4JJCA

Crystal structure of the abl-sh3 domain at ph5
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Abl-SH3 domain at pH5
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ABL1
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jjcA00
1IO6A 1ZLMA 1M30A 3UF4A 3VS6A 2EYZA 2KXDA 1GBQA 2EYWA 1QKXA 1NEGA 1SSHA 5FWBA 4CC3A 1JEGA 1PRLC 1WXTA 4JZ4A 1UHCA 3QWYA 2ECZA 4AFZC 2DMOA 1AD5A 2V1QA 3QWXX 1CKBA 4ESRA 1GRIA 3NMZC 1BK2A 2X3WD 2L3SA 3M0UA 2LZ6B 2L3QA 2LJ0A 1OEBA 3GBQA 4AG2C 2EYYA 1QWEA 4R0KA 2ROLA 3NGPA 1RUWA 1PNJA 2K9GA 1PKSA 2K3BA 1VYUA 2F2XA 1M3BA 1X2QA 4X1VA 3VRZA 1UECA 2X3XD 2DNUA 1UGVA 2M0YA 1MV0B 1QWFA 3O5ZA 2FG0A 2O31A 1W1FA 2EPDA 4DEXA 2EQIA 3C0CA 1M8MA 1ABQA 2DLPA 1WDXA 4Z88A 1WI7A 4EIKA 2JS2A 2DVJA 2J05A 4AFSC 1UE9A 4AG1C 2L2PA 3VS7A 1SHFA 1JU5C 4DEYA 5IH2A 2W0ZA 2JMCA 4K11A 1HSQA 1E6HA 2RF0A 3NHNA 2XMFA 1RLQC 1SRMA 5GJVB 1GFCA 2DA9A 1NLPC 2KNBB 1YCSB 2AK5A 3H41A 2I0NA 1PWTA 1X27A 2CSQA 1I07A 2LMJA 1K4US 1NM7A 2JT4A 2CUDA 1M3CA 3UA7A 1XOVA 5I22A 2CT3A 4JPBW 3NPFA 2NWMA 1X69A 1PKTA 2EKHA 1YN8A 1BU1A 2AKKA 1NYFA 2VKNA 3M0RA 1UJ0A 2G6FX 2OAWA 3I35A 3RNJA 2KE9A 2O88A 3ULRB 2MIOA 2HBWA 1T3SA 2LX7A 4FSSA 4J9FA 1TUCA 2LQWA 1NEBA 4OMNA 2AZSA 2DX1A 4HXJA 1NLOC 2D8JA 2BZYA 2GGRA 2KYBA 1KFZA 2CUBA 2CT4A 1OOTA 1ZSGA 1PRMC 3VS0A 2MOXA 2V1RA 3THKA 4CC4B 2J6KA 3TSWA 4OMOA 1V1CA 2DL4A 4WCIA 1UDLA 2HCKA 2KT1A 4HVVA 5IHKA 2ABLA 1AVZC 2FRYA 5GJWB 3VS4A 2K7AA 2K2MA 2F2WA 1U3OA 4LUDA 4LUEA 2KRMA 2RQTA 4KRTA 4RTYA 1ZUKA 1AEYA 1K1ZA 3VS2A 2RMOA 1AWXA 5EC7A 2MCNA 3I9QA 1AWOA 2HDAA 3EG0A 3VS5A 2YSQA 1VA7A 2DL8A 2JS0A 4ZNXA 2ESWA 3CQTA 4RTVA 1QLYA 3H0IA 1X6BA 1G83A 1SHGA 2ROTA 2D8HA 1EFNA 3H0HA 3VS1A 2L3PA 1JXMA 1YWOA 2DL7A 3M0TA 5FW9A 1ABOA 2RNAA 1LCKA 4RTWA 3RBBB 2SEMA 3KFVA 5IHIA 2DE0X 1ZX6A 2KRSA 1CKAA 1GL5A 2BZXA 1ZUUA 2AKLA 1KJWA 2KT8A 4RUGA 1UFFA 4HCKA 1KSWA 1K9AA 1X6GA 2EGEA 2IIMA 4GLMA 3TSZA 2DBMA 2F2VA 1JQQA 2KYMA 1Y0MA 4RTXA 1JO8A 1H8KA 2GTOA 4J9CA 3PVQA 2FEIA 3U23A 2JTEA 2FPDA 2RQRA 1UG1A 3UATA 1E7OA 2J6OA 2FPEA 2C0OA 1OV3A 2VVKA 1K0SA 4CC7A 4IIOA 3A98A 2A28A 3R6NA 3LH5A 4RTTA 1RLPC 4JJBA 2DL5A 5ECAA 3VS3A 4Z89A 4RTZA 2RN8A 1SRLA 1BB9A 2AZVA 4J9BA 2P4RA 2EVRA 2A36A 1U06A 1A0NB 3REAB 4ORZA 4IIMA 1NG2A 2K79A 4D8DA 1VYVA 2EGCA 2DRMA 3FJ5A 1OPLA 4M4ZA 1U5SA 1H92A 4Z8AA 2DL3A 2RPNA 4J9IA 2OI3A 2KRNA 1B07A 2EBPA 5FWCA 1I0CA 4QT7A 4LNPA 1T0HA 4J9GA 3PE0A 2J7IA 2H8HA 3TVTA 1N5ZA 4HVUA 4OMLA 1AWJA 2O9SA 2D1XA 2LNHB 4F14A 4OMPA 3EGUA 1CSKA 1ZBJA 4HVWA 1K76A 2L0AA 2J6FA 4D8KA 5IXFA 1M3AA 2OJ2A 1AOJA 1VYTA 3JV3A 1TUDA 2FRWA 2NUZA 1Y57A 2KEAA 1HD3A 2C0IA 1YNZA 3EG1A 1S1NA 4LN2A 1ARKA 1Z9ZA 2BTTA 1J3TA 2DRKA 4F17A 2LP5A 1GBRA 2YUQA 4E6RA 1WLPB 2GQIA 2KGTA 3IQLA 2ED0A 2CDTA 4J9HA 2J06A 1WIEA 1GCPA 1PHTA 1AWWA 2A08A 2EW3A 4F16A 2YDLA 1GCQC 1QKWA 1M27C 1WX6A 4RTUA 4LE9A 2GTJA 1KIKA 2EGAA 2YUOA 3H0FA 1BBZA 2RQVA 1AZEA 1G2BA 1T0JA 2QDLA 1YP5A 1GFDA 4Y92A 2EYXA 2CH4A 2CH4W 3EHQA 4J9DA 1T3LA 3EHRA 4CC2A 2JW4A 5IHNA 2HEQA 2O9VA 2E5KA 2KXCA 2O2OA 3EG3A 2C0TA 4OMMA 2JXBA 3M0SA 1UUEA 2RQUA 1HJDA 2JM9A 1SEMA 5IXBA 1W70A 2VWFA 3I5SA 1QCFA 2DBKA 2YUNA 1RI9A 3REBB 3VRYA 4J9EA 1K0XA 1E6GA 3EG2A 2W10A 1W6XA 2KROA 2CREA 1GCQA 2HSPA 1B3QA 2RQWA 2DM1A 2DJQA 3M0QA 2LQNA 1I1JA 2JM8A 1AZGB 2ED1A 1WFWA 3ZL7C 1WYXA 2PTKA 2M51A 2DF6A 5HCKA 3M0PA 1YWPA 4AFQC 4A63B 2LJ3A 2JMAA 2FO0A 4AFUC 5I11A 2KR3A 2B86A 2DILA 2PZ1A 1UTIA 2ENMA 1X2KA 1MV3A 3I5RA 2FPFA 1WXUA 2A37A 2LJ1A 2YUPA 2D0NA 2LCSA 1OPKA 2PNIA 1FYNA 2CSIA 1X43A 4JZ3A 1UJYA 2K6DA 5L23A 1TG0A 1JXOA 4GBQA 1H3HA 1WXBA 1WA7A 3PVLA 4JJCA 1MUZA 1UHFA 2SRCA 1SPKA 2GBQA 2DYBA 2BZ8A 1FMKA 3SHWA 1Z9QA 3UA6A 3SEMA 1NYGA 2YT6A 4JJDA 2GNCA 2KBTA 4OMQA 1ZUYA
chains in the Genus database with same CATH superfamily
1TSFA 1FMVA 3UF4A 1YBYA 4DOWA 2KXDA 1TTHB 1R0BG 1GBQA 1RAIB 2EYWA 1QKXA 3CCMT 1UHCA 3S3OA 2QI2A 4M78E 3I55A 1G8XA 3QJ6A 1MNEA 3S3NA 2QQAA 2LJ0A 2YRDA 4IUPA 2EIFA 2DD5A 3DKMA 2MI6A 2GF7A 4BDZA 3BW1A 2EYYA 1RUWA 1PNJA 2K9GA 2P84A 1VYUA 2F2XA 4PFZA 1SG5A 5AT1B 4X1VA 2RHUA 5A0LA 3L2ZA 4M7AF 3VU3C 3UPUA 3FC3A 5D6WA 1VQMA 3O5ZA 3VYHB 1KQSS 1M1KU 5GAMh 1W1FA 3CC7A 1K8AR 4DEXA 3QUIA 3CC7Q 3PFSA 1K9MC 1PCXA 1W2BS 3EH2A 5GMKh 3RUXA 2DVJA 2O01E 1YIJQ 2GFUA 2L2PA 4FT4A 3VS7A 5M9OA 2P0KA 1K73U 5GAN4 1U1TA 2W0ZA 5KE2A 1OZ3A 1RLQC 1KD1R 2DD4A 1GFCA 2DA9A 1NLPC 2KNBB 1N27A 2I0NA 2CSQA 2CZ0B 2JT4A 2V26A 6AT1B 1M2VB 2CUDA 1XOVA 5I22A 4JPBW 5KYWA 2NWMA 4N4IA 4OB2B 1YN8A 2EKHA 4FYWB 2D0QB 1QVFP 1YHQQ 1BU1A 4ATOA 4BB7A 2JJ9A 1NYFA 2VKNA 2OAWA 3RNJA 2O88A 2E10A 2MIOA 3NTKA 2ATCB 4FSSA 2Y4YA 2F5KA 1NEBA 2QGGA 3QJYA 3HRTA 2KI7A 1RAHB 2RJFA 2GGRA 5CK9A 3QHSA 2CT4A 2HNIA 2AT1B 1YI2A 2WACA 1N6AA 3AT1B 5A0DA 8ATCB 1IHVA 2JZ2A 1M1KR 5GMKm 3TSWA 1VQ6T 3TREA 3MCAB 4OMOA 2DL4A 2QXFA 3OMGA 2OTLA 5CVIA 1U3OA 2E65A 4TVRA 2KRMA 1VQ7A 1C6VX 1YCYA 3KUFA 1K1ZA 1LPLA 2M1HA 1VQ5A 1D0YA 3M4YA 2M9UA 3CC2A 2KK4A 3EG0A 2QA4A 2XICA 1VQ5Q 2DL8A 3UDCA 3OA6A 3H0IA 2CZ1B 3PMTA 1BI3A 1SHGA 2D8HA 3SB2A 3T9NA 2COWA 4M7AG 3H0HA 2HBPA 4QQDA 1VQLA 1QMCA 3G6ET 4KGZB 2L3PA 2MK5A 5CKEA 1OYXA 5D6YA 2JVVA 1AHJB 5IHIA 2DTOA 2EQKA 3SFMA 1ZUUA 2AKLA 4KUIA 2VASA 5CKDA 3JB9H 1WGSA 4BACA 2KT8A 2MAMA 3CPWS 1K9AA 1X6GA 2EGEA 2F69A 4QVZA 5GAMf 3WVDB 2DBMA 2F2VA 5GAMd 2E41A 2RI5A 4A54A 1VQOT 2GTOA 1ZHIA 4IUUA 5IN1A 3CBOA 4XTZA 2K4YA 1VQMT 2JTEA 5KYUA 2RQRA 3QKJA 4EPCA 3OYAA 4FYVB 2VUBA 1K0SA 4EMGA 4IIOA 3FEOA 3A98A 3M58A 3TQ7P 4A53A 4C92B 1PG5B 3OMCA 1SRLA 1BB9A 4EDUA 2P4RA 3A8GB 2EVRA 2A36A 2FVUA 3QYHB 3HTRA 4EMKA 1BYMA 1VQKA 2ZPEB 4D8DA 2DRMA 1Q86U 3CCUT 4MZTA 3I55Q 1LVKA 2RPNA 1VQ4T 2OI3A 2KRNA 4C0GA 4X9DA 2XHCA 2DAQA 5KYYB 1IGUA 3O8VA 4J9GA 2O4XB 2DTIA 3I56T 2J7IA 2HAXA 4ZTJA 2H8HA 3TVTA 3X28B 4M77B 4OB1B 5KYNA 3EGDB 3OYYA 1D0XA 2V8IA 2P4TA 4ZGEB 2EJFA 3QO3A 2L0AA 4D8KA 1M3AA 2OJ2A 3JCMc 3QYGB 1VYTA 4M7DG 3S3MA 1LNXA 4ELZC 2KEAA 5LJ5j 2C0IA 2LVMA 1YNZA 2ZPGB 1R8OB 4JUVA 2EJ9A 1Z9ZA 1O75A 1VQLQ 4F17A 4E6RA 5GAOq 2J06A 1WIEA 1PHTA 5J26A 2WSFE 1KD1U 2OTJT 1AWWA 4F16A 3H8ZA 4N4HA 2X51A 4RTUA 3MP6A 3HFNA 3CCLQ 1N8RR 2YUOA 1XTDA 3H0FA 3EFRA 4LDWA 1AZEA 2LC4A 4A4HA 1I8FA 4FSXA 2LTOA 1EX4A 1I5LA 1KQ1A 2BUDA 4PJOG 3LH0A 3JB9J 3GPLA 2HEQA 5D6XA 3PIPA 4BE1A 2O9VA 5FRNA 2L3RA 2KXCA 4IUVA 4NOYA 3ZFJA 2CKKA 3MEVA 1WHLA 4JJNK 2VWFA 3I5SA 2KY9A 4WF2A 5GMKj 1QP3A 3EG2A 4E7JA 2CREA 1B3QA 2DM1A 4M75D 1I1JA 2HZYA 3PT9A 4Z02A 4MMLA 3JCMe 1WYXA 2M51A 3OYLA 3JCMb 2BKDN 5HCKA 3JB9D 4JS5A 1S72A 5I11A 1YJNA 1JJ2S 3QZ5B 4FYYB 4GLKA 4QQGA 1Q81U 1VQ9A 1MV3A 2QEXQ 4FW2A 3LGFA 1WXUA 5KYYA 3QXEB 2XDDA 1OI1A 4M77E 1PSEA 2LJ1A 4IKFA 1FX7A 3M9QA 4BDYA 2D0NA 5LJ5g 2PNIA 2CSIA 1UJYA 3LLRA 2WSCE 1XNIA 2K6DA 2CZ6B 4GBQA 2NUPA 3CXCA 3M54A 3HRUA 5FLXE 1MNDA 3CEYA 1MUZA 2ZCFB 2LNVA 1D3BB 3RIRA 2DYBA 2BZ8A 5LL6S 1N9RA 2EQJA 2YT6A 3AHUA 4M78B 4BUGA 4M7DC 1NEGA 5J39A 2BIVA 4FYXB 3OYCA 3VS6A 4PLLA 3CD6T 4VUBA 4QKUA 1SKUB 1SSHA 1D1AA 3CCST 1QVGA 1JEGA 2LRQA 3QWYA 2OTLT 2HQEA 3MPUB 1WNLA 4E7KA 4OVAA 1W4SA 1BK2A 4Q5WA 4F7UA 2X3WD 1MMDA 2LZ6B 1IREB 4KT0E 1MMGA 1OEBA 1QQJA 3BE3A 4GY5A 1R77A 4AG2C 1Q82U 2OX7A 5I2MA 2C06A 1PKSA 5GANd 5LJ3f 3SWNC 4E47A 1VUBA 3Q1JA 1XJWB 3VRZA 1JB0E 3NTHA 2NUTB 2E70A 2X3XD 2DNUA 1FWZA 1YITT 1VQNA 1IB8A 3MP1A 2EAYA 5A2QE 3C0CA 1Q82C 1WDXA 5FU7B 3JB9G 3G71T 1WI7A 4HA8A 2ZPBB 4AG1C 1D3BA 5IH2A 1RL2A 4HKEA 4K11A 2RI3A 2L8DA 3EH1A 2RH2A 1HSQA 2XMFA 1B34B 3BY7A 1MGQA 3CCRA 3RMSA 4J7FA 3R6OA 3CBMA 2XG8D 2PUKB 2IG0A 4M7AD 1X27A 1I07A 1UB4A 2COYA 4C5GA 4OGCA 3OW2P 1W2BA 3UA7A 4BE2A 1RACB 2CT3A 4M77F 4B6MA 3A1PA 1WJRA 4MMKA 4C8QB 3GNFB 1PKTA 3OYHA 2ZPIB 2F5TX 3QDFA 1G3WA 1I4K1 4IURA 2HBWA 3CCET 3EGXA 2LX7A 3CCQT 1RAFB 1TUCA 1NZ9A 1M2VA 2AZSA 4CRIA 3HL8A 2D8JA 3CMEQ 4N4GA 4J83A 4KH1B 2KYBA 1M90U 1KFZA 1ZSGA 2MOXA 2CP6A 3HKSA 1UEBA 3S6WA 3E19A 4BI8B 1V1CA 5DLQE 2E12A 3PNWC 5LJ5e 2KT1A 4HVVA 4D6WA 5GJWB 2K2MA 3OYNA 2F2WA 4LUDA 4LUEA 2RQTA 4RTYA 2FB7A 1AEYA 5GAOp 3VS2A 3JCMP 1AWXA 2VC8A 3I9QA 2MCNA 5LJ5h 4ME7A 5DY9A 1AWOA 2QEXA 1M2OA 3CMET 5LJ3j 3VS5A 4ZN3A 1WHMA 3WXMB 4HCCA 1VA7A 4ZNXA 1ZSZA 3CCQQ 3CCEQ 4C92E 4RTVA 1QLYA 3VUZA 5EG2A 1G83A 2QGFB 2EQUA 3TCJA 2G3RA 2ROTA 1EFNA 3QIIA 5DM7R 3VS1A 4BD3A 4ELYC 4C5EA 1I5OB 2X4XA 1YWOA 3RR6A 4LD9K 3M0TA 4C0FA 5FW9A 1LCKA 4RTWA 3RBBB 2SEMA 1FMWA 4LDVA 4FW1A 2FZGB 2LX9A 5GAN3 2KRSA 3NTIA 1CKAA 3RDVA 4HCBA 1GL5A 1O9SA 3DLMA 4F7UB 1KJWA 1OU8A 4J6WA 2RHYA 4HCKA 2E3IA 1KSWA 1OX8A 2GQVA 3DB4A 3RKYA 3TSZA 3CCSA 1VQOA 3BDLA 1H8KA 5HK3A 4J9CA 4PNOA 1ZA1B 1M90R 2FEIA 3SDZA 4F04B 1KD1C 2FYKA 4XU0A 2O4XA 3G71Q 2FPDA 4NL2A 3OYDA 2C0OA 1YJWA 2HKNA 4KUDK 4PJJA 4CC7A 2M0OA 3OSSC 9ATCB 2A28A 3OYMA 2DL5A 3CCEA 8AT1B 2R5AA 4RG8A 1YITQ 4F7UF 1U06A 1A0NB 2RHIA 4FIBA 1NG2A 2K5FA 1VYVA 4PJOC 2EGCA 4M4ZA 4M77G 1X75C 2CP5A 2XK0A 1H92A 1VQ4A 4Z8AA 3C95A 1YHQA 2EBPA 4MZPA 5FWCA 1ZA2B 2EJGA 1P92A 3GLXA 2PQWA 3V8KA 4EMHA 1T0HA 5KYUB 3PE0A 5GMKi 4XU3A 2DEUA 1N5ZA 1B34A 2OTLQ 4NL3A 1AWJA 2D1XA 4BY6C 3CCSQ 3EGUA 1CSKA 1ZBJA 2EQMA 2L5QA 2DYIA 1Q7YU 3CD6Q 5IXFA 4M7AE 1K73C 1Y57A 2PVDB 4C0DB 1K9MR 3GIBA 4E2FB 3JB9F 4ZGJB 4LN2A 1ARKA 1K9MU 2BTTA 3QBYA 2LP5A 2YUQA 2KGTA 3IQLA 2CDTA 2RJCA 3FDRA 2A08A 3CPWP 2KDSA 2E64A 2NUTA 5FROA 1WX6A 4M75G 1YFNA 4X9CA 2GTJA 2MF2A 3HHTB 4DA4A 3MO8A 1BBZA 4PJOF 2RQVA 4J6XA 2E6NA 4E7HA 1YP5A 4CI0C 3RESA 1QVPA 4Y92A 1AT1B 2EYXA 4QQ6A 3EHQA 4LDYA 1PD0A 1T3LA 3EHRA 3C12A 2QEXT 5IHNA 1Q81R 1NPPA 2XDPA 3OQ5A 5KYXA 1QVGS 3G6EA 5CIUA 2JXBA 3X24B 1HYOA 1UUEA 2RQUA 1HJDA 1M8VA 2JM9A 2LT4A 1SEMA 5IXBA 1W70A 1ZSZB 2DIGA 1WQWA 4M75A 4J9EA 3MEAA 1E6GA 4QW2A 1W6XA 4XU2A 1PM3A 2X9HA 1WQ7A 1OX9A 1BI2A 2JM8A 3ZL7C 2PTKA 3JCMJ 1Y96B 4R55A 1YWPA 4DQ2A 2QK0A 2IVWA 2LJ3A 1KQ2A 2FO0A 3INZA 2KR3A 4JS4A 3OS5A 4FM4B 4QVDA 4XTWA 2YLCA 1M1GA 2K3YA 3X25B 2A37A 2DXBA 1RI0A 2YUPA 3FB9A 3V8JA 4M7AC 1BIBA 1OPKA 4J8OA 3MJXA 3L2UA 3EGXB 3OYFA 3CCLT 3P8HA 1JXOA 4C0DC 2HQHA 3OS0A 1M4ZA 1WA7A 3PVLA 1WHGA 2OTJQ 1WPYA 1TWBA 3JSCA 1K73R 2GBQA 1QW1A 3OBWA 1VQLT 1UGRB 1FMKA 1ACMB 3UA6A 4C92C 4JJDA 1LJOA 2GNCA 2KBTA 3META 1ZUYA 2DZCA 2NLUA 4PKCC 1IO6A 1ZLMA 4M75B 3V7CA 3CXCP 3N5BB 3EG9B 3FJPA 4B9XA 2VGNA 4CC3A 4JZ4A 2DK3A 4AFZC 2DMOA 2V1QA 3M55A 4ESRA 1GRIA 3I56Q 4MDXA 1H3ZA 3M0UA 2L3QA 2XKOC 3CMEA 1VQ4Q 1QWEA 2ROLA 3I55T 2E3HA 3JCMf 3CCUQ 2K3BA 1Q7YC 1KQSP 3OYKA 2HKQB 1MV0B 2O31A 1JJ2P 4JRQA 2RB6A 2EQIA 2M02A 3CD6A 1ABQA 1Y71A 1F1BB 4DOVA 5LJ5d 3CCUA 3JCMQ 1VQMQ 4EIKA 1QCNA 1LOJA 3V7RA 3D7SB 4AFSC 1UE9A 2A3LA 2H3JA 1SHFA 1JU5C 3URGA 1VQOQ 3F70A 5FU6C 4KGVB 5FRMA 4PFOA 1JJ2A 3JCMV 3CCMA 1E6HA 5GAOr 2RF0A 5CKFA 1QP2A 5GJVB 1M90C 3M57A 2CP3A 3OYBA 4M78A 3CCQA 1PWTA 1K4US 2LMJA 2FZCB 3WVEB 4C92D 3HP9A 2LT1A 1Q7YR 2LQ8A 2YHTA 5IT9E 4KGXB 3RKXA 1JRIA 3L2RA 2Y4XA 1X69A 3E9FA 3G6EQ 4HT8A 2PVOB 3M0RA 4XK8E 2KE9A 3ULRB 4PJOD 1VQ5T 3PMIA 4OMNA 2LQWA 1N8RC 3JCMd 1D1CA 2YWWA 2KQWA 2BZYA 2F1LA 2CUBA 1OOTA 2V8JA 3LW5E 2YLBA 2XD0A 4PL6A 4L6V5 1K8AU 1UDLA 2HCKA 3G71A 4LXCA 2ABLA 3J7AF 5GMKe 2D9TA 1VQ6Q 1Y96A 4KRTA 1ZUKA 5GAN8 5C0MA 5EC7A 2MYSA 2RHXA 2HDAA 2RD1A 2CZ7B 2CYZB 3CCVA 2JS0A 5CAIA 2ESWA 4J6YA 2XI9A 3CQTA 1X6BA 1TH7A 1VQ6A 1YHQT 1VOMA 2RK2A 2R58A 4ZN1A 4MDWA 2OTJA 1ABOA 2RNAA 2DKGA 2YXYA 1M5Q1 2DE0X 1ZX6A 3H6ZA 4PJOB 1WHJA 3A8MB 5LJ3h 1BI1A 3E2UA 2DEQA 2BZXA 3RMQA 4IUQA 4RUGA 2L89A 1UFFA 2QYZA 1G3TA 2RA2A 3L2WA 4A4KA 2AIRB 5A0GA 2IIMA 2FL7A 4PJOE 2VXFA 5KH6A 1JQQA 2KMTA 1JO8A 1C1AA 3U23A 1YIJT 2VGMA 2ZAEA 1HXDA 3LWHA 4RCCA 2KAFA 1UG1A 3UATA 1E7OA 2FPEA 4M75C 3CC7T 1OV3A 3TU4K 2E5QA 4DBQA 2E4HA 1Q86C 3JCMh 4N0AA 3R6NA 4RTTA 2QQRA 4JJBA 4Z89A 2RN8A 2AZVA 4JLIA 4E7SA 5GAN5 4ORZA 2RJDA 3BFMA 3JAME 5FU7C 1U5SA 2DO3A 3LGLA 4A4EA 1RABB 5KYWB 3CBPA 2R57A 2DL3A 4J9IA 1VQ8A 2ZPFB 3G4SA 3QZ9B 1I0CA 2MMPA 4LNPA 3FRNA 4M7DB 4M7AA 2M16A 1IXDA 5FU6B 4V2SA 1SSFA 1U1SA 4HVUA 2AHJB 3C94A 3RKWA 3CCMQ 2O9SA 4F14A 2JNGA 4XU1A 4LD6A 3V7SA 4C5IA 1K76A 4OP0A 3OS1A 1JBMA 3HSBA 4Y28E 1HD3A 3ZEHA 1X6OA 1NE8A 4PJOA 1Q82R 1ZSZC 2QDYB 2X4WA 2DRKA 2ZZDA 1VQPA 4XAXB 1GBRA 1WLPB 1EZZB 2GQIA 2BE7D 1GCPA 3MP8A 1PC0A 2YDLA 1GCQC 1QKWA 4M78C 1M27C 5AYFA 1MMNA 4DBFA 1VQ9T 1G3YA 2EGAA 3L42A 2PUOB 2HSEB 2VB6A 2QASA 4OF1A 1BIAA 2P0QA 1G2BA 3QG1A 1T0JA 4PJLA 4XTUA 3V8LA 2QDLA 3X20B 1GFDA 5CQXA 4PJMA 1UGSB 2CH4A 1KHCA 2CH4W 3HRSA 4CC2A 3VJPA 4PK4A 5L8RE 1Q86R 2QQBA 2C0TA 1C0MA 5DLOA 4OMMA 1OQKA 2HL3A 5D7UA 5GANh 2DPPB 5GMKl 4XTYA 1QCFA 3REBB 1K0XA 3L2VA 1M1FA 3E9GA 5LJ5f 2RK1A 3OW2A 1W2BP 1UGPB 2RQWA 5IAYA 2QTVA 3M0QA 2LQNA 3LX7A 1D1BA 1RADB 3VKIA 2OAUA 2DFUA 4FU6A 1Q81C 1VQPQ 4E7IA 3M0PA 4M77C 1YJ9T 1NJIC 4A63B 5GAOm 2A0FB 3ER0A 4KBMB 4J5YA 1WJQA 4AFUC 2B86A 2DILA 2PZ1A 1U8RA 4FL6A 1UTIA 1KQSA 2ENMA 2XIDA 5CCAA 2YRVA 3UWNA 2DERA 3TEEA 1WJSA 2K3XA 4C8QD 2LCSA 2Z0WA 1FYNA 2CP0A 1WHKA 4JZ3A 2LCCA 3ASKA 2CP2A 3GF5A 2RO0A 1VQ8Q 1H3HA 1WXBA 1KK7A 4F7UG 4DBHA 2E6ZA 1R0CB 5GAN2 4C8QA 2X4YA 3OBYA 2KVQG 4M78F 1KC8C 5C6SA 5HKCA 2FZKB 3EFOA 4O6JA 5GAMe 4BI4A 5KCHA 4OMQA 2H3EB 1M1KC 4PLIA 1M30A 4BE0A 4C8QF 2EYZA 3CC4A 4L5GA 5FWBA 5HY6A 1PRLC 1WXTA 2ECZA 5HK0A 1AD5A 3QWXX 3CCRT 2PU9B 1CKBA 2I2LA 3GOXA 3A5ZB 3NMZC 2VV5A 3J80E 2L3SA 2DZ9A 3G4SQ 3GBQA 5GAMj 4R0KA 3CCVT 3NGPA 5CKBA 1YJ9A 2DXTA 3CPWA 4M75F 1M3BA 1X2QA 4X34A 1VQKQ 1UECA 1YJNQ 1UGVA 2M0YA 1QWFA 3OY9A 4C92G 3CMAA 2FG0A 2JOYA 3EG9A 2V8KA 2HQXA 3GNGA 2EPDA 2BE9B 4XQ3A 2MPXC 1M8MA 2DLPA 3ZBDA 4Z88A 1G5VA 5CO7A 3EFOB 2JS2A 4RMOA 2J05A 4JRIA 2K2VA 2IPOB 4DEYA 4FCYA 2ZPHB 3CC4T 5LJ3g 3CCJQ 2JMCA 1D09B 2EYQA 1YI2T 4FT2A 1TXQA 4M77A 2QTXA 3NHNA 1VQ7Q 1SRMA 4OB3B 3LWIA 4RCBA 1YCSB 2EFIA 2EKOA 1VIEA 1B7TA 3CPFA 2AK5A 3H41A 4Y91A 3CMAT 4ANJA 3QSUA 3GP8A 1NM7A 3SWNB 1M3CA 2CS7A 1H641 5GANj 4M75E 3NPFA 1SF9A 1NBEB 2X35A 4HT9A 1BCMA 4O5VA 3I56A 2NUPB 2Y90A 2AKKA 3JCMg 1UJ0A 2G6FX 3I35A 4OMFB 1YITA 2D6FA 1IZ6A 1ZBXA 3EAEA 1T3SA 1S72T 1IGQA 4E7LA 4J9FA 3JCMX 2DX1A 4HXJA 2QA4Q 1Y07A 3A8LB 1NLOC 1HK9A 1YJWQ 1Y7XA 3CCLA 1PRMC 3VS0A 2V1RA 2HD0A 3THKA 3CC2T 4CC4B 1TOVA 2J6KA 4YTLA 3HPWA 3CXCS 1VQNT 4WCIA 5IHKA 4ZTFA 1AVZC 2FRYA 3FIFA 3VS4A 2K7AA 1VQNQ 1KC8R 3OYJA 3M59A 3CC2Q 3H9NA 1KHIA 1BI0A 2RMOA 2DVEA 4BI3A 3DB3A 4OB0B 1YJWT 2GFAA 1VIFA 1QVFS 2QA4T 2RI2A 3JRZA 2QQSA 2YSQA 1S72Q 4IUTA 2DXCA 1EIFA 2JN0A 4MZMA 1M9SA 3M56A 3OS2A 4NS5A 3OYGA 1N9SA 3PGGA 1JXMA 2COZA 7AT1B 2DL7A 3SD4A 4C0ZA 1MHNA 2MWOA 3JB9I 3KFVA 4II1A 3NFCA 1MMAA 4A4FA 4RKUE 3CMAQ 3PIOA 1QVFA 2JTFA 4A4GA 4M77D 1BKBA 4XTVA 1VQ7T 4RG2A 4C8QC 1IRXA 5GANg 3X26B 4GLMA 1YI2Q 4R56A 1WZOA 2JTMA 1KG1A 3CCJT 3E1SA 2KYMA 1Y0MA 3CC4Q 4RTXA 5CQYA 4L59A 5CR2A 2WSEE 3PVQA 4M7DA 3M4GA 3VYGA 3MEWA 1ZQ1A 2J6OA 3VUBA 4HCZA 3EFSA 2VVKA 4AMCA 2E1HA 4F7UE 3QPHA 3LH5A 1RAEB 1RLPC 1V29B 2RJEA 4OGEA 2CGHA 2LQKA 5ECAA 3VS3A 4RTZA 4J9BA 3EGDA 5I21A 1YJNT 2QAZA 3REAB 1VQKT 4M7DE 1G3SA 4IIMA 2K79A 4JRKA 4WTOB 3FJ5A 1OPLA 1GXIE 4QVCA 3CCVQ 2YRCA 3MEUA 2DETA 2GCXA 3G4ST 3SWNA 1B07A 1IHWA 4QT7A 2RM4A 3J81E 1V76A 2DXUA 5I2SA 2DTHA 3CCRQ 4EMKB 5CKHA 3A8HB 4DBRA 3KXTA 4OMLA 5J3BA 2LNHB 1QVGP 4OMPA 1UGQB 3P8DA 4C5HA 5KE3A 4N0AC 3PTAA 3FLGA 2DIQA 4HVWA 1NPRA 4C92A 2J6FA 1BCOA 1AOJA 1QCOA 4BY6B 2QQ9A 4PJNA 3JV3A 3L2QA 2HMAA 4M78D 5GAMg 1TUDA 2FRWA 2NUZA 4ZGDB 3EG1A 1S1NA 2KSSA 4P5NA 2VYTA 1J3TA 1TUGB 3VV0A 4B9WA 3G7ZA 2ED0A 4C92F 4J9HA 2P0PA 2EW3A 5GAOl 4J7IA 1OU9A 2PVGB 2DJZA 1TS9A 1OZ2A 1VQ8T 5KYXB 4LDXA 4LE9A 1KIKA 1PSFA 1X01A 3UT1A 2K5LA 2A7YA 4KH0B 3HFOA 3LYIA 2JUFA 3CCJA 1NJIR 4J9DA 1DJ7B 2JW4A 5GAOn 4JDSA 3C4SA 3MKDA 2E5KA 2O2OA 2CP7A 3EG3A 3M0SA 1D0ZA 2XDBA 1YJ9Q 4C8QG 2EWNA 3OB9A 2RHZA 4JRPA 2YUNA 2DBKA 3VRYA 1RI9A 3M53A 1YIJA 1VQPT 4LDUA 2W10A 2X4JA 1RAGB 2KROA 2FHDA 3DLLA 1GCQA 2HSPA 2DJQA 3L1AA 3QDRB 1AZGB 3KBGA 2ED1A 1WFWA 1N8RU 3G1JA 4M7DF 3M5AA 5KCOA 2DF6A 4M78G 5LJ3e 1Q95G 3OYIA 1KC8U 4AFQC 3MHXA 4EMKC 2JMAA 3BDUA 1XQHA 4JLGA 5GAN7 1FXXA 2QG9B 2NYSA 2LCLA 3JCMW 1X2KA 4M7AB 5LJ3d 5GANf 3I5RA 2FPFA 2HL5C 1K8AC 5GANe 3ME9A 2ZGWA 4C8QE 1I81A 5GAN6 1TU0B 2MWPA 3OSVA 1WHHA 1X43A 1OULA 3A8OB 2B8AA 4E7ZA 1VQ9Q 4KULA 5L23A 1TG0A 4M7DD 4PFPA 4AT1B 4UC4A 2VXEA 4JJCA 2XU8A 2K5IA 1UHFA 2SRCA 3P8BB 1RAAB 1SPKA 3RERA 1NJIU 4XTXA 2R5MA 3SHWA 3OW2S 1Z9QA 3OYEA 3SEMA 1NYGA 2K57A 1PD1A 2LDMA
chains in the Genus database with same CATH topology
1IO6A 1ZLMA 1M30A 3UF4A 3VS6A 2EYZA 2KXDA 1GBQA 2EYWA 1QKXA 1NEGA 1SSHA 5FWBA 4CC3A 1JEGA 1PRLC 1WXTA 4JZ4A 1UHCA 3QWYA 2ECZA 4AFZC 2DMOA 1AD5A 2V1QA 3QWXX 1CKBA 4ESRA 1GRIA 3NMZC 1BK2A 2X3WD 2L3SA 3M0UA 2LZ6B 2L3QA 2LJ0A 1OEBA 3GBQA 4AG2C 2EYYA 1QWEA 4R0KA 2ROLA 3NGPA 1RUWA 1PNJA 2K9GA 1PKSA 2K3BA 1VYUA 2F2XA 1M3BA 1X2QA 4X1VA 3VRZA 1UECA 2X3XD 2DNUA 1UGVA 2M0YA 1MV0B 1QWFA 3O5ZA 2FG0A 2O31A 1W1FA 2EPDA 4DEXA 2EQIA 3C0CA 1M8MA 1ABQA 2DLPA 1WDXA 4Z88A 1WI7A 4EIKA 2JS2A 2DVJA 2J05A 4AFSC 1UE9A 4AG1C 2L2PA 3VS7A 1SHFA 1JU5C 4DEYA 5IH2A 2W0ZA 2JMCA 4K11A 1HSQA 1E6HA 2RF0A 3NHNA 2XMFA 1RLQC 1SRMA 5GJVB 1GFCA 2DA9A 1NLPC 2KNBB 1YCSB 2AK5A 3H41A 2I0NA 1PWTA 1X27A 2CSQA 1I07A 2LMJA 1K4US 1NM7A 2JT4A 2CUDA 1M3CA 3UA7A 1XOVA 5I22A 2CT3A 4JPBW 3NPFA 2NWMA 1X69A 1PKTA 2EKHA 1YN8A 1BU1A 2AKKA 1NYFA 2VKNA 3M0RA 1UJ0A 2G6FX 2OAWA 3I35A 3RNJA 2KE9A 2O88A 3ULRB 2MIOA 2HBWA 1T3SA 2LX7A 4FSSA 4J9FA 1TUCA 2LQWA 1NEBA 4OMNA 2AZSA 2DX1A 4HXJA 1NLOC 2D8JA 2BZYA 2GGRA 2KYBA 1KFZA 2CUBA 2CT4A 1OOTA 1ZSGA 1PRMC 3VS0A 2MOXA 2V1RA 3THKA 4CC4B 2J6KA 3TSWA 4OMOA 1V1CA 2DL4A 4WCIA 1UDLA 2HCKA 2KT1A 4HVVA 5IHKA 2ABLA 1AVZC 2FRYA 5GJWB 3VS4A 2K7AA 2K2MA 2F2WA 1U3OA 4LUDA 4LUEA 2KRMA 2RQTA 4KRTA 4RTYA 1ZUKA 1AEYA 1K1ZA 3VS2A 2RMOA 1AWXA 5EC7A 2MCNA 3I9QA 1AWOA 2HDAA 3EG0A 3VS5A 2YSQA 1VA7A 2DL8A 2JS0A 4ZNXA 2ESWA 3CQTA 4RTVA 1QLYA 3H0IA 1X6BA 1G83A 1SHGA 2ROTA 2D8HA 1EFNA 3H0HA 3VS1A 2L3PA 1JXMA 1YWOA 2DL7A 3M0TA 5FW9A 1ABOA 2RNAA 1LCKA 4RTWA 3RBBB 2SEMA 3KFVA 5IHIA 2DE0X 1ZX6A 2KRSA 1CKAA 1GL5A 2BZXA 1ZUUA 2AKLA 1KJWA 2KT8A 4RUGA 1UFFA 4HCKA 1KSWA 1K9AA 1X6GA 2EGEA 2IIMA 4GLMA 3TSZA 2DBMA 2F2VA 1JQQA 2KYMA 1Y0MA 4RTXA 1JO8A 1H8KA 2GTOA 4J9CA 3PVQA 2FEIA 3U23A 2JTEA 2FPDA 2RQRA 1UG1A 3UATA 1E7OA 2J6OA 2FPEA 2C0OA 1OV3A 2VVKA 1K0SA 4CC7A 4IIOA 3A98A 2A28A 3R6NA 3LH5A 4RTTA 1RLPC 4JJBA 2DL5A 5ECAA 3VS3A 4Z89A 4RTZA 2RN8A 1SRLA 1BB9A 2AZVA 4J9BA 2P4RA 2EVRA 2A36A 1U06A 1A0NB 3REAB 4ORZA 4IIMA 1NG2A 2K79A 4D8DA 1VYVA 2EGCA 2DRMA 3FJ5A 1OPLA 4M4ZA 1U5SA 1H92A 4Z8AA 2DL3A 2RPNA 4J9IA 2OI3A 2KRNA 1B07A 2EBPA 5FWCA 1I0CA 4QT7A 4LNPA 1T0HA 4J9GA 3PE0A 2J7IA 2H8HA 3TVTA 1N5ZA 4HVUA 4OMLA 1AWJA 2O9SA 2D1XA 2LNHB 4F14A 4OMPA 3EGUA 1CSKA 1ZBJA 4HVWA 1K76A 2L0AA 2J6FA 4D8KA 5IXFA 1M3AA 2OJ2A 1AOJA 1VYTA 3JV3A 1TUDA 2FRWA 2NUZA 1Y57A 2KEAA 1HD3A 2C0IA 1YNZA 3EG1A 1S1NA 4LN2A 1ARKA 1Z9ZA 2BTTA 1J3TA 2DRKA 4F17A 2LP5A 1GBRA 2YUQA 4E6RA 1WLPB 2GQIA 2KGTA 3IQLA 2ED0A 2CDTA 4J9HA 2J06A 1WIEA 1GCPA 1PHTA 1AWWA 2A08A 2EW3A 4F16A 2YDLA 1GCQC 1QKWA 1M27C 1WX6A 4RTUA 4LE9A 2GTJA 1KIKA 2EGAA 2YUOA 3H0FA 1BBZA 2RQVA 1AZEA 1G2BA 1T0JA 2QDLA 1YP5A 1GFDA 4Y92A 2EYXA 2CH4A 2CH4W 3EHQA 4J9DA 1T3LA 3EHRA 4CC2A 2JW4A 5IHNA 2HEQA 2O9VA 2E5KA 2KXCA 2O2OA 3EG3A 2C0TA 4OMMA 2JXBA 3M0SA 1UUEA 2RQUA 1HJDA 2JM9A 1SEMA 5IXBA 1W70A 2VWFA 3I5SA 1QCFA 2DBKA 2YUNA 1RI9A 3REBB 3VRYA 4J9EA 1K0XA 1E6GA 3EG2A 2W10A 1W6XA 2KROA 2CREA 1GCQA 2HSPA 1B3QA 2RQWA 2DM1A 2DJQA 3M0QA 2LQNA 1I1JA 2JM8A 1AZGB 2ED1A 1WFWA 3ZL7C 1WYXA 2PTKA 2M51A 2DF6A 5HCKA 3M0PA 1YWPA 4AFQC 4A63B 2LJ3A 2JMAA 2FO0A 4AFUC 5I11A 2KR3A 2B86A 2DILA 2PZ1A 1UTIA 2ENMA 1X2KA 1MV3A 3I5RA 2FPFA 1WXUA 2A37A 2LJ1A 2YUPA 2D0NA 2LCSA 1OPKA 2PNIA 1FYNA 2CSIA 1X43A 4JZ3A 1UJYA 2K6DA 5L23A 1TG0A 1JXOA 4GBQA 1H3HA 1WXBA 1WA7A 3PVLA 4JJCA 1MUZA 1UHFA 2SRCA 1SPKA 2GBQA 2DYBA 2BZ8A 1FMKA 3SHWA 1Z9QA 3UA6A 3SEMA 1NYGA 2YT6A 4JJDA 2GNCA 2KBTA 4OMQA 1ZUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IO6 A;  1ZLM A;  1M30 A;  3UF4 A;  3VS6 A;  2EYZ A;  2KXD A;  1GBQ A;  2EYW A;  1QKX A;  1NEG A;  1SSH A;  5FWB A;  4CC3 A;  1JEG A;  1PRL C;  1WXT A;  4JZ4 A;  1UHC A;  3QWY A;  2ECZ A;  4AFZ C;  2DMO A;  1AD5 A;  2V1Q A;  3QWX X;  1CKB A;  4ESR A;  1GRI A;  3NMZ C;  1BK2 A;  2X3W D;  2L3S A;  3M0U A;  2LZ6 B;  2L3Q A;  2LJ0 A;  1OEB A;  3GBQ A;  4AG2 C;  2EYY A;  1QWE A;  4R0K A;  2ROL A;  3NGP A;  1RUW A;  1PNJ A;  2K9G A;  1PKS A;  2K3B A;  1VYU A;  2F2X A;  1M3B A;  1X2Q A;  4X1V A;  3VRZ A;  1UEC A;  2X3X D;  2DNU A;  1UGV A;  2M0Y A;  1MV0 B;  1QWF A;  3O5Z A;  2FG0 A;  2O31 A;  1W1F A;  2EPD A;  4DEX A;  2EQI A;  3C0C A;  1M8M A;  1ABQ A;  2DLP A;  1WDX A;  4Z88 A;  1WI7 A;  4EIK A;  2JS2 A;  2DVJ A;  2J05 A;  4AFS C;  1UE9 A;  4AG1 C;  2L2P A;  3VS7 A;  1SHF A;  1JU5 C;  4DEY A;  5IH2 A;  2W0Z A;  2JMC A;  4K11 A;  1HSQ A;  1E6H A;  2RF0 A;  3NHN A;  2XMF A;  1RLQ C;  1SRM A;  5GJV B;  1GFC A;  2DA9 A;  1NLP C;  2KNB B;  1YCS B;  2AK5 A;  3H41 A;  2I0N A;  1PWT A;  1X27 A;  2CSQ A;  1I07 A;  2LMJ A;  1K4U S;  1NM7 A;  2JT4 A;  2CUD A;  1M3C A;  3UA7 A;  1XOV A;  5I22 A;  2CT3 A;  4JPB W;  3NPF A;  2NWM A;  1X69 A;  1PKT A;  2EKH A;  1YN8 A;  1BU1 A;  2AKK A;  1NYF A;  2VKN A;  3M0R A;  1UJ0 A;  2G6F X;  2OAW A;  3I35 A;  3RNJ A;  2KE9 A;  2O88 A;  3ULR B;  2MIO A;  2HBW A;  1T3S A;  2LX7 A;  4FSS A;  4J9F A;  1TUC A;  2LQW A;  1NEB A;  4OMN A;  2AZS A;  2DX1 A;  4HXJ A;  1NLO C;  2D8J A;  2BZY A;  2GGR A;  2KYB A;  1KFZ A;  2CUB A;  2CT4 A;  1OOT A;  1ZSG A;  1PRM C;  3VS0 A;  2MOX A;  2V1R A;  3THK A;  4CC4 B;  2J6K A;  3TSW A;  4OMO A;  1V1C A;  2DL4 A;  4WCI A;  1UDL A;  2HCK A;  2KT1 A;  4HVV A;  5IHK A;  2ABL A;  1AVZ C;  2FRY A;  5GJW B;  3VS4 A;  2K7A A;  2K2M A;  2F2W A;  1U3O A;  4LUD A;  4LUE A;  2KRM A;  2RQT A;  4KRT A;  4RTY A;  1ZUK A;  1AEY A;  1K1Z A;  3VS2 A;  2RMO A;  1AWX A;  5EC7 A;  2MCN A;  3I9Q A;  1AWO A;  2HDA A;  3EG0 A;  3VS5 A;  2YSQ A;  1VA7 A;  2DL8 A;  2JS0 A;  4ZNX A;  2ESW A;  3CQT A;  4RTV A;  1QLY A;  3H0I A;  1X6B A;  1G83 A;  1SHG A;  2ROT A;  2D8H A;  1EFN A;  3H0H A;  3VS1 A;  2L3P A;  1JXM A;  1YWO A;  2DL7 A;  3M0T A;  5FW9 A;  1ABO A;  2RNA A;  1LCK A;  4RTW A;  3RBB B;  2SEM A;  3KFV A;  5IHI A;  2DE0 X;  1ZX6 A;  2KRS A;  1CKA A;  1GL5 A;  2BZX A;  1ZUU A;  2AKL A;  1KJW A;  2KT8 A;  4RUG A;  1UFF A;  4HCK A;  1KSW A;  1K9A A;  1X6G A;  2EGE A;  2IIM A;  4GLM A;  3TSZ A;  2DBM A;  2F2V A;  1JQQ A;  2KYM A;  1Y0M A;  4RTX A;  1JO8 A;  1H8K A;  2GTO A;  4J9C A;  3PVQ A;  2FEI A;  3U23 A;  2JTE A;  2FPD A;  2RQR A;  1UG1 A;  3UAT A;  1E7O A;  2J6O A;  2FPE A;  2C0O A;  1OV3 A;  2VVK A;  1K0S A;  4CC7 A;  4IIO A;  3A98 A;  2A28 A;  3R6N A;  3LH5 A;  4RTT A;  1RLP C;  4JJB A;  2DL5 A;  5ECA A;  3VS3 A;  4Z89 A;  4RTZ A;  2RN8 A;  1SRL A;  1BB9 A;  2AZV A;  4J9B A;  2P4R A;  2EVR A;  2A36 A;  1U06 A;  1A0N B;  3REA B;  4ORZ A;  4IIM A;  1NG2 A;  2K79 A;  4D8D A;  1VYV A;  2EGC A;  2DRM A;  3FJ5 A;  1OPL A;  4M4Z A;  1U5S A;  1H92 A;  4Z8A A;  2DL3 A;  2RPN A;  4J9I A;  2OI3 A;  2KRN A;  1B07 A;  2EBP A;  5FWC A;  1I0C A;  4QT7 A;  4LNP A;  1T0H A;  4J9G A;  3PE0 A;  2J7I A;  2H8H A;  3TVT A;  1N5Z A;  4HVU A;  4OML A;  1AWJ A;  2O9S A;  2D1X A;  2LNH B;  4F14 A;  4OMP A;  3EGU A;  1CSK A;  1ZBJ A;  4HVW A;  1K76 A;  2L0A A;  2J6F A;  4D8K A;  5IXF A;  1M3A A;  2OJ2 A;  1AOJ A;  1VYT A;  3JV3 A;  1TUD A;  2FRW A;  2NUZ A;  1Y57 A;  2KEA A;  1HD3 A;  2C0I A;  1YNZ A;  3EG1 A;  1S1N A;  4LN2 A;  1ARK A;  1Z9Z A;  2BTT A;  1J3T A;  2DRK A;  4F17 A;  2LP5 A;  1GBR A;  2YUQ A;  4E6R A;  1WLP B;  2GQI A;  2KGT A;  3IQL A;  2ED0 A;  2CDT A;  4J9H A;  2J06 A;  1WIE A;  1GCP A;  1PHT A;  1AWW A;  2A08 A;  2EW3 A;  4F16 A;  2YDL A;  1GCQ C;  1QKW A;  1M27 C;  1WX6 A;  4RTU A;  4LE9 A;  2GTJ A;  1KIK A;  2EGA A;  2YUO A;  3H0F A;  1BBZ A;  2RQV A;  1AZE A;  1G2B A;  1T0J A;  2QDL A;  1YP5 A;  1GFD A;  4Y92 A;  2EYX A;  2CH4 A;  2CH4 W;  3EHQ A;  4J9D A;  1T3L A;  3EHR A;  4CC2 A;  2JW4 A;  5IHN A;  2HEQ A;  2O9V A;  2E5K A;  2KXC A;  2O2O A;  3EG3 A;  2C0T A;  4OMM A;  2JXB A;  3M0S A;  1UUE A;  2RQU A;  1HJD A;  2JM9 A;  1SEM A;  5IXB A;  1W70 A;  2VWF A;  3I5S A;  1QCF A;  2DBK A;  2YUN A;  1RI9 A;  3REB B;  3VRY A;  4J9E A;  1K0X A;  1E6G A;  3EG2 A;  2W10 A;  1W6X A;  2KRO A;  2CRE A;  1GCQ A;  2HSP A;  1B3Q A;  2RQW A;  2DM1 A;  2DJQ A;  3M0Q A;  2LQN A;  1I1J A;  2JM8 A;  1AZG B;  2ED1 A;  1WFW A;  3ZL7 C;  1WYX A;  2PTK A;  2M51 A;  2DF6 A;  5HCK A;  3M0P A;  1YWP A;  4AFQ C;  4A63 B;  2LJ3 A;  2JMA A;  2FO0 A;  4AFU C;  5I11 A;  2KR3 A;  2B86 A;  2DIL A;  2PZ1 A;  1UTI A;  2ENM A;  1X2K A;  1MV3 A;  3I5R A;  2FPF A;  1WXU A;  2A37 A;  2LJ1 A;  2YUP A;  2D0N A;  2LCS A;  1OPK A;  2PNI A;  1FYN A;  2CSI A;  1X43 A;  4JZ3 A;  1UJY A;  2K6D A;  5L23 A;  1TG0 A;  1JXO A;  4GBQ A;  1H3H A;  1WXB A;  1WA7 A;  3PVL A;  4JJC A;  1MUZ A;  1UHF A;  2SRC A;  1SPK A;  2GBQ A;  2DYB A;  2BZ8 A;  1FMK A;  3SHW A;  1Z9Q A;  3UA6 A;  3SEM A;  1NYG A;  2YT6 A;  4JJD A;  2GNC A;  2KBT A;  4OMQ A;  1ZUY A; 
#chains in the Genus database with same CATH topology
 1TSF A;  1FMV A;  3UF4 A;  1YBY A;  4DOW A;  2KXD A;  1TTH B;  1R0B G;  1GBQ A;  1RAI B;  2EYW A;  1QKX A;  3CCM T;  1UHC A;  3S3O A;  2QI2 A;  4M78 E;  3I55 A;  1G8X A;  3QJ6 A;  1MNE A;  3S3N A;  2QQA A;  2LJ0 A;  2YRD A;  4IUP A;  2EIF A;  2DD5 A;  3DKM A;  2MI6 A;  2GF7 A;  4BDZ A;  3BW1 A;  2EYY A;  1RUW A;  1PNJ A;  2K9G A;  2P84 A;  1VYU A;  2F2X A;  4PFZ A;  1SG5 A;  5AT1 B;  4X1V A;  2RHU A;  5A0L A;  3L2Z A;  4M7A F;  3VU3 C;  3UPU A;  3FC3 A;  5D6W A;  1VQM A;  3O5Z A;  3VYH B;  1KQS S;  1M1K U;  5GAM h;  1W1F A;  3CC7 A;  1K8A R;  4DEX A;  3QUI A;  3CC7 Q;  3PFS A;  1K9M C;  1PCX A;  1W2B S;  3EH2 A;  5GMK h;  3RUX A;  2DVJ A;  2O01 E;  1YIJ Q;  2GFU A;  2L2P A;  4FT4 A;  3VS7 A;  5M9O A;  2P0K A;  1K73 U;  5GAN 4;  1U1T A;  2W0Z A;  5KE2 A;  1OZ3 A;  1RLQ C;  1KD1 R;  2DD4 A;  1GFC A;  2DA9 A;  1NLP C;  2KNB B;  1N27 A;  2I0N A;  2CSQ A;  2CZ0 B;  2JT4 A;  2V26 A;  6AT1 B;  1M2V B;  2CUD A;  1XOV A;  5I22 A;  4JPB W;  5KYW A;  2NWM A;  4N4I A;  4OB2 B;  1YN8 A;  2EKH A;  4FYW B;  2D0Q B;  1QVF P;  1YHQ Q;  1BU1 A;  4ATO A;  4BB7 A;  2JJ9 A;  1NYF A;  2VKN A;  2OAW A;  3RNJ A;  2O88 A;  2E10 A;  2MIO A;  3NTK A;  2ATC B;  4FSS A;  2Y4Y A;  2F5K A;  1NEB A;  2QGG A;  3QJY A;  3HRT A;  2KI7 A;  1RAH B;  2RJF A;  2GGR A;  5CK9 A;  3QHS A;  2CT4 A;  2HNI A;  2AT1 B;  1YI2 A;  2WAC A;  1N6A A;  3AT1 B;  5A0D A;  8ATC B;  1IHV A;  2JZ2 A;  1M1K R;  5GMK m;  3TSW A;  1VQ6 T;  3TRE A;  3MCA B;  4OMO A;  2DL4 A;  2QXF A;  3OMG A;  2OTL A;  5CVI A;  1U3O A;  2E65 A;  4TVR A;  2KRM A;  1VQ7 A;  1C6V X;  1YCY A;  3KUF A;  1K1Z A;  1LPL A;  2M1H A;  1VQ5 A;  1D0Y A;  3M4Y A;  2M9U A;  3CC2 A;  2KK4 A;  3EG0 A;  2QA4 A;  2XIC A;  1VQ5 Q;  2DL8 A;  3UDC A;  3OA6 A;  3H0I A;  2CZ1 B;  3PMT A;  1BI3 A;  1SHG A;  2D8H A;  3SB2 A;  3T9N A;  2COW A;  4M7A G;  3H0H A;  2HBP A;  4QQD A;  1VQL A;  1QMC A;  3G6E T;  4KGZ B;  2L3P A;  2MK5 A;  5CKE A;  1OYX A;  5D6Y A;  2JVV A;  1AHJ B;  5IHI A;  2DTO A;  2EQK A;  3SFM A;  1ZUU A;  2AKL A;  4KUI A;  2VAS A;  5CKD A;  3JB9 H;  1WGS A;  4BAC A;  2KT8 A;  2MAM A;  3CPW S;  1K9A A;  1X6G A;  2EGE A;  2F69 A;  4QVZ A;  5GAM f;  3WVD B;  2DBM A;  2F2V A;  5GAM d;  2E41 A;  2RI5 A;  4A54 A;  1VQO T;  2GTO A;  1ZHI A;  4IUU A;  5IN1 A;  3CBO A;  4XTZ A;  2K4Y A;  1VQM T;  2JTE A;  5KYU A;  2RQR A;  3QKJ A;  4EPC A;  3OYA A;  4FYV B;  2VUB A;  1K0S A;  4EMG A;  4IIO A;  3FEO A;  3A98 A;  3M58 A;  3TQ7 P;  4A53 A;  4C92 B;  1PG5 B;  3OMC A;  1SRL A;  1BB9 A;  4EDU A;  2P4R A;  3A8G B;  2EVR A;  2A36 A;  2FVU A;  3QYH B;  3HTR A;  4EMK A;  1BYM A;  1VQK A;  2ZPE B;  4D8D A;  2DRM A;  1Q86 U;  3CCU T;  4MZT A;  3I55 Q;  1LVK A;  2RPN A;  1VQ4 T;  2OI3 A;  2KRN A;  4C0G A;  4X9D A;  2XHC A;  2DAQ A;  5KYY B;  1IGU A;  3O8V A;  4J9G A;  2O4X B;  2DTI A;  3I56 T;  2J7I A;  2HAX A;  4ZTJ A;  2H8H A;  3TVT A;  3X28 B;  4M77 B;  4OB1 B;  5KYN A;  3EGD B;  3OYY A;  1D0X A;  2V8I A;  2P4T A;  4ZGE B;  2EJF A;  3QO3 A;  2L0A A;  4D8K A;  1M3A A;  2OJ2 A;  3JCM c;  3QYG B;  1VYT A;  4M7D G;  3S3M A;  1LNX A;  4ELZ C;  2KEA A;  5LJ5 j;  2C0I A;  2LVM A;  1YNZ A;  2ZPG B;  1R8O B;  4JUV A;  2EJ9 A;  1Z9Z A;  1O75 A;  1VQL Q;  4F17 A;  4E6R A;  5GAO q;  2J06 A;  1WIE A;  1PHT A;  5J26 A;  2WSF E;  1KD1 U;  2OTJ T;  1AWW A;  4F16 A;  3H8Z A;  4N4H A;  2X51 A;  4RTU A;  3MP6 A;  3HFN A;  3CCL Q;  1N8R R;  2YUO A;  1XTD A;  3H0F A;  3EFR A;  4LDW A;  1AZE A;  2LC4 A;  4A4H A;  1I8F A;  4FSX A;  2LTO A;  1EX4 A;  1I5L A;  1KQ1 A;  2BUD A;  4PJO G;  3LH0 A;  3JB9 J;  3GPL A;  2HEQ A;  5D6X A;  3PIP A;  4BE1 A;  2O9V A;  5FRN A;  2L3R A;  2KXC A;  4IUV A;  4NOY A;  3ZFJ A;  2CKK A;  3MEV A;  1WHL A;  4JJN K;  2VWF A;  3I5S A;  2KY9 A;  4WF2 A;  5GMK j;  1QP3 A;  3EG2 A;  4E7J A;  2CRE A;  1B3Q A;  2DM1 A;  4M75 D;  1I1J A;  2HZY A;  3PT9 A;  4Z02 A;  4MML A;  3JCM e;  1WYX A;  2M51 A;  3OYL A;  3JCM b;  2BKD N;  5HCK A;  3JB9 D;  4JS5 A;  1S72 A;  5I11 A;  1YJN A;  1JJ2 S;  3QZ5 B;  4FYY B;  4GLK A;  4QQG A;  1Q81 U;  1VQ9 A;  1MV3 A;  2QEX Q;  4FW2 A;  3LGF A;  1WXU A;  5KYY A;  3QXE B;  2XDD A;  1OI1 A;  4M77 E;  1PSE A;  2LJ1 A;  4IKF A;  1FX7 A;  3M9Q A;  4BDY A;  2D0N A;  5LJ5 g;  2PNI A;  2CSI A;  1UJY A;  3LLR A;  2WSC E;  1XNI A;  2K6D A;  2CZ6 B;  4GBQ A;  2NUP A;  3CXC A;  3M54 A;  3HRU A;  5FLX E;  1MND A;  3CEY A;  1MUZ A;  2ZCF B;  2LNV A;  1D3B B;  3RIR A;  2DYB A;  2BZ8 A;  5LL6 S;  1N9R A;  2EQJ A;  2YT6 A;  3AHU A;  4M78 B;  4BUG A;  4M7D C;  1NEG A;  5J39 A;  2BIV A;  4FYX B;  3OYC A;  3VS6 A;  4PLL A;  3CD6 T;  4VUB A;  4QKU A;  1SKU B;  1SSH A;  1D1A A;  3CCS T;  1QVG A;  1JEG A;  2LRQ A;  3QWY A;  2OTL T;  2HQE A;  3MPU B;  1WNL A;  4E7K A;  4OVA A;  1W4S A;  1BK2 A;  4Q5W A;  4F7U A;  2X3W D;  1MMD A;  2LZ6 B;  1IRE B;  4KT0 E;  1MMG A;  1OEB A;  1QQJ A;  3BE3 A;  4GY5 A;  1R77 A;  4AG2 C;  1Q82 U;  2OX7 A;  5I2M A;  2C06 A;  1PKS A;  5GAN d;  5LJ3 f;  3SWN C;  4E47 A;  1VUB A;  3Q1J A;  1XJW B;  3VRZ A;  1JB0 E;  3NTH A;  2NUT B;  2E70 A;  2X3X D;  2DNU A;  1FWZ A;  1YIT T;  1VQN A;  1IB8 A;  3MP1 A;  2EAY A;  5A2Q E;  3C0C A;  1Q82 C;  1WDX A;  5FU7 B;  3JB9 G;  3G71 T;  1WI7 A;  4HA8 A;  2ZPB B;  4AG1 C;  1D3B A;  5IH2 A;  1RL2 A;  4HKE A;  4K11 A;  2RI3 A;  2L8D A;  3EH1 A;  2RH2 A;  1HSQ A;  2XMF A;  1B34 B;  3BY7 A;  1MGQ A;  3CCR A;  3RMS A;  4J7F A;  3R6O A;  3CBM A;  2XG8 D;  2PUK B;  2IG0 A;  4M7A D;  1X27 A;  1I07 A;  1UB4 A;  2COY A;  4C5G A;  4OGC A;  3OW2 P;  1W2B A;  3UA7 A;  4BE2 A;  1RAC B;  2CT3 A;  4M77 F;  4B6M A;  3A1P A;  1WJR A;  4MMK A;  4C8Q B;  3GNF B;  1PKT A;  3OYH A;  2ZPI B;  2F5T X;  3QDF A;  1G3W A;  1I4K 1;  4IUR A;  2HBW A;  3CCE T;  3EGX A;  2LX7 A;  3CCQ T;  1RAF B;  1TUC A;  1NZ9 A;  1M2V A;  2AZS A;  4CRI A;  3HL8 A;  2D8J A;  3CME Q;  4N4G A;  4J83 A;  4KH1 B;  2KYB A;  1M90 U;  1KFZ A;  1ZSG A;  2MOX A;  2CP6 A;  3HKS A;  1UEB A;  3S6W A;  3E19 A;  4BI8 B;  1V1C A;  5DLQ E;  2E12 A;  3PNW C;  5LJ5 e;  2KT1 A;  4HVV A;  4D6W A;  5GJW B;  2K2M A;  3OYN A;  2F2W A;  4LUD A;  4LUE A;  2RQT A;  4RTY A;  2FB7 A;  1AEY A;  5GAO p;  3VS2 A;  3JCM P;  1AWX A;  2VC8 A;  3I9Q A;  2MCN A;  5LJ5 h;  4ME7 A;  5DY9 A;  1AWO A;  2QEX A;  1M2O A;  3CME T;  5LJ3 j;  3VS5 A;  4ZN3 A;  1WHM A;  3WXM B;  4HCC A;  1VA7 A;  4ZNX A;  1ZSZ A;  3CCQ Q;  3CCE Q;  4C92 E;  4RTV A;  1QLY A;  3VUZ A;  5EG2 A;  1G83 A;  2QGF B;  2EQU A;  3TCJ A;  2G3R A;  2ROT A;  1EFN A;  3QII A;  5DM7 R;  3VS1 A;  4BD3 A;  4ELY C;  4C5E A;  1I5O B;  2X4X A;  1YWO A;  3RR6 A;  4LD9 K;  3M0T A;  4C0F A;  5FW9 A;  1LCK A;  4RTW A;  3RBB B;  2SEM A;  1FMW A;  4LDV A;  4FW1 A;  2FZG B;  2LX9 A;  5GAN 3;  2KRS A;  3NTI A;  1CKA A;  3RDV A;  4HCB A;  1GL5 A;  1O9S A;  3DLM A;  4F7U B;  1KJW A;  1OU8 A;  4J6W A;  2RHY A;  4HCK A;  2E3I A;  1KSW A;  1OX8 A;  2GQV A;  3DB4 A;  3RKY A;  3TSZ A;  3CCS A;  1VQO A;  3BDL A;  1H8K A;  5HK3 A;  4J9C A;  4PNO A;  1ZA1 B;  1M90 R;  2FEI A;  3SDZ A;  4F04 B;  1KD1 C;  2FYK A;  4XU0 A;  2O4X A;  3G71 Q;  2FPD A;  4NL2 A;  3OYD A;  2C0O A;  1YJW A;  2HKN A;  4KUD K;  4PJJ A;  4CC7 A;  2M0O A;  3OSS C;  9ATC B;  2A28 A;  3OYM A;  2DL5 A;  3CCE A;  8AT1 B;  2R5A A;  4RG8 A;  1YIT Q;  4F7U F;  1U06 A;  1A0N B;  2RHI A;  4FIB A;  1NG2 A;  2K5F A;  1VYV A;  4PJO C;  2EGC A;  4M4Z A;  4M77 G;  1X75 C;  2CP5 A;  2XK0 A;  1H92 A;  1VQ4 A;  4Z8A A;  3C95 A;  1YHQ A;  2EBP A;  4MZP A;  5FWC A;  1ZA2 B;  2EJG A;  1P92 A;  3GLX A;  2PQW A;  3V8K A;  4EMH A;  1T0H A;  5KYU B;  3PE0 A;  5GMK i;  4XU3 A;  2DEU A;  1N5Z A;  1B34 A;  2OTL Q;  4NL3 A;  1AWJ A;  2D1X A;  4BY6 C;  3CCS Q;  3EGU A;  1CSK A;  1ZBJ A;  2EQM A;  2L5Q A;  2DYI A;  1Q7Y U;  3CD6 Q;  5IXF A;  4M7A E;  1K73 C;  1Y57 A;  2PVD B;  4C0D B;  1K9M R;  3GIB A;  4E2F B;  3JB9 F;  4ZGJ B;  4LN2 A;  1ARK A;  1K9M U;  2BTT A;  3QBY A;  2LP5 A;  2YUQ A;  2KGT A;  3IQL A;  2CDT A;  2RJC A;  3FDR A;  2A08 A;  3CPW P;  2KDS A;  2E64 A;  2NUT A;  5FRO A;  1WX6 A;  4M75 G;  1YFN A;  4X9C A;  2GTJ A;  2MF2 A;  3HHT B;  4DA4 A;  3MO8 A;  1BBZ A;  4PJO F;  2RQV A;  4J6X A;  2E6N A;  4E7H A;  1YP5 A;  4CI0 C;  3RES A;  1QVP A;  4Y92 A;  1AT1 B;  2EYX A;  4QQ6 A;  3EHQ A;  4LDY A;  1PD0 A;  1T3L A;  3EHR A;  3C12 A;  2QEX T;  5IHN A;  1Q81 R;  1NPP A;  2XDP A;  3OQ5 A;  5KYX A;  1QVG S;  3G6E A;  5CIU A;  2JXB A;  3X24 B;  1HYO A;  1UUE A;  2RQU A;  1HJD A;  1M8V A;  2JM9 A;  2LT4 A;  1SEM A;  5IXB A;  1W70 A;  1ZSZ B;  2DIG A;  1WQW A;  4M75 A;  4J9E A;  3MEA A;  1E6G A;  4QW2 A;  1W6X A;  4XU2 A;  1PM3 A;  2X9H A;  1WQ7 A;  1OX9 A;  1BI2 A;  2JM8 A;  3ZL7 C;  2PTK A;  3JCM J;  1Y96 B;  4R55 A;  1YWP A;  4DQ2 A;  2QK0 A;  2IVW A;  2LJ3 A;  1KQ2 A;  2FO0 A;  3INZ A;  2KR3 A;  4JS4 A;  3OS5 A;  4FM4 B;  4QVD A;  4XTW A;  2YLC A;  1M1G A;  2K3Y A;  3X25 B;  2A37 A;  2DXB A;  1RI0 A;  2YUP A;  3FB9 A;  3V8J A;  4M7A C;  1BIB A;  1OPK A;  4J8O A;  3MJX A;  3L2U A;  3EGX B;  3OYF A;  3CCL T;  3P8H A;  1JXO A;  4C0D C;  2HQH A;  3OS0 A;  1M4Z A;  1WA7 A;  3PVL A;  1WHG A;  2OTJ Q;  1WPY A;  1TWB A;  3JSC A;  1K73 R;  2GBQ A;  1QW1 A;  3OBW A;  1VQL T;  1UGR B;  1FMK A;  1ACM B;  3UA6 A;  4C92 C;  4JJD A;  1LJO A;  2GNC A;  2KBT A;  3MET A;  1ZUY A;  2DZC A;  2NLU A;  4PKC C;  1IO6 A;  1ZLM A;  4M75 B;  3V7C A;  3CXC P;  3N5B B;  3EG9 B;  3FJP A;  4B9X A;  2VGN A;  4CC3 A;  4JZ4 A;  2DK3 A;  4AFZ C;  2DMO A;  2V1Q A;  3M55 A;  4ESR A;  1GRI A;  3I56 Q;  4MDX A;  1H3Z A;  3M0U A;  2L3Q A;  2XKO C;  3CME A;  1VQ4 Q;  1QWE A;  2ROL A;  3I55 T;  2E3H A;  3JCM f;  3CCU Q;  2K3B A;  1Q7Y C;  1KQS P;  3OYK A;  2HKQ B;  1MV0 B;  2O31 A;  1JJ2 P;  4JRQ A;  2RB6 A;  2EQI A;  2M02 A;  3CD6 A;  1ABQ A;  1Y71 A;  1F1B B;  4DOV A;  5LJ5 d;  3CCU A;  3JCM Q;  1VQM Q;  4EIK A;  1QCN A;  1LOJ A;  3V7R A;  3D7S B;  4AFS C;  1UE9 A;  2A3L A;  2H3J A;  1SHF A;  1JU5 C;  3URG A;  1VQO Q;  3F70 A;  5FU6 C;  4KGV B;  5FRM A;  4PFO A;  1JJ2 A;  3JCM V;  3CCM A;  1E6H A;  5GAO r;  2RF0 A;  5CKF A;  1QP2 A;  5GJV B;  1M90 C;  3M57 A;  2CP3 A;  3OYB A;  4M78 A;  3CCQ A;  1PWT A;  1K4U S;  2LMJ A;  2FZC B;  3WVE B;  4C92 D;  3HP9 A;  2LT1 A;  1Q7Y R;  2LQ8 A;  2YHT A;  5IT9 E;  4KGX B;  3RKX A;  1JRI A;  3L2R A;  2Y4X A;  1X69 A;  3E9F A;  3G6E Q;  4HT8 A;  2PVO B;  3M0R A;  4XK8 E;  2KE9 A;  3ULR B;  4PJO D;  1VQ5 T;  3PMI A;  4OMN A;  2LQW A;  1N8R C;  3JCM d;  1D1C A;  2YWW A;  2KQW A;  2BZY A;  2F1L A;  2CUB A;  1OOT A;  2V8J A;  3LW5 E;  2YLB A;  2XD0 A;  4PL6 A;  4L6V 5;  1K8A U;  1UDL A;  2HCK A;  3G71 A;  4LXC A;  2ABL A;  3J7A F;  5GMK e;  2D9T A;  1VQ6 Q;  1Y96 A;  4KRT A;  1ZUK A;  5GAN 8;  5C0M A;  5EC7 A;  2MYS A;  2RHX A;  2HDA A;  2RD1 A;  2CZ7 B;  2CYZ B;  3CCV A;  2JS0 A;  5CAI A;  2ESW A;  4J6Y A;  2XI9 A;  3CQT A;  1X6B A;  1TH7 A;  1VQ6 A;  1YHQ T;  1VOM A;  2RK2 A;  2R58 A;  4ZN1 A;  4MDW A;  2OTJ A;  1ABO A;  2RNA A;  2DKG A;  2YXY A;  1M5Q 1;  2DE0 X;  1ZX6 A;  3H6Z A;  4PJO B;  1WHJ A;  3A8M B;  5LJ3 h;  1BI1 A;  3E2U A;  2DEQ A;  2BZX A;  3RMQ A;  4IUQ A;  4RUG A;  2L89 A;  1UFF A;  2QYZ A;  1G3T A;  2RA2 A;  3L2W A;  4A4K A;  2AIR B;  5A0G A;  2IIM A;  2FL7 A;  4PJO E;  2VXF A;  5KH6 A;  1JQQ A;  2KMT A;  1JO8 A;  1C1A A;  3U23 A;  1YIJ T;  2VGM A;  2ZAE A;  1HXD A;  3LWH A;  4RCC A;  2KAF A;  1UG1 A;  3UAT A;  1E7O A;  2FPE A;  4M75 C;  3CC7 T;  1OV3 A;  3TU4 K;  2E5Q A;  4DBQ A;  2E4H A;  1Q86 C;  3JCM h;  4N0A A;  3R6N A;  4RTT A;  2QQR A;  4JJB A;  4Z89 A;  2RN8 A;  2AZV A;  4JLI A;  4E7S A;  5GAN 5;  4ORZ A;  2RJD A;  3BFM A;  3JAM E;  5FU7 C;  1U5S A;  2DO3 A;  3LGL A;  4A4E A;  1RAB B;  5KYW B;  3CBP A;  2R57 A;  2DL3 A;  4J9I A;  1VQ8 A;  2ZPF B;  3G4S A;  3QZ9 B;  1I0C A;  2MMP A;  4LNP A;  3FRN A;  4M7D B;  4M7A A;  2M16 A;  1IXD A;  5FU6 B;  4V2S A;  1SSF A;  1U1S A;  4HVU A;  2AHJ B;  3C94 A;  3RKW A;  3CCM Q;  2O9S A;  4F14 A;  2JNG A;  4XU1 A;  4LD6 A;  3V7S A;  4C5I A;  1K76 A;  4OP0 A;  3OS1 A;  1JBM A;  3HSB A;  4Y28 E;  1HD3 A;  3ZEH A;  1X6O A;  1NE8 A;  4PJO A;  1Q82 R;  1ZSZ C;  2QDY B;  2X4W A;  2DRK A;  2ZZD A;  1VQP A;  4XAX B;  1GBR A;  1WLP B;  1EZZ B;  2GQI A;  2BE7 D;  1GCP A;  3MP8 A;  1PC0 A;  2YDL A;  1GCQ C;  1QKW A;  4M78 C;  1M27 C;  5AYF A;  1MMN A;  4DBF A;  1VQ9 T;  1G3Y A;  2EGA A;  3L42 A;  2PUO B;  2HSE B;  2VB6 A;  2QAS A;  4OF1 A;  1BIA A;  2P0Q A;  1G2B A;  3QG1 A;  1T0J A;  4PJL A;  4XTU A;  3V8L A;  2QDL A;  3X20 B;  1GFD A;  5CQX A;  4PJM A;  1UGS B;  2CH4 A;  1KHC A;  2CH4 W;  3HRS A;  4CC2 A;  3VJP A;  4PK4 A;  5L8R E;  1Q86 R;  2QQB A;  2C0T A;  1C0M A;  5DLO A;  4OMM A;  1OQK A;  2HL3 A;  5D7U A;  5GAN h;  2DPP B;  5GMK l;  4XTY A;  1QCF A;  3REB B;  1K0X A;  3L2V A;  1M1F A;  3E9G A;  5LJ5 f;  2RK1 A;  3OW2 A;  1W2B P;  1UGP B;  2RQW A;  5IAY A;  2QTV A;  3M0Q A;  2LQN A;  3LX7 A;  1D1B A;  1RAD B;  3VKI A;  2OAU A;  2DFU A;  4FU6 A;  1Q81 C;  1VQP Q;  4E7I A;  3M0P A;  4M77 C;  1YJ9 T;  1NJI C;  4A63 B;  5GAO m;  2A0F B;  3ER0 A;  4KBM B;  4J5Y A;  1WJQ A;  4AFU C;  2B86 A;  2DIL A;  2PZ1 A;  1U8R A;  4FL6 A;  1UTI A;  1KQS A;  2ENM A;  2XID A;  5CCA A;  2YRV A;  3UWN A;  2DER A;  3TEE A;  1WJS A;  2K3X A;  4C8Q D;  2LCS A;  2Z0W A;  1FYN A;  2CP0 A;  1WHK A;  4JZ3 A;  2LCC A;  3ASK A;  2CP2 A;  3GF5 A;  2RO0 A;  1VQ8 Q;  1H3H A;  1WXB A;  1KK7 A;  4F7U G;  4DBH A;  2E6Z A;  1R0C B;  5GAN 2;  4C8Q A;  2X4Y A;  3OBY A;  2KVQ G;  4M78 F;  1KC8 C;  5C6S A;  5HKC A;  2FZK B;  3EFO A;  4O6J A;  5GAM e;  4BI4 A;  5KCH A;  4OMQ A;  2H3E B;  1M1K C;  4PLI A;  1M30 A;  4BE0 A;  4C8Q F;  2EYZ A;  3CC4 A;  4L5G A;  5FWB A;  5HY6 A;  1PRL C;  1WXT A;  2ECZ A;  5HK0 A;  1AD5 A;  3QWX X;  3CCR T;  2PU9 B;  1CKB A;  2I2L A;  3GOX A;  3A5Z B;  3NMZ C;  2VV5 A;  3J80 E;  2L3S A;  2DZ9 A;  3G4S Q;  3GBQ A;  5GAM j;  4R0K A;  3CCV T;  3NGP A;  5CKB A;  1YJ9 A;  2DXT A;  3CPW A;  4M75 F;  1M3B A;  1X2Q A;  4X34 A;  1VQK Q;  1UEC A;  1YJN Q;  1UGV A;  2M0Y A;  1QWF A;  3OY9 A;  4C92 G;  3CMA A;  2FG0 A;  2JOY A;  3EG9 A;  2V8K A;  2HQX A;  3GNG A;  2EPD A;  2BE9 B;  4XQ3 A;  2MPX C;  1M8M A;  2DLP A;  3ZBD A;  4Z88 A;  1G5V A;  5CO7 A;  3EFO B;  2JS2 A;  4RMO A;  2J05 A;  4JRI A;  2K2V A;  2IPO B;  4DEY A;  4FCY A;  2ZPH B;  3CC4 T;  5LJ3 g;  3CCJ Q;  2JMC A;  1D09 B;  2EYQ A;  1YI2 T;  4FT2 A;  1TXQ A;  4M77 A;  2QTX A;  3NHN A;  1VQ7 Q;  1SRM A;  4OB3 B;  3LWI A;  4RCB A;  1YCS B;  2EFI A;  2EKO A;  1VIE A;  1B7T A;  3CPF A;  2AK5 A;  3H41 A;  4Y91 A;  3CMA T;  4ANJ A;  3QSU A;  3GP8 A;  1NM7 A;  3SWN B;  1M3C A;  2CS7 A;  1H64 1;  5GAN j;  4M75 E;  3NPF A;  1SF9 A;  1NBE B;  2X35 A;  4HT9 A;  1BCM A;  4O5V A;  3I56 A;  2NUP B;  2Y90 A;  2AKK A;  3JCM g;  1UJ0 A;  2G6F X;  3I35 A;  4OMF B;  1YIT A;  2D6F A;  1IZ6 A;  1ZBX A;  3EAE A;  1T3S A;  1S72 T;  1IGQ A;  4E7L A;  4J9F A;  3JCM X;  2DX1 A;  4HXJ A;  2QA4 Q;  1Y07 A;  3A8L B;  1NLO C;  1HK9 A;  1YJW Q;  1Y7X A;  3CCL A;  1PRM C;  3VS0 A;  2V1R A;  2HD0 A;  3THK A;  3CC2 T;  4CC4 B;  1TOV A;  2J6K A;  4YTL A;  3HPW A;  3CXC S;  1VQN T;  4WCI A;  5IHK A;  4ZTF A;  1AVZ C;  2FRY A;  3FIF A;  3VS4 A;  2K7A A;  1VQN Q;  1KC8 R;  3OYJ A;  3M59 A;  3CC2 Q;  3H9N A;  1KHI A;  1BI0 A;  2RMO A;  2DVE A;  4BI3 A;  3DB3 A;  4OB0 B;  1YJW T;  2GFA A;  1VIF A;  1QVF S;  2QA4 T;  2RI2 A;  3JRZ A;  2QQS A;  2YSQ A;  1S72 Q;  4IUT A;  2DXC A;  1EIF A;  2JN0 A;  4MZM A;  1M9S A;  3M56 A;  3OS2 A;  4NS5 A;  3OYG A;  1N9S A;  3PGG A;  1JXM A;  2COZ A;  7AT1 B;  2DL7 A;  3SD4 A;  4C0Z A;  1MHN A;  2MWO A;  3JB9 I;  3KFV A;  4II1 A;  3NFC A;  1MMA A;  4A4F A;  4RKU E;  3CMA Q;  3PIO A;  1QVF A;  2JTF A;  4A4G A;  4M77 D;  1BKB A;  4XTV A;  1VQ7 T;  4RG2 A;  4C8Q C;  1IRX A;  5GAN g;  3X26 B;  4GLM A;  1YI2 Q;  4R56 A;  1WZO A;  2JTM A;  1KG1 A;  3CCJ T;  3E1S A;  2KYM A;  1Y0M A;  3CC4 Q;  4RTX A;  5CQY A;  4L59 A;  5CR2 A;  2WSE E;  3PVQ A;  4M7D A;  3M4G A;  3VYG A;  3MEW A;  1ZQ1 A;  2J6O A;  3VUB A;  4HCZ A;  3EFS A;  2VVK A;  4AMC A;  2E1H A;  4F7U E;  3QPH A;  3LH5 A;  1RAE B;  1RLP C;  1V29 B;  2RJE A;  4OGE A;  2CGH A;  2LQK A;  5ECA A;  3VS3 A;  4RTZ A;  4J9B A;  3EGD A;  5I21 A;  1YJN T;  2QAZ A;  3REA B;  1VQK T;  4M7D E;  1G3S A;  4IIM A;  2K79 A;  4JRK A;  4WTO B;  3FJ5 A;  1OPL A;  1GXI E;  4QVC A;  3CCV Q;  2YRC A;  3MEU A;  2DET A;  2GCX A;  3G4S T;  3SWN A;  1B07 A;  1IHW A;  4QT7 A;  2RM4 A;  3J81 E;  1V76 A;  2DXU A;  5I2S A;  2DTH A;  3CCR Q;  4EMK B;  5CKH A;  3A8H B;  4DBR A;  3KXT A;  4OML A;  5J3B A;  2LNH B;  1QVG P;  4OMP A;  1UGQ B;  3P8D A;  4C5H A;  5KE3 A;  4N0A C;  3PTA A;  3FLG A;  2DIQ A;  4HVW A;  1NPR A;  4C92 A;  2J6F A;  1BCO A;  1AOJ A;  1QCO A;  4BY6 B;  2QQ9 A;  4PJN A;  3JV3 A;  3L2Q A;  2HMA A;  4M78 D;  5GAM g;  1TUD A;  2FRW A;  2NUZ A;  4ZGD B;  3EG1 A;  1S1N A;  2KSS A;  4P5N A;  2VYT A;  1J3T A;  1TUG B;  3VV0 A;  4B9W A;  3G7Z A;  2ED0 A;  4C92 F;  4J9H A;  2P0P A;  2EW3 A;  5GAO l;  4J7I A;  1OU9 A;  2PVG B;  2DJZ A;  1TS9 A;  1OZ2 A;  1VQ8 T;  5KYX B;  4LDX A;  4LE9 A;  1KIK A;  1PSF A;  1X01 A;  3UT1 A;  2K5L A;  2A7Y A;  4KH0 B;  3HFO A;  3LYI A;  2JUF A;  3CCJ A;  1NJI R;  4J9D A;  1DJ7 B;  2JW4 A;  5GAO n;  4JDS A;  3C4S A;  3MKD A;  2E5K A;  2O2O A;  2CP7 A;  3EG3 A;  3M0S A;  1D0Z A;  2XDB A;  1YJ9 Q;  4C8Q G;  2EWN A;  3OB9 A;  2RHZ A;  4JRP A;  2YUN A;  2DBK A;  3VRY A;  1RI9 A;  3M53 A;  1YIJ A;  1VQP T;  4LDU A;  2W10 A;  2X4J A;  1RAG B;  2KRO A;  2FHD A;  3DLL A;  1GCQ A;  2HSP A;  2DJQ A;  3L1A A;  3QDR B;  1AZG B;  3KBG A;  2ED1 A;  1WFW A;  1N8R U;  3G1J A;  4M7D F;  3M5A A;  5KCO A;  2DF6 A;  4M78 G;  5LJ3 e;  1Q95 G;  3OYI A;  1KC8 U;  4AFQ C;  3MHX A;  4EMK C;  2JMA A;  3BDU A;  1XQH A;  4JLG A;  5GAN 7;  1FXX A;  2QG9 B;  2NYS A;  2LCL A;  3JCM W;  1X2K A;  4M7A B;  5LJ3 d;  5GAN f;  3I5R A;  2FPF A;  2HL5 C;  1K8A C;  5GAN e;  3ME9 A;  2ZGW A;  4C8Q E;  1I81 A;  5GAN 6;  1TU0 B;  2MWP A;  3OSV A;  1WHH A;  1X43 A;  1OUL A;  3A8O B;  2B8A A;  4E7Z A;  1VQ9 Q;  4KUL A;  5L23 A;  1TG0 A;  4M7D D;  4PFP A;  4AT1 B;  4UC4 A;  2VXE A;  4JJC A;  2XU8 A;  2K5I A;  1UHF A;  2SRC A;  3P8B B;  1RAA B;  1SPK A;  3RER A;  1NJI U;  4XTX A;  2R5M A;  3SHW A;  3OW2 S;  1Z9Q A;  3OYE A;  3SEM A;  1NYG A;  2K57 A;  1PD1 A;  2LDM A; 
#chains in the Genus database with same CATH homology
 1IO6 A;  1ZLM A;  1M30 A;  3UF4 A;  3VS6 A;  2EYZ A;  2KXD A;  1GBQ A;  2EYW A;  1QKX A;  1NEG A;  1SSH A;  5FWB A;  4CC3 A;  1JEG A;  1PRL C;  1WXT A;  4JZ4 A;  1UHC A;  3QWY A;  2ECZ A;  4AFZ C;  2DMO A;  1AD5 A;  2V1Q A;  3QWX X;  1CKB A;  4ESR A;  1GRI A;  3NMZ C;  1BK2 A;  2X3W D;  2L3S A;  3M0U A;  2LZ6 B;  2L3Q A;  2LJ0 A;  1OEB A;  3GBQ A;  4AG2 C;  2EYY A;  1QWE A;  4R0K A;  2ROL A;  3NGP A;  1RUW A;  1PNJ A;  2K9G A;  1PKS A;  2K3B A;  1VYU A;  2F2X A;  1M3B A;  1X2Q A;  4X1V A;  3VRZ A;  1UEC A;  2X3X D;  2DNU A;  1UGV A;  2M0Y A;  1MV0 B;  1QWF A;  3O5Z A;  2FG0 A;  2O31 A;  1W1F A;  2EPD A;  4DEX A;  2EQI A;  3C0C A;  1M8M A;  1ABQ A;  2DLP A;  1WDX A;  4Z88 A;  1WI7 A;  4EIK A;  2JS2 A;  2DVJ A;  2J05 A;  4AFS C;  1UE9 A;  4AG1 C;  2L2P A;  3VS7 A;  1SHF A;  1JU5 C;  4DEY A;  5IH2 A;  2W0Z A;  2JMC A;  4K11 A;  1HSQ A;  1E6H A;  2RF0 A;  3NHN A;  2XMF A;  1RLQ C;  1SRM A;  5GJV B;  1GFC A;  2DA9 A;  1NLP C;  2KNB B;  1YCS B;  2AK5 A;  3H41 A;  2I0N A;  1PWT A;  1X27 A;  2CSQ A;  1I07 A;  2LMJ A;  1K4U S;  1NM7 A;  2JT4 A;  2CUD A;  1M3C A;  3UA7 A;  1XOV A;  5I22 A;  2CT3 A;  4JPB W;  3NPF A;  2NWM A;  1X69 A;  1PKT A;  2EKH A;  1YN8 A;  1BU1 A;  2AKK A;  1NYF A;  2VKN A;  3M0R A;  1UJ0 A;  2G6F X;  2OAW A;  3I35 A;  3RNJ A;  2KE9 A;  2O88 A;  3ULR B;  2MIO A;  2HBW A;  1T3S A;  2LX7 A;  4FSS A;  4J9F A;  1TUC A;  2LQW A;  1NEB A;  4OMN A;  2AZS A;  2DX1 A;  4HXJ A;  1NLO C;  2D8J A;  2BZY A;  2GGR A;  2KYB A;  1KFZ A;  2CUB A;  2CT4 A;  1OOT A;  1ZSG A;  1PRM C;  3VS0 A;  2MOX A;  2V1R A;  3THK A;  4CC4 B;  2J6K A;  3TSW A;  4OMO A;  1V1C A;  2DL4 A;  4WCI A;  1UDL A;  2HCK A;  2KT1 A;  4HVV A;  5IHK A;  2ABL A;  1AVZ C;  2FRY A;  5GJW B;  3VS4 A;  2K7A A;  2K2M A;  2F2W A;  1U3O A;  4LUD A;  4LUE A;  2KRM A;  2RQT A;  4KRT A;  4RTY A;  1ZUK A;  1AEY A;  1K1Z A;  3VS2 A;  2RMO A;  1AWX A;  5EC7 A;  2MCN A;  3I9Q A;  1AWO A;  2HDA A;  3EG0 A;  3VS5 A;  2YSQ A;  1VA7 A;  2DL8 A;  2JS0 A;  4ZNX A;  2ESW A;  3CQT A;  4RTV A;  1QLY A;  3H0I A;  1X6B A;  1G83 A;  1SHG A;  2ROT A;  2D8H A;  1EFN A;  3H0H A;  3VS1 A;  2L3P A;  1JXM A;  1YWO A;  2DL7 A;  3M0T A;  5FW9 A;  1ABO A;  2RNA A;  1LCK A;  4RTW A;  3RBB B;  2SEM A;  3KFV A;  5IHI A;  2DE0 X;  1ZX6 A;  2KRS A;  1CKA A;  1GL5 A;  2BZX A;  1ZUU A;  2AKL A;  1KJW A;  2KT8 A;  4RUG A;  1UFF A;  4HCK A;  1KSW A;  1K9A A;  1X6G A;  2EGE A;  2IIM A;  4GLM A;  3TSZ A;  2DBM A;  2F2V A;  1JQQ A;  2KYM A;  1Y0M A;  4RTX A;  1JO8 A;  1H8K A;  2GTO A;  4J9C A;  3PVQ A;  2FEI A;  3U23 A;  2JTE A;  2FPD A;  2RQR A;  1UG1 A;  3UAT A;  1E7O A;  2J6O A;  2FPE A;  2C0O A;  1OV3 A;  2VVK A;  1K0S A;  4CC7 A;  4IIO A;  3A98 A;  2A28 A;  3R6N A;  3LH5 A;  4RTT A;  1RLP C;  4JJB A;  2DL5 A;  5ECA A;  3VS3 A;  4Z89 A;  4RTZ A;  2RN8 A;  1SRL A;  1BB9 A;  2AZV A;  4J9B A;  2P4R A;  2EVR A;  2A36 A;  1U06 A;  1A0N B;  3REA B;  4ORZ A;  4IIM A;  1NG2 A;  2K79 A;  4D8D A;  1VYV A;  2EGC A;  2DRM A;  3FJ5 A;  1OPL A;  4M4Z A;  1U5S A;  1H92 A;  4Z8A A;  2DL3 A;  2RPN A;  4J9I A;  2OI3 A;  2KRN A;  1B07 A;  2EBP A;  5FWC A;  1I0C A;  4QT7 A;  4LNP A;  1T0H A;  4J9G A;  3PE0 A;  2J7I A;  2H8H A;  3TVT A;  1N5Z A;  4HVU A;  4OML A;  1AWJ A;  2O9S A;  2D1X A;  2LNH B;  4F14 A;  4OMP A;  3EGU A;  1CSK A;  1ZBJ A;  4HVW A;  1K76 A;  2L0A A;  2J6F A;  4D8K A;  5IXF A;  1M3A A;  2OJ2 A;  1AOJ A;  1VYT A;  3JV3 A;  1TUD A;  2FRW A;  2NUZ A;  1Y57 A;  2KEA A;  1HD3 A;  2C0I A;  1YNZ A;  3EG1 A;  1S1N A;  4LN2 A;  1ARK A;  1Z9Z A;  2BTT A;  1J3T A;  2DRK A;  4F17 A;  2LP5 A;  1GBR A;  2YUQ A;  4E6R A;  1WLP B;  2GQI A;  2KGT A;  3IQL A;  2ED0 A;  2CDT A;  4J9H A;  2J06 A;  1WIE A;  1GCP A;  1PHT A;  1AWW A;  2A08 A;  2EW3 A;  4F16 A;  2YDL A;  1GCQ C;  1QKW A;  1M27 C;  1WX6 A;  4RTU A;  4LE9 A;  2GTJ A;  1KIK A;  2EGA A;  2YUO A;  3H0F A;  1BBZ A;  2RQV A;  1AZE A;  1G2B A;  1T0J A;  2QDL A;  1YP5 A;  1GFD A;  4Y92 A;  2EYX A;  2CH4 A;  2CH4 W;  3EHQ A;  4J9D A;  1T3L A;  3EHR A;  4CC2 A;  2JW4 A;  5IHN A;  2HEQ A;  2O9V A;  2E5K A;  2KXC A;  2O2O A;  3EG3 A;  2C0T A;  4OMM A;  2JXB A;  3M0S A;  1UUE A;  2RQU A;  1HJD A;  2JM9 A;  1SEM A;  5IXB A;  1W70 A;  2VWF A;  3I5S A;  1QCF A;  2DBK A;  2YUN A;  1RI9 A;  3REB B;  3VRY A;  4J9E A;  1K0X A;  1E6G A;  3EG2 A;  2W10 A;  1W6X A;  2KRO A;  2CRE A;  1GCQ A;  2HSP A;  1B3Q A;  2RQW A;  2DM1 A;  2DJQ A;  3M0Q A;  2LQN A;  1I1J A;  2JM8 A;  1AZG B;  2ED1 A;  1WFW A;  3ZL7 C;  1WYX A;  2PTK A;  2M51 A;  2DF6 A;  5HCK A;  3M0P A;  1YWP A;  4AFQ C;  4A63 B;  2LJ3 A;  2JMA A;  2FO0 A;  4AFU C;  5I11 A;  2KR3 A;  2B86 A;  2DIL A;  2PZ1 A;  1UTI A;  2ENM A;  1X2K A;  1MV3 A;  3I5R A;  2FPF A;  1WXU A;  2A37 A;  2LJ1 A;  2YUP A;  2D0N A;  2LCS A;  1OPK A;  2PNI A;  1FYN A;  2CSI A;  1X43 A;  4JZ3 A;  1UJY A;  2K6D A;  5L23 A;  1TG0 A;  1JXO A;  4GBQ A;  1H3H A;  1WXB A;  1WA7 A;  3PVL A;  4JJC A;  1MUZ A;  1UHF A;  2SRC A;  1SPK A;  2GBQ A;  2DYB A;  2BZ8 A;  1FMK A;  3SHW A;  1Z9Q A;  3UA6 A;  3SEM A;  1NYG A;  2YT6 A;  4JJD A;  2GNC A;  2KBT A;  4OMQ A;  1ZUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...