43A 2JCSA 1QO0D 1T2AA 4KYTA 3H9CA 2IDMA 2QRPA 5F73A 3SICE 4BPRA 2H1FA 4BFUA 2C42A 4EG1A 2PFKA 3CW8X 1R0ZA 1YI0A 5K3FA 3TZ6A 3MSCA 2PIAA 1RWXA 4G5QA 1U8FO 4F11A 4B3DA 4EW1A 2WFZA 4H4DA 4XJTA 4DSTA 5DHPA 1C0KA 4Y0VA 2A92A 5HEKA 3NT5A 3GFSA 1UF9A 4GOXA 4JLUA 5REQA 5TX7A 2DG2A 3ZHRA 4NARA 1RHJA 5FPPA 4BCCA 1VB3A 2CLDX 3LQQA 4K3UA 4CL0A 4CLRA 4JI5B 3L6UA 3AW9A 4G8CA 1U81A 1Y6RA 1ZMTA 1UMDB 1SR8A 3DVRX 3IT0A 3NGMA 5CA0A 3TTUA 2P6OA 3O8NA 2AKEA 3EXHC 4NMMA 4C1NA 1PRYA 1J0AA 2HO4A 4S1WA 3W5CA 1MOSA 2XVAA 3NH6A 4B43A 2FY8A 4CQNA 4G8BA 3UFXB 1VG8A 4TXJA 1ZA1A 2Y0BA 5BN4A 5LDDC 2QGFA 1UUFA 4K28A 5T4FA 4CT5A 1RYNA 1GRRA 1YRBA 1D2AA 3U4HA 1JAZA 4FX2A 4U2GA 5KSZA 1XG5A 2Z5FA 4U7DA 1TEXA 1ESMA 1JILA 4J9VA 4D4IA 3VQTA 3QEAZ 2QW1A 2V7PA 1Y33E 4JDPA 3ZI7A 3AB3A 4EVIA 4WLNA 1E4YA 1SC1A 3G2IA 1IWOA 4EYOA 1AQIA 4AUMA 5HBGA 3G1UA 1KKMA 2NPOA 4GX5A 3VYWA 2IZ5A 3ENNA 2KYRA 2OYRA 1XJWA 2ADOA 2FW0A 4TN5A 1ZUNB 3SZMA 3P1JA 5KVAA 1E98A 1RE1A 3BYZA 1WO8A 3ZK8A 2R6ZA 2PM8A 3FZQA 5DSXA 2WF7A 5KWEA 1U4OA 5SY6A 2NN3C 1Z0UA 1GUAA 4LK2A 1GPH1 3HCOA 4YFYA 3E5RA 1IVNA 1E96A 2ST1A 2WU3A 5LU9A 2FR1A 5JS8A 3DMTC 5T6BA 3W8EA 3W77A 5IT5A 2XCIA 4AZWA 1EUDB 2N47A 4DZRA 2GPBA 2ZQZA 4TQAA 3RAGA 3B52X 1Z7EA 2UU9B 2O7QA 4H6PA 1XK7A 4G1EB 1YS1X 4ID3A 4KXWA 4QD3A 3RGWS 3ZDRA 1XC7A 3IQXA 4MKIA 1ZIDA 4PYLA 4YT4A 4A23A 4B47A 5B3AA 3OZBA 1CR0A 1NBIA 3I9MA 3S2YA 1UZNA 1N1EA 2B21A 1KAOA 2JJQA 1UFOA 4JLMA 1RHMA 2LUOA 3KHSA 5HZHA 1YAHA 3W6OA 3C6ZA 2UZ1B 4M22A 5H3CA 3VUEA 2J5XA 4CV2A 3DH0A 5BV0A 5FHQA 1EWKA 1PGNA 1QIIA 4XWYA 4J0DA 4QE3A 5I9TA 5JXHA 3GRKA 2P9YA 3HL4A