4JJBA

Crystal structure of the abl-sh3 domain at ph3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the Abl-SH3 domain at pH3
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 11
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jjbA00
3EG0A 1KIKA 1T3SA 3I35A 3KFVA 3O5ZA 1WDXA 3C0CA 3EHQA 3EG2A 1NYFA 2KRMA 3VRZA 1UTIA 2GTJA 1PRLC 2D1XA 2FO0A 2XMFA 5L23A 4LUEA 2BZXA 1E6GA 2PZ1A 2CUBA 4JPBW 4HVVA 2HSPA 1T3LA 2K6DA 1M8MA 1XOVA 1X27A 2LQWA 2AZVA 2GGRA 2DA9A 2AKKA 2FEIA 4Z8AA 4M4ZA 2KE9A 1CKBA 3H0IA 1QWEA 2BZYA 4HVUA 2H8HA 4HVWA 2DYBA 3M0UA 1ZUYA 5I11A 4OMPA 4KRTA 3SHWA 1KJWA 2F2VA 1RLPC 2DNUA 4J9HA 2RQUA 2KR3A 2OAWA 1GFDA 4EIKA 5I22A 1M30A 2DL5A 2NUZA 1MV3A 1TG0A 1G83A 1AWXA 3RNJA 1EFNA 1JXMA 4JZ4A 3H0FA 2DL4A 1W1FA 2MOXA 1JU5C 4AFZC 1K76A 1B07A 3VS6A 2A36A 1H92A 2CSIA 3RBBB 2QDLA 3CQTA 1WXUA 1GFCA 1MV0B 1WXBA 4E6RA 1SSHA 2X3WD 2C0TA 4AFQC 3VS0A 1KFZA 1PNJA 2K7AA 3UF4A 4D8KA 1UHCA 2LJ1A 1RUWA 5FW9A 1Y57A 2LX7A 3EGUA 1Z9ZA 1ABQA 2L0AA 2LMJA 2E5KA 2HBWA 1WI7A 2RQRA 4ORZA 3TSWA 3VS2A 1M3CA 1T0HA 1X2KA 4RTWA 3TVTA 2CT3A 2ROTA 2DMOA 2L3QA 1U3OA 1X2QA 3M0SA 2LJ0A 1SPKA 2V1RA 1GCPA 2KXDA 1PWTA 2ED0A 1UGVA 3LH5A 2EYZA 2PNIA 3REBB 4CC7A 5IXFA 1W6XA 2ED1A 4RTXA 2EVRA 1Z9QA 2YT6A 1NYGA 1X6GA 2DRMA 1AVZC 1UJ0A 2YUPA 1VYVA 2W10A 2EGAA 1SRLA 2P4RA 3SEMA 1T0JA 4HXJA 4RTTA 1S1NA 4CC2A 4DEXA 1UDLA 1PRMC 4D8DA 4WCIA 3VS4A 2DX1A 4GBQA 2NWMA 2B86A 4OMMA 1W70A 4JJBA 1GBRA 2CT4A 2L2PA 2OI3A 1SHFA 1ZSGA 3NMZC 3ULRB 1GRIA 3EG3A 1OOTA 4J9IA 1VYUA 1M3AA 1I1JA 5HCKA 1ZUKA 4RTYA 5IHKA 4RUGA 2K3BA 2EKHA 1M3BA 1SRMA 2KYBA 2EBPA 2CUDA 2DL7A 2HCKA 2V1QA 2SEMA 4AFUC 1BB9A 2J6OA 2A28A 2LQNA 1VA7A 2PTKA 2MIOA 4J9BA 1BU1A 3U23A 2YSQA 5GJVB 2C0OA 5ECAA 5EC7A 1OPKA 2ENMA 1CSKA 1K0XA 4OMLA 4F14A 2O9VA 3REAB 3NGPA 2KRSA 2EYWA 3QWYA 4Y92A 1HJDA 1OPLA 1VYTA 3NPFA 2JTEA 2IIMA 1Y0MA 3M0PA 4GLMA 1UUEA 4J9FA 3TSZA 1ARKA 3EHRA 4OMOA 2J06A 2DLPA 4J9EA 2EGCA 4Z88A 1WX6A 2GBQA 2LJ3A 4IIMA 1AWJA 2LP5A 2FRWA 3VS7A 3VRYA 2BTTA 1YCSB 2AZSA 2HDAA 2D8HA 2L3SA 2DL8A 1YWPA 2EYXA 2RNAA 1YNZA 1YN8A 2LNHB 3I9QA 2DBMA 1YP5A 2SRCA 1MUZA 2KT8A 1X6BA 2EGEA 2RQWA 4FSSA 2EPDA 2X3XD 2L3PA 1I0CA 1CKAA 2CDTA 4JJCA 1K0SA 2EQIA 2J6KA 1GL5A 1WA7A 2I0NA 1A0NB 2CREA 3UA6A 4OMQA 4JZ3A 4RTUA 1ZX6A 2K79A 1QLYA 2FRYA 1IO6A 2KROA 5FWBA 2BZ8A 1QKWA 3M0QA 1I07A 4ZNXA 4DEYA 2G6FX 3H0HA 2DVJA 1G2BA 4IIOA 2A08A 1JEGA 2KT1A 1RI9A 2O9SA 2YUQA 2FPFA 3THKA 1NEBA 4AG1C 1HD3A 2DJQA 2KRNA 2YDLA 1AZEA 2MCNA 3IQLA 1RLQC 2ABLA 2KXCA 1V1CA 4Z89A 4J9GA 1UE9A 2GQIA 1NEGA 2ECZA 4X1VA 2LCSA 1B3QA 3NHNA 2DBKA 3I5SA 2CSQA 4LNPA 5IH2A 5IHIA 1ZBJA 1U5SA 2JXBA 2DILA 2JS0A 2J6FA 2D0NA 2DE0X 2VWFA 1QWFA 3M0TA 1E7OA 4OMNA 1UG1A 2RN8A 1WLPB 1BK2A 2LZ6B 1WIEA 2GTOA 2F2XA 1PKTA 2KEAA 2EW3A 4CC4B 2JS2A 4AG2C 1AD5A 4LUDA 2VKNA 4F17A 2RMOA 4CC3A 3JV3A 1NLOC 1UJYA 1FYNA 3PE0A 2EYYA 2J7IA 4ESRA 1K9AA 1QCFA 2RQTA 2W0ZA 3VS3A 2O88A 2DRKA 1YWOA 3FJ5A 2AKLA 3VS5A 1K1ZA 3QWXX 5GJWB 1E6HA 1GCQA 1PKSA 4K11A 2RF0A 2JW4A 2CH4A 4JJDA 4RTVA 1ZLMA 2M0YA 4AFSC 1AWOA 1QKXA 4QT7A 1NM7A 4LN2A 2HEQA 1PHTA 4LE9A 3R6NA 2RPNA 1HSQA 1GCQC 1UECA 1ABOA 2ESWA 1BBZA 3PVQA 1SEMA 3M0RA 4HCKA 2KYMA 2M51A 2ROLA 1H3HA 1OV3A 1JXOA 2JM8A 2YUNA 2KBTA 1ZUUA 1J3TA 1FMKA 1M27C 2DL3A 2F2WA 1GBQA 2J05A 3EG1A 4RTZA 5IXBA 1JQQA 2JMAA 2JT4A 2O31A 3VS1A 3PVLA 2A37A 3UATA 1X43A 3UA7A 4A63B 4J9CA 2KGTA 1TUDA 1KSWA 3I5RA 1UFFA 2VVKA 1U06A 2FPDA 4R0KA 3ZL7C 2DF6A 3H41A 2FG0A 5FWCA 1H8KA 1X69A 2OJ2A 2FPEA 1AWWA 2CH4W 1LCKA 2JM9A 2AK5A 1JO8A 3GBQA 2RQVA 4J9DA 1AEYA 5IHNA 2GNCA 2C0IA 1K4US 3A98A 1WYXA 1NLPC 1NG2A 2D8JA 2O2OA 2K2MA 1WFWA 1UHFA 2YUOA 1OEBA 2DM1A 4F16A 1AZGB 1N5ZA 2K9GA 2KNBB 1SHGA 2JMCA 1TUCA 1AOJA 1WXTA
chains in the Genus database with same CATH superfamily
3EG0A 5GANe 3KFVA 1QCOA 3QHSA 4J83A 5HKCA 5GMKj 2LNVA 4FT4A 2GTJA 2RJEA 2XMFA 2RHZA 5L23A 3NTKA 1ACMB 3CPWS 2BZXA 4E7JA 1E6GA 4PNOA 4RCCA 3RESA 4J7FA 1R0CB 4DBFA 2CUBA 3PTAA 1VQOT 1RI0A 2VC8A 2LVMA 1VQ9A 4HVVA 2E70A 5GMKe 1YHQT 1X27A 4FL6A 2M0OA 2KSSA 2LDMA 2DA9A 2KE9A 4M75A 1ZA1B 4ZN3A 1P92A 2BZYA 5LJ5g 2H8HA 4HVWA 1PC0A 1WHLA 1VQMQ 4BI8B 3JB9F 1KQ2A 4KRTA 4OF1A 1KC8R 1KJWA 1BI1A 2IVWA 1RLPC 1FMVA 2DNUA 3MP6A 2KR3A 4E47A 3INZA 2ZPFB 1YIJT 2X51A 1GFDA 5KYNA 3CCQQ 1C0MA 5CQYA 1OULA 3SWNC 2KMTA 3CEYA 4KULA 2NUZA 3CCMA 2KK4A 1H3ZA 5C0MA 1NE8A 2EQUA 3CC2Q 2E6NA 3H0FA 1LPLA 2DYIA 2CZ6B 2R58A 4M77D 3VUZA 1B07A 2G3RA 4M78F 5DLOA 3VS6A 1Q81R 4XQ3A 3I56T 1GFCA 1MV0B 1WXBA 2RI3A 2C0TA 3OYAA 3VS0A 4R55A 3EFRA 4D8KA 1BCMA 4CI0C 1UHCA 4C5GA 3G71Q 2L0AA 2RQRA 4ORZA 3JCMe 2ZZDA 5J26A 3DB3A 1X2KA 3CMAT 4J5YA 1KK7A 2L3QA 1YHQA 1U3OA 1X2QA 3M0SA 2V1RA 2V8KA 2X4WA 4QVDA 3LH5A 4OVAA 2PNIA 3C94A 2VUBA 4RTXA 2PQWA 1NYGA 1VQ9Q 3S3NA 4N4HA 2DRMA 1AVZC 3QDRB 1NJIR 2MAMA 1NPPA 1YJNA 4XTWA 1RAEB 2P4RA 4C92C 4NOYA 4D8DA 4WCIA 2BE9B 3VS4A 2DXBA 2RA2A 4GBQA 4LDWA 1YIJA 1W70A 3GIBA 3HL8A 4M77B 2RHYA 1KC8C 2OI3A 1BIAA 1SHFA 3OYHA 1ZSGA 1QVFP 3EG3A 5C6SA 4XTXA 1M1KC 1I1JA 1VQ7A 3CCMQ 4M7DE 3HP9A 3LGLA 5IHKA 4RUGA 4F7UE 2XICA 1M3BA 3CMEQ 4IKFA 3MO8A 4QKUA 1HYOA 3CPWA 4YTLA 1XQHA 2SEMA 5GAOl 2XU8A 2JN0A 1YI2Q 1BB9A 2A28A 1YBYA 3SWNA 4UC4A 4IURA 4M75D 3U23A 2YSQA 1LJOA 2GF7A 2C0OA 4NS5A 8AT1B 3CXCP 3CMAA 5M9OA 1H641 3OMCA 4FYWB 4OMLA 4XTVA 3TCJA 3CCUT 2O9VA 1WHJA 3REAB 4EPCA 5KE2A 3NGPA 1W4SA 2KRSA 5LJ5d 2EYWA 2JZ2A 1TWBA 4PJOF 1I5LA 2EQMA 4ZTFA 4IUPA 3OYCA 3FEOA 3OYIA 3OYLA 3RDVA 2M16A 1UGRB 1AHJB 4EMKC 3X25B 3MEUA 2JTEA 3H6ZA 4EDUA 1ZBXA 4OMOA 2X4JA 1VIEA 2J06A 3GP8A 3J80E 2EGCA 1YJ9T 1WX6A 2QGGA 4PFOA 2QG9B 3JCMP 1VQ4A 4IIMA 1K8AU 2HNIA 5LJ3f 2HAXA 5I21A 1M1KU 2I2LA 2PVGB 1YJNQ 2BTTA 3OBWA 2AZSA 2JJ9A 2NUTA 3MKDA 2ATCB 4EMGA 4LDXA 2EYXA 5DY9A 1YNZA 2A3LA 3BDUA 1YN8A 3CCST 2LNHB 2DBMA 2COWA 2OTLT 1UB4A 2SRCA 2KT8A 2X3XD 2LX9A 3JCMJ 5GANh 3JCMb 3FJPA 3JB9H 3G1JA 2HQEA 4XU2A 1YJWT 1A0NB 1R77A 1HXDA 3UA6A 1WQWA 4OMQA 4E7KA 2OTJT 2ZPEB 4RTUA 1QLYA 2FRYA 4M75B 5FWBA 1FX7A 2L8DA 4DBQA 3HHTB 3M0QA 1VQ7Q 1I07A 5GMKh 1G8XA 3L2VA 2DVJA 1JEGA 1I81A 2YUQA 2FPFA 5KYWA 2K3YA 1NEBA 1AZEA 2K57A 3CCRQ 1TUGB 4Z89A 4MZTA 1VQ5T 3NHNA 2CSQA 1IGUA 2DD5A 2LC4A 3QZ9B 5GMKm 1YJ9A 2JXBA 3KXTA 2JS0A 2RJDA 1W2BP 2AT1B 2DE0X 3M0TA 3CC7A 3EG9A 1E7OA 1BK2A 2GTOA 2F2XA 2RHXA 3QJYA 3MEWA 1VQ4Q 3HTRA 1K73R 1MMNA 3CCSA 2P0KA 2DTIA 1FYNA 2J7IA 3QKJA 5CAIA 1QCNA 3RIRA 1U8RA 1VQ6A 2K3XA 1WHMA 2DRKA 1I5OB 3URGA 3CCLA 3QWXX 2BIVA 2OTJA 1TH7A 4KGVB 1VQPA 5CR2A 2JW4A 3JCMh 2JUFA 2AIRB 4RTVA 1ZLMA 4AFSC 2LRQA 4M7AD 1VQLT 2XI9A 4LN2A 1Q86R 4LE9A 1EIFA 1HSQA 2VYTA 3M5AA 1SEMA 5GAN4 3V7SA 2MWOA 4BACA 2ROLA 2Y4XA 4PJOC 2JM8A 2YUNA 2HQXA 2KBTA 2X35A 2NLUA 3EG1A 4RTZA 2JMAA 2O31A 3V7RA 1X43A 1VOMA 2RD1A 1VQ5A 3JB9I 3HRSA 1TUDA 1KSWA 3MHXA 1JJ2A 4M77G 3EFOA 2QDYB 4R0KA 3QYHB 3ZL7C 3H41A 1H8KA 1X69A 4O5VA 1AWWA 1S72Q 3OYFA 5I2SA 2CP7A 4J9DA 4DOWA 2KY9A 5LJ3j 4HKEA 2GNCA 1K4US 2DPPB 3M4YA 4HA8A 5IAYA 4BI3A 3CC7Q 3I55A 2HBPA 3H8ZA 1JRIA 1N5ZA 1G5VA 4PFZA 2YWWA 1BI0A 1QP2A 1VQMT 5LJ3e 2HD0A 3E2UA 2GFUA 1RADB 2A0FB 5IXFA 2CP5A 4M7AB 1KIKA 4B9WA 1WDXA 3EHQA 3A5ZB 2D1XA 2FO0A 1VQ6Q 3CCQT 4LUEA 3TQ7P 1VQLA 5GAMg 3CCLQ 3HSBA 4RG2A 4Y91A 3CC2T 2K6DA 1M8MA 3S6WA 1D1BA 4KUDK 2PVDB 2FB7A 2RJCA 5KCHA 2AZVA 4KGZB 2AKKA 2FEIA 3RUXA 4M4ZA 1Q86C 1M5Q1 3BDLA 5GAN6 1QWEA 3GNGA 5GAOm 3OYJA 3M0UA 5GAN3 1ZUYA 5I11A 2ZPHB 2WSEE 1KQSP 2BUDA 4M75C 2RQUA 2M1HA 3JRZA 4KBMB 2FL7A 1NBEB 4ELZC 1MNEA 7AT1B 4XU3A 1WGSA 2B8AA 2DEQA 4M77A 3RERA 1V76A 3UPUA 3DKMA 3EFSA 2QQAA 4QW2A 1M1GA 5I22A 1M30A 5LJ5f 2DD4A 1MV3A 1VQ9T 4M75G 5HY6A 1TG0A 2Z0WA 3M59A 1EFNA 2P84A 2YRVA 3QDFA 4XU0A 1WZOA 3NFCA 3O8VA 4BE1A 2RJFA 4IUUA 1WNLA 2DZCA 4AFZC 3JB9D 1SKUB 5KYWB 1D1CA 4M7DG 2IG0A 4M78E 3CC4A 1ZSZA 3KBGA 3OYMA 1H92A 2Y4YA 2CSIA 3I55Q 3LGFA 3X28B 1WXUA 1D09B 1LNXA 2X3WD 5FRNA 4MMKA 2QEXA 1KFZA 3JB9J 3M56A 1PD1A 3EGDB 2OX7A 1OYXA 1RAFB 1RUWA 1M8VA 5FW9A 3DB4A 3EGUA 2CZ7B 2E5KA 1WI7A 1Q82C 3TSWA 5KH6A 1M3CA 4MZPA 4C8QD 3AHUA 1RACB 2QQ9A 2KVQG 4RTWA 2DMOA 4C92F 1FXXA 3EG9B 2DEUA 4BI4A 2KI7A 1SPKA 4ELYC 1SG5A 2KXDA 3REBB 3CCMT 3OW2P 2EYZA 1W6XA 4L59A 1PCXA 3CMET 3DLMA 1X6GA 3S3OA 3G7ZA 5KE3A 3JAME 1M4ZA 1OQKA 2FVUA 2YUPA 2QAZA 4XTYA 1OU9A 1YI2T 2W10A 2EGAA 3V8KA 3A8LB 3G71A 1SRLA 1NPRA 4HXJA 1S1NA 4CC2A 4DEXA 2HMAA 2JVVA 4ATOA 3QO3A 2DX1A 3BE3A 2NWMA 1IB8A 2CZ1B 4OMMA 3OYGA 4JJBA 3M58A 2JTFA 1GBRA 2L2PA 3CCVA 5GMKl 4FW2A 2CZ0B 4IUQA 1QVFA 4HT8A 4PJMA 1IREB 1VYUA 1M3AA 4B6MA 1Q82U 4J6XA 3TREA 2L5QA 1BCOA 1UGPB 2EKHA 3JCMg 2XIDA 2KYBA 4C8QB 2CUDA 2HCKA 4ME7A 2DIQA 1YJNT 3FC3A 5GAMd 1WJRA 2J6OA 4M7DA 3T9NA 3CC4Q 1DJ7B 1VA7A 3ASKA 3EFOB 4J9BA 3CXCA 1K8AR 2EWNA 2QEXQ 1MMDA 1M1KR 2EJ9A 1Q7YC 4Q5WA 3PGGA 2RK1A 3WVDB 2MMPA 1MMAA 3CMEA 4PJOE 2LT4A 2VV5A 4Y92A 2CKKA 2IIMA 4J9FA 1YI2A 1VQ7T 1PSFA 3OS0A 4NL2A 1ZA2B 4PJNA 1VQNQ 2LJ3A 1AWJA 2QYZA 2FRWA 1OI1A 3G4SA 1YCSB 2XDPA 2D8HA 2L3SA 4KUIA 2DL8A 4C0DC 2RNAA 4KT0E 3SB2A 1U1TA 4JS5A 2M9UA 5GAOr 4M7AG 3X26B 3CCRT 3I9QA 5LJ3h 1YP5A 5LJ5j 5CCAA 5I2MA 2RQWA 2EPDA 4JJCA 1KHCA 3CCVQ 2K5IA 1O75A 2K79A 1Q7YU 1TTHB 5LJ5e 5A2QE 1U1SA 2BZ8A 5CVIA 1QKWA 1VQ4T 4JRKA 1G2BA 2A08A 3MEVA 2E65A 3VYHB 3VV0A 2EQJA 2LCCA 2YHTA 3MEAA 3THKA 4AG1C 1PM3A 3KUFA 2MCNA 3IQLA 2XDBA 5IT9E 4J8OA 5D6XA 2ABLA 4X34A 3CCEA 3HFOA 2E10A 2F5KA 1VIFA 3LWIA 1K8AC 4X1VA 3ZEHA 1Y07A 3I5SA 4LNPA 2P4TA 3JCMc 1ZSZB 1W2BA 4BY6B 2J6FA 1BYMA 1QWFA 1RL2A 4OGCA 2ZCFB 4DOVA 4A4KA 1WIEA 2WSFE 2KEAA 3HPWA 3JCMQ 1AD5A 3A8MB 2VKNA 2HL5C 2E41A 3CCRA 1UJYA 3E1SA 1D1AA 3G4SQ 2EYYA 4ESRA 1K9AA 2CP2A 3LWHA 1D0YA 1IHWA 4M7DD 2R5MA 1QCFA 4QQDA 3VS3A 2O88A 4M77F 3JCMd 2R5AA 3FJ5A 4M7AA 2ZGWA 3RKXA 1M2VB 2COYA 1E6HA 1GCQA 1PKSA 8ATCB 2RF0A 3BY7A 5D6WA 2M0YA 1AWOA 1HK9A 4QT7A 1NM7A 2HEQA 1JJ2S 1QQJA 2CP6A 2NYSA 1UECA 3CC7T 3OYDA 5EG2A 3M0RA 4C5EA 1M2OA 3VJPA 1H3HA 1WHHA 1BI3A 3EH1A 2DVEA 1UEBA 3SD4A 2DL3A 4CRIA 2F2WA 5CKDA 3OW2S 2HL3A 4L5GA 2JT4A 3PVLA 1VQ6T 1TOVA 3LX7A 4J9CA 4X9CA 1UGSB 3OB9A 3RKYA 3JCMX 1U06A 2FPDA 1VQKA 3CCLT 3JB9G 4A4FA 2FG0A 4C8QC 2F69A 3BW1A 3V8JA 3CCEQ 2YLBA 1VQPT 2CH4W 3JCMW 4BD3A 5IHNA 4EMHA 4M7DB 2O4XB 4Z02A 4F7UB 1C6VX 1WYXA 1KQ1A 1B34A 2D6FA 4C8QG 4LDVA 2O2OA 4F16A 3C95A 3L2UA 3C4SA 1X6OA 1N27A 4DQ2A 2KNBB 1SHGA 4N4GA 4M78G 1TUCA 1WXTA 1T3SA 2EKOA 3O5ZA 1D0ZA 1S72A 1AT1B 1NYFA 2KRMA 3VRZA 1UTIA 3EGDA 3OYYA 1PRLC 3AT1B 3V7CA 5D7UA 2QXFA 2MYSA 2RHUA 3JSCA 2PUOB 4M75F 3P8HA 2CGHA 1T3LA 3OS1A 1M90U 1PSEA 1XOVA 1TSFA 3HFNA 2CP3A 2YLCA 3EGXB 3PNWC 2LQWA 4BDZA 1D3BA 4Z8AA 3I55T 4MZMA 3VYGA 1CKBA 4HVUA 3VKIA 2E12A 2DYBA 5GAMf 2MPXC 1KQSA 2GQVA 4OMPA 4BDYA 3FRNA 4ZTJA 2X9HA 2XK0A 3META 4C0FA 2F2VA 4XTZA 2VGNA 3QYGB 2OAWA 1R8OB 2HQHA 4OB2B 2QA4Q 3M53A 2XDDA 2H3JA 4EIKA 1VQKQ 2DL5A 1G83A 1TU0B 2P0QA 4M77C 3L1AA 4HT9A 2MOXA 1YFNA 4FYVB 1JU5C 1K76A 4X9DA 5LJ5h 1PG5B 2D0QB 2GFAA 2A36A 3RBBB 2QDLA 1O9SA 3CQTA 4C8QA 4E6RA 2QQBA 2EJGA 2X4XA 2DTHA 1PNJA 2DXTA 3UF4A 3ER0A 2LJ1A 4N0AA 1ZSZC 3R6OA 4M78A 3QSUA 1QVGP 4BY6C 2LX7A 1Z9ZA 1ABQA 2LMJA 2HBWA 3L2QA 2CT3A 1XNIA 4C92E 4MMLA 1G3YA 4ZGEB 3OW2A 1GCPA 4DBHA 9ATCB 2EVRA 1FMWA 1Z9QA 3F70A 2YT6A 1WPYA 1YITQ 1UJ0A 2V8JA 1QVFS 1VYVA 2E6ZA 3OYEA 2L89A 1Q82R 3A8HB 2ZPIB 3CC4T 1BIBA 1MNDA 2JTMA 3SEMA 2Y90A 1C1AA 4C92D 2QEXT 1UDLA 1IHVA 2B86A 1X75C 5GAN8 1KG1A 2CT4A 4P5NA 2MI6A 3CXCS 1GRIA 5FRMA 5HCKA 2HZYA 2MK5A 1ZUKA 5CO7A 5KCOA 2DXUA 1VQNT 2RHIA 1SRMA 1WQ7A 2DL7A 4KGXB 2IPOB 2V1QA 4AFUC 3MCAB 3EH2A 3NTHA 3G71T 1N8RU 3CD6A 3VUBA 2PTKA 2MIOA 4M7AF 4J7IA 5EC7A 1V29B 2DKGA 1I4K1 1EZZB 5CQXA 4M7DC 1ZHIA 4F14A 2FZKB 2XHCA 4LDYA 1MGQA 3JCMf 3CCVT 3VU3C 5GANg 1XTDA 1OZ2A 4E7IA 3GPLA 2AHJB 4PJLA 1B34B 1VYTA 1OX9A 1K9MU 3NPFA 1Y0MA 3MP1A 4GLMA 1Y71A 4C0GA 1ARKA 4OB3B 2DLPA 3OSVA 5GAMj 3N5BB 4F7UG 5KYXA 2GBQA 4PL6A 4A54A 1RAGB 1N9RA 2LP5A 2CS7A 3QG1A 1Q7YR 3OSSC 3VS7A 4E7HA 3VRYA 2HDAA 3G6EA 1YWPA 4PJJA 4JJNK 2PU9B 5GAMe 4FCYA 3HRTA 3LW5E 2RB6A 1MUZA 2EGEA 2F1LA 3S3MA 3PT9A 5FU6B 1CKAA 2CDTA 4M78D 1LVKA 2J6KA 1M2VA 4MDWA 1VQNA 3CBOA 2CREA 1D3BB 4C0ZA 4KH1B 1IO6A 2VASA 2KQWA 4RKUE 1TS9A 4II1A 3OA6A 3Q1JA 2VXEA 5J39A 2F5TX 4ZNXA 4QQ6A 4DEYA 1EX4A 2G6FX 3H0HA 3QPHA 1UGQB 3G4ST 4PLLA 1W2BS 1G3SA 2O9SA 2V8IA 4ANJA 4ZGDB 3CCJQ 1HD3A 3CD6Q 2KRNA 2YDLA 2LQ8A 2DAQA 2FZCB 4A4GA 3CBPA 1RLQC 3LLRA 4FYYB 2KXCA 1IRXA 1V1CA 2GQIA 1NEGA 3SDZA 2LCSA 1B3QA 4DBRA 3UT1A 2DBKA 3GF5A 5A0DA 5IH2A 5IHIA 4RG8A 3QBYA 2FYKA 1RAHB 2D0NA 4OMNA 1UG1A 2PVOB 1WLPB 1RAAB 1PKTA 1LOJA 4OB1B 3C12A 3QZ5B 2EW3A 2O4XA 4F7UA 1WJSA 4M78B 2DO3A 1Y7XA 4CC3A 1OZ3A 1NLOC 4PFPA 5LL6S 3G6EQ 5IN1A 2E3HA 1VQ8A 2W0ZA 2LCLA 4AT1B 1YWOA 4M77E 2AKLA 4OGEA 4FIBA 2M02A 5CKHA 5A0LA 1K1ZA 3CCET 5GJWB 2QQSA 2E64A 3P8BB 4K11A 3MP8A 4HCBA 2CH4A 4LDUA 2DZ9A 4M7AC 1QKXA 5GAN7 2COZA 3R6NA 1G3WA 1QVGS 1GCQC 3PVQA 4JLIA 4HCKA 3HKSA 4C8QF 2A7YA 2XG8D 2KYMA 3EGXA 3A8OB 1R0BG 4B9XA 1JXOA 2H3EB 1ZUUA 2XKOC 1J3TA 5GANd 4PJOD 3D7SB 1M27C 5IXBA 2L3RA 2KAFA 2DERA 1JQQA 3FB9A 1I8FA 5GAOp 2WSCE 2V26A 3UATA 3H9NA 4ZN1A 1N9SA 1UFFA 2VVKA 4N4IA 4FT2A 1QVPA 2DF6A 3PMTA 2CP0A 2QTVA 2OJ2A 3E9GA 1VQOA 1LCKA 2EQKA 1BKBA 3TU4K 2JM9A 2AK5A 1JO8A 4F04B 1WHKA 3GBQA 4FYXB 3M4GA 2EIFA 3NTIA 2DJZA 5CK9A 2ZAEA 5AYFA 3LH0A 3OYBA 5A0GA 2QQRA 1NLPC 1NG2A 2D8JA 4JUVA 4XU1A 1JBMA 1WFWA 1UHFA 3QJ6A 2YUOA 3QIIA 2ZPBB 1AZGB 1M90R 2K9GA 2FHDA 4OP0A 3V8LA 5FLXE 3HRUA 1TXQA 3L2RA 3I35A 4E7SA 1WHGA 1XJWB 3C0CA 3EG2A 4HCZA 4E2FB 3QXEB 2RI5A 4JS4A 3OYNA 1VQ8Q 2QA4T 4FU6A 4E7LA 1VQKT 3J81E 3GNFB 4IUVA 4J6WA 1KQSS 3OQ5A 5L8RE 2QASA 4KH0B 5KYXB 2PZ1A 4PJOB 4JPBW 5GAOn 4M75E 4Y28E 2HSPA 3FDRA 4C92G 4O6JA 4FM4B 5KYYA 2JOYA 2EJFA 2GGRA 4BE2A 4QVCA 1KD1R 2LT1A 1PD0A 3H0IA 5FU6C 2RH2A 3I56A 5CKFA 4C5IA 4TVRA 1KHIA 3A8GB 4BB7A 3SHWA 2FZGB 1S72T 4J9HA 1N6AA 2D9TA 1Q81C 5GAMh 4AMCA 4XTUA 2MWPA 4JRPA 2CYZB 3E9FA 5GMKi 1YITT 1VQOQ 1AWXA 3RNJA 1JXMA 4JZ4A 2K2VA 2DL4A 1W1FA 1YHQQ 1YCYA 1RABB 3P8DA 2MF2A 5J3BA 1KC8U 4QQGA 2YRCA 1F1BB 1SSHA 4AFQC 2O01E 2QA4A 2K7AA 1M90C 1QVGA 1Y57A 1NJIC 2HKQB 4VUBA 3VS2A 1T0HA 1M1FA 3TVTA 2ROTA 3X24B 4N0AC 1YIJQ 4M78C 2LJ0A 3RMSA 1PWTA 2ED0A 1UGVA 2K4YA 4CC7A 4QVZA 3MJXA 2ED1A 1Q81U 3M55A 2ZPGB 4OMFB 4C92A 5HK3A 2YRDA 4FW1A 5GAOq 3DLLA 4BE0A 2BE7D 2GCXA 1T0JA 4RTTA 3I56Q 1KD1C 2OAUA 3OY9A 1PRMC 3UDCA 1NZ9A 4JRIA 2DXCA 1N8RR 3CCUA 3ZBDA 1IGQA 2RK2A 1YITA 1G3TA 2NUPA 3CMAQ 3NMZC 3ULRB 1NJIU 1Y96A 1OOTA 4J9IA 3PIPA 5KYUA 3OYKA 1QW1A 2RI2A 4M7DF 4ZGJB 4L6V5 4RTYA 4A53A 4F7UF 5FROA 5FU7B 3OS5A 2K3BA 2EBPA 3QUIA 1K9MR 5GAN5 1B7TA 3CPWP 1ZQ1A 4OB0B 2LQNA 1BU1A 4M7AE 5GJVB 5DLQE 5ECAA 1OPKA 2ENMA 1CSKA 1QP3A 3CBMA 2OTLA 1K0XA 4C5HA 3ZFJA 2VGMA 4EMKA 5LJ3g 1OU8A 4XAXB 1KD1U 2YXYA 4BUGA 1GXIE 3QWYA 1YJWA 2BKDN 1HJDA 1OPLA 2QTXA 5DM7R 3M0PA 1UUEA 3TSZA 3EAEA 3EHRA 4GLKA 3GLXA 3PMIA 4J9EA 4Z88A 1OX8A 2C06A 2DTOA 4RCBA 3OBYA 3E19A 3L42A 1MMGA 3CCJT 1X01A 5AT1B 2LQKA 5GANf 3CD6T 3WXMB 3PIOA 1SSFA 3OMGA 2X4YA 3M9QA 4PLIA 1X6BA 4FSSA 2L3PA 1I0CA 4JRQA 2QI2A 3CCUQ 1K0SA 2EQIA 2DK3A 1GL5A 5KYYB 1WA7A 1SF9A 2I0NA 1N8RC 2EFIA 4PJOG 2HKNA 4JZ3A 1IZ6A 1ZX6A 3X20B 3CPFA 2KROA 4PKCC 1IXDA 2VB6A 3FIFA 4V2SA 3M57A 4LXCA 3JCMV 5CKEA 3L2WA 2EAYA 3A1PA 4J6YA 1YJ9Q 1D0XA 4GY5A 3SWNB 4IIOA 2KT1A 1JB0E 1RI9A 2E4HA 3G6ET 1K9MC 2DJQA 3MPUB 4LD9K 2DETA 5CIUA 3WVEB 3CCSQ 3TEEA 2OTLQ 4J9GA 3SFMA 2RO0A 1UE9A 1K73C 2E5QA 2ECZA 2VXFA 2E3IA 2QK0A 4JDSA 1RAIB 1ZBJA 1U5SA 1YJWQ 2DILA 3OS2A 1MHNA 2OTJQ 2VWFA 2E1HA 1Q95G 4C0DB 5CKBA 1VQPQ 2RN8A 2LZ6B 3CCJA 3RR6A 3RMQA 4HCCA 2NUTB 4CC4B 2JS2A 4AG2C 4LUDA 4F17A 2RM4A 2RMOA 3UWNA 2JNGA 3JV3A 2DFUA 4DA4A 4A4EA 3PE0A 2RQTA 2EYQA 2PUKB 3VS5A 5GAN2 4R56A 4C92B 4JJDA 4WTOB 1VQ5Q 2HSEB 4PJOA 4IUTA 1PHTA 2RPNA 2P0PA 1K73U 1BI2A 1ABOA 2ESWA 4FSXA 3BFMA 1BBZA 1VUBA 3J7AF 1QMCA 5LJ3d 4C8QE 2M51A 2QGFB 1OV3A 4PK4A 6AT1B 5HK0A 1VQMA 1WJQA 1FMKA 2DIGA 2R57A 1GBQA 2J05A 3M54A 1M9SA 5D6YA 2LTOA 4A4HA 3VS1A 2NUPB 2A37A 2K5FA 4XK8E 3UA7A 1VQ8T 4A63B 1FWZA 3ME9A 4RMOA 2KGTA 1Y96B 2KDSA 2XD0A 5FU7C 3I5RA 3CCQA 5KYUB 1JJ2P 1Q86U 3L2ZA 3PFSA 5FWCA 3RKWA 4WF2A 4NL3A 2FPEA 2K5LA 3CC2A 4MDXA 2RQVA 2WACA 1AEYA 4JLGA 1VQLQ 2C0IA 5GANj 3A98A 4E7ZA 3LYIA 4LD6A 4D6WA 2K2MA 1OEBA 2DM1A 4EMKB 3FLGA 2JMCA 1AOJA 3GOXA
chains in the Genus database with same CATH topology
3EG0A 1KIKA 1T3SA 3I35A 3KFVA 3O5ZA 1WDXA 3C0CA 3EHQA 3EG2A 1NYFA 2KRMA 3VRZA 1UTIA 2GTJA 1PRLC 2D1XA 2FO0A 2XMFA 5L23A 4LUEA 2BZXA 1E6GA 2PZ1A 2CUBA 4JPBW 4HVVA 2HSPA 1T3LA 2K6DA 1M8MA 1XOVA 1X27A 2LQWA 2AZVA 2GGRA 2DA9A 2AKKA 2FEIA 4Z8AA 4M4ZA 2KE9A 1CKBA 3H0IA 1QWEA 2BZYA 4HVUA 2H8HA 4HVWA 2DYBA 3M0UA 1ZUYA 5I11A 4OMPA 4KRTA 3SHWA 1KJWA 2F2VA 1RLPC 2DNUA 4J9HA 2RQUA 2KR3A 2OAWA 1GFDA 4EIKA 5I22A 1M30A 2DL5A 2NUZA 1MV3A 1TG0A 1G83A 1AWXA 3RNJA 1EFNA 1JXMA 4JZ4A 3H0FA 2DL4A 1W1FA 2MOXA 1JU5C 4AFZC 1K76A 1B07A 3VS6A 2A36A 1H92A 2CSIA 3RBBB 2QDLA 3CQTA 1WXUA 1GFCA 1MV0B 1WXBA 4E6RA 1SSHA 2X3WD 2C0TA 4AFQC 3VS0A 1KFZA 1PNJA 2K7AA 3UF4A 4D8KA 1UHCA 2LJ1A 1RUWA 5FW9A 1Y57A 2LX7A 3EGUA 1Z9ZA 1ABQA 2L0AA 2LMJA 2E5KA 2HBWA 1WI7A 2RQRA 4ORZA 3TSWA 3VS2A 1M3CA 1T0HA 1X2KA 4RTWA 3TVTA 2CT3A 2ROTA 2DMOA 2L3QA 1U3OA 1X2QA 3M0SA 2LJ0A 1SPKA 2V1RA 1GCPA 2KXDA 1PWTA 2ED0A 1UGVA 3LH5A 2EYZA 2PNIA 3REBB 4CC7A 5IXFA 1W6XA 2ED1A 4RTXA 2EVRA 1Z9QA 2YT6A 1NYGA 1X6GA 2DRMA 1AVZC 1UJ0A 2YUPA 1VYVA 2W10A 2EGAA 1SRLA 2P4RA 3SEMA 1T0JA 4HXJA 4RTTA 1S1NA 4CC2A 4DEXA 1UDLA 1PRMC 4D8DA 4WCIA 3VS4A 2DX1A 4GBQA 2NWMA 2B86A 4OMMA 1W70A 4JJBA 1GBRA 2CT4A 2L2PA 2OI3A 1SHFA 1ZSGA 3NMZC 3ULRB 1GRIA 3EG3A 1OOTA 4J9IA 1VYUA 1M3AA 1I1JA 5HCKA 1ZUKA 4RTYA 5IHKA 4RUGA 2K3BA 2EKHA 1M3BA 1SRMA 2KYBA 2EBPA 2CUDA 2DL7A 2HCKA 2V1QA 2SEMA 4AFUC 1BB9A 2J6OA 2A28A 2LQNA 1VA7A 2PTKA 2MIOA 4J9BA 1BU1A 3U23A 2YSQA 5GJVB 2C0OA 5ECAA 5EC7A 1OPKA 2ENMA 1CSKA 1K0XA 4OMLA 4F14A 2O9VA 3REAB 3NGPA 2KRSA 2EYWA 3QWYA 4Y92A 1HJDA 1OPLA 1VYTA 3NPFA 2JTEA 2IIMA 1Y0MA 3M0PA 4GLMA 1UUEA 4J9FA 3TSZA 1ARKA 3EHRA 4OMOA 2J06A 2DLPA 4J9EA 2EGCA 4Z88A 1WX6A 2GBQA 2LJ3A 4IIMA 1AWJA 2LP5A 2FRWA 3VS7A 3VRYA 2BTTA 1YCSB 2AZSA 2HDAA 2D8HA 2L3SA 2DL8A 1YWPA 2EYXA 2RNAA 1YNZA 1YN8A 2LNHB 3I9QA 2DBMA 1YP5A 2SRCA 1MUZA 2KT8A 1X6BA 2EGEA 2RQWA 4FSSA 2EPDA 2X3XD 2L3PA 1I0CA 1CKAA 2CDTA 4JJCA 1K0SA 2EQIA 2J6KA 1GL5A 1WA7A 2I0NA 1A0NB 2CREA 3UA6A 4OMQA 4JZ3A 4RTUA 1ZX6A 2K79A 1QLYA 2FRYA 1IO6A 2KROA 5FWBA 2BZ8A 1QKWA 3M0QA 1I07A 4ZNXA 4DEYA 2G6FX 3H0HA 2DVJA 1G2BA 4IIOA 2A08A 1JEGA 2KT1A 1RI9A 2O9SA 2YUQA 2FPFA 3THKA 1NEBA 4AG1C 1HD3A 2DJQA 2KRNA 2YDLA 1AZEA 2MCNA 3IQLA 1RLQC 2ABLA 2KXCA 1V1CA 4Z89A 4J9GA 1UE9A 2GQIA 1NEGA 2ECZA 4X1VA 2LCSA 1B3QA 3NHNA 2DBKA 3I5SA 2CSQA 4LNPA 5IH2A 5IHIA 1ZBJA 1U5SA 2JXBA 2DILA 2JS0A 2J6FA 2D0NA 2DE0X 2VWFA 1QWFA 3M0TA 1E7OA 4OMNA 1UG1A 2RN8A 1WLPB 1BK2A 2LZ6B 1WIEA 2GTOA 2F2XA 1PKTA 2KEAA 2EW3A 4CC4B 2JS2A 4AG2C 1AD5A 4LUDA 2VKNA 4F17A 2RMOA 4CC3A 3JV3A 1NLOC 1UJYA 1FYNA 3PE0A 2EYYA 2J7IA 4ESRA 1K9AA 1QCFA 2RQTA 2W0ZA 3VS3A 2O88A 2DRKA 1YWOA 3FJ5A 2AKLA 3VS5A 1K1ZA 3QWXX 5GJWB 1E6HA 1GCQA 1PKSA 4K11A 2RF0A 2JW4A 2CH4A 4JJDA 4RTVA 1ZLMA 2M0YA 4AFSC 1AWOA 1QKXA 4QT7A 1NM7A 4LN2A 2HEQA 1PHTA 4LE9A 3R6NA 2RPNA 1HSQA 1GCQC 1UECA 1ABOA 2ESWA 1BBZA 3PVQA 1SEMA 3M0RA 4HCKA 2KYMA 2M51A 2ROLA 1H3HA 1OV3A 1JXOA 2JM8A 2YUNA 2KBTA 1ZUUA 1J3TA 1FMKA 1M27C 2DL3A 2F2WA 1GBQA 2J05A 3EG1A 4RTZA 5IXBA 1JQQA 2JMAA 2JT4A 2O31A 3VS1A 3PVLA 2A37A 3UATA 1X43A 3UA7A 4A63B 4J9CA 2KGTA 1TUDA 1KSWA 3I5RA 1UFFA 2VVKA 1U06A 2FPDA 4R0KA 3ZL7C 2DF6A 3H41A 2FG0A 5FWCA 1H8KA 1X69A 2OJ2A 2FPEA 1AWWA 2CH4W 1LCKA 2JM9A 2AK5A 1JO8A 3GBQA 2RQVA 4J9DA 1AEYA 5IHNA 2GNCA 2C0IA 1K4US 3A98A 1WYXA 1NLPC 1NG2A 2D8JA 2O2OA 2K2MA 1WFWA 1UHFA 2YUOA 1OEBA 2DM1A 4F16A 1AZGB 1N5ZA 2K9GA 2KNBB 1SHGA 2JMCA 1TUCA 1AOJA 1WXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG0 A;  1KIK A;  1T3S A;  3I35 A;  3KFV A;  3O5Z A;  1WDX A;  3C0C A;  3EHQ A;  3EG2 A;  1NYF A;  2KRM A;  3VRZ A;  1UTI A;  2GTJ A;  1PRL C;  2D1X A;  2FO0 A;  2XMF A;  5L23 A;  4LUE A;  2BZX A;  1E6G A;  2PZ1 A;  2CUB A;  4JPB W;  4HVV A;  2HSP A;  1T3L A;  2K6D A;  1M8M A;  1XOV A;  1X27 A;  2LQW A;  2AZV A;  2GGR A;  2DA9 A;  2AKK A;  2FEI A;  4Z8A A;  4M4Z A;  2KE9 A;  1CKB A;  3H0I A;  1QWE A;  2BZY A;  4HVU A;  2H8H A;  4HVW A;  2DYB A;  3M0U A;  1ZUY A;  5I11 A;  4OMP A;  4KRT A;  3SHW A;  1KJW A;  2F2V A;  1RLP C;  2DNU A;  4J9H A;  2RQU A;  2KR3 A;  2OAW A;  1GFD A;  4EIK A;  5I22 A;  1M30 A;  2DL5 A;  2NUZ A;  1MV3 A;  1TG0 A;  1G83 A;  1AWX A;  3RNJ A;  1EFN A;  1JXM A;  4JZ4 A;  3H0F A;  2DL4 A;  1W1F A;  2MOX A;  1JU5 C;  4AFZ C;  1K76 A;  1B07 A;  3VS6 A;  2A36 A;  1H92 A;  2CSI A;  3RBB B;  2QDL A;  3CQT A;  1WXU A;  1GFC A;  1MV0 B;  1WXB A;  4E6R A;  1SSH A;  2X3W D;  2C0T A;  4AFQ C;  3VS0 A;  1KFZ A;  1PNJ A;  2K7A A;  3UF4 A;  4D8K A;  1UHC A;  2LJ1 A;  1RUW A;  5FW9 A;  1Y57 A;  2LX7 A;  3EGU A;  1Z9Z A;  1ABQ A;  2L0A A;  2LMJ A;  2E5K A;  2HBW A;  1WI7 A;  2RQR A;  4ORZ A;  3TSW A;  3VS2 A;  1M3C A;  1T0H A;  1X2K A;  4RTW A;  3TVT A;  2CT3 A;  2ROT A;  2DMO A;  2L3Q A;  1U3O A;  1X2Q A;  3M0S A;  2LJ0 A;  1SPK A;  2V1R A;  1GCP A;  2KXD A;  1PWT A;  2ED0 A;  1UGV A;  3LH5 A;  2EYZ A;  2PNI A;  3REB B;  4CC7 A;  5IXF A;  1W6X A;  2ED1 A;  4RTX A;  2EVR A;  1Z9Q A;  2YT6 A;  1NYG A;  1X6G A;  2DRM A;  1AVZ C;  1UJ0 A;  2YUP A;  1VYV A;  2W10 A;  2EGA A;  1SRL A;  2P4R A;  3SEM A;  1T0J A;  4HXJ A;  4RTT A;  1S1N A;  4CC2 A;  4DEX A;  1UDL A;  1PRM C;  4D8D A;  4WCI A;  3VS4 A;  2DX1 A;  4GBQ A;  2NWM A;  2B86 A;  4OMM A;  1W70 A;  4JJB A;  1GBR A;  2CT4 A;  2L2P A;  2OI3 A;  1SHF A;  1ZSG A;  3NMZ C;  3ULR B;  1GRI A;  3EG3 A;  1OOT A;  4J9I A;  1VYU A;  1M3A A;  1I1J A;  5HCK A;  1ZUK A;  4RTY A;  5IHK A;  4RUG A;  2K3B A;  2EKH A;  1M3B A;  1SRM A;  2KYB A;  2EBP A;  2CUD A;  2DL7 A;  2HCK A;  2V1Q A;  2SEM A;  4AFU C;  1BB9 A;  2J6O A;  2A28 A;  2LQN A;  1VA7 A;  2PTK A;  2MIO A;  4J9B A;  1BU1 A;  3U23 A;  2YSQ A;  5GJV B;  2C0O A;  5ECA A;  5EC7 A;  1OPK A;  2ENM A;  1CSK A;  1K0X A;  4OML A;  4F14 A;  2O9V A;  3REA B;  3NGP A;  2KRS A;  2EYW A;  3QWY A;  4Y92 A;  1HJD A;  1OPL A;  1VYT A;  3NPF A;  2JTE A;  2IIM A;  1Y0M A;  3M0P A;  4GLM A;  1UUE A;  4J9F A;  3TSZ A;  1ARK A;  3EHR A;  4OMO A;  2J06 A;  2DLP A;  4J9E A;  2EGC A;  4Z88 A;  1WX6 A;  2GBQ A;  2LJ3 A;  4IIM A;  1AWJ A;  2LP5 A;  2FRW A;  3VS7 A;  3VRY A;  2BTT A;  1YCS B;  2AZS A;  2HDA A;  2D8H A;  2L3S A;  2DL8 A;  1YWP A;  2EYX A;  2RNA A;  1YNZ A;  1YN8 A;  2LNH B;  3I9Q A;  2DBM A;  1YP5 A;  2SRC A;  1MUZ A;  2KT8 A;  1X6B A;  2EGE A;  2RQW A;  4FSS A;  2EPD A;  2X3X D;  2L3P A;  1I0C A;  1CKA A;  2CDT A;  4JJC A;  1K0S A;  2EQI A;  2J6K A;  1GL5 A;  1WA7 A;  2I0N A;  1A0N B;  2CRE A;  3UA6 A;  4OMQ A;  4JZ3 A;  4RTU A;  1ZX6 A;  2K79 A;  1QLY A;  2FRY A;  1IO6 A;  2KRO A;  5FWB A;  2BZ8 A;  1QKW A;  3M0Q A;  1I07 A;  4ZNX A;  4DEY A;  2G6F X;  3H0H A;  2DVJ A;  1G2B A;  4IIO A;  2A08 A;  1JEG A;  2KT1 A;  1RI9 A;  2O9S A;  2YUQ A;  2FPF A;  3THK A;  1NEB A;  4AG1 C;  1HD3 A;  2DJQ A;  2KRN A;  2YDL A;  1AZE A;  2MCN A;  3IQL A;  1RLQ C;  2ABL A;  2KXC A;  1V1C A;  4Z89 A;  4J9G A;  1UE9 A;  2GQI A;  1NEG A;  2ECZ A;  4X1V A;  2LCS A;  1B3Q A;  3NHN A;  2DBK A;  3I5S A;  2CSQ A;  4LNP A;  5IH2 A;  5IHI A;  1ZBJ A;  1U5S A;  2JXB A;  2DIL A;  2JS0 A;  2J6F A;  2D0N A;  2DE0 X;  2VWF A;  1QWF A;  3M0T A;  1E7O A;  4OMN A;  1UG1 A;  2RN8 A;  1WLP B;  1BK2 A;  2LZ6 B;  1WIE A;  2GTO A;  2F2X A;  1PKT A;  2KEA A;  2EW3 A;  4CC4 B;  2JS2 A;  4AG2 C;  1AD5 A;  4LUD A;  2VKN A;  4F17 A;  2RMO A;  4CC3 A;  3JV3 A;  1NLO C;  1UJY A;  1FYN A;  3PE0 A;  2EYY A;  2J7I A;  4ESR A;  1K9A A;  1QCF A;  2RQT A;  2W0Z A;  3VS3 A;  2O88 A;  2DRK A;  1YWO A;  3FJ5 A;  2AKL A;  3VS5 A;  1K1Z A;  3QWX X;  5GJW B;  1E6H A;  1GCQ A;  1PKS A;  4K11 A;  2RF0 A;  2JW4 A;  2CH4 A;  4JJD A;  4RTV A;  1ZLM A;  2M0Y A;  4AFS C;  1AWO A;  1QKX A;  4QT7 A;  1NM7 A;  4LN2 A;  2HEQ A;  1PHT A;  4LE9 A;  3R6N A;  2RPN A;  1HSQ A;  1GCQ C;  1UEC A;  1ABO A;  2ESW A;  1BBZ A;  3PVQ A;  1SEM A;  3M0R A;  4HCK A;  2KYM A;  2M51 A;  2ROL A;  1H3H A;  1OV3 A;  1JXO A;  2JM8 A;  2YUN A;  2KBT A;  1ZUU A;  1J3T A;  1FMK A;  1M27 C;  2DL3 A;  2F2W A;  1GBQ A;  2J05 A;  3EG1 A;  4RTZ A;  5IXB A;  1JQQ A;  2JMA A;  2JT4 A;  2O31 A;  3VS1 A;  3PVL A;  2A37 A;  3UAT A;  1X43 A;  3UA7 A;  4A63 B;  4J9C A;  2KGT A;  1TUD A;  1KSW A;  3I5R A;  1UFF A;  2VVK A;  1U06 A;  2FPD A;  4R0K A;  3ZL7 C;  2DF6 A;  3H41 A;  2FG0 A;  5FWC A;  1H8K A;  1X69 A;  2OJ2 A;  2FPE A;  1AWW A;  2CH4 W;  1LCK A;  2JM9 A;  2AK5 A;  1JO8 A;  3GBQ A;  2RQV A;  4J9D A;  1AEY A;  5IHN A;  2GNC A;  2C0I A;  1K4U S;  3A98 A;  1WYX A;  1NLP C;  1NG2 A;  2D8J A;  2O2O A;  2K2M A;  1WFW A;  1UHF A;  2YUO A;  1OEB A;  2DM1 A;  4F16 A;  1AZG B;  1N5Z A;  2K9G A;  2KNB B;  1SHG A;  2JMC A;  1TUC A;  1AOJ A;  1WXT A; 
#chains in the Genus database with same CATH topology
 3EG0 A;  5GAN e;  3KFV A;  1QCO A;  3QHS A;  4J83 A;  5HKC A;  5GMK j;  2LNV A;  4FT4 A;  2GTJ A;  2RJE A;  2XMF A;  2RHZ A;  5L23 A;  3NTK A;  1ACM B;  3CPW S;  2BZX A;  4E7J A;  1E6G A;  4PNO A;  4RCC A;  3RES A;  4J7F A;  1R0C B;  4DBF A;  2CUB A;  3PTA A;  1VQO T;  1RI0 A;  2VC8 A;  2LVM A;  1VQ9 A;  4HVV A;  2E70 A;  5GMK e;  1YHQ T;  1X27 A;  4FL6 A;  2M0O A;  2KSS A;  2LDM A;  2DA9 A;  2KE9 A;  4M75 A;  1ZA1 B;  4ZN3 A;  1P92 A;  2BZY A;  5LJ5 g;  2H8H A;  4HVW A;  1PC0 A;  1WHL A;  1VQM Q;  4BI8 B;  3JB9 F;  1KQ2 A;  4KRT A;  4OF1 A;  1KC8 R;  1KJW A;  1BI1 A;  2IVW A;  1RLP C;  1FMV A;  2DNU A;  3MP6 A;  2KR3 A;  4E47 A;  3INZ A;  2ZPF B;  1YIJ T;  2X51 A;  1GFD A;  5KYN A;  3CCQ Q;  1C0M A;  5CQY A;  1OUL A;  3SWN C;  2KMT A;  3CEY A;  4KUL A;  2NUZ A;  3CCM A;  2KK4 A;  1H3Z A;  5C0M A;  1NE8 A;  2EQU A;  3CC2 Q;  2E6N A;  3H0F A;  1LPL A;  2DYI A;  2CZ6 B;  2R58 A;  4M77 D;  3VUZ A;  1B07 A;  2G3R A;  4M78 F;  5DLO A;  3VS6 A;  1Q81 R;  4XQ3 A;  3I56 T;  1GFC A;  1MV0 B;  1WXB A;  2RI3 A;  2C0T A;  3OYA A;  3VS0 A;  4R55 A;  3EFR A;  4D8K A;  1BCM A;  4CI0 C;  1UHC A;  4C5G A;  3G71 Q;  2L0A A;  2RQR A;  4ORZ A;  3JCM e;  2ZZD A;  5J26 A;  3DB3 A;  1X2K A;  3CMA T;  4J5Y A;  1KK7 A;  2L3Q A;  1YHQ A;  1U3O A;  1X2Q A;  3M0S A;  2V1R A;  2V8K A;  2X4W A;  4QVD A;  3LH5 A;  4OVA A;  2PNI A;  3C94 A;  2VUB A;  4RTX A;  2PQW A;  1NYG A;  1VQ9 Q;  3S3N A;  4N4H A;  2DRM A;  1AVZ C;  3QDR B;  1NJI R;  2MAM A;  1NPP A;  1YJN A;  4XTW A;  1RAE B;  2P4R A;  4C92 C;  4NOY A;  4D8D A;  4WCI A;  2BE9 B;  3VS4 A;  2DXB A;  2RA2 A;  4GBQ A;  4LDW A;  1YIJ A;  1W70 A;  3GIB A;  3HL8 A;  4M77 B;  2RHY A;  1KC8 C;  2OI3 A;  1BIA A;  1SHF A;  3OYH A;  1ZSG A;  1QVF P;  3EG3 A;  5C6S A;  4XTX A;  1M1K C;  1I1J A;  1VQ7 A;  3CCM Q;  4M7D E;  3HP9 A;  3LGL A;  5IHK A;  4RUG A;  4F7U E;  2XIC A;  1M3B A;  3CME Q;  4IKF A;  3MO8 A;  4QKU A;  1HYO A;  3CPW A;  4YTL A;  1XQH A;  2SEM A;  5GAO l;  2XU8 A;  2JN0 A;  1YI2 Q;  1BB9 A;  2A28 A;  1YBY A;  3SWN A;  4UC4 A;  4IUR A;  4M75 D;  3U23 A;  2YSQ A;  1LJO A;  2GF7 A;  2C0O A;  4NS5 A;  8AT1 B;  3CXC P;  3CMA A;  5M9O A;  1H64 1;  3OMC A;  4FYW B;  4OML A;  4XTV A;  3TCJ A;  3CCU T;  2O9V A;  1WHJ A;  3REA B;  4EPC A;  5KE2 A;  3NGP A;  1W4S A;  2KRS A;  5LJ5 d;  2EYW A;  2JZ2 A;  1TWB A;  4PJO F;  1I5L A;  2EQM A;  4ZTF A;  4IUP A;  3OYC A;  3FEO A;  3OYI A;  3OYL A;  3RDV A;  2M16 A;  1UGR B;  1AHJ B;  4EMK C;  3X25 B;  3MEU A;  2JTE A;  3H6Z A;  4EDU A;  1ZBX A;  4OMO A;  2X4J A;  1VIE A;  2J06 A;  3GP8 A;  3J80 E;  2EGC A;  1YJ9 T;  1WX6 A;  2QGG A;  4PFO A;  2QG9 B;  3JCM P;  1VQ4 A;  4IIM A;  1K8A U;  2HNI A;  5LJ3 f;  2HAX A;  5I21 A;  1M1K U;  2I2L A;  2PVG B;  1YJN Q;  2BTT A;  3OBW A;  2AZS A;  2JJ9 A;  2NUT A;  3MKD A;  2ATC B;  4EMG A;  4LDX A;  2EYX A;  5DY9 A;  1YNZ A;  2A3L A;  3BDU A;  1YN8 A;  3CCS T;  2LNH B;  2DBM A;  2COW A;  2OTL T;  1UB4 A;  2SRC A;  2KT8 A;  2X3X D;  2LX9 A;  3JCM J;  5GAN h;  3JCM b;  3FJP A;  3JB9 H;  3G1J A;  2HQE A;  4XU2 A;  1YJW T;  1A0N B;  1R77 A;  1HXD A;  3UA6 A;  1WQW A;  4OMQ A;  4E7K A;  2OTJ T;  2ZPE B;  4RTU A;  1QLY A;  2FRY A;  4M75 B;  5FWB A;  1FX7 A;  2L8D A;  4DBQ A;  3HHT B;  3M0Q A;  1VQ7 Q;  1I07 A;  5GMK h;  1G8X A;  3L2V A;  2DVJ A;  1JEG A;  1I81 A;  2YUQ A;  2FPF A;  5KYW A;  2K3Y A;  1NEB A;  1AZE A;  2K57 A;  3CCR Q;  1TUG B;  4Z89 A;  4MZT A;  1VQ5 T;  3NHN A;  2CSQ A;  1IGU A;  2DD5 A;  2LC4 A;  3QZ9 B;  5GMK m;  1YJ9 A;  2JXB A;  3KXT A;  2JS0 A;  2RJD A;  1W2B P;  2AT1 B;  2DE0 X;  3M0T A;  3CC7 A;  3EG9 A;  1E7O A;  1BK2 A;  2GTO A;  2F2X A;  2RHX A;  3QJY A;  3MEW A;  1VQ4 Q;  3HTR A;  1K73 R;  1MMN A;  3CCS A;  2P0K A;  2DTI A;  1FYN A;  2J7I A;  3QKJ A;  5CAI A;  1QCN A;  3RIR A;  1U8R A;  1VQ6 A;  2K3X A;  1WHM A;  2DRK A;  1I5O B;  3URG A;  3CCL A;  3QWX X;  2BIV A;  2OTJ A;  1TH7 A;  4KGV B;  1VQP A;  5CR2 A;  2JW4 A;  3JCM h;  2JUF A;  2AIR B;  4RTV A;  1ZLM A;  4AFS C;  2LRQ A;  4M7A D;  1VQL T;  2XI9 A;  4LN2 A;  1Q86 R;  4LE9 A;  1EIF A;  1HSQ A;  2VYT A;  3M5A A;  1SEM A;  5GAN 4;  3V7S A;  2MWO A;  4BAC A;  2ROL A;  2Y4X A;  4PJO C;  2JM8 A;  2YUN A;  2HQX A;  2KBT A;  2X35 A;  2NLU A;  3EG1 A;  4RTZ A;  2JMA A;  2O31 A;  3V7R A;  1X43 A;  1VOM A;  2RD1 A;  1VQ5 A;  3JB9 I;  3HRS A;  1TUD A;  1KSW A;  3MHX A;  1JJ2 A;  4M77 G;  3EFO A;  2QDY B;  4R0K A;  3QYH B;  3ZL7 C;  3H41 A;  1H8K A;  1X69 A;  4O5V A;  1AWW A;  1S72 Q;  3OYF A;  5I2S A;  2CP7 A;  4J9D A;  4DOW A;  2KY9 A;  5LJ3 j;  4HKE A;  2GNC A;  1K4U S;  2DPP B;  3M4Y A;  4HA8 A;  5IAY A;  4BI3 A;  3CC7 Q;  3I55 A;  2HBP A;  3H8Z A;  1JRI A;  1N5Z A;  1G5V A;  4PFZ A;  2YWW A;  1BI0 A;  1QP2 A;  1VQM T;  5LJ3 e;  2HD0 A;  3E2U A;  2GFU A;  1RAD B;  2A0F B;  5IXF A;  2CP5 A;  4M7A B;  1KIK A;  4B9W A;  1WDX A;  3EHQ A;  3A5Z B;  2D1X A;  2FO0 A;  1VQ6 Q;  3CCQ T;  4LUE A;  3TQ7 P;  1VQL A;  5GAM g;  3CCL Q;  3HSB A;  4RG2 A;  4Y91 A;  3CC2 T;  2K6D A;  1M8M A;  3S6W A;  1D1B A;  4KUD K;  2PVD B;  2FB7 A;  2RJC A;  5KCH A;  2AZV A;  4KGZ B;  2AKK A;  2FEI A;  3RUX A;  4M4Z A;  1Q86 C;  1M5Q 1;  3BDL A;  5GAN 6;  1QWE A;  3GNG A;  5GAO m;  3OYJ A;  3M0U A;  5GAN 3;  1ZUY A;  5I11 A;  2ZPH B;  2WSE E;  1KQS P;  2BUD A;  4M75 C;  2RQU A;  2M1H A;  3JRZ A;  4KBM B;  2FL7 A;  1NBE B;  4ELZ C;  1MNE A;  7AT1 B;  4XU3 A;  1WGS A;  2B8A A;  2DEQ A;  4M77 A;  3RER A;  1V76 A;  3UPU A;  3DKM A;  3EFS A;  2QQA A;  4QW2 A;  1M1G A;  5I22 A;  1M30 A;  5LJ5 f;  2DD4 A;  1MV3 A;  1VQ9 T;  4M75 G;  5HY6 A;  1TG0 A;  2Z0W A;  3M59 A;  1EFN A;  2P84 A;  2YRV A;  3QDF A;  4XU0 A;  1WZO A;  3NFC A;  3O8V A;  4BE1 A;  2RJF A;  4IUU A;  1WNL A;  2DZC A;  4AFZ C;  3JB9 D;  1SKU B;  5KYW B;  1D1C A;  4M7D G;  2IG0 A;  4M78 E;  3CC4 A;  1ZSZ A;  3KBG A;  3OYM A;  1H92 A;  2Y4Y A;  2CSI A;  3I55 Q;  3LGF A;  3X28 B;  1WXU A;  1D09 B;  1LNX A;  2X3W D;  5FRN A;  4MMK A;  2QEX A;  1KFZ A;  3JB9 J;  3M56 A;  1PD1 A;  3EGD B;  2OX7 A;  1OYX A;  1RAF B;  1RUW A;  1M8V A;  5FW9 A;  3DB4 A;  3EGU A;  2CZ7 B;  2E5K A;  1WI7 A;  1Q82 C;  3TSW A;  5KH6 A;  1M3C A;  4MZP A;  4C8Q D;  3AHU A;  1RAC B;  2QQ9 A;  2KVQ G;  4RTW A;  2DMO A;  4C92 F;  1FXX A;  3EG9 B;  2DEU A;  4BI4 A;  2KI7 A;  1SPK A;  4ELY C;  1SG5 A;  2KXD A;  3REB B;  3CCM T;  3OW2 P;  2EYZ A;  1W6X A;  4L59 A;  1PCX A;  3CME T;  3DLM A;  1X6G A;  3S3O A;  3G7Z A;  5KE3 A;  3JAM E;  1M4Z A;  1OQK A;  2FVU A;  2YUP A;  2QAZ A;  4XTY A;  1OU9 A;  1YI2 T;  2W10 A;  2EGA A;  3V8K A;  3A8L B;  3G71 A;  1SRL A;  1NPR A;  4HXJ A;  1S1N A;  4CC2 A;  4DEX A;  2HMA A;  2JVV A;  4ATO A;  3QO3 A;  2DX1 A;  3BE3 A;  2NWM A;  1IB8 A;  2CZ1 B;  4OMM A;  3OYG A;  4JJB A;  3M58 A;  2JTF A;  1GBR A;  2L2P A;  3CCV A;  5GMK l;  4FW2 A;  2CZ0 B;  4IUQ A;  1QVF A;  4HT8 A;  4PJM A;  1IRE B;  1VYU A;  1M3A A;  4B6M A;  1Q82 U;  4J6X A;  3TRE A;  2L5Q A;  1BCO A;  1UGP B;  2EKH A;  3JCM g;  2XID A;  2KYB A;  4C8Q B;  2CUD A;  2HCK A;  4ME7 A;  2DIQ A;  1YJN T;  3FC3 A;  5GAM d;  1WJR A;  2J6O A;  4M7D A;  3T9N A;  3CC4 Q;  1DJ7 B;  1VA7 A;  3ASK A;  3EFO B;  4J9B A;  3CXC A;  1K8A R;  2EWN A;  2QEX Q;  1MMD A;  1M1K R;  2EJ9 A;  1Q7Y C;  4Q5W A;  3PGG A;  2RK1 A;  3WVD B;  2MMP A;  1MMA A;  3CME A;  4PJO E;  2LT4 A;  2VV5 A;  4Y92 A;  2CKK A;  2IIM A;  4J9F A;  1YI2 A;  1VQ7 T;  1PSF A;  3OS0 A;  4NL2 A;  1ZA2 B;  4PJN A;  1VQN Q;  2LJ3 A;  1AWJ A;  2QYZ A;  2FRW A;  1OI1 A;  3G4S A;  1YCS B;  2XDP A;  2D8H A;  2L3S A;  4KUI A;  2DL8 A;  4C0D C;  2RNA A;  4KT0 E;  3SB2 A;  1U1T A;  4JS5 A;  2M9U A;  5GAO r;  4M7A G;  3X26 B;  3CCR T;  3I9Q A;  5LJ3 h;  1YP5 A;  5LJ5 j;  5CCA A;  5I2M A;  2RQW A;  2EPD A;  4JJC A;  1KHC A;  3CCV Q;  2K5I A;  1O75 A;  2K79 A;  1Q7Y U;  1TTH B;  5LJ5 e;  5A2Q E;  1U1S A;  2BZ8 A;  5CVI A;  1QKW A;  1VQ4 T;  4JRK A;  1G2B A;  2A08 A;  3MEV A;  2E65 A;  3VYH B;  3VV0 A;  2EQJ A;  2LCC A;  2YHT A;  3MEA A;  3THK A;  4AG1 C;  1PM3 A;  3KUF A;  2MCN A;  3IQL A;  2XDB A;  5IT9 E;  4J8O A;  5D6X A;  2ABL A;  4X34 A;  3CCE A;  3HFO A;  2E10 A;  2F5K A;  1VIF A;  3LWI A;  1K8A C;  4X1V A;  3ZEH A;  1Y07 A;  3I5S A;  4LNP A;  2P4T A;  3JCM c;  1ZSZ B;  1W2B A;  4BY6 B;  2J6F A;  1BYM A;  1QWF A;  1RL2 A;  4OGC A;  2ZCF B;  4DOV A;  4A4K A;  1WIE A;  2WSF E;  2KEA A;  3HPW A;  3JCM Q;  1AD5 A;  3A8M B;  2VKN A;  2HL5 C;  2E41 A;  3CCR A;  1UJY A;  3E1S A;  1D1A A;  3G4S Q;  2EYY A;  4ESR A;  1K9A A;  2CP2 A;  3LWH A;  1D0Y A;  1IHW A;  4M7D D;  2R5M A;  1QCF A;  4QQD A;  3VS3 A;  2O88 A;  4M77 F;  3JCM d;  2R5A A;  3FJ5 A;  4M7A A;  2ZGW A;  3RKX A;  1M2V B;  2COY A;  1E6H A;  1GCQ A;  1PKS A;  8ATC B;  2RF0 A;  3BY7 A;  5D6W A;  2M0Y A;  1AWO A;  1HK9 A;  4QT7 A;  1NM7 A;  2HEQ A;  1JJ2 S;  1QQJ A;  2CP6 A;  2NYS A;  1UEC A;  3CC7 T;  3OYD A;  5EG2 A;  3M0R A;  4C5E A;  1M2O A;  3VJP A;  1H3H A;  1WHH A;  1BI3 A;  3EH1 A;  2DVE A;  1UEB A;  3SD4 A;  2DL3 A;  4CRI A;  2F2W A;  5CKD A;  3OW2 S;  2HL3 A;  4L5G A;  2JT4 A;  3PVL A;  1VQ6 T;  1TOV A;  3LX7 A;  4J9C A;  4X9C A;  1UGS B;  3OB9 A;  3RKY A;  3JCM X;  1U06 A;  2FPD A;  1VQK A;  3CCL T;  3JB9 G;  4A4F A;  2FG0 A;  4C8Q C;  2F69 A;  3BW1 A;  3V8J A;  3CCE Q;  2YLB A;  1VQP T;  2CH4 W;  3JCM W;  4BD3 A;  5IHN A;  4EMH A;  4M7D B;  2O4X B;  4Z02 A;  4F7U B;  1C6V X;  1WYX A;  1KQ1 A;  1B34 A;  2D6F A;  4C8Q G;  4LDV A;  2O2O A;  4F16 A;  3C95 A;  3L2U A;  3C4S A;  1X6O A;  1N27 A;  4DQ2 A;  2KNB B;  1SHG A;  4N4G A;  4M78 G;  1TUC A;  1WXT A;  1T3S A;  2EKO A;  3O5Z A;  1D0Z A;  1S72 A;  1AT1 B;  1NYF A;  2KRM A;  3VRZ A;  1UTI A;  3EGD A;  3OYY A;  1PRL C;  3AT1 B;  3V7C A;  5D7U A;  2QXF A;  2MYS A;  2RHU A;  3JSC A;  2PUO B;  4M75 F;  3P8H A;  2CGH A;  1T3L A;  3OS1 A;  1M90 U;  1PSE A;  1XOV A;  1TSF A;  3HFN A;  2CP3 A;  2YLC A;  3EGX B;  3PNW C;  2LQW A;  4BDZ A;  1D3B A;  4Z8A A;  3I55 T;  4MZM A;  3VYG A;  1CKB A;  4HVU A;  3VKI A;  2E12 A;  2DYB A;  5GAM f;  2MPX C;  1KQS A;  2GQV A;  4OMP A;  4BDY A;  3FRN A;  4ZTJ A;  2X9H A;  2XK0 A;  3MET A;  4C0F A;  2F2V A;  4XTZ A;  2VGN A;  3QYG B;  2OAW A;  1R8O B;  2HQH A;  4OB2 B;  2QA4 Q;  3M53 A;  2XDD A;  2H3J A;  4EIK A;  1VQK Q;  2DL5 A;  1G83 A;  1TU0 B;  2P0Q A;  4M77 C;  3L1A A;  4HT9 A;  2MOX A;  1YFN A;  4FYV B;  1JU5 C;  1K76 A;  4X9D A;  5LJ5 h;  1PG5 B;  2D0Q B;  2GFA A;  2A36 A;  3RBB B;  2QDL A;  1O9S A;  3CQT A;  4C8Q A;  4E6R A;  2QQB A;  2EJG A;  2X4X A;  2DTH A;  1PNJ A;  2DXT A;  3UF4 A;  3ER0 A;  2LJ1 A;  4N0A A;  1ZSZ C;  3R6O A;  4M78 A;  3QSU A;  1QVG P;  4BY6 C;  2LX7 A;  1Z9Z A;  1ABQ A;  2LMJ A;  2HBW A;  3L2Q A;  2CT3 A;  1XNI A;  4C92 E;  4MML A;  1G3Y A;  4ZGE B;  3OW2 A;  1GCP A;  4DBH A;  9ATC B;  2EVR A;  1FMW A;  1Z9Q A;  3F70 A;  2YT6 A;  1WPY A;  1YIT Q;  1UJ0 A;  2V8J A;  1QVF S;  1VYV A;  2E6Z A;  3OYE A;  2L89 A;  1Q82 R;  3A8H B;  2ZPI B;  3CC4 T;  1BIB A;  1MND A;  2JTM A;  3SEM A;  2Y90 A;  1C1A A;  4C92 D;  2QEX T;  1UDL A;  1IHV A;  2B86 A;  1X75 C;  5GAN 8;  1KG1 A;  2CT4 A;  4P5N A;  2MI6 A;  3CXC S;  1GRI A;  5FRM A;  5HCK A;  2HZY A;  2MK5 A;  1ZUK A;  5CO7 A;  5KCO A;  2DXU A;  1VQN T;  2RHI A;  1SRM A;  1WQ7 A;  2DL7 A;  4KGX B;  2IPO B;  2V1Q A;  4AFU C;  3MCA B;  3EH2 A;  3NTH A;  3G71 T;  1N8R U;  3CD6 A;  3VUB A;  2PTK A;  2MIO A;  4M7A F;  4J7I A;  5EC7 A;  1V29 B;  2DKG A;  1I4K 1;  1EZZ B;  5CQX A;  4M7D C;  1ZHI A;  4F14 A;  2FZK B;  2XHC A;  4LDY A;  1MGQ A;  3JCM f;  3CCV T;  3VU3 C;  5GAN g;  1XTD A;  1OZ2 A;  4E7I A;  3GPL A;  2AHJ B;  4PJL A;  1B34 B;  1VYT A;  1OX9 A;  1K9M U;  3NPF A;  1Y0M A;  3MP1 A;  4GLM A;  1Y71 A;  4C0G A;  1ARK A;  4OB3 B;  2DLP A;  3OSV A;  5GAM j;  3N5B B;  4F7U G;  5KYX A;  2GBQ A;  4PL6 A;  4A54 A;  1RAG B;  1N9R A;  2LP5 A;  2CS7 A;  3QG1 A;  1Q7Y R;  3OSS C;  3VS7 A;  4E7H A;  3VRY A;  2HDA A;  3G6E A;  1YWP A;  4PJJ A;  4JJN K;  2PU9 B;  5GAM e;  4FCY A;  3HRT A;  3LW5 E;  2RB6 A;  1MUZ A;  2EGE A;  2F1L A;  3S3M A;  3PT9 A;  5FU6 B;  1CKA A;  2CDT A;  4M78 D;  1LVK A;  2J6K A;  1M2V A;  4MDW A;  1VQN A;  3CBO A;  2CRE A;  1D3B B;  4C0Z A;  4KH1 B;  1IO6 A;  2VAS A;  2KQW A;  4RKU E;  1TS9 A;  4II1 A;  3OA6 A;  3Q1J A;  2VXE A;  5J39 A;  2F5T X;  4ZNX A;  4QQ6 A;  4DEY A;  1EX4 A;  2G6F X;  3H0H A;  3QPH A;  1UGQ B;  3G4S T;  4PLL A;  1W2B S;  1G3S A;  2O9S A;  2V8I A;  4ANJ A;  4ZGD B;  3CCJ Q;  1HD3 A;  3CD6 Q;  2KRN A;  2YDL A;  2LQ8 A;  2DAQ A;  2FZC B;  4A4G A;  3CBP A;  1RLQ C;  3LLR A;  4FYY B;  2KXC A;  1IRX A;  1V1C A;  2GQI A;  1NEG A;  3SDZ A;  2LCS A;  1B3Q A;  4DBR A;  3UT1 A;  2DBK A;  3GF5 A;  5A0D A;  5IH2 A;  5IHI A;  4RG8 A;  3QBY A;  2FYK A;  1RAH B;  2D0N A;  4OMN A;  1UG1 A;  2PVO B;  1WLP B;  1RAA B;  1PKT A;  1LOJ A;  4OB1 B;  3C12 A;  3QZ5 B;  2EW3 A;  2O4X A;  4F7U A;  1WJS A;  4M78 B;  2DO3 A;  1Y7X A;  4CC3 A;  1OZ3 A;  1NLO C;  4PFP A;  5LL6 S;  3G6E Q;  5IN1 A;  2E3H A;  1VQ8 A;  2W0Z A;  2LCL A;  4AT1 B;  1YWO A;  4M77 E;  2AKL A;  4OGE A;  4FIB A;  2M02 A;  5CKH A;  5A0L A;  1K1Z A;  3CCE T;  5GJW B;  2QQS A;  2E64 A;  3P8B B;  4K11 A;  3MP8 A;  4HCB A;  2CH4 A;  4LDU A;  2DZ9 A;  4M7A C;  1QKX A;  5GAN 7;  2COZ A;  3R6N A;  1G3W A;  1QVG S;  1GCQ C;  3PVQ A;  4JLI A;  4HCK A;  3HKS A;  4C8Q F;  2A7Y A;  2XG8 D;  2KYM A;  3EGX A;  3A8O B;  1R0B G;  4B9X A;  1JXO A;  2H3E B;  1ZUU A;  2XKO C;  1J3T A;  5GAN d;  4PJO D;  3D7S B;  1M27 C;  5IXB A;  2L3R A;  2KAF A;  2DER A;  1JQQ A;  3FB9 A;  1I8F A;  5GAO p;  2WSC E;  2V26 A;  3UAT A;  3H9N A;  4ZN1 A;  1N9S A;  1UFF A;  2VVK A;  4N4I A;  4FT2 A;  1QVP A;  2DF6 A;  3PMT A;  2CP0 A;  2QTV A;  2OJ2 A;  3E9G A;  1VQO A;  1LCK A;  2EQK A;  1BKB A;  3TU4 K;  2JM9 A;  2AK5 A;  1JO8 A;  4F04 B;  1WHK A;  3GBQ A;  4FYX B;  3M4G A;  2EIF A;  3NTI A;  2DJZ A;  5CK9 A;  2ZAE A;  5AYF A;  3LH0 A;  3OYB A;  5A0G A;  2QQR A;  1NLP C;  1NG2 A;  2D8J A;  4JUV A;  4XU1 A;  1JBM A;  1WFW A;  1UHF A;  3QJ6 A;  2YUO A;  3QII A;  2ZPB B;  1AZG B;  1M90 R;  2K9G A;  2FHD A;  4OP0 A;  3V8L A;  5FLX E;  3HRU A;  1TXQ A;  3L2R A;  3I35 A;  4E7S A;  1WHG A;  1XJW B;  3C0C A;  3EG2 A;  4HCZ A;  4E2F B;  3QXE B;  2RI5 A;  4JS4 A;  3OYN A;  1VQ8 Q;  2QA4 T;  4FU6 A;  4E7L A;  1VQK T;  3J81 E;  3GNF B;  4IUV A;  4J6W A;  1KQS S;  3OQ5 A;  5L8R E;  2QAS A;  4KH0 B;  5KYX B;  2PZ1 A;  4PJO B;  4JPB W;  5GAO n;  4M75 E;  4Y28 E;  2HSP A;  3FDR A;  4C92 G;  4O6J A;  4FM4 B;  5KYY A;  2JOY A;  2EJF A;  2GGR A;  4BE2 A;  4QVC A;  1KD1 R;  2LT1 A;  1PD0 A;  3H0I A;  5FU6 C;  2RH2 A;  3I56 A;  5CKF A;  4C5I A;  4TVR A;  1KHI A;  3A8G B;  4BB7 A;  3SHW A;  2FZG B;  1S72 T;  4J9H A;  1N6A A;  2D9T A;  1Q81 C;  5GAM h;  4AMC A;  4XTU A;  2MWP A;  4JRP A;  2CYZ B;  3E9F A;  5GMK i;  1YIT T;  1VQO Q;  1AWX A;  3RNJ A;  1JXM A;  4JZ4 A;  2K2V A;  2DL4 A;  1W1F A;  1YHQ Q;  1YCY A;  1RAB B;  3P8D A;  2MF2 A;  5J3B A;  1KC8 U;  4QQG A;  2YRC A;  1F1B B;  1SSH A;  4AFQ C;  2O01 E;  2QA4 A;  2K7A A;  1M90 C;  1QVG A;  1Y57 A;  1NJI C;  2HKQ B;  4VUB A;  3VS2 A;  1T0H A;  1M1F A;  3TVT A;  2ROT A;  3X24 B;  4N0A C;  1YIJ Q;  4M78 C;  2LJ0 A;  3RMS A;  1PWT A;  2ED0 A;  1UGV A;  2K4Y A;  4CC7 A;  4QVZ A;  3MJX A;  2ED1 A;  1Q81 U;  3M55 A;  2ZPG B;  4OMF B;  4C92 A;  5HK3 A;  2YRD A;  4FW1 A;  5GAO q;  3DLL A;  4BE0 A;  2BE7 D;  2GCX A;  1T0J A;  4RTT A;  3I56 Q;  1KD1 C;  2OAU A;  3OY9 A;  1PRM C;  3UDC A;  1NZ9 A;  4JRI A;  2DXC A;  1N8R R;  3CCU A;  3ZBD A;  1IGQ A;  2RK2 A;  1YIT A;  1G3T A;  2NUP A;  3CMA Q;  3NMZ C;  3ULR B;  1NJI U;  1Y96 A;  1OOT A;  4J9I A;  3PIP A;  5KYU A;  3OYK A;  1QW1 A;  2RI2 A;  4M7D F;  4ZGJ B;  4L6V 5;  4RTY A;  4A53 A;  4F7U F;  5FRO A;  5FU7 B;  3OS5 A;  2K3B A;  2EBP A;  3QUI A;  1K9M R;  5GAN 5;  1B7T A;  3CPW P;  1ZQ1 A;  4OB0 B;  2LQN A;  1BU1 A;  4M7A E;  5GJV B;  5DLQ E;  5ECA A;  1OPK A;  2ENM A;  1CSK A;  1QP3 A;  3CBM A;  2OTL A;  1K0X A;  4C5H A;  3ZFJ A;  2VGM A;  4EMK A;  5LJ3 g;  1OU8 A;  4XAX B;  1KD1 U;  2YXY A;  4BUG A;  1GXI E;  3QWY A;  1YJW A;  2BKD N;  1HJD A;  1OPL A;  2QTX A;  5DM7 R;  3M0P A;  1UUE A;  3TSZ A;  3EAE A;  3EHR A;  4GLK A;  3GLX A;  3PMI A;  4J9E A;  4Z88 A;  1OX8 A;  2C06 A;  2DTO A;  4RCB A;  3OBY A;  3E19 A;  3L42 A;  1MMG A;  3CCJ T;  1X01 A;  5AT1 B;  2LQK A;  5GAN f;  3CD6 T;  3WXM B;  3PIO A;  1SSF A;  3OMG A;  2X4Y A;  3M9Q A;  4PLI A;  1X6B A;  4FSS A;  2L3P A;  1I0C A;  4JRQ A;  2QI2 A;  3CCU Q;  1K0S A;  2EQI A;  2DK3 A;  1GL5 A;  5KYY B;  1WA7 A;  1SF9 A;  2I0N A;  1N8R C;  2EFI A;  4PJO G;  2HKN A;  4JZ3 A;  1IZ6 A;  1ZX6 A;  3X20 B;  3CPF A;  2KRO A;  4PKC C;  1IXD A;  2VB6 A;  3FIF A;  4V2S A;  3M57 A;  4LXC A;  3JCM V;  5CKE A;  3L2W A;  2EAY A;  3A1P A;  4J6Y A;  1YJ9 Q;  1D0X A;  4GY5 A;  3SWN B;  4IIO A;  2KT1 A;  1JB0 E;  1RI9 A;  2E4H A;  3G6E T;  1K9M C;  2DJQ A;  3MPU B;  4LD9 K;  2DET A;  5CIU A;  3WVE B;  3CCS Q;  3TEE A;  2OTL Q;  4J9G A;  3SFM A;  2RO0 A;  1UE9 A;  1K73 C;  2E5Q A;  2ECZ A;  2VXF A;  2E3I A;  2QK0 A;  4JDS A;  1RAI B;  1ZBJ A;  1U5S A;  1YJW Q;  2DIL A;  3OS2 A;  1MHN A;  2OTJ Q;  2VWF A;  2E1H A;  1Q95 G;  4C0D B;  5CKB A;  1VQP Q;  2RN8 A;  2LZ6 B;  3CCJ A;  3RR6 A;  3RMQ A;  4HCC A;  2NUT B;  4CC4 B;  2JS2 A;  4AG2 C;  4LUD A;  4F17 A;  2RM4 A;  2RMO A;  3UWN A;  2JNG A;  3JV3 A;  2DFU A;  4DA4 A;  4A4E A;  3PE0 A;  2RQT A;  2EYQ A;  2PUK B;  3VS5 A;  5GAN 2;  4R56 A;  4C92 B;  4JJD A;  4WTO B;  1VQ5 Q;  2HSE B;  4PJO A;  4IUT A;  1PHT A;  2RPN A;  2P0P A;  1K73 U;  1BI2 A;  1ABO A;  2ESW A;  4FSX A;  3BFM A;  1BBZ A;  1VUB A;  3J7A F;  1QMC A;  5LJ3 d;  4C8Q E;  2M51 A;  2QGF B;  1OV3 A;  4PK4 A;  6AT1 B;  5HK0 A;  1VQM A;  1WJQ A;  1FMK A;  2DIG A;  2R57 A;  1GBQ A;  2J05 A;  3M54 A;  1M9S A;  5D6Y A;  2LTO A;  4A4H A;  3VS1 A;  2NUP B;  2A37 A;  2K5F A;  4XK8 E;  3UA7 A;  1VQ8 T;  4A63 B;  1FWZ A;  3ME9 A;  4RMO A;  2KGT A;  1Y96 B;  2KDS A;  2XD0 A;  5FU7 C;  3I5R A;  3CCQ A;  5KYU B;  1JJ2 P;  1Q86 U;  3L2Z A;  3PFS A;  5FWC A;  3RKW A;  4WF2 A;  4NL3 A;  2FPE A;  2K5L A;  3CC2 A;  4MDX A;  2RQV A;  2WAC A;  1AEY A;  4JLG A;  1VQL Q;  2C0I A;  5GAN j;  3A98 A;  4E7Z A;  3LYI A;  4LD6 A;  4D6W A;  2K2M A;  1OEB A;  2DM1 A;  4EMK B;  3FLG A;  2JMC A;  1AOJ A;  3GOX A; 
#chains in the Genus database with same CATH homology
 3EG0 A;  1KIK A;  1T3S A;  3I35 A;  3KFV A;  3O5Z A;  1WDX A;  3C0C A;  3EHQ A;  3EG2 A;  1NYF A;  2KRM A;  3VRZ A;  1UTI A;  2GTJ A;  1PRL C;  2D1X A;  2FO0 A;  2XMF A;  5L23 A;  4LUE A;  2BZX A;  1E6G A;  2PZ1 A;  2CUB A;  4JPB W;  4HVV A;  2HSP A;  1T3L A;  2K6D A;  1M8M A;  1XOV A;  1X27 A;  2LQW A;  2AZV A;  2GGR A;  2DA9 A;  2AKK A;  2FEI A;  4Z8A A;  4M4Z A;  2KE9 A;  1CKB A;  3H0I A;  1QWE A;  2BZY A;  4HVU A;  2H8H A;  4HVW A;  2DYB A;  3M0U A;  1ZUY A;  5I11 A;  4OMP A;  4KRT A;  3SHW A;  1KJW A;  2F2V A;  1RLP C;  2DNU A;  4J9H A;  2RQU A;  2KR3 A;  2OAW A;  1GFD A;  4EIK A;  5I22 A;  1M30 A;  2DL5 A;  2NUZ A;  1MV3 A;  1TG0 A;  1G83 A;  1AWX A;  3RNJ A;  1EFN A;  1JXM A;  4JZ4 A;  3H0F A;  2DL4 A;  1W1F A;  2MOX A;  1JU5 C;  4AFZ C;  1K76 A;  1B07 A;  3VS6 A;  2A36 A;  1H92 A;  2CSI A;  3RBB B;  2QDL A;  3CQT A;  1WXU A;  1GFC A;  1MV0 B;  1WXB A;  4E6R A;  1SSH A;  2X3W D;  2C0T A;  4AFQ C;  3VS0 A;  1KFZ A;  1PNJ A;  2K7A A;  3UF4 A;  4D8K A;  1UHC A;  2LJ1 A;  1RUW A;  5FW9 A;  1Y57 A;  2LX7 A;  3EGU A;  1Z9Z A;  1ABQ A;  2L0A A;  2LMJ A;  2E5K A;  2HBW A;  1WI7 A;  2RQR A;  4ORZ A;  3TSW A;  3VS2 A;  1M3C A;  1T0H A;  1X2K A;  4RTW A;  3TVT A;  2CT3 A;  2ROT A;  2DMO A;  2L3Q A;  1U3O A;  1X2Q A;  3M0S A;  2LJ0 A;  1SPK A;  2V1R A;  1GCP A;  2KXD A;  1PWT A;  2ED0 A;  1UGV A;  3LH5 A;  2EYZ A;  2PNI A;  3REB B;  4CC7 A;  5IXF A;  1W6X A;  2ED1 A;  4RTX A;  2EVR A;  1Z9Q A;  2YT6 A;  1NYG A;  1X6G A;  2DRM A;  1AVZ C;  1UJ0 A;  2YUP A;  1VYV A;  2W10 A;  2EGA A;  1SRL A;  2P4R A;  3SEM A;  1T0J A;  4HXJ A;  4RTT A;  1S1N A;  4CC2 A;  4DEX A;  1UDL A;  1PRM C;  4D8D A;  4WCI A;  3VS4 A;  2DX1 A;  4GBQ A;  2NWM A;  2B86 A;  4OMM A;  1W70 A;  4JJB A;  1GBR A;  2CT4 A;  2L2P A;  2OI3 A;  1SHF A;  1ZSG A;  3NMZ C;  3ULR B;  1GRI A;  3EG3 A;  1OOT A;  4J9I A;  1VYU A;  1M3A A;  1I1J A;  5HCK A;  1ZUK A;  4RTY A;  5IHK A;  4RUG A;  2K3B A;  2EKH A;  1M3B A;  1SRM A;  2KYB A;  2EBP A;  2CUD A;  2DL7 A;  2HCK A;  2V1Q A;  2SEM A;  4AFU C;  1BB9 A;  2J6O A;  2A28 A;  2LQN A;  1VA7 A;  2PTK A;  2MIO A;  4J9B A;  1BU1 A;  3U23 A;  2YSQ A;  5GJV B;  2C0O A;  5ECA A;  5EC7 A;  1OPK A;  2ENM A;  1CSK A;  1K0X A;  4OML A;  4F14 A;  2O9V A;  3REA B;  3NGP A;  2KRS A;  2EYW A;  3QWY A;  4Y92 A;  1HJD A;  1OPL A;  1VYT A;  3NPF A;  2JTE A;  2IIM A;  1Y0M A;  3M0P A;  4GLM A;  1UUE A;  4J9F A;  3TSZ A;  1ARK A;  3EHR A;  4OMO A;  2J06 A;  2DLP A;  4J9E A;  2EGC A;  4Z88 A;  1WX6 A;  2GBQ A;  2LJ3 A;  4IIM A;  1AWJ A;  2LP5 A;  2FRW A;  3VS7 A;  3VRY A;  2BTT A;  1YCS B;  2AZS A;  2HDA A;  2D8H A;  2L3S A;  2DL8 A;  1YWP A;  2EYX A;  2RNA A;  1YNZ A;  1YN8 A;  2LNH B;  3I9Q A;  2DBM A;  1YP5 A;  2SRC A;  1MUZ A;  2KT8 A;  1X6B A;  2EGE A;  2RQW A;  4FSS A;  2EPD A;  2X3X D;  2L3P A;  1I0C A;  1CKA A;  2CDT A;  4JJC A;  1K0S A;  2EQI A;  2J6K A;  1GL5 A;  1WA7 A;  2I0N A;  1A0N B;  2CRE A;  3UA6 A;  4OMQ A;  4JZ3 A;  4RTU A;  1ZX6 A;  2K79 A;  1QLY A;  2FRY A;  1IO6 A;  2KRO A;  5FWB A;  2BZ8 A;  1QKW A;  3M0Q A;  1I07 A;  4ZNX A;  4DEY A;  2G6F X;  3H0H A;  2DVJ A;  1G2B A;  4IIO A;  2A08 A;  1JEG A;  2KT1 A;  1RI9 A;  2O9S A;  2YUQ A;  2FPF A;  3THK A;  1NEB A;  4AG1 C;  1HD3 A;  2DJQ A;  2KRN A;  2YDL A;  1AZE A;  2MCN A;  3IQL A;  1RLQ C;  2ABL A;  2KXC A;  1V1C A;  4Z89 A;  4J9G A;  1UE9 A;  2GQI A;  1NEG A;  2ECZ A;  4X1V A;  2LCS A;  1B3Q A;  3NHN A;  2DBK A;  3I5S A;  2CSQ A;  4LNP A;  5IH2 A;  5IHI A;  1ZBJ A;  1U5S A;  2JXB A;  2DIL A;  2JS0 A;  2J6F A;  2D0N A;  2DE0 X;  2VWF A;  1QWF A;  3M0T A;  1E7O A;  4OMN A;  1UG1 A;  2RN8 A;  1WLP B;  1BK2 A;  2LZ6 B;  1WIE A;  2GTO A;  2F2X A;  1PKT A;  2KEA A;  2EW3 A;  4CC4 B;  2JS2 A;  4AG2 C;  1AD5 A;  4LUD A;  2VKN A;  4F17 A;  2RMO A;  4CC3 A;  3JV3 A;  1NLO C;  1UJY A;  1FYN A;  3PE0 A;  2EYY A;  2J7I A;  4ESR A;  1K9A A;  1QCF A;  2RQT A;  2W0Z A;  3VS3 A;  2O88 A;  2DRK A;  1YWO A;  3FJ5 A;  2AKL A;  3VS5 A;  1K1Z A;  3QWX X;  5GJW B;  1E6H A;  1GCQ A;  1PKS A;  4K11 A;  2RF0 A;  2JW4 A;  2CH4 A;  4JJD A;  4RTV A;  1ZLM A;  2M0Y A;  4AFS C;  1AWO A;  1QKX A;  4QT7 A;  1NM7 A;  4LN2 A;  2HEQ A;  1PHT A;  4LE9 A;  3R6N A;  2RPN A;  1HSQ A;  1GCQ C;  1UEC A;  1ABO A;  2ESW A;  1BBZ A;  3PVQ A;  1SEM A;  3M0R A;  4HCK A;  2KYM A;  2M51 A;  2ROL A;  1H3H A;  1OV3 A;  1JXO A;  2JM8 A;  2YUN A;  2KBT A;  1ZUU A;  1J3T A;  1FMK A;  1M27 C;  2DL3 A;  2F2W A;  1GBQ A;  2J05 A;  3EG1 A;  4RTZ A;  5IXB A;  1JQQ A;  2JMA A;  2JT4 A;  2O31 A;  3VS1 A;  3PVL A;  2A37 A;  3UAT A;  1X43 A;  3UA7 A;  4A63 B;  4J9C A;  2KGT A;  1TUD A;  1KSW A;  3I5R A;  1UFF A;  2VVK A;  1U06 A;  2FPD A;  4R0K A;  3ZL7 C;  2DF6 A;  3H41 A;  2FG0 A;  5FWC A;  1H8K A;  1X69 A;  2OJ2 A;  2FPE A;  1AWW A;  2CH4 W;  1LCK A;  2JM9 A;  2AK5 A;  1JO8 A;  3GBQ A;  2RQV A;  4J9D A;  1AEY A;  5IHN A;  2GNC A;  2C0I A;  1K4U S;  3A98 A;  1WYX A;  1NLP C;  1NG2 A;  2D8J A;  2O2O A;  2K2M A;  1WFW A;  1UHF A;  2YUO A;  1OEB A;  2DM1 A;  4F16 A;  1AZG B;  1N5Z A;  2K9G A;  2KNB B;  1SHG A;  2JMC A;  1TUC A;  1AOJ A;  1WXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...