4JJBA

Crystal structure of the abl-sh3 domain at ph3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Abl-SH3 domain at pH3
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ABL1
total genus 11
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jjbA00
4CC4B 3VRZA 4LE9A 4OMLA 2D8HA 2ECZA 2YUPA 4R0KA 3JV3A 5GJWB 2DLPA 4RTYA 2CUDA 1H3HA 2KT8A 1FYNA 4CC3A 4J9EA 1T3LA 1Y57A 2KEAA 1VYTA 4JPBW 2FPFA 1JXOA 2EYYA 1BU1A 2RQUA 2PNIA 1X43A 1JEGA 3QWXX 3R6NA 2LQWA 5FWCA 4J9FA 5L23A 1EFNA 1JQQA 1X69A 5FW9A 1WXTA 2RQWA 4AG1C 2J6KA 2CH4W 1UE9A 1ZSGA 1AWJA 1PNJA 1AWWA 2DL7A 1X6GA 2O9SA 3VS5A 4LNPA 1PRLC 1QKXA 3TSZA 1E6HA 2GBQA 1ZUYA 2FEIA 5HCKA 1HD3A 4CC2A 2C0IA 2YUNA 3VS3A 2KRNA 2A28A 1ARKA 1YWOA 1Y0MA 1X2QA 1X2KA 2X3WD 4ORZA 1GFDA 3NMZC 3I35A 2K9GA 5EC7A 1VYUA 4OMMA 1M3CA 3VS0A 1K0XA 2J06A 1JXMA 2KYBA 2E5KA 2EW3A 2RF0A 2K2MA 2DE0X 4J9IA 1ZX6A 2GNCA 3M0QA 1X27A 2HDAA 2ROTA 2EYZA 1GCQC 4ESRA 2AZSA 3ZL7C 3FJ5A 2VWFA 2BZXA 1T3SA 1G2BA 4HVUA 2FRYA 2VVKA 4F16A 1AVZC 1UJYA 2J6FA 2VKNA 2HSPA 2F2XA 2A37A 3M0PA 1WA7A 1BB9A 4AFQC 1NYFA 4CC7A 2BZYA 2DL5A 3NGPA 2AKLA 2DBKA 2L3QA 1AWXA 2KROA 3H0FA 4KRTA 2JMAA 2RQVA 2CT3A 1UHCA 1K76A 1OOTA 4D8DA 2C0OA 2DILA 1A0NB 2LCSA 1B3QA 4K11A 1ZUUA 2F2WA 1U3OA 1YWPA 2A08A 2DMOA 1SHGA 3NHNA 1WDXA 1WXBA 3RNJA 1V1CA 3EGUA 4D8KA 3SHWA 2FRWA 3SEMA 1E7OA 1VYVA 4QT7A 4J9HA 2AK5A 1NM7A 4GLMA 4OMPA 1M27C 2JT4A 3EHRA 2L3PA 4F14A 1MV3A 1J3TA 1ZLMA 4HVWA 2OJ2A 1GBRA 2RMOA 5I11A 2K3BA 1Z9QA 2H8HA 5IHKA 4RTXA 2DYBA 1K1ZA 1MUZA 2YSQA 2KE9A 2ESWA 1K4US 1QKWA 2EQIA 4LN2A 4OMOA 2W10A 3M0UA 3VS2A 1GCPA 1ZUKA 2RNAA 1NEGA 2ED0A 3I9QA 4J9BA 1GCQA 2O9VA 2J05A 1PHTA 1E6GA 2D8JA 2G6FX 1WFWA 2RN8A 2D0NA 1AWOA 2W0ZA 1GFCA 1UECA 4GBQA 1N5ZA 3H0HA 1K0SA 1KSWA 1SPKA 1QWFA 1HJDA 2DF6A 3VS4A 5IHNA 1BK2A 4JZ4A 1PKSA 2HCKA 2B86A 2YDLA 3VS6A 3REAB 3U23A 1W70A 4M4ZA 2AZVA 3TVTA 2DNUA 3UF4A 3QWYA 1HSQA 2LX7A 1UDLA 1NLOC 1YN8A 2YUQA 4AFUC 2YT6A 4HXJA 1Z9ZA 2JS2A 4ZNXA 3UA7A 5IXBA 2RQTA 1SRMA 4RUGA 2FO0A 2KBTA 2OI3A 2O2OA 1QLYA 1NG2A 3O5ZA 2V1QA 2K79A 1S1NA 2L3SA 4HVVA 1PWTA 1T0HA 2JTEA 4LUEA 2KXDA 1RUWA 2DL8A 2J6OA 4RTWA 2V1RA 4RTZA 1JU5C 2J7IA 2GTJA 2PTKA 3ULRB 2LZ6B 2BZ8A 2NWMA 1RI9A 3H41A 2RPNA 1PKTA 2CUBA 3VS7A 1GRIA 2KGTA 5IH2A 1X6BA 5FWBA 2MIOA 4JJBA 1LCKA 1YCSB 2EGEA 1WIEA 1VA7A 1M3BA 2NUZA 3EG2A 3EG3A 1TG0A 1SHFA 1RLPC 2OAWA 1OV3A 1GL5A 1AD5A 1WX6A 1ZBJA 1H8KA 1AZEA 2QDLA 3PE0A 4RTTA 2K7AA 4RTVA 5GJVB 1KFZA 1SEMA 1NYGA 2KR3A 2ENMA 2GQIA 1GBQA 2KRMA 1NEBA 2FPDA 1OPKA 3CQTA 3EG1A 1WI7A 1SSHA 2KXCA 2JMCA 1CKBA 2F2VA 1PRMC 1TUDA 1B07A 2JS0A 3PVLA 2YUOA 2LP5A 2HEQA 1UHFA 2LJ0A 2X3XD 2CSIA 4A63B 2DX1A 2DRMA 2JM8A 1K9AA 4EIKA 4X1VA 2KNBB 5IXFA 2SEMA 1KJWA 2FPEA 2L2PA 1H92A 3EG0A 3REBB 1WLPB 2KYMA 1WXUA 1FMKA 2M0YA 1UTIA 2DVJA 3NPFA 1AOJA 2O31A 2ROLA 1CKAA 4JJDA 4IIMA 1M30A 3TSWA 4IIOA 1UUEA 2MCNA 5I22A 2CDTA 2RQRA 3M0SA 2ED1A 1I07A 2PZ1A 2JXBA 4Z8AA 3IQLA 3LH5A 1OPLA 4J9CA 4RTUA 1UJ0A 2DM1A 4AG2C 1TUCA 4AFZC 2K6DA 1JO8A 2I0NA 1W6XA 2IIMA 1KIKA 2CREA 3M0TA 3KFVA 2JM9A 4AFSC 2DA9A 4JZ3A 1OEBA 2HBWA 1WYXA 1UFFA 2KT1A 2LNHB 3THKA 1CSKA 4OMNA 4HCKA 1U5SA 1UGVA 3C0CA 4DEXA 2CT4A 2LMJA 1YNZA 1SRLA 2D1XA 3H0IA 2DJQA 1AEYA 2GGRA 1I0CA 2DRKA 4OMQA 3EHQA 2EPDA 2DL4A 2M51A 2EKHA 2KRSA 2EGAA 3PVQA 2AKKA 2LQNA 1XOVA 1QCFA 3UA6A 2CH4A 3A98A 1AZGB 4E6RA 2SRCA 2DL3A 1W1FA 2XMFA 1BBZA 2LJ3A 2EVRA 2CSQA 4JJCA 3M0RA 3VS1A 4DEYA 1ABOA 4Y92A 1RLQC 1ABQA 1M8MA 1NLPC 2GTOA 3I5SA 2MOXA 2O88A 4F17A 3I5RA 5IHIA 2BTTA 4Z88A 1IO6A 1I1JA 2DBMA 1QWEA 2EGCA 4LUDA 2A36A 2JW4A 5ECAA 4WCIA 1YP5A 3UATA 4J9GA 4FSSA 1UG1A 2ABLA 1MV0B 4J9DA 2L0AA 2EYWA 3GBQA 2EBPA 3RBBB 4Z89A 2LJ1A 2EYXA 1G83A 1T0JA 2P4RA 2C0TA 1U06A 2FG0A 3VRYA 1M3AA
chains in the Genus database with same CATH superfamily
2V26A 4PJLA 4II1A 4CC4B 4OP0A 4OGCA 1YI2A 4XTWA 4JUVA 2QG9B 2XHCA 3JCMd 1FYNA 4A4EA 3CXCS 3FJPA 1T3LA 1VYTA 2F1LA 1YITQ 2PVOB 2E3HA 5FROA 1X43A 4PLIA 4M75F 3CCLT 2LQWA 5FWCA 3SD4A 2C06A 1JQQA 5FW9A 1SF9A 1VQOT 4BI4A 4PFPA 5LL6S 1JB0E 1AWJA 1PRLC 1QKXA 3VJPA 1E6HA 3BDUA 3CCRQ 2WSFE 4NL2A 2AIRB 1AT1B 3EFOB 3E9FA 4CC2A 2O4XA 3CD6T 3VS3A 2VUBA 1OYXA 5CKFA 2HMAA 1WHJA 1Q82R 3TEEA 1G8XA 5M9OA 3BW1A 1UGQB 4M75C 5LJ5j 2VC8A 1BIAA 1M3CA 1W4SA 2J06A 3FB9A 3KBGA 1B7TA 1PCXA 2RF0A 4JRIA 2RK1A 1RAGB 2AZSA 5LJ5f 4KH1B 4M77D 2BZXA 4E7JA 1YHQQ 2KVQG 1T3SA 1G2BA 2FRYA 1AVZC 2H3EB 5LJ5d 2HSPA 4NOYA 1KHIA 2F2XA 3E2UA 2X35A 2X9HA 2BZYA 5FU6B 3GF5A 1LVKA 1BKBA 4KRTA 1VQ4T 2M9UA 4B9WA 1YI2Q 2VYTA 4LD9K 1UHCA 2X4WA 1N8RC 1D1CA 2IVWA 3QJYA 3JAME 2C0OA 2BKDN 2LCSA 3X24B 1YJWT 1ZUUA 5GAMh 1YWPA 2A08A 2XDBA 3CCRA 1WDXA 1WXBA 5FU7C 1V1CA 3EGUA 4PJOF 3SHWA 3HPWA 4QT7A 2AK5A 2NUTB 2JT4A 2L3PA 1J3TA 4GLKA 1ZLMA 5A0DA 4HVWA 2OJ2A 3CCUT 2RMOA 2K3BA 2H8HA 4OB3B 3CCSA 2R57A 4RTXA 5LJ3e 5DLQE 4EMKA 2ESWA 1QKWA 2L3RA 1Y96B 4OMOA 1JJ2S 2W10A 1X75C 2E3IA 1MNDA 3V7CA 1F1BB 2E4HA 3J81E 1R0BG 6AT1B 5LJ3d 1N5ZA 2YRCA 2D6FA 4ATOA 2XI9A 3H0HA 1QVFA 2FVUA 3VKIA 3L2QA 1QWFA 2DXCA 4XU3A 2K5FA 4BUGA 2COWA 1WHGA 1BK2A 4JZ4A 1PKSA 1PSFA 4F7UG 2YDLA 3U23A 3CPWA 2AZVA 2LC4A 4C0ZA 3CXCA 1YJNA 3QWYA 1HSQA 3S3OA 3L2ZA 2YT6A 3CPFA 4J8OA 3VU3C 3CC4Q 4OF1A 5GANh 3CCMQ 2CZ1B 2RQTA 4XQ3A 1QVGA 4JRQA 3O5ZA 2K79A 3E9GA 3GPLA 3CCET 1S1NA 4HVVA 1VQMT 2JTEA 4LUEA 1K8AR 3MPUB 4RTZA 3MEAA 1JU5C 2J7IA 1VQ5Q 1WNLA 2BZ8A 3X28B 1YJNT 4PK4A 2EJFA 1RI9A 1QCOA 2RPNA 2KI7A 5HK3A 1YITT 1BCMA 3M56A 1C6VX 5CVIA 5IH2A 1WJQA 4R55A 5FWBA 2EQMA 4XTUA 4HKEA 1WIEA 1M3BA 3CCVQ 3L2WA 4DOVA 4M7AB 1RLPC 3EH1A 2OAWA 5DLOA 1H8KA 2QDLA 4J83A 3PE0A 4RTTA 4RTVA 3PIPA 3PNWC 2KR3A 3GOXA 3J7AF 1KQSS 1BCOA 5CQYA 2FPDA 1OPKA 3EG1A 3G6EA 3A8GB 4F7UE 4PJMA 2RJFA 1ZSZA 1CKBA 1WZOA 3M54A 4ZGDB 1QVGS 1M8VA 5AT1B 2F5TX 1PRMC 1VQ6T 1DJ7B 2YUOA 2G3RA 2LP5A 3CBOA 2X3XD 5CAIA 5LJ3f 2CSIA 2F5KA 5EG2A 1JBMA 4X1VA 3RR6A 2CP7A 4LDYA 3CPWS 2VXEA 3OW2P 3SDZA 3DKMA 3V8LA 4MMLA 2WSCE 4A4KA 1NBEB 4QKUA 4V2SA 3EG0A 3REBB 1QVFS 1VQ8Q 5HKCA 5DM7R 9ATCB 2M0YA 3RERA 4M7DG 2DVJA 5KYYB 2RHYA 2E6ZA 3CCQT 3CCSQ 1VQ6Q 1UGSB 5J3BA 4IIOA 1UUEA 1S72A 3OYYA 2PZ1A 2ZCFB 3F70A 2L5QA 3V8KA 4PJOB 2LDMA 3LH5A 4J9CA 4AG2C 3M4YA 2HAXA 2QTXA 5CR2A 4A4GA 3HFOA 2I0NA 2IIMA 3HRUA 4MDXA 4BI8B 4AFSC 3OYLA 2HZYA 3MEVA 1LPLA 3C4SA 2HBWA 5CKDA 4J7FA 4M7AC 3L42A 4OVAA 1UFFA 2KT1A 4JS5A 1KC8U 1WQ7A 3OYNA 1CSKA 2ZPEB 5GAN4 3N5BB 4X9CA 2CT4A 3OB9A 1X01A 3JCMJ 2F69A 3WVEB 2MWPA 1AEYA 2Y4XA 3PTAA 1I0CA 3H9NA 2X4YA 4FYYB 2DVEA 3EHQA 3M53A 5KYXB 2EPDA 1Q81C 1JJ2P 2DEUA 3QO3A 3V7RA 2AKKA 3LGLA 1N9RA 3JCMQ 3CC7Q 2E64A 1XOVA 1BI2A 5FRNA 3ASKA 1AZGB 2PVGB 4E6RA 2CZ7B 4LDUA 1P92A 2BIVA 2DL3A 1RABB 5HK0A 1IGQA 3MO8A 4D6WA 3CMET 3CMAT 4Y92A 4XU1A 2Z0WA 1NLPC 5GAMg 3I5RA 2QYZA 4Z88A 3H6ZA 1IO6A 4YTLA 1M90R 1VQKQ 2YHTA 4PL6A 2FB7A 1YIJQ 2A36A 2JW4A 3UATA 3CPWP 3OW2S 1M90U 1VQPT 4FSSA 3CXCP 3I55T 3AT1B 1H641 2ABLA 4J9DA 4PFZA 4DQ2A 3M59A 2P4RA 1U06A 4O5VA 1NJIR 1UGRB 3JRZA 3VRZA 2ECZA 4HCBA 3EGDB 4OB0B 3I56Q 2K2VA 4RTYA 1UGPB 2CUDA 3KUFA 1EZZB 4M7DE 5KYWA 3JB9D 1QMCA 2EQJA 5KE3A 3M55A 4J9EA 4FM4B 2RI5A 4A4FA 3META 5GAOq 4M78C 5IT9E 1IHWA 2PNIA 4PJOG 3PMTA 2XD0A 4CRIA 1JEGA 3R6NA 3JCMg 3CCLA 4M7DC 1RACB 3KXTA 3OMGA 2ZPBB 3T9NA 4AG1C 5KYUA 3JCMf 5GAN2 3MEWA 4IUUA 1PC0A 2DL7A 2O9SA 4QQDA 3JB9I 3CMEA 1VQ7A 1ZUYA 4BE1A 1M1KR 1HD3A 5LJ5g 3MP6A 5GAOl 1RAAB 2K57A 1QP2A 1I8FA 2XU8A 3QDRB 1RAHB 4ORZA 4EMGA 3UPUA 1K0XA 5GAOp 4F7UA 3HFNA 1B34A 1VQ7T 2EW3A 1K73U 2OTLQ 1NPRA 2DE0X 3CMAQ 1ZX6A 1PG5B 4QW2A 2XK0A 4ESRA 2QGFB 2IPOB 4XAXB 1U1SA 1X6OA 4JRKA 2VXFA 5LJ3h 2LCCA 2Y4YA 1G3TA 4BE0A 2P0KA 2VKNA 3GIBA 1WA7A 4AFQC 1MGQA 2OAUA 1NYFA 4CC7A 3CCUQ 1YFNA 5GANd 2DBKA 5GAMf 2XDDA 2A3LA 5IN1A 2JMAA 2RQVA 1K76A 1OOTA 4RG8A 4E7IA 1Q7YU 1M1GA 2E70A 3A8HB 4QVDA 1B3QA 2GFUA 1U3OA 2DMOA 2AT1B 5GAN6 3L2RA 3CMEQ 1XTDA 3Q1JA 1RAFB 3LWIA 1WHMA 4C8QD 1VYVA 1NM7A 4GLMA 1LOJA 5FLXE 3HL8A 2JN0A 4BI3A 3JB9F 2RHIA 3AHUA 2DYBA 2RA2A 1K1ZA 1MUZA 2YSQA 4IUTA 3EGXA 2KE9A 1VOMA 1TU0B 4C8QB 2EQIA 2RHUA 4LN2A 1MMAA 1JJ2A 3VS2A 4QQ6A 3EFSA 1GCPA 1ZUKA 5KYYA 2RNAA 2P0PA 3CEYA 5FU6C 1IB8A 2A7YA 4XU2A 2J05A 2O9VA 3QKJA 3GP8A 1PHTA 3QYHB 2D8JA 2G6FX 2KSSA 1GFCA 2W0ZA 3BDLA 1VQMQ 3HRSA 4ELYC 1VQ9Q 1OI1A 1HJDA 1R0CB 5IHNA 1VQOA 2HCKA 3OMCA 2EAYA 4C5EA 3G1JA 3TQ7P 4PJOC 2DNUA 1YN8A 2JS2A 1VQ5T 4BB7A 3BE3A 1BI3A 3M5AA 2K5LA 8ATCB 2PQWA 3LX7A 1Q82C 3G7ZA 2HD0A 3URGA 2CKKA 3NTIA 1VQKT 2L3SA 1PWTA 2RJDA 4BE2A 3CCMA 4JDSA 2J6OA 3VUBA 4RCBA 3OYIA 2RJEA 1TSFA 1WPYA 3CCMT 1OX9A 1YJ9T 3OYFA 4HCZA 3L1AA 4PKCC 3CCJA 3MEUA 1LCKA 4JRPA 2DKGA 3RKWA 3NTKA 3DLMA 2EGEA 1VA7A 3RKYA 2NUZA 3EG3A 1YJNQ 4P5NA 1TG0A 4R56A 1EIFA 1FX7A 1OV3A 1WX6A 4KT0E 4RG2A 2R5AA 2LNVA 1KFZA 1KK7A 4N0AA 4M78G 4M75A 1SEMA 1NYGA 2QEXT 1YBYA 1N9SA 1GBQA 2KRMA 1KQ1A 4PNOA 4E7LA 3A8LB 1SSHA 5GMKm 2RHZA 4E7ZA 1TUDA 1B07A 2JS0A 4WF2A 3CCST 1IHVA 4FIBA 1Q95G 5GAN7 2FZCB 4A63B 4HA8A 2CP0A 1K9AA 3M4GA 3OSSC 3CCEA 2QK0A 4M77G 1H3ZA 1Q86C 4LXCA 2SEMA 2KDSA 3CCLQ 1NE8A 3EG9B 2L2PA 1H92A 4FYXB 3QZ5B 4NS5A 1D1AA 3JCMh 2MAMA 2MMPA 1WXUA 4ZGEB 3CD6A 4FW2A 1FMKA 5CO7A 4FT4A 2ZPGB 4DOWA 2KK4A 3NPFA 4A53A 1AOJA 3DB4A 2IG0A 1VIEA 4C8QF 5I2MA 3CCEQ 3RUXA 1YIJT 1D09B 2VV5A 2GQVA 3OYEA 1KQ2A 3OA6A 2JJ9A 1OPLA 2P4TA 2DTIA 1JO8A 1W6XA 3JCMW 1KIKA 1KC8C 4M7DB 2CREA 4X9DA 2DXUA 2V8IA 1BYMA 3OYMA 1FMWA 3WVDB 3CCJQ 3I56T 4KUDK 3C12A 2NUPA 4FW1A 1Y7XA 4HCKA 4X34A 3C0CA 3G6ET 2GF7A 2LMJA 2I2LA 2MPXC 1YNZA 2CP3A 2VGMA 1SRLA 2D1XA 3CBMA 5GANg 2DJQA 2YWWA 2GGRA 4B9XA 4PJJA 2YRDA 2DRKA 4OMQA 2QA4T 1BIBA 4HT8A 1VQ6A 2CS7A 2DL4A 1Q81R 1G3YA 2KRSA 2EGAA 3ZEHA 3P8DA 1JRIA 1XJWB 2ATCB 1WHLA 3UA6A 1WHHA 3M57A 2FHDA 1R77A 3V7SA 2MWOA 3DB3A 3CC2Q 2ZZDA 2XMFA 3A5ZB 4M75E 1VQPA 2CSQA 4JJCA 2NUTA 3M0RA 7AT1B 3VS1A 3SFMA 4MDWA 2K3XA 2GTOA 3RMQA 2MOXA 1WJRA 2E1HA 1M2VA 2O88A 4F17A 4FL6A 2QEXA 5GAN8 2OX7A 5IHIA 5KH6A 3G4SQ 3MP8A 2R58A 2QAZA 2X4JA 1QWEA 2EGCA 4M7DF 4C92D 1WGSA 4WCIA 4XK8E 4J9GA 4XTZA 2P84A 4RKUE 4F7UF 3OYBA 1UG1A 2L0AA 3GBQA 3RBBB 2RD1A 2O01E 3S3MA 4M7AA 1T0JA 1TTHB 2C0TA 2RI3A 4C92B 2FG0A 1RADB 1HK9A 3QIIA 4LE9A 2HQXA 4OMLA 2D8HA 2YUPA 4ZN1A 3G71A 1U1TA 3JV3A 2LQKA 5GJWB 3HKSA 3S3NA 2RO0A 1H3HA 3EGXB 4CC3A 3VV0A 4C8QA 3M9QA 1Y57A 4FCYA 4JPBW 1PM3A 2FPFA 1MMDA 1JXOA 1BU1A 2QTVA 1YJ9Q 3JB9H 4J9FA 5J39A 5LJ3j 1EFNA 2LT1A 1QVFP 1WXTA 2RQWA 2J6KA 2CH4W 3FIFA 1AWWA 1PNJA 1XQHA 3VS5A 3TSZA 4FSXA 2FEIA 3QDFA 2XICA 1RI0A 5HCKA 3JCMc 3BY7A 2DERA 3CMAA 2P0QA 4AT1B 3S6WA 2YUNA 3QSUA 4L59A 3VYHB 1QVGP 1YWOA 1Y0MA 5GMKj 1GFDA 3NMZC 3I35A 3E1SA 1D3BA 1NPPA 4RCCA 2WACA 1VYUA 3H8ZA 4OMMA 5FRMA 4J6YA 1KQSP 2KYBA 4M77C 4JS4A 3CC4T 2GNCA 1TOVA 4QQGA 2ROTA 1ZSZB 2EYZA 1GCQC 4ZGJB 3FJ5A 3CCQA 2VWFA 2VVKA 1C0MA 1FXXA 1S72T 4MZMA 3M0PA 2ZPHB 4M75G 1BB9A 1I4K1 3QJ6A 1D0XA 2DL5A 3CC4A 2AKLA 2RB6A 3H0FA 1V29B 2YRVA 4DBQA 2EQKA 3BFMA 2L8DA 3PGGA 2RI2A 3HSBA 3UT1A 2K5IA 4K11A 1OU8A 1D0ZA 1G5VA 2EYQA 1M9SA 3RNJA 2DTOA 4J7IA 1VQ9T 2OTLA 2FRWA 3OQ5A 1E7OA 4J9HA 4PJOA 1FMVA 1M27C 3OW2A 2A0FB 4F14A 3G4SA 1M4ZA 3VUZA 1QCNA 3CBPA 5GAOr 1GBRA 1VQ4Q 5I11A 5IHKA 2MF2A 4DA4A 3X25B 1BI1A 2V8KA 1K4US 2QQRA 4OGEA 2LX9A 2QEXQ 1HXDA 2M0OA 1VQPQ 2DAQA 4C92E 2RJCA 2HNIA 4J9BA 5LJ5h 1QQJA 2DPPB 1E6GA 3OYHA 2RN8A 1AWOA 3G4ST 3RDVA 1VQ5A 1VQ7Q 4A4HA 1VQ8T 1SPKA 5L8RE 3OBWA 4JJNK 3VS4A 1ZSZC 4BDZA 4RMOA 4PJOE 4LD6A 5GAN3 1W70A 2ZGWA 5D6XA 4C5HA 1Q81U 3EFOA 1MNEA 1NLOC 3CC7A 4DBRA 4AFUC 5I2SA 2O4XB 4M7DD 4GY5A 3UA7A 3CC7T 4RUGA 1SRMA 2O2OA 1QLYA 1NG2A 5C6SA 3RKXA 3QYGB 2KXDA 1RUWA 2DL8A 4RTWA 2GTJA 2PTKA 3ULRB 3MCAB 2NWMA 2XIDA 1OZ3A 3H41A 3FDRA 1PKTA 3X26B 3VS7A 1GRIA 2DD5A 2QXFA 4C5IA 1X6BA 2V8JA 2PUOB 1IGUA 5CKEA 2MIOA 2DZ9A 1GXIE 3GNGA 4M77E 2XG8D 2K4YA 4QVZA 4ZTFA 3EG2A 1FWZA 1SHFA 3JSCA 3PT9A 3JCMP 3EFRA 1GL5A 4TVRA 1AD5A 1ZBJA 2K7AA 4E2FB 3GLXA 2ENMA 1N6AA 5GANe 2HQHA 1M5Q1 2GQIA 1B34B 4E7KA 1NEBA 3CQTA 1IREB 1V76A 4ZTJA 4UC4A 4L5GA 2JMCA 3PMIA 4EMKC 1VQ8A 3A8OB 3SWNB 4PJOD 2EFIA 2DX1A 2OTLT 2LVMA 4EIKA 3R6OA 3TREA 2PVDB 3A1PA 1VIFA 4XTVA 1IZ6A 1ACMB 5IXFA 2OTJT 2FPEA 4C92C 5KE2A 2DETA 1YJWQ 1W2BP 4ME7A 5GMKi 2AHJB 4EMKB 2QQ9A 2KYMA 1KQSA 4OMFB 2LRQA 4KGZB 1NJIU 3UWNA 5FU7B 2EJ9A 2O31A 2ROLA 1IXDA 1CKAA 2JZ2A 4IIMA 4Q5WA 1M30A 3TSWA 1K8AC 4ELZC 2CDTA 3DLLA 2OTJA 2RQRA 2CZ6B 2ED1A 1I07A 1C1AA 2KMTA 3QPHA 3QZ9B 4RTUA 4F7UB 2E6NA 1TUCA 5LJ5e 2BUDA 2CGHA 1S72Q 2HQEA 3M0TA 5GMKh 1TXQA 3KFVA 1K9MU 2JM9A 2CZ0B 4JZ3A 1W2BS 1K8AU 1OEBA 1LNXA 1WYXA 2DYIA 3I55A 1M90C 2LNHB 2KQWA 3M58A 3HRTA 3QG1A 1PD1A 5KCHA 3OS0A 4OMNA 2QI2A 1U5SA 4DEXA 5GAOm 4QVCA 2RH2A 1UEBA 4XTXA 1D3BB 2E10A 1YI2T 1ZQ1A 1EX4A 2MYSA 2EKHA 2FZKB 2COYA 2QA4A 3FLGA 2LQNA 1IRXA 3E19A 1VQOQ 2CH4A 3NTHA 3A98A 5CKBA 5D7UA 2E12A 2SRCA 1M1KC 1TUGB 1M2OA 4C0GA 1K73R 2EWNA 1Q86R 4XTYA 3OYCA 1BBZA 1NZ9A 3L2VA 2XKOC 4KGVB 4A54A 1Q86U 1ABOA 4N4IA 3EH2A 1M8MA 3JCMe 3I5SA 2DIQA 1N8RU 2LT4A 8AT1B 1WHKA 2DBMA 1I1JA 1K73C 1Y96A 2HBPA 4LUDA 2KAFA 5ECAA 1YP5A 2ZPFB 1YJ9A 3MHXA 3JCMb 1KHCA 1I81A 1MV0B 2QQSA 3FC3A 3CC2T 1Q82U 2LJ1A 1G83A 3X20B 2VGNA 4DBHA 2EKOA 3VRYA 1I5OB 3HHTB 1VUBA 2FL7A 5CIUA 5GAN5 1VQMA 2MK5A 2DD4A 3CCRT 3LYIA 4J5YA 1SKUB 1MMGA 4R0KA 2COZA 4N4HA 2LTOA 2QQAA 2DLPA 3RMSA 3ZFJA 2KT8A 4M78D 5LJ3g 4C0DC 2KEAA 3G6EQ 3P8HA 2KY9A 4C92G 3CCUA 2NYSA 2EYYA 2HL5C 2JTMA 5J26A 2RQUA 1OZ2A 5GAMj 4JLIA 3QWXX 2OTJQ 5GAMe 5L23A 3A8MB 1X69A 2EQUA 3LGFA 4C92F 2QGGA 1UE9A 1ZSGA 4IURA 1KC8R 2H3JA 1X6GA 3CCVA 4LNPA 3NFCA 3L2UA 2GBQA 5D6WA 3C94A 4DBFA 2C0IA 1ZHIA 1RL2A 3ER0A 4MZTA 2KRNA 2A28A 1ARKA 4C0DB 5KCOA 1X2QA 1X2KA 1Y71A 2X3WD 4M7AF 2HSEB 3LW5E 4IUVA 4M75B 2K9GA 5EC7A 2VB6A 1O9SA 1YIJA 4KH0B 3O8VA 3VS0A 1OQKA 1JXMA 2E5KA 3G71T 3SWNC 2K2MA 4J9IA 4FYWB 1VQNQ 3M0QA 1X27A 2HDAA 4BD3A 3ZL7C 4EDUA 4IKFA 3SB2A 4HVUA 4F16A 3GNFB 4MMKA 3CD6Q 1UJYA 5A0LA 2MI6A 2J6FA 4PFOA 2A37A 1RAIB 2BE9B 2DEQA 3I56A 2NUPB 3QBYA 5CCAA 5A2QE 4BDYA 3NGPA 4B6MA 2L3QA 3OS2A 1AWXA 2KROA 3EG9A 5GANf 2CT3A 4M78B 3CC2A 4E47A 4D8DA 1YJWA 3JCMX 2DILA 2EIFA 3C95A 4HT9A 3FEOA 1A0NB 3OBYA 2F2WA 3HTRA 1SHGA 3NHNA 4Y91A 4M77A 4C8QC 4D8KA 3SWNA 1YITA 4Z02A 2VASA 1N8RR 2XDPA 1QVPA 2HKNA 2Y90A 3SEMA 1VQ4A 4WTOB 3CCVT 2CP2A 4OMPA 2QDYB 2GFAA 4VUBA 3EHRA 2PU9B 1MHNA 2DFUA 1MV3A 1N27A 3EGDA 1Z9QA 4M7DA 3OYDA 5DY9A 4MZPA 2M1HA 2RM4A 3MJXA 2CP5A 4LDXA 2RK2A 3OYAA 1BI0A 4OB2B 2PUKB 2X4XA 2YLCA 3M0UA 1LJOA 1NEGA 2ED0A 3I9QA 1GCQA 4FT2A 2NLUA 4BY6B 1WFWA 2D0NA 4OB1B 3PIOA 1UECA 4GBQA 4IUQA 4EPCA 4E7SA 5AYFA 4C92A 1K0SA 2DIGA 1PD0A 1KSWA 2JNGA 4Y28E 5GAMd 1I5LA 3ZBDA 4M78F 1VQLA 2DF6A 1WJSA 4IUPA 5KYXA 2D0QB 1VQLT 2B86A 4JLGA 3VS6A 3QHSA 3REAB 3OYKA 2JVVA 4M4ZA 1HYOA 3TVTA 3UF4A 2LX7A 1UDLA 2YUQA 4HXJA 1Z9ZA 4LDWA 4ZNXA 4FU6A 5IXBA 2FO0A 2KBTA 2OI3A 3QUIA 1ZA1B 5A0GA 2V1QA 3D7SB 2E65A 4KBMB 1T0HA 2V1RA 3OY9A 1M2VB 2LZ6B 1R8OB 2HKQB 4PJNA 5KYUB 3JCMV 2JTFA 3UDCA 5I21A 2CUBA 2KGTA 4LDVA 2E41A 4JJBA 2FZGB 4KGXB 1YCSB 5CKHA 3OYGA 1D0YA 4M78E 4C0FA 2LQ8A 3JB9J 1AHJB 4CI0C 1AZEA 4XU0A 1SG5A 5GJVB 5HY6A 1TWBA 2R5MA 2M16A 1K9MC 5D6YA 4PLLA 1KG1A 4F04B 3ME9A 1G3SA 3RESA 4AMCA 1TS9A 1WI7A 2DXTA 3CCQQ 3I55Q 5C0MA 5KYWB 2RHXA 1Y07A 2KXCA 2YLBA 3INZA 1YHQT 2F2VA 2E5QA 5IAYA 4M7AG 2BE7D 5GMKe 4FYVB 1SSFA 3PVLA 1O75A 2HEQA 3OYJA 1UHFA 2LJ0A 3EAEA 2DRMA 3G71Q 2JM8A 4O6JA 2KNBB 3PFSA 1QP3A 1NJIC 1YCYA 1KJWA 3JB9G 4KULA 3FRNA 2ZPIB 4C8QG 2YXYA 5GANj 1WLPB 2CYZB 2QASA 3TCJA 3CCJT 1UTIA 1G3WA 3HP9A 3VYGA 3LWHA 1VQNA 2X51A 4JJDA 2DTHA 3QXEB 2DZCA 1KD1U 2MCNA 5I22A 4N4GA 3M0SA 1Q7YR 1ZBXA 1KD1R 2JXBA 4L6V5 4Z8AA 3IQLA 1VQ9A 4EMHA 4C8QE 1UJ0A 5CQXA 2DM1A 2QA4Q 1U8RA 4AFZC 2K6DA 5KYNA 1VQNT 3WXMB 4BY6C 4ANJA 4J6WA 3V8JA 2DA9A 1Q7YC 1KD1C 2QQBA 3THKA 4M7AE 4M77F 1UGVA 2DJZA 3OS1A 1UB4A 2FYKA 4M7AD 1M1FA 3H0IA 2L89A 2DXBA 2HL3A 4J6XA 3TU4K 3RIRA 4N0AC 2JUFA 3OSVA 2GCXA 2M51A 2LCLA 3PVQA 1W2BA 2DO3A 4BACA 2D9TA 1QCFA 2DK3A 2EJGA 4KUIA 1ZA2B 3P8BB 2M02A 3MP1A 1W1FA 1TH7A 1VQLQ 1OU9A 2LJ3A 2EVRA 5CK9A 4NL3A 2B8AA 3OS5A 4DEYA 4HCCA 1RLQC 1K9MR 1ABQA 4C5GA 1PSEA 1MMNA 4M75D 5GAOn 1OULA 1D1BA 5GMKl 4E7HA 3MKDA 2BTTA 4M78A 2K3YA 1WQWA 1OX8A 3J80E 3LLRA 1QW1A 1YHQA 2WSEE 2JOYA 2CP6A 2EYWA 1VQKA 2EBPA 1RAEB 4M77B 4Z89A 2EYXA 1M1KU 4ZN3A 1XNIA 3LH0A 2ZAEA 1M3AA
chains in the Genus database with same CATH topology
4CC4B 3VRZA 4LE9A 4OMLA 2D8HA 2ECZA 2YUPA 4R0KA 3JV3A 5GJWB 2DLPA 4RTYA 2CUDA 1H3HA 2KT8A 1FYNA 4CC3A 4J9EA 1T3LA 1Y57A 2KEAA 1VYTA 4JPBW 2FPFA 1JXOA 2EYYA 1BU1A 2RQUA 2PNIA 1X43A 1JEGA 3QWXX 3R6NA 2LQWA 5FWCA 4J9FA 5L23A 1EFNA 1JQQA 1X69A 5FW9A 1WXTA 2RQWA 4AG1C 2J6KA 2CH4W 1UE9A 1ZSGA 1AWJA 1PNJA 1AWWA 2DL7A 1X6GA 2O9SA 3VS5A 4LNPA 1PRLC 1QKXA 3TSZA 1E6HA 2GBQA 1ZUYA 2FEIA 5HCKA 1HD3A 4CC2A 2C0IA 2YUNA 3VS3A 2KRNA 2A28A 1ARKA 1YWOA 1Y0MA 1X2QA 1X2KA 2X3WD 4ORZA 1GFDA 3NMZC 3I35A 2K9GA 5EC7A 1VYUA 4OMMA 1M3CA 3VS0A 1K0XA 2J06A 1JXMA 2KYBA 2E5KA 2EW3A 2RF0A 2K2MA 2DE0X 4J9IA 1ZX6A 2GNCA 3M0QA 1X27A 2HDAA 2ROTA 2EYZA 1GCQC 4ESRA 2AZSA 3ZL7C 3FJ5A 2VWFA 2BZXA 1T3SA 1G2BA 4HVUA 2FRYA 2VVKA 4F16A 1AVZC 1UJYA 2J6FA 2VKNA 2HSPA 2F2XA 2A37A 3M0PA 1WA7A 1BB9A 4AFQC 1NYFA 4CC7A 2BZYA 2DL5A 3NGPA 2AKLA 2DBKA 2L3QA 1AWXA 2KROA 3H0FA 4KRTA 2JMAA 2RQVA 2CT3A 1UHCA 1K76A 1OOTA 4D8DA 2C0OA 2DILA 1A0NB 2LCSA 1B3QA 4K11A 1ZUUA 2F2WA 1U3OA 1YWPA 2A08A 2DMOA 1SHGA 3NHNA 1WDXA 1WXBA 3RNJA 1V1CA 3EGUA 4D8KA 3SHWA 2FRWA 3SEMA 1E7OA 1VYVA 4QT7A 4J9HA 2AK5A 1NM7A 4GLMA 4OMPA 1M27C 2JT4A 3EHRA 2L3PA 4F14A 1MV3A 1J3TA 1ZLMA 4HVWA 2OJ2A 1GBRA 2RMOA 5I11A 2K3BA 1Z9QA 2H8HA 5IHKA 4RTXA 2DYBA 1K1ZA 1MUZA 2YSQA 2KE9A 2ESWA 1K4US 1QKWA 2EQIA 4LN2A 4OMOA 2W10A 3M0UA 3VS2A 1GCPA 1ZUKA 2RNAA 1NEGA 2ED0A 3I9QA 4J9BA 1GCQA 2O9VA 2J05A 1PHTA 1E6GA 2D8JA 2G6FX 1WFWA 2RN8A 2D0NA 1AWOA 2W0ZA 1GFCA 1UECA 4GBQA 1N5ZA 3H0HA 1K0SA 1KSWA 1SPKA 1QWFA 1HJDA 2DF6A 3VS4A 5IHNA 1BK2A 4JZ4A 1PKSA 2HCKA 2B86A 2YDLA 3VS6A 3REAB 3U23A 1W70A 4M4ZA 2AZVA 3TVTA 2DNUA 3UF4A 3QWYA 1HSQA 2LX7A 1UDLA 1NLOC 1YN8A 2YUQA 4AFUC 2YT6A 4HXJA 1Z9ZA 2JS2A 4ZNXA 3UA7A 5IXBA 2RQTA 1SRMA 4RUGA 2FO0A 2KBTA 2OI3A 2O2OA 1QLYA 1NG2A 3O5ZA 2V1QA 2K79A 1S1NA 2L3SA 4HVVA 1PWTA 1T0HA 2JTEA 4LUEA 2KXDA 1RUWA 2DL8A 2J6OA 4RTWA 2V1RA 4RTZA 1JU5C 2J7IA 2GTJA 2PTKA 3ULRB 2LZ6B 2BZ8A 2NWMA 1RI9A 3H41A 2RPNA 1PKTA 2CUBA 3VS7A 1GRIA 2KGTA 5IH2A 1X6BA 5FWBA 2MIOA 4JJBA 1LCKA 1YCSB 2EGEA 1WIEA 1VA7A 1M3BA 2NUZA 3EG2A 3EG3A 1TG0A 1SHFA 1RLPC 2OAWA 1OV3A 1GL5A 1AD5A 1WX6A 1ZBJA 1H8KA 1AZEA 2QDLA 3PE0A 4RTTA 2K7AA 4RTVA 5GJVB 1KFZA 1SEMA 1NYGA 2KR3A 2ENMA 2GQIA 1GBQA 2KRMA 1NEBA 2FPDA 1OPKA 3CQTA 3EG1A 1WI7A 1SSHA 2KXCA 2JMCA 1CKBA 2F2VA 1PRMC 1TUDA 1B07A 2JS0A 3PVLA 2YUOA 2LP5A 2HEQA 1UHFA 2LJ0A 2X3XD 2CSIA 4A63B 2DX1A 2DRMA 2JM8A 1K9AA 4EIKA 4X1VA 2KNBB 5IXFA 2SEMA 1KJWA 2FPEA 2L2PA 1H92A 3EG0A 3REBB 1WLPB 2KYMA 1WXUA 1FMKA 2M0YA 1UTIA 2DVJA 3NPFA 1AOJA 2O31A 2ROLA 1CKAA 4JJDA 4IIMA 1M30A 3TSWA 4IIOA 1UUEA 2MCNA 5I22A 2CDTA 2RQRA 3M0SA 2ED1A 1I07A 2PZ1A 2JXBA 4Z8AA 3IQLA 3LH5A 1OPLA 4J9CA 4RTUA 1UJ0A 2DM1A 4AG2C 1TUCA 4AFZC 2K6DA 1JO8A 2I0NA 1W6XA 2IIMA 1KIKA 2CREA 3M0TA 3KFVA 2JM9A 4AFSC 2DA9A 4JZ3A 1OEBA 2HBWA 1WYXA 1UFFA 2KT1A 2LNHB 3THKA 1CSKA 4OMNA 4HCKA 1U5SA 1UGVA 3C0CA 4DEXA 2CT4A 2LMJA 1YNZA 1SRLA 2D1XA 3H0IA 2DJQA 1AEYA 2GGRA 1I0CA 2DRKA 4OMQA 3EHQA 2EPDA 2DL4A 2M51A 2EKHA 2KRSA 2EGAA 3PVQA 2AKKA 2LQNA 1XOVA 1QCFA 3UA6A 2CH4A 3A98A 1AZGB 4E6RA 2SRCA 2DL3A 1W1FA 2XMFA 1BBZA 2LJ3A 2EVRA 2CSQA 4JJCA 3M0RA 3VS1A 4DEYA 1ABOA 4Y92A 1RLQC 1ABQA 1M8MA 1NLPC 2GTOA 3I5SA 2MOXA 2O88A 4F17A 3I5RA 5IHIA 2BTTA 4Z88A 1IO6A 1I1JA 2DBMA 1QWEA 2EGCA 4LUDA 2A36A 2JW4A 5ECAA 4WCIA 1YP5A 3UATA 4J9GA 4FSSA 1UG1A 2ABLA 1MV0B 4J9DA 2L0AA 2EYWA 3GBQA 2EBPA 3RBBB 4Z89A 2LJ1A 2EYXA 1G83A 1T0JA 2P4RA 2C0TA 1U06A 2FG0A 3VRYA 1M3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CC4 B;  3VRZ A;  4LE9 A;  4OML A;  2D8H A;  2ECZ A;  2YUP A;  4R0K A;  3JV3 A;  5GJW B;  2DLP A;  4RTY A;  2CUD A;  1H3H A;  2KT8 A;  1FYN A;  4CC3 A;  4J9E A;  1T3L A;  1Y57 A;  2KEA A;  1VYT A;  4JPB W;  2FPF A;  1JXO A;  2EYY A;  1BU1 A;  2RQU A;  2PNI A;  1X43 A;  1JEG A;  3QWX X;  3R6N A;  2LQW A;  5FWC A;  4J9F A;  5L23 A;  1EFN A;  1JQQ A;  1X69 A;  5FW9 A;  1WXT A;  2RQW A;  4AG1 C;  2J6K A;  2CH4 W;  1UE9 A;  1ZSG A;  1AWJ A;  1PNJ A;  1AWW A;  2DL7 A;  1X6G A;  2O9S A;  3VS5 A;  4LNP A;  1PRL C;  1QKX A;  3TSZ A;  1E6H A;  2GBQ A;  1ZUY A;  2FEI A;  5HCK A;  1HD3 A;  4CC2 A;  2C0I A;  2YUN A;  3VS3 A;  2KRN A;  2A28 A;  1ARK A;  1YWO A;  1Y0M A;  1X2Q A;  1X2K A;  2X3W D;  4ORZ A;  1GFD A;  3NMZ C;  3I35 A;  2K9G A;  5EC7 A;  1VYU A;  4OMM A;  1M3C A;  3VS0 A;  1K0X A;  2J06 A;  1JXM A;  2KYB A;  2E5K A;  2EW3 A;  2RF0 A;  2K2M A;  2DE0 X;  4J9I A;  1ZX6 A;  2GNC A;  3M0Q A;  1X27 A;  2HDA A;  2ROT A;  2EYZ A;  1GCQ C;  4ESR A;  2AZS A;  3ZL7 C;  3FJ5 A;  2VWF A;  2BZX A;  1T3S A;  1G2B A;  4HVU A;  2FRY A;  2VVK A;  4F16 A;  1AVZ C;  1UJY A;  2J6F A;  2VKN A;  2HSP A;  2F2X A;  2A37 A;  3M0P A;  1WA7 A;  1BB9 A;  4AFQ C;  1NYF A;  4CC7 A;  2BZY A;  2DL5 A;  3NGP A;  2AKL A;  2DBK A;  2L3Q A;  1AWX A;  2KRO A;  3H0F A;  4KRT A;  2JMA A;  2RQV A;  2CT3 A;  1UHC A;  1K76 A;  1OOT A;  4D8D A;  2C0O A;  2DIL A;  1A0N B;  2LCS A;  1B3Q A;  4K11 A;  1ZUU A;  2F2W A;  1U3O A;  1YWP A;  2A08 A;  2DMO A;  1SHG A;  3NHN A;  1WDX A;  1WXB A;  3RNJ A;  1V1C A;  3EGU A;  4D8K A;  3SHW A;  2FRW A;  3SEM A;  1E7O A;  1VYV A;  4QT7 A;  4J9H A;  2AK5 A;  1NM7 A;  4GLM A;  4OMP A;  1M27 C;  2JT4 A;  3EHR A;  2L3P A;  4F14 A;  1MV3 A;  1J3T A;  1ZLM A;  4HVW A;  2OJ2 A;  1GBR A;  2RMO A;  5I11 A;  2K3B A;  1Z9Q A;  2H8H A;  5IHK A;  4RTX A;  2DYB A;  1K1Z A;  1MUZ A;  2YSQ A;  2KE9 A;  2ESW A;  1K4U S;  1QKW A;  2EQI A;  4LN2 A;  4OMO A;  2W10 A;  3M0U A;  3VS2 A;  1GCP A;  1ZUK A;  2RNA A;  1NEG A;  2ED0 A;  3I9Q A;  4J9B A;  1GCQ A;  2O9V A;  2J05 A;  1PHT A;  1E6G A;  2D8J A;  2G6F X;  1WFW A;  2RN8 A;  2D0N A;  1AWO A;  2W0Z A;  1GFC A;  1UEC A;  4GBQ A;  1N5Z A;  3H0H A;  1K0S A;  1KSW A;  1SPK A;  1QWF A;  1HJD A;  2DF6 A;  3VS4 A;  5IHN A;  1BK2 A;  4JZ4 A;  1PKS A;  2HCK A;  2B86 A;  2YDL A;  3VS6 A;  3REA B;  3U23 A;  1W70 A;  4M4Z A;  2AZV A;  3TVT A;  2DNU A;  3UF4 A;  3QWY A;  1HSQ A;  2LX7 A;  1UDL A;  1NLO C;  1YN8 A;  2YUQ A;  4AFU C;  2YT6 A;  4HXJ A;  1Z9Z A;  2JS2 A;  4ZNX A;  3UA7 A;  5IXB A;  2RQT A;  1SRM A;  4RUG A;  2FO0 A;  2KBT A;  2OI3 A;  2O2O A;  1QLY A;  1NG2 A;  3O5Z A;  2V1Q A;  2K79 A;  1S1N A;  2L3S A;  4HVV A;  1PWT A;  1T0H A;  2JTE A;  4LUE A;  2KXD A;  1RUW A;  2DL8 A;  2J6O A;  4RTW A;  2V1R A;  4RTZ A;  1JU5 C;  2J7I A;  2GTJ A;  2PTK A;  3ULR B;  2LZ6 B;  2BZ8 A;  2NWM A;  1RI9 A;  3H41 A;  2RPN A;  1PKT A;  2CUB A;  3VS7 A;  1GRI A;  2KGT A;  5IH2 A;  1X6B A;  5FWB A;  2MIO A;  4JJB A;  1LCK A;  1YCS B;  2EGE A;  1WIE A;  1VA7 A;  1M3B A;  2NUZ A;  3EG2 A;  3EG3 A;  1TG0 A;  1SHF A;  1RLP C;  2OAW A;  1OV3 A;  1GL5 A;  1AD5 A;  1WX6 A;  1ZBJ A;  1H8K A;  1AZE A;  2QDL A;  3PE0 A;  4RTT A;  2K7A A;  4RTV A;  5GJV B;  1KFZ A;  1SEM A;  1NYG A;  2KR3 A;  2ENM A;  2GQI A;  1GBQ A;  2KRM A;  1NEB A;  2FPD A;  1OPK A;  3CQT A;  3EG1 A;  1WI7 A;  1SSH A;  2KXC A;  2JMC A;  1CKB A;  2F2V A;  1PRM C;  1TUD A;  1B07 A;  2JS0 A;  3PVL A;  2YUO A;  2LP5 A;  2HEQ A;  1UHF A;  2LJ0 A;  2X3X D;  2CSI A;  4A63 B;  2DX1 A;  2DRM A;  2JM8 A;  1K9A A;  4EIK A;  4X1V A;  2KNB B;  5IXF A;  2SEM A;  1KJW A;  2FPE A;  2L2P A;  1H92 A;  3EG0 A;  3REB B;  1WLP B;  2KYM A;  1WXU A;  1FMK A;  2M0Y A;  1UTI A;  2DVJ A;  3NPF A;  1AOJ A;  2O31 A;  2ROL A;  1CKA A;  4JJD A;  4IIM A;  1M30 A;  3TSW A;  4IIO A;  1UUE A;  2MCN A;  5I22 A;  2CDT A;  2RQR A;  3M0S A;  2ED1 A;  1I07 A;  2PZ1 A;  2JXB A;  4Z8A A;  3IQL A;  3LH5 A;  1OPL A;  4J9C A;  4RTU A;  1UJ0 A;  2DM1 A;  4AG2 C;  1TUC A;  4AFZ C;  2K6D A;  1JO8 A;  2I0N A;  1W6X A;  2IIM A;  1KIK A;  2CRE A;  3M0T A;  3KFV A;  2JM9 A;  4AFS C;  2DA9 A;  4JZ3 A;  1OEB A;  2HBW A;  1WYX A;  1UFF A;  2KT1 A;  2LNH B;  3THK A;  1CSK A;  4OMN A;  4HCK A;  1U5S A;  1UGV A;  3C0C A;  4DEX A;  2CT4 A;  2LMJ A;  1YNZ A;  1SRL A;  2D1X A;  3H0I A;  2DJQ A;  1AEY A;  2GGR A;  1I0C A;  2DRK A;  4OMQ A;  3EHQ A;  2EPD A;  2DL4 A;  2M51 A;  2EKH A;  2KRS A;  2EGA A;  3PVQ A;  2AKK A;  2LQN A;  1XOV A;  1QCF A;  3UA6 A;  2CH4 A;  3A98 A;  1AZG B;  4E6R A;  2SRC A;  2DL3 A;  1W1F A;  2XMF A;  1BBZ A;  2LJ3 A;  2EVR A;  2CSQ A;  4JJC A;  3M0R A;  3VS1 A;  4DEY A;  1ABO A;  4Y92 A;  1RLQ C;  1ABQ A;  1M8M A;  1NLP C;  2GTO A;  3I5S A;  2MOX A;  2O88 A;  4F17 A;  3I5R A;  5IHI A;  2BTT A;  4Z88 A;  1IO6 A;  1I1J A;  2DBM A;  1QWE A;  2EGC A;  4LUD A;  2A36 A;  2JW4 A;  5ECA A;  4WCI A;  1YP5 A;  3UAT A;  4J9G A;  4FSS A;  1UG1 A;  2ABL A;  1MV0 B;  4J9D A;  2L0A A;  2EYW A;  3GBQ A;  2EBP A;  3RBB B;  4Z89 A;  2LJ1 A;  2EYX A;  1G83 A;  1T0J A;  2P4R A;  2C0T A;  1U06 A;  2FG0 A;  3VRY A;  1M3A A; 
#chains in the Genus database with same CATH topology
 2V26 A;  4PJL A;  4II1 A;  4CC4 B;  4OP0 A;  4OGC A;  1YI2 A;  4XTW A;  4JUV A;  2QG9 B;  2XHC A;  3JCM d;  1FYN A;  4A4E A;  3CXC S;  3FJP A;  1T3L A;  1VYT A;  2F1L A;  1YIT Q;  2PVO B;  2E3H A;  5FRO A;  1X43 A;  4PLI A;  4M75 F;  3CCL T;  2LQW A;  5FWC A;  3SD4 A;  2C06 A;  1JQQ A;  5FW9 A;  1SF9 A;  1VQO T;  4BI4 A;  4PFP A;  5LL6 S;  1JB0 E;  1AWJ A;  1PRL C;  1QKX A;  3VJP A;  1E6H A;  3BDU A;  3CCR Q;  2WSF E;  4NL2 A;  2AIR B;  1AT1 B;  3EFO B;  3E9F A;  4CC2 A;  2O4X A;  3CD6 T;  3VS3 A;  2VUB A;  1OYX A;  5CKF A;  2HMA A;  1WHJ A;  1Q82 R;  3TEE A;  1G8X A;  5M9O A;  3BW1 A;  1UGQ B;  4M75 C;  5LJ5 j;  2VC8 A;  1BIA A;  1M3C A;  1W4S A;  2J06 A;  3FB9 A;  3KBG A;  1B7T A;  1PCX A;  2RF0 A;  4JRI A;  2RK1 A;  1RAG B;  2AZS A;  5LJ5 f;  4KH1 B;  4M77 D;  2BZX A;  4E7J A;  1YHQ Q;  2KVQ G;  1T3S A;  1G2B A;  2FRY A;  1AVZ C;  2H3E B;  5LJ5 d;  2HSP A;  4NOY A;  1KHI A;  2F2X A;  3E2U A;  2X35 A;  2X9H A;  2BZY A;  5FU6 B;  3GF5 A;  1LVK A;  1BKB A;  4KRT A;  1VQ4 T;  2M9U A;  4B9W A;  1YI2 Q;  2VYT A;  4LD9 K;  1UHC A;  2X4W A;  1N8R C;  1D1C A;  2IVW A;  3QJY A;  3JAM E;  2C0O A;  2BKD N;  2LCS A;  3X24 B;  1YJW T;  1ZUU A;  5GAM h;  1YWP A;  2A08 A;  2XDB A;  3CCR A;  1WDX A;  1WXB A;  5FU7 C;  1V1C A;  3EGU A;  4PJO F;  3SHW A;  3HPW A;  4QT7 A;  2AK5 A;  2NUT B;  2JT4 A;  2L3P A;  1J3T A;  4GLK A;  1ZLM A;  5A0D A;  4HVW A;  2OJ2 A;  3CCU T;  2RMO A;  2K3B A;  2H8H A;  4OB3 B;  3CCS A;  2R57 A;  4RTX A;  5LJ3 e;  5DLQ E;  4EMK A;  2ESW A;  1QKW A;  2L3R A;  1Y96 B;  4OMO A;  1JJ2 S;  2W10 A;  1X75 C;  2E3I A;  1MND A;  3V7C A;  1F1B B;  2E4H A;  3J81 E;  1R0B G;  6AT1 B;  5LJ3 d;  1N5Z A;  2YRC A;  2D6F A;  4ATO A;  2XI9 A;  3H0H A;  1QVF A;  2FVU A;  3VKI A;  3L2Q A;  1QWF A;  2DXC A;  4XU3 A;  2K5F A;  4BUG A;  2COW A;  1WHG A;  1BK2 A;  4JZ4 A;  1PKS A;  1PSF A;  4F7U G;  2YDL A;  3U23 A;  3CPW A;  2AZV A;  2LC4 A;  4C0Z A;  3CXC A;  1YJN A;  3QWY A;  1HSQ A;  3S3O A;  3L2Z A;  2YT6 A;  3CPF A;  4J8O A;  3VU3 C;  3CC4 Q;  4OF1 A;  5GAN h;  3CCM Q;  2CZ1 B;  2RQT A;  4XQ3 A;  1QVG A;  4JRQ A;  3O5Z A;  2K79 A;  3E9G A;  3GPL A;  3CCE T;  1S1N A;  4HVV A;  1VQM T;  2JTE A;  4LUE A;  1K8A R;  3MPU B;  4RTZ A;  3MEA A;  1JU5 C;  2J7I A;  1VQ5 Q;  1WNL A;  2BZ8 A;  3X28 B;  1YJN T;  4PK4 A;  2EJF A;  1RI9 A;  1QCO A;  2RPN A;  2KI7 A;  5HK3 A;  1YIT T;  1BCM A;  3M56 A;  1C6V X;  5CVI A;  5IH2 A;  1WJQ A;  4R55 A;  5FWB A;  2EQM A;  4XTU A;  4HKE A;  1WIE A;  1M3B A;  3CCV Q;  3L2W A;  4DOV A;  4M7A B;  1RLP C;  3EH1 A;  2OAW A;  5DLO A;  1H8K A;  2QDL A;  4J83 A;  3PE0 A;  4RTT A;  4RTV A;  3PIP A;  3PNW C;  2KR3 A;  3GOX A;  3J7A F;  1KQS S;  1BCO A;  5CQY A;  2FPD A;  1OPK A;  3EG1 A;  3G6E A;  3A8G B;  4F7U E;  4PJM A;  2RJF A;  1ZSZ A;  1CKB A;  1WZO A;  3M54 A;  4ZGD B;  1QVG S;  1M8V A;  5AT1 B;  2F5T X;  1PRM C;  1VQ6 T;  1DJ7 B;  2YUO A;  2G3R A;  2LP5 A;  3CBO A;  2X3X D;  5CAI A;  5LJ3 f;  2CSI A;  2F5K A;  5EG2 A;  1JBM A;  4X1V A;  3RR6 A;  2CP7 A;  4LDY A;  3CPW S;  2VXE A;  3OW2 P;  3SDZ A;  3DKM A;  3V8L A;  4MML A;  2WSC E;  4A4K A;  1NBE B;  4QKU A;  4V2S A;  3EG0 A;  3REB B;  1QVF S;  1VQ8 Q;  5HKC A;  5DM7 R;  9ATC B;  2M0Y A;  3RER A;  4M7D G;  2DVJ A;  5KYY B;  2RHY A;  2E6Z A;  3CCQ T;  3CCS Q;  1VQ6 Q;  1UGS B;  5J3B A;  4IIO A;  1UUE A;  1S72 A;  3OYY A;  2PZ1 A;  2ZCF B;  3F70 A;  2L5Q A;  3V8K A;  4PJO B;  2LDM A;  3LH5 A;  4J9C A;  4AG2 C;  3M4Y A;  2HAX A;  2QTX A;  5CR2 A;  4A4G A;  3HFO A;  2I0N A;  2IIM A;  3HRU A;  4MDX A;  4BI8 B;  4AFS C;  3OYL A;  2HZY A;  3MEV A;  1LPL A;  3C4S A;  2HBW A;  5CKD A;  4J7F A;  4M7A C;  3L42 A;  4OVA A;  1UFF A;  2KT1 A;  4JS5 A;  1KC8 U;  1WQ7 A;  3OYN A;  1CSK A;  2ZPE B;  5GAN 4;  3N5B B;  4X9C A;  2CT4 A;  3OB9 A;  1X01 A;  3JCM J;  2F69 A;  3WVE B;  2MWP A;  1AEY A;  2Y4X A;  3PTA A;  1I0C A;  3H9N A;  2X4Y A;  4FYY B;  2DVE A;  3EHQ A;  3M53 A;  5KYX B;  2EPD A;  1Q81 C;  1JJ2 P;  2DEU A;  3QO3 A;  3V7R A;  2AKK A;  3LGL A;  1N9R A;  3JCM Q;  3CC7 Q;  2E64 A;  1XOV A;  1BI2 A;  5FRN A;  3ASK A;  1AZG B;  2PVG B;  4E6R A;  2CZ7 B;  4LDU A;  1P92 A;  2BIV A;  2DL3 A;  1RAB B;  5HK0 A;  1IGQ A;  3MO8 A;  4D6W A;  3CME T;  3CMA T;  4Y92 A;  4XU1 A;  2Z0W A;  1NLP C;  5GAM g;  3I5R A;  2QYZ A;  4Z88 A;  3H6Z A;  1IO6 A;  4YTL A;  1M90 R;  1VQK Q;  2YHT A;  4PL6 A;  2FB7 A;  1YIJ Q;  2A36 A;  2JW4 A;  3UAT A;  3CPW P;  3OW2 S;  1M90 U;  1VQP T;  4FSS A;  3CXC P;  3I55 T;  3AT1 B;  1H64 1;  2ABL A;  4J9D A;  4PFZ A;  4DQ2 A;  3M59 A;  2P4R A;  1U06 A;  4O5V A;  1NJI R;  1UGR B;  3JRZ A;  3VRZ A;  2ECZ A;  4HCB A;  3EGD B;  4OB0 B;  3I56 Q;  2K2V A;  4RTY A;  1UGP B;  2CUD A;  3KUF A;  1EZZ B;  4M7D E;  5KYW A;  3JB9 D;  1QMC A;  2EQJ A;  5KE3 A;  3M55 A;  4J9E A;  4FM4 B;  2RI5 A;  4A4F A;  3MET A;  5GAO q;  4M78 C;  5IT9 E;  1IHW A;  2PNI A;  4PJO G;  3PMT A;  2XD0 A;  4CRI A;  1JEG A;  3R6N A;  3JCM g;  3CCL A;  4M7D C;  1RAC B;  3KXT A;  3OMG A;  2ZPB B;  3T9N A;  4AG1 C;  5KYU A;  3JCM f;  5GAN 2;  3MEW A;  4IUU A;  1PC0 A;  2DL7 A;  2O9S A;  4QQD A;  3JB9 I;  3CME A;  1VQ7 A;  1ZUY A;  4BE1 A;  1M1K R;  1HD3 A;  5LJ5 g;  3MP6 A;  5GAO l;  1RAA B;  2K57 A;  1QP2 A;  1I8F A;  2XU8 A;  3QDR B;  1RAH B;  4ORZ A;  4EMG A;  3UPU A;  1K0X A;  5GAO p;  4F7U A;  3HFN A;  1B34 A;  1VQ7 T;  2EW3 A;  1K73 U;  2OTL Q;  1NPR A;  2DE0 X;  3CMA Q;  1ZX6 A;  1PG5 B;  4QW2 A;  2XK0 A;  4ESR A;  2QGF B;  2IPO B;  4XAX B;  1U1S A;  1X6O A;  4JRK A;  2VXF A;  5LJ3 h;  2LCC A;  2Y4Y A;  1G3T A;  4BE0 A;  2P0K A;  2VKN A;  3GIB A;  1WA7 A;  4AFQ C;  1MGQ A;  2OAU A;  1NYF A;  4CC7 A;  3CCU Q;  1YFN A;  5GAN d;  2DBK A;  5GAM f;  2XDD A;  2A3L A;  5IN1 A;  2JMA A;  2RQV A;  1K76 A;  1OOT A;  4RG8 A;  4E7I A;  1Q7Y U;  1M1G A;  2E70 A;  3A8H B;  4QVD A;  1B3Q A;  2GFU A;  1U3O A;  2DMO A;  2AT1 B;  5GAN 6;  3L2R A;  3CME Q;  1XTD A;  3Q1J A;  1RAF B;  3LWI A;  1WHM A;  4C8Q D;  1VYV A;  1NM7 A;  4GLM A;  1LOJ A;  5FLX E;  3HL8 A;  2JN0 A;  4BI3 A;  3JB9 F;  2RHI A;  3AHU A;  2DYB A;  2RA2 A;  1K1Z A;  1MUZ A;  2YSQ A;  4IUT A;  3EGX A;  2KE9 A;  1VOM A;  1TU0 B;  4C8Q B;  2EQI A;  2RHU A;  4LN2 A;  1MMA A;  1JJ2 A;  3VS2 A;  4QQ6 A;  3EFS A;  1GCP A;  1ZUK A;  5KYY A;  2RNA A;  2P0P A;  3CEY A;  5FU6 C;  1IB8 A;  2A7Y A;  4XU2 A;  2J05 A;  2O9V A;  3QKJ A;  3GP8 A;  1PHT A;  3QYH B;  2D8J A;  2G6F X;  2KSS A;  1GFC A;  2W0Z A;  3BDL A;  1VQM Q;  3HRS A;  4ELY C;  1VQ9 Q;  1OI1 A;  1HJD A;  1R0C B;  5IHN A;  1VQO A;  2HCK A;  3OMC A;  2EAY A;  4C5E A;  3G1J A;  3TQ7 P;  4PJO C;  2DNU A;  1YN8 A;  2JS2 A;  1VQ5 T;  4BB7 A;  3BE3 A;  1BI3 A;  3M5A A;  2K5L A;  8ATC B;  2PQW A;  3LX7 A;  1Q82 C;  3G7Z A;  2HD0 A;  3URG A;  2CKK A;  3NTI A;  1VQK T;  2L3S A;  1PWT A;  2RJD A;  4BE2 A;  3CCM A;  4JDS A;  2J6O A;  3VUB A;  4RCB A;  3OYI A;  2RJE A;  1TSF A;  1WPY A;  3CCM T;  1OX9 A;  1YJ9 T;  3OYF A;  4HCZ A;  3L1A A;  4PKC C;  3CCJ A;  3MEU A;  1LCK A;  4JRP A;  2DKG A;  3RKW A;  3NTK A;  3DLM A;  2EGE A;  1VA7 A;  3RKY A;  2NUZ A;  3EG3 A;  1YJN Q;  4P5N A;  1TG0 A;  4R56 A;  1EIF A;  1FX7 A;  1OV3 A;  1WX6 A;  4KT0 E;  4RG2 A;  2R5A A;  2LNV A;  1KFZ A;  1KK7 A;  4N0A A;  4M78 G;  4M75 A;  1SEM A;  1NYG A;  2QEX T;  1YBY A;  1N9S A;  1GBQ A;  2KRM A;  1KQ1 A;  4PNO A;  4E7L A;  3A8L B;  1SSH A;  5GMK m;  2RHZ A;  4E7Z A;  1TUD A;  1B07 A;  2JS0 A;  4WF2 A;  3CCS T;  1IHV A;  4FIB A;  1Q95 G;  5GAN 7;  2FZC B;  4A63 B;  4HA8 A;  2CP0 A;  1K9A A;  3M4G A;  3OSS C;  3CCE A;  2QK0 A;  4M77 G;  1H3Z A;  1Q86 C;  4LXC A;  2SEM A;  2KDS A;  3CCL Q;  1NE8 A;  3EG9 B;  2L2P A;  1H92 A;  4FYX B;  3QZ5 B;  4NS5 A;  1D1A A;  3JCM h;  2MAM A;  2MMP A;  1WXU A;  4ZGE B;  3CD6 A;  4FW2 A;  1FMK A;  5CO7 A;  4FT4 A;  2ZPG B;  4DOW A;  2KK4 A;  3NPF A;  4A53 A;  1AOJ A;  3DB4 A;  2IG0 A;  1VIE A;  4C8Q F;  5I2M A;  3CCE Q;  3RUX A;  1YIJ T;  1D09 B;  2VV5 A;  2GQV A;  3OYE A;  1KQ2 A;  3OA6 A;  2JJ9 A;  1OPL A;  2P4T A;  2DTI A;  1JO8 A;  1W6X A;  3JCM W;  1KIK A;  1KC8 C;  4M7D B;  2CRE A;  4X9D A;  2DXU A;  2V8I A;  1BYM A;  3OYM A;  1FMW A;  3WVD B;  3CCJ Q;  3I56 T;  4KUD K;  3C12 A;  2NUP A;  4FW1 A;  1Y7X A;  4HCK A;  4X34 A;  3C0C A;  3G6E T;  2GF7 A;  2LMJ A;  2I2L A;  2MPX C;  1YNZ A;  2CP3 A;  2VGM A;  1SRL A;  2D1X A;  3CBM A;  5GAN g;  2DJQ A;  2YWW A;  2GGR A;  4B9X A;  4PJJ A;  2YRD A;  2DRK A;  4OMQ A;  2QA4 T;  1BIB A;  4HT8 A;  1VQ6 A;  2CS7 A;  2DL4 A;  1Q81 R;  1G3Y A;  2KRS A;  2EGA A;  3ZEH A;  3P8D A;  1JRI A;  1XJW B;  2ATC B;  1WHL A;  3UA6 A;  1WHH A;  3M57 A;  2FHD A;  1R77 A;  3V7S A;  2MWO A;  3DB3 A;  3CC2 Q;  2ZZD A;  2XMF A;  3A5Z B;  4M75 E;  1VQP A;  2CSQ A;  4JJC A;  2NUT A;  3M0R A;  7AT1 B;  3VS1 A;  3SFM A;  4MDW A;  2K3X A;  2GTO A;  3RMQ A;  2MOX A;  1WJR A;  2E1H A;  1M2V A;  2O88 A;  4F17 A;  4FL6 A;  2QEX A;  5GAN 8;  2OX7 A;  5IHI A;  5KH6 A;  3G4S Q;  3MP8 A;  2R58 A;  2QAZ A;  2X4J A;  1QWE A;  2EGC A;  4M7D F;  4C92 D;  1WGS A;  4WCI A;  4XK8 E;  4J9G A;  4XTZ A;  2P84 A;  4RKU E;  4F7U F;  3OYB A;  1UG1 A;  2L0A A;  3GBQ A;  3RBB B;  2RD1 A;  2O01 E;  3S3M A;  4M7A A;  1T0J A;  1TTH B;  2C0T A;  2RI3 A;  4C92 B;  2FG0 A;  1RAD B;  1HK9 A;  3QII A;  4LE9 A;  2HQX A;  4OML A;  2D8H A;  2YUP A;  4ZN1 A;  3G71 A;  1U1T A;  3JV3 A;  2LQK A;  5GJW B;  3HKS A;  3S3N A;  2RO0 A;  1H3H A;  3EGX B;  4CC3 A;  3VV0 A;  4C8Q A;  3M9Q A;  1Y57 A;  4FCY A;  4JPB W;  1PM3 A;  2FPF A;  1MMD A;  1JXO A;  1BU1 A;  2QTV A;  1YJ9 Q;  3JB9 H;  4J9F A;  5J39 A;  5LJ3 j;  1EFN A;  2LT1 A;  1QVF P;  1WXT A;  2RQW A;  2J6K A;  2CH4 W;  3FIF A;  1AWW A;  1PNJ A;  1XQH A;  3VS5 A;  3TSZ A;  4FSX A;  2FEI A;  3QDF A;  2XIC A;  1RI0 A;  5HCK A;  3JCM c;  3BY7 A;  2DER A;  3CMA A;  2P0Q A;  4AT1 B;  3S6W A;  2YUN A;  3QSU A;  4L59 A;  3VYH B;  1QVG P;  1YWO A;  1Y0M A;  5GMK j;  1GFD A;  3NMZ C;  3I35 A;  3E1S A;  1D3B A;  1NPP A;  4RCC A;  2WAC A;  1VYU A;  3H8Z A;  4OMM A;  5FRM A;  4J6Y A;  1KQS P;  2KYB A;  4M77 C;  4JS4 A;  3CC4 T;  2GNC A;  1TOV A;  4QQG A;  2ROT A;  1ZSZ B;  2EYZ A;  1GCQ C;  4ZGJ B;  3FJ5 A;  3CCQ A;  2VWF A;  2VVK A;  1C0M A;  1FXX A;  1S72 T;  4MZM A;  3M0P A;  2ZPH B;  4M75 G;  1BB9 A;  1I4K 1;  3QJ6 A;  1D0X A;  2DL5 A;  3CC4 A;  2AKL A;  2RB6 A;  3H0F A;  1V29 B;  2YRV A;  4DBQ A;  2EQK A;  3BFM A;  2L8D A;  3PGG A;  2RI2 A;  3HSB A;  3UT1 A;  2K5I A;  4K11 A;  1OU8 A;  1D0Z A;  1G5V A;  2EYQ A;  1M9S A;  3RNJ A;  2DTO A;  4J7I A;  1VQ9 T;  2OTL A;  2FRW A;  3OQ5 A;  1E7O A;  4J9H A;  4PJO A;  1FMV A;  1M27 C;  3OW2 A;  2A0F B;  4F14 A;  3G4S A;  1M4Z A;  3VUZ A;  1QCN A;  3CBP A;  5GAO r;  1GBR A;  1VQ4 Q;  5I11 A;  5IHK A;  2MF2 A;  4DA4 A;  3X25 B;  1BI1 A;  2V8K A;  1K4U S;  2QQR A;  4OGE A;  2LX9 A;  2QEX Q;  1HXD A;  2M0O A;  1VQP Q;  2DAQ A;  4C92 E;  2RJC A;  2HNI A;  4J9B A;  5LJ5 h;  1QQJ A;  2DPP B;  1E6G A;  3OYH A;  2RN8 A;  1AWO A;  3G4S T;  3RDV A;  1VQ5 A;  1VQ7 Q;  4A4H A;  1VQ8 T;  1SPK A;  5L8R E;  3OBW A;  4JJN K;  3VS4 A;  1ZSZ C;  4BDZ A;  4RMO A;  4PJO E;  4LD6 A;  5GAN 3;  1W70 A;  2ZGW A;  5D6X A;  4C5H A;  1Q81 U;  3EFO A;  1MNE A;  1NLO C;  3CC7 A;  4DBR A;  4AFU C;  5I2S A;  2O4X B;  4M7D D;  4GY5 A;  3UA7 A;  3CC7 T;  4RUG A;  1SRM A;  2O2O A;  1QLY A;  1NG2 A;  5C6S A;  3RKX A;  3QYG B;  2KXD A;  1RUW A;  2DL8 A;  4RTW A;  2GTJ A;  2PTK A;  3ULR B;  3MCA B;  2NWM A;  2XID A;  1OZ3 A;  3H41 A;  3FDR A;  1PKT A;  3X26 B;  3VS7 A;  1GRI A;  2DD5 A;  2QXF A;  4C5I A;  1X6B A;  2V8J A;  2PUO B;  1IGU A;  5CKE A;  2MIO A;  2DZ9 A;  1GXI E;  3GNG A;  4M77 E;  2XG8 D;  2K4Y A;  4QVZ A;  4ZTF A;  3EG2 A;  1FWZ A;  1SHF A;  3JSC A;  3PT9 A;  3JCM P;  3EFR A;  1GL5 A;  4TVR A;  1AD5 A;  1ZBJ A;  2K7A A;  4E2F B;  3GLX A;  2ENM A;  1N6A A;  5GAN e;  2HQH A;  1M5Q 1;  2GQI A;  1B34 B;  4E7K A;  1NEB A;  3CQT A;  1IRE B;  1V76 A;  4ZTJ A;  4UC4 A;  4L5G A;  2JMC A;  3PMI A;  4EMK C;  1VQ8 A;  3A8O B;  3SWN B;  4PJO D;  2EFI A;  2DX1 A;  2OTL T;  2LVM A;  4EIK A;  3R6O A;  3TRE A;  2PVD B;  3A1P A;  1VIF A;  4XTV A;  1IZ6 A;  1ACM B;  5IXF A;  2OTJ T;  2FPE A;  4C92 C;  5KE2 A;  2DET A;  1YJW Q;  1W2B P;  4ME7 A;  5GMK i;  2AHJ B;  4EMK B;  2QQ9 A;  2KYM A;  1KQS A;  4OMF B;  2LRQ A;  4KGZ B;  1NJI U;  3UWN A;  5FU7 B;  2EJ9 A;  2O31 A;  2ROL A;  1IXD A;  1CKA A;  2JZ2 A;  4IIM A;  4Q5W A;  1M30 A;  3TSW A;  1K8A C;  4ELZ C;  2CDT A;  3DLL A;  2OTJ A;  2RQR A;  2CZ6 B;  2ED1 A;  1I07 A;  1C1A A;  2KMT A;  3QPH A;  3QZ9 B;  4RTU A;  4F7U B;  2E6N A;  1TUC A;  5LJ5 e;  2BUD A;  2CGH A;  1S72 Q;  2HQE A;  3M0T A;  5GMK h;  1TXQ A;  3KFV A;  1K9M U;  2JM9 A;  2CZ0 B;  4JZ3 A;  1W2B S;  1K8A U;  1OEB A;  1LNX A;  1WYX A;  2DYI A;  3I55 A;  1M90 C;  2LNH B;  2KQW A;  3M58 A;  3HRT A;  3QG1 A;  1PD1 A;  5KCH A;  3OS0 A;  4OMN A;  2QI2 A;  1U5S A;  4DEX A;  5GAO m;  4QVC A;  2RH2 A;  1UEB A;  4XTX A;  1D3B B;  2E10 A;  1YI2 T;  1ZQ1 A;  1EX4 A;  2MYS A;  2EKH A;  2FZK B;  2COY A;  2QA4 A;  3FLG A;  2LQN A;  1IRX A;  3E19 A;  1VQO Q;  2CH4 A;  3NTH A;  3A98 A;  5CKB A;  5D7U A;  2E12 A;  2SRC A;  1M1K C;  1TUG B;  1M2O A;  4C0G A;  1K73 R;  2EWN A;  1Q86 R;  4XTY A;  3OYC A;  1BBZ A;  1NZ9 A;  3L2V A;  2XKO C;  4KGV B;  4A54 A;  1Q86 U;  1ABO A;  4N4I A;  3EH2 A;  1M8M A;  3JCM e;  3I5S A;  2DIQ A;  1N8R U;  2LT4 A;  8AT1 B;  1WHK A;  2DBM A;  1I1J A;  1K73 C;  1Y96 A;  2HBP A;  4LUD A;  2KAF A;  5ECA A;  1YP5 A;  2ZPF B;  1YJ9 A;  3MHX A;  3JCM b;  1KHC A;  1I81 A;  1MV0 B;  2QQS A;  3FC3 A;  3CC2 T;  1Q82 U;  2LJ1 A;  1G83 A;  3X20 B;  2VGN A;  4DBH A;  2EKO A;  3VRY A;  1I5O B;  3HHT B;  1VUB A;  2FL7 A;  5CIU A;  5GAN 5;  1VQM A;  2MK5 A;  2DD4 A;  3CCR T;  3LYI A;  4J5Y A;  1SKU B;  1MMG A;  4R0K A;  2COZ A;  4N4H A;  2LTO A;  2QQA A;  2DLP A;  3RMS A;  3ZFJ A;  2KT8 A;  4M78 D;  5LJ3 g;  4C0D C;  2KEA A;  3G6E Q;  3P8H A;  2KY9 A;  4C92 G;  3CCU A;  2NYS A;  2EYY A;  2HL5 C;  2JTM A;  5J26 A;  2RQU A;  1OZ2 A;  5GAM j;  4JLI A;  3QWX X;  2OTJ Q;  5GAM e;  5L23 A;  3A8M B;  1X69 A;  2EQU A;  3LGF A;  4C92 F;  2QGG A;  1UE9 A;  1ZSG A;  4IUR A;  1KC8 R;  2H3J A;  1X6G A;  3CCV A;  4LNP A;  3NFC A;  3L2U A;  2GBQ A;  5D6W A;  3C94 A;  4DBF A;  2C0I A;  1ZHI A;  1RL2 A;  3ER0 A;  4MZT A;  2KRN A;  2A28 A;  1ARK A;  4C0D B;  5KCO A;  1X2Q A;  1X2K A;  1Y71 A;  2X3W D;  4M7A F;  2HSE B;  3LW5 E;  4IUV A;  4M75 B;  2K9G A;  5EC7 A;  2VB6 A;  1O9S A;  1YIJ A;  4KH0 B;  3O8V A;  3VS0 A;  1OQK A;  1JXM A;  2E5K A;  3G71 T;  3SWN C;  2K2M A;  4J9I A;  4FYW B;  1VQN Q;  3M0Q A;  1X27 A;  2HDA A;  4BD3 A;  3ZL7 C;  4EDU A;  4IKF A;  3SB2 A;  4HVU A;  4F16 A;  3GNF B;  4MMK A;  3CD6 Q;  1UJY A;  5A0L A;  2MI6 A;  2J6F A;  4PFO A;  2A37 A;  1RAI B;  2BE9 B;  2DEQ A;  3I56 A;  2NUP B;  3QBY A;  5CCA A;  5A2Q E;  4BDY A;  3NGP A;  4B6M A;  2L3Q A;  3OS2 A;  1AWX A;  2KRO A;  3EG9 A;  5GAN f;  2CT3 A;  4M78 B;  3CC2 A;  4E47 A;  4D8D A;  1YJW A;  3JCM X;  2DIL A;  2EIF A;  3C95 A;  4HT9 A;  3FEO A;  1A0N B;  3OBY A;  2F2W A;  3HTR A;  1SHG A;  3NHN A;  4Y91 A;  4M77 A;  4C8Q C;  4D8K A;  3SWN A;  1YIT A;  4Z02 A;  2VAS A;  1N8R R;  2XDP A;  1QVP A;  2HKN A;  2Y90 A;  3SEM A;  1VQ4 A;  4WTO B;  3CCV T;  2CP2 A;  4OMP A;  2QDY B;  2GFA A;  4VUB A;  3EHR A;  2PU9 B;  1MHN A;  2DFU A;  1MV3 A;  1N27 A;  3EGD A;  1Z9Q A;  4M7D A;  3OYD A;  5DY9 A;  4MZP A;  2M1H A;  2RM4 A;  3MJX A;  2CP5 A;  4LDX A;  2RK2 A;  3OYA A;  1BI0 A;  4OB2 B;  2PUK B;  2X4X A;  2YLC A;  3M0U A;  1LJO A;  1NEG A;  2ED0 A;  3I9Q A;  1GCQ A;  4FT2 A;  2NLU A;  4BY6 B;  1WFW A;  2D0N A;  4OB1 B;  3PIO A;  1UEC A;  4GBQ A;  4IUQ A;  4EPC A;  4E7S A;  5AYF A;  4C92 A;  1K0S A;  2DIG A;  1PD0 A;  1KSW A;  2JNG A;  4Y28 E;  5GAM d;  1I5L A;  3ZBD A;  4M78 F;  1VQL A;  2DF6 A;  1WJS A;  4IUP A;  5KYX A;  2D0Q B;  1VQL T;  2B86 A;  4JLG A;  3VS6 A;  3QHS A;  3REA B;  3OYK A;  2JVV A;  4M4Z A;  1HYO A;  3TVT A;  3UF4 A;  2LX7 A;  1UDL A;  2YUQ A;  4HXJ A;  1Z9Z A;  4LDW A;  4ZNX A;  4FU6 A;  5IXB A;  2FO0 A;  2KBT A;  2OI3 A;  3QUI A;  1ZA1 B;  5A0G A;  2V1Q A;  3D7S B;  2E65 A;  4KBM B;  1T0H A;  2V1R A;  3OY9 A;  1M2V B;  2LZ6 B;  1R8O B;  2HKQ B;  4PJN A;  5KYU B;  3JCM V;  2JTF A;  3UDC A;  5I21 A;  2CUB A;  2KGT A;  4LDV A;  2E41 A;  4JJB A;  2FZG B;  4KGX B;  1YCS B;  5CKH A;  3OYG A;  1D0Y A;  4M78 E;  4C0F A;  2LQ8 A;  3JB9 J;  1AHJ B;  4CI0 C;  1AZE A;  4XU0 A;  1SG5 A;  5GJV B;  5HY6 A;  1TWB A;  2R5M A;  2M16 A;  1K9M C;  5D6Y A;  4PLL A;  1KG1 A;  4F04 B;  3ME9 A;  1G3S A;  3RES A;  4AMC A;  1TS9 A;  1WI7 A;  2DXT A;  3CCQ Q;  3I55 Q;  5C0M A;  5KYW B;  2RHX A;  1Y07 A;  2KXC A;  2YLB A;  3INZ A;  1YHQ T;  2F2V A;  2E5Q A;  5IAY A;  4M7A G;  2BE7 D;  5GMK e;  4FYV B;  1SSF A;  3PVL A;  1O75 A;  2HEQ A;  3OYJ A;  1UHF A;  2LJ0 A;  3EAE A;  2DRM A;  3G71 Q;  2JM8 A;  4O6J A;  2KNB B;  3PFS A;  1QP3 A;  1NJI C;  1YCY A;  1KJW A;  3JB9 G;  4KUL A;  3FRN A;  2ZPI B;  4C8Q G;  2YXY A;  5GAN j;  1WLP B;  2CYZ B;  2QAS A;  3TCJ A;  3CCJ T;  1UTI A;  1G3W A;  3HP9 A;  3VYG A;  3LWH A;  1VQN A;  2X51 A;  4JJD A;  2DTH A;  3QXE B;  2DZC A;  1KD1 U;  2MCN A;  5I22 A;  4N4G A;  3M0S A;  1Q7Y R;  1ZBX A;  1KD1 R;  2JXB A;  4L6V 5;  4Z8A A;  3IQL A;  1VQ9 A;  4EMH A;  4C8Q E;  1UJ0 A;  5CQX A;  2DM1 A;  2QA4 Q;  1U8R A;  4AFZ C;  2K6D A;  5KYN A;  1VQN T;  3WXM B;  4BY6 C;  4ANJ A;  4J6W A;  3V8J A;  2DA9 A;  1Q7Y C;  1KD1 C;  2QQB A;  3THK A;  4M7A E;  4M77 F;  1UGV A;  2DJZ A;  3OS1 A;  1UB4 A;  2FYK A;  4M7A D;  1M1F A;  3H0I A;  2L89 A;  2DXB A;  2HL3 A;  4J6X A;  3TU4 K;  3RIR A;  4N0A C;  2JUF A;  3OSV A;  2GCX A;  2M51 A;  2LCL A;  3PVQ A;  1W2B A;  2DO3 A;  4BAC A;  2D9T A;  1QCF A;  2DK3 A;  2EJG A;  4KUI A;  1ZA2 B;  3P8B B;  2M02 A;  3MP1 A;  1W1F A;  1TH7 A;  1VQL Q;  1OU9 A;  2LJ3 A;  2EVR A;  5CK9 A;  4NL3 A;  2B8A A;  3OS5 A;  4DEY A;  4HCC A;  1RLQ C;  1K9M R;  1ABQ A;  4C5G A;  1PSE A;  1MMN A;  4M75 D;  5GAO n;  1OUL A;  1D1B A;  5GMK l;  4E7H A;  3MKD A;  2BTT A;  4M78 A;  2K3Y A;  1WQW A;  1OX8 A;  3J80 E;  3LLR A;  1QW1 A;  1YHQ A;  2WSE E;  2JOY A;  2CP6 A;  2EYW A;  1VQK A;  2EBP A;  1RAE B;  4M77 B;  4Z89 A;  2EYX A;  1M1K U;  4ZN3 A;  1XNI A;  3LH0 A;  2ZAE A;  1M3A A; 
#chains in the Genus database with same CATH homology
 4CC4 B;  3VRZ A;  4LE9 A;  4OML A;  2D8H A;  2ECZ A;  2YUP A;  4R0K A;  3JV3 A;  5GJW B;  2DLP A;  4RTY A;  2CUD A;  1H3H A;  2KT8 A;  1FYN A;  4CC3 A;  4J9E A;  1T3L A;  1Y57 A;  2KEA A;  1VYT A;  4JPB W;  2FPF A;  1JXO A;  2EYY A;  1BU1 A;  2RQU A;  2PNI A;  1X43 A;  1JEG A;  3QWX X;  3R6N A;  2LQW A;  5FWC A;  4J9F A;  5L23 A;  1EFN A;  1JQQ A;  1X69 A;  5FW9 A;  1WXT A;  2RQW A;  4AG1 C;  2J6K A;  2CH4 W;  1UE9 A;  1ZSG A;  1AWJ A;  1PNJ A;  1AWW A;  2DL7 A;  1X6G A;  2O9S A;  3VS5 A;  4LNP A;  1PRL C;  1QKX A;  3TSZ A;  1E6H A;  2GBQ A;  1ZUY A;  2FEI A;  5HCK A;  1HD3 A;  4CC2 A;  2C0I A;  2YUN A;  3VS3 A;  2KRN A;  2A28 A;  1ARK A;  1YWO A;  1Y0M A;  1X2Q A;  1X2K A;  2X3W D;  4ORZ A;  1GFD A;  3NMZ C;  3I35 A;  2K9G A;  5EC7 A;  1VYU A;  4OMM A;  1M3C A;  3VS0 A;  1K0X A;  2J06 A;  1JXM A;  2KYB A;  2E5K A;  2EW3 A;  2RF0 A;  2K2M A;  2DE0 X;  4J9I A;  1ZX6 A;  2GNC A;  3M0Q A;  1X27 A;  2HDA A;  2ROT A;  2EYZ A;  1GCQ C;  4ESR A;  2AZS A;  3ZL7 C;  3FJ5 A;  2VWF A;  2BZX A;  1T3S A;  1G2B A;  4HVU A;  2FRY A;  2VVK A;  4F16 A;  1AVZ C;  1UJY A;  2J6F A;  2VKN A;  2HSP A;  2F2X A;  2A37 A;  3M0P A;  1WA7 A;  1BB9 A;  4AFQ C;  1NYF A;  4CC7 A;  2BZY A;  2DL5 A;  3NGP A;  2AKL A;  2DBK A;  2L3Q A;  1AWX A;  2KRO A;  3H0F A;  4KRT A;  2JMA A;  2RQV A;  2CT3 A;  1UHC A;  1K76 A;  1OOT A;  4D8D A;  2C0O A;  2DIL A;  1A0N B;  2LCS A;  1B3Q A;  4K11 A;  1ZUU A;  2F2W A;  1U3O A;  1YWP A;  2A08 A;  2DMO A;  1SHG A;  3NHN A;  1WDX A;  1WXB A;  3RNJ A;  1V1C A;  3EGU A;  4D8K A;  3SHW A;  2FRW A;  3SEM A;  1E7O A;  1VYV A;  4QT7 A;  4J9H A;  2AK5 A;  1NM7 A;  4GLM A;  4OMP A;  1M27 C;  2JT4 A;  3EHR A;  2L3P A;  4F14 A;  1MV3 A;  1J3T A;  1ZLM A;  4HVW A;  2OJ2 A;  1GBR A;  2RMO A;  5I11 A;  2K3B A;  1Z9Q A;  2H8H A;  5IHK A;  4RTX A;  2DYB A;  1K1Z A;  1MUZ A;  2YSQ A;  2KE9 A;  2ESW A;  1K4U S;  1QKW A;  2EQI A;  4LN2 A;  4OMO A;  2W10 A;  3M0U A;  3VS2 A;  1GCP A;  1ZUK A;  2RNA A;  1NEG A;  2ED0 A;  3I9Q A;  4J9B A;  1GCQ A;  2O9V A;  2J05 A;  1PHT A;  1E6G A;  2D8J A;  2G6F X;  1WFW A;  2RN8 A;  2D0N A;  1AWO A;  2W0Z A;  1GFC A;  1UEC A;  4GBQ A;  1N5Z A;  3H0H A;  1K0S A;  1KSW A;  1SPK A;  1QWF A;  1HJD A;  2DF6 A;  3VS4 A;  5IHN A;  1BK2 A;  4JZ4 A;  1PKS A;  2HCK A;  2B86 A;  2YDL A;  3VS6 A;  3REA B;  3U23 A;  1W70 A;  4M4Z A;  2AZV A;  3TVT A;  2DNU A;  3UF4 A;  3QWY A;  1HSQ A;  2LX7 A;  1UDL A;  1NLO C;  1YN8 A;  2YUQ A;  4AFU C;  2YT6 A;  4HXJ A;  1Z9Z A;  2JS2 A;  4ZNX A;  3UA7 A;  5IXB A;  2RQT A;  1SRM A;  4RUG A;  2FO0 A;  2KBT A;  2OI3 A;  2O2O A;  1QLY A;  1NG2 A;  3O5Z A;  2V1Q A;  2K79 A;  1S1N A;  2L3S A;  4HVV A;  1PWT A;  1T0H A;  2JTE A;  4LUE A;  2KXD A;  1RUW A;  2DL8 A;  2J6O A;  4RTW A;  2V1R A;  4RTZ A;  1JU5 C;  2J7I A;  2GTJ A;  2PTK A;  3ULR B;  2LZ6 B;  2BZ8 A;  2NWM A;  1RI9 A;  3H41 A;  2RPN A;  1PKT A;  2CUB A;  3VS7 A;  1GRI A;  2KGT A;  5IH2 A;  1X6B A;  5FWB A;  2MIO A;  4JJB A;  1LCK A;  1YCS B;  2EGE A;  1WIE A;  1VA7 A;  1M3B A;  2NUZ A;  3EG2 A;  3EG3 A;  1TG0 A;  1SHF A;  1RLP C;  2OAW A;  1OV3 A;  1GL5 A;  1AD5 A;  1WX6 A;  1ZBJ A;  1H8K A;  1AZE A;  2QDL A;  3PE0 A;  4RTT A;  2K7A A;  4RTV A;  5GJV B;  1KFZ A;  1SEM A;  1NYG A;  2KR3 A;  2ENM A;  2GQI A;  1GBQ A;  2KRM A;  1NEB A;  2FPD A;  1OPK A;  3CQT A;  3EG1 A;  1WI7 A;  1SSH A;  2KXC A;  2JMC A;  1CKB A;  2F2V A;  1PRM C;  1TUD A;  1B07 A;  2JS0 A;  3PVL A;  2YUO A;  2LP5 A;  2HEQ A;  1UHF A;  2LJ0 A;  2X3X D;  2CSI A;  4A63 B;  2DX1 A;  2DRM A;  2JM8 A;  1K9A A;  4EIK A;  4X1V A;  2KNB B;  5IXF A;  2SEM A;  1KJW A;  2FPE A;  2L2P A;  1H92 A;  3EG0 A;  3REB B;  1WLP B;  2KYM A;  1WXU A;  1FMK A;  2M0Y A;  1UTI A;  2DVJ A;  3NPF A;  1AOJ A;  2O31 A;  2ROL A;  1CKA A;  4JJD A;  4IIM A;  1M30 A;  3TSW A;  4IIO A;  1UUE A;  2MCN A;  5I22 A;  2CDT A;  2RQR A;  3M0S A;  2ED1 A;  1I07 A;  2PZ1 A;  2JXB A;  4Z8A A;  3IQL A;  3LH5 A;  1OPL A;  4J9C A;  4RTU A;  1UJ0 A;  2DM1 A;  4AG2 C;  1TUC A;  4AFZ C;  2K6D A;  1JO8 A;  2I0N A;  1W6X A;  2IIM A;  1KIK A;  2CRE A;  3M0T A;  3KFV A;  2JM9 A;  4AFS C;  2DA9 A;  4JZ3 A;  1OEB A;  2HBW A;  1WYX A;  1UFF A;  2KT1 A;  2LNH B;  3THK A;  1CSK A;  4OMN A;  4HCK A;  1U5S A;  1UGV A;  3C0C A;  4DEX A;  2CT4 A;  2LMJ A;  1YNZ A;  1SRL A;  2D1X A;  3H0I A;  2DJQ A;  1AEY A;  2GGR A;  1I0C A;  2DRK A;  4OMQ A;  3EHQ A;  2EPD A;  2DL4 A;  2M51 A;  2EKH A;  2KRS A;  2EGA A;  3PVQ A;  2AKK A;  2LQN A;  1XOV A;  1QCF A;  3UA6 A;  2CH4 A;  3A98 A;  1AZG B;  4E6R A;  2SRC A;  2DL3 A;  1W1F A;  2XMF A;  1BBZ A;  2LJ3 A;  2EVR A;  2CSQ A;  4JJC A;  3M0R A;  3VS1 A;  4DEY A;  1ABO A;  4Y92 A;  1RLQ C;  1ABQ A;  1M8M A;  1NLP C;  2GTO A;  3I5S A;  2MOX A;  2O88 A;  4F17 A;  3I5R A;  5IHI A;  2BTT A;  4Z88 A;  1IO6 A;  1I1J A;  2DBM A;  1QWE A;  2EGC A;  4LUD A;  2A36 A;  2JW4 A;  5ECA A;  4WCI A;  1YP5 A;  3UAT A;  4J9G A;  4FSS A;  1UG1 A;  2ABL A;  1MV0 B;  4J9D A;  2L0A A;  2EYW A;  3GBQ A;  2EBP A;  3RBB B;  4Z89 A;  2LJ1 A;  2EYX A;  1G83 A;  1T0J A;  2P4R A;  2C0T A;  1U06 A;  2FG0 A;  3VRY A;  1M3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...