4JJBA

Crystal structure of the abl-sh3 domain at ph3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the Abl-SH3 domain at pH3
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 11
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jjbA00
1M30A 4HXJA 4OMQA 4AG1C 4ZNXA 5L23A 1AVZC 4RTTA 4IIOA 4X1VA 1AWOA 5IXBA 5IHNA 1YP5A 3M0TA 1CKAA 1ARKA 2KT8A 2DL4A 2XMFA 2HEQA 3PVQA 2LZ6B 1QCFA 3UA6A 2A36A 2KRNA 2DJQA 2K79A 2CSIA 1U5SA 1GCPA 1KJWA 2LP5A 1MV0B 5GJVB 1Y57A 1T0JA 2C0TA 2YUOA 3EG3A 1N5ZA 1WYXA 2V1RA 1GFCA 1U3OA 1M3CA 3VS2A 2DL8A 4CC4B 1GBRA 2I0NA 2C0OA 3M0RA 2B86A 3RNJA 1BBZA 2YUPA 2D8JA 2GQIA 1WLPB 1RI9A 1UUEA 2RQRA 3EG2A 2KT1A 2J05A 1SRMA 1T3SA 3H0HA 1Z9ZA 1QLYA 2FEIA 2LQNA 1YCSB 3EG1A 2YSQA 2KNBB 2JXBA 2SEMA 4J9BA 4OMMA 2ROLA 2P4RA 4IIMA 4AFQC 4JJDA 1V1CA 2VKNA 1ZUUA 1AD5A 2CSQA 1I0CA 2HDAA 2MCNA 4J9EA 3RBBB 2PNIA 4OMPA 1NYFA 2CH4W 2EBPA 1WA7A 4D8DA 1TUDA 3NMZC 2GTJA 2OJ2A 2BZXA 1ZSGA 2DVJA 1PKSA 2VWFA 3JV3A 4RTYA 2HSPA 3VS1A 1K1ZA 2L2PA 1I07A 4R0KA 5I22A 2L3QA 2F2XA 4CC7A 4QT7A 1NEGA 1NYGA 1ZLMA 4FSSA 3UATA 4D8KA 1CSKA 2DX1A 1MV3A 2KBTA 5FW9A 4F17A 1GBQA 2YUQA 1UE9A 2KE9A 1AWXA 4JJBA 2J6FA 1Y0MA 2D8HA 2O2OA 1UHFA 4RUGA 1X43A 3U23A 1E6HA 1WFWA 2CT3A 1W70A 1AOJA 1GFDA 1WIEA 1EFNA 2C0IA 5FWCA 2DBKA 2KRSA 2O31A 1WI7A 1ABOA 1NG2A 1ZUYA 4E6RA 2FO0A 2DILA 3TSZA 5I11A 3UA7A 2F2WA 4A63B 4Z89A 4F16A 3UF4A 3EG0A 1K76A 1CKBA 5HCKA 4HVVA 2NUZA 1UJYA 1KIKA 3SEMA 4J9IA 1AWJA 2DM1A 3VS0A 4LN2A 2J6OA 2KRMA 4Z8AA 3C0CA 2VVKA 2EQIA 1Z9QA 1QWFA 2G6FX 2KXCA 1M3AA 1HJDA 1U06A 2EPDA 1SRLA 2CDTA 2JMAA 2EVRA 4WCIA 1ABQA 1KSWA 3TVTA 2DE0X 1OEBA 4DEYA 2A08A 2CT4A 4AFZC 2KYBA 2RQWA 2KEAA 2OAWA 2K6DA 4ESRA 2DA9A 3LH5A 3EHQA 2HCKA 2PTKA 2BZ8A 2DYBA 4AFSC 4LUDA 3EHRA 1TUCA 2O9VA 1GRIA 2W0ZA 4Z88A 2DF6A 1OPKA 1H3HA 1X6GA 1ZX6A 4OMNA 2M51A 3M0PA 4JZ4A 4KRTA 1PRLC 2FRWA 3ULRB 5IHKA 2ED1A 1QKXA 2YT6A 1WDXA 2DNUA 2FG0A 2E5KA 1SEMA 1X6BA 1UECA 1K4US 1ZBJA 3QWYA 2ECZA 4OMLA 1OV3A 2F2VA 2AK5A 1XOVA 1B3QA 4JZ3A 2RNAA 2JT4A 1UFFA 1H8KA 1RLQC 1E6GA 1FYNA 3KFVA 3SHWA 2EGAA 1UTIA 3FJ5A 1K0SA 1A0NB 1WX6A 2DRMA 2LCSA 3M0QA 2CUDA 2LMJA 3M0SA 4Y92A 1BB9A 2EYXA 2RN8A 3VS5A 4RTVA 1X2KA 2AZVA 1SHFA 2DBMA 2X3WD 2GBQA 1HD3A 5GJWB 1M3BA 2RQVA 2RQUA 2AKLA 2FPEA 1VA7A 1H92A 2GNCA 2J7IA 2ABLA 1I1JA 4GBQA 1X2QA 2FPDA 2DRKA 1QKWA 4DEXA 1NM7A 1X69A 2KYMA 3A98A 3PVLA 1PKTA 2KGTA 2PZ1A 2K7AA 2DL3A 4AFUC 3VS4A 3I5RA 2GTOA 1WXTA 4J9CA 1YWPA 2ED0A 3M0UA 2RF0A 3H41A 4J9HA 1K9AA 3NGPA 2X3XD 1JQQA 1X27A 1SSHA 1GL5A 2MIOA 1RLPC 4F14A 2EYWA 2KR3A 1RUWA 4CC3A 4OMOA 2LQWA 2AZSA 2K3BA 4JPBW 2HBWA 1JO8A 2M0YA 1WXBA 3CQTA 1BK2A 1W6XA 1AWWA 3ZL7C 2CH4A 2FRYA 3VS3A 1KFZA 2K2MA 1GCQC 2JW4A 4AG2C 1QWEA 2LX7A 1TG0A 4RTWA 2V1QA 2SRCA 4J9DA 3REBB 2JM8A 5FWBA 4RTXA 2O9SA 1PWTA 3NPFA 1SPKA 1YN8A 2LJ0A 2LNHB 4HVWA 2OI3A 2JS0A 2L0AA 1M27C 4LUEA 2ENMA 3VRYA 1UHCA 2FPFA 1UDLA 2DL7A 5ECAA 1YNZA 1FMKA 1BU1A 4GLMA 1UGVA 2GGRA 1OOTA 2IIMA 2ROTA 2O88A 1AZEA 3H0IA 2LJ3A 2JS2A 3NHNA 5EC7A 2W10A 2ESWA 1YWOA 2H8HA 1G83A 4K11A 3GBQA 1NLPC 1IO6A 1NLOC 2A37A 2EYZA 1GCQA 1PHTA 2JTEA 3H0FA 3QWXX 4M4ZA 1T3LA 2J06A 1JXOA 1AZGB 2EKHA 1K0XA 1MUZA 2RMOA 2KROA 4HVUA 1JEGA 1OPLA 2D0NA 4LNPA 1M8MA 4J9FA 1J3TA 4CC2A 3VS7A 2EGCA 1VYVA 2JM9A 2AKKA 3PE0A 3EGUA 1ZUKA 2A28A 1VYTA 2YUNA 1W1FA 3I5SA 3I9QA 2RPNA 4JJCA 1G2BA 1UJ0A 4J9GA 3REAB 4LE9A 5IH2A 1JXMA 2DLPA 2J6KA 4RTZA 1B07A 3TSWA 4ORZA 5IHIA 2RQTA 3R6NA 1HSQA 3I35A 3IQLA 1SHGA 2LJ1A 2EW3A 2EYYA 5IXFA 2K9GA 2CUBA 2JMCA 3THKA 2QDLA 2L3PA 2BZYA 2DMOA 1E7OA 4EIKA 1AEYA 2NWMA 4RTUA 1LCKA 1PRMC 1VYUA 1T0HA 4HCKA 2L3SA 3O5ZA 2YDLA 1UG1A 2BTTA 2KXDA 1PNJA 3VS6A 2D1XA 1WXUA 2MOXA 2DL5A 2CREA 1S1NA 2EGEA 3VRZA 1NEBA 1JU5C
chains in the Genus database with same CATH superfamily
1M30A 4AG1C 4OMQA 1AWOA 5IXBA 1YP5A 3QUIA 2XMFA 1OQKA 2HEQA 2CP3A 1QCFA 2NUTB 2A36A 3UA6A 1YJ9Q 2K5IA 3X28B 2DJQA 5FLXE 2FL7A 5CO7A 1K9MC 3FB9A 3S3OA 2OAUA 3RKWA 4C0FA 5GJVB 2YUOA 3L42A 2HBPA 1GFCA 1JB0E 2JTFA 3G71Q 1GBRA 2DL8A 2B86A 2AHJB 2RD1A 2JUFA 1EIFA 3HFNA 1LNXA 2QAZA 4HT9A 3FDRA 4PJOF 1UUEA 1S72A 3EG2A 4QKUA 1T3SA 2D9TA 2IG0A 2YLCA 2KNBB 3G7ZA 4LDXA 5GMKe 2SEMA 1X01A 4IIMA 1ZBXA 4M77C 4C92G 5LL6S 2VKNA 1ZUUA 2QA4A 4PJMA 2CSQA 2DJZA 2DTOA 5GAMh 3X20B 2CH4W 3PNWC 3JB9D 1WA7A 4D8DA 4FU6A 3RKXA 1QQJA 2OJ2A 3JV3A 4M77D 1BIAA 2DPPB 3CC7Q 4RTYA 1M5Q1 4PJOE 2HSPA 1H3ZA 1KHCA 3ER0A 4R0KA 1WQWA 2Y90A 5I22A 4M78A 1FMVA 5GMKj 3SWNC 2VGNA 2ZGWA 1NEGA 1I8FA 3MP6A 4F7UG 4V2SA 1ZLMA 3JSCA 3UATA 4D8KA 2A7YA 5FRMA 2KK4A 3ASKA 1NZ9A 2M0OA 1MV3A 3CBOA 3CPFA 1KC8R 2X4WA 3G4SA 1RAFB 1VQ7A 4M78B 2X4XA 2KE9A 2G3RA 4FYYB 2JZ2A 2D8HA 5J3BA 4RUGA 1E6HA 4BE0A 3QDFA 3CMET 3QJ6A 3A5ZB 3D7SB 3GNGA 3CCUA 1AOJA 3EFSA 1EFNA 4M7AA 2DBKA 2K3YA 5KYWB 4PLLA 1NG2A 1ZUYA 1PC0A 3A8OB 2FO0A 2V8KA 3R6OA 3CC4T 3JCMb 1Q82C 3DKMA 2DILA 2A0FB 3LYIA 4C8QC 3UA7A 3OY9A 4F16A 1UGQB 1CKBA 3EFOA 4LD6A 1UJYA 2V26A 2QYZA 1QVFP 1AWJA 2DM1A 3VS0A 4QVZA 4LN2A 1Y96A 3EFOB 5GAMe 1MMAA 4C92B 2EPDA 4LDYA 1TS9A 4C5EA 2RI3A 1Y96B 2E70A 8AT1B 2VYTA 1VQNQ 2X51A 4EMKC 2DE0X 1OEBA 3KBGA 2KEAA 1WJRA 3CMAA 2RO0A 5GAMj 3VYGA 4AFSC 3VKIA 4A4KA 4PJJA 1YHQQ 4BDYA 4C8QF 4F7UB 3CD6A 2O9VA 4XTVA 1YI2A 3JCMd 1R0CB 2LDMA 1QP2A 4QQGA 1BI0A 3G6ET 4JZ4A 1RAGB 2YT6A 4OB1B 2QQSA 2DNUA 1G3WA 1M90R 2E5KA 2PVGB 2E3HA 1SEMA 1M8VA 1EX4A 1K4US 5AYFA 1OV3A 3V8KA 3I56A 2AK5A 5I21A 4M75C 2GF7A 3CC4Q 4HCCA 1H8KA 3KFVA 2KI7A 1C6VX 3CCUT 2RHIA 2OTLQ 5GAN7 2YHTA 2CUDA 2KDSA 2LMJA 4C8QE 5GAN4 1BB9A 5LJ5f 2P0KA 2VGMA 1VQ9A 2GBQA 4DBHA 4ATOA 1Y07A 4IUPA 3JCMQ 2OTJA 2RQUA 3EG9B 1QW1A 1G5VA 2CZ1B 1VQ5A 5D6WA 4DEXA 3JB9J 4XU0A 3H6ZA 2KGTA 1QVGS 1W2BA 4MMLA 3I5RA 4BD3A 1WXTA 1X75C 3CCRQ 5GAN5 4AMCA 3VUBA 1BCOA 1UGRB 1K9AA 4M75F 2CP6A 1VQ6Q 1JQQA 1SSHA 1RABB 1U1SA 3QPHA 2AT1B 3QZ5B 2JVVA 4J83A 5GAMg 2DFUA 1BK2A 3E2UA 1D1BA 2CH4A 3G6EQ 1NPPA 2JW4A 2LX7A 1KC8C 2V1QA 3REBB 2JM8A 3PIOA 2LNVA 3C95A 2XDDA 2RB6A 1HYOA 3PT9A 1M4ZA 1PWTA 1ZA1B 3CEYA 4OGCA 4ZGJB 1YI2T 2LNHB 1M27C 2ZPIB 4LUEA 4N4HA 1VQMT 1D09B 4M75E 2DD4A 3CCEA 5KCHA 2PVOB 3QSUA 1FMKA 4RG8A 2L8DA 1XQHA 2GGRA 2HQHA 2IIMA 1R77A 1U8RA 3I56T 2QQRA 3NHNA 4L5GA 4C5IA 1M9SA 1YWOA 2H8HA 2H3JA 1G83A 4A4EA 3UDCA 1O9SA 1NLPC 1W2BP 1PHTA 2J06A 4M78D 1JXOA 1IXDA 1K0XA 1MUZA 2KROA 2KAFA 3CC2T 4E7HA 1VQ9T 5GAOp 4N4GA 4QQDA 1YJ9A 5I2MA 2C06A 2DO3A 2EGCA 2X35A 3PE0A 4C0DC 3EGUA 5GAMd 3P8HA 2X4JA 1LOJA 3SDZA 2RPNA 1W4SA 4J9GA 3G71A 4GY5A 5HK3A 5IH2A 1YFNA 2LRQA 1N9SA 4RTZA 3MPUB 1OYXA 2BUDA 3BDLA 1HSQA 2EJFA 3T9NA 5CKDA 1K9MU 4C92C 4A4HA 5IXFA 2ZCFB 2JMCA 2QDLA 4DQ2A 2L3PA 1OZ2A 1E7OA 1G3TA 3OB9A 5CKEA 1PD1A 1PRMC 3L2VA 4FYWB 1G3YA 1VYUA 3FRNA 4J8OA 2MK5A 4FT4A 1I5OB 5C0MA 2O01E 3P8BB 2DTHA 1UG1A 1VQMQ 3V7CA 3VS6A 4JRQA 2D1XA 4JLGA 3OSSC 2DL5A 1S1NA 1M90C 2ZZDA 3CCJT 1LVKA 2FB7A 2QEXT 2CZ6B 1K8AR 3VRZA 1NEBA 2E1HA 1JU5C 2E12A 1QMCA 4X1VA 4IIOA 5IHNA 2M16A 3M0TA 4LDVA 1ARKA 3CC7A 2PUOB 2DL4A 2KVQG 3O8VA 3S6WA 4HA8A 2DAQA 3CCET 2CSIA 3TCJA 1K8AU 3GLXA 4C92F 4O5VA 3PMIA 1N5ZA 1ZQ1A 3CC2Q 2CP0A 1VIEA 4CC4B 4E7IA 3RNJA 2C0OA 4PLIA 1VQPT 1BBZA 3QXEB 1JJ2A 2IPOB 2YUPA 1RI9A 1KQ1A 3GNFB 4NL2A 2E6ZA 2ZPGB 1SRMA 5GANf 3H0HA 1VQOQ 2EQJA 1VOMA 2XKOC 2LQNA 1YCSB 1YJ9T 4F7UF 2YSQA 2DXUA 1N8RR 3QO3A 2JXBA 3V8LA 4J9BA 4DBQA 4OMMA 4AFQC 4IUUA 1LPLA 1V1CA 4C92E 1AD5A 1TWBA 1I0CA 2HDAA 2MCNA 2Y4YA 4J9EA 2PNIA 1NBEB 2QASA 2MAMA 1BI2A 1NYFA 4KGZB 3OW2P 2R58A 2EBPA 2GFAA 1ZSGA 5FU6B 2P0QA 2VWFA 2QK0A 4R55A 3INZA 3VUZA 5CVIA 2L2PA 3CCSQ 3OYYA 5D6XA 3CCJQ 2F2XA 3HPWA 4QT7A 1TU0B 1NYGA 2RHYA 6AT1B 2NUPA 3FJPA 2CGHA 4F7UE 4ZGDB 1ACMB 2MI6A 5IN1A 3GP8A 1VQNA 2KBTA 1RAIB 2HNIA 4F17A 5I2SA 1AWXA 3V8JA 1BCMA 1WHMA 2HQEA 1Y0MA 1IB8A 2O2OA 5CQXA 4QVDA 2MWPA 1QCOA 4ELYC 3NFCA 3VU3C 3OYDA 1M2VB 1YHQA 1Q81C 3CXCP 5GAOr 1GFDA 1IREB 1WPYA 3TQ7P 2C0IA 1VQPQ 4FW1A 2XU8A 2KRSA 2HZYA 3E19A 4E6RA 5CQYA 1YJNT 4M78G 2KMTA 1FX7A 4A63B 5FU7C 3UF4A 4CRIA 4HVVA 2NUZA 3OYLA 1KIKA 1KQSP 3CC4A 3HSBA 3MP8A 4C5GA 4WTOB 1YITT 2KRMA 4Z8AA 2VVKA 1Z9QA 1QWFA 3C94A 2OTLA 2G6FX 2KXCA 2L5QA 1RL2A 4J6WA 1HJDA 2CYZB 5LJ5h 1D0YA 3CBPA 3CCLQ 1Q86R 3GOXA 3DB3A 4M7AG 3JCMc 4JS4A 2JMAA 3N5BB 3FC3A 4DEYA 5C6SA 2A08A 2CT4A 3QYHB 1OX9A 2KYBA 4ESRA 2M1HA 4N0AA 1WJQA 2DA9A 3LH5A 2PTKA 4DOVA 2O4XA 4FL6A 4DOWA 4LUDA 3EHRA 3CCRA 3OS2A 3H8ZA 4Z88A 1OPKA 1X6GA 1K8AC 1QVFA 2M51A 1VQ6A 3M0PA 2O4XB 2FRWA 1AHJB 3E1SA 3EH1A 4HKEA 1WDXA 4F04B 4X9DA 1VQNT 1M1FA 1ZBJA 2ECZA 4BY6B 1BIBA 3L2QA 3G6EA 4JZ3A 2RNAA 2JT4A 4P5NA 3V7RA 4EMGA 1UFFA 1YJNQ 3SHWA 5KE3A 4XAXB 2EGAA 3FJ5A 1K0SA 1A0NB 1WX6A 2LCSA 3BY7A 1YHQT 4MZTA 2BE9B 3M0QA 1MNEA 2EJGA 1BI3A 4MDXA 2LVMA 3VS5A 3JB9F 2DBMA 2X3WD 1JRIA 4J6YA 1HD3A 5GJWB 1YITQ 3QBYA 4M77F 1M3BA 1KC8U 2FPEA 4E7ZA 3JCMP 3RIRA 4GBQA 1X2QA 2OX7A 2DEUA 3CCMQ 1N8RC 1NPRA 3JCMf 3CBMA 4PNOA 1MNDA 1X69A 4PFPA 4KH1B 2DXTA 3CPWA 4M7AB 1LJOA 1G8XA 2OTLT 2WSCE 3M0UA 2RF0A 3MEVA 1SKUB 5KE2A 3NGPA 2X3XD 1X27A 4PK4A 2MIOA 1RLPC 5LJ5j 4F14A 2EYWA 2KR3A 4CC3A 4OMOA 2K3BA 3M55A 4M77E 3HFOA 1AWWA 3ZL7C 1KFZA 1VUBA 2K2MA 1GCQC 4AG2C 1QWEA 3M58A 4RTWA 2SRCA 2DKGA 4BE1A 5FU6C 4RTXA 4C0ZA 3CCRT 1RAEB 3NTKA 1XJWB 4HVWA 2JS0A 2ENMA 1VQ6T 1UHCA 2DL7A 4KUIA 1ZSZA 5ECAA 4GLMA 2MWOA 1AZEA 3C4SA 2ROTA 2O88A 4MZPA 2JOYA 2EQUA 1TSFA 1VQMA 1ZSZB 3M4GA 3X26B 1TOVA 2PVDB 4KULA 5GAN6 3GBQA 1IO6A 4M7DA 4A54A 3QWXX 3CPWP 1T3LA 2EQKA 2RMOA 4HVUA 1JEGA 1OPLA 2QG9B 4BDZA 2P0PA 4M7DB 4LNPA 1UEBA 4ANJA 3VS7A 3EFRA 1M90U 3JAME 2JM9A 2AKKA 2V8JA 3TREA 3WVDB 3OYCA 1Q86C 4FW2A 4RMOA 3CC2A 2FYKA 1G2BA 1UJ0A 2M9UA 1QVGA 4JS5A 2XICA 1B07A 4AT1B 5CCAA 2ZPHB 3IQLA 4B9WA 1PD0A 5LJ5g 3HL8A 2EW3A 3M54A 2K9GA 2CUBA 3THKA 3NTHA 5GANh 4EIKA 2NWMA 4IUTA 4RTUA 5GMKm 1LCKA 3OYEA 1T0HA 5KYUA 3WXMB 3ME9A 3O5ZA 2XD0A 2YDLA 3M57A 1PNJA 2COWA 1WXUA 2MOXA 2P4TA 5KYUB 2CREA 2DK3A 1N27A 3OYGA 3RKYA 2EGEA 2XI9A 2BE7D 3QIIA 4HXJA 4ZNXA 3QDRB 1CKAA 3HRTA 2GQVA 2M02A 2X4YA 3PVQA 3PGGA 4J5YA 4JDSA 2YRDA 1PSEA 2KRNA 2K79A 3CCSA 3OYMA 2F5KA 3CCJA 1U5SA 1GCPA 4OMFB 2QEXA 4JUVA 2X9HA 4A53A 1Y57A 1T0JA 2C0TA 3L1AA 1WYXA 2YRVA 2V1RA 4IUQA 1U3OA 2CZ7B 1M3CA 4MZMA 3VS2A 1F1BB 2I0NA 3M0RA 2VV5A 4XU3A 4PJOA 1QVGP 4YTLA 2LT4A 2D8JA 3CCVT 2GQIA 4J6XA 1WLPB 2FZGB 1VQLT 4C5HA 3A1PA 4M78C 3PTAA 2KT1A 2R57A 3TEEA 2J05A 5LJ5d 3UPUA 2E4HA 2DXCA 1Z9ZA 1Q81R 1WHKA 5GAN8 1M2OA 1QLYA 1VQPA 2FEIA 2DD5A 1RAAB 1WNLA 3DLMA 3OSVA 4JJDA 3OYNA 3QKJA 5GANe 2YRCA 2QTXA 1YJWQ 3RESA 1TTHB 1YCYA 1Q81U 4OMPA 4A4FA 4QW2A 3MHXA 4NL3A 2LQKA 4E7LA 4M7AC 3NMZC 2DVJA 1PKSA 2ZPEB 2EJ9A 4JRIA 3JCMW 2VASA 3VS1A 1K1ZA 3MO8A 3FEOA 1I07A 1VQOT 2K5FA 2L3QA 4WF2A 3OS1A 4CC7A 5GANj 4FSSA 4M78F 2DX1A 4M7AD 1UGSB 5FW9A 3OYBA 4J7FA 1UE9A 2E6NA 1XTDA 4N4IA 2E65A 2VC8A 1UHFA 1X43A 3U23A 1WFWA 2HSEB 5FROA 4J7IA 5LJ3f 1JBMA 1WJSA 1WIEA 2A3LA 4BI3A 2PQWA 3OW2A 1WI7A 4E7SA 3CCST 3CCVQ 2RHUA 1VQLQ 4M7AF 4KGXB 5D7UA 5KYYA 4FM4B 5J39A 2F2WA 4M78E 2BIVA 7AT1B 1KD1R 2COYA 4X9CA 3OMGA 4DBFA 3M5AA 2HKNA 2WACA 2K57A 3SEMA 2J6OA 1YJNA 1UGPB 2EQIA 5GAN3 3V7SA 3RDVA 1FXXA 1SG5A 3HRUA 1U06A 2JNGA 2EYQA 5IT9E 1SRLA 1R0BG 1TH7A 4TVRA 2CDTA 1YITA 4M7AE 2EVRA 4WCIA 3CXCA 1ABQA 4XK8E 3TVTA 1KK7A 4AFZC 3QJYA 2FZKB 3EAEA 4RCCA 4PKCC 5AT1B 3CCMA 4RG2A 4C8QA 4EDUA 4M7DD 3JCMh 3EHQA 1ZHIA 3L2ZA 3RMSA 2BZ8A 4MMKA 1XNIA 5CIUA 3MEUA 3QHSA 2COZA 1WHGA 5GANg 3OS0A 4PL6A 1GRIA 2EFIA 2R5AA 1MMGA 1H3HA 2JTMA 2XDBA 1KQSA 1WHHA 1ZX6A 4NOYA 4OMNA 5HK0A 1N8RU 4JRKA 1PRLC 3EGDA 3CCLT 3VYHB 4XQ3A 2RJCA 3JB9I 3ULRB 3L2RA 1QKXA 1JJ2S 2FG0A 4BI8B 1VQ4Q 1X6BA 3SFMA 2HMAA 3QWYA 2DYIA 2F2VA 3EGDB 3I55Q 4PJLA 1XOVA 4PFZA 5KYXA 1B3QA 3UWNA 4EMKA 4HT8A 4KUDK 4OP0A 1RLQC 1E6GA 2YLBA 3EGXA 3M9QA 1HK9A 3X25B 4BB7A 1I5LA 3MKDA 3TU4K 3AHUA 1HXDA 4Y92A 4CI0C 2EYXA 2RN8A 3BDUA 4RTVA 1X2KA 2NUPB 1SHFA 3EGXB 4L6V5 4VUBA 3PFSA 4XTXA 2K2VA 3RERA 1MMNA 4JJNK 4Q5WA 2RQVA 1YIJQ 3LH0A 2MPXC 1VA7A 1H92A 3J7AF 2DVEA 4LXCA 1I1JA 1K73R 1QKWA 1PG5B 1NM7A 1PKTA 3ZBDA 1D3BA 4AFUC 5GAOm 2VUBA 2LQ8A 4OB3B 2GTOA 4J9CA 4M75A 1QP3A 1YWPA 1B34A 2ED0A 1K73U 5GANd 4J9HA 4XU2A 1D3BB 2CP5A 1GL5A 4PFOA 3WVEB 2NUTA 3OMCA 2L3RA 2RHZA 2YXYA 4JPBW 4JRPA 1SF9A 2FHDA 3CQTA 4PJOD 1IZ6A 1W6XA 4PJNA 3L2WA 3URGA 3VS3A 2V8IA 1MHNA 3CCMT 5GAN2 1TG0A 3OBYA 3JCMX 3OYFA 5FWBA 2O9SA 3LW5E 3NPFA 3CCQT 1SPKA 4FYXB 1Q86U 2CKKA 2OI3A 2L0AA 5HY6A 3VRYA 2FPFA 2DIGA 1UDLA 4KBMB 1H641 2LT1A 5CR2A 3LWHA 4II1A 2NLUA 1YNZA 1IHWA 1BU1A 3A8MB 2LJ3A 4FT2A 5DY9A 3S3NA 2JS2A 5EC7A 1NE8A 3JCMV 2ESWA 4OB0B 4QVCA 2A37A 1NLOC 1KD1C 3LLRA 4IUVA 4M4ZA 3SB2A 2EKHA 3VV0A 3M59A 3MEAA 1I81A 1VQKQ 4E7KA 3AT1B 5HKCA 4LD9K 4J9FA 4A4GA 1J3TA 2VXEA 4FSXA 4ZGEB 3OQ5A 2HD0A 1U1TA 1Q7YC 1ZUKA 2A28A 2YUNA 5GAOn 3I5SA 3I9QA 4JJCA 2K3XA 3LX7A 9ATCB 3LWIA 2DZCA 1JXMA 2DLPA 2J6KA 2AIRB 2D6FA 2JJ9A 1QVFS 4ORZA 5IHIA 3R6NA 2QXFA 3I35A 5LJ5e 5DLOA 5J26A 2EYYA 3JB9H 1R8OB 3OA6A 3BFMA 4M7DG 1AEYA 1M1KC 2MYSA 2EQMA 1VQ8T 4KT0E 4C0GA 5KYWA 4HCKA 2GCXA 3CCQQ 3M53A 3JCMg 5GMKl 3GIBA 1BKBA 2BTTA 1YJWA 1KQ2A 4Z02A 4OF1A 4EPCA 2RJEA 1EZZB 2QDYB 5L23A 1AVZC 4RTTA 5M9OA 4BI4A 1X6OA 4C0DB 2XDPA 2KT8A 2LCCA 2LZ6B 4C92A 4OVAA 2CS7A 4ZN3A 2RK2A 3A8LB 1KJWA 2LP5A 3H9NA 1S72T 1C0MA 1MV0B 2QQBA 3EG3A 2BKDN 2R5MA 4C8QD 4FIBA 5CKFA 3CPWS 1YBYA 2HKQB 4NS5A 4E7JA 2LX9A 4XTZA 3A8HB 3LGFA 5FRNA 3MJXA 1K73C 4L59A 2RQRA 5LJ3h 2QA4T 4F7UA 1UB4A 3OS5A 1C1AA 1B7TA 3L2UA 2DEQA 1NJIC 3EG1A 3CCVA 1VQLA 2ROLA 2P4RA 3SD4A 3X24B 2WSFE 3KUFA 3RBBB 4KGVB 4D6WA 1VQ8Q 4OB2B 3CMEQ 3GF5A 2RK1A 1TUDA 2GTJA 2BZXA 4X34A 4PJOG 2PUKB 2L89A 3G4ST 1VQ7T 1V29B 1PM3A 5A0GA 8ATCB 3KXTA 1FMWA 3HP9A 4ZTFA 1CSKA 2E10A 3EG9A 2RHXA 2E5QA 1GBQA 2YUQA 1YJWT 3META 2KSSA 1VQOA 4BE2A 2J6FA 2DIQA 2ZAEA 4M75D 3MEWA 3DB4A 3NTIA 1S72Q 3FIFA 2NYSA 3Q1JA 2CT3A 2EIFA 1W70A 3OYIA 4E2FB 5GAOq 4ZTJA 1FWZA 4ELZC 4B6MA 1RACB 2QQAA 5FWCA 2QQ9A 4MDWA 2O31A 1OU8A 1ABOA 1IHVA 2P84A 3RUXA 5LJ3e 3J80E 3TSZA 5I11A 2QA4Q 4JLIA 4N0AC 3P8DA 1O75A 4Z89A 2RJDA 4RCBA 3EG0A 1OI1A 3J81E 1K76A 3E9FA 5GAMf 5HCKA 1VQ4A 2K4YA 1TXQA 3JB9G 2LTOA 1BYMA 1WGSA 3I55A 5KH6A 4J9IA 1G3SA 4M77G 1W2BS 3C0CA 3RR6A 3A8GB 2RA2A 1N9RA 3ZEHA 2KY9A 2CZ0B 4BY6C 4QQ6A 1M3AA 1P92A 2VXFA 2MF2A 5LJ3j 3CMAT 4LDWA 1QVPA 5D6YA 1QCNA 3G4SQ 3S3MA 3CD6T 1VQ7Q 1IGUA 1KSWA 1YIJA 2ZPBB 4PJOB 2RQWA 2OAWA 2K6DA 5EG2A 2XHCA 2F5TX 5CK9A 4IKFA 2HCKA 1OU9A 2DYBA 4DBRA 2GFUA 4KH0B 3CCUQ 3M56A 5A2QE 2I2LA 2HL5C 4OGEA 4FCYA 1TUCA 4XTWA 2QGGA 2W0ZA 2DF6A 3HHTB 5FU7B 3E9GA 2Z0WA 1VIFA 3EH2A 4KRTA 2XIDA 5L8RE 5A0LA 5IHKA 2ED1A 3QG1A 3QZ9B 5CKBA 1SSFA 2E3IA 2IVWA 3C12A 1UECA 5KYNA 4OMLA 3RMQA 3HRSA 3CCLA 1WZOA 1FYNA 3UT1A 1UTIA 2RM4A 2OTJT 4XU1A 2DRMA 4C8QG 4DA4A 4UC4A 2CP7A 3BW1A 3M0SA 1K9MR 2F1LA 2EAYA 1VQ5T 3OYHA 2AZVA 5GMKi 4M77A 3MCAB 3OYAA 3OYJA 2LC4A 3OBWA 1Q95G 2AKLA 2GNCA 2ZPFB 1M1GA 2J7IA 2ABLA 4M77B 2Y4XA 1I4K1 2FPDA 2DRKA 1VQ4T 4XTYA 3CMAQ 1N6AA 2KYMA 3A98A 2RI5A 3PVLA 3I55T 2PZ1A 2K7AA 2DL3A 3VS4A 5LJ3g 3M4YA 2E64A 3CD6Q 3MP1A 4XTUA 3SWNA 1MMDA 2EKOA 2PU9B 3DLLA 1YI2Q 4C92D 3H41A 1KG1A 1ZSZC 4Y91A 5GAOl 4HCZA 1RAHB 3BE3A 5DLQE 1WHJA 2VB6A 1WHLA 5KYYB 1VQKA 5IAYA 3SWNB 2YWWA 1RUWA 2LQWA 2AZSA 2HBWA 3FLGA 1YIJT 1JO8A 3QYGB 2M0YA 1WXBA 5CAIA 1KD1U 3I56Q 1RI0A 2FRYA 3ZFJA 4M7DC 1Q7YR 2HL3A 4Y28E 1D0XA 4J9DA 3OW2S 1PSFA 1OULA 2XG8D 1PCXA 2QI2A 1Y71A 1YN8A 2D0QB 2E41A 2LJ0A 1Q7YU 1VQ9Q 1OZ3A 4M75G 3OYKA 4R56A 4B9XA 3HKSA 2DXBA 2OTJQ 1MGQA 2CP2A 1AT1B 1M1KR 3JRZA 1UGVA 1OOTA 1VQ5Q 3CCQA 4C8QB 1IRXA 3H0IA 2DZ9A 3JCMJ 1D1AA 3VJPA 5DM7R 2W10A 2EWNA 2XK0A 4K11A 1M1KU 2EYZA 2WSEE 5A0DA 5LJ3d 1GCQA 2JTEA 5KCOA 3H0FA 4GLKA 2FZCB 1AZGB 1Q82R 3GPLA 3CXCS 4M7DF 2K5LA 2JN0A 1IGQA 3HTRA 3G71T 2D0NA 5CKHA 4O6JA 1M8MA 4LDUA 2HAXA 4E47A 2RI2A 4CC2A 1TUGB 1WQ7A 4BUGA 3G1JA 2HQXA 1VYVA 2MMPA 1Q82U 1D0ZA 5KYXB 1OX8A 4EMKB 1VYTA 1D1CA 1W1FA 2QTVA 2DERA 4BACA 1RADB 2KQWA 2B8AA 2DETA 3REAB 1V76A 4FYVB 4LE9A 2RH2A 1KQSS 3F70A 3TSWA 2QEXQ 2RQTA 4RKUE 1SHGA 3PMTA 2LJ1A 2QGFB 2ATCB 5GMKh 1M2VA 2BZYA 2DMOA 3CCEQ 2F69A 4M7DE 4ZN1A 1BI1A 1VQKT 1JJ2P 3LGLA 2FVUA 1KHIA 4IURA 1NJIR 2L3SA 4PJOC 3JCMe 1DJ7B 1ZA2B 1Y7XA 2KXDA 3CC7T 2LCLA 4HCBA 2RJFA 4M75B 4EMHA 2H3EB 1GXIE 4ME7A 1B34B 2DTIA 1VQ8A 1NJIU 3PIPA 3CMEA 4JJBA
chains in the Genus database with same CATH topology
1M30A 4HXJA 4OMQA 4AG1C 4ZNXA 5L23A 1AVZC 4RTTA 4IIOA 4X1VA 1AWOA 5IXBA 5IHNA 1YP5A 3M0TA 1CKAA 1ARKA 2KT8A 2DL4A 2XMFA 2HEQA 3PVQA 2LZ6B 1QCFA 3UA6A 2A36A 2KRNA 2DJQA 2K79A 2CSIA 1U5SA 1GCPA 1KJWA 2LP5A 1MV0B 5GJVB 1Y57A 1T0JA 2C0TA 2YUOA 3EG3A 1N5ZA 1WYXA 2V1RA 1GFCA 1U3OA 1M3CA 3VS2A 2DL8A 4CC4B 1GBRA 2I0NA 2C0OA 3M0RA 2B86A 3RNJA 1BBZA 2YUPA 2D8JA 2GQIA 1WLPB 1RI9A 1UUEA 2RQRA 3EG2A 2KT1A 2J05A 1SRMA 1T3SA 3H0HA 1Z9ZA 1QLYA 2FEIA 2LQNA 1YCSB 3EG1A 2YSQA 2KNBB 2JXBA 2SEMA 4J9BA 4OMMA 2ROLA 2P4RA 4IIMA 4AFQC 4JJDA 1V1CA 2VKNA 1ZUUA 1AD5A 2CSQA 1I0CA 2HDAA 2MCNA 4J9EA 3RBBB 2PNIA 4OMPA 1NYFA 2CH4W 2EBPA 1WA7A 4D8DA 1TUDA 3NMZC 2GTJA 2OJ2A 2BZXA 1ZSGA 2DVJA 1PKSA 2VWFA 3JV3A 4RTYA 2HSPA 3VS1A 1K1ZA 2L2PA 1I07A 4R0KA 5I22A 2L3QA 2F2XA 4CC7A 4QT7A 1NEGA 1NYGA 1ZLMA 4FSSA 3UATA 4D8KA 1CSKA 2DX1A 1MV3A 2KBTA 5FW9A 4F17A 1GBQA 2YUQA 1UE9A 2KE9A 1AWXA 4JJBA 2J6FA 1Y0MA 2D8HA 2O2OA 1UHFA 4RUGA 1X43A 3U23A 1E6HA 1WFWA 2CT3A 1W70A 1AOJA 1GFDA 1WIEA 1EFNA 2C0IA 5FWCA 2DBKA 2KRSA 2O31A 1WI7A 1ABOA 1NG2A 1ZUYA 4E6RA 2FO0A 2DILA 3TSZA 5I11A 3UA7A 2F2WA 4A63B 4Z89A 4F16A 3UF4A 3EG0A 1K76A 1CKBA 5HCKA 4HVVA 2NUZA 1UJYA 1KIKA 3SEMA 4J9IA 1AWJA 2DM1A 3VS0A 4LN2A 2J6OA 2KRMA 4Z8AA 3C0CA 2VVKA 2EQIA 1Z9QA 1QWFA 2G6FX 2KXCA 1M3AA 1HJDA 1U06A 2EPDA 1SRLA 2CDTA 2JMAA 2EVRA 4WCIA 1ABQA 1KSWA 3TVTA 2DE0X 1OEBA 4DEYA 2A08A 2CT4A 4AFZC 2KYBA 2RQWA 2KEAA 2OAWA 2K6DA 4ESRA 2DA9A 3LH5A 3EHQA 2HCKA 2PTKA 2BZ8A 2DYBA 4AFSC 4LUDA 3EHRA 1TUCA 2O9VA 1GRIA 2W0ZA 4Z88A 2DF6A 1OPKA 1H3HA 1X6GA 1ZX6A 4OMNA 2M51A 3M0PA 4JZ4A 4KRTA 1PRLC 2FRWA 3ULRB 5IHKA 2ED1A 1QKXA 2YT6A 1WDXA 2DNUA 2FG0A 2E5KA 1SEMA 1X6BA 1UECA 1K4US 1ZBJA 3QWYA 2ECZA 4OMLA 1OV3A 2F2VA 2AK5A 1XOVA 1B3QA 4JZ3A 2RNAA 2JT4A 1UFFA 1H8KA 1RLQC 1E6GA 1FYNA 3KFVA 3SHWA 2EGAA 1UTIA 3FJ5A 1K0SA 1A0NB 1WX6A 2DRMA 2LCSA 3M0QA 2CUDA 2LMJA 3M0SA 4Y92A 1BB9A 2EYXA 2RN8A 3VS5A 4RTVA 1X2KA 2AZVA 1SHFA 2DBMA 2X3WD 2GBQA 1HD3A 5GJWB 1M3BA 2RQVA 2RQUA 2AKLA 2FPEA 1VA7A 1H92A 2GNCA 2J7IA 2ABLA 1I1JA 4GBQA 1X2QA 2FPDA 2DRKA 1QKWA 4DEXA 1NM7A 1X69A 2KYMA 3A98A 3PVLA 1PKTA 2KGTA 2PZ1A 2K7AA 2DL3A 4AFUC 3VS4A 3I5RA 2GTOA 1WXTA 4J9CA 1YWPA 2ED0A 3M0UA 2RF0A 3H41A 4J9HA 1K9AA 3NGPA 2X3XD 1JQQA 1X27A 1SSHA 1GL5A 2MIOA 1RLPC 4F14A 2EYWA 2KR3A 1RUWA 4CC3A 4OMOA 2LQWA 2AZSA 2K3BA 4JPBW 2HBWA 1JO8A 2M0YA 1WXBA 3CQTA 1BK2A 1W6XA 1AWWA 3ZL7C 2CH4A 2FRYA 3VS3A 1KFZA 2K2MA 1GCQC 2JW4A 4AG2C 1QWEA 2LX7A 1TG0A 4RTWA 2V1QA 2SRCA 4J9DA 3REBB 2JM8A 5FWBA 4RTXA 2O9SA 1PWTA 3NPFA 1SPKA 1YN8A 2LJ0A 2LNHB 4HVWA 2OI3A 2JS0A 2L0AA 1M27C 4LUEA 2ENMA 3VRYA 1UHCA 2FPFA 1UDLA 2DL7A 5ECAA 1YNZA 1FMKA 1BU1A 4GLMA 1UGVA 2GGRA 1OOTA 2IIMA 2ROTA 2O88A 1AZEA 3H0IA 2LJ3A 2JS2A 3NHNA 5EC7A 2W10A 2ESWA 1YWOA 2H8HA 1G83A 4K11A 3GBQA 1NLPC 1IO6A 1NLOC 2A37A 2EYZA 1GCQA 1PHTA 2JTEA 3H0FA 3QWXX 4M4ZA 1T3LA 2J06A 1JXOA 1AZGB 2EKHA 1K0XA 1MUZA 2RMOA 2KROA 4HVUA 1JEGA 1OPLA 2D0NA 4LNPA 1M8MA 4J9FA 1J3TA 4CC2A 3VS7A 2EGCA 1VYVA 2JM9A 2AKKA 3PE0A 3EGUA 1ZUKA 2A28A 1VYTA 2YUNA 1W1FA 3I5SA 3I9QA 2RPNA 4JJCA 1G2BA 1UJ0A 4J9GA 3REAB 4LE9A 5IH2A 1JXMA 2DLPA 2J6KA 4RTZA 1B07A 3TSWA 4ORZA 5IHIA 2RQTA 3R6NA 1HSQA 3I35A 3IQLA 1SHGA 2LJ1A 2EW3A 2EYYA 5IXFA 2K9GA 2CUBA 2JMCA 3THKA 2QDLA 2L3PA 2BZYA 2DMOA 1E7OA 4EIKA 1AEYA 2NWMA 4RTUA 1LCKA 1PRMC 1VYUA 1T0HA 4HCKA 2L3SA 3O5ZA 2YDLA 1UG1A 2BTTA 2KXDA 1PNJA 3VS6A 2D1XA 1WXUA 2MOXA 2DL5A 2CREA 1S1NA 2EGEA 3VRZA 1NEBA 1JU5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M30 A;  4HXJ A;  4OMQ A;  4AG1 C;  4ZNX A;  5L23 A;  1AVZ C;  4RTT A;  4IIO A;  4X1V A;  1AWO A;  5IXB A;  5IHN A;  1YP5 A;  3M0T A;  1CKA A;  1ARK A;  2KT8 A;  2DL4 A;  2XMF A;  2HEQ A;  3PVQ A;  2LZ6 B;  1QCF A;  3UA6 A;  2A36 A;  2KRN A;  2DJQ A;  2K79 A;  2CSI A;  1U5S A;  1GCP A;  1KJW A;  2LP5 A;  1MV0 B;  5GJV B;  1Y57 A;  1T0J A;  2C0T A;  2YUO A;  3EG3 A;  1N5Z A;  1WYX A;  2V1R A;  1GFC A;  1U3O A;  1M3C A;  3VS2 A;  2DL8 A;  4CC4 B;  1GBR A;  2I0N A;  2C0O A;  3M0R A;  2B86 A;  3RNJ A;  1BBZ A;  2YUP A;  2D8J A;  2GQI A;  1WLP B;  1RI9 A;  1UUE A;  2RQR A;  3EG2 A;  2KT1 A;  2J05 A;  1SRM A;  1T3S A;  3H0H A;  1Z9Z A;  1QLY A;  2FEI A;  2LQN A;  1YCS B;  3EG1 A;  2YSQ A;  2KNB B;  2JXB A;  2SEM A;  4J9B A;  4OMM A;  2ROL A;  2P4R A;  4IIM A;  4AFQ C;  4JJD A;  1V1C A;  2VKN A;  1ZUU A;  1AD5 A;  2CSQ A;  1I0C A;  2HDA A;  2MCN A;  4J9E A;  3RBB B;  2PNI A;  4OMP A;  1NYF A;  2CH4 W;  2EBP A;  1WA7 A;  4D8D A;  1TUD A;  3NMZ C;  2GTJ A;  2OJ2 A;  2BZX A;  1ZSG A;  2DVJ A;  1PKS A;  2VWF A;  3JV3 A;  4RTY A;  2HSP A;  3VS1 A;  1K1Z A;  2L2P A;  1I07 A;  4R0K A;  5I22 A;  2L3Q A;  2F2X A;  4CC7 A;  4QT7 A;  1NEG A;  1NYG A;  1ZLM A;  4FSS A;  3UAT A;  4D8K A;  1CSK A;  2DX1 A;  1MV3 A;  2KBT A;  5FW9 A;  4F17 A;  1GBQ A;  2YUQ A;  1UE9 A;  2KE9 A;  1AWX A;  4JJB A;  2J6F A;  1Y0M A;  2D8H A;  2O2O A;  1UHF A;  4RUG A;  1X43 A;  3U23 A;  1E6H A;  1WFW A;  2CT3 A;  1W70 A;  1AOJ A;  1GFD A;  1WIE A;  1EFN A;  2C0I A;  5FWC A;  2DBK A;  2KRS A;  2O31 A;  1WI7 A;  1ABO A;  1NG2 A;  1ZUY A;  4E6R A;  2FO0 A;  2DIL A;  3TSZ A;  5I11 A;  3UA7 A;  2F2W A;  4A63 B;  4Z89 A;  4F16 A;  3UF4 A;  3EG0 A;  1K76 A;  1CKB A;  5HCK A;  4HVV A;  2NUZ A;  1UJY A;  1KIK A;  3SEM A;  4J9I A;  1AWJ A;  2DM1 A;  3VS0 A;  4LN2 A;  2J6O A;  2KRM A;  4Z8A A;  3C0C A;  2VVK A;  2EQI A;  1Z9Q A;  1QWF A;  2G6F X;  2KXC A;  1M3A A;  1HJD A;  1U06 A;  2EPD A;  1SRL A;  2CDT A;  2JMA A;  2EVR A;  4WCI A;  1ABQ A;  1KSW A;  3TVT A;  2DE0 X;  1OEB A;  4DEY A;  2A08 A;  2CT4 A;  4AFZ C;  2KYB A;  2RQW A;  2KEA A;  2OAW A;  2K6D A;  4ESR A;  2DA9 A;  3LH5 A;  3EHQ A;  2HCK A;  2PTK A;  2BZ8 A;  2DYB A;  4AFS C;  4LUD A;  3EHR A;  1TUC A;  2O9V A;  1GRI A;  2W0Z A;  4Z88 A;  2DF6 A;  1OPK A;  1H3H A;  1X6G A;  1ZX6 A;  4OMN A;  2M51 A;  3M0P A;  4JZ4 A;  4KRT A;  1PRL C;  2FRW A;  3ULR B;  5IHK A;  2ED1 A;  1QKX A;  2YT6 A;  1WDX A;  2DNU A;  2FG0 A;  2E5K A;  1SEM A;  1X6B A;  1UEC A;  1K4U S;  1ZBJ A;  3QWY A;  2ECZ A;  4OML A;  1OV3 A;  2F2V A;  2AK5 A;  1XOV A;  1B3Q A;  4JZ3 A;  2RNA A;  2JT4 A;  1UFF A;  1H8K A;  1RLQ C;  1E6G A;  1FYN A;  3KFV A;  3SHW A;  2EGA A;  1UTI A;  3FJ5 A;  1K0S A;  1A0N B;  1WX6 A;  2DRM A;  2LCS A;  3M0Q A;  2CUD A;  2LMJ A;  3M0S A;  4Y92 A;  1BB9 A;  2EYX A;  2RN8 A;  3VS5 A;  4RTV A;  1X2K A;  2AZV A;  1SHF A;  2DBM A;  2X3W D;  2GBQ A;  1HD3 A;  5GJW B;  1M3B A;  2RQV A;  2RQU A;  2AKL A;  2FPE A;  1VA7 A;  1H92 A;  2GNC A;  2J7I A;  2ABL A;  1I1J A;  4GBQ A;  1X2Q A;  2FPD A;  2DRK A;  1QKW A;  4DEX A;  1NM7 A;  1X69 A;  2KYM A;  3A98 A;  3PVL A;  1PKT A;  2KGT A;  2PZ1 A;  2K7A A;  2DL3 A;  4AFU C;  3VS4 A;  3I5R A;  2GTO A;  1WXT A;  4J9C A;  1YWP A;  2ED0 A;  3M0U A;  2RF0 A;  3H41 A;  4J9H A;  1K9A A;  3NGP A;  2X3X D;  1JQQ A;  1X27 A;  1SSH A;  1GL5 A;  2MIO A;  1RLP C;  4F14 A;  2EYW A;  2KR3 A;  1RUW A;  4CC3 A;  4OMO A;  2LQW A;  2AZS A;  2K3B A;  4JPB W;  2HBW A;  1JO8 A;  2M0Y A;  1WXB A;  3CQT A;  1BK2 A;  1W6X A;  1AWW A;  3ZL7 C;  2CH4 A;  2FRY A;  3VS3 A;  1KFZ A;  2K2M A;  1GCQ C;  2JW4 A;  4AG2 C;  1QWE A;  2LX7 A;  1TG0 A;  4RTW A;  2V1Q A;  2SRC A;  4J9D A;  3REB B;  2JM8 A;  5FWB A;  4RTX A;  2O9S A;  1PWT A;  3NPF A;  1SPK A;  1YN8 A;  2LJ0 A;  2LNH B;  4HVW A;  2OI3 A;  2JS0 A;  2L0A A;  1M27 C;  4LUE A;  2ENM A;  3VRY A;  1UHC A;  2FPF A;  1UDL A;  2DL7 A;  5ECA A;  1YNZ A;  1FMK A;  1BU1 A;  4GLM A;  1UGV A;  2GGR A;  1OOT A;  2IIM A;  2ROT A;  2O88 A;  1AZE A;  3H0I A;  2LJ3 A;  2JS2 A;  3NHN A;  5EC7 A;  2W10 A;  2ESW A;  1YWO A;  2H8H A;  1G83 A;  4K11 A;  3GBQ A;  1NLP C;  1IO6 A;  1NLO C;  2A37 A;  2EYZ A;  1GCQ A;  1PHT A;  2JTE A;  3H0F A;  3QWX X;  4M4Z A;  1T3L A;  2J06 A;  1JXO A;  1AZG B;  2EKH A;  1K0X A;  1MUZ A;  2RMO A;  2KRO A;  4HVU A;  1JEG A;  1OPL A;  2D0N A;  4LNP A;  1M8M A;  4J9F A;  1J3T A;  4CC2 A;  3VS7 A;  2EGC A;  1VYV A;  2JM9 A;  2AKK A;  3PE0 A;  3EGU A;  1ZUK A;  2A28 A;  1VYT A;  2YUN A;  1W1F A;  3I5S A;  3I9Q A;  2RPN A;  4JJC A;  1G2B A;  1UJ0 A;  4J9G A;  3REA B;  4LE9 A;  5IH2 A;  1JXM A;  2DLP A;  2J6K A;  4RTZ A;  1B07 A;  3TSW A;  4ORZ A;  5IHI A;  2RQT A;  3R6N A;  1HSQ A;  3I35 A;  3IQL A;  1SHG A;  2LJ1 A;  2EW3 A;  2EYY A;  5IXF A;  2K9G A;  2CUB A;  2JMC A;  3THK A;  2QDL A;  2L3P A;  2BZY A;  2DMO A;  1E7O A;  4EIK A;  1AEY A;  2NWM A;  4RTU A;  1LCK A;  1PRM C;  1VYU A;  1T0H A;  4HCK A;  2L3S A;  3O5Z A;  2YDL A;  1UG1 A;  2BTT A;  2KXD A;  1PNJ A;  3VS6 A;  2D1X A;  1WXU A;  2MOX A;  2DL5 A;  2CRE A;  1S1N A;  2EGE A;  3VRZ A;  1NEB A;  1JU5 C; 
#chains in the Genus database with same CATH topology
 1M30 A;  4AG1 C;  4OMQ A;  1AWO A;  5IXB A;  1YP5 A;  3QUI A;  2XMF A;  1OQK A;  2HEQ A;  2CP3 A;  1QCF A;  2NUT B;  2A36 A;  3UA6 A;  1YJ9 Q;  2K5I A;  3X28 B;  2DJQ A;  5FLX E;  2FL7 A;  5CO7 A;  1K9M C;  3FB9 A;  3S3O A;  2OAU A;  3RKW A;  4C0F A;  5GJV B;  2YUO A;  3L42 A;  2HBP A;  1GFC A;  1JB0 E;  2JTF A;  3G71 Q;  1GBR A;  2DL8 A;  2B86 A;  2AHJ B;  2RD1 A;  2JUF A;  1EIF A;  3HFN A;  1LNX A;  2QAZ A;  4HT9 A;  3FDR A;  4PJO F;  1UUE A;  1S72 A;  3EG2 A;  4QKU A;  1T3S A;  2D9T A;  2IG0 A;  2YLC A;  2KNB B;  3G7Z A;  4LDX A;  5GMK e;  2SEM A;  1X01 A;  4IIM A;  1ZBX A;  4M77 C;  4C92 G;  5LL6 S;  2VKN A;  1ZUU A;  2QA4 A;  4PJM A;  2CSQ A;  2DJZ A;  2DTO A;  5GAM h;  3X20 B;  2CH4 W;  3PNW C;  3JB9 D;  1WA7 A;  4D8D A;  4FU6 A;  3RKX A;  1QQJ A;  2OJ2 A;  3JV3 A;  4M77 D;  1BIA A;  2DPP B;  3CC7 Q;  4RTY A;  1M5Q 1;  4PJO E;  2HSP A;  1H3Z A;  1KHC A;  3ER0 A;  4R0K A;  1WQW A;  2Y90 A;  5I22 A;  4M78 A;  1FMV A;  5GMK j;  3SWN C;  2VGN A;  2ZGW A;  1NEG A;  1I8F A;  3MP6 A;  4F7U G;  4V2S A;  1ZLM A;  3JSC A;  3UAT A;  4D8K A;  2A7Y A;  5FRM A;  2KK4 A;  3ASK A;  1NZ9 A;  2M0O A;  1MV3 A;  3CBO A;  3CPF A;  1KC8 R;  2X4W A;  3G4S A;  1RAF B;  1VQ7 A;  4M78 B;  2X4X A;  2KE9 A;  2G3R A;  4FYY B;  2JZ2 A;  2D8H A;  5J3B A;  4RUG A;  1E6H A;  4BE0 A;  3QDF A;  3CME T;  3QJ6 A;  3A5Z B;  3D7S B;  3GNG A;  3CCU A;  1AOJ A;  3EFS A;  1EFN A;  4M7A A;  2DBK A;  2K3Y A;  5KYW B;  4PLL A;  1NG2 A;  1ZUY A;  1PC0 A;  3A8O B;  2FO0 A;  2V8K A;  3R6O A;  3CC4 T;  3JCM b;  1Q82 C;  3DKM A;  2DIL A;  2A0F B;  3LYI A;  4C8Q C;  3UA7 A;  3OY9 A;  4F16 A;  1UGQ B;  1CKB A;  3EFO A;  4LD6 A;  1UJY A;  2V26 A;  2QYZ A;  1QVF P;  1AWJ A;  2DM1 A;  3VS0 A;  4QVZ A;  4LN2 A;  1Y96 A;  3EFO B;  5GAM e;  1MMA A;  4C92 B;  2EPD A;  4LDY A;  1TS9 A;  4C5E A;  2RI3 A;  1Y96 B;  2E70 A;  8AT1 B;  2VYT A;  1VQN Q;  2X51 A;  4EMK C;  2DE0 X;  1OEB A;  3KBG A;  2KEA A;  1WJR A;  3CMA A;  2RO0 A;  5GAM j;  3VYG A;  4AFS C;  3VKI A;  4A4K A;  4PJJ A;  1YHQ Q;  4BDY A;  4C8Q F;  4F7U B;  3CD6 A;  2O9V A;  4XTV A;  1YI2 A;  3JCM d;  1R0C B;  2LDM A;  1QP2 A;  4QQG A;  1BI0 A;  3G6E T;  4JZ4 A;  1RAG B;  2YT6 A;  4OB1 B;  2QQS A;  2DNU A;  1G3W A;  1M90 R;  2E5K A;  2PVG B;  2E3H A;  1SEM A;  1M8V A;  1EX4 A;  1K4U S;  5AYF A;  1OV3 A;  3V8K A;  3I56 A;  2AK5 A;  5I21 A;  4M75 C;  2GF7 A;  3CC4 Q;  4HCC A;  1H8K A;  3KFV A;  2KI7 A;  1C6V X;  3CCU T;  2RHI A;  2OTL Q;  5GAN 7;  2YHT A;  2CUD A;  2KDS A;  2LMJ A;  4C8Q E;  5GAN 4;  1BB9 A;  5LJ5 f;  2P0K A;  2VGM A;  1VQ9 A;  2GBQ A;  4DBH A;  4ATO A;  1Y07 A;  4IUP A;  3JCM Q;  2OTJ A;  2RQU A;  3EG9 B;  1QW1 A;  1G5V A;  2CZ1 B;  1VQ5 A;  5D6W A;  4DEX A;  3JB9 J;  4XU0 A;  3H6Z A;  2KGT A;  1QVG S;  1W2B A;  4MML A;  3I5R A;  4BD3 A;  1WXT A;  1X75 C;  3CCR Q;  5GAN 5;  4AMC A;  3VUB A;  1BCO A;  1UGR B;  1K9A A;  4M75 F;  2CP6 A;  1VQ6 Q;  1JQQ A;  1SSH A;  1RAB B;  1U1S A;  3QPH A;  2AT1 B;  3QZ5 B;  2JVV A;  4J83 A;  5GAM g;  2DFU A;  1BK2 A;  3E2U A;  1D1B A;  2CH4 A;  3G6E Q;  1NPP A;  2JW4 A;  2LX7 A;  1KC8 C;  2V1Q A;  3REB B;  2JM8 A;  3PIO A;  2LNV A;  3C95 A;  2XDD A;  2RB6 A;  1HYO A;  3PT9 A;  1M4Z A;  1PWT A;  1ZA1 B;  3CEY A;  4OGC A;  4ZGJ B;  1YI2 T;  2LNH B;  1M27 C;  2ZPI B;  4LUE A;  4N4H A;  1VQM T;  1D09 B;  4M75 E;  2DD4 A;  3CCE A;  5KCH A;  2PVO B;  3QSU A;  1FMK A;  4RG8 A;  2L8D A;  1XQH A;  2GGR A;  2HQH A;  2IIM A;  1R77 A;  1U8R A;  3I56 T;  2QQR A;  3NHN A;  4L5G A;  4C5I A;  1M9S A;  1YWO A;  2H8H A;  2H3J A;  1G83 A;  4A4E A;  3UDC A;  1O9S A;  1NLP C;  1W2B P;  1PHT A;  2J06 A;  4M78 D;  1JXO A;  1IXD A;  1K0X A;  1MUZ A;  2KRO A;  2KAF A;  3CC2 T;  4E7H A;  1VQ9 T;  5GAO p;  4N4G A;  4QQD A;  1YJ9 A;  5I2M A;  2C06 A;  2DO3 A;  2EGC A;  2X35 A;  3PE0 A;  4C0D C;  3EGU A;  5GAM d;  3P8H A;  2X4J A;  1LOJ A;  3SDZ A;  2RPN A;  1W4S A;  4J9G A;  3G71 A;  4GY5 A;  5HK3 A;  5IH2 A;  1YFN A;  2LRQ A;  1N9S A;  4RTZ A;  3MPU B;  1OYX A;  2BUD A;  3BDL A;  1HSQ A;  2EJF A;  3T9N A;  5CKD A;  1K9M U;  4C92 C;  4A4H A;  5IXF A;  2ZCF B;  2JMC A;  2QDL A;  4DQ2 A;  2L3P A;  1OZ2 A;  1E7O A;  1G3T A;  3OB9 A;  5CKE A;  1PD1 A;  1PRM C;  3L2V A;  4FYW B;  1G3Y A;  1VYU A;  3FRN A;  4J8O A;  2MK5 A;  4FT4 A;  1I5O B;  5C0M A;  2O01 E;  3P8B B;  2DTH A;  1UG1 A;  1VQM Q;  3V7C A;  3VS6 A;  4JRQ A;  2D1X A;  4JLG A;  3OSS C;  2DL5 A;  1S1N A;  1M90 C;  2ZZD A;  3CCJ T;  1LVK A;  2FB7 A;  2QEX T;  2CZ6 B;  1K8A R;  3VRZ A;  1NEB A;  2E1H A;  1JU5 C;  2E12 A;  1QMC A;  4X1V A;  4IIO A;  5IHN A;  2M16 A;  3M0T A;  4LDV A;  1ARK A;  3CC7 A;  2PUO B;  2DL4 A;  2KVQ G;  3O8V A;  3S6W A;  4HA8 A;  2DAQ A;  3CCE T;  2CSI A;  3TCJ A;  1K8A U;  3GLX A;  4C92 F;  4O5V A;  3PMI A;  1N5Z A;  1ZQ1 A;  3CC2 Q;  2CP0 A;  1VIE A;  4CC4 B;  4E7I A;  3RNJ A;  2C0O A;  4PLI A;  1VQP T;  1BBZ A;  3QXE B;  1JJ2 A;  2IPO B;  2YUP A;  1RI9 A;  1KQ1 A;  3GNF B;  4NL2 A;  2E6Z A;  2ZPG B;  1SRM A;  5GAN f;  3H0H A;  1VQO Q;  2EQJ A;  1VOM A;  2XKO C;  2LQN A;  1YCS B;  1YJ9 T;  4F7U F;  2YSQ A;  2DXU A;  1N8R R;  3QO3 A;  2JXB A;  3V8L A;  4J9B A;  4DBQ A;  4OMM A;  4AFQ C;  4IUU A;  1LPL A;  1V1C A;  4C92 E;  1AD5 A;  1TWB A;  1I0C A;  2HDA A;  2MCN A;  2Y4Y A;  4J9E A;  2PNI A;  1NBE B;  2QAS A;  2MAM A;  1BI2 A;  1NYF A;  4KGZ B;  3OW2 P;  2R58 A;  2EBP A;  2GFA A;  1ZSG A;  5FU6 B;  2P0Q A;  2VWF A;  2QK0 A;  4R55 A;  3INZ A;  3VUZ A;  5CVI A;  2L2P A;  3CCS Q;  3OYY A;  5D6X A;  3CCJ Q;  2F2X A;  3HPW A;  4QT7 A;  1TU0 B;  1NYG A;  2RHY A;  6AT1 B;  2NUP A;  3FJP A;  2CGH A;  4F7U E;  4ZGD B;  1ACM B;  2MI6 A;  5IN1 A;  3GP8 A;  1VQN A;  2KBT A;  1RAI B;  2HNI A;  4F17 A;  5I2S A;  1AWX A;  3V8J A;  1BCM A;  1WHM A;  2HQE A;  1Y0M A;  1IB8 A;  2O2O A;  5CQX A;  4QVD A;  2MWP A;  1QCO A;  4ELY C;  3NFC A;  3VU3 C;  3OYD A;  1M2V B;  1YHQ A;  1Q81 C;  3CXC P;  5GAO r;  1GFD A;  1IRE B;  1WPY A;  3TQ7 P;  2C0I A;  1VQP Q;  4FW1 A;  2XU8 A;  2KRS A;  2HZY A;  3E19 A;  4E6R A;  5CQY A;  1YJN T;  4M78 G;  2KMT A;  1FX7 A;  4A63 B;  5FU7 C;  3UF4 A;  4CRI A;  4HVV A;  2NUZ A;  3OYL A;  1KIK A;  1KQS P;  3CC4 A;  3HSB A;  3MP8 A;  4C5G A;  4WTO B;  1YIT T;  2KRM A;  4Z8A A;  2VVK A;  1Z9Q A;  1QWF A;  3C94 A;  2OTL A;  2G6F X;  2KXC A;  2L5Q A;  1RL2 A;  4J6W A;  1HJD A;  2CYZ B;  5LJ5 h;  1D0Y A;  3CBP A;  3CCL Q;  1Q86 R;  3GOX A;  3DB3 A;  4M7A G;  3JCM c;  4JS4 A;  2JMA A;  3N5B B;  3FC3 A;  4DEY A;  5C6S A;  2A08 A;  2CT4 A;  3QYH B;  1OX9 A;  2KYB A;  4ESR A;  2M1H A;  4N0A A;  1WJQ A;  2DA9 A;  3LH5 A;  2PTK A;  4DOV A;  2O4X A;  4FL6 A;  4DOW A;  4LUD A;  3EHR A;  3CCR A;  3OS2 A;  3H8Z A;  4Z88 A;  1OPK A;  1X6G A;  1K8A C;  1QVF A;  2M51 A;  1VQ6 A;  3M0P A;  2O4X B;  2FRW A;  1AHJ B;  3E1S A;  3EH1 A;  4HKE A;  1WDX A;  4F04 B;  4X9D A;  1VQN T;  1M1F A;  1ZBJ A;  2ECZ A;  4BY6 B;  1BIB A;  3L2Q A;  3G6E A;  4JZ3 A;  2RNA A;  2JT4 A;  4P5N A;  3V7R A;  4EMG A;  1UFF A;  1YJN Q;  3SHW A;  5KE3 A;  4XAX B;  2EGA A;  3FJ5 A;  1K0S A;  1A0N B;  1WX6 A;  2LCS A;  3BY7 A;  1YHQ T;  4MZT A;  2BE9 B;  3M0Q A;  1MNE A;  2EJG A;  1BI3 A;  4MDX A;  2LVM A;  3VS5 A;  3JB9 F;  2DBM A;  2X3W D;  1JRI A;  4J6Y A;  1HD3 A;  5GJW B;  1YIT Q;  3QBY A;  4M77 F;  1M3B A;  1KC8 U;  2FPE A;  4E7Z A;  3JCM P;  3RIR A;  4GBQ A;  1X2Q A;  2OX7 A;  2DEU A;  3CCM Q;  1N8R C;  1NPR A;  3JCM f;  3CBM A;  4PNO A;  1MND A;  1X69 A;  4PFP A;  4KH1 B;  2DXT A;  3CPW A;  4M7A B;  1LJO A;  1G8X A;  2OTL T;  2WSC E;  3M0U A;  2RF0 A;  3MEV A;  1SKU B;  5KE2 A;  3NGP A;  2X3X D;  1X27 A;  4PK4 A;  2MIO A;  1RLP C;  5LJ5 j;  4F14 A;  2EYW A;  2KR3 A;  4CC3 A;  4OMO A;  2K3B A;  3M55 A;  4M77 E;  3HFO A;  1AWW A;  3ZL7 C;  1KFZ A;  1VUB A;  2K2M A;  1GCQ C;  4AG2 C;  1QWE A;  3M58 A;  4RTW A;  2SRC A;  2DKG A;  4BE1 A;  5FU6 C;  4RTX A;  4C0Z A;  3CCR T;  1RAE B;  3NTK A;  1XJW B;  4HVW A;  2JS0 A;  2ENM A;  1VQ6 T;  1UHC A;  2DL7 A;  4KUI A;  1ZSZ A;  5ECA A;  4GLM A;  2MWO A;  1AZE A;  3C4S A;  2ROT A;  2O88 A;  4MZP A;  2JOY A;  2EQU A;  1TSF A;  1VQM A;  1ZSZ B;  3M4G A;  3X26 B;  1TOV A;  2PVD B;  4KUL A;  5GAN 6;  3GBQ A;  1IO6 A;  4M7D A;  4A54 A;  3QWX X;  3CPW P;  1T3L A;  2EQK A;  2RMO A;  4HVU A;  1JEG A;  1OPL A;  2QG9 B;  4BDZ A;  2P0P A;  4M7D B;  4LNP A;  1UEB A;  4ANJ A;  3VS7 A;  3EFR A;  1M90 U;  3JAM E;  2JM9 A;  2AKK A;  2V8J A;  3TRE A;  3WVD B;  3OYC A;  1Q86 C;  4FW2 A;  4RMO A;  3CC2 A;  2FYK A;  1G2B A;  1UJ0 A;  2M9U A;  1QVG A;  4JS5 A;  2XIC A;  1B07 A;  4AT1 B;  5CCA A;  2ZPH B;  3IQL A;  4B9W A;  1PD0 A;  5LJ5 g;  3HL8 A;  2EW3 A;  3M54 A;  2K9G A;  2CUB A;  3THK A;  3NTH A;  5GAN h;  4EIK A;  2NWM A;  4IUT A;  4RTU A;  5GMK m;  1LCK A;  3OYE A;  1T0H A;  5KYU A;  3WXM B;  3ME9 A;  3O5Z A;  2XD0 A;  2YDL A;  3M57 A;  1PNJ A;  2COW A;  1WXU A;  2MOX A;  2P4T A;  5KYU B;  2CRE A;  2DK3 A;  1N27 A;  3OYG A;  3RKY A;  2EGE A;  2XI9 A;  2BE7 D;  3QII A;  4HXJ A;  4ZNX A;  3QDR B;  1CKA A;  3HRT A;  2GQV A;  2M02 A;  2X4Y A;  3PVQ A;  3PGG A;  4J5Y A;  4JDS A;  2YRD A;  1PSE A;  2KRN A;  2K79 A;  3CCS A;  3OYM A;  2F5K A;  3CCJ A;  1U5S A;  1GCP A;  4OMF B;  2QEX A;  4JUV A;  2X9H A;  4A53 A;  1Y57 A;  1T0J A;  2C0T A;  3L1A A;  1WYX A;  2YRV A;  2V1R A;  4IUQ A;  1U3O A;  2CZ7 B;  1M3C A;  4MZM A;  3VS2 A;  1F1B B;  2I0N A;  3M0R A;  2VV5 A;  4XU3 A;  4PJO A;  1QVG P;  4YTL A;  2LT4 A;  2D8J A;  3CCV T;  2GQI A;  4J6X A;  1WLP B;  2FZG B;  1VQL T;  4C5H A;  3A1P A;  4M78 C;  3PTA A;  2KT1 A;  2R57 A;  3TEE A;  2J05 A;  5LJ5 d;  3UPU A;  2E4H A;  2DXC A;  1Z9Z A;  1Q81 R;  1WHK A;  5GAN 8;  1M2O A;  1QLY A;  1VQP A;  2FEI A;  2DD5 A;  1RAA B;  1WNL A;  3DLM A;  3OSV A;  4JJD A;  3OYN A;  3QKJ A;  5GAN e;  2YRC A;  2QTX A;  1YJW Q;  3RES A;  1TTH B;  1YCY A;  1Q81 U;  4OMP A;  4A4F A;  4QW2 A;  3MHX A;  4NL3 A;  2LQK A;  4E7L A;  4M7A C;  3NMZ C;  2DVJ A;  1PKS A;  2ZPE B;  2EJ9 A;  4JRI A;  3JCM W;  2VAS A;  3VS1 A;  1K1Z A;  3MO8 A;  3FEO A;  1I07 A;  1VQO T;  2K5F A;  2L3Q A;  4WF2 A;  3OS1 A;  4CC7 A;  5GAN j;  4FSS A;  4M78 F;  2DX1 A;  4M7A D;  1UGS B;  5FW9 A;  3OYB A;  4J7F A;  1UE9 A;  2E6N A;  1XTD A;  4N4I A;  2E65 A;  2VC8 A;  1UHF A;  1X43 A;  3U23 A;  1WFW A;  2HSE B;  5FRO A;  4J7I A;  5LJ3 f;  1JBM A;  1WJS A;  1WIE A;  2A3L A;  4BI3 A;  2PQW A;  3OW2 A;  1WI7 A;  4E7S A;  3CCS T;  3CCV Q;  2RHU A;  1VQL Q;  4M7A F;  4KGX B;  5D7U A;  5KYY A;  4FM4 B;  5J39 A;  2F2W A;  4M78 E;  2BIV A;  7AT1 B;  1KD1 R;  2COY A;  4X9C A;  3OMG A;  4DBF A;  3M5A A;  2HKN A;  2WAC A;  2K57 A;  3SEM A;  2J6O A;  1YJN A;  1UGP B;  2EQI A;  5GAN 3;  3V7S A;  3RDV A;  1FXX A;  1SG5 A;  3HRU A;  1U06 A;  2JNG A;  2EYQ A;  5IT9 E;  1SRL A;  1R0B G;  1TH7 A;  4TVR A;  2CDT A;  1YIT A;  4M7A E;  2EVR A;  4WCI A;  3CXC A;  1ABQ A;  4XK8 E;  3TVT A;  1KK7 A;  4AFZ C;  3QJY A;  2FZK B;  3EAE A;  4RCC A;  4PKC C;  5AT1 B;  3CCM A;  4RG2 A;  4C8Q A;  4EDU A;  4M7D D;  3JCM h;  3EHQ A;  1ZHI A;  3L2Z A;  3RMS A;  2BZ8 A;  4MMK A;  1XNI A;  5CIU A;  3MEU A;  3QHS A;  2COZ A;  1WHG A;  5GAN g;  3OS0 A;  4PL6 A;  1GRI A;  2EFI A;  2R5A A;  1MMG A;  1H3H A;  2JTM A;  2XDB A;  1KQS A;  1WHH A;  1ZX6 A;  4NOY A;  4OMN A;  5HK0 A;  1N8R U;  4JRK A;  1PRL C;  3EGD A;  3CCL T;  3VYH B;  4XQ3 A;  2RJC A;  3JB9 I;  3ULR B;  3L2R A;  1QKX A;  1JJ2 S;  2FG0 A;  4BI8 B;  1VQ4 Q;  1X6B A;  3SFM A;  2HMA A;  3QWY A;  2DYI A;  2F2V A;  3EGD B;  3I55 Q;  4PJL A;  1XOV A;  4PFZ A;  5KYX A;  1B3Q A;  3UWN A;  4EMK A;  4HT8 A;  4KUD K;  4OP0 A;  1RLQ C;  1E6G A;  2YLB A;  3EGX A;  3M9Q A;  1HK9 A;  3X25 B;  4BB7 A;  1I5L A;  3MKD A;  3TU4 K;  3AHU A;  1HXD A;  4Y92 A;  4CI0 C;  2EYX A;  2RN8 A;  3BDU A;  4RTV A;  1X2K A;  2NUP B;  1SHF A;  3EGX B;  4L6V 5;  4VUB A;  3PFS A;  4XTX A;  2K2V A;  3RER A;  1MMN A;  4JJN K;  4Q5W A;  2RQV A;  1YIJ Q;  3LH0 A;  2MPX C;  1VA7 A;  1H92 A;  3J7A F;  2DVE A;  4LXC A;  1I1J A;  1K73 R;  1QKW A;  1PG5 B;  1NM7 A;  1PKT A;  3ZBD A;  1D3B A;  4AFU C;  5GAO m;  2VUB A;  2LQ8 A;  4OB3 B;  2GTO A;  4J9C A;  4M75 A;  1QP3 A;  1YWP A;  1B34 A;  2ED0 A;  1K73 U;  5GAN d;  4J9H A;  4XU2 A;  1D3B B;  2CP5 A;  1GL5 A;  4PFO A;  3WVE B;  2NUT A;  3OMC A;  2L3R A;  2RHZ A;  2YXY A;  4JPB W;  4JRP A;  1SF9 A;  2FHD A;  3CQT A;  4PJO D;  1IZ6 A;  1W6X A;  4PJN A;  3L2W A;  3URG A;  3VS3 A;  2V8I A;  1MHN A;  3CCM T;  5GAN 2;  1TG0 A;  3OBY A;  3JCM X;  3OYF A;  5FWB A;  2O9S A;  3LW5 E;  3NPF A;  3CCQ T;  1SPK A;  4FYX B;  1Q86 U;  2CKK A;  2OI3 A;  2L0A A;  5HY6 A;  3VRY A;  2FPF A;  2DIG A;  1UDL A;  4KBM B;  1H64 1;  2LT1 A;  5CR2 A;  3LWH A;  4II1 A;  2NLU A;  1YNZ A;  1IHW A;  1BU1 A;  3A8M B;  2LJ3 A;  4FT2 A;  5DY9 A;  3S3N A;  2JS2 A;  5EC7 A;  1NE8 A;  3JCM V;  2ESW A;  4OB0 B;  4QVC A;  2A37 A;  1NLO C;  1KD1 C;  3LLR A;  4IUV A;  4M4Z A;  3SB2 A;  2EKH A;  3VV0 A;  3M59 A;  3MEA A;  1I81 A;  1VQK Q;  4E7K A;  3AT1 B;  5HKC A;  4LD9 K;  4J9F A;  4A4G A;  1J3T A;  2VXE A;  4FSX A;  4ZGE B;  3OQ5 A;  2HD0 A;  1U1T A;  1Q7Y C;  1ZUK A;  2A28 A;  2YUN A;  5GAO n;  3I5S A;  3I9Q A;  4JJC A;  2K3X A;  3LX7 A;  9ATC B;  3LWI A;  2DZC A;  1JXM A;  2DLP A;  2J6K A;  2AIR B;  2D6F A;  2JJ9 A;  1QVF S;  4ORZ A;  5IHI A;  3R6N A;  2QXF A;  3I35 A;  5LJ5 e;  5DLO A;  5J26 A;  2EYY A;  3JB9 H;  1R8O B;  3OA6 A;  3BFM A;  4M7D G;  1AEY A;  1M1K C;  2MYS A;  2EQM A;  1VQ8 T;  4KT0 E;  4C0G A;  5KYW A;  4HCK A;  2GCX A;  3CCQ Q;  3M53 A;  3JCM g;  5GMK l;  3GIB A;  1BKB A;  2BTT A;  1YJW A;  1KQ2 A;  4Z02 A;  4OF1 A;  4EPC A;  2RJE A;  1EZZ B;  2QDY B;  5L23 A;  1AVZ C;  4RTT A;  5M9O A;  4BI4 A;  1X6O A;  4C0D B;  2XDP A;  2KT8 A;  2LCC A;  2LZ6 B;  4C92 A;  4OVA A;  2CS7 A;  4ZN3 A;  2RK2 A;  3A8L B;  1KJW A;  2LP5 A;  3H9N A;  1S72 T;  1C0M A;  1MV0 B;  2QQB A;  3EG3 A;  2BKD N;  2R5M A;  4C8Q D;  4FIB A;  5CKF A;  3CPW S;  1YBY A;  2HKQ B;  4NS5 A;  4E7J A;  2LX9 A;  4XTZ A;  3A8H B;  3LGF A;  5FRN A;  3MJX A;  1K73 C;  4L59 A;  2RQR A;  5LJ3 h;  2QA4 T;  4F7U A;  1UB4 A;  3OS5 A;  1C1A A;  1B7T A;  3L2U A;  2DEQ A;  1NJI C;  3EG1 A;  3CCV A;  1VQL A;  2ROL A;  2P4R A;  3SD4 A;  3X24 B;  2WSF E;  3KUF A;  3RBB B;  4KGV B;  4D6W A;  1VQ8 Q;  4OB2 B;  3CME Q;  3GF5 A;  2RK1 A;  1TUD A;  2GTJ A;  2BZX A;  4X34 A;  4PJO G;  2PUK B;  2L89 A;  3G4S T;  1VQ7 T;  1V29 B;  1PM3 A;  5A0G A;  8ATC B;  3KXT A;  1FMW A;  3HP9 A;  4ZTF A;  1CSK A;  2E10 A;  3EG9 A;  2RHX A;  2E5Q A;  1GBQ A;  2YUQ A;  1YJW T;  3MET A;  2KSS A;  1VQO A;  4BE2 A;  2J6F A;  2DIQ A;  2ZAE A;  4M75 D;  3MEW A;  3DB4 A;  3NTI A;  1S72 Q;  3FIF A;  2NYS A;  3Q1J A;  2CT3 A;  2EIF A;  1W70 A;  3OYI A;  4E2F B;  5GAO q;  4ZTJ A;  1FWZ A;  4ELZ C;  4B6M A;  1RAC B;  2QQA A;  5FWC A;  2QQ9 A;  4MDW A;  2O31 A;  1OU8 A;  1ABO A;  1IHV A;  2P84 A;  3RUX A;  5LJ3 e;  3J80 E;  3TSZ A;  5I11 A;  2QA4 Q;  4JLI A;  4N0A C;  3P8D A;  1O75 A;  4Z89 A;  2RJD A;  4RCB A;  3EG0 A;  1OI1 A;  3J81 E;  1K76 A;  3E9F A;  5GAM f;  5HCK A;  1VQ4 A;  2K4Y A;  1TXQ A;  3JB9 G;  2LTO A;  1BYM A;  1WGS A;  3I55 A;  5KH6 A;  4J9I A;  1G3S A;  4M77 G;  1W2B S;  3C0C A;  3RR6 A;  3A8G B;  2RA2 A;  1N9R A;  3ZEH A;  2KY9 A;  2CZ0 B;  4BY6 C;  4QQ6 A;  1M3A A;  1P92 A;  2VXF A;  2MF2 A;  5LJ3 j;  3CMA T;  4LDW A;  1QVP A;  5D6Y A;  1QCN A;  3G4S Q;  3S3M A;  3CD6 T;  1VQ7 Q;  1IGU A;  1KSW A;  1YIJ A;  2ZPB B;  4PJO B;  2RQW A;  2OAW A;  2K6D A;  5EG2 A;  2XHC A;  2F5T X;  5CK9 A;  4IKF A;  2HCK A;  1OU9 A;  2DYB A;  4DBR A;  2GFU A;  4KH0 B;  3CCU Q;  3M56 A;  5A2Q E;  2I2L A;  2HL5 C;  4OGE A;  4FCY A;  1TUC A;  4XTW A;  2QGG A;  2W0Z A;  2DF6 A;  3HHT B;  5FU7 B;  3E9G A;  2Z0W A;  1VIF A;  3EH2 A;  4KRT A;  2XID A;  5L8R E;  5A0L A;  5IHK A;  2ED1 A;  3QG1 A;  3QZ9 B;  5CKB A;  1SSF A;  2E3I A;  2IVW A;  3C12 A;  1UEC A;  5KYN A;  4OML A;  3RMQ A;  3HRS A;  3CCL A;  1WZO A;  1FYN A;  3UT1 A;  1UTI A;  2RM4 A;  2OTJ T;  4XU1 A;  2DRM A;  4C8Q G;  4DA4 A;  4UC4 A;  2CP7 A;  3BW1 A;  3M0S A;  1K9M R;  2F1L A;  2EAY A;  1VQ5 T;  3OYH A;  2AZV A;  5GMK i;  4M77 A;  3MCA B;  3OYA A;  3OYJ A;  2LC4 A;  3OBW A;  1Q95 G;  2AKL A;  2GNC A;  2ZPF B;  1M1G A;  2J7I A;  2ABL A;  4M77 B;  2Y4X A;  1I4K 1;  2FPD A;  2DRK A;  1VQ4 T;  4XTY A;  3CMA Q;  1N6A A;  2KYM A;  3A98 A;  2RI5 A;  3PVL A;  3I55 T;  2PZ1 A;  2K7A A;  2DL3 A;  3VS4 A;  5LJ3 g;  3M4Y A;  2E64 A;  3CD6 Q;  3MP1 A;  4XTU A;  3SWN A;  1MMD A;  2EKO A;  2PU9 B;  3DLL A;  1YI2 Q;  4C92 D;  3H41 A;  1KG1 A;  1ZSZ C;  4Y91 A;  5GAO l;  4HCZ A;  1RAH B;  3BE3 A;  5DLQ E;  1WHJ A;  2VB6 A;  1WHL A;  5KYY B;  1VQK A;  5IAY A;  3SWN B;  2YWW A;  1RUW A;  2LQW A;  2AZS A;  2HBW A;  3FLG A;  1YIJ T;  1JO8 A;  3QYG B;  2M0Y A;  1WXB A;  5CAI A;  1KD1 U;  3I56 Q;  1RI0 A;  2FRY A;  3ZFJ A;  4M7D C;  1Q7Y R;  2HL3 A;  4Y28 E;  1D0X A;  4J9D A;  3OW2 S;  1PSF A;  1OUL A;  2XG8 D;  1PCX A;  2QI2 A;  1Y71 A;  1YN8 A;  2D0Q B;  2E41 A;  2LJ0 A;  1Q7Y U;  1VQ9 Q;  1OZ3 A;  4M75 G;  3OYK A;  4R56 A;  4B9X A;  3HKS A;  2DXB A;  2OTJ Q;  1MGQ A;  2CP2 A;  1AT1 B;  1M1K R;  3JRZ A;  1UGV A;  1OOT A;  1VQ5 Q;  3CCQ A;  4C8Q B;  1IRX A;  3H0I A;  2DZ9 A;  3JCM J;  1D1A A;  3VJP A;  5DM7 R;  2W10 A;  2EWN A;  2XK0 A;  4K11 A;  1M1K U;  2EYZ A;  2WSE E;  5A0D A;  5LJ3 d;  1GCQ A;  2JTE A;  5KCO A;  3H0F A;  4GLK A;  2FZC B;  1AZG B;  1Q82 R;  3GPL A;  3CXC S;  4M7D F;  2K5L A;  2JN0 A;  1IGQ A;  3HTR A;  3G71 T;  2D0N A;  5CKH A;  4O6J A;  1M8M A;  4LDU A;  2HAX A;  4E47 A;  2RI2 A;  4CC2 A;  1TUG B;  1WQ7 A;  4BUG A;  3G1J A;  2HQX A;  1VYV A;  2MMP A;  1Q82 U;  1D0Z A;  5KYX B;  1OX8 A;  4EMK B;  1VYT A;  1D1C A;  1W1F A;  2QTV A;  2DER A;  4BAC A;  1RAD B;  2KQW A;  2B8A A;  2DET A;  3REA B;  1V76 A;  4FYV B;  4LE9 A;  2RH2 A;  1KQS S;  3F70 A;  3TSW A;  2QEX Q;  2RQT A;  4RKU E;  1SHG A;  3PMT A;  2LJ1 A;  2QGF B;  2ATC B;  5GMK h;  1M2V A;  2BZY A;  2DMO A;  3CCE Q;  2F69 A;  4M7D E;  4ZN1 A;  1BI1 A;  1VQK T;  1JJ2 P;  3LGL A;  2FVU A;  1KHI A;  4IUR A;  1NJI R;  2L3S A;  4PJO C;  3JCM e;  1DJ7 B;  1ZA2 B;  1Y7X A;  2KXD A;  3CC7 T;  2LCL A;  4HCB A;  2RJF A;  4M75 B;  4EMH A;  2H3E B;  1GXI E;  4ME7 A;  1B34 B;  2DTI A;  1VQ8 A;  1NJI U;  3PIP A;  3CME A;  4JJB A; 
#chains in the Genus database with same CATH homology
 1M30 A;  4HXJ A;  4OMQ A;  4AG1 C;  4ZNX A;  5L23 A;  1AVZ C;  4RTT A;  4IIO A;  4X1V A;  1AWO A;  5IXB A;  5IHN A;  1YP5 A;  3M0T A;  1CKA A;  1ARK A;  2KT8 A;  2DL4 A;  2XMF A;  2HEQ A;  3PVQ A;  2LZ6 B;  1QCF A;  3UA6 A;  2A36 A;  2KRN A;  2DJQ A;  2K79 A;  2CSI A;  1U5S A;  1GCP A;  1KJW A;  2LP5 A;  1MV0 B;  5GJV B;  1Y57 A;  1T0J A;  2C0T A;  2YUO A;  3EG3 A;  1N5Z A;  1WYX A;  2V1R A;  1GFC A;  1U3O A;  1M3C A;  3VS2 A;  2DL8 A;  4CC4 B;  1GBR A;  2I0N A;  2C0O A;  3M0R A;  2B86 A;  3RNJ A;  1BBZ A;  2YUP A;  2D8J A;  2GQI A;  1WLP B;  1RI9 A;  1UUE A;  2RQR A;  3EG2 A;  2KT1 A;  2J05 A;  1SRM A;  1T3S A;  3H0H A;  1Z9Z A;  1QLY A;  2FEI A;  2LQN A;  1YCS B;  3EG1 A;  2YSQ A;  2KNB B;  2JXB A;  2SEM A;  4J9B A;  4OMM A;  2ROL A;  2P4R A;  4IIM A;  4AFQ C;  4JJD A;  1V1C A;  2VKN A;  1ZUU A;  1AD5 A;  2CSQ A;  1I0C A;  2HDA A;  2MCN A;  4J9E A;  3RBB B;  2PNI A;  4OMP A;  1NYF A;  2CH4 W;  2EBP A;  1WA7 A;  4D8D A;  1TUD A;  3NMZ C;  2GTJ A;  2OJ2 A;  2BZX A;  1ZSG A;  2DVJ A;  1PKS A;  2VWF A;  3JV3 A;  4RTY A;  2HSP A;  3VS1 A;  1K1Z A;  2L2P A;  1I07 A;  4R0K A;  5I22 A;  2L3Q A;  2F2X A;  4CC7 A;  4QT7 A;  1NEG A;  1NYG A;  1ZLM A;  4FSS A;  3UAT A;  4D8K A;  1CSK A;  2DX1 A;  1MV3 A;  2KBT A;  5FW9 A;  4F17 A;  1GBQ A;  2YUQ A;  1UE9 A;  2KE9 A;  1AWX A;  4JJB A;  2J6F A;  1Y0M A;  2D8H A;  2O2O A;  1UHF A;  4RUG A;  1X43 A;  3U23 A;  1E6H A;  1WFW A;  2CT3 A;  1W70 A;  1AOJ A;  1GFD A;  1WIE A;  1EFN A;  2C0I A;  5FWC A;  2DBK A;  2KRS A;  2O31 A;  1WI7 A;  1ABO A;  1NG2 A;  1ZUY A;  4E6R A;  2FO0 A;  2DIL A;  3TSZ A;  5I11 A;  3UA7 A;  2F2W A;  4A63 B;  4Z89 A;  4F16 A;  3UF4 A;  3EG0 A;  1K76 A;  1CKB A;  5HCK A;  4HVV A;  2NUZ A;  1UJY A;  1KIK A;  3SEM A;  4J9I A;  1AWJ A;  2DM1 A;  3VS0 A;  4LN2 A;  2J6O A;  2KRM A;  4Z8A A;  3C0C A;  2VVK A;  2EQI A;  1Z9Q A;  1QWF A;  2G6F X;  2KXC A;  1M3A A;  1HJD A;  1U06 A;  2EPD A;  1SRL A;  2CDT A;  2JMA A;  2EVR A;  4WCI A;  1ABQ A;  1KSW A;  3TVT A;  2DE0 X;  1OEB A;  4DEY A;  2A08 A;  2CT4 A;  4AFZ C;  2KYB A;  2RQW A;  2KEA A;  2OAW A;  2K6D A;  4ESR A;  2DA9 A;  3LH5 A;  3EHQ A;  2HCK A;  2PTK A;  2BZ8 A;  2DYB A;  4AFS C;  4LUD A;  3EHR A;  1TUC A;  2O9V A;  1GRI A;  2W0Z A;  4Z88 A;  2DF6 A;  1OPK A;  1H3H A;  1X6G A;  1ZX6 A;  4OMN A;  2M51 A;  3M0P A;  4JZ4 A;  4KRT A;  1PRL C;  2FRW A;  3ULR B;  5IHK A;  2ED1 A;  1QKX A;  2YT6 A;  1WDX A;  2DNU A;  2FG0 A;  2E5K A;  1SEM A;  1X6B A;  1UEC A;  1K4U S;  1ZBJ A;  3QWY A;  2ECZ A;  4OML A;  1OV3 A;  2F2V A;  2AK5 A;  1XOV A;  1B3Q A;  4JZ3 A;  2RNA A;  2JT4 A;  1UFF A;  1H8K A;  1RLQ C;  1E6G A;  1FYN A;  3KFV A;  3SHW A;  2EGA A;  1UTI A;  3FJ5 A;  1K0S A;  1A0N B;  1WX6 A;  2DRM A;  2LCS A;  3M0Q A;  2CUD A;  2LMJ A;  3M0S A;  4Y92 A;  1BB9 A;  2EYX A;  2RN8 A;  3VS5 A;  4RTV A;  1X2K A;  2AZV A;  1SHF A;  2DBM A;  2X3W D;  2GBQ A;  1HD3 A;  5GJW B;  1M3B A;  2RQV A;  2RQU A;  2AKL A;  2FPE A;  1VA7 A;  1H92 A;  2GNC A;  2J7I A;  2ABL A;  1I1J A;  4GBQ A;  1X2Q A;  2FPD A;  2DRK A;  1QKW A;  4DEX A;  1NM7 A;  1X69 A;  2KYM A;  3A98 A;  3PVL A;  1PKT A;  2KGT A;  2PZ1 A;  2K7A A;  2DL3 A;  4AFU C;  3VS4 A;  3I5R A;  2GTO A;  1WXT A;  4J9C A;  1YWP A;  2ED0 A;  3M0U A;  2RF0 A;  3H41 A;  4J9H A;  1K9A A;  3NGP A;  2X3X D;  1JQQ A;  1X27 A;  1SSH A;  1GL5 A;  2MIO A;  1RLP C;  4F14 A;  2EYW A;  2KR3 A;  1RUW A;  4CC3 A;  4OMO A;  2LQW A;  2AZS A;  2K3B A;  4JPB W;  2HBW A;  1JO8 A;  2M0Y A;  1WXB A;  3CQT A;  1BK2 A;  1W6X A;  1AWW A;  3ZL7 C;  2CH4 A;  2FRY A;  3VS3 A;  1KFZ A;  2K2M A;  1GCQ C;  2JW4 A;  4AG2 C;  1QWE A;  2LX7 A;  1TG0 A;  4RTW A;  2V1Q A;  2SRC A;  4J9D A;  3REB B;  2JM8 A;  5FWB A;  4RTX A;  2O9S A;  1PWT A;  3NPF A;  1SPK A;  1YN8 A;  2LJ0 A;  2LNH B;  4HVW A;  2OI3 A;  2JS0 A;  2L0A A;  1M27 C;  4LUE A;  2ENM A;  3VRY A;  1UHC A;  2FPF A;  1UDL A;  2DL7 A;  5ECA A;  1YNZ A;  1FMK A;  1BU1 A;  4GLM A;  1UGV A;  2GGR A;  1OOT A;  2IIM A;  2ROT A;  2O88 A;  1AZE A;  3H0I A;  2LJ3 A;  2JS2 A;  3NHN A;  5EC7 A;  2W10 A;  2ESW A;  1YWO A;  2H8H A;  1G83 A;  4K11 A;  3GBQ A;  1NLP C;  1IO6 A;  1NLO C;  2A37 A;  2EYZ A;  1GCQ A;  1PHT A;  2JTE A;  3H0F A;  3QWX X;  4M4Z A;  1T3L A;  2J06 A;  1JXO A;  1AZG B;  2EKH A;  1K0X A;  1MUZ A;  2RMO A;  2KRO A;  4HVU A;  1JEG A;  1OPL A;  2D0N A;  4LNP A;  1M8M A;  4J9F A;  1J3T A;  4CC2 A;  3VS7 A;  2EGC A;  1VYV A;  2JM9 A;  2AKK A;  3PE0 A;  3EGU A;  1ZUK A;  2A28 A;  1VYT A;  2YUN A;  1W1F A;  3I5S A;  3I9Q A;  2RPN A;  4JJC A;  1G2B A;  1UJ0 A;  4J9G A;  3REA B;  4LE9 A;  5IH2 A;  1JXM A;  2DLP A;  2J6K A;  4RTZ A;  1B07 A;  3TSW A;  4ORZ A;  5IHI A;  2RQT A;  3R6N A;  1HSQ A;  3I35 A;  3IQL A;  1SHG A;  2LJ1 A;  2EW3 A;  2EYY A;  5IXF A;  2K9G A;  2CUB A;  2JMC A;  3THK A;  2QDL A;  2L3P A;  2BZY A;  2DMO A;  1E7O A;  4EIK A;  1AEY A;  2NWM A;  4RTU A;  1LCK A;  1PRM C;  1VYU A;  1T0H A;  4HCK A;  2L3S A;  3O5Z A;  2YDL A;  1UG1 A;  2BTT A;  2KXD A;  1PNJ A;  3VS6 A;  2D1X A;  1WXU A;  2MOX A;  2DL5 A;  2CRE A;  1S1N A;  2EGE A;  3VRZ A;  1NEB A;  1JU5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...