4JJCA

Crystal structure of the abl-sh3 domain at ph5
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the Abl-SH3 domain at pH5
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jjcA00
2EYXA 1GFDA 1N5ZA 1UE9A 2RQVA 1LCKA 1NLOC 1SHGA 1I07A 4LN2A 2J6OA 1AWWA 4RTYA 2YDLA 2GQIA 4CC7A 1XOVA 1WX6A 2LX7A 1WFWA 2EGEA 2M51A 2LMJA 2C0IA 3VS3A 4E6RA 2FPFA 1GBRA 3TSWA 1QKXA 1ZUUA 3VS1A 1W6XA 1WI7A 2AKLA 1RLPC 3PVLA 2KRNA 2SEMA 4K11A 4Y92A 1UHCA 1GCQC 1ABQA 1OEBA 2I0NA 4HXJA 2OJ2A 2L2PA 4ORZA 1IO6A 1OV3A 1YWOA 4J9CA 2JS0A 5IHNA 3I9QA 2J06A 2KBTA 2VVKA 5IHIA 1RLQC 4JZ3A 5ECAA 3NGPA 3SHWA 3M0QA 1UJYA 2X3XD 1SRLA 1ZBJA 2LQWA 4ESRA 2KRMA 1CKAA 2K9GA 2DA9A 2DBKA 4HVWA 2KROA 3UA7A 1UG1A 2DVJA 2NUZA 1KSWA 2DJQA 2CUDA 1PRLC 2KEAA 1AZGB 1U5SA 2DYBA 1NEGA 4AFZC 2M0YA 4JPBW 2KE9A 4Z89A 4ZNXA 1GL5A 1VYTA 4LUDA 1WIEA 3R6NA 1WXUA 2HDAA 1GCPA 4LUEA 3TVTA 3U23A 5GJWB 1JQQA 1WYXA 4GBQA 2EW3A 3QWXX 1PHTA 1U06A 4AG2C 1S1NA 2CUBA 1BK2A 4LE9A 3VS5A 2B86A 3CQTA 2KR3A 2SRCA 2DL3A 3H0HA 2G6FX 2V1RA 2CH4W 2DL7A 2CSQA 2LP5A 2CDTA 1G83A 5FWCA 4JZ4A 2O9SA 1UDLA 2RQTA 1OPLA 3M0UA 2JM9A 2MIOA 2AZVA 1HSQA 4J9IA 5GJVB 2C0OA 4CC3A 1MV0B 2VKNA 3TSZA 4OMMA 2EYWA 1Y57A 2PTKA 5FWBA 4J9GA 2ED0A 1QKWA 2LJ3A 4RUGA 4AG1C 1A0NB 2FPDA 3M0RA 4FSSA 5IXBA 2FO0A 2DM1A 2YUPA 1NM7A 2RN8A 1UUEA 1NEBA 2F2XA 2JM8A 3LH5A 1AOJA 2RNAA 1TUCA 3THKA 2JT4A 2K7AA 1K0SA 3JV3A 1ZUKA 4LNPA 2DL5A 1H8KA 1I1JA 1AWJA 4JJBA 2RQUA 4DEYA 4EIKA 1CSKA 1ZLMA 4AFUC 2L0AA 2GGRA 3IQLA 2KRSA 2E5KA 1Z9QA 2DILA 4Z8AA 2AK5A 4DEXA 3NPFA 4GLMA 2A37A 1W1FA 1VYVA 2KYMA 2DL4A 2JTEA 2XMFA 4RTTA 3A98A 3M0TA 2DF6A 2AZSA 1WXBA 4RTVA 2FRYA 1GCQA 1WLPB 2DMOA 1VA7A 2O31A 3ULRB 1MUZA 2K6DA 1PWTA 3I5RA 1YWPA 5IH2A 4HVVA 5EC7A 4AFSC 1H3HA 4D8DA 1SEMA 2D0NA 2DBMA 4J9DA 5IHKA 4Z88A 3NMZC 1K76A 1NG2A 2DRMA 1K4US 1YN8A 3REAB 4X1VA 1JXOA 2P4RA 1TUDA 2KT8A 2GTOA 2RQWA 5IXFA 2CH4A 2KGTA 1YNZA 1X69A 1GFCA 4RTZA 2YUOA 1PKTA 2O9VA 3M0PA 1AD5A 3KFVA 4RTUA 1X27A 2AKKA 2CT4A 3EG3A 1T3SA 1AWOA 1BB9A 2C0TA 1E6GA 2NWMA 5L23A 2PNIA 1OOTA 2MCNA 2CSIA 1AWXA 3M0SA 1BBZA 1PNJA 2LNHB 1JEGA 3EGUA 4CC2A 4HVUA 4KRTA 1EFNA 2DRKA 2DNUA 2EVRA 1CKBA 1WXTA 1V1CA 3EHRA 2KXCA 1OPKA 2ED1A 2ROTA 2HCKA 2JXBA 2OAWA 5HCKA 1X6BA 4CC4B 1WA7A 1J3TA 2VWFA 3PE0A 1NYGA 2GBQA 1QLYA 1YCSB 1M3CA 2YT6A 1QWFA 1ARKA 3VRZA 4IIOA 2LQNA 2FRWA 2KNBB 3EG2A 1GRIA 1T0JA 1SPKA 2CREA 2KYBA 1U3OA 2DE0X 2ESWA 4D8KA 2RPNA 3H41A 2L3QA 2J6FA 1HJDA 2YUQA 2LJ0A 1ABOA 3C0CA 1X6GA 2KT1A 1AZEA 4M4ZA 3VRYA 3VS7A 1AVZC 2FPEA 3UATA 2GNCA 2ROLA 1NYFA 3EHQA 2RQRA 1M27C 1Y0MA 2BZ8A 2D8JA 1UFFA 3SEMA 4R0KA 2LZ6B 1T3LA 2EKHA 1W70A 2O88A 1VYUA 1H92A 3PVQA 1T0HA 1M3BA 2J6KA 4JJCA 1E7OA 2ABLA 1M3AA 2F2VA 1PKSA 2BZYA 5FW9A 4J9FA 2GTJA 3EG1A 2K2MA 1KJWA 2LJ1A 5I22A 3VS6A 1JXMA 2J05A 1RUWA 2RMOA 1PRMC 4HCKA 1AEYA 4IIMA 2BTTA 2X3WD 1FMKA 1K1ZA 1SSHA 2D8HA 4OMNA 1UHFA 2ECZA 3GBQA 2EQIA 1K9AA 3H0IA 2DX1A 2EBPA 4OMQA 4OMOA 2V1QA 1BU1A 4F17A 1Z9ZA 2EGAA 2K3BA 1SRMA 1K0XA 1X43A 2YUNA 1RI9A 2YSQA 2J7IA 3I35A 1MV3A 2DL8A 1HD3A 2W0ZA 2A36A 1FYNA 4QT7A 2LCSA 1SHFA 4OMLA 2EGCA 3VS0A 2D1XA 1QWEA 4WCIA 4JJDA 1X2KA 2EPDA 2RF0A 2K79A 2A28A 1M30A 2HSPA 2L3SA 2O2OA 1B07A 1I0CA 2OI3A 3QWYA 4OMPA 2HEQA 4J9EA 2JS2A 4J9HA 1WDXA 2FG0A 2IIMA 3VS4A 2W10A 1KFZA 2ENMA 1YP5A 2QDLA 1GBQA 1X2QA 2EYYA 4RTXA 2EYZA 3H0FA 1KIKA 3RBBB 1ZX6A 2L3PA 1UTIA 3ZL7C 2JW4A 4F16A 3UA6A 2DLPA 2F2WA 4J9BA 1B3QA 3FJ5A 2HBWA 3UF4A 1G2BA 1UJ0A 1ZUYA 2MOXA 2BZXA 1E6HA 1QCFA 2FEIA 4A63B 2KXDA 1ZSGA 2H8HA 3VS2A 4AFQC 3RNJA 3NHNA 2A08A 1JO8A 1UGVA 5I11A 1TG0A 2PZ1A 1UECA 3REBB 1NLPC 4F14A 3I5SA 2JMCA 1JU5C 1M8MA 3O5ZA 3EG0A 2CT3A 4RTWA 2JMAA
chains in the Genus database with same CATH superfamily
4GY5A 4C92A 1VQKT 2QK0A 1N5ZA 3OQ5A 1SHGA 4NS5A 4M77C 3VU3C 3DLMA 3QBYA 2DETA 4ZGJB 3JCMJ 1GBRA 4PNOA 3WVEB 1TH7A 4C0FA 3LH0A 3PVLA 4A4KA 1KC8R 2QTVA 1XJWB 1ABQA 1SSFA 2I0NA 4C0ZA 5L8RE 4A4FA 2QTXA 4QVDA 3EFSA 2JS0A 1M4ZA 3CPWA 2J06A 4M77E 3A8GB 5IHIA 4JZ3A 3H8ZA 1UEBA 1UJYA 1M1FA 2DA9A 4FT2A 5I21A 3CCJT 4BY6C 3HP9A 4HVWA 4KT0E 3UA7A 2F5KA 2X35A 2DVJA 2NUZA 3P8DA 4O5VA 2DJQA 2KEAA 2OTLQ 2M0YA 1GL5A 1XQHA 5J39A 5FU7C 3R6NA 4JLIA 1WXUA 2HDAA 1OZ2A 1Q7YR 2K2VA 4LUEA 3TVTA 3U23A 1MNEA 1VQ6A 4M7AB 2QXFA 2QDYB 1WYXA 4GBQA 2EW3A 4AG2C 2HAXA 4FYVB 3HFNA 2JUFA 5CKFA 5DLOA 2V1RA 2CH4W 4ZTFA 2JN0A 2DL7A 2LP5A 5GAN7 3GNFB 5KYWA 5FWCA 8AT1B 3G1JA 1OPLA 1K73C 1Y96B 1VQMA 2JM9A 2EYQA 2BE7D 5AT1B 2C0OA 2Y90A 1MV0B 1PD1A 2A3LA 1HK9A 4RCCA 2Y4YA 4OGCA 1I81A 1YI2T 1ACMB 1UGSB 4A54A 4PJOB 4N0AA 1QP2A 4FSSA 2DZ9A 5IXBA 2OTLT 2YUPA 3G6EA 1NEBA 5GAMh 5LJ3f 2ZPEB 2HNIA 4LDXA 1PM3A 1YJWQ 3G71T 2K7AA 3JV3A 1N8RC 1I1JA 2RQUA 2YLBA 3QPHA 3CCSA 2CP5A 3J7AF 2FB7A 4M7DC 3CCET 3L2ZA 2ATCB 4FYXB 3VJPA 4GLMA 1W1FA 1VYVA 2KYMA 2JTEA 4RTTA 1MNDA 1VQPQ 2DF6A 3OS1A 3CCUA 2AZSA 5GAN6 1WLPB 2DMOA 2K6DA 5C0MA 3I5RA 1SG5A 2O4XA 4M7DD 3JCMh 3LGLA 1H3HA 2D0NA 3OS0A 1QVPA 5LJ3d 2CP7A 2WSEE 2HMAA 3CCVA 2PVDB 4HKEA 2CZ0B 4J6XA 1IRXA 4KGVB 1NJIC 1K73R 3A8LB 4M7DE 4F7UG 5A0DA 2P4RA 3HRUA 5LJ3g 5GANf 4M77G 2KT8A 3OYEA 2ZGWA 5CQYA 5LJ5e 1YJWT 4E7KA 2DXCA 4C8QA 2K4YA 1GFCA 4RTZA 4F7UF 2BUDA 4J6YA 2O9VA 3M0PA 1R0CB 4RTUA 4M77F 5CKHA 5GAOp 4CI0C 1Y71A 4MDWA 1YIJA 4BE0A 2CT4A 1T3SA 5GAOn 7AT1B 2C0TA 4YTLA 1VQPT 2XDDA 2BIVA 2KQWA 4PLIA 3M0SA 5CO7A 2P0PA 1JEGA 2RHZA 3JCMW 2VXFA 1EFNA 3NFCA 4DBFA 5GAOr 5FU6B 4TVRA 2KXCA 5GANd 1M1GA 2ROTA 5KYUB 4KULA 3CXCA 2JXBA 1M2VB 5HCKA 1X6BA 2KSSA 1Q86C 1D09B 5GANg 4HT9A 1J3TA 2AT1B 3G6EQ 1NYGA 3L2WA 1YCSB 1C0MA 3ZEHA 1QWFA 1G3YA 4OB2B 4AMCA 3RKWA 5LJ5h 1T0JA 5GMKh 3ER0A 4EDUA 4LD9K 4D8KA 1KQ1A 1EIFA 3OS5A 4FU6A 2EQUA 4FCYA 2LJ0A 1NJIR 3C0CA 3OYKA 1AZEA 5HK0A 5GMKm 3VS7A 2FPEA 4C92C 1D0XA 2ROLA 3RKYA 3OYFA 2RQRA 3DB4A 2BZ8A 2D8JA 3QSUA 5GMKi 2LZ6B 1D3BB 1AHJB 2EKHA 4LDUA 4PLLA 1H92A 3J81E 2YWWA 1E7OA 3EFOB 2M16A 4HCZA 2QA4A 2YRCA 5FW9A 2BZYA 4BACA 1OULA 2K2MA 2DJZA 3HSBA 4M7DB 1RUWA 2RMOA 4JRPA 3INZA 2HL3A 3MPUB 2E6ZA 3FRNA 5J3BA 1R0BG 3G6ET 1YITA 1FMKA 4OMFB 1K1ZA 4OMNA 1QMCA 2ZZDA 4BUGA 3BW1A 2VASA 3GBQA 2KY9A 4F17A 1VQNQ 1K0XA 2PU9B 2YUNA 3M58A 4E47A 3OYLA 1M8VA 1YIJQ 3CC2T 2RHXA 5KE3A 2KMTA 1FYNA 4QT7A 3OYBA 2LCSA 3EG9A 3JB9D 2RJCA 2EPDA 4OF1A 4E7ZA 1RAGB 2A28A 4OMPA 2NYSA 2HEQA 4E7SA 2QEXQ 2NLUA 3OYMA 1KFZA 2QDLA 2PVOB 4XTWA 4N4GA 4M75B 1WJRA 3FB9A 3UA6A 3VYHB 2CZ1B 1YFNA 4Z02A 1G2BA 4OP0A 2E12A 4ZN1A 1UJ0A 1NE8A 1E6HA 1G5VA 1ZSGA 3AT1B 3C95A 3VS2A 4MDXA 2O01E 3RNJA 1NPRA 2MF2A 5I11A 1TG0A 1VQNT 1YJ9T 1UECA 3REBB 3CC4A 1YIJT 3I5SA 1M8MA 4XK8E 1OU9A 3V7SA 4RTWA 4C5GA 2EYXA 3V8LA 5FRNA 1QVGA 3QHSA 2MPXC 1VQ8A 1LCKA 1I07A 1D3BA 5CAIA 2YRVA 1WJSA 2HL5C 2YDLA 2GQIA 4CC7A 1X6OA 2QEXT 3OB9A 4M78A 3MCAB 2QA4Q 2JTMA 4Q5WA 2K57A 3EFOA 2M51A 2C0IA 4J83A 2FPFA 1XTDA 5GAMj 1QKXA 3VS1A 4J7FA 2AKLA 2KRNA 3EGXA 5DLQE 2MK5A 2QQAA 1UHCA 1VQOA 3EH1A 2OJ2A 2L2PA 4ORZA 3CCMA 1OV3A 2DTIA 4J9CA 5IHNA 3I9QA 4JUVA 3AHUA 2CP0A 3LW5E 2V8JA 5GAOl 4MZMA 2EQJA 1YHQT 3GIBA 3M0QA 2EQKA 2X3XD 4ESRA 4DBQA 4RG8A 2KRMA 2MWOA 1I5OB 3BE3A 5HY6A 4C92G 5CR2A 4ME7A 3RKXA 3V8KA 4ZGEB 4LDWA 2FYKA 4X9DA 2MI6A 1YJNQ 2F1LA 1KQSA 1WJQA 1NEGA 1GXIE 2LQ8A 4Z89A 5GMKl 4C92F 4LUDA 1WIEA 4A4HA 3V7CA 3QDFA 4QKUA 1JJ2A 3ASKA 3CD6Q 8ATCB 3QXEB 1K9MU 4QQGA 1PHTA 1U06A 2BKDN 2HBPA 4LE9A 4ZN3A 3CQTA 4M75A 2G6FX 2E64A 4PJLA 4QVCA 1B34B 1YBYA 3OYCA 3FDRA 1UDLA 1U8RA 2MIOA 4WF2A 1IGQA 1P92A 4OMMA 3CC4Q 4JRKA 1Y57A 4EMKB 2LJ3A 4RUGA 1N8RU 3QZ5B 1M5Q1 4VUBA 2DD4A 1YJNT 4JRIA 3TCJA 3OA6A 3CCRQ 4MMKA 2DM1A 3QJYA 1KHCA 2F2XA 4IURA 2HD0A 1JRIA 1AOJA 4NL3A 1RACB 1KD1C 1TUCA 2EIFA 4GLKA 2JT4A 2OTJA 1K0SA 3CD6T 3OBYA 4JJBA 1S72Q 3G7ZA 2QQSA 2L0AA 4AFUC 2GGRA 3IQLA 5GMKj 3I56A 3V8JA 1D1AA 2P4TA 3E2UA 3NPFA 3A8MB 4L5GA 2LNVA 4M77D 2LT4A 4KGXB 1TS9A 3SWNC 3A98A 3M0TA 3DKMA 1QVFS 1W2BA 4RTVA 1GCQA 4F7UE 1VQ4A 1TTHB 4HVVA 5A0GA 3MP8A 3LGFA 3UPUA 2DIGA 5EC7A 2RI5A 4AFSC 1QVFP 3CC4T 1M90C 5GANe 1SEMA 3X24B 1K4US 5LJ3h 3I55A 2VYTA 2AHJB 3CCRT 2XK0A 1VUBA 1WPYA 1TUDA 3X25B 1WQWA 2RQWA 2CH4A 1YNZA 3QUIA 5GAN5 3BDUA 3CMAQ 1S72T 4QW2A 3KFVA 2QQBA 4HCBA 4ELYC 2IG0A 1U1SA 3CMEQ 4QQ6A 2QYZA 3MP6A 1VQ9Q 2FZGB 2PQWA 3N5BB 3EG3A 1BB9A 5A2QE 1KD1R 2JNGA 5DM7R 2NWMA 5CK9A 1Q86U 2DTOA 4C0DB 2WACA 1VQ7Q 3E19A 1AWXA 1BBZA 1PNJA 5KYNA 3EGUA 4CC2A 3FC3A 2B8AA 3CEYA 2DRKA 2DNUA 2EVRA 4C5EA 1VQ5A 2KK4A 3FLGA 3FJPA 1OPKA 1C6VX 2M9UA 3RMQA 4BE1A 3EFRA 3JAME 1RAHB 2DYIA 2OAWA 4QQDA 2LQKA 1LPLA 3CCQA 2A0FB 1M3CA 4C8QG 4JJNK 1ZSZB 2LQNA 1WGSA 2KNBB 1M90R 3EG2A 1GRIA 4HT8A 1N9RA 1U3OA 2DE0X 1MMAA 2RPNA 2XICA 2YUQA 3CMAT 1KG1A 2FZCB 3M4YA 4C8QF 2KT1A 3I56Q 4M4ZA 3CMET 5I2MA 1UGRB 1VQ9T 2X4JA 2L5QA 3JCMX 4CRIA 3M55A 3OSSC 4J6WA 1EZZB 2X9HA 4F7UB 4M78C 1VQ7T 2CP2A 3E1SA 4M77B 3JCMP 3QIIA 3PVQA 1G3WA 1PC0A 1T0HA 3HRTA 1BI2A 3A8HB 2F2VA 4Y91A 4J9FA 3M53A 2LJ1A 5I22A 3VS6A 5GAN4 3PT9A 1PRMC 1FMVA 1WHJA 4LDYA 1WNLA 5GAN8 3M9QA 3MEUA 2BTTA 2RD1A 2DXTA 1SSHA 2RH2A 3NTHA 2E5QA 2NUTB 1RAEB 4XTYA 1VQ6Q 4FT4A 2V1QA 4M7AA 1IGUA 1Q82R 2EGAA 5KYYB 3PIOA 4ZTJA 1M1KU 2YSQA 1U1TA 2RM4A 2QQRA 5KYXB 3I35A 1PG5B 2CYZB 4B6MA 4BY6B 1O9SA 2RK2A 4XU2A 2A36A 2CS7A 3LWIA 4OMLA 1QP3A 1WHLA 4C5IA 3VS0A 3OYYA 1QWEA 1M30A 1B07A 1VQMQ 2JS2A 2D0QB 5FU7B 1Y96A 1WDXA 1Q81U 2QG9B 3CCLA 2HSEB 3OSVA 4X34A 1YP5A 3RMSA 3CBOA 1GBQA 2DXBA 3GNGA 4RTXA 4Y28E 3UT1A 2EYZA 3H0FA 1UGPB 2L8DA 1ZX6A 2L3PA 4IUTA 1UTIA 3ZL7C 4PJOA 2JW4A 4F04B 4F16A 4LXCA 1MMDA 2MWPA 2EJFA 5GAOm 4J9BA 1TSFA 4UC4A 1SKUB 3UF4A 2L3RA 1ZUYA 2XDBA 1ZSZA 4V2SA 1QCFA 1G8XA 2FEIA 2OX7A 4A63B 3OYDA 2MAMA 3DLLA 1VQ6T 2H8HA 5DY9A 4KUDK 3NTIA 1JO8A 1UGVA 5CKBA 3WVDB 1NLPC 3CCSQ 4F14A 5FROA 2CP6A 2V8KA 3EG0A 1V29B 2JMAA 2WSCE 2HQEA 1GFDA 2RHYA 2NUPB 2E1HA 3VUZA 2RQVA 2DFUA 2J6OA 1AWWA 3CCUQ 3S3NA 1VQMT 4M77A 1XOVA 3C12A 3L1AA 4B9WA 3L2VA 1G3TA 1IHWA 2LX7A 2MMPA 3NTKA 2Y4XA 3VS3A 2E6NA 3S6WA 4C92D 4XAXB 5A0LA 3JCMV 1QQJA 2DZCA 2VGNA 3TSWA 1ZUUA 1OI1A 1RL2A 1W6XA 1G3SA 3CC7A 3CCVQ 3G4SA 2DEUA 3MHXA 1GCQC 4C92E 4C0GA 3TEEA 1YWOA 2E65A 4L59A 2VVKA 1WZOA 2QASA 4IUQA 1ZBJA 3R6OA 3FEOA 5IT9E 1CKAA 1KC8U 5KYYA 2GCXA 3CCST 5FLXE 2KROA 3SDZA 2P0QA 5KYXA 3L2QA 3M56A 3LYIA 5M9OA 1UG1A 1KSWA 2CUDA 1PRLC 1AZGB 1U5SA 4M78G 2KE9A 2IVWA 1ZQ1A 3CCUT 3OBWA 2LTOA 1KK7A 3HL8A 3VKIA 2DXUA 5LJ3j 3DB3A 3CCLQ 3ME9A 5CCAA 1OU8A 3OS2A 5FRMA 1M9SA 3GPLA 4M78F 3QWXX 5CIUA 3RR6A 3CBPA 2CUBA 1OYXA 3JRZA 5KYUA 3URGA 3CCVT 3VS5A 2B86A 1JB0E 2KR3A 2RI2A 2P84A 3KBGA 1M2VA 1Q7YU 1VQKA 4PFZA 2QAZA 1G83A 4JZ4A 2O9SA 2RQTA 3M0UA 1N6AA 4A53A 4HCCA 4L6V5 4N4HA 1HSQA 1HXDA 4J9IA 5GJVB 1IHVA 4XTUA 3JCMb 2E3HA 3HKSA 1BIAA 2DPPB 1V76A 2EYWA 3A1PA 4BE2A 4N0AC 3BY7A 1WHHA 1QKWA 2DIQA 2E70A 4FYYB 2Z0WA 3PNWC 1F1BB 2A7YA 2RHIA 2FPDA 4DOVA 3M0RA 1H641 2NUPA 1LVKA 1UUEA 2ZAEA 2K5IA 2XI9A 2RNAA 5D7UA 4JDSA 2DL5A 1H8KA 4P5NA 1AWJA 4M75G 4EIKA 2C06A 1CSKA 1ZLMA 4FM4B 1X01A 2E5KA 2LCCA 5IAYA 4C92B 4DEXA 4M7DA 4BDYA 1KHIA 2A37A 2DL4A 1YITQ 2XMFA 4M75F 3UWNA 5KCOA 5HKCA 1UB4A 3SFMA 2PUOB 2FRYA 1VA7A 1PWTA 5IH2A 3PTAA 3SB2A 2X4XA 2XG8D 2DBMA 3P8HA 5IHKA 3NMZC 1K76A 2DRMA 1YN8A 1QW1A 4X1VA 1JXOA 1N27A 1PD0A 2QI2A 1SF9A 2E10A 4KH0B 2I2LA 3OMGA 1K8AC 4C8QC 2MYSA 3MJXA 3VUBA 2X4YA 4M7AC 3JCMc 2XKOC 2E4HA 2QA4T 4QVZA 2F5TX 2YUOA 1XNIA 4C5HA 2LC4A 3KXTA 1AD5A 1K73U 1UGQB 2X4WA 4BB7A 2HKNA 2K5FA 3F70A 1YI2A 3OW2S 2LDMA 3M54A 4C8QD 1BKBA 4E7JA 1YITT 3OW2P 2OTLA 2MCNA 1BIBA 2R58A 1TOVA 1RADB 4C8QE 2BE9B 3G71A 1AT1B 2KDSA 4PK4A 2H3EB 3EHRA 3M59A 4OGEA 3VV0A 3HFOA 5C6SA 3CCEA 3RERA 2IPOB 1KQ2A 5I2SA 1MHNA 1HYOA 5KYWB 2GBQA 1QLYA 3P8BB 1VQ8Q 2LX9A 4IIOA 4JRQA 2H3JA 4XTXA 4IKFA 2KYBA 2FL7A 2ESWA 4J7IA 3A5ZB 2L3QA 3CPWS 4RMOA 5CQXA 1ABOA 2VXEA 4DBHA 2RO0A 3BFMA 3VRYA 2ZPFB 2XD0A 2CP3A 2HQHA 1IREB 3CPWP 5LJ5j 4BDZA 1K8AR 1NYFA 1TUGB 3EHQA 1QCNA 1VQOQ 2HQXA 3CCMQ 2DD5A 4B9XA 1NJIU 2DVEA 3MKDA 1YJWA 4JJCA 2GQVA 3LX7A 1ZA2B 4EMGA 1OX8A 1M3AA 1PKSA 2VUBA 5D6YA 1B7TA 3EG1A 4IUPA 4DA4A 2CZ7B 1JXMA 5KCHA 2ZCFB 4HCKA 5CKEA 3LWHA 1VQ8T 1VIEA 3EH2A 1VQPA 2X3WD 2DKGA 4DBRA 4II1A 2D8HA 1WHKA 3PMTA 1UHFA 3OYGA 1Y7XA 2O4XB 2EWNA 1VQLA 2F69A 2ECZA 3JB9I 2EQIA 3OMCA 2FVUA 2EBPA 3HPWA 4OMOA 1BU1A 1PSEA 1Z9ZA 3OYNA 5KE2A 1YI2Q 3OYHA 1FX7A 1RI9A 2J7IA 1MV3A 2COWA 2DL8A 2R57A 1JBMA 2K3YA 2FZKB 4E7HA 1VQOT 1NPPA 5GAMe 1QVFA 1MMNA 3CCMT 3O8VA 2D1XA 4WCIA 2HZYA 1IXDA 1X2KA 1B34A 2RF0A 2K79A 4C8QB 2L3SA 2HSPA 2OI3A 3G71Q 4FW2A 1ZA1B 4XQ3A 5FU6C 4J9HA 2IIMA 2FG0A 3VS4A 2W10A 4DQ2A 2ENMA 3JB9H 2VB6A 4BI4A 5KH6A 2EYYA 4D6WA 4JS4A 3CCEQ 4EMKA 2E3IA 3PIPA 5GANh 1BYMA 2RB6A 5D6XA 1LNXA 1VIFA 2CZ6B 5D6WA 3V7RA 1Q82C 1B3QA 3FJ5A 2AIRB 2HBWA 3QZ9B 1RAIB 2MOXA 4XU3A 4OB0B 4OB3B 1K9MC 4M7AG 3PMIA 3JCMe 1R77A 4IUVA 4MZTA 4OB1B 2OTJQ 3NHNA 2A08A 2PZ1A 4KBMB 1OQKA 2JMCA 1JU5C 4M7AF 3O5ZA 4BI3A 4RKUE 1UE9A 1NLOC 4AT1B 3J80E 4LN2A 2V26A 4RTYA 2XIDA 3OYIA 1WX6A 2CGHA 1VQ4Q 5IN1A 1WFWA 1ZHIA 2EGEA 2DO3A 2LMJA 1I4K1 2RHUA 4E6RA 4MMLA 3META 4PJOG 2L89A 4XTZA 1WI7A 3CC2A 1RLPC 2FHDA 2DAQA 2SEMA 4K11A 3I55Q 1D1BA 4Y92A 4IUUA 4M78D 4HXJA 1OEBA 3M57A 2LT1A 4PJOF 1TWBA 1IO6A 3SWNB 1VQLQ 2KBTA 3HRSA 1RLQC 5ECAA 3SHWA 3NGPA 2OTJT 2LVMA 4M78E 1I8FA 4KGZB 1SRLA 2GFAA 2LQWA 1D1CA 2XU8A 4PJJA 2K9GA 2DBKA 3I56T 2OAUA 2VV5A 2RI3A 1I5LA 1K9MR 3CXCS 2DYBA 5GMKe 4AFZC 4J8OA 4JPBW 4N4IA 4ZNXA 2E41A 1VYTA 3CXCP 2DERA 2EAYA 1VQ4T 1GCPA 1LOJA 2XDPA 2YLCA 5GJWB 1JQQA 1BI1A 4HA8A 1VQ5Q 5GAMf 1VQNA 1S1NA 1YJ9A 3L2UA 4M75C 1BK2A 2EJ9A 2SRCA 3I55T 2DL3A 3EG9B 3H0HA 1LJOA 3OYAA 2ZPGB 4FYWB 3CCQQ 2CSQA 2HKQB 1N8RR 4R56A 2CDTA 2D6FA 4FSXA 3QJ6A 4ZGDB 1VQLT 4FL6A 3E9FA 3RDVA 1H3ZA 2AZVA 2QEXA 4M75D 4CC3A 2RA2A 4BI8B 2VKNA 3TSZA 2JVVA 2PTKA 2EFIA 5FWBA 2WSFE 3BDLA 3ZBDA 4J9GA 2ED0A 3H9NA 2DTHA 3UDCA 4AG1C 1A0NB 2PUKB 3QDRB 4M75E 3JCMf 4X9CA 3PGGA 2FO0A 1NM7A 4RCBA 2RN8A 4EMHA 5GAMd 1W4SA 2JM8A 4F7UA 3LH5A 3VYGA 2RJFA 3THKA 4LD6A 3S3MA 5GAMg 9ATCB 1ZUKA 4LNPA 1YHQA 1VQ5T 1IZ6A 4DEYA 1O75A 4A4EA 1BI3A 3OY9A 3CC2Q 2KRSA 1X75C 1Z9QA 2QGGA 2DILA 4PL6A 4Z8AA 1RAFB 2AK5A 4A4GA 5GAOq 2LRQA 3QYHB 4PJNA 3CCQT 3CPFA 5LL6S 3C94A 5EG2A 3FIFA 1WXBA 3SWNA 1FXXA 3L2RA 4M78B 1OX9A 2O31A 3ULRB 1MUZA 2JZ2A 3RIRA 5HK3A 1YWPA 1K8AU 2NUTA 2COZA 3JCMd 3A8OB 5CVIA 4D8DA 4J9DA 2GFUA 3JCMQ 4O6JA 4Z88A 3JCMg 3EGXB 1NG2A 3REAB 3GOXA 2ZPIB 2GTOA 5IXFA 2RK1A 2KGTA 1X69A 1WQ7A 1Q86R 1D0YA 1BI0A 1EX4A 1PKTA 3S3OA 1YJ9Q 2KAFA 4M7DG 5LJ5f 2EJGA 4PFPA 2YXYA 3EAEA 4ANJA 1D0ZA 1X27A 1YJNA 2AKKA 4PFOA 1DJ7B 2M1HA 1AWOA 5GAN2 1E6GA 2ZPBB 5L23A 2PNIA 1OOTA 4M7DF 3EGDB 4KH1B 1QVGS 2CSIA 4XU0A 2LNHB 2XHCA 1M1KC 5J26A 4HVUA 1FMWA 2VC8A 4KRTA 1TU0B 4EPCA 2EKOA 1QVGP 4JS5A 3CD6A 3C4SA 4LDVA 1CKBA 1WXTA 3H6ZA 3X28B 4EMKC 1V1CA 3TQ7P 1BCMA 1KD1U 2ED1A 4OVAA 4E2FB 2HCKA 2X51A 2ZPHB 2K5LA 4CC4B 1WA7A 2VGMA 2VWFA 3PE0A 3QO3A 2JTFA 2YT6A 2K3XA 3E9GA 1ARKA 1Q81C 1N9SA 1M2OA 3VRZA 5LJ5d 1MGQA 2FRWA 4NL2A 3HHTB 3QKJA 5GANj 2RJEA 1SPKA 1ZBXA 2CREA 3TU4K 3RESA 1YHQQ 1PSFA 3H41A 1PCXA 2KVQG 3WXMB 3CCLT 2J6FA 1HJDA 5LJ5g 3T9NA 2PVGB 3Q1JA 1X6GA 4WTOB 1MMGA 1AVZC 1RABB 3UATA 2G3RA 2GNCA 4JLGA 3CCJA 1C1AA 3CC7Q 3LLRA 3QG1A 1M90U 2DEQA 1NBEB 2V8IA 3PFSA 4DOWA 3G4SQ 1RAAB 3MEAA 1M27C 3MEVA 3CCRA 3MEWA 1Y0MA 1UFFA 3SEMA 4R0KA 3X26B 2CKKA 3RUXA 2EQMA 4J5YA 2M02A 2RJDA 1T3LA 1KQSS 1W70A 1R8OB 3GF5A 3JB9J 2O88A 1VYUA 3X20B 3ZFJA 1M3BA 2J6KA 1KQSP 4MZPA 2ABLA 2QQ9A 3MP1A 1S72A 2GTJA 1JJ2S 3M4GA 1KJWA 2DK3A 4BD3A 5AYFA 2J05A 1NZ9A 5GAN3 2YHTA 1AEYA 4IIMA 1JJ2P 1M1KR 1OZ3A 4RG2A 4R55A 2QGFB 4ELZC 4XTVA 3GP8A 3HTRA 3MO8A 5CKDA 4FIBA 3H0IA 1K9AA 2DX1A 4OMQA 3TREA 3SD4A 6AT1B 1WHGA 4NOYA 1WHMA 3GLXA 2YRDA 2K3BA 1SRMA 3M5AA 1X43A 2R5AA 3CC7T 1Q81R 1FWZA 4FW1A 2GF7A 3G4ST 1HD3A 2W0ZA 2JJ9A 1SHFA 1VQKQ 4C0DC 1Q95G 3JSCA 2EGCA 4M7AD 4JJDA 3EGDA 1QCOA 4PJMA 2P0KA 1Q82U 1KC8C 2O2OA 3QYGB 1I0CA 2D9TA 3QWYA 4PKCC 4J9EA 2KI7A 2LCLA 3CMAA 3D7SB 4E7LA 4M7AE 1X2QA 3KUFA 3CMEA 4PJOC 1KIKA 3L42A 3RBBB 1VQ9A 3OYJA 4KUIA 1RI0A 2R5MA 2DLPA 3CBMA 2F2WA 1ZSZC 2JOYA 2BZXA 4E7IA 3JB9G 1VQ7A 4ATOA 2KXDA 4XU1A 4AFQC 1W2BS 4PJOD 1BCOA 2M0OA 3OW2A 1VOMA 2COYA 1Y07A 5LJ3e 1Q7YC 3JB9F 1W2BP 3CCJQ 1IB8A 1TXQA 1YCYA 2CT3A 4PJOE
chains in the Genus database with same CATH topology
2EYXA 1GFDA 1N5ZA 1UE9A 2RQVA 1LCKA 1NLOC 1SHGA 1I07A 4LN2A 2J6OA 1AWWA 4RTYA 2YDLA 2GQIA 4CC7A 1XOVA 1WX6A 2LX7A 1WFWA 2EGEA 2M51A 2LMJA 2C0IA 3VS3A 4E6RA 2FPFA 1GBRA 3TSWA 1QKXA 1ZUUA 3VS1A 1W6XA 1WI7A 2AKLA 1RLPC 3PVLA 2KRNA 2SEMA 4K11A 4Y92A 1UHCA 1GCQC 1ABQA 1OEBA 2I0NA 4HXJA 2OJ2A 2L2PA 4ORZA 1IO6A 1OV3A 1YWOA 4J9CA 2JS0A 5IHNA 3I9QA 2J06A 2KBTA 2VVKA 5IHIA 1RLQC 4JZ3A 5ECAA 3NGPA 3SHWA 3M0QA 1UJYA 2X3XD 1SRLA 1ZBJA 2LQWA 4ESRA 2KRMA 1CKAA 2K9GA 2DA9A 2DBKA 4HVWA 2KROA 3UA7A 1UG1A 2DVJA 2NUZA 1KSWA 2DJQA 2CUDA 1PRLC 2KEAA 1AZGB 1U5SA 2DYBA 1NEGA 4AFZC 2M0YA 4JPBW 2KE9A 4Z89A 4ZNXA 1GL5A 1VYTA 4LUDA 1WIEA 3R6NA 1WXUA 2HDAA 1GCPA 4LUEA 3TVTA 3U23A 5GJWB 1JQQA 1WYXA 4GBQA 2EW3A 3QWXX 1PHTA 1U06A 4AG2C 1S1NA 2CUBA 1BK2A 4LE9A 3VS5A 2B86A 3CQTA 2KR3A 2SRCA 2DL3A 3H0HA 2G6FX 2V1RA 2CH4W 2DL7A 2CSQA 2LP5A 2CDTA 1G83A 5FWCA 4JZ4A 2O9SA 1UDLA 2RQTA 1OPLA 3M0UA 2JM9A 2MIOA 2AZVA 1HSQA 4J9IA 5GJVB 2C0OA 4CC3A 1MV0B 2VKNA 3TSZA 4OMMA 2EYWA 1Y57A 2PTKA 5FWBA 4J9GA 2ED0A 1QKWA 2LJ3A 4RUGA 4AG1C 1A0NB 2FPDA 3M0RA 4FSSA 5IXBA 2FO0A 2DM1A 2YUPA 1NM7A 2RN8A 1UUEA 1NEBA 2F2XA 2JM8A 3LH5A 1AOJA 2RNAA 1TUCA 3THKA 2JT4A 2K7AA 1K0SA 3JV3A 1ZUKA 4LNPA 2DL5A 1H8KA 1I1JA 1AWJA 4JJBA 2RQUA 4DEYA 4EIKA 1CSKA 1ZLMA 4AFUC 2L0AA 2GGRA 3IQLA 2KRSA 2E5KA 1Z9QA 2DILA 4Z8AA 2AK5A 4DEXA 3NPFA 4GLMA 2A37A 1W1FA 1VYVA 2KYMA 2DL4A 2JTEA 2XMFA 4RTTA 3A98A 3M0TA 2DF6A 2AZSA 1WXBA 4RTVA 2FRYA 1GCQA 1WLPB 2DMOA 1VA7A 2O31A 3ULRB 1MUZA 2K6DA 1PWTA 3I5RA 1YWPA 5IH2A 4HVVA 5EC7A 4AFSC 1H3HA 4D8DA 1SEMA 2D0NA 2DBMA 4J9DA 5IHKA 4Z88A 3NMZC 1K76A 1NG2A 2DRMA 1K4US 1YN8A 3REAB 4X1VA 1JXOA 2P4RA 1TUDA 2KT8A 2GTOA 2RQWA 5IXFA 2CH4A 2KGTA 1YNZA 1X69A 1GFCA 4RTZA 2YUOA 1PKTA 2O9VA 3M0PA 1AD5A 3KFVA 4RTUA 1X27A 2AKKA 2CT4A 3EG3A 1T3SA 1AWOA 1BB9A 2C0TA 1E6GA 2NWMA 5L23A 2PNIA 1OOTA 2MCNA 2CSIA 1AWXA 3M0SA 1BBZA 1PNJA 2LNHB 1JEGA 3EGUA 4CC2A 4HVUA 4KRTA 1EFNA 2DRKA 2DNUA 2EVRA 1CKBA 1WXTA 1V1CA 3EHRA 2KXCA 1OPKA 2ED1A 2ROTA 2HCKA 2JXBA 2OAWA 5HCKA 1X6BA 4CC4B 1WA7A 1J3TA 2VWFA 3PE0A 1NYGA 2GBQA 1QLYA 1YCSB 1M3CA 2YT6A 1QWFA 1ARKA 3VRZA 4IIOA 2LQNA 2FRWA 2KNBB 3EG2A 1GRIA 1T0JA 1SPKA 2CREA 2KYBA 1U3OA 2DE0X 2ESWA 4D8KA 2RPNA 3H41A 2L3QA 2J6FA 1HJDA 2YUQA 2LJ0A 1ABOA 3C0CA 1X6GA 2KT1A 1AZEA 4M4ZA 3VRYA 3VS7A 1AVZC 2FPEA 3UATA 2GNCA 2ROLA 1NYFA 3EHQA 2RQRA 1M27C 1Y0MA 2BZ8A 2D8JA 1UFFA 3SEMA 4R0KA 2LZ6B 1T3LA 2EKHA 1W70A 2O88A 1VYUA 1H92A 3PVQA 1T0HA 1M3BA 2J6KA 4JJCA 1E7OA 2ABLA 1M3AA 2F2VA 1PKSA 2BZYA 5FW9A 4J9FA 2GTJA 3EG1A 2K2MA 1KJWA 2LJ1A 5I22A 3VS6A 1JXMA 2J05A 1RUWA 2RMOA 1PRMC 4HCKA 1AEYA 4IIMA 2BTTA 2X3WD 1FMKA 1K1ZA 1SSHA 2D8HA 4OMNA 1UHFA 2ECZA 3GBQA 2EQIA 1K9AA 3H0IA 2DX1A 2EBPA 4OMQA 4OMOA 2V1QA 1BU1A 4F17A 1Z9ZA 2EGAA 2K3BA 1SRMA 1K0XA 1X43A 2YUNA 1RI9A 2YSQA 2J7IA 3I35A 1MV3A 2DL8A 1HD3A 2W0ZA 2A36A 1FYNA 4QT7A 2LCSA 1SHFA 4OMLA 2EGCA 3VS0A 2D1XA 1QWEA 4WCIA 4JJDA 1X2KA 2EPDA 2RF0A 2K79A 2A28A 1M30A 2HSPA 2L3SA 2O2OA 1B07A 1I0CA 2OI3A 3QWYA 4OMPA 2HEQA 4J9EA 2JS2A 4J9HA 1WDXA 2FG0A 2IIMA 3VS4A 2W10A 1KFZA 2ENMA 1YP5A 2QDLA 1GBQA 1X2QA 2EYYA 4RTXA 2EYZA 3H0FA 1KIKA 3RBBB 1ZX6A 2L3PA 1UTIA 3ZL7C 2JW4A 4F16A 3UA6A 2DLPA 2F2WA 4J9BA 1B3QA 3FJ5A 2HBWA 3UF4A 1G2BA 1UJ0A 1ZUYA 2MOXA 2BZXA 1E6HA 1QCFA 2FEIA 4A63B 2KXDA 1ZSGA 2H8HA 3VS2A 4AFQC 3RNJA 3NHNA 2A08A 1JO8A 1UGVA 5I11A 1TG0A 2PZ1A 1UECA 3REBB 1NLPC 4F14A 3I5SA 2JMCA 1JU5C 1M8MA 3O5ZA 3EG0A 2CT3A 4RTWA 2JMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYX A;  1GFD A;  1N5Z A;  1UE9 A;  2RQV A;  1LCK A;  1NLO C;  1SHG A;  1I07 A;  4LN2 A;  2J6O A;  1AWW A;  4RTY A;  2YDL A;  2GQI A;  4CC7 A;  1XOV A;  1WX6 A;  2LX7 A;  1WFW A;  2EGE A;  2M51 A;  2LMJ A;  2C0I A;  3VS3 A;  4E6R A;  2FPF A;  1GBR A;  3TSW A;  1QKX A;  1ZUU A;  3VS1 A;  1W6X A;  1WI7 A;  2AKL A;  1RLP C;  3PVL A;  2KRN A;  2SEM A;  4K11 A;  4Y92 A;  1UHC A;  1GCQ C;  1ABQ A;  1OEB A;  2I0N A;  4HXJ A;  2OJ2 A;  2L2P A;  4ORZ A;  1IO6 A;  1OV3 A;  1YWO A;  4J9C A;  2JS0 A;  5IHN A;  3I9Q A;  2J06 A;  2KBT A;  2VVK A;  5IHI A;  1RLQ C;  4JZ3 A;  5ECA A;  3NGP A;  3SHW A;  3M0Q A;  1UJY A;  2X3X D;  1SRL A;  1ZBJ A;  2LQW A;  4ESR A;  2KRM A;  1CKA A;  2K9G A;  2DA9 A;  2DBK A;  4HVW A;  2KRO A;  3UA7 A;  1UG1 A;  2DVJ A;  2NUZ A;  1KSW A;  2DJQ A;  2CUD A;  1PRL C;  2KEA A;  1AZG B;  1U5S A;  2DYB A;  1NEG A;  4AFZ C;  2M0Y A;  4JPB W;  2KE9 A;  4Z89 A;  4ZNX A;  1GL5 A;  1VYT A;  4LUD A;  1WIE A;  3R6N A;  1WXU A;  2HDA A;  1GCP A;  4LUE A;  3TVT A;  3U23 A;  5GJW B;  1JQQ A;  1WYX A;  4GBQ A;  2EW3 A;  3QWX X;  1PHT A;  1U06 A;  4AG2 C;  1S1N A;  2CUB A;  1BK2 A;  4LE9 A;  3VS5 A;  2B86 A;  3CQT A;  2KR3 A;  2SRC A;  2DL3 A;  3H0H A;  2G6F X;  2V1R A;  2CH4 W;  2DL7 A;  2CSQ A;  2LP5 A;  2CDT A;  1G83 A;  5FWC A;  4JZ4 A;  2O9S A;  1UDL A;  2RQT A;  1OPL A;  3M0U A;  2JM9 A;  2MIO A;  2AZV A;  1HSQ A;  4J9I A;  5GJV B;  2C0O A;  4CC3 A;  1MV0 B;  2VKN A;  3TSZ A;  4OMM A;  2EYW A;  1Y57 A;  2PTK A;  5FWB A;  4J9G A;  2ED0 A;  1QKW A;  2LJ3 A;  4RUG A;  4AG1 C;  1A0N B;  2FPD A;  3M0R A;  4FSS A;  5IXB A;  2FO0 A;  2DM1 A;  2YUP A;  1NM7 A;  2RN8 A;  1UUE A;  1NEB A;  2F2X A;  2JM8 A;  3LH5 A;  1AOJ A;  2RNA A;  1TUC A;  3THK A;  2JT4 A;  2K7A A;  1K0S A;  3JV3 A;  1ZUK A;  4LNP A;  2DL5 A;  1H8K A;  1I1J A;  1AWJ A;  4JJB A;  2RQU A;  4DEY A;  4EIK A;  1CSK A;  1ZLM A;  4AFU C;  2L0A A;  2GGR A;  3IQL A;  2KRS A;  2E5K A;  1Z9Q A;  2DIL A;  4Z8A A;  2AK5 A;  4DEX A;  3NPF A;  4GLM A;  2A37 A;  1W1F A;  1VYV A;  2KYM A;  2DL4 A;  2JTE A;  2XMF A;  4RTT A;  3A98 A;  3M0T A;  2DF6 A;  2AZS A;  1WXB A;  4RTV A;  2FRY A;  1GCQ A;  1WLP B;  2DMO A;  1VA7 A;  2O31 A;  3ULR B;  1MUZ A;  2K6D A;  1PWT A;  3I5R A;  1YWP A;  5IH2 A;  4HVV A;  5EC7 A;  4AFS C;  1H3H A;  4D8D A;  1SEM A;  2D0N A;  2DBM A;  4J9D A;  5IHK A;  4Z88 A;  3NMZ C;  1K76 A;  1NG2 A;  2DRM A;  1K4U S;  1YN8 A;  3REA B;  4X1V A;  1JXO A;  2P4R A;  1TUD A;  2KT8 A;  2GTO A;  2RQW A;  5IXF A;  2CH4 A;  2KGT A;  1YNZ A;  1X69 A;  1GFC A;  4RTZ A;  2YUO A;  1PKT A;  2O9V A;  3M0P A;  1AD5 A;  3KFV A;  4RTU A;  1X27 A;  2AKK A;  2CT4 A;  3EG3 A;  1T3S A;  1AWO A;  1BB9 A;  2C0T A;  1E6G A;  2NWM A;  5L23 A;  2PNI A;  1OOT A;  2MCN A;  2CSI A;  1AWX A;  3M0S A;  1BBZ A;  1PNJ A;  2LNH B;  1JEG A;  3EGU A;  4CC2 A;  4HVU A;  4KRT A;  1EFN A;  2DRK A;  2DNU A;  2EVR A;  1CKB A;  1WXT A;  1V1C A;  3EHR A;  2KXC A;  1OPK A;  2ED1 A;  2ROT A;  2HCK A;  2JXB A;  2OAW A;  5HCK A;  1X6B A;  4CC4 B;  1WA7 A;  1J3T A;  2VWF A;  3PE0 A;  1NYG A;  2GBQ A;  1QLY A;  1YCS B;  1M3C A;  2YT6 A;  1QWF A;  1ARK A;  3VRZ A;  4IIO A;  2LQN A;  2FRW A;  2KNB B;  3EG2 A;  1GRI A;  1T0J A;  1SPK A;  2CRE A;  2KYB A;  1U3O A;  2DE0 X;  2ESW A;  4D8K A;  2RPN A;  3H41 A;  2L3Q A;  2J6F A;  1HJD A;  2YUQ A;  2LJ0 A;  1ABO A;  3C0C A;  1X6G A;  2KT1 A;  1AZE A;  4M4Z A;  3VRY A;  3VS7 A;  1AVZ C;  2FPE A;  3UAT A;  2GNC A;  2ROL A;  1NYF A;  3EHQ A;  2RQR A;  1M27 C;  1Y0M A;  2BZ8 A;  2D8J A;  1UFF A;  3SEM A;  4R0K A;  2LZ6 B;  1T3L A;  2EKH A;  1W70 A;  2O88 A;  1VYU A;  1H92 A;  3PVQ A;  1T0H A;  1M3B A;  2J6K A;  4JJC A;  1E7O A;  2ABL A;  1M3A A;  2F2V A;  1PKS A;  2BZY A;  5FW9 A;  4J9F A;  2GTJ A;  3EG1 A;  2K2M A;  1KJW A;  2LJ1 A;  5I22 A;  3VS6 A;  1JXM A;  2J05 A;  1RUW A;  2RMO A;  1PRM C;  4HCK A;  1AEY A;  4IIM A;  2BTT A;  2X3W D;  1FMK A;  1K1Z A;  1SSH A;  2D8H A;  4OMN A;  1UHF A;  2ECZ A;  3GBQ A;  2EQI A;  1K9A A;  3H0I A;  2DX1 A;  2EBP A;  4OMQ A;  4OMO A;  2V1Q A;  1BU1 A;  4F17 A;  1Z9Z A;  2EGA A;  2K3B A;  1SRM A;  1K0X A;  1X43 A;  2YUN A;  1RI9 A;  2YSQ A;  2J7I A;  3I35 A;  1MV3 A;  2DL8 A;  1HD3 A;  2W0Z A;  2A36 A;  1FYN A;  4QT7 A;  2LCS A;  1SHF A;  4OML A;  2EGC A;  3VS0 A;  2D1X A;  1QWE A;  4WCI A;  4JJD A;  1X2K A;  2EPD A;  2RF0 A;  2K79 A;  2A28 A;  1M30 A;  2HSP A;  2L3S A;  2O2O A;  1B07 A;  1I0C A;  2OI3 A;  3QWY A;  4OMP A;  2HEQ A;  4J9E A;  2JS2 A;  4J9H A;  1WDX A;  2FG0 A;  2IIM A;  3VS4 A;  2W10 A;  1KFZ A;  2ENM A;  1YP5 A;  2QDL A;  1GBQ A;  1X2Q A;  2EYY A;  4RTX A;  2EYZ A;  3H0F A;  1KIK A;  3RBB B;  1ZX6 A;  2L3P A;  1UTI A;  3ZL7 C;  2JW4 A;  4F16 A;  3UA6 A;  2DLP A;  2F2W A;  4J9B A;  1B3Q A;  3FJ5 A;  2HBW A;  3UF4 A;  1G2B A;  1UJ0 A;  1ZUY A;  2MOX A;  2BZX A;  1E6H A;  1QCF A;  2FEI A;  4A63 B;  2KXD A;  1ZSG A;  2H8H A;  3VS2 A;  4AFQ C;  3RNJ A;  3NHN A;  2A08 A;  1JO8 A;  1UGV A;  5I11 A;  1TG0 A;  2PZ1 A;  1UEC A;  3REB B;  1NLP C;  4F14 A;  3I5S A;  2JMC A;  1JU5 C;  1M8M A;  3O5Z A;  3EG0 A;  2CT3 A;  4RTW A;  2JMA A; 
#chains in the Genus database with same CATH topology
 4GY5 A;  4C92 A;  1VQK T;  2QK0 A;  1N5Z A;  3OQ5 A;  1SHG A;  4NS5 A;  4M77 C;  3VU3 C;  3DLM A;  3QBY A;  2DET A;  4ZGJ B;  3JCM J;  1GBR A;  4PNO A;  3WVE B;  1TH7 A;  4C0F A;  3LH0 A;  3PVL A;  4A4K A;  1KC8 R;  2QTV A;  1XJW B;  1ABQ A;  1SSF A;  2I0N A;  4C0Z A;  5L8R E;  4A4F A;  2QTX A;  4QVD A;  3EFS A;  2JS0 A;  1M4Z A;  3CPW A;  2J06 A;  4M77 E;  3A8G B;  5IHI A;  4JZ3 A;  3H8Z A;  1UEB A;  1UJY A;  1M1F A;  2DA9 A;  4FT2 A;  5I21 A;  3CCJ T;  4BY6 C;  3HP9 A;  4HVW A;  4KT0 E;  3UA7 A;  2F5K A;  2X35 A;  2DVJ A;  2NUZ A;  3P8D A;  4O5V A;  2DJQ A;  2KEA A;  2OTL Q;  2M0Y A;  1GL5 A;  1XQH A;  5J39 A;  5FU7 C;  3R6N A;  4JLI A;  1WXU A;  2HDA A;  1OZ2 A;  1Q7Y R;  2K2V A;  4LUE A;  3TVT A;  3U23 A;  1MNE A;  1VQ6 A;  4M7A B;  2QXF A;  2QDY B;  1WYX A;  4GBQ A;  2EW3 A;  4AG2 C;  2HAX A;  4FYV B;  3HFN A;  2JUF A;  5CKF A;  5DLO A;  2V1R A;  2CH4 W;  4ZTF A;  2JN0 A;  2DL7 A;  2LP5 A;  5GAN 7;  3GNF B;  5KYW A;  5FWC A;  8AT1 B;  3G1J A;  1OPL A;  1K73 C;  1Y96 B;  1VQM A;  2JM9 A;  2EYQ A;  2BE7 D;  5AT1 B;  2C0O A;  2Y90 A;  1MV0 B;  1PD1 A;  2A3L A;  1HK9 A;  4RCC A;  2Y4Y A;  4OGC A;  1I81 A;  1YI2 T;  1ACM B;  1UGS B;  4A54 A;  4PJO B;  4N0A A;  1QP2 A;  4FSS A;  2DZ9 A;  5IXB A;  2OTL T;  2YUP A;  3G6E A;  1NEB A;  5GAM h;  5LJ3 f;  2ZPE B;  2HNI A;  4LDX A;  1PM3 A;  1YJW Q;  3G71 T;  2K7A A;  3JV3 A;  1N8R C;  1I1J A;  2RQU A;  2YLB A;  3QPH A;  3CCS A;  2CP5 A;  3J7A F;  2FB7 A;  4M7D C;  3CCE T;  3L2Z A;  2ATC B;  4FYX B;  3VJP A;  4GLM A;  1W1F A;  1VYV A;  2KYM A;  2JTE A;  4RTT A;  1MND A;  1VQP Q;  2DF6 A;  3OS1 A;  3CCU A;  2AZS A;  5GAN 6;  1WLP B;  2DMO A;  2K6D A;  5C0M A;  3I5R A;  1SG5 A;  2O4X A;  4M7D D;  3JCM h;  3LGL A;  1H3H A;  2D0N A;  3OS0 A;  1QVP A;  5LJ3 d;  2CP7 A;  2WSE E;  2HMA A;  3CCV A;  2PVD B;  4HKE A;  2CZ0 B;  4J6X A;  1IRX A;  4KGV B;  1NJI C;  1K73 R;  3A8L B;  4M7D E;  4F7U G;  5A0D A;  2P4R A;  3HRU A;  5LJ3 g;  5GAN f;  4M77 G;  2KT8 A;  3OYE A;  2ZGW A;  5CQY A;  5LJ5 e;  1YJW T;  4E7K A;  2DXC A;  4C8Q A;  2K4Y A;  1GFC A;  4RTZ A;  4F7U F;  2BUD A;  4J6Y A;  2O9V A;  3M0P A;  1R0C B;  4RTU A;  4M77 F;  5CKH A;  5GAO p;  4CI0 C;  1Y71 A;  4MDW A;  1YIJ A;  4BE0 A;  2CT4 A;  1T3S A;  5GAO n;  7AT1 B;  2C0T A;  4YTL A;  1VQP T;  2XDD A;  2BIV A;  2KQW A;  4PLI A;  3M0S A;  5CO7 A;  2P0P A;  1JEG A;  2RHZ A;  3JCM W;  2VXF A;  1EFN A;  3NFC A;  4DBF A;  5GAO r;  5FU6 B;  4TVR A;  2KXC A;  5GAN d;  1M1G A;  2ROT A;  5KYU B;  4KUL A;  3CXC A;  2JXB A;  1M2V B;  5HCK A;  1X6B A;  2KSS A;  1Q86 C;  1D09 B;  5GAN g;  4HT9 A;  1J3T A;  2AT1 B;  3G6E Q;  1NYG A;  3L2W A;  1YCS B;  1C0M A;  3ZEH A;  1QWF A;  1G3Y A;  4OB2 B;  4AMC A;  3RKW A;  5LJ5 h;  1T0J A;  5GMK h;  3ER0 A;  4EDU A;  4LD9 K;  4D8K A;  1KQ1 A;  1EIF A;  3OS5 A;  4FU6 A;  2EQU A;  4FCY A;  2LJ0 A;  1NJI R;  3C0C A;  3OYK A;  1AZE A;  5HK0 A;  5GMK m;  3VS7 A;  2FPE A;  4C92 C;  1D0X A;  2ROL A;  3RKY A;  3OYF A;  2RQR A;  3DB4 A;  2BZ8 A;  2D8J A;  3QSU A;  5GMK i;  2LZ6 B;  1D3B B;  1AHJ B;  2EKH A;  4LDU A;  4PLL A;  1H92 A;  3J81 E;  2YWW A;  1E7O A;  3EFO B;  2M16 A;  4HCZ A;  2QA4 A;  2YRC A;  5FW9 A;  2BZY A;  4BAC A;  1OUL A;  2K2M A;  2DJZ A;  3HSB A;  4M7D B;  1RUW A;  2RMO A;  4JRP A;  3INZ A;  2HL3 A;  3MPU B;  2E6Z A;  3FRN A;  5J3B A;  1R0B G;  3G6E T;  1YIT A;  1FMK A;  4OMF B;  1K1Z A;  4OMN A;  1QMC A;  2ZZD A;  4BUG A;  3BW1 A;  2VAS A;  3GBQ A;  2KY9 A;  4F17 A;  1VQN Q;  1K0X A;  2PU9 B;  2YUN A;  3M58 A;  4E47 A;  3OYL A;  1M8V A;  1YIJ Q;  3CC2 T;  2RHX A;  5KE3 A;  2KMT A;  1FYN A;  4QT7 A;  3OYB A;  2LCS A;  3EG9 A;  3JB9 D;  2RJC A;  2EPD A;  4OF1 A;  4E7Z A;  1RAG B;  2A28 A;  4OMP A;  2NYS A;  2HEQ A;  4E7S A;  2QEX Q;  2NLU A;  3OYM A;  1KFZ A;  2QDL A;  2PVO B;  4XTW A;  4N4G A;  4M75 B;  1WJR A;  3FB9 A;  3UA6 A;  3VYH B;  2CZ1 B;  1YFN A;  4Z02 A;  1G2B A;  4OP0 A;  2E12 A;  4ZN1 A;  1UJ0 A;  1NE8 A;  1E6H A;  1G5V A;  1ZSG A;  3AT1 B;  3C95 A;  3VS2 A;  4MDX A;  2O01 E;  3RNJ A;  1NPR A;  2MF2 A;  5I11 A;  1TG0 A;  1VQN T;  1YJ9 T;  1UEC A;  3REB B;  3CC4 A;  1YIJ T;  3I5S A;  1M8M A;  4XK8 E;  1OU9 A;  3V7S A;  4RTW A;  4C5G A;  2EYX A;  3V8L A;  5FRN A;  1QVG A;  3QHS A;  2MPX C;  1VQ8 A;  1LCK A;  1I07 A;  1D3B A;  5CAI A;  2YRV A;  1WJS A;  2HL5 C;  2YDL A;  2GQI A;  4CC7 A;  1X6O A;  2QEX T;  3OB9 A;  4M78 A;  3MCA B;  2QA4 Q;  2JTM A;  4Q5W A;  2K57 A;  3EFO A;  2M51 A;  2C0I A;  4J83 A;  2FPF A;  1XTD A;  5GAM j;  1QKX A;  3VS1 A;  4J7F A;  2AKL A;  2KRN A;  3EGX A;  5DLQ E;  2MK5 A;  2QQA A;  1UHC A;  1VQO A;  3EH1 A;  2OJ2 A;  2L2P A;  4ORZ A;  3CCM A;  1OV3 A;  2DTI A;  4J9C A;  5IHN A;  3I9Q A;  4JUV A;  3AHU A;  2CP0 A;  3LW5 E;  2V8J A;  5GAO l;  4MZM A;  2EQJ A;  1YHQ T;  3GIB A;  3M0Q A;  2EQK A;  2X3X D;  4ESR A;  4DBQ A;  4RG8 A;  2KRM A;  2MWO A;  1I5O B;  3BE3 A;  5HY6 A;  4C92 G;  5CR2 A;  4ME7 A;  3RKX A;  3V8K A;  4ZGE B;  4LDW A;  2FYK A;  4X9D A;  2MI6 A;  1YJN Q;  2F1L A;  1KQS A;  1WJQ A;  1NEG A;  1GXI E;  2LQ8 A;  4Z89 A;  5GMK l;  4C92 F;  4LUD A;  1WIE A;  4A4H A;  3V7C A;  3QDF A;  4QKU A;  1JJ2 A;  3ASK A;  3CD6 Q;  8ATC B;  3QXE B;  1K9M U;  4QQG A;  1PHT A;  1U06 A;  2BKD N;  2HBP A;  4LE9 A;  4ZN3 A;  3CQT A;  4M75 A;  2G6F X;  2E64 A;  4PJL A;  4QVC A;  1B34 B;  1YBY A;  3OYC A;  3FDR A;  1UDL A;  1U8R A;  2MIO A;  4WF2 A;  1IGQ A;  1P92 A;  4OMM A;  3CC4 Q;  4JRK A;  1Y57 A;  4EMK B;  2LJ3 A;  4RUG A;  1N8R U;  3QZ5 B;  1M5Q 1;  4VUB A;  2DD4 A;  1YJN T;  4JRI A;  3TCJ A;  3OA6 A;  3CCR Q;  4MMK A;  2DM1 A;  3QJY A;  1KHC A;  2F2X A;  4IUR A;  2HD0 A;  1JRI A;  1AOJ A;  4NL3 A;  1RAC B;  1KD1 C;  1TUC A;  2EIF A;  4GLK A;  2JT4 A;  2OTJ A;  1K0S A;  3CD6 T;  3OBY A;  4JJB A;  1S72 Q;  3G7Z A;  2QQS A;  2L0A A;  4AFU C;  2GGR A;  3IQL A;  5GMK j;  3I56 A;  3V8J A;  1D1A A;  2P4T A;  3E2U A;  3NPF A;  3A8M B;  4L5G A;  2LNV A;  4M77 D;  2LT4 A;  4KGX B;  1TS9 A;  3SWN C;  3A98 A;  3M0T A;  3DKM A;  1QVF S;  1W2B A;  4RTV A;  1GCQ A;  4F7U E;  1VQ4 A;  1TTH B;  4HVV A;  5A0G A;  3MP8 A;  3LGF A;  3UPU A;  2DIG A;  5EC7 A;  2RI5 A;  4AFS C;  1QVF P;  3CC4 T;  1M90 C;  5GAN e;  1SEM A;  3X24 B;  1K4U S;  5LJ3 h;  3I55 A;  2VYT A;  2AHJ B;  3CCR T;  2XK0 A;  1VUB A;  1WPY A;  1TUD A;  3X25 B;  1WQW A;  2RQW A;  2CH4 A;  1YNZ A;  3QUI A;  5GAN 5;  3BDU A;  3CMA Q;  1S72 T;  4QW2 A;  3KFV A;  2QQB A;  4HCB A;  4ELY C;  2IG0 A;  1U1S A;  3CME Q;  4QQ6 A;  2QYZ A;  3MP6 A;  1VQ9 Q;  2FZG B;  2PQW A;  3N5B B;  3EG3 A;  1BB9 A;  5A2Q E;  1KD1 R;  2JNG A;  5DM7 R;  2NWM A;  5CK9 A;  1Q86 U;  2DTO A;  4C0D B;  2WAC A;  1VQ7 Q;  3E19 A;  1AWX A;  1BBZ A;  1PNJ A;  5KYN A;  3EGU A;  4CC2 A;  3FC3 A;  2B8A A;  3CEY A;  2DRK A;  2DNU A;  2EVR A;  4C5E A;  1VQ5 A;  2KK4 A;  3FLG A;  3FJP A;  1OPK A;  1C6V X;  2M9U A;  3RMQ A;  4BE1 A;  3EFR A;  3JAM E;  1RAH B;  2DYI A;  2OAW A;  4QQD A;  2LQK A;  1LPL A;  3CCQ A;  2A0F B;  1M3C A;  4C8Q G;  4JJN K;  1ZSZ B;  2LQN A;  1WGS A;  2KNB B;  1M90 R;  3EG2 A;  1GRI A;  4HT8 A;  1N9R A;  1U3O A;  2DE0 X;  1MMA A;  2RPN A;  2XIC A;  2YUQ A;  3CMA T;  1KG1 A;  2FZC B;  3M4Y A;  4C8Q F;  2KT1 A;  3I56 Q;  4M4Z A;  3CME T;  5I2M A;  1UGR B;  1VQ9 T;  2X4J A;  2L5Q A;  3JCM X;  4CRI A;  3M55 A;  3OSS C;  4J6W A;  1EZZ B;  2X9H A;  4F7U B;  4M78 C;  1VQ7 T;  2CP2 A;  3E1S A;  4M77 B;  3JCM P;  3QII A;  3PVQ A;  1G3W A;  1PC0 A;  1T0H A;  3HRT A;  1BI2 A;  3A8H B;  2F2V A;  4Y91 A;  4J9F A;  3M53 A;  2LJ1 A;  5I22 A;  3VS6 A;  5GAN 4;  3PT9 A;  1PRM C;  1FMV A;  1WHJ A;  4LDY A;  1WNL A;  5GAN 8;  3M9Q A;  3MEU A;  2BTT A;  2RD1 A;  2DXT A;  1SSH A;  2RH2 A;  3NTH A;  2E5Q A;  2NUT B;  1RAE B;  4XTY A;  1VQ6 Q;  4FT4 A;  2V1Q A;  4M7A A;  1IGU A;  1Q82 R;  2EGA A;  5KYY B;  3PIO A;  4ZTJ A;  1M1K U;  2YSQ A;  1U1T A;  2RM4 A;  2QQR A;  5KYX B;  3I35 A;  1PG5 B;  2CYZ B;  4B6M A;  4BY6 B;  1O9S A;  2RK2 A;  4XU2 A;  2A36 A;  2CS7 A;  3LWI A;  4OML A;  1QP3 A;  1WHL A;  4C5I A;  3VS0 A;  3OYY A;  1QWE A;  1M30 A;  1B07 A;  1VQM Q;  2JS2 A;  2D0Q B;  5FU7 B;  1Y96 A;  1WDX A;  1Q81 U;  2QG9 B;  3CCL A;  2HSE B;  3OSV A;  4X34 A;  1YP5 A;  3RMS A;  3CBO A;  1GBQ A;  2DXB A;  3GNG A;  4RTX A;  4Y28 E;  3UT1 A;  2EYZ A;  3H0F A;  1UGP B;  2L8D A;  1ZX6 A;  2L3P A;  4IUT A;  1UTI A;  3ZL7 C;  4PJO A;  2JW4 A;  4F04 B;  4F16 A;  4LXC A;  1MMD A;  2MWP A;  2EJF A;  5GAO m;  4J9B A;  1TSF A;  4UC4 A;  1SKU B;  3UF4 A;  2L3R A;  1ZUY A;  2XDB A;  1ZSZ A;  4V2S A;  1QCF A;  1G8X A;  2FEI A;  2OX7 A;  4A63 B;  3OYD A;  2MAM A;  3DLL A;  1VQ6 T;  2H8H A;  5DY9 A;  4KUD K;  3NTI A;  1JO8 A;  1UGV A;  5CKB A;  3WVD B;  1NLP C;  3CCS Q;  4F14 A;  5FRO A;  2CP6 A;  2V8K A;  3EG0 A;  1V29 B;  2JMA A;  2WSC E;  2HQE A;  1GFD A;  2RHY A;  2NUP B;  2E1H A;  3VUZ A;  2RQV A;  2DFU A;  2J6O A;  1AWW A;  3CCU Q;  3S3N A;  1VQM T;  4M77 A;  1XOV A;  3C12 A;  3L1A A;  4B9W A;  3L2V A;  1G3T A;  1IHW A;  2LX7 A;  2MMP A;  3NTK A;  2Y4X A;  3VS3 A;  2E6N A;  3S6W A;  4C92 D;  4XAX B;  5A0L A;  3JCM V;  1QQJ A;  2DZC A;  2VGN A;  3TSW A;  1ZUU A;  1OI1 A;  1RL2 A;  1W6X A;  1G3S A;  3CC7 A;  3CCV Q;  3G4S A;  2DEU A;  3MHX A;  1GCQ C;  4C92 E;  4C0G A;  3TEE A;  1YWO A;  2E65 A;  4L59 A;  2VVK A;  1WZO A;  2QAS A;  4IUQ A;  1ZBJ A;  3R6O A;  3FEO A;  5IT9 E;  1CKA A;  1KC8 U;  5KYY A;  2GCX A;  3CCS T;  5FLX E;  2KRO A;  3SDZ A;  2P0Q A;  5KYX A;  3L2Q A;  3M56 A;  3LYI A;  5M9O A;  1UG1 A;  1KSW A;  2CUD A;  1PRL C;  1AZG B;  1U5S A;  4M78 G;  2KE9 A;  2IVW A;  1ZQ1 A;  3CCU T;  3OBW A;  2LTO A;  1KK7 A;  3HL8 A;  3VKI A;  2DXU A;  5LJ3 j;  3DB3 A;  3CCL Q;  3ME9 A;  5CCA A;  1OU8 A;  3OS2 A;  5FRM A;  1M9S A;  3GPL A;  4M78 F;  3QWX X;  5CIU A;  3RR6 A;  3CBP A;  2CUB A;  1OYX A;  3JRZ A;  5KYU A;  3URG A;  3CCV T;  3VS5 A;  2B86 A;  1JB0 E;  2KR3 A;  2RI2 A;  2P84 A;  3KBG A;  1M2V A;  1Q7Y U;  1VQK A;  4PFZ A;  2QAZ A;  1G83 A;  4JZ4 A;  2O9S A;  2RQT A;  3M0U A;  1N6A A;  4A53 A;  4HCC A;  4L6V 5;  4N4H A;  1HSQ A;  1HXD A;  4J9I A;  5GJV B;  1IHV A;  4XTU A;  3JCM b;  2E3H A;  3HKS A;  1BIA A;  2DPP B;  1V76 A;  2EYW A;  3A1P A;  4BE2 A;  4N0A C;  3BY7 A;  1WHH A;  1QKW A;  2DIQ A;  2E70 A;  4FYY B;  2Z0W A;  3PNW C;  1F1B B;  2A7Y A;  2RHI A;  2FPD A;  4DOV A;  3M0R A;  1H64 1;  2NUP A;  1LVK A;  1UUE A;  2ZAE A;  2K5I A;  2XI9 A;  2RNA A;  5D7U A;  4JDS A;  2DL5 A;  1H8K A;  4P5N A;  1AWJ A;  4M75 G;  4EIK A;  2C06 A;  1CSK A;  1ZLM A;  4FM4 B;  1X01 A;  2E5K A;  2LCC A;  5IAY A;  4C92 B;  4DEX A;  4M7D A;  4BDY A;  1KHI A;  2A37 A;  2DL4 A;  1YIT Q;  2XMF A;  4M75 F;  3UWN A;  5KCO A;  5HKC A;  1UB4 A;  3SFM A;  2PUO B;  2FRY A;  1VA7 A;  1PWT A;  5IH2 A;  3PTA A;  3SB2 A;  2X4X A;  2XG8 D;  2DBM A;  3P8H A;  5IHK A;  3NMZ C;  1K76 A;  2DRM A;  1YN8 A;  1QW1 A;  4X1V A;  1JXO A;  1N27 A;  1PD0 A;  2QI2 A;  1SF9 A;  2E10 A;  4KH0 B;  2I2L A;  3OMG A;  1K8A C;  4C8Q C;  2MYS A;  3MJX A;  3VUB A;  2X4Y A;  4M7A C;  3JCM c;  2XKO C;  2E4H A;  2QA4 T;  4QVZ A;  2F5T X;  2YUO A;  1XNI A;  4C5H A;  2LC4 A;  3KXT A;  1AD5 A;  1K73 U;  1UGQ B;  2X4W A;  4BB7 A;  2HKN A;  2K5F A;  3F70 A;  1YI2 A;  3OW2 S;  2LDM A;  3M54 A;  4C8Q D;  1BKB A;  4E7J A;  1YIT T;  3OW2 P;  2OTL A;  2MCN A;  1BIB A;  2R58 A;  1TOV A;  1RAD B;  4C8Q E;  2BE9 B;  3G71 A;  1AT1 B;  2KDS A;  4PK4 A;  2H3E B;  3EHR A;  3M59 A;  4OGE A;  3VV0 A;  3HFO A;  5C6S A;  3CCE A;  3RER A;  2IPO B;  1KQ2 A;  5I2S A;  1MHN A;  1HYO A;  5KYW B;  2GBQ A;  1QLY A;  3P8B B;  1VQ8 Q;  2LX9 A;  4IIO A;  4JRQ A;  2H3J A;  4XTX A;  4IKF A;  2KYB A;  2FL7 A;  2ESW A;  4J7I A;  3A5Z B;  2L3Q A;  3CPW S;  4RMO A;  5CQX A;  1ABO A;  2VXE A;  4DBH A;  2RO0 A;  3BFM A;  3VRY A;  2ZPF B;  2XD0 A;  2CP3 A;  2HQH A;  1IRE B;  3CPW P;  5LJ5 j;  4BDZ A;  1K8A R;  1NYF A;  1TUG B;  3EHQ A;  1QCN A;  1VQO Q;  2HQX A;  3CCM Q;  2DD5 A;  4B9X A;  1NJI U;  2DVE A;  3MKD A;  1YJW A;  4JJC A;  2GQV A;  3LX7 A;  1ZA2 B;  4EMG A;  1OX8 A;  1M3A A;  1PKS A;  2VUB A;  5D6Y A;  1B7T A;  3EG1 A;  4IUP A;  4DA4 A;  2CZ7 B;  1JXM A;  5KCH A;  2ZCF B;  4HCK A;  5CKE A;  3LWH A;  1VQ8 T;  1VIE A;  3EH2 A;  1VQP A;  2X3W D;  2DKG A;  4DBR A;  4II1 A;  2D8H A;  1WHK A;  3PMT A;  1UHF A;  3OYG A;  1Y7X A;  2O4X B;  2EWN A;  1VQL A;  2F69 A;  2ECZ A;  3JB9 I;  2EQI A;  3OMC A;  2FVU A;  2EBP A;  3HPW A;  4OMO A;  1BU1 A;  1PSE A;  1Z9Z A;  3OYN A;  5KE2 A;  1YI2 Q;  3OYH A;  1FX7 A;  1RI9 A;  2J7I A;  1MV3 A;  2COW A;  2DL8 A;  2R57 A;  1JBM A;  2K3Y A;  2FZK B;  4E7H A;  1VQO T;  1NPP A;  5GAM e;  1QVF A;  1MMN A;  3CCM T;  3O8V A;  2D1X A;  4WCI A;  2HZY A;  1IXD A;  1X2K A;  1B34 A;  2RF0 A;  2K79 A;  4C8Q B;  2L3S A;  2HSP A;  2OI3 A;  3G71 Q;  4FW2 A;  1ZA1 B;  4XQ3 A;  5FU6 C;  4J9H A;  2IIM A;  2FG0 A;  3VS4 A;  2W10 A;  4DQ2 A;  2ENM A;  3JB9 H;  2VB6 A;  4BI4 A;  5KH6 A;  2EYY A;  4D6W A;  4JS4 A;  3CCE Q;  4EMK A;  2E3I A;  3PIP A;  5GAN h;  1BYM A;  2RB6 A;  5D6X A;  1LNX A;  1VIF A;  2CZ6 B;  5D6W A;  3V7R A;  1Q82 C;  1B3Q A;  3FJ5 A;  2AIR B;  2HBW A;  3QZ9 B;  1RAI B;  2MOX A;  4XU3 A;  4OB0 B;  4OB3 B;  1K9M C;  4M7A G;  3PMI A;  3JCM e;  1R77 A;  4IUV A;  4MZT A;  4OB1 B;  2OTJ Q;  3NHN A;  2A08 A;  2PZ1 A;  4KBM B;  1OQK A;  2JMC A;  1JU5 C;  4M7A F;  3O5Z A;  4BI3 A;  4RKU E;  1UE9 A;  1NLO C;  4AT1 B;  3J80 E;  4LN2 A;  2V26 A;  4RTY A;  2XID A;  3OYI A;  1WX6 A;  2CGH A;  1VQ4 Q;  5IN1 A;  1WFW A;  1ZHI A;  2EGE A;  2DO3 A;  2LMJ A;  1I4K 1;  2RHU A;  4E6R A;  4MML A;  3MET A;  4PJO G;  2L89 A;  4XTZ A;  1WI7 A;  3CC2 A;  1RLP C;  2FHD A;  2DAQ A;  2SEM A;  4K11 A;  3I55 Q;  1D1B A;  4Y92 A;  4IUU A;  4M78 D;  4HXJ A;  1OEB A;  3M57 A;  2LT1 A;  4PJO F;  1TWB A;  1IO6 A;  3SWN B;  1VQL Q;  2KBT A;  3HRS A;  1RLQ C;  5ECA A;  3SHW A;  3NGP A;  2OTJ T;  2LVM A;  4M78 E;  1I8F A;  4KGZ B;  1SRL A;  2GFA A;  2LQW A;  1D1C A;  2XU8 A;  4PJJ A;  2K9G A;  2DBK A;  3I56 T;  2OAU A;  2VV5 A;  2RI3 A;  1I5L A;  1K9M R;  3CXC S;  2DYB A;  5GMK e;  4AFZ C;  4J8O A;  4JPB W;  4N4I A;  4ZNX A;  2E41 A;  1VYT A;  3CXC P;  2DER A;  2EAY A;  1VQ4 T;  1GCP A;  1LOJ A;  2XDP A;  2YLC A;  5GJW B;  1JQQ A;  1BI1 A;  4HA8 A;  1VQ5 Q;  5GAM f;  1VQN A;  1S1N A;  1YJ9 A;  3L2U A;  4M75 C;  1BK2 A;  2EJ9 A;  2SRC A;  3I55 T;  2DL3 A;  3EG9 B;  3H0H A;  1LJO A;  3OYA A;  2ZPG B;  4FYW B;  3CCQ Q;  2CSQ A;  2HKQ B;  1N8R R;  4R56 A;  2CDT A;  2D6F A;  4FSX A;  3QJ6 A;  4ZGD B;  1VQL T;  4FL6 A;  3E9F A;  3RDV A;  1H3Z A;  2AZV A;  2QEX A;  4M75 D;  4CC3 A;  2RA2 A;  4BI8 B;  2VKN A;  3TSZ A;  2JVV A;  2PTK A;  2EFI A;  5FWB A;  2WSF E;  3BDL A;  3ZBD A;  4J9G A;  2ED0 A;  3H9N A;  2DTH A;  3UDC A;  4AG1 C;  1A0N B;  2PUK B;  3QDR B;  4M75 E;  3JCM f;  4X9C A;  3PGG A;  2FO0 A;  1NM7 A;  4RCB A;  2RN8 A;  4EMH A;  5GAM d;  1W4S A;  2JM8 A;  4F7U A;  3LH5 A;  3VYG A;  2RJF A;  3THK A;  4LD6 A;  3S3M A;  5GAM g;  9ATC B;  1ZUK A;  4LNP A;  1YHQ A;  1VQ5 T;  1IZ6 A;  4DEY A;  1O75 A;  4A4E A;  1BI3 A;  3OY9 A;  3CC2 Q;  2KRS A;  1X75 C;  1Z9Q A;  2QGG A;  2DIL A;  4PL6 A;  4Z8A A;  1RAF B;  2AK5 A;  4A4G A;  5GAO q;  2LRQ A;  3QYH B;  4PJN A;  3CCQ T;  3CPF A;  5LL6 S;  3C94 A;  5EG2 A;  3FIF A;  1WXB A;  3SWN A;  1FXX A;  3L2R A;  4M78 B;  1OX9 A;  2O31 A;  3ULR B;  1MUZ A;  2JZ2 A;  3RIR A;  5HK3 A;  1YWP A;  1K8A U;  2NUT A;  2COZ A;  3JCM d;  3A8O B;  5CVI A;  4D8D A;  4J9D A;  2GFU A;  3JCM Q;  4O6J A;  4Z88 A;  3JCM g;  3EGX B;  1NG2 A;  3REA B;  3GOX A;  2ZPI B;  2GTO A;  5IXF A;  2RK1 A;  2KGT A;  1X69 A;  1WQ7 A;  1Q86 R;  1D0Y A;  1BI0 A;  1EX4 A;  1PKT A;  3S3O A;  1YJ9 Q;  2KAF A;  4M7D G;  5LJ5 f;  2EJG A;  4PFP A;  2YXY A;  3EAE A;  4ANJ A;  1D0Z A;  1X27 A;  1YJN A;  2AKK A;  4PFO A;  1DJ7 B;  2M1H A;  1AWO A;  5GAN 2;  1E6G A;  2ZPB B;  5L23 A;  2PNI A;  1OOT A;  4M7D F;  3EGD B;  4KH1 B;  1QVG S;  2CSI A;  4XU0 A;  2LNH B;  2XHC A;  1M1K C;  5J26 A;  4HVU A;  1FMW A;  2VC8 A;  4KRT A;  1TU0 B;  4EPC A;  2EKO A;  1QVG P;  4JS5 A;  3CD6 A;  3C4S A;  4LDV A;  1CKB A;  1WXT A;  3H6Z A;  3X28 B;  4EMK C;  1V1C A;  3TQ7 P;  1BCM A;  1KD1 U;  2ED1 A;  4OVA A;  4E2F B;  2HCK A;  2X51 A;  2ZPH B;  2K5L A;  4CC4 B;  1WA7 A;  2VGM A;  2VWF A;  3PE0 A;  3QO3 A;  2JTF A;  2YT6 A;  2K3X A;  3E9G A;  1ARK A;  1Q81 C;  1N9S A;  1M2O A;  3VRZ A;  5LJ5 d;  1MGQ A;  2FRW A;  4NL2 A;  3HHT B;  3QKJ A;  5GAN j;  2RJE A;  1SPK A;  1ZBX A;  2CRE A;  3TU4 K;  3RES A;  1YHQ Q;  1PSF A;  3H41 A;  1PCX A;  2KVQ G;  3WXM B;  3CCL T;  2J6F A;  1HJD A;  5LJ5 g;  3T9N A;  2PVG B;  3Q1J A;  1X6G A;  4WTO B;  1MMG A;  1AVZ C;  1RAB B;  3UAT A;  2G3R A;  2GNC A;  4JLG A;  3CCJ A;  1C1A A;  3CC7 Q;  3LLR A;  3QG1 A;  1M90 U;  2DEQ A;  1NBE B;  2V8I A;  3PFS A;  4DOW A;  3G4S Q;  1RAA B;  3MEA A;  1M27 C;  3MEV A;  3CCR A;  3MEW A;  1Y0M A;  1UFF A;  3SEM A;  4R0K A;  3X26 B;  2CKK A;  3RUX A;  2EQM A;  4J5Y A;  2M02 A;  2RJD A;  1T3L A;  1KQS S;  1W70 A;  1R8O B;  3GF5 A;  3JB9 J;  2O88 A;  1VYU A;  3X20 B;  3ZFJ A;  1M3B A;  2J6K A;  1KQS P;  4MZP A;  2ABL A;  2QQ9 A;  3MP1 A;  1S72 A;  2GTJ A;  1JJ2 S;  3M4G A;  1KJW A;  2DK3 A;  4BD3 A;  5AYF A;  2J05 A;  1NZ9 A;  5GAN 3;  2YHT A;  1AEY A;  4IIM A;  1JJ2 P;  1M1K R;  1OZ3 A;  4RG2 A;  4R55 A;  2QGF B;  4ELZ C;  4XTV A;  3GP8 A;  3HTR A;  3MO8 A;  5CKD A;  4FIB A;  3H0I A;  1K9A A;  2DX1 A;  4OMQ A;  3TRE A;  3SD4 A;  6AT1 B;  1WHG A;  4NOY A;  1WHM A;  3GLX A;  2YRD A;  2K3B A;  1SRM A;  3M5A A;  1X43 A;  2R5A A;  3CC7 T;  1Q81 R;  1FWZ A;  4FW1 A;  2GF7 A;  3G4S T;  1HD3 A;  2W0Z A;  2JJ9 A;  1SHF A;  1VQK Q;  4C0D C;  1Q95 G;  3JSC A;  2EGC A;  4M7A D;  4JJD A;  3EGD A;  1QCO A;  4PJM A;  2P0K A;  1Q82 U;  1KC8 C;  2O2O A;  3QYG B;  1I0C A;  2D9T A;  3QWY A;  4PKC C;  4J9E A;  2KI7 A;  2LCL A;  3CMA A;  3D7S B;  4E7L A;  4M7A E;  1X2Q A;  3KUF A;  3CME A;  4PJO C;  1KIK A;  3L42 A;  3RBB B;  1VQ9 A;  3OYJ A;  4KUI A;  1RI0 A;  2R5M A;  2DLP A;  3CBM A;  2F2W A;  1ZSZ C;  2JOY A;  2BZX A;  4E7I A;  3JB9 G;  1VQ7 A;  4ATO A;  2KXD A;  4XU1 A;  4AFQ C;  1W2B S;  4PJO D;  1BCO A;  2M0O A;  3OW2 A;  1VOM A;  2COY A;  1Y07 A;  5LJ3 e;  1Q7Y C;  3JB9 F;  1W2B P;  3CCJ Q;  1IB8 A;  1TXQ A;  1YCY A;  2CT3 A;  4PJO E; 
#chains in the Genus database with same CATH homology
 2EYX A;  1GFD A;  1N5Z A;  1UE9 A;  2RQV A;  1LCK A;  1NLO C;  1SHG A;  1I07 A;  4LN2 A;  2J6O A;  1AWW A;  4RTY A;  2YDL A;  2GQI A;  4CC7 A;  1XOV A;  1WX6 A;  2LX7 A;  1WFW A;  2EGE A;  2M51 A;  2LMJ A;  2C0I A;  3VS3 A;  4E6R A;  2FPF A;  1GBR A;  3TSW A;  1QKX A;  1ZUU A;  3VS1 A;  1W6X A;  1WI7 A;  2AKL A;  1RLP C;  3PVL A;  2KRN A;  2SEM A;  4K11 A;  4Y92 A;  1UHC A;  1GCQ C;  1ABQ A;  1OEB A;  2I0N A;  4HXJ A;  2OJ2 A;  2L2P A;  4ORZ A;  1IO6 A;  1OV3 A;  1YWO A;  4J9C A;  2JS0 A;  5IHN A;  3I9Q A;  2J06 A;  2KBT A;  2VVK A;  5IHI A;  1RLQ C;  4JZ3 A;  5ECA A;  3NGP A;  3SHW A;  3M0Q A;  1UJY A;  2X3X D;  1SRL A;  1ZBJ A;  2LQW A;  4ESR A;  2KRM A;  1CKA A;  2K9G A;  2DA9 A;  2DBK A;  4HVW A;  2KRO A;  3UA7 A;  1UG1 A;  2DVJ A;  2NUZ A;  1KSW A;  2DJQ A;  2CUD A;  1PRL C;  2KEA A;  1AZG B;  1U5S A;  2DYB A;  1NEG A;  4AFZ C;  2M0Y A;  4JPB W;  2KE9 A;  4Z89 A;  4ZNX A;  1GL5 A;  1VYT A;  4LUD A;  1WIE A;  3R6N A;  1WXU A;  2HDA A;  1GCP A;  4LUE A;  3TVT A;  3U23 A;  5GJW B;  1JQQ A;  1WYX A;  4GBQ A;  2EW3 A;  3QWX X;  1PHT A;  1U06 A;  4AG2 C;  1S1N A;  2CUB A;  1BK2 A;  4LE9 A;  3VS5 A;  2B86 A;  3CQT A;  2KR3 A;  2SRC A;  2DL3 A;  3H0H A;  2G6F X;  2V1R A;  2CH4 W;  2DL7 A;  2CSQ A;  2LP5 A;  2CDT A;  1G83 A;  5FWC A;  4JZ4 A;  2O9S A;  1UDL A;  2RQT A;  1OPL A;  3M0U A;  2JM9 A;  2MIO A;  2AZV A;  1HSQ A;  4J9I A;  5GJV B;  2C0O A;  4CC3 A;  1MV0 B;  2VKN A;  3TSZ A;  4OMM A;  2EYW A;  1Y57 A;  2PTK A;  5FWB A;  4J9G A;  2ED0 A;  1QKW A;  2LJ3 A;  4RUG A;  4AG1 C;  1A0N B;  2FPD A;  3M0R A;  4FSS A;  5IXB A;  2FO0 A;  2DM1 A;  2YUP A;  1NM7 A;  2RN8 A;  1UUE A;  1NEB A;  2F2X A;  2JM8 A;  3LH5 A;  1AOJ A;  2RNA A;  1TUC A;  3THK A;  2JT4 A;  2K7A A;  1K0S A;  3JV3 A;  1ZUK A;  4LNP A;  2DL5 A;  1H8K A;  1I1J A;  1AWJ A;  4JJB A;  2RQU A;  4DEY A;  4EIK A;  1CSK A;  1ZLM A;  4AFU C;  2L0A A;  2GGR A;  3IQL A;  2KRS A;  2E5K A;  1Z9Q A;  2DIL A;  4Z8A A;  2AK5 A;  4DEX A;  3NPF A;  4GLM A;  2A37 A;  1W1F A;  1VYV A;  2KYM A;  2DL4 A;  2JTE A;  2XMF A;  4RTT A;  3A98 A;  3M0T A;  2DF6 A;  2AZS A;  1WXB A;  4RTV A;  2FRY A;  1GCQ A;  1WLP B;  2DMO A;  1VA7 A;  2O31 A;  3ULR B;  1MUZ A;  2K6D A;  1PWT A;  3I5R A;  1YWP A;  5IH2 A;  4HVV A;  5EC7 A;  4AFS C;  1H3H A;  4D8D A;  1SEM A;  2D0N A;  2DBM A;  4J9D A;  5IHK A;  4Z88 A;  3NMZ C;  1K76 A;  1NG2 A;  2DRM A;  1K4U S;  1YN8 A;  3REA B;  4X1V A;  1JXO A;  2P4R A;  1TUD A;  2KT8 A;  2GTO A;  2RQW A;  5IXF A;  2CH4 A;  2KGT A;  1YNZ A;  1X69 A;  1GFC A;  4RTZ A;  2YUO A;  1PKT A;  2O9V A;  3M0P A;  1AD5 A;  3KFV A;  4RTU A;  1X27 A;  2AKK A;  2CT4 A;  3EG3 A;  1T3S A;  1AWO A;  1BB9 A;  2C0T A;  1E6G A;  2NWM A;  5L23 A;  2PNI A;  1OOT A;  2MCN A;  2CSI A;  1AWX A;  3M0S A;  1BBZ A;  1PNJ A;  2LNH B;  1JEG A;  3EGU A;  4CC2 A;  4HVU A;  4KRT A;  1EFN A;  2DRK A;  2DNU A;  2EVR A;  1CKB A;  1WXT A;  1V1C A;  3EHR A;  2KXC A;  1OPK A;  2ED1 A;  2ROT A;  2HCK A;  2JXB A;  2OAW A;  5HCK A;  1X6B A;  4CC4 B;  1WA7 A;  1J3T A;  2VWF A;  3PE0 A;  1NYG A;  2GBQ A;  1QLY A;  1YCS B;  1M3C A;  2YT6 A;  1QWF A;  1ARK A;  3VRZ A;  4IIO A;  2LQN A;  2FRW A;  2KNB B;  3EG2 A;  1GRI A;  1T0J A;  1SPK A;  2CRE A;  2KYB A;  1U3O A;  2DE0 X;  2ESW A;  4D8K A;  2RPN A;  3H41 A;  2L3Q A;  2J6F A;  1HJD A;  2YUQ A;  2LJ0 A;  1ABO A;  3C0C A;  1X6G A;  2KT1 A;  1AZE A;  4M4Z A;  3VRY A;  3VS7 A;  1AVZ C;  2FPE A;  3UAT A;  2GNC A;  2ROL A;  1NYF A;  3EHQ A;  2RQR A;  1M27 C;  1Y0M A;  2BZ8 A;  2D8J A;  1UFF A;  3SEM A;  4R0K A;  2LZ6 B;  1T3L A;  2EKH A;  1W70 A;  2O88 A;  1VYU A;  1H92 A;  3PVQ A;  1T0H A;  1M3B A;  2J6K A;  4JJC A;  1E7O A;  2ABL A;  1M3A A;  2F2V A;  1PKS A;  2BZY A;  5FW9 A;  4J9F A;  2GTJ A;  3EG1 A;  2K2M A;  1KJW A;  2LJ1 A;  5I22 A;  3VS6 A;  1JXM A;  2J05 A;  1RUW A;  2RMO A;  1PRM C;  4HCK A;  1AEY A;  4IIM A;  2BTT A;  2X3W D;  1FMK A;  1K1Z A;  1SSH A;  2D8H A;  4OMN A;  1UHF A;  2ECZ A;  3GBQ A;  2EQI A;  1K9A A;  3H0I A;  2DX1 A;  2EBP A;  4OMQ A;  4OMO A;  2V1Q A;  1BU1 A;  4F17 A;  1Z9Z A;  2EGA A;  2K3B A;  1SRM A;  1K0X A;  1X43 A;  2YUN A;  1RI9 A;  2YSQ A;  2J7I A;  3I35 A;  1MV3 A;  2DL8 A;  1HD3 A;  2W0Z A;  2A36 A;  1FYN A;  4QT7 A;  2LCS A;  1SHF A;  4OML A;  2EGC A;  3VS0 A;  2D1X A;  1QWE A;  4WCI A;  4JJD A;  1X2K A;  2EPD A;  2RF0 A;  2K79 A;  2A28 A;  1M30 A;  2HSP A;  2L3S A;  2O2O A;  1B07 A;  1I0C A;  2OI3 A;  3QWY A;  4OMP A;  2HEQ A;  4J9E A;  2JS2 A;  4J9H A;  1WDX A;  2FG0 A;  2IIM A;  3VS4 A;  2W10 A;  1KFZ A;  2ENM A;  1YP5 A;  2QDL A;  1GBQ A;  1X2Q A;  2EYY A;  4RTX A;  2EYZ A;  3H0F A;  1KIK A;  3RBB B;  1ZX6 A;  2L3P A;  1UTI A;  3ZL7 C;  2JW4 A;  4F16 A;  3UA6 A;  2DLP A;  2F2W A;  4J9B A;  1B3Q A;  3FJ5 A;  2HBW A;  3UF4 A;  1G2B A;  1UJ0 A;  1ZUY A;  2MOX A;  2BZX A;  1E6H A;  1QCF A;  2FEI A;  4A63 B;  2KXD A;  1ZSG A;  2H8H A;  3VS2 A;  4AFQ C;  3RNJ A;  3NHN A;  2A08 A;  1JO8 A;  1UGV A;  5I11 A;  1TG0 A;  2PZ1 A;  1UEC A;  3REB B;  1NLP C;  4F14 A;  3I5S A;  2JMC A;  1JU5 C;  1M8M A;  3O5Z A;  3EG0 A;  2CT3 A;  4RTW A;  2JMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...