4JJBA

Crystal structure of the abl-sh3 domain at ph3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Abl-SH3 domain at pH3
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ABL1
total genus 11
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jjbA00
3ZL7C 2KT1A 2FPFA 2B86A 2G6FX 4JJBA 4ZNXA 2HBWA 1RLQC 1WXBA 1A0NB 2LQWA 2O9VA 1NYFA 1K76A 2F2WA 1K0XA 2RQTA 2BTTA 4E6RA 1ARKA 1WDXA 2KGTA 1GBRA 2M0YA 2CT4A 1YN8A 2AZSA 2J7IA 2LZ6B 3C0CA 1I1JA 2V1RA 4RUGA 2K7AA 2A28A 4OMLA 2LJ0A 1M27C 2YDLA 2PTKA 3H0FA 4LUEA 2GBQA 1ZX6A 2H8HA 4RTVA 2O2OA 1AWOA 2CH4W 2YUPA 4DEYA 2HDAA 2RPNA 1PRMC 2DL3A 1NLOC 2YT6A 1NLPC 1UE9A 4X1VA 1NEBA 2DL8A 3EGUA 1UJYA 4AFZC 4J9CA 4CC4B 2LJ3A 4JJCA 3A98A 2JM9A 4A63B 2C0IA 2FG0A 1V1CA 4KRTA 2L0AA 3VS5A 1LCKA 3FJ5A 2J06A 2O9SA 4AG2C 5IXFA 5EC7A 1CSKA 1GL5A 2YUNA 2LMJA 1X2QA 2D8JA 3M0UA 1AD5A 2EGEA 3NHNA 3EHQA 3EG2A 1Y57A 3UF4A 1GRIA 1E6HA 4D8DA 2DMOA 2HCKA 1M3AA 1TUDA 1KJWA 4HCKA 4WCIA 1PRLC 4EIKA 1HSQA 1M30A 1I07A 2KNBB 1WYXA 2A36A 1T0JA 1WX6A 1WXTA 2CUBA 1B3QA 1KSWA 2FPDA 1BB9A 5GJVB 2KXCA 2W10A 2KT8A 1NG2A 2K2MA 1ZLMA 2M51A 1OOTA 5IHNA 4HVUA 2DRKA 2LQNA 1UTIA 3IQLA 4JJDA 2F2XA 4K11A 1QWFA 1WXUA 2VWFA 3U23A 5FWBA 2AZVA 1UG1A 4GLMA 2K9GA 2VKNA 2MOXA 1AWJA 4J9EA 2CT3A 1W70A 2E5KA 3THKA 4GBQA 5L23A 2KRMA 1TG0A 2OJ2A 1S1NA 4HVWA 2PZ1A 1QKWA 1JQQA 1G83A 3VS1A 2DM1A 4RTWA 3VS2A 4J9IA 4J9FA 2SRCA 1W1FA 1RUWA 1SEMA 3VS0A 2DX1A 1NEGA 3R6NA 1RLPC 3M0TA 1AOJA 1EFNA 2EGAA 2RNAA 2EKHA 3VRYA 2CREA 2L3QA 4OMPA 2DLPA 1ABOA 4QT7A 3UA7A 4Z88A 1G2BA 3TVTA 1SHFA 3QWYA 3NGPA 1VYVA 4OMQA 1MV0B 4FSSA 1YCSB 2ECZA 2JT4A 2EVRA 2DYBA 1B07A 3PVLA 1NM7A 1M3CA 2EYWA 4OMOA 1H3HA 3QWXX 3JV3A 2FO0A 1X27A 1UECA 1YNZA 2HSPA 2DL5A 1MV3A 1SRLA 2FPEA 2DE0X 1GBQA 2KBTA 3NPFA 2CUDA 2LX7A 4ORZA 1X43A 4AG1C 2EGCA 1M3BA 1E7OA 1Z9ZA 2LCSA 2GQIA 2NUZA 3PVQA 2SEMA 5IXBA 2JM8A 2DA9A 2KROA 2K6DA 1AVZC 4CC7A 1KFZA 1J3TA 2GNCA 4OMMA 3SHWA 4CC3A 1RI9A 4JZ4A 2MIOA 4IIMA 4JPBW 2RQWA 1T3SA 4ESRA 2RQVA 1VYUA 3REAB 5IHKA 3I5SA 1ZUKA 2BZYA 4F17A 2AKLA 4HVVA 2GTOA 4HXJA 5FW9A 2EYZA 2ABLA 1PKTA 3UATA 3VS6A 1K0SA 1GFCA 2DRMA 3RNJA 1CKBA 2GTJA 2W0ZA 2YUOA 1FMKA 4Z8AA 1U3OA 2DL7A 3SEMA 2DNUA 3LH5A 2D1XA 2J6OA 3I9QA 2L3SA 4LUDA 3REBB 1GFDA 1HJDA 2RF0A 1H8KA 2JMCA 4LE9A 2RQUA 2AK5A 3H0IA 3VS3A 3I35A 4J9BA 1WI7A 2J6KA 3TSZA 2JMAA 4J9HA 2OAWA 2CSIA 1OPKA 1T3LA 3VS4A 3M0PA 2DILA 1PWTA 3EHRA 1VYTA 2DBMA 1T0HA 2KYBA 2DBKA 1M8MA 2BZ8A 5I11A 4AFQC 1X69A 1YWOA 2DF6A 4JZ3A 2A37A 2GGRA 1JXMA 1PHTA 4D8KA 1KIKA 2D0NA 2ED0A 3EG0A 2P4RA 1BBZA 4RTYA 4Y92A 1OPLA 2ENMA 2VVKA 2F2VA 4LNPA 1U06A 1JEGA 1OV3A 1ZBJA 1K9AA 1AWXA 4F14A 2KE9A 2PNIA 1H92A 5ECAA 1ZUUA 3O5ZA 1IO6A 2MCNA 2LP5A 1QCFA 2DL4A 2JXBA 1U5SA 1K1ZA 1UHFA 1ABQA 2CH4A 1PNJA 3RBBB 3EG1A 4RTTA 4RTZA 2YSQA 2JTEA 4CC2A 1X6GA 1PKSA 4OMNA 1WFWA 2XMFA 2K79A 2KRSA 1AZGB 2X3WD 5FWCA 2IIMA 2EW3A 2LNHB 1CKAA 2OI3A 4R0KA 2X3XD 2EQIA 4RTUA 2V1QA 1BK2A 1E6GA 2A08A 2ROTA 3M0SA 5GJWB 1GCQA 5I22A 4Z89A 1X6BA 1JXOA 2K3BA 1WA7A 4J9GA 4AFSC 2KR3A 2KRNA 2L3PA 1GCPA 4AFUC 2FRYA 3TSWA 1ZSGA 1AWWA 5IHIA 1HD3A 1JU5C 3GBQA 2EPDA 3NMZC 1UJ0A 2O31A 1W6XA 3CQTA 2J05A 1QLYA 1Z9QA 4RTXA 2BZXA 2KEAA 2ROLA 1I0CA 2FEIA 3VS7A 2QDLA 2J6FA 2JW4A 1QKXA 4LN2A 4DEXA 1BU1A 2KYMA 2C0OA 2L2PA 2JS2A 3EG3A 1UDLA 4M4ZA 1VA7A 1MUZA 1NYGA 2O88A 1FYNA 2YUQA 1SSHA 1SPKA 1UFFA 1TUCA 2C0TA 1WIEA 2KXDA 1YWPA 2CDTA 2CSQA 3VRZA 2RQRA 1Y0MA 2RN8A 1XOVA 2ED1A 1N5ZA 2D8HA 2NWMA 1K4US 2LJ1A 2RMOA 2HEQA 1UUEA 3H41A 1SHGA 2JS0A 2AKKA 3H0HA 5HCKA 3M0RA 3ULRB 2EYXA 3UA6A 1AZEA 1JO8A 1WLPB 1OEBA 4F16A 2I0NA 2EBPA 1SRMA 1UHCA 4J9DA 1ZUYA 2DVJA 3PE0A 1GCQC 3I5RA 1X2KA 2EYYA 5IH2A 2FRWA 2DJQA 2ESWA 3KFVA 4IIOA 1QWEA 1UGVA 3M0QA 1AEYA 1YP5A
chains in the Genus database with same CATH superfamily
2KT1A 4JS5A 4M75D 3CCQQ 1X01A 4ZNXA 2K5LA 4LDVA 1YITQ 1WHGA 2LQWA 4M78C 3OYEA 1VQ5A 1QVFA 2HMAA 1NYFA 4HT9A 2M1HA 1D0ZA 1RAGB 1M8VA 3OMGA 2BTTA 1ARKA 1LVKA 1WJSA 2KGTA 3CCEA 2M0YA 1WJRA 3L2RA 3OYFA 3G71A 4ATOA 1BI1A 2BE7D 1IB8A 1I1JA 2A28A 3HFOA 1VIEA 4LUEA 5CKDA 3QG1A 3X28B 1ZX6A 4IUTA 1Q7YU 3V8JA 1NLOC 3L2UA 2DL8A 3OBWA 4AFZC 1TU0B 1B7TA 2FG0A 3OSVA 1VQ7Q 2AT1B 2O9SA 2P4TA 3VUBA 5IXFA 2YUNA 2LMJA 3D7SB 3FLGA 3CCRQ 4BI3A 2LQKA 4J83A 3M54A 1QQJA 1VQ7T 2OTLT 1GRIA 1E6HA 4D8DA 4C5IA 1WHHA 2XK0A 4MZTA 4VUBA 4C8QB 1M3AA 2QA4A 5GAN3 5GAOl 1VQ4A 3CC2Q 3FB9A 3H6ZA 3OBYA 4EIKA 3PFSA 4M7AD 2KNBB 3OA6A 2A36A 2OTJQ 3A8LB 2FYKA 1B3QA 2FPDA 5M9OA 2M51A 1NE8A 1Q82U 2X4JA 4FT2A 3FRNA 1MNDA 3JB9J 2F2XA 2FL7A 3QJ6A 1VQ9A 2AZVA 3MEUA 1UG1A 5GANe 4LD9K 4JRQA 1ACMB 1RAHB 1AWJA 1YJ9A 4DQ2A 3HHTB 1EIFA 2E5KA 4X9DA 2K2VA 2KRMA 1TOVA 3HRUA 3G4SA 4HVWA 3OYDA 1NJIR 4NL3A 3L2ZA 5KYXB 3VS1A 1SSFA 2DM1A 4RTWA 3VS2A 1YI2A 1TXQA 1W1FA 2FHDA 3VS0A 3CCQA 1NEGA 3QSUA 3MEWA 4JRKA 4X9CA 4BY6B 3CCLA 2EQMA 2CREA 2DLPA 2RJDA 2X35A 1ABOA 2OTLA 4Z88A 3TVTA 3LLRA 3QWYA 1VYVA 1IHWA 4OMQA 3M5AA 3OB9A 1MV0B 3F70A 2DYIA 1EZZB 2ECZA 3FJPA 2HL5C 4XQ3A 4E7HA 2EYWA 1H3HA 2O01E 2FO0A 4M75F 1VQ6Q 3O8VA 4J5YA 1JJ2S 1YJ9Q 1VQ8T 2DE0X 2V8IA 1GBQA 2KBTA 4M7DB 5LJ3d 3SDZA 1E7OA 1VQ6T 2GQIA 2P0PA 3PVQA 4WTOB 1YJ9T 1OYXA 2K6DA 4LDXA 2ZAEA 5LJ3f 3PIPA 1KFZA 1J3TA 3UDCA 2CKKA 4OMMA 4EMGA 1RI9A 2ZZDA 2E41A 3JB9D 2HAXA 2JUFA 3CBMA 2LC4A 5J39A 2RHUA 2E1HA 4ESRA 2KQWA 3OW2A 1KG1A 1MMNA 3I5SA 5I2SA 2DD4A 1ZUKA 4EMHA 4C8QE 4HXJA 3SWNA 4RMOA 2D6FA 1PKTA 3UATA 2DRMA 2HSEB 2FVUA 4KH0B 4ZTFA 1CKBA 2YUOA 1FMKA 1SG5A 1XTDA 1U3OA 1H3ZA 3LH5A 1PD1A 5AT1B 2D1XA 3JCMb 1XJWB 1XNIA 2JNGA 2EFIA 1KD1C 4LUDA 1VQ9Q 1HJDA 1V76A 2VUBA 4PJMA 2JMCA 2YRVA 3I55T 4LE9A 2K3XA 3H0IA 3VS3A 2HBPA 3I35A 3UWNA 2XG8D 4CI0C 4N4HA 3I55Q 3UT1A 1VQ8A 1PWTA 4XTWA 2MMPA 4BY6C 1UGRB 5I11A 1YI2Q 3LW5E 1X69A 1YWOA 1Q95G 2DF6A 5FROA 3E9FA 2ED0A 1QP3A 4Y92A 1OPLA 3L42A 1U06A 2K5IA 1OV3A 4FYWB 4OB1B 5GAOn 2QQBA 1W2BS 3CXCS 2KE9A 2NUPB 2RA2A 3ASKA 2QAZA 2JTFA 5ECAA 2MCNA 2KSSA 1IO6A 1QCFA 2OX7A 4M77A 2DL4A 1W2BA 4XTVA 3L2QA 3CEYA 1ABQA 1RAAB 3VYHB 4CC2A 4TVRA 2IVWA 1Q82C 3JSCA 1PKSA 3A8MB 2E65A 2KRSA 2XKOC 1VQKA 1QW1A 3OYBA 4KUIA 1VQ7A 2RJEA 4M7AF 2XD0A 4A4KA 2LNHB 5D6YA 5L8RE 4R0KA 1WJQA 4KH1B 1VQ4T 3M0SA 3V7RA 4ZGJB 1SKUB 4XTUA 5I22A 2E5QA 5A0LA 3E1SA 2CZ0B 4KUDK 1YFNA 1KQ1A 1BIAA 4M7DF 4M78E 1MMGA 2V8JA 4UC4A 3RR6A 2L3PA 1Y71A 1JRIA 4M75B 2FRYA 2YHTA 1AWWA 5IHIA 4FSXA 1HD3A 5J3BA 1UJ0A 3CQTA 4RTXA 3NFCA 1YJNT 2BZXA 2KEAA 4A4HA 2DEQA 4YTLA 5GANg 2J6FA 2JW4A 1QKXA 4RCBA 1NJIC 3MCAB 1BU1A 2KYMA 2MPXC 2FZCB 1UDLA 2DETA 2GQVA 3CCQT 1EX4A 2O88A 4B9WA 2YUQA 1SSHA 3JCMd 2PU9B 3GNGA 2KDSA 2A3LA 2CDTA 1YHQQ 2HEQA 1QVFP 5IAYA 1SHGA 1W2BP 1QMCA 3GF5A 1HYOA 3EGDA 2QASA 3UA6A 2C06A 1AZEA 2E10A 1JO8A 2CP0A 3SWNC 4ZGEB 1OU8A 2Y4YA 1IHVA 4PFZA 1UHCA 5GANf 4J9DA 2DVJA 2K4YA 3I5RA 1X2KA 1OX9A 3WXMB 3KFVA 2F5KA 9ATCB 4F04B 1QWEA 3M0QA 1AEYA 4QVCA 1VQOA 3ZL7C 1VQ6A 5GAOq 1VQ5T 2B86A 2G6FX 2K3YA 4JJBA 5CKHA 1M1KR 3FDRA 1WHMA 4AT1B 3JB9I 1BIBA 3CCVA 3A8GB 1VQMA 3G71T 2RQTA 1X6OA 2QYZA 1OZ2A 3OYAA 1BI3A 1IZ6A 2PVDB 3OW2P 3L1AA 4NS5A 2J7IA 2LZ6B 4OMFB 3CCST 2V1RA 1MHNA 1U1TA 1M27C 2ZGWA 3H0FA 3CBPA 1XQHA 1KQSA 2YUPA 3CCSQ 4DEYA 2HDAA 4R56A 4PLIA 2DL3A 1IRXA 1NLPC 3M53A 1UE9A 3MEVA 3VYGA 3X24B 1UJYA 4J9CA 2A7YA 2LJ3A 2LNVA 4MMLA 4A63B 2C0IA 1V1CA 4KRTA 5LJ5j 3VS5A 4WF2A 1SF9A 2XIDA 1GL5A 3CC4T 2KVQG 1X2QA 5LJ3e 2Z0WA 3VUZA 1AD5A 4IUQA 3QDFA 1Y57A 3UF4A 3RKXA 1F1BB 1G3TA 4A54A 2HCKA 1VQOT 2RHIA 3CXCA 3CBOA 3MP8A 1TUDA 3M56A 1WYXA 2DFUA 1BKBA 1TTHB 1KHCA 1WX6A 2CS7A 2RD1A 4BD3A 4HVUA 5GAMj 4OF1A 5LJ5f 5KYXA 1VQNT 1UTIA 2EIFA 4C0FA 3CXCP 4K11A 2VWFA 3U23A 5GAN5 1RACB 5FWBA 1BYMA 5LJ5d 1RADB 3FIFA 2CGHA 2CZ6B 2E64A 4N0AC 1VQNQ 2HQEA 2MOXA 4PJJA 2CT3A 4XTZA 2CP2A 3THKA 4M77G 3CCRT 1KHIA 3CCLQ 1TG0A 2OJ2A 3RKWA 2DTIA 4PJLA 1R0CB 1JQQA 3RDVA 4J9FA 4JJNK 1QVGA 3CCLT 1MGQA 4Y28E 2LVMA 2X9HA 3R6NA 3M0TA 1N6AA 3RUXA 2EGAA 2H3EB 5D6XA 2RH2A 2F1LA 2L3QA 2QQRA 3EH2A 4MMKA 2RK2A 4QT7A 1G2BA 3ZFJA 5CQXA 3T9NA 2ZPHB 5KYYA 1Q81C 1U8RA 1TSFA 1VOMA 4HT8A 2WSFE 1PG5B 4FIBA 2CZ1B 3OW2S 3PVLA 1NM7A 1KC8C 4OMOA 3QWXX 1X27A 1P92A 5KYWB 1YNZA 1VQNA 5J26A 3C94A 3QZ9B 3OYCA 1X43A 2PUKB 1IGQA 3JCMc 1M3BA 1Z9ZA 2LCSA 1ZSZA 2GCXA 2SEMA 2JM8A 4DBHA 2KROA 1AVZC 4CC7A 4PJNA 4M77B 2M02A 1UGSB 3SHWA 2A0FB 4M7DE 4XU0A 4JZ4A 1V29B 4OP0A 1YIJT 3QBYA 2R5AA 2RQVA 3JCMW 2YRDA 1C6VX 3REAB 3R6OA 3P8BB 3OYJA 5KCHA 4BACA 4O5VA 2E4HA 5GAOm 2ABLA 3VS6A 2QQSA 4PJOF 1VQPQ 1VQLA 1OI1A 3OMCA 1N8RR 1G3YA 3CCUA 4C0DB 2DNUA 4PJOG 3I55A 1VQ8Q 1TS9A 4L6V5 3I9QA 2L3SA 4C8QG 4F7UF 3JB9G 3REBB 4BUGA 3TU4K 2GFAA 3CC7T 3ME9A 3E2UA 1BI2A 1UEBA 5LJ3h 2EQJA 2RF0A 2CP3A 1QVPA 3J7AF 3TSZA 4J6YA 2BE9B 2JMAA 2OAWA 5CVIA 1Q7YC 3JCMX 1OPKA 4E7ZA 3M0PA 2DILA 1VYTA 2DBMA 1T0HA 3PIOA 2OTJA 2D9TA 1M8MA 3CCVT 4E7IA 4OB0B 4NOYA 2BZ8A 2RHYA 7AT1B 4M7AE 5FU6B 1Q86R 1K8AR 1I5OB 4C92D 2GGRA 2QGGA 2L5QA 2AHJB 1D0XA 1KIKA 2D0NA 1JB0E 3BE3A 2KK4A 3JCMg 5KYWA 4C8QF 1NZ9A 3A8HB 4Q5WA 4J7FA 3TREA 1AWXA 5CK9A 3HP9A 2WSEE 1PSEA 1ZUUA 2XU8A 1WHKA 2JXBA 1OZ3A 3LGFA 1FMVA 1RAEB 1PNJA 1VQKT 4RTZA 1VQLT 1PC0A 2QGFB 2E6NA 4OMNA 4ZTJA 5FWCA 3G6EQ 4JRPA 1N8RC 3AHUA 1R8OB 2IIMA 2K5FA 2NYSA 2YWWA 3LGLA 3N5BB 4ELYC 2KAFA 2OI3A 5HY6A 3S3MA 3CCEQ 4XTYA 2RJFA 2EQIA 3OYLA 1E6GA 2A08A 3CCJT 1U1SA 3TEEA 5GJWB 1KQSS 1R77A 3CCET 4LDYA 3PNWC 4MDWA 3GIBA 1YHQT 4XAXB 1K9MR 2M16A 5GAMh 5HK0A 1QVFS 3EFRA 2BKDN 3MP6A 2HQHA 1YJNA 4C92E 3BW1A 3GBQA 2EWNA 2EPDA 2XHCA 3NMZC 2O31A 1W6XA 3NTKA 5KYYB 1S72T 3OYKA 3CCRA 2EKOA 4RG2A 1AT1B 1QLYA 3JAME 3CCMT 4XK8E 4ZGDB 2RI2A 2QDLA 3GOXA 4DEXA 1UGPB 4FYVB 2L2PA 1VQ4Q 2JS2A 3EG3A 2WSCE 2XDPA 3DKMA 1MUZA 1RABB 1NYGA 2KMTA 1KD1U 1SPKA 4N4IA 2MAMA 1TUCA 2DK3A 3G71Q 2CSQA 3VRZA 1Y0MA 2NWMA 2LJ1A 2RMOA 1NPPA 4M78F 3S3NA 3WVDB 3ULRB 3AT1B 1I5LA 4J8OA 1OEBA 4C8QA 4JLGA 2QQAA 4QQGA 2GF7A 3CMAQ 1M1GA 3CPWP 2EYYA 3HL8A 4II1A 2ZPBB 1YITT 3S6WA 4RKUE 2ESWA 3L2WA 4EMKC 3MEAA 1UGVA 2FZKB 3RKYA 1M1KU 3JRZA 4IURA 5DY9A 4AMCA 3G4ST 2QEXQ 1KK7A 2M0OA 2O9VA 3M57A 1NJIU 2PUOB 2F2WA 1K0XA 2P0KA 3CCSA 1YIJA 1WDXA 2VASA 1OX8A 3KBGA 1VQOQ 4X34A 4RUGA 2K7AA 4OMLA 5CCAA 2LJ0A 2YDLA 1N8RU 4QQDA 2PTKA 1YBYA 2H8HA 4RTVA 1AWOA 2RPNA 2JN0A 1PRMC 3EGDB 2YRCA 3OS5A 1WGSA 4X1VA 1NEBA 3EGUA 4RCCA 1N27A 4CC4B 4JJCA 2EJFA 2JM9A 1KC8U 2WACA 3CC7A 2HQXA 1ZBXA 5IN1A 3A5ZB 1LCKA 3FJ5A 2J06A 4AG2C 1Y7XA 2DEUA 1CSKA 1Q81U 3M0UA 1O75A 3VKIA 3NHNA 5LJ3g 4J7IA 1OULA 3EHQA 4A4EA 3EG2A 2ZPEB 2YLCA 3HTRA 5CIUA 3QHSA 2DMOA 3LWHA 2B8AA 2EJ9A 4F7UE 4N4GA 1O9SA 4HCKA 1KJWA 4WCIA 1PRLC 3I56Q 1HSQA 4R55A 1M30A 4PJOE 1I07A 4RG8A 2Y90A 2CUBA 2W10A 2KT8A 1NG2A 2DTOA 4ZN3A 2LQNA 2RJCA 3IQLA 5GAN7 2CP5A 4C92C 3JCMJ 4OGCA 1QWFA 4MZPA 4M78A 4O6JA 3OYYA 2K9GA 2VGNA 3LWIA 2BUDA 2JVVA 3C12A 4J9EA 1W70A 4GBQA 1QP2A 3CC4Q 1TWBA 5L23A 4FT4A 3VU3C 4BE2A 2PZ1A 1X75C 1KD1R 3OS1A 1UB4A 2RB6A 3ZBDA 4J9IA 4IUUA 3QYHB 1RUWA 3CPWA 1SEMA 2CP7A 2M9UA 2DX1A 3CD6T 1AOJA 1EFNA 2XDDA 3CCJA 1N9SA 3LX7A 5D7UA 4XU1A 2MI6A 3CD6Q 3NGPA 3CPFA 2COZA 4M7AA 2DJZA 3GLXA 1H641 6AT1B 4IUPA 4FL6A 3EG9B 5GANj 2NUPA 2EVRA 2DYBA 3Q1JA 2ZPFB 2VV5A 5GAMg 5FLXE 2NLUA 1UECA 2HSPA 3OQ5A 4JDSA 4BI8B 1MNEA 1MV3A 1S72A 1OU9A 5GAN8 3NPFA 2CUDA 3NTHA 2LX7A 3JCMf 4AG1C 3H9NA 3PMTA 3CC7Q 3EFOA 2NUZA 5CQYA 2O4XB 2LT4A 3SD4A 2HKQB 2I2LA 2DPPB 5IXBA 5KE3A 2DA9A 3BDUA 2QA4T 2GNCA 1WHLA 3QZ5B 2MIOA 4N0AA 3VV0A 4JPBW 4PK4A 1T3SA 5GAMd 4KULA 1VYUA 3CC2A 5IHKA 5GANd 1C1AA 3CCUT 4HVVA 3QKJA 1HXDA 4C92B 5GAMf 3DLLA 5KH6A 2EYZA 2DXCA 4BDZA 1VQ9T 1K0SA 4PFPA 1GFCA 2W0ZA 4Z8AA 3SB2A 2DL7A 3SEMA 3RMSA 2JOYA 5CAIA 4FW2A 1RAFB 3X20B 2CP6A 4KBMB 3QUIA 1GFDA 1G3SA 2HKNA 2DXTA 1H8KA 1GXIE 3A8OB 3CMET 2ZCFB 3OSSC 1WI7A 1WNLA 1VQKQ 1VQLQ 4A53A 2CSIA 2XDBA 1QCNA 3VS4A 5LJ5h 1M2OA 2E70A 1Y96B 2KYBA 2DBKA 4M7DC 1BI0A 4A4GA 2JJ9A 4E47A 5LJ5g 2A37A 4PJOC 1JXMA 1OQKA 1PHTA 1G3WA 2LDMA 3EG0A 3PTAA 1BBZA 4D6WA 1JJ2P 1Q81R 3OYHA 3M59A 2ENMA 5GMKm 2VVKA 2F2VA 2ZPIB 4LNPA 4L5GA 1MMAA 3PT9A 5KYNA 3EAEA 1K9AA 3HPWA 3G7ZA 4F14A 2QTVA 3ER0A 4FU6A 5KCOA 4C5GA 2E3HA 1RL2A 1H92A 5LL6S 3O5ZA 3G6EA 2LP5A 5I2MA 4M77F 1ZA2B 2R57A 2G3RA 1U5SA 1JJ2A 4KT0E 1K1ZA 1UHFA 3QXEB 1RAIB 3RBBB 3EG1A 4C92F 2YSQA 2JTEA 4J6XA 5DLQE 5GAN2 4DOWA 1G8XA 2O4XA 3M4GA 3KXTA 1WFWA 3EFOB 2DIGA 2E3IA 2CZ7B 4HA8A 4M7AG 1AZGB 2X3WD 3CCVQ 2DKGA 4E7KA 3GP8A 2RI5A 2EW3A 4XU2A 2PVOB 2V1QA 1BK2A 2ROTA 1VQMT 1KC8R 4Z89A 2DTHA 4M75A 5CKFA 4XU3A 2V26A 3SWNB 5C6SA 4HCBA 3J80E 3OYMA 5A0DA 2R5MA 2X4WA 2KRNA 4M7DG 3HFNA 4GLKA 4AFUC 4KGXB 4PFOA 4E7LA 3TSWA 2JZ2A 1ZSGA 3GNFB 2QTXA 4Y91A 4C5EA 1LPLA 1D0YA 2VXFA 5EG2A 2CYZB 4BB7A 2J05A 4KGVB 3G6ET 2FZGB 2ROLA 1I0CA 4HCCA 2FEIA 2P84A 3V7CA 1FXXA 3QDRB 2EAYA 3CC4A 4HCZA 2C0OA 4FW1A 1K8AC 1WQWA 1YJNQ 1M9SA 3G4SQ 3SFMA 3P8DA 1D1BA 1FYNA 2JTMA 1UFFA 4DBFA 1QVGP 5D6WA 2C0TA 2KXDA 4EPCA 2PQWA 3JCMh 1YWPA 8AT1B 5FRMA 4LD6A 2RQRA 1XOVA 2ED1A 2D8HA 1K4US 4M7AC 3H41A 1D09B 2JS0A 5HCKA 1FWZA 3M0RA 5FU7B 1QVGS 2MK5A 2HL3A 3M4YA 2EYXA 2LTOA 4PNOA 3JCMP 4IKFA 2ZPGB 1K8AU 1ZA1B 1BCOA 1BCMA 2RK1A 2QEXA 3JCMV 2EBPA 1YITA 1SRMA 4E7SA 4ZN1A 3EGXA 3CCMQ 4QKUA 4ME7A 5IH2A 2DVEA 2FRWA 4PJOA 4M75C 3OYNA 1R0BG 4IIOA 4ANJA 1UGQB 5HKCA 1YP5A 5LJ5e 4M78D 2IPOB 2FPFA 1IXDA 4F7UA 2MWOA 2X51A 5CKBA 2VGMA 2HBWA 1RLQC 1WXBA 2RHZA 1M90R 1A0NB 3EH1A 1D1AA 3BFMA 3OS2A 3V8LA 2EQKA 5GMKl 1K76A 2VYTA 1IGUA 3DB3A 5HK3A 3OYIA 4E6RA 3G1JA 5GMKe 2AIRB 1GBRA 2XI9A 2CT4A 4F7UG 2DIQA 1YN8A 2AZSA 5GAOp 3CC2T 3C0CA 3I56T 3RESA 4JRIA 1Q82R 3E9GA 2MF2A 2GBQA 1G5VA 2O2OA 5GAMe 2CH4W 2QK0A 1WZOA 2QDYB 1B34B 2YT6A 4OB3B 4E2FB 1RI0A 1NBEB 2NUTB 1I8FA 1AHJB 1HK9A 1PSFA 3A98A 4PLLA 3X25B 2L0AA 4HKEA 2QEXT 5EC7A 3CMEA 2LQ8A 3EG9A 2YLBA 2D8JA 2EGEA 5LJ3j 4M7DA 5KYUB 5GAOr 2DD5A 3HRTA 2VXEA 2QI2A 4MDXA 4ELZC 3BDLA 2L3RA 4M75G 1FX7A 1Q7YR 4L59A 1T0JA 5CO7A 1WXTA 4DA4A 1KSWA 5GJVB 1BB9A 4QVDA 2KXCA 3PMIA 2K2MA 1ZLMA 1OOTA 5IHNA 3CPWS 3S3OA 1Q86U 1LNXA 2DRKA 1Q86C 3E19A 1PD0A 4M77E 2E6ZA 4JJDA 4OGEA 2DAQA 1WXUA 3I56A 4GLMA 2VKNA 2QXFA 4M77D 4NL2A 3MJXA 4DBRA 3L2VA 3C95A 4M77C 1S1NA 4C8QD 1K73U 2OTLQ 1QKWA 3CD6A 1KQSP 4OVAA 1K73C 1G83A 3MKDA 2SRCA 3BY7A 3QYGB 4EDUA 1RLPC 4J6WA 3JCMe 2LX9A 2OTJT 2RNAA 2RO0A 4FM4B 2EKHA 3VRYA 5CKEA 2L8DA 2RI3A 4OMPA 4C92G 4LDWA 5GANh 3UA7A 1MMDA 4B9XA 4V2SA 2DXUA 1SHFA 1JBMA 3X26B 2HZYA 4C0DC 4FSSA 1YCSB 3MPUB 1VQPA 4QQ6A 3CMAA 2JT4A 3CCUQ 2X4XA 1B07A 4BI4A 1M3CA 4M7AB 1TH7A 3JV3A 4JLIA 4MZMA 2DL5A 1SRLA 2FPEA 1LJOA 5FU7C 1YCYA 5KE2A 4ORZA 2EGCA 3V7SA 1DJ7B 1YIJQ 3CMEQ 4FYXB 5DM7R 3C4SA 1VUBA 3TCJA 3EGXB 3ZEHA 2LT1A 4CC3A 2QQ9A 4C5HA 3META 1M5Q1 3URGA 3PGGA 3M9QA 4IIMA 1YJWA 2PVGB 2RQWA 2VC8A 3HSBA 1W4SA 3WVEB 2GFUA 5CR2A 3RERA 3FEOA 3M55A 2BZYA 4CRIA 4F17A 2AKLA 2GTOA 1M2VA 4B6MA 5FW9A 1YHQA 4PL6A 3RNJA 2GTJA 1M2VB 1D3BA 1WQ7A 2J6OA 2V8KA 2HD0A 5A0GA 5I21A 1VQPT 2ATCB 4C8QC 3RMQA 2RQUA 4JS4A 2AK5A 4J9BA 2J6KA 3CCMA 2QA4Q 4J9HA 1C0MA 1B34A 3QO3A 4IUVA 4EMKA 1T3LA 2MWPA 5DLOA 4BDYA 2Y4XA 4QW2A 1WHJA 3EHRA 3QJYA 2L89A 2OAUA 2RM4A 3H8ZA 3UPUA 4AFQC 5AYFA 4JZ3A 2RHXA 3MP1A 4OB2B 4D8KA 4EMKB 1YJWQ 4M7DD 2P4RA 3LYIA 3TQ7P 4RTYA 3MHXA 1IREB 5GAN6 5GMKi 5IT9E 5GMKh 1VQMQ 4KGZB 1VIFA 1JEGA 3NTIA 1ZBJA 1YJWT 1PCXA 3A1PA 1I4K1 4LDUA 4BE1A 2DERA 4F7UB 3M58A 3VJPA 2PNIA 2MYSA 1FMWA 2YXYA 3JCMQ 5C0MA 5A2QE 1M90U 3QPHA 2FB7A 4PJOB 4BE0A 2CH4A 3EFSA 2X4YA 4RTTA 2EYQA 5FRNA 1X6GA 4C0ZA 1ZSZB 2DO3A 3OYGA 2XMFA 2K79A 3GPLA 3J81E 1D1CA 2BIVA 3CCJQ 3KUFA 3HRSA 1YI2T 1M1FA 1K73R 2P0QA 1CKAA 4P5NA 4E7JA 2X3XD 4Z02A 3DLMA 2EQUA 2D0QB 4C0GA 4RTUA 2DZ9A 1D3BB 2LCCA 1GCQA 3LH0A 3P8HA 1WPYA 1ZHIA 4GY5A 1LOJA 4JUVA 2E12A 1X6BA 1JXOA 1Y07A 2K3BA 4C92A 1WA7A 3FC3A 4J9GA 4AFSC 2IG0A 4PJOD 2KR3A 1GCPA 2DXBA 1S72Q 2NUTA 2R58A 2QG9B 1M1KC 4M78G 1JU5C 4DOVA 1Y96A 3DB4A 1M90C 2K57A 5FU6C 5GMKj 1M4ZA 4FYYB 1Z9QA 4M75E 3RIRA 4XTXA 1PM3A 2F5TX 4FCYA 3MO8A 4DBQA 4PKCC 2DZCA 3VS7A 4LN2A 2COYA 2KY9A 1N9RA 5KYUA 1VQ5Q 1QCOA 2H3JA 4M4ZA 3JB9H 1NPRA 1K9MU 1VA7A 3OY9A 4QVZA 4M78B 2XICA 4A4FA 1WIEA 3INZA 2COWA 3HKSA 2RN8A 1N5ZA 2LRQA 1K9MC 1UUEA 2VB6A 1I81A 2KI7A 2F69A 1TUGB 2AKKA 2EJGA 3H0HA 3QIIA 3JB9F 4LXCA 3V8KA 3CMAT 1WLPB 4F16A 2I0NA 5GAN4 1ZUYA 3OS0A 3PE0A 1KQ2A 1GCQC 2LCLA 2DJQA 1ZQ1A 1ZSZC 2HNIA 8ATCB
chains in the Genus database with same CATH topology
3ZL7C 2KT1A 2FPFA 2B86A 2G6FX 4JJBA 4ZNXA 2HBWA 1RLQC 1WXBA 1A0NB 2LQWA 2O9VA 1NYFA 1K76A 2F2WA 1K0XA 2RQTA 2BTTA 4E6RA 1ARKA 1WDXA 2KGTA 1GBRA 2M0YA 2CT4A 1YN8A 2AZSA 2J7IA 2LZ6B 3C0CA 1I1JA 2V1RA 4RUGA 2K7AA 2A28A 4OMLA 2LJ0A 1M27C 2YDLA 2PTKA 3H0FA 4LUEA 2GBQA 1ZX6A 2H8HA 4RTVA 2O2OA 1AWOA 2CH4W 2YUPA 4DEYA 2HDAA 2RPNA 1PRMC 2DL3A 1NLOC 2YT6A 1NLPC 1UE9A 4X1VA 1NEBA 2DL8A 3EGUA 1UJYA 4AFZC 4J9CA 4CC4B 2LJ3A 4JJCA 3A98A 2JM9A 4A63B 2C0IA 2FG0A 1V1CA 4KRTA 2L0AA 3VS5A 1LCKA 3FJ5A 2J06A 2O9SA 4AG2C 5IXFA 5EC7A 1CSKA 1GL5A 2YUNA 2LMJA 1X2QA 2D8JA 3M0UA 1AD5A 2EGEA 3NHNA 3EHQA 3EG2A 1Y57A 3UF4A 1GRIA 1E6HA 4D8DA 2DMOA 2HCKA 1M3AA 1TUDA 1KJWA 4HCKA 4WCIA 1PRLC 4EIKA 1HSQA 1M30A 1I07A 2KNBB 1WYXA 2A36A 1T0JA 1WX6A 1WXTA 2CUBA 1B3QA 1KSWA 2FPDA 1BB9A 5GJVB 2KXCA 2W10A 2KT8A 1NG2A 2K2MA 1ZLMA 2M51A 1OOTA 5IHNA 4HVUA 2DRKA 2LQNA 1UTIA 3IQLA 4JJDA 2F2XA 4K11A 1QWFA 1WXUA 2VWFA 3U23A 5FWBA 2AZVA 1UG1A 4GLMA 2K9GA 2VKNA 2MOXA 1AWJA 4J9EA 2CT3A 1W70A 2E5KA 3THKA 4GBQA 5L23A 2KRMA 1TG0A 2OJ2A 1S1NA 4HVWA 2PZ1A 1QKWA 1JQQA 1G83A 3VS1A 2DM1A 4RTWA 3VS2A 4J9IA 4J9FA 2SRCA 1W1FA 1RUWA 1SEMA 3VS0A 2DX1A 1NEGA 3R6NA 1RLPC 3M0TA 1AOJA 1EFNA 2EGAA 2RNAA 2EKHA 3VRYA 2CREA 2L3QA 4OMPA 2DLPA 1ABOA 4QT7A 3UA7A 4Z88A 1G2BA 3TVTA 1SHFA 3QWYA 3NGPA 1VYVA 4OMQA 1MV0B 4FSSA 1YCSB 2ECZA 2JT4A 2EVRA 2DYBA 1B07A 3PVLA 1NM7A 1M3CA 2EYWA 4OMOA 1H3HA 3QWXX 3JV3A 2FO0A 1X27A 1UECA 1YNZA 2HSPA 2DL5A 1MV3A 1SRLA 2FPEA 2DE0X 1GBQA 2KBTA 3NPFA 2CUDA 2LX7A 4ORZA 1X43A 4AG1C 2EGCA 1M3BA 1E7OA 1Z9ZA 2LCSA 2GQIA 2NUZA 3PVQA 2SEMA 5IXBA 2JM8A 2DA9A 2KROA 2K6DA 1AVZC 4CC7A 1KFZA 1J3TA 2GNCA 4OMMA 3SHWA 4CC3A 1RI9A 4JZ4A 2MIOA 4IIMA 4JPBW 2RQWA 1T3SA 4ESRA 2RQVA 1VYUA 3REAB 5IHKA 3I5SA 1ZUKA 2BZYA 4F17A 2AKLA 4HVVA 2GTOA 4HXJA 5FW9A 2EYZA 2ABLA 1PKTA 3UATA 3VS6A 1K0SA 1GFCA 2DRMA 3RNJA 1CKBA 2GTJA 2W0ZA 2YUOA 1FMKA 4Z8AA 1U3OA 2DL7A 3SEMA 2DNUA 3LH5A 2D1XA 2J6OA 3I9QA 2L3SA 4LUDA 3REBB 1GFDA 1HJDA 2RF0A 1H8KA 2JMCA 4LE9A 2RQUA 2AK5A 3H0IA 3VS3A 3I35A 4J9BA 1WI7A 2J6KA 3TSZA 2JMAA 4J9HA 2OAWA 2CSIA 1OPKA 1T3LA 3VS4A 3M0PA 2DILA 1PWTA 3EHRA 1VYTA 2DBMA 1T0HA 2KYBA 2DBKA 1M8MA 2BZ8A 5I11A 4AFQC 1X69A 1YWOA 2DF6A 4JZ3A 2A37A 2GGRA 1JXMA 1PHTA 4D8KA 1KIKA 2D0NA 2ED0A 3EG0A 2P4RA 1BBZA 4RTYA 4Y92A 1OPLA 2ENMA 2VVKA 2F2VA 4LNPA 1U06A 1JEGA 1OV3A 1ZBJA 1K9AA 1AWXA 4F14A 2KE9A 2PNIA 1H92A 5ECAA 1ZUUA 3O5ZA 1IO6A 2MCNA 2LP5A 1QCFA 2DL4A 2JXBA 1U5SA 1K1ZA 1UHFA 1ABQA 2CH4A 1PNJA 3RBBB 3EG1A 4RTTA 4RTZA 2YSQA 2JTEA 4CC2A 1X6GA 1PKSA 4OMNA 1WFWA 2XMFA 2K79A 2KRSA 1AZGB 2X3WD 5FWCA 2IIMA 2EW3A 2LNHB 1CKAA 2OI3A 4R0KA 2X3XD 2EQIA 4RTUA 2V1QA 1BK2A 1E6GA 2A08A 2ROTA 3M0SA 5GJWB 1GCQA 5I22A 4Z89A 1X6BA 1JXOA 2K3BA 1WA7A 4J9GA 4AFSC 2KR3A 2KRNA 2L3PA 1GCPA 4AFUC 2FRYA 3TSWA 1ZSGA 1AWWA 5IHIA 1HD3A 1JU5C 3GBQA 2EPDA 3NMZC 1UJ0A 2O31A 1W6XA 3CQTA 2J05A 1QLYA 1Z9QA 4RTXA 2BZXA 2KEAA 2ROLA 1I0CA 2FEIA 3VS7A 2QDLA 2J6FA 2JW4A 1QKXA 4LN2A 4DEXA 1BU1A 2KYMA 2C0OA 2L2PA 2JS2A 3EG3A 1UDLA 4M4ZA 1VA7A 1MUZA 1NYGA 2O88A 1FYNA 2YUQA 1SSHA 1SPKA 1UFFA 1TUCA 2C0TA 1WIEA 2KXDA 1YWPA 2CDTA 2CSQA 3VRZA 2RQRA 1Y0MA 2RN8A 1XOVA 2ED1A 1N5ZA 2D8HA 2NWMA 1K4US 2LJ1A 2RMOA 2HEQA 1UUEA 3H41A 1SHGA 2JS0A 2AKKA 3H0HA 5HCKA 3M0RA 3ULRB 2EYXA 3UA6A 1AZEA 1JO8A 1WLPB 1OEBA 4F16A 2I0NA 2EBPA 1SRMA 1UHCA 4J9DA 1ZUYA 2DVJA 3PE0A 1GCQC 3I5RA 1X2KA 2EYYA 5IH2A 2FRWA 2DJQA 2ESWA 3KFVA 4IIOA 1QWEA 1UGVA 3M0QA 1AEYA 1YP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZL7 C;  2KT1 A;  2FPF A;  2B86 A;  2G6F X;  4JJB A;  4ZNX A;  2HBW A;  1RLQ C;  1WXB A;  1A0N B;  2LQW A;  2O9V A;  1NYF A;  1K76 A;  2F2W A;  1K0X A;  2RQT A;  2BTT A;  4E6R A;  1ARK A;  1WDX A;  2KGT A;  1GBR A;  2M0Y A;  2CT4 A;  1YN8 A;  2AZS A;  2J7I A;  2LZ6 B;  3C0C A;  1I1J A;  2V1R A;  4RUG A;  2K7A A;  2A28 A;  4OML A;  2LJ0 A;  1M27 C;  2YDL A;  2PTK A;  3H0F A;  4LUE A;  2GBQ A;  1ZX6 A;  2H8H A;  4RTV A;  2O2O A;  1AWO A;  2CH4 W;  2YUP A;  4DEY A;  2HDA A;  2RPN A;  1PRM C;  2DL3 A;  1NLO C;  2YT6 A;  1NLP C;  1UE9 A;  4X1V A;  1NEB A;  2DL8 A;  3EGU A;  1UJY A;  4AFZ C;  4J9C A;  4CC4 B;  2LJ3 A;  4JJC A;  3A98 A;  2JM9 A;  4A63 B;  2C0I A;  2FG0 A;  1V1C A;  4KRT A;  2L0A A;  3VS5 A;  1LCK A;  3FJ5 A;  2J06 A;  2O9S A;  4AG2 C;  5IXF A;  5EC7 A;  1CSK A;  1GL5 A;  2YUN A;  2LMJ A;  1X2Q A;  2D8J A;  3M0U A;  1AD5 A;  2EGE A;  3NHN A;  3EHQ A;  3EG2 A;  1Y57 A;  3UF4 A;  1GRI A;  1E6H A;  4D8D A;  2DMO A;  2HCK A;  1M3A A;  1TUD A;  1KJW A;  4HCK A;  4WCI A;  1PRL C;  4EIK A;  1HSQ A;  1M30 A;  1I07 A;  2KNB B;  1WYX A;  2A36 A;  1T0J A;  1WX6 A;  1WXT A;  2CUB A;  1B3Q A;  1KSW A;  2FPD A;  1BB9 A;  5GJV B;  2KXC A;  2W10 A;  2KT8 A;  1NG2 A;  2K2M A;  1ZLM A;  2M51 A;  1OOT A;  5IHN A;  4HVU A;  2DRK A;  2LQN A;  1UTI A;  3IQL A;  4JJD A;  2F2X A;  4K11 A;  1QWF A;  1WXU A;  2VWF A;  3U23 A;  5FWB A;  2AZV A;  1UG1 A;  4GLM A;  2K9G A;  2VKN A;  2MOX A;  1AWJ A;  4J9E A;  2CT3 A;  1W70 A;  2E5K A;  3THK A;  4GBQ A;  5L23 A;  2KRM A;  1TG0 A;  2OJ2 A;  1S1N A;  4HVW A;  2PZ1 A;  1QKW A;  1JQQ A;  1G83 A;  3VS1 A;  2DM1 A;  4RTW A;  3VS2 A;  4J9I A;  4J9F A;  2SRC A;  1W1F A;  1RUW A;  1SEM A;  3VS0 A;  2DX1 A;  1NEG A;  3R6N A;  1RLP C;  3M0T A;  1AOJ A;  1EFN A;  2EGA A;  2RNA A;  2EKH A;  3VRY A;  2CRE A;  2L3Q A;  4OMP A;  2DLP A;  1ABO A;  4QT7 A;  3UA7 A;  4Z88 A;  1G2B A;  3TVT A;  1SHF A;  3QWY A;  3NGP A;  1VYV A;  4OMQ A;  1MV0 B;  4FSS A;  1YCS B;  2ECZ A;  2JT4 A;  2EVR A;  2DYB A;  1B07 A;  3PVL A;  1NM7 A;  1M3C A;  2EYW A;  4OMO A;  1H3H A;  3QWX X;  3JV3 A;  2FO0 A;  1X27 A;  1UEC A;  1YNZ A;  2HSP A;  2DL5 A;  1MV3 A;  1SRL A;  2FPE A;  2DE0 X;  1GBQ A;  2KBT A;  3NPF A;  2CUD A;  2LX7 A;  4ORZ A;  1X43 A;  4AG1 C;  2EGC A;  1M3B A;  1E7O A;  1Z9Z A;  2LCS A;  2GQI A;  2NUZ A;  3PVQ A;  2SEM A;  5IXB A;  2JM8 A;  2DA9 A;  2KRO A;  2K6D A;  1AVZ C;  4CC7 A;  1KFZ A;  1J3T A;  2GNC A;  4OMM A;  3SHW A;  4CC3 A;  1RI9 A;  4JZ4 A;  2MIO A;  4IIM A;  4JPB W;  2RQW A;  1T3S A;  4ESR A;  2RQV A;  1VYU A;  3REA B;  5IHK A;  3I5S A;  1ZUK A;  2BZY A;  4F17 A;  2AKL A;  4HVV A;  2GTO A;  4HXJ A;  5FW9 A;  2EYZ A;  2ABL A;  1PKT A;  3UAT A;  3VS6 A;  1K0S A;  1GFC A;  2DRM A;  3RNJ A;  1CKB A;  2GTJ A;  2W0Z A;  2YUO A;  1FMK A;  4Z8A A;  1U3O A;  2DL7 A;  3SEM A;  2DNU A;  3LH5 A;  2D1X A;  2J6O A;  3I9Q A;  2L3S A;  4LUD A;  3REB B;  1GFD A;  1HJD A;  2RF0 A;  1H8K A;  2JMC A;  4LE9 A;  2RQU A;  2AK5 A;  3H0I A;  3VS3 A;  3I35 A;  4J9B A;  1WI7 A;  2J6K A;  3TSZ A;  2JMA A;  4J9H A;  2OAW A;  2CSI A;  1OPK A;  1T3L A;  3VS4 A;  3M0P A;  2DIL A;  1PWT A;  3EHR A;  1VYT A;  2DBM A;  1T0H A;  2KYB A;  2DBK A;  1M8M A;  2BZ8 A;  5I11 A;  4AFQ C;  1X69 A;  1YWO A;  2DF6 A;  4JZ3 A;  2A37 A;  2GGR A;  1JXM A;  1PHT A;  4D8K A;  1KIK A;  2D0N A;  2ED0 A;  3EG0 A;  2P4R A;  1BBZ A;  4RTY A;  4Y92 A;  1OPL A;  2ENM A;  2VVK A;  2F2V A;  4LNP A;  1U06 A;  1JEG A;  1OV3 A;  1ZBJ A;  1K9A A;  1AWX A;  4F14 A;  2KE9 A;  2PNI A;  1H92 A;  5ECA A;  1ZUU A;  3O5Z A;  1IO6 A;  2MCN A;  2LP5 A;  1QCF A;  2DL4 A;  2JXB A;  1U5S A;  1K1Z A;  1UHF A;  1ABQ A;  2CH4 A;  1PNJ A;  3RBB B;  3EG1 A;  4RTT A;  4RTZ A;  2YSQ A;  2JTE A;  4CC2 A;  1X6G A;  1PKS A;  4OMN A;  1WFW A;  2XMF A;  2K79 A;  2KRS A;  1AZG B;  2X3W D;  5FWC A;  2IIM A;  2EW3 A;  2LNH B;  1CKA A;  2OI3 A;  4R0K A;  2X3X D;  2EQI A;  4RTU A;  2V1Q A;  1BK2 A;  1E6G A;  2A08 A;  2ROT A;  3M0S A;  5GJW B;  1GCQ A;  5I22 A;  4Z89 A;  1X6B A;  1JXO A;  2K3B A;  1WA7 A;  4J9G A;  4AFS C;  2KR3 A;  2KRN A;  2L3P A;  1GCP A;  4AFU C;  2FRY A;  3TSW A;  1ZSG A;  1AWW A;  5IHI A;  1HD3 A;  1JU5 C;  3GBQ A;  2EPD A;  3NMZ C;  1UJ0 A;  2O31 A;  1W6X A;  3CQT A;  2J05 A;  1QLY A;  1Z9Q A;  4RTX A;  2BZX A;  2KEA A;  2ROL A;  1I0C A;  2FEI A;  3VS7 A;  2QDL A;  2J6F A;  2JW4 A;  1QKX A;  4LN2 A;  4DEX A;  1BU1 A;  2KYM A;  2C0O A;  2L2P A;  2JS2 A;  3EG3 A;  1UDL A;  4M4Z A;  1VA7 A;  1MUZ A;  1NYG A;  2O88 A;  1FYN A;  2YUQ A;  1SSH A;  1SPK A;  1UFF A;  1TUC A;  2C0T A;  1WIE A;  2KXD A;  1YWP A;  2CDT A;  2CSQ A;  3VRZ A;  2RQR A;  1Y0M A;  2RN8 A;  1XOV A;  2ED1 A;  1N5Z A;  2D8H A;  2NWM A;  1K4U S;  2LJ1 A;  2RMO A;  2HEQ A;  1UUE A;  3H41 A;  1SHG A;  2JS0 A;  2AKK A;  3H0H A;  5HCK A;  3M0R A;  3ULR B;  2EYX A;  3UA6 A;  1AZE A;  1JO8 A;  1WLP B;  1OEB A;  4F16 A;  2I0N A;  2EBP A;  1SRM A;  1UHC A;  4J9D A;  1ZUY A;  2DVJ A;  3PE0 A;  1GCQ C;  3I5R A;  1X2K A;  2EYY A;  5IH2 A;  2FRW A;  2DJQ A;  2ESW A;  3KFV A;  4IIO A;  1QWE A;  1UGV A;  3M0Q A;  1AEY A;  1YP5 A; 
#chains in the Genus database with same CATH topology
 2KT1 A;  4JS5 A;  4M75 D;  3CCQ Q;  1X01 A;  4ZNX A;  2K5L A;  4LDV A;  1YIT Q;  1WHG A;  2LQW A;  4M78 C;  3OYE A;  1VQ5 A;  1QVF A;  2HMA A;  1NYF A;  4HT9 A;  2M1H A;  1D0Z A;  1RAG B;  1M8V A;  3OMG A;  2BTT A;  1ARK A;  1LVK A;  1WJS A;  2KGT A;  3CCE A;  2M0Y A;  1WJR A;  3L2R A;  3OYF A;  3G71 A;  4ATO A;  1BI1 A;  2BE7 D;  1IB8 A;  1I1J A;  2A28 A;  3HFO A;  1VIE A;  4LUE A;  5CKD A;  3QG1 A;  3X28 B;  1ZX6 A;  4IUT A;  1Q7Y U;  3V8J A;  1NLO C;  3L2U A;  2DL8 A;  3OBW A;  4AFZ C;  1TU0 B;  1B7T A;  2FG0 A;  3OSV A;  1VQ7 Q;  2AT1 B;  2O9S A;  2P4T A;  3VUB A;  5IXF A;  2YUN A;  2LMJ A;  3D7S B;  3FLG A;  3CCR Q;  4BI3 A;  2LQK A;  4J83 A;  3M54 A;  1QQJ A;  1VQ7 T;  2OTL T;  1GRI A;  1E6H A;  4D8D A;  4C5I A;  1WHH A;  2XK0 A;  4MZT A;  4VUB A;  4C8Q B;  1M3A A;  2QA4 A;  5GAN 3;  5GAO l;  1VQ4 A;  3CC2 Q;  3FB9 A;  3H6Z A;  3OBY A;  4EIK A;  3PFS A;  4M7A D;  2KNB B;  3OA6 A;  2A36 A;  2OTJ Q;  3A8L B;  2FYK A;  1B3Q A;  2FPD A;  5M9O A;  2M51 A;  1NE8 A;  1Q82 U;  2X4J A;  4FT2 A;  3FRN A;  1MND A;  3JB9 J;  2F2X A;  2FL7 A;  3QJ6 A;  1VQ9 A;  2AZV A;  3MEU A;  1UG1 A;  5GAN e;  4LD9 K;  4JRQ A;  1ACM B;  1RAH B;  1AWJ A;  1YJ9 A;  4DQ2 A;  3HHT B;  1EIF A;  2E5K A;  4X9D A;  2K2V A;  2KRM A;  1TOV A;  3HRU A;  3G4S A;  4HVW A;  3OYD A;  1NJI R;  4NL3 A;  3L2Z A;  5KYX B;  3VS1 A;  1SSF A;  2DM1 A;  4RTW A;  3VS2 A;  1YI2 A;  1TXQ A;  1W1F A;  2FHD A;  3VS0 A;  3CCQ A;  1NEG A;  3QSU A;  3MEW A;  4JRK A;  4X9C A;  4BY6 B;  3CCL A;  2EQM A;  2CRE A;  2DLP A;  2RJD A;  2X35 A;  1ABO A;  2OTL A;  4Z88 A;  3TVT A;  3LLR A;  3QWY A;  1VYV A;  1IHW A;  4OMQ A;  3M5A A;  3OB9 A;  1MV0 B;  3F70 A;  2DYI A;  1EZZ B;  2ECZ A;  3FJP A;  2HL5 C;  4XQ3 A;  4E7H A;  2EYW A;  1H3H A;  2O01 E;  2FO0 A;  4M75 F;  1VQ6 Q;  3O8V A;  4J5Y A;  1JJ2 S;  1YJ9 Q;  1VQ8 T;  2DE0 X;  2V8I A;  1GBQ A;  2KBT A;  4M7D B;  5LJ3 d;  3SDZ A;  1E7O A;  1VQ6 T;  2GQI A;  2P0P A;  3PVQ A;  4WTO B;  1YJ9 T;  1OYX A;  2K6D A;  4LDX A;  2ZAE A;  5LJ3 f;  3PIP A;  1KFZ A;  1J3T A;  3UDC A;  2CKK A;  4OMM A;  4EMG A;  1RI9 A;  2ZZD A;  2E41 A;  3JB9 D;  2HAX A;  2JUF A;  3CBM A;  2LC4 A;  5J39 A;  2RHU A;  2E1H A;  4ESR A;  2KQW A;  3OW2 A;  1KG1 A;  1MMN A;  3I5S A;  5I2S A;  2DD4 A;  1ZUK A;  4EMH A;  4C8Q E;  4HXJ A;  3SWN A;  4RMO A;  2D6F A;  1PKT A;  3UAT A;  2DRM A;  2HSE B;  2FVU A;  4KH0 B;  4ZTF A;  1CKB A;  2YUO A;  1FMK A;  1SG5 A;  1XTD A;  1U3O A;  1H3Z A;  3LH5 A;  1PD1 A;  5AT1 B;  2D1X A;  3JCM b;  1XJW B;  1XNI A;  2JNG A;  2EFI A;  1KD1 C;  4LUD A;  1VQ9 Q;  1HJD A;  1V76 A;  2VUB A;  4PJM A;  2JMC A;  2YRV A;  3I55 T;  4LE9 A;  2K3X A;  3H0I A;  3VS3 A;  2HBP A;  3I35 A;  3UWN A;  2XG8 D;  4CI0 C;  4N4H A;  3I55 Q;  3UT1 A;  1VQ8 A;  1PWT A;  4XTW A;  2MMP A;  4BY6 C;  1UGR B;  5I11 A;  1YI2 Q;  3LW5 E;  1X69 A;  1YWO A;  1Q95 G;  2DF6 A;  5FRO A;  3E9F A;  2ED0 A;  1QP3 A;  4Y92 A;  1OPL A;  3L42 A;  1U06 A;  2K5I A;  1OV3 A;  4FYW B;  4OB1 B;  5GAO n;  2QQB A;  1W2B S;  3CXC S;  2KE9 A;  2NUP B;  2RA2 A;  3ASK A;  2QAZ A;  2JTF A;  5ECA A;  2MCN A;  2KSS A;  1IO6 A;  1QCF A;  2OX7 A;  4M77 A;  2DL4 A;  1W2B A;  4XTV A;  3L2Q A;  3CEY A;  1ABQ A;  1RAA B;  3VYH B;  4CC2 A;  4TVR A;  2IVW A;  1Q82 C;  3JSC A;  1PKS A;  3A8M B;  2E65 A;  2KRS A;  2XKO C;  1VQK A;  1QW1 A;  3OYB A;  4KUI A;  1VQ7 A;  2RJE A;  4M7A F;  2XD0 A;  4A4K A;  2LNH B;  5D6Y A;  5L8R E;  4R0K A;  1WJQ A;  4KH1 B;  1VQ4 T;  3M0S A;  3V7R A;  4ZGJ B;  1SKU B;  4XTU A;  5I22 A;  2E5Q A;  5A0L A;  3E1S A;  2CZ0 B;  4KUD K;  1YFN A;  1KQ1 A;  1BIA A;  4M7D F;  4M78 E;  1MMG A;  2V8J A;  4UC4 A;  3RR6 A;  2L3P A;  1Y71 A;  1JRI A;  4M75 B;  2FRY A;  2YHT A;  1AWW A;  5IHI A;  4FSX A;  1HD3 A;  5J3B A;  1UJ0 A;  3CQT A;  4RTX A;  3NFC A;  1YJN T;  2BZX A;  2KEA A;  4A4H A;  2DEQ A;  4YTL A;  5GAN g;  2J6F A;  2JW4 A;  1QKX A;  4RCB A;  1NJI C;  3MCA B;  1BU1 A;  2KYM A;  2MPX C;  2FZC B;  1UDL A;  2DET A;  2GQV A;  3CCQ T;  1EX4 A;  2O88 A;  4B9W A;  2YUQ A;  1SSH A;  3JCM d;  2PU9 B;  3GNG A;  2KDS A;  2A3L A;  2CDT A;  1YHQ Q;  2HEQ A;  1QVF P;  5IAY A;  1SHG A;  1W2B P;  1QMC A;  3GF5 A;  1HYO A;  3EGD A;  2QAS A;  3UA6 A;  2C06 A;  1AZE A;  2E10 A;  1JO8 A;  2CP0 A;  3SWN C;  4ZGE B;  1OU8 A;  2Y4Y A;  1IHV A;  4PFZ A;  1UHC A;  5GAN f;  4J9D A;  2DVJ A;  2K4Y A;  3I5R A;  1X2K A;  1OX9 A;  3WXM B;  3KFV A;  2F5K A;  9ATC B;  4F04 B;  1QWE A;  3M0Q A;  1AEY A;  4QVC A;  1VQO A;  3ZL7 C;  1VQ6 A;  5GAO q;  1VQ5 T;  2B86 A;  2G6F X;  2K3Y A;  4JJB A;  5CKH A;  1M1K R;  3FDR A;  1WHM A;  4AT1 B;  3JB9 I;  1BIB A;  3CCV A;  3A8G B;  1VQM A;  3G71 T;  2RQT A;  1X6O A;  2QYZ A;  1OZ2 A;  3OYA A;  1BI3 A;  1IZ6 A;  2PVD B;  3OW2 P;  3L1A A;  4NS5 A;  2J7I A;  2LZ6 B;  4OMF B;  3CCS T;  2V1R A;  1MHN A;  1U1T A;  1M27 C;  2ZGW A;  3H0F A;  3CBP A;  1XQH A;  1KQS A;  2YUP A;  3CCS Q;  4DEY A;  2HDA A;  4R56 A;  4PLI A;  2DL3 A;  1IRX A;  1NLP C;  3M53 A;  1UE9 A;  3MEV A;  3VYG A;  3X24 B;  1UJY A;  4J9C A;  2A7Y A;  2LJ3 A;  2LNV A;  4MML A;  4A63 B;  2C0I A;  1V1C A;  4KRT A;  5LJ5 j;  3VS5 A;  4WF2 A;  1SF9 A;  2XID A;  1GL5 A;  3CC4 T;  2KVQ G;  1X2Q A;  5LJ3 e;  2Z0W A;  3VUZ A;  1AD5 A;  4IUQ A;  3QDF A;  1Y57 A;  3UF4 A;  3RKX A;  1F1B B;  1G3T A;  4A54 A;  2HCK A;  1VQO T;  2RHI A;  3CXC A;  3CBO A;  3MP8 A;  1TUD A;  3M56 A;  1WYX A;  2DFU A;  1BKB A;  1TTH B;  1KHC A;  1WX6 A;  2CS7 A;  2RD1 A;  4BD3 A;  4HVU A;  5GAM j;  4OF1 A;  5LJ5 f;  5KYX A;  1VQN T;  1UTI A;  2EIF A;  4C0F A;  3CXC P;  4K11 A;  2VWF A;  3U23 A;  5GAN 5;  1RAC B;  5FWB A;  1BYM A;  5LJ5 d;  1RAD B;  3FIF A;  2CGH A;  2CZ6 B;  2E64 A;  4N0A C;  1VQN Q;  2HQE A;  2MOX A;  4PJJ A;  2CT3 A;  4XTZ A;  2CP2 A;  3THK A;  4M77 G;  3CCR T;  1KHI A;  3CCL Q;  1TG0 A;  2OJ2 A;  3RKW A;  2DTI A;  4PJL A;  1R0C B;  1JQQ A;  3RDV A;  4J9F A;  4JJN K;  1QVG A;  3CCL T;  1MGQ A;  4Y28 E;  2LVM A;  2X9H A;  3R6N A;  3M0T A;  1N6A A;  3RUX A;  2EGA A;  2H3E B;  5D6X A;  2RH2 A;  2F1L A;  2L3Q A;  2QQR A;  3EH2 A;  4MMK A;  2RK2 A;  4QT7 A;  1G2B A;  3ZFJ A;  5CQX A;  3T9N A;  2ZPH B;  5KYY A;  1Q81 C;  1U8R A;  1TSF A;  1VOM A;  4HT8 A;  2WSF E;  1PG5 B;  4FIB A;  2CZ1 B;  3OW2 S;  3PVL A;  1NM7 A;  1KC8 C;  4OMO A;  3QWX X;  1X27 A;  1P92 A;  5KYW B;  1YNZ A;  1VQN A;  5J26 A;  3C94 A;  3QZ9 B;  3OYC A;  1X43 A;  2PUK B;  1IGQ A;  3JCM c;  1M3B A;  1Z9Z A;  2LCS A;  1ZSZ A;  2GCX A;  2SEM A;  2JM8 A;  4DBH A;  2KRO A;  1AVZ C;  4CC7 A;  4PJN A;  4M77 B;  2M02 A;  1UGS B;  3SHW A;  2A0F B;  4M7D E;  4XU0 A;  4JZ4 A;  1V29 B;  4OP0 A;  1YIJ T;  3QBY A;  2R5A A;  2RQV A;  3JCM W;  2YRD A;  1C6V X;  3REA B;  3R6O A;  3P8B B;  3OYJ A;  5KCH A;  4BAC A;  4O5V A;  2E4H A;  5GAO m;  2ABL A;  3VS6 A;  2QQS A;  4PJO F;  1VQP Q;  1VQL A;  1OI1 A;  3OMC A;  1N8R R;  1G3Y A;  3CCU A;  4C0D B;  2DNU A;  4PJO G;  3I55 A;  1VQ8 Q;  1TS9 A;  4L6V 5;  3I9Q A;  2L3S A;  4C8Q G;  4F7U F;  3JB9 G;  3REB B;  4BUG A;  3TU4 K;  2GFA A;  3CC7 T;  3ME9 A;  3E2U A;  1BI2 A;  1UEB A;  5LJ3 h;  2EQJ A;  2RF0 A;  2CP3 A;  1QVP A;  3J7A F;  3TSZ A;  4J6Y A;  2BE9 B;  2JMA A;  2OAW A;  5CVI A;  1Q7Y C;  3JCM X;  1OPK A;  4E7Z A;  3M0P A;  2DIL A;  1VYT A;  2DBM A;  1T0H A;  3PIO A;  2OTJ A;  2D9T A;  1M8M A;  3CCV T;  4E7I A;  4OB0 B;  4NOY A;  2BZ8 A;  2RHY A;  7AT1 B;  4M7A E;  5FU6 B;  1Q86 R;  1K8A R;  1I5O B;  4C92 D;  2GGR A;  2QGG A;  2L5Q A;  2AHJ B;  1D0X A;  1KIK A;  2D0N A;  1JB0 E;  3BE3 A;  2KK4 A;  3JCM g;  5KYW A;  4C8Q F;  1NZ9 A;  3A8H B;  4Q5W A;  4J7F A;  3TRE A;  1AWX A;  5CK9 A;  3HP9 A;  2WSE E;  1PSE A;  1ZUU A;  2XU8 A;  1WHK A;  2JXB A;  1OZ3 A;  3LGF A;  1FMV A;  1RAE B;  1PNJ A;  1VQK T;  4RTZ A;  1VQL T;  1PC0 A;  2QGF B;  2E6N A;  4OMN A;  4ZTJ A;  5FWC A;  3G6E Q;  4JRP A;  1N8R C;  3AHU A;  1R8O B;  2IIM A;  2K5F A;  2NYS A;  2YWW A;  3LGL A;  3N5B B;  4ELY C;  2KAF A;  2OI3 A;  5HY6 A;  3S3M A;  3CCE Q;  4XTY A;  2RJF A;  2EQI A;  3OYL A;  1E6G A;  2A08 A;  3CCJ T;  1U1S A;  3TEE A;  5GJW B;  1KQS S;  1R77 A;  3CCE T;  4LDY A;  3PNW C;  4MDW A;  3GIB A;  1YHQ T;  4XAX B;  1K9M R;  2M16 A;  5GAM h;  5HK0 A;  1QVF S;  3EFR A;  2BKD N;  3MP6 A;  2HQH A;  1YJN A;  4C92 E;  3BW1 A;  3GBQ A;  2EWN A;  2EPD A;  2XHC A;  3NMZ C;  2O31 A;  1W6X A;  3NTK A;  5KYY B;  1S72 T;  3OYK A;  3CCR A;  2EKO A;  4RG2 A;  1AT1 B;  1QLY A;  3JAM E;  3CCM T;  4XK8 E;  4ZGD B;  2RI2 A;  2QDL A;  3GOX A;  4DEX A;  1UGP B;  4FYV B;  2L2P A;  1VQ4 Q;  2JS2 A;  3EG3 A;  2WSC E;  2XDP A;  3DKM A;  1MUZ A;  1RAB B;  1NYG A;  2KMT A;  1KD1 U;  1SPK A;  4N4I A;  2MAM A;  1TUC A;  2DK3 A;  3G71 Q;  2CSQ A;  3VRZ A;  1Y0M A;  2NWM A;  2LJ1 A;  2RMO A;  1NPP A;  4M78 F;  3S3N A;  3WVD B;  3ULR B;  3AT1 B;  1I5L A;  4J8O A;  1OEB A;  4C8Q A;  4JLG A;  2QQA A;  4QQG A;  2GF7 A;  3CMA Q;  1M1G A;  3CPW P;  2EYY A;  3HL8 A;  4II1 A;  2ZPB B;  1YIT T;  3S6W A;  4RKU E;  2ESW A;  3L2W A;  4EMK C;  3MEA A;  1UGV A;  2FZK B;  3RKY A;  1M1K U;  3JRZ A;  4IUR A;  5DY9 A;  4AMC A;  3G4S T;  2QEX Q;  1KK7 A;  2M0O A;  2O9V A;  3M57 A;  1NJI U;  2PUO B;  2F2W A;  1K0X A;  2P0K A;  3CCS A;  1YIJ A;  1WDX A;  2VAS A;  1OX8 A;  3KBG A;  1VQO Q;  4X34 A;  4RUG A;  2K7A A;  4OML A;  5CCA A;  2LJ0 A;  2YDL A;  1N8R U;  4QQD A;  2PTK A;  1YBY A;  2H8H A;  4RTV A;  1AWO A;  2RPN A;  2JN0 A;  1PRM C;  3EGD B;  2YRC A;  3OS5 A;  1WGS A;  4X1V A;  1NEB A;  3EGU A;  4RCC A;  1N27 A;  4CC4 B;  4JJC A;  2EJF A;  2JM9 A;  1KC8 U;  2WAC A;  3CC7 A;  2HQX A;  1ZBX A;  5IN1 A;  3A5Z B;  1LCK A;  3FJ5 A;  2J06 A;  4AG2 C;  1Y7X A;  2DEU A;  1CSK A;  1Q81 U;  3M0U A;  1O75 A;  3VKI A;  3NHN A;  5LJ3 g;  4J7I A;  1OUL A;  3EHQ A;  4A4E A;  3EG2 A;  2ZPE B;  2YLC A;  3HTR A;  5CIU A;  3QHS A;  2DMO A;  3LWH A;  2B8A A;  2EJ9 A;  4F7U E;  4N4G A;  1O9S A;  4HCK A;  1KJW A;  4WCI A;  1PRL C;  3I56 Q;  1HSQ A;  4R55 A;  1M30 A;  4PJO E;  1I07 A;  4RG8 A;  2Y90 A;  2CUB A;  2W10 A;  2KT8 A;  1NG2 A;  2DTO A;  4ZN3 A;  2LQN A;  2RJC A;  3IQL A;  5GAN 7;  2CP5 A;  4C92 C;  3JCM J;  4OGC A;  1QWF A;  4MZP A;  4M78 A;  4O6J A;  3OYY A;  2K9G A;  2VGN A;  3LWI A;  2BUD A;  2JVV A;  3C12 A;  4J9E A;  1W70 A;  4GBQ A;  1QP2 A;  3CC4 Q;  1TWB A;  5L23 A;  4FT4 A;  3VU3 C;  4BE2 A;  2PZ1 A;  1X75 C;  1KD1 R;  3OS1 A;  1UB4 A;  2RB6 A;  3ZBD A;  4J9I A;  4IUU A;  3QYH B;  1RUW A;  3CPW A;  1SEM A;  2CP7 A;  2M9U A;  2DX1 A;  3CD6 T;  1AOJ A;  1EFN A;  2XDD A;  3CCJ A;  1N9S A;  3LX7 A;  5D7U A;  4XU1 A;  2MI6 A;  3CD6 Q;  3NGP A;  3CPF A;  2COZ A;  4M7A A;  2DJZ A;  3GLX A;  1H64 1;  6AT1 B;  4IUP A;  4FL6 A;  3EG9 B;  5GAN j;  2NUP A;  2EVR A;  2DYB A;  3Q1J A;  2ZPF B;  2VV5 A;  5GAM g;  5FLX E;  2NLU A;  1UEC A;  2HSP A;  3OQ5 A;  4JDS A;  4BI8 B;  1MNE A;  1MV3 A;  1S72 A;  1OU9 A;  5GAN 8;  3NPF A;  2CUD A;  3NTH A;  2LX7 A;  3JCM f;  4AG1 C;  3H9N A;  3PMT A;  3CC7 Q;  3EFO A;  2NUZ A;  5CQY A;  2O4X B;  2LT4 A;  3SD4 A;  2HKQ B;  2I2L A;  2DPP B;  5IXB A;  5KE3 A;  2DA9 A;  3BDU A;  2QA4 T;  2GNC A;  1WHL A;  3QZ5 B;  2MIO A;  4N0A A;  3VV0 A;  4JPB W;  4PK4 A;  1T3S A;  5GAM d;  4KUL A;  1VYU A;  3CC2 A;  5IHK A;  5GAN d;  1C1A A;  3CCU T;  4HVV A;  3QKJ A;  1HXD A;  4C92 B;  5GAM f;  3DLL A;  5KH6 A;  2EYZ A;  2DXC A;  4BDZ A;  1VQ9 T;  1K0S A;  4PFP A;  1GFC A;  2W0Z A;  4Z8A A;  3SB2 A;  2DL7 A;  3SEM A;  3RMS A;  2JOY A;  5CAI A;  4FW2 A;  1RAF B;  3X20 B;  2CP6 A;  4KBM B;  3QUI A;  1GFD A;  1G3S A;  2HKN A;  2DXT A;  1H8K A;  1GXI E;  3A8O B;  3CME T;  2ZCF B;  3OSS C;  1WI7 A;  1WNL A;  1VQK Q;  1VQL Q;  4A53 A;  2CSI A;  2XDB A;  1QCN A;  3VS4 A;  5LJ5 h;  1M2O A;  2E70 A;  1Y96 B;  2KYB A;  2DBK A;  4M7D C;  1BI0 A;  4A4G A;  2JJ9 A;  4E47 A;  5LJ5 g;  2A37 A;  4PJO C;  1JXM A;  1OQK A;  1PHT A;  1G3W A;  2LDM A;  3EG0 A;  3PTA A;  1BBZ A;  4D6W A;  1JJ2 P;  1Q81 R;  3OYH A;  3M59 A;  2ENM A;  5GMK m;  2VVK A;  2F2V A;  2ZPI B;  4LNP A;  4L5G A;  1MMA A;  3PT9 A;  5KYN A;  3EAE A;  1K9A A;  3HPW A;  3G7Z A;  4F14 A;  2QTV A;  3ER0 A;  4FU6 A;  5KCO A;  4C5G A;  2E3H A;  1RL2 A;  1H92 A;  5LL6 S;  3O5Z A;  3G6E A;  2LP5 A;  5I2M A;  4M77 F;  1ZA2 B;  2R57 A;  2G3R A;  1U5S A;  1JJ2 A;  4KT0 E;  1K1Z A;  1UHF A;  3QXE B;  1RAI B;  3RBB B;  3EG1 A;  4C92 F;  2YSQ A;  2JTE A;  4J6X A;  5DLQ E;  5GAN 2;  4DOW A;  1G8X A;  2O4X A;  3M4G A;  3KXT A;  1WFW A;  3EFO B;  2DIG A;  2E3I A;  2CZ7 B;  4HA8 A;  4M7A G;  1AZG B;  2X3W D;  3CCV Q;  2DKG A;  4E7K A;  3GP8 A;  2RI5 A;  2EW3 A;  4XU2 A;  2PVO B;  2V1Q A;  1BK2 A;  2ROT A;  1VQM T;  1KC8 R;  4Z89 A;  2DTH A;  4M75 A;  5CKF A;  4XU3 A;  2V26 A;  3SWN B;  5C6S A;  4HCB A;  3J80 E;  3OYM A;  5A0D A;  2R5M A;  2X4W A;  2KRN A;  4M7D G;  3HFN A;  4GLK A;  4AFU C;  4KGX B;  4PFO A;  4E7L A;  3TSW A;  2JZ2 A;  1ZSG A;  3GNF B;  2QTX A;  4Y91 A;  4C5E A;  1LPL A;  1D0Y A;  2VXF A;  5EG2 A;  2CYZ B;  4BB7 A;  2J05 A;  4KGV B;  3G6E T;  2FZG B;  2ROL A;  1I0C A;  4HCC A;  2FEI A;  2P84 A;  3V7C A;  1FXX A;  3QDR B;  2EAY A;  3CC4 A;  4HCZ A;  2C0O A;  4FW1 A;  1K8A C;  1WQW A;  1YJN Q;  1M9S A;  3G4S Q;  3SFM A;  3P8D A;  1D1B A;  1FYN A;  2JTM A;  1UFF A;  4DBF A;  1QVG P;  5D6W A;  2C0T A;  2KXD A;  4EPC A;  2PQW A;  3JCM h;  1YWP A;  8AT1 B;  5FRM A;  4LD6 A;  2RQR A;  1XOV A;  2ED1 A;  2D8H A;  1K4U S;  4M7A C;  3H41 A;  1D09 B;  2JS0 A;  5HCK A;  1FWZ A;  3M0R A;  5FU7 B;  1QVG S;  2MK5 A;  2HL3 A;  3M4Y A;  2EYX A;  2LTO A;  4PNO A;  3JCM P;  4IKF A;  2ZPG B;  1K8A U;  1ZA1 B;  1BCO A;  1BCM A;  2RK1 A;  2QEX A;  3JCM V;  2EBP A;  1YIT A;  1SRM A;  4E7S A;  4ZN1 A;  3EGX A;  3CCM Q;  4QKU A;  4ME7 A;  5IH2 A;  2DVE A;  2FRW A;  4PJO A;  4M75 C;  3OYN A;  1R0B G;  4IIO A;  4ANJ A;  1UGQ B;  5HKC A;  1YP5 A;  5LJ5 e;  4M78 D;  2IPO B;  2FPF A;  1IXD A;  4F7U A;  2MWO A;  2X51 A;  5CKB A;  2VGM A;  2HBW A;  1RLQ C;  1WXB A;  2RHZ A;  1M90 R;  1A0N B;  3EH1 A;  1D1A A;  3BFM A;  3OS2 A;  3V8L A;  2EQK A;  5GMK l;  1K76 A;  2VYT A;  1IGU A;  3DB3 A;  5HK3 A;  3OYI A;  4E6R A;  3G1J A;  5GMK e;  2AIR B;  1GBR A;  2XI9 A;  2CT4 A;  4F7U G;  2DIQ A;  1YN8 A;  2AZS A;  5GAO p;  3CC2 T;  3C0C A;  3I56 T;  3RES A;  4JRI A;  1Q82 R;  3E9G A;  2MF2 A;  2GBQ A;  1G5V A;  2O2O A;  5GAM e;  2CH4 W;  2QK0 A;  1WZO A;  2QDY B;  1B34 B;  2YT6 A;  4OB3 B;  4E2F B;  1RI0 A;  1NBE B;  2NUT B;  1I8F A;  1AHJ B;  1HK9 A;  1PSF A;  3A98 A;  4PLL A;  3X25 B;  2L0A A;  4HKE A;  2QEX T;  5EC7 A;  3CME A;  2LQ8 A;  3EG9 A;  2YLB A;  2D8J A;  2EGE A;  5LJ3 j;  4M7D A;  5KYU B;  5GAO r;  2DD5 A;  3HRT A;  2VXE A;  2QI2 A;  4MDX A;  4ELZ C;  3BDL A;  2L3R A;  4M75 G;  1FX7 A;  1Q7Y R;  4L59 A;  1T0J A;  5CO7 A;  1WXT A;  4DA4 A;  1KSW A;  5GJV B;  1BB9 A;  4QVD A;  2KXC A;  3PMI A;  2K2M A;  1ZLM A;  1OOT A;  5IHN A;  3CPW S;  3S3O A;  1Q86 U;  1LNX A;  2DRK A;  1Q86 C;  3E19 A;  1PD0 A;  4M77 E;  2E6Z A;  4JJD A;  4OGE A;  2DAQ A;  1WXU A;  3I56 A;  4GLM A;  2VKN A;  2QXF A;  4M77 D;  4NL2 A;  3MJX A;  4DBR A;  3L2V A;  3C95 A;  4M77 C;  1S1N A;  4C8Q D;  1K73 U;  2OTL Q;  1QKW A;  3CD6 A;  1KQS P;  4OVA A;  1K73 C;  1G83 A;  3MKD A;  2SRC A;  3BY7 A;  3QYG B;  4EDU A;  1RLP C;  4J6W A;  3JCM e;  2LX9 A;  2OTJ T;  2RNA A;  2RO0 A;  4FM4 B;  2EKH A;  3VRY A;  5CKE A;  2L8D A;  2RI3 A;  4OMP A;  4C92 G;  4LDW A;  5GAN h;  3UA7 A;  1MMD A;  4B9X A;  4V2S A;  2DXU A;  1SHF A;  1JBM A;  3X26 B;  2HZY A;  4C0D C;  4FSS A;  1YCS B;  3MPU B;  1VQP A;  4QQ6 A;  3CMA A;  2JT4 A;  3CCU Q;  2X4X A;  1B07 A;  4BI4 A;  1M3C A;  4M7A B;  1TH7 A;  3JV3 A;  4JLI A;  4MZM A;  2DL5 A;  1SRL A;  2FPE A;  1LJO A;  5FU7 C;  1YCY A;  5KE2 A;  4ORZ A;  2EGC A;  3V7S A;  1DJ7 B;  1YIJ Q;  3CME Q;  4FYX B;  5DM7 R;  3C4S A;  1VUB A;  3TCJ A;  3EGX B;  3ZEH A;  2LT1 A;  4CC3 A;  2QQ9 A;  4C5H A;  3MET A;  1M5Q 1;  3URG A;  3PGG A;  3M9Q A;  4IIM A;  1YJW A;  2PVG B;  2RQW A;  2VC8 A;  3HSB A;  1W4S A;  3WVE B;  2GFU A;  5CR2 A;  3RER A;  3FEO A;  3M55 A;  2BZY A;  4CRI A;  4F17 A;  2AKL A;  2GTO A;  1M2V A;  4B6M A;  5FW9 A;  1YHQ A;  4PL6 A;  3RNJ A;  2GTJ A;  1M2V B;  1D3B A;  1WQ7 A;  2J6O A;  2V8K A;  2HD0 A;  5A0G A;  5I21 A;  1VQP T;  2ATC B;  4C8Q C;  3RMQ A;  2RQU A;  4JS4 A;  2AK5 A;  4J9B A;  2J6K A;  3CCM A;  2QA4 Q;  4J9H A;  1C0M A;  1B34 A;  3QO3 A;  4IUV A;  4EMK A;  1T3L A;  2MWP A;  5DLO A;  4BDY A;  2Y4X A;  4QW2 A;  1WHJ A;  3EHR A;  3QJY A;  2L89 A;  2OAU A;  2RM4 A;  3H8Z A;  3UPU A;  4AFQ C;  5AYF A;  4JZ3 A;  2RHX A;  3MP1 A;  4OB2 B;  4D8K A;  4EMK B;  1YJW Q;  4M7D D;  2P4R A;  3LYI A;  3TQ7 P;  4RTY A;  3MHX A;  1IRE B;  5GAN 6;  5GMK i;  5IT9 E;  5GMK h;  1VQM Q;  4KGZ B;  1VIF A;  1JEG A;  3NTI A;  1ZBJ A;  1YJW T;  1PCX A;  3A1P A;  1I4K 1;  4LDU A;  4BE1 A;  2DER A;  4F7U B;  3M58 A;  3VJP A;  2PNI A;  2MYS A;  1FMW A;  2YXY A;  3JCM Q;  5C0M A;  5A2Q E;  1M90 U;  3QPH A;  2FB7 A;  4PJO B;  4BE0 A;  2CH4 A;  3EFS A;  2X4Y A;  4RTT A;  2EYQ A;  5FRN A;  1X6G A;  4C0Z A;  1ZSZ B;  2DO3 A;  3OYG A;  2XMF A;  2K79 A;  3GPL A;  3J81 E;  1D1C A;  2BIV A;  3CCJ Q;  3KUF A;  3HRS A;  1YI2 T;  1M1F A;  1K73 R;  2P0Q A;  1CKA A;  4P5N A;  4E7J A;  2X3X D;  4Z02 A;  3DLM A;  2EQU A;  2D0Q B;  4C0G A;  4RTU A;  2DZ9 A;  1D3B B;  2LCC A;  1GCQ A;  3LH0 A;  3P8H A;  1WPY A;  1ZHI A;  4GY5 A;  1LOJ A;  4JUV A;  2E12 A;  1X6B A;  1JXO A;  1Y07 A;  2K3B A;  4C92 A;  1WA7 A;  3FC3 A;  4J9G A;  4AFS C;  2IG0 A;  4PJO D;  2KR3 A;  1GCP A;  2DXB A;  1S72 Q;  2NUT A;  2R58 A;  2QG9 B;  1M1K C;  4M78 G;  1JU5 C;  4DOV A;  1Y96 A;  3DB4 A;  1M90 C;  2K57 A;  5FU6 C;  5GMK j;  1M4Z A;  4FYY B;  1Z9Q A;  4M75 E;  3RIR A;  4XTX A;  1PM3 A;  2F5T X;  4FCY A;  3MO8 A;  4DBQ A;  4PKC C;  2DZC A;  3VS7 A;  4LN2 A;  2COY A;  2KY9 A;  1N9R A;  5KYU A;  1VQ5 Q;  1QCO A;  2H3J A;  4M4Z A;  3JB9 H;  1NPR A;  1K9M U;  1VA7 A;  3OY9 A;  4QVZ A;  4M78 B;  2XIC A;  4A4F A;  1WIE A;  3INZ A;  2COW A;  3HKS A;  2RN8 A;  1N5Z A;  2LRQ A;  1K9M C;  1UUE A;  2VB6 A;  1I81 A;  2KI7 A;  2F69 A;  1TUG B;  2AKK A;  2EJG A;  3H0H A;  3QII A;  3JB9 F;  4LXC A;  3V8K A;  3CMA T;  1WLP B;  4F16 A;  2I0N A;  5GAN 4;  1ZUY A;  3OS0 A;  3PE0 A;  1KQ2 A;  1GCQ C;  2LCL A;  2DJQ A;  1ZQ1 A;  1ZSZ C;  2HNI A;  8ATC B; 
#chains in the Genus database with same CATH homology
 3ZL7 C;  2KT1 A;  2FPF A;  2B86 A;  2G6F X;  4JJB A;  4ZNX A;  2HBW A;  1RLQ C;  1WXB A;  1A0N B;  2LQW A;  2O9V A;  1NYF A;  1K76 A;  2F2W A;  1K0X A;  2RQT A;  2BTT A;  4E6R A;  1ARK A;  1WDX A;  2KGT A;  1GBR A;  2M0Y A;  2CT4 A;  1YN8 A;  2AZS A;  2J7I A;  2LZ6 B;  3C0C A;  1I1J A;  2V1R A;  4RUG A;  2K7A A;  2A28 A;  4OML A;  2LJ0 A;  1M27 C;  2YDL A;  2PTK A;  3H0F A;  4LUE A;  2GBQ A;  1ZX6 A;  2H8H A;  4RTV A;  2O2O A;  1AWO A;  2CH4 W;  2YUP A;  4DEY A;  2HDA A;  2RPN A;  1PRM C;  2DL3 A;  1NLO C;  2YT6 A;  1NLP C;  1UE9 A;  4X1V A;  1NEB A;  2DL8 A;  3EGU A;  1UJY A;  4AFZ C;  4J9C A;  4CC4 B;  2LJ3 A;  4JJC A;  3A98 A;  2JM9 A;  4A63 B;  2C0I A;  2FG0 A;  1V1C A;  4KRT A;  2L0A A;  3VS5 A;  1LCK A;  3FJ5 A;  2J06 A;  2O9S A;  4AG2 C;  5IXF A;  5EC7 A;  1CSK A;  1GL5 A;  2YUN A;  2LMJ A;  1X2Q A;  2D8J A;  3M0U A;  1AD5 A;  2EGE A;  3NHN A;  3EHQ A;  3EG2 A;  1Y57 A;  3UF4 A;  1GRI A;  1E6H A;  4D8D A;  2DMO A;  2HCK A;  1M3A A;  1TUD A;  1KJW A;  4HCK A;  4WCI A;  1PRL C;  4EIK A;  1HSQ A;  1M30 A;  1I07 A;  2KNB B;  1WYX A;  2A36 A;  1T0J A;  1WX6 A;  1WXT A;  2CUB A;  1B3Q A;  1KSW A;  2FPD A;  1BB9 A;  5GJV B;  2KXC A;  2W10 A;  2KT8 A;  1NG2 A;  2K2M A;  1ZLM A;  2M51 A;  1OOT A;  5IHN A;  4HVU A;  2DRK A;  2LQN A;  1UTI A;  3IQL A;  4JJD A;  2F2X A;  4K11 A;  1QWF A;  1WXU A;  2VWF A;  3U23 A;  5FWB A;  2AZV A;  1UG1 A;  4GLM A;  2K9G A;  2VKN A;  2MOX A;  1AWJ A;  4J9E A;  2CT3 A;  1W70 A;  2E5K A;  3THK A;  4GBQ A;  5L23 A;  2KRM A;  1TG0 A;  2OJ2 A;  1S1N A;  4HVW A;  2PZ1 A;  1QKW A;  1JQQ A;  1G83 A;  3VS1 A;  2DM1 A;  4RTW A;  3VS2 A;  4J9I A;  4J9F A;  2SRC A;  1W1F A;  1RUW A;  1SEM A;  3VS0 A;  2DX1 A;  1NEG A;  3R6N A;  1RLP C;  3M0T A;  1AOJ A;  1EFN A;  2EGA A;  2RNA A;  2EKH A;  3VRY A;  2CRE A;  2L3Q A;  4OMP A;  2DLP A;  1ABO A;  4QT7 A;  3UA7 A;  4Z88 A;  1G2B A;  3TVT A;  1SHF A;  3QWY A;  3NGP A;  1VYV A;  4OMQ A;  1MV0 B;  4FSS A;  1YCS B;  2ECZ A;  2JT4 A;  2EVR A;  2DYB A;  1B07 A;  3PVL A;  1NM7 A;  1M3C A;  2EYW A;  4OMO A;  1H3H A;  3QWX X;  3JV3 A;  2FO0 A;  1X27 A;  1UEC A;  1YNZ A;  2HSP A;  2DL5 A;  1MV3 A;  1SRL A;  2FPE A;  2DE0 X;  1GBQ A;  2KBT A;  3NPF A;  2CUD A;  2LX7 A;  4ORZ A;  1X43 A;  4AG1 C;  2EGC A;  1M3B A;  1E7O A;  1Z9Z A;  2LCS A;  2GQI A;  2NUZ A;  3PVQ A;  2SEM A;  5IXB A;  2JM8 A;  2DA9 A;  2KRO A;  2K6D A;  1AVZ C;  4CC7 A;  1KFZ A;  1J3T A;  2GNC A;  4OMM A;  3SHW A;  4CC3 A;  1RI9 A;  4JZ4 A;  2MIO A;  4IIM A;  4JPB W;  2RQW A;  1T3S A;  4ESR A;  2RQV A;  1VYU A;  3REA B;  5IHK A;  3I5S A;  1ZUK A;  2BZY A;  4F17 A;  2AKL A;  4HVV A;  2GTO A;  4HXJ A;  5FW9 A;  2EYZ A;  2ABL A;  1PKT A;  3UAT A;  3VS6 A;  1K0S A;  1GFC A;  2DRM A;  3RNJ A;  1CKB A;  2GTJ A;  2W0Z A;  2YUO A;  1FMK A;  4Z8A A;  1U3O A;  2DL7 A;  3SEM A;  2DNU A;  3LH5 A;  2D1X A;  2J6O A;  3I9Q A;  2L3S A;  4LUD A;  3REB B;  1GFD A;  1HJD A;  2RF0 A;  1H8K A;  2JMC A;  4LE9 A;  2RQU A;  2AK5 A;  3H0I A;  3VS3 A;  3I35 A;  4J9B A;  1WI7 A;  2J6K A;  3TSZ A;  2JMA A;  4J9H A;  2OAW A;  2CSI A;  1OPK A;  1T3L A;  3VS4 A;  3M0P A;  2DIL A;  1PWT A;  3EHR A;  1VYT A;  2DBM A;  1T0H A;  2KYB A;  2DBK A;  1M8M A;  2BZ8 A;  5I11 A;  4AFQ C;  1X69 A;  1YWO A;  2DF6 A;  4JZ3 A;  2A37 A;  2GGR A;  1JXM A;  1PHT A;  4D8K A;  1KIK A;  2D0N A;  2ED0 A;  3EG0 A;  2P4R A;  1BBZ A;  4RTY A;  4Y92 A;  1OPL A;  2ENM A;  2VVK A;  2F2V A;  4LNP A;  1U06 A;  1JEG A;  1OV3 A;  1ZBJ A;  1K9A A;  1AWX A;  4F14 A;  2KE9 A;  2PNI A;  1H92 A;  5ECA A;  1ZUU A;  3O5Z A;  1IO6 A;  2MCN A;  2LP5 A;  1QCF A;  2DL4 A;  2JXB A;  1U5S A;  1K1Z A;  1UHF A;  1ABQ A;  2CH4 A;  1PNJ A;  3RBB B;  3EG1 A;  4RTT A;  4RTZ A;  2YSQ A;  2JTE A;  4CC2 A;  1X6G A;  1PKS A;  4OMN A;  1WFW A;  2XMF A;  2K79 A;  2KRS A;  1AZG B;  2X3W D;  5FWC A;  2IIM A;  2EW3 A;  2LNH B;  1CKA A;  2OI3 A;  4R0K A;  2X3X D;  2EQI A;  4RTU A;  2V1Q A;  1BK2 A;  1E6G A;  2A08 A;  2ROT A;  3M0S A;  5GJW B;  1GCQ A;  5I22 A;  4Z89 A;  1X6B A;  1JXO A;  2K3B A;  1WA7 A;  4J9G A;  4AFS C;  2KR3 A;  2KRN A;  2L3P A;  1GCP A;  4AFU C;  2FRY A;  3TSW A;  1ZSG A;  1AWW A;  5IHI A;  1HD3 A;  1JU5 C;  3GBQ A;  2EPD A;  3NMZ C;  1UJ0 A;  2O31 A;  1W6X A;  3CQT A;  2J05 A;  1QLY A;  1Z9Q A;  4RTX A;  2BZX A;  2KEA A;  2ROL A;  1I0C A;  2FEI A;  3VS7 A;  2QDL A;  2J6F A;  2JW4 A;  1QKX A;  4LN2 A;  4DEX A;  1BU1 A;  2KYM A;  2C0O A;  2L2P A;  2JS2 A;  3EG3 A;  1UDL A;  4M4Z A;  1VA7 A;  1MUZ A;  1NYG A;  2O88 A;  1FYN A;  2YUQ A;  1SSH A;  1SPK A;  1UFF A;  1TUC A;  2C0T A;  1WIE A;  2KXD A;  1YWP A;  2CDT A;  2CSQ A;  3VRZ A;  2RQR A;  1Y0M A;  2RN8 A;  1XOV A;  2ED1 A;  1N5Z A;  2D8H A;  2NWM A;  1K4U S;  2LJ1 A;  2RMO A;  2HEQ A;  1UUE A;  3H41 A;  1SHG A;  2JS0 A;  2AKK A;  3H0H A;  5HCK A;  3M0R A;  3ULR B;  2EYX A;  3UA6 A;  1AZE A;  1JO8 A;  1WLP B;  1OEB A;  4F16 A;  2I0N A;  2EBP A;  1SRM A;  1UHC A;  4J9D A;  1ZUY A;  2DVJ A;  3PE0 A;  1GCQ C;  3I5R A;  1X2K A;  2EYY A;  5IH2 A;  2FRW A;  2DJQ A;  2ESW A;  3KFV A;  4IIO A;  1QWE A;  1UGV A;  3M0Q A;  1AEY A;  1YP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...