4JJCA

Crystal structure of the abl-sh3 domain at ph5
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structure of the Abl-SH3 domain at pH5
rcsb
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jjcA00
2ED0A 1E7OA 1RLQC 1SHGA 4J9BA 1CSKA 2EYZA 5FWCA 4HVWA 3I9QA 4J9CA 2G6FX 2RQUA 4OMLA 4ZNXA 2DJQA 2AK5A 2FRYA 2PNIA 2YDLA 2JXBA 3SHWA 1YNZA 2LNHB 1T3LA 1WI7A 3IQLA 2HEQA 1Y0MA 1M3AA 2C0IA 3NHNA 4AFQC 2KT8A 4KRTA 1K9AA 4OMNA 5IXFA 1UHCA 2ED1A 1X2KA 4OMPA 2W0ZA 2DL3A 1I0CA 2DBMA 3THKA 2CH4A 4A63B 3CQTA 4JJCA 4LUDA 2RQVA 2HCKA 1U06A 1AZEA 5FWBA 1QKXA 4RTVA 1YWOA 2ESWA 2J7IA 4IIMA 1X27A 4LE9A 2K7AA 2SRCA 2SEMA 3TVTA 5GJWB 1RI9A 1AWJA 1B07A 4RUGA 1BBZA 2EBPA 2O9SA 3NGPA 4FSSA 2KRSA 2CSIA 2AKLA 2HBWA 1K76A 1YN8A 2FPFA 4CC3A 1UJYA 3EG1A 1X69A 4JZ4A 1ZLMA 1VYUA 2CREA 2KE9A 2EPDA 1JXOA 3UATA 3H0HA 2DL5A 3ULRB 2JT4A 4ORZA 1KJWA 1JEGA 1PKSA 4Y92A 2DX1A 2ENMA 2YUOA 1WXBA 1ZUKA 2J06A 2VVKA 2DILA 4OMQA 1YCSB 3EG3A 2AZVA 2X3WD 3NPFA 2RN8A 1CKBA 4AFSC 3VS6A 4R0KA 1NLOC 4RTYA 1ZUYA 2HSPA 3EG2A 2FRWA 3EHQA 2J6OA 1GBQA 2RMOA 2CT3A 5I22A 1OOTA 2EYWA 2KBTA 2NUZA 4J9FA 2EKHA 3JV3A 2I0NA 3RNJA 1RLPC 2LJ1A 1GCQC 2GBQA 4RTZA 1K4US 1YWPA 2KXDA 2DRKA 1U3OA 1KFZA 1W6XA 3NMZC 2KEAA 1X43A 2OJ2A 1ZBJA 2VKNA 1QKWA 2IIMA 4Z89A 2L3QA 3VS7A 1OV3A 2OI3A 2RQRA 4RTWA 4X1VA 1NM7A 2DE0X 3ZL7C 3VS5A 1K1ZA 1KSWA 4LNPA 1UG1A 2EYYA 2FG0A 1AWWA 1JU5C 5ECAA 3C0CA 2FPEA 2KNBB 1UFFA 4ESRA 1WDXA 2DRMA 1HJDA 2F2XA 1W1FA 1MUZA 2E5KA 4J9DA 2EW3A 2KXCA 2XMFA 2RQTA 4AFUC 4JJBA 2A08A 1PNJA 1UJ0A 1NYFA 2L3SA 1ABOA 1GCPA 2GTJA 1HSQA 2JTEA 2DA9A 1GRIA 2ECZA 1K0XA 1T0HA 3RBBB 5IXBA 1MV0B 1FMKA 2CH4W 1TG0A 1Y57A 1ZX6A 2CDTA 1OEBA 3VS3A 2A36A 3H0IA 1PHTA 3KFVA 2LQNA 1WYXA 1Z9ZA 1SHFA 1PRMC 2YT6A 1VA7A 2DYBA 3M0SA 4HVVA 2ROTA 2CUBA 2KR3A 2DLPA 3VS1A 3FJ5A 3TSZA 1UECA 1QWEA 2RNAA 5IH2A 1UHFA 4GBQA 5IHNA 5GJVB 2LQWA 2EVRA 3REAB 3VRYA 1GFCA 5L23A 1E6GA 1SSHA 3H41A 5IHKA 3U23A 1AD5A 2JW4A 3SEMA 2RPNA 4AG1C 2KYBA 2EYXA 2D1XA 1ARKA 3M0QA 1GBRA 1FYNA 1M3BA 3GBQA 2C0OA 3VS2A 5EC7A 2EGCA 1H3HA 2JS2A 1XOVA 1UDLA 1JXMA 1PRLC 2GNCA 4F14A 2LCSA 2V1QA 1WA7A 2RF0A 2X3XD 1MV3A 1I07A 1ABQA 1BB9A 1JQQA 2ROLA 1UE9A 1KIKA 1S1NA 1X6BA 3LH5A 2JM9A 2V1RA 1VYTA 1J3TA 2QDLA 2EGEA 2J05A 2P4RA 3M0TA 4GLMA 1OPKA 2AZSA 2YUPA 1G2BA 4DEYA 4CC2A 1TUCA 1NEBA 3H0FA 1BK2A 2H8HA 4HVUA 2K6DA 1SRMA 1WX6A 1SRLA 4E6RA 1T0JA 2DBKA 4J9IA 2EQIA 1WFWA 4JZ3A 2D8HA 1PKTA 1UTIA 4AG2C 4D8KA 4CC4B 2DL8A 2VWFA 2GGRA 1K0SA 2AKKA 1WXUA 1W70A 1GL5A 5IHIA 3M0RA 2M0YA 2PZ1A 3TSWA 1IO6A 4OMMA 5HCKA 1H92A 2M51A 1V1CA 4OMOA 1GFDA 2DNUA 1M8MA 2K79A 2DMOA 2J6FA 2EGAA 1U5SA 1AWOA 3VRZA 2A37A 2BZXA 1H8KA 3PE0A 3QWXX 2KROA 2O2OA 4F17A 2KYMA 4LN2A 1RUWA 3UA6A 1VYVA 1AEYA 2KRNA 2PTKA 2A28A 4J9EA 1Z9QA 4Z8AA 4D8DA 1OPLA 2HDAA 1X6GA 3M0UA 4J9HA 1YP5A 2GQIA 2F2WA 4HXJA 4Z88A 3I5RA 1ZUUA 1M27C 2ABLA 2DL7A 3PVLA 1EFNA 1X2QA 1B3QA 2FEIA 1AVZC 1WLPB 2K3BA 3O5ZA 2JM8A 1NEGA 2CUDA 1JO8A 2YUNA 5FW9A 4M4ZA 2MIOA 1PWTA 2BZYA 3I35A 1GCQA 4QT7A 1WXTA 1HD3A 4CC7A 3EG0A 4RTXA 2JMAA 2LMJA 3VS0A 2KRMA 4RTUA 2OAWA 2MOXA 5I11A 2FO0A 4F16A 2MCNA 3I5SA 2KT1A 2F2VA 4JJDA 2JS0A 4K11A 1SEMA 3QWYA 3M0PA 2BZ8A 1AWXA 1QLYA 4HCKA 1WIEA 2RQWA 3UF4A 2LP5A 4RTTA 3VS4A 1ZSGA 1A0NB 2W10A 1NG2A 1CKAA 1UGVA 2O88A 2C0TA 2DM1A 2BTTA 2CT4A 2LJ0A 1QCFA 2YSQA 1G83A 4J9GA 2L3PA 1T3SA 2YUQA 3PVQA 1AZGB 1NLPC 2LX7A 2KGTA 2L0AA 2CSQA 4IIOA 1AOJA 2O9VA 2O31A 2DF6A 4WCIA 2JMCA 1SPKA 4EIKA 2NWMA 3R6NA 1QWFA 1E6HA 2D8JA 2K9GA 2DVJA 2B86A 2DL4A 4AFZC 1M3CA 2LZ6B 1M30A 2FPDA 2D0NA 3EHRA 4LUEA 3EGUA 1N5ZA 2GTOA 1TUDA 2LJ3A 1NYGA 3A98A 1BU1A 2J6KA 3REBB 4JPBW 2L2PA 4DEXA 2K2MA 1LCKA 3UA7A 1I1JA 1UUEA
chains in the Genus database with same CATH superfamily
1CSKA 4E7LA 4HCBA 5CCAA 1IHVA 3DB3A 4J9CA 4JRIA 1K9MR 2XDDA 4Y91A 4OB1B 1JRIA 2FRYA 4QQDA 2PNIA 1YI2T 3CCLA 2YDLA 4E2FB 5A0DA 1B34A 1IXDA 3H9NA 1QVFS 2OTJT 3G71Q 3E9GA 1UHCA 3L2WA 1YITQ 5CVIA 1VQ4A 4EDUA 3KUFA 1OQKA 1I0CA 2DBMA 4XU0A 4A63B 3CQTA 4QKUA 4OB3B 4C0DC 2K2VA 3CCUT 1U06A 2KQWA 4M77B 1AZEA 1M2VB 1WHMA 4R56A 2ZPHB 4JS5A 1QKXA 4CRIA 5KE2A 3L2RA 4LDWA 1VQLQ 2KDSA 4HA8A 1YJWT 1Q7YC 1B07A 1IHWA 2EBPA 4HCZA 1K8AU 4J7FA 3MHXA 2CSIA 1K76A 4WF2A 1YN8A 2FPFA 5M9OA 2MF2A 1UJYA 3SWNC 4C8QC 1VYUA 3L1AA 5KYWA 4L59A 1UB4A 4N4GA 2K5LA 3H6ZA 2EQUA 3JCMV 2KK4A 2EQJA 4C92B 4ORZA 1K8AR 1PKSA 4MMKA 2E65A 1ZUKA 2XD0A 3EG3A 3ZFJA 3HPWA 1Q82U 2RN8A 2KMTA 5GAMj 3J80E 1MNEA 2HSPA 5CAIA 1KD1R 2RMOA 3OYLA 1HK9A 5GANd 3EGXA 2EYWA 4A4KA 2KBTA 4C0DB 4J83A 2QEXT 5IT9E 4PLIA 2QQBA 2VKNA 1MMGA 2XU8A 5A0GA 1Q81R 3L2QA 2MAMA 5KYXA 3X28B 2RHXA 1O9SA 4ME7A 3RIRA 3C0CA 2O01E 2HQEA 1UFFA 1X01A 2CP0A 2EKOA 3BDUA 4ESRA 2H3JA 1WDXA 3OY9A 1HJDA 4N4HA 4DBFA 3CBMA 2E5KA 4J9DA 4BE2A 2ZPBB 3WVDB 5A2QE 4PJLA 5FU6C 3MP8A 2A08A 1PNJA 4C8QG 1ABOA 2FB7A 2E1HA 3OYCA 1TSFA 1M1FA 5CQYA 2NUTA 2HNIA 3TCJA 1PSEA 3JRZA 1T0HA 1TOVA 3RBBB 3X26B 2CH4W 1Y57A 1VQ6Q 3OYAA 1OULA 5GANg 3VS3A 1VQ9Q 4A53A 3RR6A 3CCUA 3KFVA 4QQGA 3OB9A 4JRPA 2RH2A 1SHFA 4L6V5 4XTXA 4R55A 5FU7C 2ROTA 4XTZA 2CUBA 3FJ5A 4A4HA 1K73R 2QGFB 1UECA 1YCYA 2RNAA 1NJIU 1RI0A 3VRYA 4PNOA 4PJOE 1UGSB 4JRQA 1SSHA 2Z0WA 1AHJB 3U23A 1BCOA 4AG1C 1RADB 1TXQA 2LT4A 1VQMT 3T9NA 1Q7YR 3GF5A 2QAZA 2ZGWA 2OAUA 2C0OA 1H3HA 1N8RR 2GNCA 1M1KR 3C12A 4NL3A 3URGA 3LWIA 4E7IA 1X6BA 5GAOn 2KAFA 2JM9A 2V1RA 2RJCA 2WACA 4BE0A 1YHQT 2JZ2A 2EGEA 2J05A 4GLMA 2YUPA 1G2BA 3MO8A 1VQ7T 4CC2A 4M75F 2H8HA 2DFUA 4N0AA 4HVUA 2FVUA 4OP0A 5GANe 2FYKA 3F70A 2EQIA 3JCMh 2D8HA 2VXFA 2QQRA 4C92G 5HY6A 4XU1A 3CEYA 1WXUA 2BKDN 1LOJA 1GL5A 2MI6A 5FU7B 3M0RA 1YITA 5DLOA 3CMAT 4M78C 2A7YA 5HCKA 1H92A 1NPRA 1S72T 2EGAA 1U5SA 2E10A 2A37A 1HXDA 2E6NA 4OB2B 3PE0A 4RCBA 3M5AA 2JUFA 2O2OA 1D1CA 4M75B 4Z02A 1YJNT 3LLRA 5GMKj 1U1TA 2C06A 1AEYA 2MYSA 3EFOA 1G3SA 5GAOq 4OB0B 3JCMf 4Z8AA 3I56T 1N8RU 4D8DA 2NUPB 2HDAA 2LQ8A 1X6GA 3FLGA 4PJMA 1YP5A 4XU2A 1ZUUA 1YHQQ 2DL7A 1NE8A 3A8GB 4PJOD 1ZSZC 3MEWA 4DBHA 3JB9D 3HRTA 2X4JA 4M7DA 4N0AC 5KYYA 4CI0C 3GNFB 2F69A 3JCMQ 3EG9A 3SD4A 1GCQA 1WXTA 3EG0A 2JMAA 3VS0A 4RTUA 4M75C 5GAOp 1Q81U 3AHUA 2FO0A 2EJ9A 3I5SA 2KT1A 4JJDA 2JS0A 2MMPA 4E7SA 1SEMA 3M0PA 2BZ8A 1WIEA 2RM4A 4Q5WA 2LP5A 3EG9B 2AHJB 2VGNA 4QVZA 5CK9A 5LJ3e 1NG2A 3VKIA 2O88A 1VQ8T 2DM1A 2BTTA 4LXCA 4J9GA 1WJSA 1T3SA 3OBYA 4X34A 3C4SA 4MZMA 1VQLA 1AZGB 4M7DD 2ZPGB 3S6WA 2CSQA 4IIOA 1YJ9A 4ZGJB 1M9SA 3CCRA 3JCMd 4M7AA 4A54A 2DVJA 3CC7Q 3CPFA 3CCET 4JJNK 2DXCA 2FZKB 3RERA 3RESA 1ZSZB 1MGQA 4M78E 4J6WA 3EHRA 3S3OA 3A98A 1RAAB 4EMKA 5HKCA 4JPBW 3TEEA 4C8QE 4EMHA 4F7UG 2DJZA 2ED0A 1E7OA 1RLQC 4J9BA 1Q86C 3A1PA 3CC2T 3CC4T 2COWA 1OU9A 2G6FX 4JRKA 2E64A 2EJGA 3G6EQ 2E3HA 2LVMA 4XTVA 4EMKB 4OMLA 3EGXB 3A8HB 2AK5A 4LD9K 3G4SQ 4M75G 1MMDA 3SHWA 1IZ6A 1YNZA 2LNHB 3LW5E 1N9RA 1R8OB 2GQVA 1WI7A 3IQLA 2HEQA 4AFQC 3NHNA 2F5KA 4JDSA 4KRTA 1QCOA 4OMNA 2DKGA 3FJPA 1W4SA 4BD3A 2DL3A 5GANh 3CPWP 3THKA 2GCXA 4JLIA 3G6ET 3HFOA 2CH4A 3MCAB 3A5ZB 3CBPA 3PIPA 1OX8A 3Q1JA 3RKXA 5GAMd 2HCKA 3QJ6A 3V7CA 4M77A 5FWBA 1NJIR 4E47A 3OBWA 1Q82R 4KULA 1H641 3CCEA 2J7IA 4AMCA 2LTOA 4ELZC 4LE9A 2FL7A 4PKCC 1IREB 1WGSA 3QIIA 1K9MU 4F04B 4GY5A 1PM3A 4RUGA 3CXCS 1BBZA 3NGPA 5KCOA 5DM7R 2HBWA 4QW2A 3EFSA 1TTHB 4CC3A 1X69A 4JZ4A 1VOMA 1QW1A 3M4YA 5GAN7 1VQLT 1M90U 3UATA 2M9UA 2P0QA 2PVOB 2RHYA 2JT4A 4RG2A 3NTKA 2FZCB 5GAOr 4O5VA 3CD6Q 3SWNA 4Y92A 1K8AC 2DX1A 2ENMA 3GNGA 2DETA 5J3BA 3FC3A 3P8HA 2K57A 5IAYA 4FW1A 4C0FA 3VV0A 3NPFA 3HSBA 3EAEA 1ZBXA 3VS6A 2QQ9A 4R0KA 4RTYA 1KC8U 1WNLA 4II1A 2NUTB 3EG2A 3EFOB 5LL6S 2K5IA 3CBOA 2J6OA 1GBQA 1Y7XA 3OS0A 5FU6B 3FDRA 1U1SA 1W2BA 5KYXB 2I0NA 1NBEB 1GCQC 4C92E 2DTIA 4RTZA 3ME9A 1K4US 2F1LA 2XDPA 4LD6A 3H8ZA 2DRKA 2F5TX 4KUIA 1ZA2B 4PFOA 5CQXA 2IIMA 1OZ3A 2L3QA 4ZN1A 5GAN4 1B7TA 1IGUA 2WSCE 2OI3A 4BI4A 2DO3A 2LQKA 2NYSA 2CGHA 4RTWA 4X1VA 2IPOB 2DE0X 3GOXA 1K1ZA 1KD1U 3BW1A 1VQPQ 3RKYA 1D09B 1HYOA 1BI0A 3JB9J 2QG9B 3ASKA 4J6XA 3M56A 3CCJA 2ZCFB 2KVQG 2KXCA 3S3MA 2RQTA 4AFUC 4JJBA 1DJ7B 1VQPA 1NYFA 1GCPA 4J6YA 2L89A 1S72Q 4KUDK 2BE9B 2K3YA 3ZEHA 5IXBA 1MV0B 5GAN3 3UWNA 1RAHB 1TG0A 1QVGS 1YITT 4P5NA 3LWHA 3E1SA 1SKUB 5GAMe 3TQ7P 4FYXB 1V76A 1QMCA 1VA7A 1OZ2A 3M0SA 4HVVA 4M77D 4XQ3A 9ATCB 2KR3A 1QVPA 4M77E 5DLQE 1QQJA 4FL6A 1IRXA 4WTOB 5IH2A 3CMET 3CC4Q 2H3EB 2EVRA 3JCMb 3REAB 3VUZA 1VQNT 1LNXA 4IUQA 5L23A 3H41A 2JTFA 4PL6A 5GMKh 1AD5A 3JCMP 2KYBA 3OSVA 3DLLA 1Y96B 1YJWA 1ARKA 2D9TA 4M78G 4E7HA 1FYNA 1WHKA 2EGCA 1V29B 5IN1A 1XOVA 4FT2A 2DVEA 1MHNA 1XTDA 1ZHIA 1VQ9A 2RF0A 2P0KA 2X3XD 1VIFA 1I07A 2LCLA 4IUPA 2VGMA 3LH5A 1KC8R 1VYTA 1KQSP 1Q81C 1J3TA 2QDLA 2X51A 2EQMA 2P4RA 1RAIB 1BKBA 2IVWA 3C95A 4EPCA 3CCST 1WX6A 5L8RE 2ZPFB 1TWBA 4KT0E 2DBKA 5C0MA 1B34B 1YJ9Q 4KBMB 1UTIA 1VQKT 2DL8A 2RHZA 2VWFA 1K0SA 2AKKA 1VQ5A 4RKUE 1EZZB 3A8OB 2M0YA 1BI3A 2PZ1A 4M78F 4V2SA 1C0MA 3V8JA 1AWOA 4J5YA 4LDYA 2BZXA 1H8KA 3CXCP 2QDYB 4F17A 4BY6C 2HAXA 3EFRA 3OYNA 4DOWA 5LJ5j 1VQ4Q 3JB9I 3UA6A 1VYVA 1I5OB 4GLKA 2KRNA 4UC4A 2D0QB 4J9EA 1Q95G 1Z9QA 3X25B 3CCSQ 3I56A 3G6EA 1KG1A 1FMVA 3M9QA 3SFMA 4C8QD 1OPLA 4J9HA 3ZBDA 3O8VA 1Q86R 2GQIA 2F2WA 4HXJA 4Z88A 4LDUA 3RKWA 1C1AA 5LJ5f 1M27C 2ABLA 3G4ST 2R5AA 3I56Q 3CCSA 4M7AE 2PQWA 3LX7A 2ZZDA 1AVZC 4F7UA 3O5ZA 1I5LA 1NEGA 4PJOF 2QA4Q 1N8RC 5FROA 1IGQA 1SG5A 4C92D 5FW9A 3M55A 4M4ZA 2MIOA 1PWTA 4QT7A 2RJFA 1QVFA 3CCQA 4RTXA 2DZ9A 2CZ0B 2LMJA 2KRMA 2OAWA 2MOXA 3E9FA 4F7UB 2MCNA 1TU0B 3GIBA 1I8FA 3DLMA 4RG8A 2HZYA 5LJ3d 2W10A 4M75D 1QCFA 2Y4XA 2KSSA 3OYFA 3NFCA 3TREA 1MMNA 4E7ZA 1G3YA 4PJOB 2L0AA 1AOJA 3PTAA 2O9VA 2O31A 3G7ZA 2DF6A 2EAYA 1YBYA 4JLGA 4BACA 3M53A 3CCRT 4EIKA 4BUGA 1E6HA 2D8JA 1Q86U 2R58A 3WXMB 2V8KA 3CCQT 2B86A 2DXUA 2QXFA 1M3CA 2COZA 2LZ6B 3MPUB 1SF9A 2D0NA 3CCVQ 1M90C 4LUEA 1LPLA 1NYGA 3L2VA 1Y07A 3OA6A 4DEXA 5D7UA 2DTHA 4BI8B 4BDYA 1UUEA 2OTJQ 3JCMg 1SHGA 5HK0A 2YLCA 3L2UA 2I2LA 2EYZA 5FWCA 4C8QB 3GP8A 4IUTA 3I9QA 3NTHA 3GPLA 2JTMA 3OYDA 3INZA 3MEVA 4ZNXA 3E19A 2CP6A 2JXBA 3SB2A 2GF7A 4FU6A 3VJPA 1JJ2A 1Y0MA 5GAMf 3KXTA 4XTYA 1YFNA 2ED1A 3CCMQ 4OMPA 2OTLA 3HHTB 1YJNQ 2E5QA 4JJCA 1FX7A 4LUDA 2YRDA 3CCUQ 1UGPB 4PJOA 4BI3A 3CCEQ 4DQ2A 3G71T 2DEUA 4F7UF 5KYNA 4MZPA 2ZPIB 3V7RA 4RTVA 3EGDB 1YWOA 3MEAA 3JB9G 2MWOA 4D6WA 4M77G 3TVTA 2ATCB 3I55A 5GJWB 1QP3A 1M5Q1 2EWNA 2QYZA 3CCQQ 2O9SA 5GAMg 2AKLA 5GMKm 1PG5B 1C6VX 2RJDA 1MNDA 1VQ5T 4M7AG 1M1KC 1KC8C 3ER0A 1JXOA 4EMKC 1Y71A 3HRSA 2DL5A 1KJWA 1VQ7A 1JEGA 1VQ4T 3QG1A 4A4GA 2YUOA 2RB6A 4A4FA 3JCMX 2VVKA 4PFPA 1YCSB 3BFMA 2XI9A 4AFSC 1P92A 5CR2A 2EIFA 2YLBA 3QYHB 3QPHA 1M8VA 2X4XA 3CC7T 2HMAA 5LJ3f 3MP1A 2COYA 2FRWA 4VUBA 2CT3A 2NUZA 2RI5A 1JJ2P 3RNJA 1RLPC 2LJ1A 2GBQA 2WSEE 4OGEA 3RMQA 3CC7A 4E7JA 2L3RA 2KXDA 3JCMJ 1U3OA 4RMOA 1KFZA 1W6XA 2JOYA 2KEAA 1X43A 2OJ2A 1ZBJA 1QKWA 4Z89A 4J8OA 3RDVA 1JB0E 4C92F 2RQRA 1NM7A 4FT4A 3JAME 2QTVA 3ZL7C 3SDZA 3VS5A 1KSWA 4LNPA 1VQ7Q 3L42A 3OYKA 2BIVA 2CP3A 3QYGB 2KNBB 1W2BP 2IG0A 2DRMA 4PFZA 1LJOA 2F2XA 1W1FA 5GMKi 2EW3A 2EFIA 3V8KA 2ZAEA 4PK4A 2XMFA 4LDVA 1K9MC 2KY9A 2M02A 3PNWC 3QDRB 1KD1C 1UJ0A 4YTLA 2VXEA 4N4IA 2RHUA 2GTJA 1FMWA 2JTEA 4DBQA 1WHLA 2DA9A 2ECZA 3PGGA 1K0XA 2E3IA 1K73U 2VV5A 1UEBA 1ZX6A 1OEBA 1WJQA 4ZGEB 3H0IA 1PHTA 1XJWB 4KH0B 3L2ZA 3SWNB 2QA4A 3CXCA 2LQNA 1RAEB 3WVEB 4DA4A 1Z9ZA 5D6XA 1PRMC 3OSSC 1MMAA 2DLPA 3VS1A 1YJNA 3G71A 3TSZA 2NLUA 1QWEA 4GBQA 1UHFA 5IHNA 2RK1A 5KYUB 4XU3A 1I81A 4M77F 1FWZA 1GFCA 1KQSS 2JN0A 4NL2A 4XAXB 1E6GA 2QEXQ 3AT1B 1R0BG 3CCLQ 3OYGA 1XQHA 3SEMA 2RPNA 5FLXE 1WPYA 1N6AA 4PJJA 5J26A 4KH1B 2D1XA 5J39A 5GAN5 2MK5A 1M3BA 3GBQA 3VS2A 1WHJA 2QGGA 5CIUA 2JS2A 1D0YA 1UDLA 1JXMA 4F14A 5EG2A 2V1QA 2HBPA 2HL5C 1ABQA 1VQMQ 1JQQA 2VC8A 2ROLA 1UE9A 3CD6T 8ATCB 1QP2A 1RABB 3MEUA 3M0TA 1OPKA 4L5GA 1FXXA 3J7AF 1TUCA 1NEBA 5HK3A 3CMEQ 1NPPA 3LGLA 2K6DA 1IB8A 4BB7A 3VUBA 5LJ3g 1SRLA 2XIDA 1VUBA 4HT8A 3JCMe 2K3XA 4C5IA 3OW2P 3MKDA 2ZPEB 4M75E 1PKTA 2GFAA 2RD1A 1R0CB 4TVRA 1BIBA 2OTLQ 1W70A 5IHIA 3PIOA 2QQSA 3CCMA 5I21A 2O4XB 2CZ1B 2P4TA 2XKOC 4OMMA 3P8BB 4XTWA 1V1CA 2M51A 1LVKA 5LJ3j 2DNUA 1M8MA 2K79A 3CCLT 1YI2A 1GFDA 1VQOA 2R57A 4FYYB 5I2MA 3QJYA 3VRZA 1VIEA 4M78D 1D0XA 1KHIA 3QWXX 2KROA 3VYGA 4QVCA 2KYMA 5I2SA 3OYEA 4LN2A 4ANJA 1D3BA 1YJ9T 2PTKA 4ZGDB 1WJRA 2A28A 3M4GA 2BUDA 2X9HA 3M0UA 2DPPB 3I5RA 3TU4K 1EFNA 1X2QA 4C8QF 1B3QA 2FEIA 1WHHA 4ELYC 1WLPB 3OMGA 4C92C 1JO8A 4FM4B 2YUNA 1SSFA 2BZYA 4ZTJA 3MJXA 3M59A 4CC7A 3DB4A 1QVGP 2DZCA 2FHDA 5GMKl 2LC4A 3E2UA 5I11A 4F16A 3A8MB 2DD4A 4K11A 1G3WA 3FRNA 2OTLT 3CPWS 3JB9F 2WSFE 3OW2S 3X20B 4HT9A 1QLYA 1ZA1B 4HCKA 1YIJT 5LJ3h 4XTUA 1ZSGA 2LCCA 1KHCA 1TS9A 3CCJQ 3CMEA 1CKAA 1VQ8A 2C0TA 2CT4A 2P0PA 3VYHB 4M7DB 2EQKA 3QSUA 4FIBA 1NLPC 1W2BS 2KGTA 1D3BB 5CKDA 3OYYA 1VQ5Q 1VQ8Q 4C5EA 2KI7A 3OS5A 3JB9H 1BI1A 2NWMA 2HL3A 3PMIA 1WQ7A 4FYVB 2K9GA 3BE3A 2P84A 1KQ2A 4JS4A 2JNGA 3CC2Q 3JCMc 1PCXA 1M30A 2AT1B 3EGUA 2QI2A 4M75A 1N5ZA 2GTOA 2RO0A 2YHTA 2J6KA 1N9SA 2CP5A 3REBB 1RAFB 1TUGB 4DOVA 1I1JA 1VQOT 3FEOA 4HVWA 8AT1B 3PFSA 2HD0A 2MPXC 2A3LA 2RQUA 4KGVB 2VASA 2DJQA 5CO7A 5CKFA 3EH2A 3QKJA 2X4YA 3EH1A 2BE7D 1T3LA 3PT9A 1KQSA 2PVGB 3V7SA 4Y28E 1H3ZA 1M3AA 2C0IA 1QVGA 2KT8A 1K9AA 5IXFA 1VQ6T 2Y90A 5LJ5h 1X2KA 5FRMA 1ZQ1A 2EYQA 2W0ZA 1PC0A 3UT1A 2JJ9A 2MWPA 2E4HA 3OYHA 2RQVA 3HFNA 1VQOQ 2DD5A 5AYFA 3CC2A 1QVFP 4PJNA 2HQXA 5AT1B 2ESWA 1M1KU 4HCCA 4IIMA 1X27A 1KQ1A 2K7AA 2SRCA 2SEMA 2YRCA 1G8XA 3RMSA 4OMFB 4IURA 1S72A 1RI9A 1AWJA 4PJOC 4FSSA 1RACB 2KRSA 3CMAA 2LDMA 3EGDA 1X6OA 2QASA 3EG1A 7AT1B 2CP2A 2DERA 1ZLMA 5KCHA 3HKSA 3V8LA 2CREA 2RK2A 3RUXA 3LYIA 1QCNA 2KE9A 2EPDA 3OYBA 5KYYB 4BDZA 5GAN6 3LGFA 1GXIE 1M1GA 2DAQA 4J7IA 3H0HA 3ULRB 1OU8A 5KE3A 1VQMA 1G3TA 1WXBA 2E6ZA 2J06A 1N27A 2DILA 1TH7A 3FB9A 4OMQA 2AZVA 3OYJA 2X3WD 3M57A 1ACMB 2RI3A 1NJIC 1CKBA 5FRNA 4MDWA 4B6MA 2L5QA 1NLOC 1ZUYA 2PUOB 2GFUA 3OQ5A 3EHQA 5I22A 1OOTA 3NTIA 4J9FA 2EKHA 3JV3A 3UDCA 2CS7A 2DIGA 1AT1B 5KH6A 3CCVT 1YWPA 3C94A 3NMZC 4LDXA 5GAMh 2YWWA 3VS7A 4OF1A 1Y96A 1OV3A 5D6YA 1YI2Q 4QVDA 1D1AA 2X35A 2OTJA 3CCRQ 4IUUA 2DTOA 3I55Q 1WHGA 1BIAA 2HKNA 3CD6A 1UG1A 3HTRA 2EYYA 2FG0A 3HL8A 2R5MA 1AWWA 1JU5C 5ECAA 2FPEA 4IKFA 1K73C 2M1HA 3VU3C 2RHIA 1MUZA 1VQ6A 2JVVA 1D1BA 5GANf 1OX9A 4FYWB 3CPWA 4BE1A 1Q7YU 2L3SA 1WQWA 2QTXA 1I4K1 2LX9A 4C92A 5GAOm 2O4XA 1HSQA 3GLXA 1OI1A 1GRIA 2OX7A 2V26A 4ZN3A 5GANj 3JCMW 5GAN8 1FMKA 2A0FB 2CDTA 1JBMA 3CCMT 4C5GA 2A36A 2X4WA 3OYIA 2V8JA 1PD1A 4A4EA 2QA4T 1WYXA 2EJFA 5GAN2 3OS2A 4M7DF 2YT6A 3S3NA 1M4ZA 2DYBA 3MP6A 4EMGA 1XNIA 3D7SB 4OGCA 1Q82C 1ZSZA 3QXEB 5GJVB 2LQWA 3JSCA 2XDBA 3G1JA 5KYUA 2XG8D 1F1BB 1EIFA 2V8IA 5IHKA 2JW4A 4BY6B 2M16A 4XK8E 4M7AB 3QBYA 5GMKe 1VQKA 3CCVA 4M7AD 2EYXA 5LJ5e 4MZTA 3BY7A 3G4SA 3M0QA 3OW2A 1GBRA 2VB6A 2DYIA 3CC4A 5EC7A 1PRLC 2QEXA 4KGZB 2LCSA 1WA7A 2Y4YA 2YRVA 1MV3A 1BB9A 1KIKA 1S1NA 1X75C 4HKEA 2E41A 2LRQA 2XHCA 2RI2A 2D6FA 3CMAQ 2QK0A 2VUBA 1YIJA 4IUVA 2AZSA 4PLLA 1UGQB 4DEYA 1VQ9T 1UGRB 1PSFA 3H0FA 4MDXA 1BK2A 1NZ9A 2RJEA 6AT1B 4E7KA 5D6WA 5DY9A 4B9XA 1SRMA 4C8QA 5CKEA 4M7DC 4E6RA 2HQHA 1T0JA 2HKQB 4J9IA 2LT1A 3OMCA 1WFWA 4JZ3A 2VYTA 2DIQA 2LNVA 2PUKB 4JUVA 4AG2C 4D8KA 1YIJQ 4CC4B 4ATOA 2QQAA 2GGRA 3R6OA 4FW2A 5CKHA 1VQNA 3DKMA 4C0ZA 1JJ2S 3TSWA 1IO6A 4OMOA 4M77C 2DMOA 2J6FA 2CYZB 4QQ6A 2DEQA 3PMTA 2NUPA 2E70A 1VQKQ 3QHSA 4FCYA 5LJ5g 1RL2A 1RUWA 2CZ6B 2L8DA 1D0ZA 2HSEB 3QZ9B 4DBRA 2M0OA 3M58A 4M78A 4M7DG 2CZ7B 1BYMA 3HRUA 2E12A 5GAOl 4NS5A 3PVLA 3I55T 3QDFA 2AIRB 2YXYA 2K3BA 2DK3A 2JM8A 2CP7A 1KK7A 4AT1B 2CUDA 3UPUA 5A0LA 2FZGB 3N5BB 1M2OA 1RAGB 3I35A 2K5FA 1HD3A 3QZ5B 4F7UE 4KGXB 2PVDB 5CKBA 2K4YA 4OVAA 3P8DA 1BCMA 4RCCA 4C0GA 1R77A 2F2VA 1VQNQ 3KBGA 3QO3A 3QWYA 1PD0A 2G3RA 2PU9B 4O6JA 2RA2A 1AWXA 2XK0A 2RQWA 3UF4A 4RTTA 3VS4A 1BI2A 1OYXA 1A0NB 5LJ5d 1UGVA 3LH0A 2DXBA 2LJ0A 5KYWB 2YSQA 1G83A 4FSXA 2L3PA 5C6SA 2YUQA 3META 3HP9A 3PVQA 4MMLA 1EX4A 2LX7A 3A8LB 1VQPT 2CKKA 3J81E 4X9DA 4M7DE 2B8AA 4M7AF 4WCIA 2JMCA 3CCJT 3OYMA 4PJOG 1SPKA 3R6NA 1QWFA 4X9CA 3FIFA 3OS1A 4ZTFA 4M78B 2DL4A 4AFZC 1WZOA 4M7AC 2FPDA 1YJWQ 3M54A 1M90R 3QUIA 1O75A 1M2VA 2DXTA 4C5HA 1U8RA 1YHQA 1TUDA 4B9WA 2LJ3A 4NOYA 1BU1A 1G5VA 3BDLA 3X24B 2XICA 2L2PA 2K2MA 1LCKA 3UA7A
chains in the Genus database with same CATH topology
2ED0A 1E7OA 1RLQC 1SHGA 4J9BA 1CSKA 2EYZA 5FWCA 4HVWA 3I9QA 4J9CA 2G6FX 2RQUA 4OMLA 4ZNXA 2DJQA 2AK5A 2FRYA 2PNIA 2YDLA 2JXBA 3SHWA 1YNZA 2LNHB 1T3LA 1WI7A 3IQLA 2HEQA 1Y0MA 1M3AA 2C0IA 3NHNA 4AFQC 2KT8A 4KRTA 1K9AA 4OMNA 5IXFA 1UHCA 2ED1A 1X2KA 4OMPA 2W0ZA 2DL3A 1I0CA 2DBMA 3THKA 2CH4A 4A63B 3CQTA 4JJCA 4LUDA 2RQVA 2HCKA 1U06A 1AZEA 5FWBA 1QKXA 4RTVA 1YWOA 2ESWA 2J7IA 4IIMA 1X27A 4LE9A 2K7AA 2SRCA 2SEMA 3TVTA 5GJWB 1RI9A 1AWJA 1B07A 4RUGA 1BBZA 2EBPA 2O9SA 3NGPA 4FSSA 2KRSA 2CSIA 2AKLA 2HBWA 1K76A 1YN8A 2FPFA 4CC3A 1UJYA 3EG1A 1X69A 4JZ4A 1ZLMA 1VYUA 2CREA 2KE9A 2EPDA 1JXOA 3UATA 3H0HA 2DL5A 3ULRB 2JT4A 4ORZA 1KJWA 1JEGA 1PKSA 4Y92A 2DX1A 2ENMA 2YUOA 1WXBA 1ZUKA 2J06A 2VVKA 2DILA 4OMQA 1YCSB 3EG3A 2AZVA 2X3WD 3NPFA 2RN8A 1CKBA 4AFSC 3VS6A 4R0KA 1NLOC 4RTYA 1ZUYA 2HSPA 3EG2A 2FRWA 3EHQA 2J6OA 1GBQA 2RMOA 2CT3A 5I22A 1OOTA 2EYWA 2KBTA 2NUZA 4J9FA 2EKHA 3JV3A 2I0NA 3RNJA 1RLPC 2LJ1A 1GCQC 2GBQA 4RTZA 1K4US 1YWPA 2KXDA 2DRKA 1U3OA 1KFZA 1W6XA 3NMZC 2KEAA 1X43A 2OJ2A 1ZBJA 2VKNA 1QKWA 2IIMA 4Z89A 2L3QA 3VS7A 1OV3A 2OI3A 2RQRA 4RTWA 4X1VA 1NM7A 2DE0X 3ZL7C 3VS5A 1K1ZA 1KSWA 4LNPA 1UG1A 2EYYA 2FG0A 1AWWA 1JU5C 5ECAA 3C0CA 2FPEA 2KNBB 1UFFA 4ESRA 1WDXA 2DRMA 1HJDA 2F2XA 1W1FA 1MUZA 2E5KA 4J9DA 2EW3A 2KXCA 2XMFA 2RQTA 4AFUC 4JJBA 2A08A 1PNJA 1UJ0A 1NYFA 2L3SA 1ABOA 1GCPA 2GTJA 1HSQA 2JTEA 2DA9A 1GRIA 2ECZA 1K0XA 1T0HA 3RBBB 5IXBA 1MV0B 1FMKA 2CH4W 1TG0A 1Y57A 1ZX6A 2CDTA 1OEBA 3VS3A 2A36A 3H0IA 1PHTA 3KFVA 2LQNA 1WYXA 1Z9ZA 1SHFA 1PRMC 2YT6A 1VA7A 2DYBA 3M0SA 4HVVA 2ROTA 2CUBA 2KR3A 2DLPA 3VS1A 3FJ5A 3TSZA 1UECA 1QWEA 2RNAA 5IH2A 1UHFA 4GBQA 5IHNA 5GJVB 2LQWA 2EVRA 3REAB 3VRYA 1GFCA 5L23A 1E6GA 1SSHA 3H41A 5IHKA 3U23A 1AD5A 2JW4A 3SEMA 2RPNA 4AG1C 2KYBA 2EYXA 2D1XA 1ARKA 3M0QA 1GBRA 1FYNA 1M3BA 3GBQA 2C0OA 3VS2A 5EC7A 2EGCA 1H3HA 2JS2A 1XOVA 1UDLA 1JXMA 1PRLC 2GNCA 4F14A 2LCSA 2V1QA 1WA7A 2RF0A 2X3XD 1MV3A 1I07A 1ABQA 1BB9A 1JQQA 2ROLA 1UE9A 1KIKA 1S1NA 1X6BA 3LH5A 2JM9A 2V1RA 1VYTA 1J3TA 2QDLA 2EGEA 2J05A 2P4RA 3M0TA 4GLMA 1OPKA 2AZSA 2YUPA 1G2BA 4DEYA 4CC2A 1TUCA 1NEBA 3H0FA 1BK2A 2H8HA 4HVUA 2K6DA 1SRMA 1WX6A 1SRLA 4E6RA 1T0JA 2DBKA 4J9IA 2EQIA 1WFWA 4JZ3A 2D8HA 1PKTA 1UTIA 4AG2C 4D8KA 4CC4B 2DL8A 2VWFA 2GGRA 1K0SA 2AKKA 1WXUA 1W70A 1GL5A 5IHIA 3M0RA 2M0YA 2PZ1A 3TSWA 1IO6A 4OMMA 5HCKA 1H92A 2M51A 1V1CA 4OMOA 1GFDA 2DNUA 1M8MA 2K79A 2DMOA 2J6FA 2EGAA 1U5SA 1AWOA 3VRZA 2A37A 2BZXA 1H8KA 3PE0A 3QWXX 2KROA 2O2OA 4F17A 2KYMA 4LN2A 1RUWA 3UA6A 1VYVA 1AEYA 2KRNA 2PTKA 2A28A 4J9EA 1Z9QA 4Z8AA 4D8DA 1OPLA 2HDAA 1X6GA 3M0UA 4J9HA 1YP5A 2GQIA 2F2WA 4HXJA 4Z88A 3I5RA 1ZUUA 1M27C 2ABLA 2DL7A 3PVLA 1EFNA 1X2QA 1B3QA 2FEIA 1AVZC 1WLPB 2K3BA 3O5ZA 2JM8A 1NEGA 2CUDA 1JO8A 2YUNA 5FW9A 4M4ZA 2MIOA 1PWTA 2BZYA 3I35A 1GCQA 4QT7A 1WXTA 1HD3A 4CC7A 3EG0A 4RTXA 2JMAA 2LMJA 3VS0A 2KRMA 4RTUA 2OAWA 2MOXA 5I11A 2FO0A 4F16A 2MCNA 3I5SA 2KT1A 2F2VA 4JJDA 2JS0A 4K11A 1SEMA 3QWYA 3M0PA 2BZ8A 1AWXA 1QLYA 4HCKA 1WIEA 2RQWA 3UF4A 2LP5A 4RTTA 3VS4A 1ZSGA 1A0NB 2W10A 1NG2A 1CKAA 1UGVA 2O88A 2C0TA 2DM1A 2BTTA 2CT4A 2LJ0A 1QCFA 2YSQA 1G83A 4J9GA 2L3PA 1T3SA 2YUQA 3PVQA 1AZGB 1NLPC 2LX7A 2KGTA 2L0AA 2CSQA 4IIOA 1AOJA 2O9VA 2O31A 2DF6A 4WCIA 2JMCA 1SPKA 4EIKA 2NWMA 3R6NA 1QWFA 1E6HA 2D8JA 2K9GA 2DVJA 2B86A 2DL4A 4AFZC 1M3CA 2LZ6B 1M30A 2FPDA 2D0NA 3EHRA 4LUEA 3EGUA 1N5ZA 2GTOA 1TUDA 2LJ3A 1NYGA 3A98A 1BU1A 2J6KA 3REBB 4JPBW 2L2PA 4DEXA 2K2MA 1LCKA 3UA7A 1I1JA 1UUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ED0 A;  1E7O A;  1RLQ C;  1SHG A;  4J9B A;  1CSK A;  2EYZ A;  5FWC A;  4HVW A;  3I9Q A;  4J9C A;  2G6F X;  2RQU A;  4OML A;  4ZNX A;  2DJQ A;  2AK5 A;  2FRY A;  2PNI A;  2YDL A;  2JXB A;  3SHW A;  1YNZ A;  2LNH B;  1T3L A;  1WI7 A;  3IQL A;  2HEQ A;  1Y0M A;  1M3A A;  2C0I A;  3NHN A;  4AFQ C;  2KT8 A;  4KRT A;  1K9A A;  4OMN A;  5IXF A;  1UHC A;  2ED1 A;  1X2K A;  4OMP A;  2W0Z A;  2DL3 A;  1I0C A;  2DBM A;  3THK A;  2CH4 A;  4A63 B;  3CQT A;  4JJC A;  4LUD A;  2RQV A;  2HCK A;  1U06 A;  1AZE A;  5FWB A;  1QKX A;  4RTV A;  1YWO A;  2ESW A;  2J7I A;  4IIM A;  1X27 A;  4LE9 A;  2K7A A;  2SRC A;  2SEM A;  3TVT A;  5GJW B;  1RI9 A;  1AWJ A;  1B07 A;  4RUG A;  1BBZ A;  2EBP A;  2O9S A;  3NGP A;  4FSS A;  2KRS A;  2CSI A;  2AKL A;  2HBW A;  1K76 A;  1YN8 A;  2FPF A;  4CC3 A;  1UJY A;  3EG1 A;  1X69 A;  4JZ4 A;  1ZLM A;  1VYU A;  2CRE A;  2KE9 A;  2EPD A;  1JXO A;  3UAT A;  3H0H A;  2DL5 A;  3ULR B;  2JT4 A;  4ORZ A;  1KJW A;  1JEG A;  1PKS A;  4Y92 A;  2DX1 A;  2ENM A;  2YUO A;  1WXB A;  1ZUK A;  2J06 A;  2VVK A;  2DIL A;  4OMQ A;  1YCS B;  3EG3 A;  2AZV A;  2X3W D;  3NPF A;  2RN8 A;  1CKB A;  4AFS C;  3VS6 A;  4R0K A;  1NLO C;  4RTY A;  1ZUY A;  2HSP A;  3EG2 A;  2FRW A;  3EHQ A;  2J6O A;  1GBQ A;  2RMO A;  2CT3 A;  5I22 A;  1OOT A;  2EYW A;  2KBT A;  2NUZ A;  4J9F A;  2EKH A;  3JV3 A;  2I0N A;  3RNJ A;  1RLP C;  2LJ1 A;  1GCQ C;  2GBQ A;  4RTZ A;  1K4U S;  1YWP A;  2KXD A;  2DRK A;  1U3O A;  1KFZ A;  1W6X A;  3NMZ C;  2KEA A;  1X43 A;  2OJ2 A;  1ZBJ A;  2VKN A;  1QKW A;  2IIM A;  4Z89 A;  2L3Q A;  3VS7 A;  1OV3 A;  2OI3 A;  2RQR A;  4RTW A;  4X1V A;  1NM7 A;  2DE0 X;  3ZL7 C;  3VS5 A;  1K1Z A;  1KSW A;  4LNP A;  1UG1 A;  2EYY A;  2FG0 A;  1AWW A;  1JU5 C;  5ECA A;  3C0C A;  2FPE A;  2KNB B;  1UFF A;  4ESR A;  1WDX A;  2DRM A;  1HJD A;  2F2X A;  1W1F A;  1MUZ A;  2E5K A;  4J9D A;  2EW3 A;  2KXC A;  2XMF A;  2RQT A;  4AFU C;  4JJB A;  2A08 A;  1PNJ A;  1UJ0 A;  1NYF A;  2L3S A;  1ABO A;  1GCP A;  2GTJ A;  1HSQ A;  2JTE A;  2DA9 A;  1GRI A;  2ECZ A;  1K0X A;  1T0H A;  3RBB B;  5IXB A;  1MV0 B;  1FMK A;  2CH4 W;  1TG0 A;  1Y57 A;  1ZX6 A;  2CDT A;  1OEB A;  3VS3 A;  2A36 A;  3H0I A;  1PHT A;  3KFV A;  2LQN A;  1WYX A;  1Z9Z A;  1SHF A;  1PRM C;  2YT6 A;  1VA7 A;  2DYB A;  3M0S A;  4HVV A;  2ROT A;  2CUB A;  2KR3 A;  2DLP A;  3VS1 A;  3FJ5 A;  3TSZ A;  1UEC A;  1QWE A;  2RNA A;  5IH2 A;  1UHF A;  4GBQ A;  5IHN A;  5GJV B;  2LQW A;  2EVR A;  3REA B;  3VRY A;  1GFC A;  5L23 A;  1E6G A;  1SSH A;  3H41 A;  5IHK A;  3U23 A;  1AD5 A;  2JW4 A;  3SEM A;  2RPN A;  4AG1 C;  2KYB A;  2EYX A;  2D1X A;  1ARK A;  3M0Q A;  1GBR A;  1FYN A;  1M3B A;  3GBQ A;  2C0O A;  3VS2 A;  5EC7 A;  2EGC A;  1H3H A;  2JS2 A;  1XOV A;  1UDL A;  1JXM A;  1PRL C;  2GNC A;  4F14 A;  2LCS A;  2V1Q A;  1WA7 A;  2RF0 A;  2X3X D;  1MV3 A;  1I07 A;  1ABQ A;  1BB9 A;  1JQQ A;  2ROL A;  1UE9 A;  1KIK A;  1S1N A;  1X6B A;  3LH5 A;  2JM9 A;  2V1R A;  1VYT A;  1J3T A;  2QDL A;  2EGE A;  2J05 A;  2P4R A;  3M0T A;  4GLM A;  1OPK A;  2AZS A;  2YUP A;  1G2B A;  4DEY A;  4CC2 A;  1TUC A;  1NEB A;  3H0F A;  1BK2 A;  2H8H A;  4HVU A;  2K6D A;  1SRM A;  1WX6 A;  1SRL A;  4E6R A;  1T0J A;  2DBK A;  4J9I A;  2EQI A;  1WFW A;  4JZ3 A;  2D8H A;  1PKT A;  1UTI A;  4AG2 C;  4D8K A;  4CC4 B;  2DL8 A;  2VWF A;  2GGR A;  1K0S A;  2AKK A;  1WXU A;  1W70 A;  1GL5 A;  5IHI A;  3M0R A;  2M0Y A;  2PZ1 A;  3TSW A;  1IO6 A;  4OMM A;  5HCK A;  1H92 A;  2M51 A;  1V1C A;  4OMO A;  1GFD A;  2DNU A;  1M8M A;  2K79 A;  2DMO A;  2J6F A;  2EGA A;  1U5S A;  1AWO A;  3VRZ A;  2A37 A;  2BZX A;  1H8K A;  3PE0 A;  3QWX X;  2KRO A;  2O2O A;  4F17 A;  2KYM A;  4LN2 A;  1RUW A;  3UA6 A;  1VYV A;  1AEY A;  2KRN A;  2PTK A;  2A28 A;  4J9E A;  1Z9Q A;  4Z8A A;  4D8D A;  1OPL A;  2HDA A;  1X6G A;  3M0U A;  4J9H A;  1YP5 A;  2GQI A;  2F2W A;  4HXJ A;  4Z88 A;  3I5R A;  1ZUU A;  1M27 C;  2ABL A;  2DL7 A;  3PVL A;  1EFN A;  1X2Q A;  1B3Q A;  2FEI A;  1AVZ C;  1WLP B;  2K3B A;  3O5Z A;  2JM8 A;  1NEG A;  2CUD A;  1JO8 A;  2YUN A;  5FW9 A;  4M4Z A;  2MIO A;  1PWT A;  2BZY A;  3I35 A;  1GCQ A;  4QT7 A;  1WXT A;  1HD3 A;  4CC7 A;  3EG0 A;  4RTX A;  2JMA A;  2LMJ A;  3VS0 A;  2KRM A;  4RTU A;  2OAW A;  2MOX A;  5I11 A;  2FO0 A;  4F16 A;  2MCN A;  3I5S A;  2KT1 A;  2F2V A;  4JJD A;  2JS0 A;  4K11 A;  1SEM A;  3QWY A;  3M0P A;  2BZ8 A;  1AWX A;  1QLY A;  4HCK A;  1WIE A;  2RQW A;  3UF4 A;  2LP5 A;  4RTT A;  3VS4 A;  1ZSG A;  1A0N B;  2W10 A;  1NG2 A;  1CKA A;  1UGV A;  2O88 A;  2C0T A;  2DM1 A;  2BTT A;  2CT4 A;  2LJ0 A;  1QCF A;  2YSQ A;  1G83 A;  4J9G A;  2L3P A;  1T3S A;  2YUQ A;  3PVQ A;  1AZG B;  1NLP C;  2LX7 A;  2KGT A;  2L0A A;  2CSQ A;  4IIO A;  1AOJ A;  2O9V A;  2O31 A;  2DF6 A;  4WCI A;  2JMC A;  1SPK A;  4EIK A;  2NWM A;  3R6N A;  1QWF A;  1E6H A;  2D8J A;  2K9G A;  2DVJ A;  2B86 A;  2DL4 A;  4AFZ C;  1M3C A;  2LZ6 B;  1M30 A;  2FPD A;  2D0N A;  3EHR A;  4LUE A;  3EGU A;  1N5Z A;  2GTO A;  1TUD A;  2LJ3 A;  1NYG A;  3A98 A;  1BU1 A;  2J6K A;  3REB B;  4JPB W;  2L2P A;  4DEX A;  2K2M A;  1LCK A;  3UA7 A;  1I1J A;  1UUE A; 
#chains in the Genus database with same CATH topology
 1CSK A;  4E7L A;  4HCB A;  5CCA A;  1IHV A;  3DB3 A;  4J9C A;  4JRI A;  1K9M R;  2XDD A;  4Y91 A;  4OB1 B;  1JRI A;  2FRY A;  4QQD A;  2PNI A;  1YI2 T;  3CCL A;  2YDL A;  4E2F B;  5A0D A;  1B34 A;  1IXD A;  3H9N A;  1QVF S;  2OTJ T;  3G71 Q;  3E9G A;  1UHC A;  3L2W A;  1YIT Q;  5CVI A;  1VQ4 A;  4EDU A;  3KUF A;  1OQK A;  1I0C A;  2DBM A;  4XU0 A;  4A63 B;  3CQT A;  4QKU A;  4OB3 B;  4C0D C;  2K2V A;  3CCU T;  1U06 A;  2KQW A;  4M77 B;  1AZE A;  1M2V B;  1WHM A;  4R56 A;  2ZPH B;  4JS5 A;  1QKX A;  4CRI A;  5KE2 A;  3L2R A;  4LDW A;  1VQL Q;  2KDS A;  4HA8 A;  1YJW T;  1Q7Y C;  1B07 A;  1IHW A;  2EBP A;  4HCZ A;  1K8A U;  4J7F A;  3MHX A;  2CSI A;  1K76 A;  4WF2 A;  1YN8 A;  2FPF A;  5M9O A;  2MF2 A;  1UJY A;  3SWN C;  4C8Q C;  1VYU A;  3L1A A;  5KYW A;  4L59 A;  1UB4 A;  4N4G A;  2K5L A;  3H6Z A;  2EQU A;  3JCM V;  2KK4 A;  2EQJ A;  4C92 B;  4ORZ A;  1K8A R;  1PKS A;  4MMK A;  2E65 A;  1ZUK A;  2XD0 A;  3EG3 A;  3ZFJ A;  3HPW A;  1Q82 U;  2RN8 A;  2KMT A;  5GAM j;  3J80 E;  1MNE A;  2HSP A;  5CAI A;  1KD1 R;  2RMO A;  3OYL A;  1HK9 A;  5GAN d;  3EGX A;  2EYW A;  4A4K A;  2KBT A;  4C0D B;  4J83 A;  2QEX T;  5IT9 E;  4PLI A;  2QQB A;  2VKN A;  1MMG A;  2XU8 A;  5A0G A;  1Q81 R;  3L2Q A;  2MAM A;  5KYX A;  3X28 B;  2RHX A;  1O9S A;  4ME7 A;  3RIR A;  3C0C A;  2O01 E;  2HQE A;  1UFF A;  1X01 A;  2CP0 A;  2EKO A;  3BDU A;  4ESR A;  2H3J A;  1WDX A;  3OY9 A;  1HJD A;  4N4H A;  4DBF A;  3CBM A;  2E5K A;  4J9D A;  4BE2 A;  2ZPB B;  3WVD B;  5A2Q E;  4PJL A;  5FU6 C;  3MP8 A;  2A08 A;  1PNJ A;  4C8Q G;  1ABO A;  2FB7 A;  2E1H A;  3OYC A;  1TSF A;  1M1F A;  5CQY A;  2NUT A;  2HNI A;  3TCJ A;  1PSE A;  3JRZ A;  1T0H A;  1TOV A;  3RBB B;  3X26 B;  2CH4 W;  1Y57 A;  1VQ6 Q;  3OYA A;  1OUL A;  5GAN g;  3VS3 A;  1VQ9 Q;  4A53 A;  3RR6 A;  3CCU A;  3KFV A;  4QQG A;  3OB9 A;  4JRP A;  2RH2 A;  1SHF A;  4L6V 5;  4XTX A;  4R55 A;  5FU7 C;  2ROT A;  4XTZ A;  2CUB A;  3FJ5 A;  4A4H A;  1K73 R;  2QGF B;  1UEC A;  1YCY A;  2RNA A;  1NJI U;  1RI0 A;  3VRY A;  4PNO A;  4PJO E;  1UGS B;  4JRQ A;  1SSH A;  2Z0W A;  1AHJ B;  3U23 A;  1BCO A;  4AG1 C;  1RAD B;  1TXQ A;  2LT4 A;  1VQM T;  3T9N A;  1Q7Y R;  3GF5 A;  2QAZ A;  2ZGW A;  2OAU A;  2C0O A;  1H3H A;  1N8R R;  2GNC A;  1M1K R;  3C12 A;  4NL3 A;  3URG A;  3LWI A;  4E7I A;  1X6B A;  5GAO n;  2KAF A;  2JM9 A;  2V1R A;  2RJC A;  2WAC A;  4BE0 A;  1YHQ T;  2JZ2 A;  2EGE A;  2J05 A;  4GLM A;  2YUP A;  1G2B A;  3MO8 A;  1VQ7 T;  4CC2 A;  4M75 F;  2H8H A;  2DFU A;  4N0A A;  4HVU A;  2FVU A;  4OP0 A;  5GAN e;  2FYK A;  3F70 A;  2EQI A;  3JCM h;  2D8H A;  2VXF A;  2QQR A;  4C92 G;  5HY6 A;  4XU1 A;  3CEY A;  1WXU A;  2BKD N;  1LOJ A;  1GL5 A;  2MI6 A;  5FU7 B;  3M0R A;  1YIT A;  5DLO A;  3CMA T;  4M78 C;  2A7Y A;  5HCK A;  1H92 A;  1NPR A;  1S72 T;  2EGA A;  1U5S A;  2E10 A;  2A37 A;  1HXD A;  2E6N A;  4OB2 B;  3PE0 A;  4RCB A;  3M5A A;  2JUF A;  2O2O A;  1D1C A;  4M75 B;  4Z02 A;  1YJN T;  3LLR A;  5GMK j;  1U1T A;  2C06 A;  1AEY A;  2MYS A;  3EFO A;  1G3S A;  5GAO q;  4OB0 B;  3JCM f;  4Z8A A;  3I56 T;  1N8R U;  4D8D A;  2NUP B;  2HDA A;  2LQ8 A;  1X6G A;  3FLG A;  4PJM A;  1YP5 A;  4XU2 A;  1ZUU A;  1YHQ Q;  2DL7 A;  1NE8 A;  3A8G B;  4PJO D;  1ZSZ C;  3MEW A;  4DBH A;  3JB9 D;  3HRT A;  2X4J A;  4M7D A;  4N0A C;  5KYY A;  4CI0 C;  3GNF B;  2F69 A;  3JCM Q;  3EG9 A;  3SD4 A;  1GCQ A;  1WXT A;  3EG0 A;  2JMA A;  3VS0 A;  4RTU A;  4M75 C;  5GAO p;  1Q81 U;  3AHU A;  2FO0 A;  2EJ9 A;  3I5S A;  2KT1 A;  4JJD A;  2JS0 A;  2MMP A;  4E7S A;  1SEM A;  3M0P A;  2BZ8 A;  1WIE A;  2RM4 A;  4Q5W A;  2LP5 A;  3EG9 B;  2AHJ B;  2VGN A;  4QVZ A;  5CK9 A;  5LJ3 e;  1NG2 A;  3VKI A;  2O88 A;  1VQ8 T;  2DM1 A;  2BTT A;  4LXC A;  4J9G A;  1WJS A;  1T3S A;  3OBY A;  4X34 A;  3C4S A;  4MZM A;  1VQL A;  1AZG B;  4M7D D;  2ZPG B;  3S6W A;  2CSQ A;  4IIO A;  1YJ9 A;  4ZGJ B;  1M9S A;  3CCR A;  3JCM d;  4M7A A;  4A54 A;  2DVJ A;  3CC7 Q;  3CPF A;  3CCE T;  4JJN K;  2DXC A;  2FZK B;  3RER A;  3RES A;  1ZSZ B;  1MGQ A;  4M78 E;  4J6W A;  3EHR A;  3S3O A;  3A98 A;  1RAA B;  4EMK A;  5HKC A;  4JPB W;  3TEE A;  4C8Q E;  4EMH A;  4F7U G;  2DJZ A;  2ED0 A;  1E7O A;  1RLQ C;  4J9B A;  1Q86 C;  3A1P A;  3CC2 T;  3CC4 T;  2COW A;  1OU9 A;  2G6F X;  4JRK A;  2E64 A;  2EJG A;  3G6E Q;  2E3H A;  2LVM A;  4XTV A;  4EMK B;  4OML A;  3EGX B;  3A8H B;  2AK5 A;  4LD9 K;  3G4S Q;  4M75 G;  1MMD A;  3SHW A;  1IZ6 A;  1YNZ A;  2LNH B;  3LW5 E;  1N9R A;  1R8O B;  2GQV A;  1WI7 A;  3IQL A;  2HEQ A;  4AFQ C;  3NHN A;  2F5K A;  4JDS A;  4KRT A;  1QCO A;  4OMN A;  2DKG A;  3FJP A;  1W4S A;  4BD3 A;  2DL3 A;  5GAN h;  3CPW P;  3THK A;  2GCX A;  4JLI A;  3G6E T;  3HFO A;  2CH4 A;  3MCA B;  3A5Z B;  3CBP A;  3PIP A;  1OX8 A;  3Q1J A;  3RKX A;  5GAM d;  2HCK A;  3QJ6 A;  3V7C A;  4M77 A;  5FWB A;  1NJI R;  4E47 A;  3OBW A;  1Q82 R;  4KUL A;  1H64 1;  3CCE A;  2J7I A;  4AMC A;  2LTO A;  4ELZ C;  4LE9 A;  2FL7 A;  4PKC C;  1IRE B;  1WGS A;  3QII A;  1K9M U;  4F04 B;  4GY5 A;  1PM3 A;  4RUG A;  3CXC S;  1BBZ A;  3NGP A;  5KCO A;  5DM7 R;  2HBW A;  4QW2 A;  3EFS A;  1TTH B;  4CC3 A;  1X69 A;  4JZ4 A;  1VOM A;  1QW1 A;  3M4Y A;  5GAN 7;  1VQL T;  1M90 U;  3UAT A;  2M9U A;  2P0Q A;  2PVO B;  2RHY A;  2JT4 A;  4RG2 A;  3NTK A;  2FZC B;  5GAO r;  4O5V A;  3CD6 Q;  3SWN A;  4Y92 A;  1K8A C;  2DX1 A;  2ENM A;  3GNG A;  2DET A;  5J3B A;  3FC3 A;  3P8H A;  2K57 A;  5IAY A;  4FW1 A;  4C0F A;  3VV0 A;  3NPF A;  3HSB A;  3EAE A;  1ZBX A;  3VS6 A;  2QQ9 A;  4R0K A;  4RTY A;  1KC8 U;  1WNL A;  4II1 A;  2NUT B;  3EG2 A;  3EFO B;  5LL6 S;  2K5I A;  3CBO A;  2J6O A;  1GBQ A;  1Y7X A;  3OS0 A;  5FU6 B;  3FDR A;  1U1S A;  1W2B A;  5KYX B;  2I0N A;  1NBE B;  1GCQ C;  4C92 E;  2DTI A;  4RTZ A;  3ME9 A;  1K4U S;  2F1L A;  2XDP A;  4LD6 A;  3H8Z A;  2DRK A;  2F5T X;  4KUI A;  1ZA2 B;  4PFO A;  5CQX A;  2IIM A;  1OZ3 A;  2L3Q A;  4ZN1 A;  5GAN 4;  1B7T A;  1IGU A;  2WSC E;  2OI3 A;  4BI4 A;  2DO3 A;  2LQK A;  2NYS A;  2CGH A;  4RTW A;  4X1V A;  2IPO B;  2DE0 X;  3GOX A;  1K1Z A;  1KD1 U;  3BW1 A;  1VQP Q;  3RKY A;  1D09 B;  1HYO A;  1BI0 A;  3JB9 J;  2QG9 B;  3ASK A;  4J6X A;  3M56 A;  3CCJ A;  2ZCF B;  2KVQ G;  2KXC A;  3S3M A;  2RQT A;  4AFU C;  4JJB A;  1DJ7 B;  1VQP A;  1NYF A;  1GCP A;  4J6Y A;  2L89 A;  1S72 Q;  4KUD K;  2BE9 B;  2K3Y A;  3ZEH A;  5IXB A;  1MV0 B;  5GAN 3;  3UWN A;  1RAH B;  1TG0 A;  1QVG S;  1YIT T;  4P5N A;  3LWH A;  3E1S A;  1SKU B;  5GAM e;  3TQ7 P;  4FYX B;  1V76 A;  1QMC A;  1VA7 A;  1OZ2 A;  3M0S A;  4HVV A;  4M77 D;  4XQ3 A;  9ATC B;  2KR3 A;  1QVP A;  4M77 E;  5DLQ E;  1QQJ A;  4FL6 A;  1IRX A;  4WTO B;  5IH2 A;  3CME T;  3CC4 Q;  2H3E B;  2EVR A;  3JCM b;  3REA B;  3VUZ A;  1VQN T;  1LNX A;  4IUQ A;  5L23 A;  3H41 A;  2JTF A;  4PL6 A;  5GMK h;  1AD5 A;  3JCM P;  2KYB A;  3OSV A;  3DLL A;  1Y96 B;  1YJW A;  1ARK A;  2D9T A;  4M78 G;  4E7H A;  1FYN A;  1WHK A;  2EGC A;  1V29 B;  5IN1 A;  1XOV A;  4FT2 A;  2DVE A;  1MHN A;  1XTD A;  1ZHI A;  1VQ9 A;  2RF0 A;  2P0K A;  2X3X D;  1VIF A;  1I07 A;  2LCL A;  4IUP A;  2VGM A;  3LH5 A;  1KC8 R;  1VYT A;  1KQS P;  1Q81 C;  1J3T A;  2QDL A;  2X51 A;  2EQM A;  2P4R A;  1RAI B;  1BKB A;  2IVW A;  3C95 A;  4EPC A;  3CCS T;  1WX6 A;  5L8R E;  2ZPF B;  1TWB A;  4KT0 E;  2DBK A;  5C0M A;  1B34 B;  1YJ9 Q;  4KBM B;  1UTI A;  1VQK T;  2DL8 A;  2RHZ A;  2VWF A;  1K0S A;  2AKK A;  1VQ5 A;  4RKU E;  1EZZ B;  3A8O B;  2M0Y A;  1BI3 A;  2PZ1 A;  4M78 F;  4V2S A;  1C0M A;  3V8J A;  1AWO A;  4J5Y A;  4LDY A;  2BZX A;  1H8K A;  3CXC P;  2QDY B;  4F17 A;  4BY6 C;  2HAX A;  3EFR A;  3OYN A;  4DOW A;  5LJ5 j;  1VQ4 Q;  3JB9 I;  3UA6 A;  1VYV A;  1I5O B;  4GLK A;  2KRN A;  4UC4 A;  2D0Q B;  4J9E A;  1Q95 G;  1Z9Q A;  3X25 B;  3CCS Q;  3I56 A;  3G6E A;  1KG1 A;  1FMV A;  3M9Q A;  3SFM A;  4C8Q D;  1OPL A;  4J9H A;  3ZBD A;  3O8V A;  1Q86 R;  2GQI A;  2F2W A;  4HXJ A;  4Z88 A;  4LDU A;  3RKW A;  1C1A A;  5LJ5 f;  1M27 C;  2ABL A;  3G4S T;  2R5A A;  3I56 Q;  3CCS A;  4M7A E;  2PQW A;  3LX7 A;  2ZZD A;  1AVZ C;  4F7U A;  3O5Z A;  1I5L A;  1NEG A;  4PJO F;  2QA4 Q;  1N8R C;  5FRO A;  1IGQ A;  1SG5 A;  4C92 D;  5FW9 A;  3M55 A;  4M4Z A;  2MIO A;  1PWT A;  4QT7 A;  2RJF A;  1QVF A;  3CCQ A;  4RTX A;  2DZ9 A;  2CZ0 B;  2LMJ A;  2KRM A;  2OAW A;  2MOX A;  3E9F A;  4F7U B;  2MCN A;  1TU0 B;  3GIB A;  1I8F A;  3DLM A;  4RG8 A;  2HZY A;  5LJ3 d;  2W10 A;  4M75 D;  1QCF A;  2Y4X A;  2KSS A;  3OYF A;  3NFC A;  3TRE A;  1MMN A;  4E7Z A;  1G3Y A;  4PJO B;  2L0A A;  1AOJ A;  3PTA A;  2O9V A;  2O31 A;  3G7Z A;  2DF6 A;  2EAY A;  1YBY A;  4JLG A;  4BAC A;  3M53 A;  3CCR T;  4EIK A;  4BUG A;  1E6H A;  2D8J A;  1Q86 U;  2R58 A;  3WXM B;  2V8K A;  3CCQ T;  2B86 A;  2DXU A;  2QXF A;  1M3C A;  2COZ A;  2LZ6 B;  3MPU B;  1SF9 A;  2D0N A;  3CCV Q;  1M90 C;  4LUE A;  1LPL A;  1NYG A;  3L2V A;  1Y07 A;  3OA6 A;  4DEX A;  5D7U A;  2DTH A;  4BI8 B;  4BDY A;  1UUE A;  2OTJ Q;  3JCM g;  1SHG A;  5HK0 A;  2YLC A;  3L2U A;  2I2L A;  2EYZ A;  5FWC A;  4C8Q B;  3GP8 A;  4IUT A;  3I9Q A;  3NTH A;  3GPL A;  2JTM A;  3OYD A;  3INZ A;  3MEV A;  4ZNX A;  3E19 A;  2CP6 A;  2JXB A;  3SB2 A;  2GF7 A;  4FU6 A;  3VJP A;  1JJ2 A;  1Y0M A;  5GAM f;  3KXT A;  4XTY A;  1YFN A;  2ED1 A;  3CCM Q;  4OMP A;  2OTL A;  3HHT B;  1YJN Q;  2E5Q A;  4JJC A;  1FX7 A;  4LUD A;  2YRD A;  3CCU Q;  1UGP B;  4PJO A;  4BI3 A;  3CCE Q;  4DQ2 A;  3G71 T;  2DEU A;  4F7U F;  5KYN A;  4MZP A;  2ZPI B;  3V7R A;  4RTV A;  3EGD B;  1YWO A;  3MEA A;  3JB9 G;  2MWO A;  4D6W A;  4M77 G;  3TVT A;  2ATC B;  3I55 A;  5GJW B;  1QP3 A;  1M5Q 1;  2EWN A;  2QYZ A;  3CCQ Q;  2O9S A;  5GAM g;  2AKL A;  5GMK m;  1PG5 B;  1C6V X;  2RJD A;  1MND A;  1VQ5 T;  4M7A G;  1M1K C;  1KC8 C;  3ER0 A;  1JXO A;  4EMK C;  1Y71 A;  3HRS A;  2DL5 A;  1KJW A;  1VQ7 A;  1JEG A;  1VQ4 T;  3QG1 A;  4A4G A;  2YUO A;  2RB6 A;  4A4F A;  3JCM X;  2VVK A;  4PFP A;  1YCS B;  3BFM A;  2XI9 A;  4AFS C;  1P92 A;  5CR2 A;  2EIF A;  2YLB A;  3QYH B;  3QPH A;  1M8V A;  2X4X A;  3CC7 T;  2HMA A;  5LJ3 f;  3MP1 A;  2COY A;  2FRW A;  4VUB A;  2CT3 A;  2NUZ A;  2RI5 A;  1JJ2 P;  3RNJ A;  1RLP C;  2LJ1 A;  2GBQ A;  2WSE E;  4OGE A;  3RMQ A;  3CC7 A;  4E7J A;  2L3R A;  2KXD A;  3JCM J;  1U3O A;  4RMO A;  1KFZ A;  1W6X A;  2JOY A;  2KEA A;  1X43 A;  2OJ2 A;  1ZBJ A;  1QKW A;  4Z89 A;  4J8O A;  3RDV A;  1JB0 E;  4C92 F;  2RQR A;  1NM7 A;  4FT4 A;  3JAM E;  2QTV A;  3ZL7 C;  3SDZ A;  3VS5 A;  1KSW A;  4LNP A;  1VQ7 Q;  3L42 A;  3OYK A;  2BIV A;  2CP3 A;  3QYG B;  2KNB B;  1W2B P;  2IG0 A;  2DRM A;  4PFZ A;  1LJO A;  2F2X A;  1W1F A;  5GMK i;  2EW3 A;  2EFI A;  3V8K A;  2ZAE A;  4PK4 A;  2XMF A;  4LDV A;  1K9M C;  2KY9 A;  2M02 A;  3PNW C;  3QDR B;  1KD1 C;  1UJ0 A;  4YTL A;  2VXE A;  4N4I A;  2RHU A;  2GTJ A;  1FMW A;  2JTE A;  4DBQ A;  1WHL A;  2DA9 A;  2ECZ A;  3PGG A;  1K0X A;  2E3I A;  1K73 U;  2VV5 A;  1UEB A;  1ZX6 A;  1OEB A;  1WJQ A;  4ZGE B;  3H0I A;  1PHT A;  1XJW B;  4KH0 B;  3L2Z A;  3SWN B;  2QA4 A;  3CXC A;  2LQN A;  1RAE B;  3WVE B;  4DA4 A;  1Z9Z A;  5D6X A;  1PRM C;  3OSS C;  1MMA A;  2DLP A;  3VS1 A;  1YJN A;  3G71 A;  3TSZ A;  2NLU A;  1QWE A;  4GBQ A;  1UHF A;  5IHN A;  2RK1 A;  5KYU B;  4XU3 A;  1I81 A;  4M77 F;  1FWZ A;  1GFC A;  1KQS S;  2JN0 A;  4NL2 A;  4XAX B;  1E6G A;  2QEX Q;  3AT1 B;  1R0B G;  3CCL Q;  3OYG A;  1XQH A;  3SEM A;  2RPN A;  5FLX E;  1WPY A;  1N6A A;  4PJJ A;  5J26 A;  4KH1 B;  2D1X A;  5J39 A;  5GAN 5;  2MK5 A;  1M3B A;  3GBQ A;  3VS2 A;  1WHJ A;  2QGG A;  5CIU A;  2JS2 A;  1D0Y A;  1UDL A;  1JXM A;  4F14 A;  5EG2 A;  2V1Q A;  2HBP A;  2HL5 C;  1ABQ A;  1VQM Q;  1JQQ A;  2VC8 A;  2ROL A;  1UE9 A;  3CD6 T;  8ATC B;  1QP2 A;  1RAB B;  3MEU A;  3M0T A;  1OPK A;  4L5G A;  1FXX A;  3J7A F;  1TUC A;  1NEB A;  5HK3 A;  3CME Q;  1NPP A;  3LGL A;  2K6D A;  1IB8 A;  4BB7 A;  3VUB A;  5LJ3 g;  1SRL A;  2XID A;  1VUB A;  4HT8 A;  3JCM e;  2K3X A;  4C5I A;  3OW2 P;  3MKD A;  2ZPE B;  4M75 E;  1PKT A;  2GFA A;  2RD1 A;  1R0C B;  4TVR A;  1BIB A;  2OTL Q;  1W70 A;  5IHI A;  3PIO A;  2QQS A;  3CCM A;  5I21 A;  2O4X B;  2CZ1 B;  2P4T A;  2XKO C;  4OMM A;  3P8B B;  4XTW A;  1V1C A;  2M51 A;  1LVK A;  5LJ3 j;  2DNU A;  1M8M A;  2K79 A;  3CCL T;  1YI2 A;  1GFD A;  1VQO A;  2R57 A;  4FYY B;  5I2M A;  3QJY A;  3VRZ A;  1VIE A;  4M78 D;  1D0X A;  1KHI A;  3QWX X;  2KRO A;  3VYG A;  4QVC A;  2KYM A;  5I2S A;  3OYE A;  4LN2 A;  4ANJ A;  1D3B A;  1YJ9 T;  2PTK A;  4ZGD B;  1WJR A;  2A28 A;  3M4G A;  2BUD A;  2X9H A;  3M0U A;  2DPP B;  3I5R A;  3TU4 K;  1EFN A;  1X2Q A;  4C8Q F;  1B3Q A;  2FEI A;  1WHH A;  4ELY C;  1WLP B;  3OMG A;  4C92 C;  1JO8 A;  4FM4 B;  2YUN A;  1SSF A;  2BZY A;  4ZTJ A;  3MJX A;  3M59 A;  4CC7 A;  3DB4 A;  1QVG P;  2DZC A;  2FHD A;  5GMK l;  2LC4 A;  3E2U A;  5I11 A;  4F16 A;  3A8M B;  2DD4 A;  4K11 A;  1G3W A;  3FRN A;  2OTL T;  3CPW S;  3JB9 F;  2WSF E;  3OW2 S;  3X20 B;  4HT9 A;  1QLY A;  1ZA1 B;  4HCK A;  1YIJ T;  5LJ3 h;  4XTU A;  1ZSG A;  2LCC A;  1KHC A;  1TS9 A;  3CCJ Q;  3CME A;  1CKA A;  1VQ8 A;  2C0T A;  2CT4 A;  2P0P A;  3VYH B;  4M7D B;  2EQK A;  3QSU A;  4FIB A;  1NLP C;  1W2B S;  2KGT A;  1D3B B;  5CKD A;  3OYY A;  1VQ5 Q;  1VQ8 Q;  4C5E A;  2KI7 A;  3OS5 A;  3JB9 H;  1BI1 A;  2NWM A;  2HL3 A;  3PMI A;  1WQ7 A;  4FYV B;  2K9G A;  3BE3 A;  2P84 A;  1KQ2 A;  4JS4 A;  2JNG A;  3CC2 Q;  3JCM c;  1PCX A;  1M30 A;  2AT1 B;  3EGU A;  2QI2 A;  4M75 A;  1N5Z A;  2GTO A;  2RO0 A;  2YHT A;  2J6K A;  1N9S A;  2CP5 A;  3REB B;  1RAF B;  1TUG B;  4DOV A;  1I1J A;  1VQO T;  3FEO A;  4HVW A;  8AT1 B;  3PFS A;  2HD0 A;  2MPX C;  2A3L A;  2RQU A;  4KGV B;  2VAS A;  2DJQ A;  5CO7 A;  5CKF A;  3EH2 A;  3QKJ A;  2X4Y A;  3EH1 A;  2BE7 D;  1T3L A;  3PT9 A;  1KQS A;  2PVG B;  3V7S A;  4Y28 E;  1H3Z A;  1M3A A;  2C0I A;  1QVG A;  2KT8 A;  1K9A A;  5IXF A;  1VQ6 T;  2Y90 A;  5LJ5 h;  1X2K A;  5FRM A;  1ZQ1 A;  2EYQ A;  2W0Z A;  1PC0 A;  3UT1 A;  2JJ9 A;  2MWP A;  2E4H A;  3OYH A;  2RQV A;  3HFN A;  1VQO Q;  2DD5 A;  5AYF A;  3CC2 A;  1QVF P;  4PJN A;  2HQX A;  5AT1 B;  2ESW A;  1M1K U;  4HCC A;  4IIM A;  1X27 A;  1KQ1 A;  2K7A A;  2SRC A;  2SEM A;  2YRC A;  1G8X A;  3RMS A;  4OMF B;  4IUR A;  1S72 A;  1RI9 A;  1AWJ A;  4PJO C;  4FSS A;  1RAC B;  2KRS A;  3CMA A;  2LDM A;  3EGD A;  1X6O A;  2QAS A;  3EG1 A;  7AT1 B;  2CP2 A;  2DER A;  1ZLM A;  5KCH A;  3HKS A;  3V8L A;  2CRE A;  2RK2 A;  3RUX A;  3LYI A;  1QCN A;  2KE9 A;  2EPD A;  3OYB A;  5KYY B;  4BDZ A;  5GAN 6;  3LGF A;  1GXI E;  1M1G A;  2DAQ A;  4J7I A;  3H0H A;  3ULR B;  1OU8 A;  5KE3 A;  1VQM A;  1G3T A;  1WXB A;  2E6Z A;  2J06 A;  1N27 A;  2DIL A;  1TH7 A;  3FB9 A;  4OMQ A;  2AZV A;  3OYJ A;  2X3W D;  3M57 A;  1ACM B;  2RI3 A;  1NJI C;  1CKB A;  5FRN A;  4MDW A;  4B6M A;  2L5Q A;  1NLO C;  1ZUY A;  2PUO B;  2GFU A;  3OQ5 A;  3EHQ A;  5I22 A;  1OOT A;  3NTI A;  4J9F A;  2EKH A;  3JV3 A;  3UDC A;  2CS7 A;  2DIG A;  1AT1 B;  5KH6 A;  3CCV T;  1YWP A;  3C94 A;  3NMZ C;  4LDX A;  5GAM h;  2YWW A;  3VS7 A;  4OF1 A;  1Y96 A;  1OV3 A;  5D6Y A;  1YI2 Q;  4QVD A;  1D1A A;  2X35 A;  2OTJ A;  3CCR Q;  4IUU A;  2DTO A;  3I55 Q;  1WHG A;  1BIA A;  2HKN A;  3CD6 A;  1UG1 A;  3HTR A;  2EYY A;  2FG0 A;  3HL8 A;  2R5M A;  1AWW A;  1JU5 C;  5ECA A;  2FPE A;  4IKF A;  1K73 C;  2M1H A;  3VU3 C;  2RHI A;  1MUZ A;  1VQ6 A;  2JVV A;  1D1B A;  5GAN f;  1OX9 A;  4FYW B;  3CPW A;  4BE1 A;  1Q7Y U;  2L3S A;  1WQW A;  2QTX A;  1I4K 1;  2LX9 A;  4C92 A;  5GAO m;  2O4X A;  1HSQ A;  3GLX A;  1OI1 A;  1GRI A;  2OX7 A;  2V26 A;  4ZN3 A;  5GAN j;  3JCM W;  5GAN 8;  1FMK A;  2A0F B;  2CDT A;  1JBM A;  3CCM T;  4C5G A;  2A36 A;  2X4W A;  3OYI A;  2V8J A;  1PD1 A;  4A4E A;  2QA4 T;  1WYX A;  2EJF A;  5GAN 2;  3OS2 A;  4M7D F;  2YT6 A;  3S3N A;  1M4Z A;  2DYB A;  3MP6 A;  4EMG A;  1XNI A;  3D7S B;  4OGC A;  1Q82 C;  1ZSZ A;  3QXE B;  5GJV B;  2LQW A;  3JSC A;  2XDB A;  3G1J A;  5KYU A;  2XG8 D;  1F1B B;  1EIF A;  2V8I A;  5IHK A;  2JW4 A;  4BY6 B;  2M16 A;  4XK8 E;  4M7A B;  3QBY A;  5GMK e;  1VQK A;  3CCV A;  4M7A D;  2EYX A;  5LJ5 e;  4MZT A;  3BY7 A;  3G4S A;  3M0Q A;  3OW2 A;  1GBR A;  2VB6 A;  2DYI A;  3CC4 A;  5EC7 A;  1PRL C;  2QEX A;  4KGZ B;  2LCS A;  1WA7 A;  2Y4Y A;  2YRV A;  1MV3 A;  1BB9 A;  1KIK A;  1S1N A;  1X75 C;  4HKE A;  2E41 A;  2LRQ A;  2XHC A;  2RI2 A;  2D6F A;  3CMA Q;  2QK0 A;  2VUB A;  1YIJ A;  4IUV A;  2AZS A;  4PLL A;  1UGQ B;  4DEY A;  1VQ9 T;  1UGR B;  1PSF A;  3H0F A;  4MDX A;  1BK2 A;  1NZ9 A;  2RJE A;  6AT1 B;  4E7K A;  5D6W A;  5DY9 A;  4B9X A;  1SRM A;  4C8Q A;  5CKE A;  4M7D C;  4E6R A;  2HQH A;  1T0J A;  2HKQ B;  4J9I A;  2LT1 A;  3OMC A;  1WFW A;  4JZ3 A;  2VYT A;  2DIQ A;  2LNV A;  2PUK B;  4JUV A;  4AG2 C;  4D8K A;  1YIJ Q;  4CC4 B;  4ATO A;  2QQA A;  2GGR A;  3R6O A;  4FW2 A;  5CKH A;  1VQN A;  3DKM A;  4C0Z A;  1JJ2 S;  3TSW A;  1IO6 A;  4OMO A;  4M77 C;  2DMO A;  2J6F A;  2CYZ B;  4QQ6 A;  2DEQ A;  3PMT A;  2NUP A;  2E70 A;  1VQK Q;  3QHS A;  4FCY A;  5LJ5 g;  1RL2 A;  1RUW A;  2CZ6 B;  2L8D A;  1D0Z A;  2HSE B;  3QZ9 B;  4DBR A;  2M0O A;  3M58 A;  4M78 A;  4M7D G;  2CZ7 B;  1BYM A;  3HRU A;  2E12 A;  5GAO l;  4NS5 A;  3PVL A;  3I55 T;  3QDF A;  2AIR B;  2YXY A;  2K3B A;  2DK3 A;  2JM8 A;  2CP7 A;  1KK7 A;  4AT1 B;  2CUD A;  3UPU A;  5A0L A;  2FZG B;  3N5B B;  1M2O A;  1RAG B;  3I35 A;  2K5F A;  1HD3 A;  3QZ5 B;  4F7U E;  4KGX B;  2PVD B;  5CKB A;  2K4Y A;  4OVA A;  3P8D A;  1BCM A;  4RCC A;  4C0G A;  1R77 A;  2F2V A;  1VQN Q;  3KBG A;  3QO3 A;  3QWY A;  1PD0 A;  2G3R A;  2PU9 B;  4O6J A;  2RA2 A;  1AWX A;  2XK0 A;  2RQW A;  3UF4 A;  4RTT A;  3VS4 A;  1BI2 A;  1OYX A;  1A0N B;  5LJ5 d;  1UGV A;  3LH0 A;  2DXB A;  2LJ0 A;  5KYW B;  2YSQ A;  1G83 A;  4FSX A;  2L3P A;  5C6S A;  2YUQ A;  3MET A;  3HP9 A;  3PVQ A;  4MML A;  1EX4 A;  2LX7 A;  3A8L B;  1VQP T;  2CKK A;  3J81 E;  4X9D A;  4M7D E;  2B8A A;  4M7A F;  4WCI A;  2JMC A;  3CCJ T;  3OYM A;  4PJO G;  1SPK A;  3R6N A;  1QWF A;  4X9C A;  3FIF A;  3OS1 A;  4ZTF A;  4M78 B;  2DL4 A;  4AFZ C;  1WZO A;  4M7A C;  2FPD A;  1YJW Q;  3M54 A;  1M90 R;  3QUI A;  1O75 A;  1M2V A;  2DXT A;  4C5H A;  1U8R A;  1YHQ A;  1TUD A;  4B9W A;  2LJ3 A;  4NOY A;  1BU1 A;  1G5V A;  3BDL A;  3X24 B;  2XIC A;  2L2P A;  2K2M A;  1LCK A;  3UA7 A; 
#chains in the Genus database with same CATH homology
 2ED0 A;  1E7O A;  1RLQ C;  1SHG A;  4J9B A;  1CSK A;  2EYZ A;  5FWC A;  4HVW A;  3I9Q A;  4J9C A;  2G6F X;  2RQU A;  4OML A;  4ZNX A;  2DJQ A;  2AK5 A;  2FRY A;  2PNI A;  2YDL A;  2JXB A;  3SHW A;  1YNZ A;  2LNH B;  1T3L A;  1WI7 A;  3IQL A;  2HEQ A;  1Y0M A;  1M3A A;  2C0I A;  3NHN A;  4AFQ C;  2KT8 A;  4KRT A;  1K9A A;  4OMN A;  5IXF A;  1UHC A;  2ED1 A;  1X2K A;  4OMP A;  2W0Z A;  2DL3 A;  1I0C A;  2DBM A;  3THK A;  2CH4 A;  4A63 B;  3CQT A;  4JJC A;  4LUD A;  2RQV A;  2HCK A;  1U06 A;  1AZE A;  5FWB A;  1QKX A;  4RTV A;  1YWO A;  2ESW A;  2J7I A;  4IIM A;  1X27 A;  4LE9 A;  2K7A A;  2SRC A;  2SEM A;  3TVT A;  5GJW B;  1RI9 A;  1AWJ A;  1B07 A;  4RUG A;  1BBZ A;  2EBP A;  2O9S A;  3NGP A;  4FSS A;  2KRS A;  2CSI A;  2AKL A;  2HBW A;  1K76 A;  1YN8 A;  2FPF A;  4CC3 A;  1UJY A;  3EG1 A;  1X69 A;  4JZ4 A;  1ZLM A;  1VYU A;  2CRE A;  2KE9 A;  2EPD A;  1JXO A;  3UAT A;  3H0H A;  2DL5 A;  3ULR B;  2JT4 A;  4ORZ A;  1KJW A;  1JEG A;  1PKS A;  4Y92 A;  2DX1 A;  2ENM A;  2YUO A;  1WXB A;  1ZUK A;  2J06 A;  2VVK A;  2DIL A;  4OMQ A;  1YCS B;  3EG3 A;  2AZV A;  2X3W D;  3NPF A;  2RN8 A;  1CKB A;  4AFS C;  3VS6 A;  4R0K A;  1NLO C;  4RTY A;  1ZUY A;  2HSP A;  3EG2 A;  2FRW A;  3EHQ A;  2J6O A;  1GBQ A;  2RMO A;  2CT3 A;  5I22 A;  1OOT A;  2EYW A;  2KBT A;  2NUZ A;  4J9F A;  2EKH A;  3JV3 A;  2I0N A;  3RNJ A;  1RLP C;  2LJ1 A;  1GCQ C;  2GBQ A;  4RTZ A;  1K4U S;  1YWP A;  2KXD A;  2DRK A;  1U3O A;  1KFZ A;  1W6X A;  3NMZ C;  2KEA A;  1X43 A;  2OJ2 A;  1ZBJ A;  2VKN A;  1QKW A;  2IIM A;  4Z89 A;  2L3Q A;  3VS7 A;  1OV3 A;  2OI3 A;  2RQR A;  4RTW A;  4X1V A;  1NM7 A;  2DE0 X;  3ZL7 C;  3VS5 A;  1K1Z A;  1KSW A;  4LNP A;  1UG1 A;  2EYY A;  2FG0 A;  1AWW A;  1JU5 C;  5ECA A;  3C0C A;  2FPE A;  2KNB B;  1UFF A;  4ESR A;  1WDX A;  2DRM A;  1HJD A;  2F2X A;  1W1F A;  1MUZ A;  2E5K A;  4J9D A;  2EW3 A;  2KXC A;  2XMF A;  2RQT A;  4AFU C;  4JJB A;  2A08 A;  1PNJ A;  1UJ0 A;  1NYF A;  2L3S A;  1ABO A;  1GCP A;  2GTJ A;  1HSQ A;  2JTE A;  2DA9 A;  1GRI A;  2ECZ A;  1K0X A;  1T0H A;  3RBB B;  5IXB A;  1MV0 B;  1FMK A;  2CH4 W;  1TG0 A;  1Y57 A;  1ZX6 A;  2CDT A;  1OEB A;  3VS3 A;  2A36 A;  3H0I A;  1PHT A;  3KFV A;  2LQN A;  1WYX A;  1Z9Z A;  1SHF A;  1PRM C;  2YT6 A;  1VA7 A;  2DYB A;  3M0S A;  4HVV A;  2ROT A;  2CUB A;  2KR3 A;  2DLP A;  3VS1 A;  3FJ5 A;  3TSZ A;  1UEC A;  1QWE A;  2RNA A;  5IH2 A;  1UHF A;  4GBQ A;  5IHN A;  5GJV B;  2LQW A;  2EVR A;  3REA B;  3VRY A;  1GFC A;  5L23 A;  1E6G A;  1SSH A;  3H41 A;  5IHK A;  3U23 A;  1AD5 A;  2JW4 A;  3SEM A;  2RPN A;  4AG1 C;  2KYB A;  2EYX A;  2D1X A;  1ARK A;  3M0Q A;  1GBR A;  1FYN A;  1M3B A;  3GBQ A;  2C0O A;  3VS2 A;  5EC7 A;  2EGC A;  1H3H A;  2JS2 A;  1XOV A;  1UDL A;  1JXM A;  1PRL C;  2GNC A;  4F14 A;  2LCS A;  2V1Q A;  1WA7 A;  2RF0 A;  2X3X D;  1MV3 A;  1I07 A;  1ABQ A;  1BB9 A;  1JQQ A;  2ROL A;  1UE9 A;  1KIK A;  1S1N A;  1X6B A;  3LH5 A;  2JM9 A;  2V1R A;  1VYT A;  1J3T A;  2QDL A;  2EGE A;  2J05 A;  2P4R A;  3M0T A;  4GLM A;  1OPK A;  2AZS A;  2YUP A;  1G2B A;  4DEY A;  4CC2 A;  1TUC A;  1NEB A;  3H0F A;  1BK2 A;  2H8H A;  4HVU A;  2K6D A;  1SRM A;  1WX6 A;  1SRL A;  4E6R A;  1T0J A;  2DBK A;  4J9I A;  2EQI A;  1WFW A;  4JZ3 A;  2D8H A;  1PKT A;  1UTI A;  4AG2 C;  4D8K A;  4CC4 B;  2DL8 A;  2VWF A;  2GGR A;  1K0S A;  2AKK A;  1WXU A;  1W70 A;  1GL5 A;  5IHI A;  3M0R A;  2M0Y A;  2PZ1 A;  3TSW A;  1IO6 A;  4OMM A;  5HCK A;  1H92 A;  2M51 A;  1V1C A;  4OMO A;  1GFD A;  2DNU A;  1M8M A;  2K79 A;  2DMO A;  2J6F A;  2EGA A;  1U5S A;  1AWO A;  3VRZ A;  2A37 A;  2BZX A;  1H8K A;  3PE0 A;  3QWX X;  2KRO A;  2O2O A;  4F17 A;  2KYM A;  4LN2 A;  1RUW A;  3UA6 A;  1VYV A;  1AEY A;  2KRN A;  2PTK A;  2A28 A;  4J9E A;  1Z9Q A;  4Z8A A;  4D8D A;  1OPL A;  2HDA A;  1X6G A;  3M0U A;  4J9H A;  1YP5 A;  2GQI A;  2F2W A;  4HXJ A;  4Z88 A;  3I5R A;  1ZUU A;  1M27 C;  2ABL A;  2DL7 A;  3PVL A;  1EFN A;  1X2Q A;  1B3Q A;  2FEI A;  1AVZ C;  1WLP B;  2K3B A;  3O5Z A;  2JM8 A;  1NEG A;  2CUD A;  1JO8 A;  2YUN A;  5FW9 A;  4M4Z A;  2MIO A;  1PWT A;  2BZY A;  3I35 A;  1GCQ A;  4QT7 A;  1WXT A;  1HD3 A;  4CC7 A;  3EG0 A;  4RTX A;  2JMA A;  2LMJ A;  3VS0 A;  2KRM A;  4RTU A;  2OAW A;  2MOX A;  5I11 A;  2FO0 A;  4F16 A;  2MCN A;  3I5S A;  2KT1 A;  2F2V A;  4JJD A;  2JS0 A;  4K11 A;  1SEM A;  3QWY A;  3M0P A;  2BZ8 A;  1AWX A;  1QLY A;  4HCK A;  1WIE A;  2RQW A;  3UF4 A;  2LP5 A;  4RTT A;  3VS4 A;  1ZSG A;  1A0N B;  2W10 A;  1NG2 A;  1CKA A;  1UGV A;  2O88 A;  2C0T A;  2DM1 A;  2BTT A;  2CT4 A;  2LJ0 A;  1QCF A;  2YSQ A;  1G83 A;  4J9G A;  2L3P A;  1T3S A;  2YUQ A;  3PVQ A;  1AZG B;  1NLP C;  2LX7 A;  2KGT A;  2L0A A;  2CSQ A;  4IIO A;  1AOJ A;  2O9V A;  2O31 A;  2DF6 A;  4WCI A;  2JMC A;  1SPK A;  4EIK A;  2NWM A;  3R6N A;  1QWF A;  1E6H A;  2D8J A;  2K9G A;  2DVJ A;  2B86 A;  2DL4 A;  4AFZ C;  1M3C A;  2LZ6 B;  1M30 A;  2FPD A;  2D0N A;  3EHR A;  4LUE A;  3EGU A;  1N5Z A;  2GTO A;  1TUD A;  2LJ3 A;  1NYG A;  3A98 A;  1BU1 A;  2J6K A;  3REB B;  4JPB W;  2L2P A;  4DEX A;  2K2M A;  1LCK A;  3UA7 A;  1I1J A;  1UUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...