4JJCA

Crystal structure of the abl-sh3 domain at ph5
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the Abl-SH3 domain at pH5
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jjcA00
4LUDA 3VRZA 2LJ0A 4ORZA 1OV3A 2EGEA 2QDLA 1QKXA 2PNIA 3M0SA 1GBQA 4HXJA 1CKAA 1FYNA 2G6FX 2L3SA 1T3SA 4F17A 4QT7A 1M3CA 1K76A 2DL5A 2GGRA 1NLOC 1GRIA 1QWEA 2KE9A 2BZ8A 1AZEA 2DBMA 1E6HA 2RF0A 3M0TA 3I5RA 1YCSB 3REBB 1PHTA 4HCKA 1H8KA 4WCIA 2O31A 1X27A 2DE0X 1M3BA 2JTEA 5IHNA 1S1NA 2ABLA 5IHIA 3H0IA 3VS6A 2D1XA 2O9SA 3FJ5A 2K6DA 1Z9ZA 2L0AA 3EG1A 1I07A 2O9VA 1ZUKA 1MUZA 1YP5A 5FW9A 2P4RA 1WA7A 1M3AA 4J9DA 1MV3A 5I22A 1CKBA 2EBPA 2A28A 1AWOA 2CT3A 4CC3A 1MV0B 1H3HA 2EVRA 1WLPB 1ZUUA 1NEGA 2KNBB 2J06A 1X69A 2F2WA 1K0XA 3I9QA 2JXBA 1KJWA 2JM8A 3VS5A 1JO8A 4JPBW 5IXFA 1SSHA 5IXBA 2MOXA 1AVZC 3REAB 4J9IA 1GFCA 2EGAA 2LJ3A 2M0YA 2X3WD 2KRMA 3EHRA 4E6RA 3CQTA 1ABOA 4LN2A 2C0TA 5FWBA 2AZSA 1A0NB 1NLPC 2C0OA 4D8KA 4AFSC 2ESWA 1YWOA 3UA6A 1YWPA 2DBKA 2KT1A 2A08A 1RLQC 3H0FA 2ROLA 2J6OA 2LNHB 1T3LA 2AZVA 5GJVB 1KIKA 1PKSA 1KFZA 2RPNA 2AKKA 2DJQA 3EG2A 1NYGA 3RBBB 1PRLC 2D8JA 2DRMA 2CH4W 4JZ3A 2F2VA 1AEYA 1WXBA 1BK2A 2ENMA 1BU1A 2A37A 2GTOA 2C0IA 4CC2A 1AOJA 4RTZA 1PKTA 3EG0A 1G83A 3I5SA 1GBRA 4JJDA 4J9GA 3M0QA 4CC4B 2JT4A 4Z89A 2J6FA 4Z88A 3UATA 4HVUA 4J9EA 1WIEA 1QKWA 1X2KA 3C0CA 4X1VA 2DVJA 4M4ZA 4RTXA 2KROA 1IO6A 3IQLA 2BZXA 4K11A 1VYUA 4GLMA 2DILA 4RTTA 3THKA 3I35A 3U23A 2YUOA 1HSQA 2EYZA 2L2PA 4HVVA 4IIOA 2GTJA 1OPKA 4KRTA 1OPLA 2KXCA 3TSWA 3VRYA 2KRNA 1NYFA 1RLPC 2EPDA 1I1JA 1X2QA 2YT6A 3EG3A 2FO0A 2CDTA 3TSZA 1K9AA 1ZUYA 2RQUA 1Y57A 2FPEA 2KXDA 2W0ZA 2EKHA 4Z8AA 1ARKA 3NHNA 4J9FA 2JMCA 2EW3A 2ECZA 1UG1A 2AKLA 2FRWA 2H8HA 1GL5A 1NM7A 2K79A 2FPFA 2HSPA 2PZ1A 4FSSA 1ZLMA 3VS0A 1EFNA 3M0PA 3SHWA 1AWWA 4ZNXA 1FMKA 1U5SA 1AD5A 1TUDA 2ROTA 4IIMA 4AG1C 1B3QA 1M8MA 1K0SA 1U3OA 1QWFA 2JW4A 4OMPA 3RNJA 3M0UA 3A98A 2DNUA 1G2BA 1UE9A 3TVTA 1B07A 1VYVA 2LMJA 3PVQA 4RTUA 1WXTA 1PNJA 1SHGA 2KT8A 2L3PA 1UJ0A 2CSIA 4F14A 1X43A 1E6GA 2PTKA 2K3BA 3NMZC 1N5ZA 3ULRB 3VS3A 2XMFA 3O5ZA 4DEYA 3EGUA 2RNAA 1WXUA 2YSQA 1JXMA 1ZBJA 1BBZA 1H92A 1W6XA 2I0NA 1WYXA 1SRLA 2SRCA 2D0NA 1T0JA 1T0HA 1W70A 3JV3A 2J7IA 1PRMC 2O88A 2DYBA 4ESRA 2O2OA 4F16A 2FRYA 2JM9A 4Y92A 1QCFA 1UHFA 1V1CA 4RTVA 5GJWB 2KYMA 3PVLA 5ECAA 1YNZA 3H0HA 1GFDA 2EYWA 1ZSGA 2OI3A 3H41A 1I0CA 1GCQA 1SHFA 4AFZC 4D8DA 4LNPA 4R0KA 1WX6A 4OMOA 4AG2C 2W10A 1Y0MA 1WDXA 2D8HA 2V1RA 1XOVA 2YUQA 2GQIA 3KFVA 3VS7A 1UTIA 2L3QA 2JS0A 1NEBA 1YN8A 5IHKA 1JU5C 2KEAA 1PWTA 2BTTA 2A36A 1BB9A 2MIOA 2CUDA 1AWJA 5FWCA 1U06A 4OMMA 1OOTA 2RQVA 2B86A 1NG2A 3UA7A 2LZ6B 4LUEA 1LCKA 2LJ1A 2OAWA 1W1FA 2DLPA 4A63B 2EYYA 1K4US 1AWXA 2MCNA 4OMLA 2RN8A 1Z9QA 1CSKA 2AK5A 4J9BA 1OEBA 3EHQA 2NUZA 1TG0A 3QWXX 2RMOA 4J9CA 1K1ZA 1UUEA 2KBTA 2X3XD 2DF6A 2HBWA 1UECA 3NGPA 1GCPA 2DL8A 2HCKA 2JMAA 2KGTA 2DMOA 1VA7A 2K9GA 4JZ4A 1RI9A 2YDLA 4CC7A 4DEXA 2NWMA 2VWFA 4JJBA 4JJCA 1HD3A 2SEMA 2E5KA 5IH2A 2YUPA 5I11A 3ZL7C 3M0RA 2KYBA 1X6GA 4OMQA 2RQRA 2K7AA 1UFFA 2FG0A 2LQWA 1E7OA 2IIMA 2RQWA 2K2MA 4EIKA 1JQQA 1GCQC 4RTYA 4AFUC 2GBQA 1AZGB 2DX1A 5L23A 1TUCA 2GNCA 4GBQA 2DRKA 1ABQA 2DL7A 1SPKA 2CUBA 3UF4A 1M30A 3PE0A 2J05A 1KSWA 2RQTA 2DM1A 2DL3A 5HCKA 2DL4A 1ZX6A 3LH5A 2CREA 3QWYA 1UJYA 1UHCA 2EQIA 2OJ2A 5EC7A 1UDLA 1JXOA 4J9HA 3GBQA 2LCSA 2YUNA 3VS1A 2J6KA 2HDAA 1WI7A 4OMNA 4RUGA 2FPDA 2EYXA 3R6NA 3VS4A 1UGVA 2JS2A 1X6BA 2M51A 2FEIA 1WFWA 4RTWA 1SRMA 2CSQA 2DA9A 4AFQC 2ED1A 1JEGA 2VVKA 3NPFA 4LE9A 1M27C 1RUWA 4HVWA 2KRSA 2KR3A 2VKNA 2LQNA 1J3TA 2BZYA 1QLYA 2CT4A 2LX7A 1VYTA 2HEQA 2V1QA 2ED0A 2EGCA 2LP5A 1HJDA 2CH4A 3SEMA 3VS2A 2F2XA 1SEMA
chains in the Genus database with same CATH superfamily
4LUDA 3EFOB 2LJ0A 1OV3A 3QDFA 3M0SA 4HXJA 1FYNA 1QMCA 1QVGA 3VUZA 2ZPFB 1TTHB 4QT7A 2DL5A 4KH0B 2YRVA 4E7JA 1LJOA 4M7AB 1QWEA 1WJSA 3TU4K 5KYXA 1RAEB 1AZEA 1VQMQ 1B34A 4F04B 1K8AU 1E6HA 4HA8A 4HCKA 1YI2Q 2GFAA 2O31A 3P8HA 4M75B 5FRMA 4DOWA 1M3BA 3OBYA 4XU2A 2ABLA 3I56T 2K6DA 1Z9ZA 4BI3A 1I07A 1ZUKA 1MUZA 3QHSA 1K8AC 2P4RA 2E41A 2H3JA 1M3AA 1K9MR 3MEWA 4PJOA 3CCQQ 1OI1A 3LWHA 3BDUA 4ZN1A 1H3HA 5LJ5g 1OX8A 5CQYA 4HKEA 1ZUUA 2RA2A 3OYHA 4C8QG 2COZA 3O8VA 2DEQA 3MEAA 1M90U 1JO8A 4JPBW 1SSHA 1YHQT 1AVZC 3REAB 4J9IA 3CC2T 2M0YA 3URGA 3ER0A 4E6RA 3CQTA 1ABOA 1PD0A 4RG2A 5FWBA 4XU3A 1A0NB 3JCMf 1IHVA 4D8KA 3ME9A 1NJIC 1M90C 1TWBA 5FROA 4V2SA 2LT4A 1Y07A 2X9HA 2RB6A 5GJVB 1BYMA 1PKSA 1HYOA 1PD1A 2RPNA 1SSFA 5LJ3h 4BE0A 2DJQA 2CH4W 1WXBA 3M53A 2YRCA 2A37A 5KH6A 2C0IA 1I8FA 4RTZA 3JCMX 1G83A 4JJDA 4CRIA 3M0QA 4FYVB 2QQAA 3JB9D 3UATA 4HVUA 4J9EA 1QKWA 1X2KA 1VQ6T 2MK5A 2HQXA 4M4ZA 4RTXA 2KROA 4M77E 3IQLA 5GAN7 1EZZB 5KYWB 5FU7B 4PJOC 4ELYC 4OGEA 3M55A 3U23A 2QEXA 3HFNA 2DXUA 2EYZA 3OW2A 3CCUT 3CCLT 2GTJA 5LL6S 1VQLQ 1U1SA 4P5NA 2PUOB 3LLRA 2DIQA 1MHNA 1U1TA 2OAUA 3TSWA 1IREB 4E7SA 3G6ET 5LJ5e 3G71A 5HK0A 1Q86R 1I1JA 1X2QA 2XU8A 2YT6A 2EJ9A 1VIEA 1YJNA 3RR6A 1VQ7A 1JJ2A 1K9AA 1S72T 2GFUA 3QBYA 2COWA 2W0ZA 4JRKA 2HBPA 4Z8AA 1ARKA 3S6WA 3NHNA 4FT4A 3QO3A 3CC7A 1UG1A 1NM7A 2HSPA 2R57A 4ME7A 1ZLMA 2E1HA 4A4GA 2BE7D 3OS2A 2D0QB 2ROTA 5GANf 2VXFA 3EFRA 1RL2A 3QJ6A 4DBHA 1VUBA 1M8MA 3QPHA 5FU6C 2CZ7B 2DTHA 1TS9A 2DNUA 3GNFB 4C0GA 4N4GA 1ZSZA 4XU0A 3OW2P 1N9SA 1N8RR 5FRNA 1MMDA 3L2VA 2LMJA 1PNJA 4PNOA 4F7UE 5A0LA 3OYYA 4M78G 1Q81R 1JJ2P 4BY6B 2XMFA 1I81A 4C5IA 4M77F 3EGUA 1JXMA 1ZBJA 5GANd 3E1SA 3S3MA 2LX9A 3BDLA 4VUBA 3LGLA 3JCMV 2MYSA 1WYXA 1VQNT 2SRCA 3JCMh 3JV3A 2D6FA 2DYBA 4ESRA 5J3BA 2XDPA 2FRYA 4Y92A 5GAOn 1WHLA 4Q5WA 2M02A 4FW1A 5HKCA 4MDWA 1IRXA 2LQ8A 3C12A 4RTVA 1Q7YU 2K5IA 5GJWB 5DY9A 3QXEB 1W2BA 3PVLA 2NUPA 3OY9A 4PLLA 1YNZA 3H0HA 4JJNK 1H3ZA 2DK3A 5CCAA 2FZCB 3CCST 2C06A 2A7YA 1SHFA 5D6YA 4OMOA 1PCXA 2RJDA 1Y0MA 3JCMQ 3V8LA 3LWIA 5I2MA 1Q7YC 3VS7A 1GXIE 1KD1R 2DKGA 2MF2A 3MJXA 3INZA 2DAQA 1YIJQ 5IHKA 2VB6A 2KEAA 2A36A 1BB9A 3CCRA 1YJWQ 4C8QD 2CUDA 4ZGJB 4OMFB 5FWCA 1U06A 3G7ZA 2XD0A 1TH7A 3EFOA 2K5FA 1K73U 1TU0B 4IUVA 2QQSA 1WHMA 3CCMA 5LJ3j 1LCKA 4FSXA 1W1FA 2DLPA 1VQMT 1O9SA 4A63B 6AT1B 4LDUA 4M7AA 1Z9QA 4KH1B 1CSKA 4PFZA 4C8QB 1TXQA 1YI2T 4O5VA 2FZGB 2LRQA 2NUZA 4F7UF 3JB9J 2FYKA 1P92A 2DZ9A 2R5MA 1W2BP 2DF6A 2HBWA 3A8GB 3NGPA 1GCPA 4HT9A 1G3WA 2DL8A 4AT1B 4M75A 2FVUA 3E19A 3FIFA 4ATOA 3MPUB 1D0YA 2K9GA 1RI9A 3CCQT 1M1GA 1KHIA 4JRQA 1VQOA 3CMEA 4JJBA 3OSVA 2P0QA 2SEMA 2ZPEB 4A4HA 3M0RA 1KQSS 4YTLA 2EQUA 2KYBA 4X34A 2RJEA 5GANh 2RQRA 2X4JA 2K2MA 4EIKA 4RTYA 3OYDA 1YJ9A 3JB9I 1VQ8A 5KYNA 1TUCA 4KBMB 5J39A 3G4SQ 4C5HA 3QJYA 3OYMA 1ACMB 2DL4A 2QTVA 2CZ1B 2EQIA 3RIRA 2DTOA 1KQ1A 4OB2B 1UDLA 5KYYB 5GAMf 3D7SB 3ZBDA 3MEVA 2LCSA 4J5YA 2YUNA 1D0ZA 3RKWA 3M9QA 2FPDA 2LCLA 4M7AC 1Q82U 4C92E 2CP6A 3R6NA 3VS4A 5J26A 2M51A 2EKOA 2YLCA 5L8RE 1M1KR 3OS5A 1SRMA 1FMVA 4AFQC 1RUWA 3JSCA 3HSBA 2BZYA 2LX7A 1M5Q1 2ED0A 2EGCA 4M75C 4A4EA 1Q82C 2EGEA 2IG0A 3A8MB 2G6FX 2QQ9A 5KYWA 2GGRA 1NLOC 3TQ7P 1VQLT 5GAMd 2KSSA 1VQKQ 2BZ8A 3I56A 3L1AA 1IGUA 4E2FB 2RJCA 4IURA 4BACA 1YCSB 3REBB 4M78D 1H8KA 1YFNA 2KAFA 4WCIA 1X27A 1RACB 1SKUB 4O6JA 3H0IA 3VS6A 2O9SA 4KULA 1K9MU 2HQHA 3EG1A 1C0MA 1YP5A 4J9DA 1MV3A 3JB9H 1CKBA 4M78B 1LOJA 2WSEE 2CT3A 4HT8A 3M58A 4CC3A 3CC2A 1MV0B 3G1JA 2KI7A 2P0KA 1WQWA 2J06A 1K9MC 2JXBA 5GAOl 2JM8A 3UWNA 2LC4A 1WPYA 2M9UA 2YXYA 3JRZA 3MP1A 5HK3A 1RADB 5CKEA 3J7AF 2X3WD 4C92F 1N9RA 2KRMA 3MKDA 4NOYA 4LN2A 3T9NA 5D7UA 3M54A 2C0OA 4R56A 3CMAQ 2MI6A 4E7KA 2FZKB 3UA6A 3V8KA 1YWPA 3OYIA 1MNEA 2J6OA 3X28B 3CCJA 5FU7C 3V7CA 2QXFA 1V29B 4JUVA 1VQ6A 4QVCA 2D8JA 2MWOA 3VUBA 3Q1JA 1AEYA 2X4XA 3PT9A 2ENMA 2LDMA 4PK4A 2Z0WA 4IUPA 4M7DE 1SF9A 4XTZA 4BDYA 4GY5A 2MAMA 4J9GA 3CCUA 4Z89A 2KDSA 4OF1A 1VQ9Q 5GAN8 3CD6Q 5GAMh 5GANj 1DJ7B 4X1VA 1BKBA 3G6EA 1TSFA 1IO6A 4K11A 3V8JA 2DILA 3KUFA 1C6VX 4RTTA 3THKA 2EQMA 1S72A 2YUOA 4BI8B 3OYBA 4D6WA 3CEYA 3OBWA 1OPKA 1Q86U 2KXCA 5GMKi 3QYHB 2OTLQ 5A0DA 2WACA 1VOMA 3OYKA 1YJWT 1JRIA 4B9WA 2CDTA 4JS5A 1Y57A 2RHZA 2FPEA 1W4SA 2XHCA 2QEXQ 2EKHA 1Q86C 3JCMg 3S3OA 1M1FA 4J9FA 3MO8A 2ECZA 2AKLA 3HP9A 1GL5A 1LNXA 2FPFA 2K5LA 3PTAA 3VS0A 3FEOA 1I5OB 2RM4A 4LD6A 1YJNQ 1VQ7Q 2HD0A 1AWWA 4C8QA 4BE2A 2DPPB 4MDXA 2DIGA 3E2UA 3P8BB 4BY6C 4AG1C 2JUFA 2L3RA 3L2RA 3CC7Q 1K0SA 2CP2A 1NJIU 4OMPA 1N8RU 3RNJA 3M0UA 3A98A 1VYVA 3L2UA 4M77G 4M7DF 4RTUA 1WXTA 1SHGA 2KT8A 2Y4YA 1VQNA 4PFPA 5CKBA 2CSIA 4E7HA 2F1LA 2K3BA 2PTKA 3NMZC 3PMTA 4IUUA 3PIOA 1N8RC 3RESA 3ULRB 1IXDA 2QGFB 1WXUA 2YSQA 3G4ST 1VQPT 3EH1A 1XJWB 3BW1A 1KQ2A 1Q81C 3OB9A 1QP3A 1KQSA 1NBEB 3CCSA 1PRMC 3HRTA 2ZPBB 2O2OA 3P8DA 2DFUA 1QCFA 2E65A 1V1CA 2NYSA 2K3XA 4JDSA 4PJOE 1YBYA 5KYYA 3JCMe 4R55A 2QI2A 3H41A 1BI2A 3RERA 4D8DA 2DXBA 4R0KA 4N0AC 5AYFA 1KD1U 4C8QC 8ATCB 2D8HA 2GQIA 3CBPA 1UTIA 2L3QA 1VQMA 3DLMA 3META 1M4ZA 3VYGA 4FYYB 1BCOA 5CR2A 4FIBA 1YI2A 5CVIA 2BIVA 5C6SA 1TUGB 1YITQ 1KD1C 2CGHA 2LVMA 4F7UG 2LZ6B 1VQKT 4LUEA 5LJ5d 2LJ1A 3H8ZA 2HKNA 3TREA 1KQSP 2VC8A 2QG9B 2EYYA 4XTXA 2EJGA 2MCNA 3FLGA 2RN8A 3CCQA 3DB4A 4J9BA 1K8AR 4XTVA 1TG0A 2RMOA 1BI3A 2K2VA 1RAFB 4LDVA 1UECA 1UGSB 5GAMj 3SDZA 4XTUA 4B9XA 2DMOA 2PU9B 1D1CA 4DBFA 4JZ4A 1QW1A 3UDCA 2BE9B 4DEXA 4OGCA 3OS1A 3CCVQ 3KBGA 1M2VB 1OX9A 2DYIA 4XAXB 1WJQA 1Q95G 2OTJA 4M78A 1IB8A 5GAN2 1UFFA 2FG0A 2L5QA 2RQWA 2HZYA 1UB4A 3SD4A 1JQQA 4J8OA 1VQOQ 3HFOA 3HTRA 4AFUC 4PJOF 3CMEQ 3JCMW 1G3TA 2ZPGB 1QCOA 2E3IA 3PGGA 3LW5E 2DX1A 4J6YA 2DETA 2GF7A 3RKYA 4GBQA 2F5KA 4E7IA 1SPKA 3CMAT 4KUDK 2Y90A 1VQ4A 1KSWA 2RQTA 1ZX6A 3LH5A 2P0PA 1MNDA 5GAN5 4OB3B 1UHCA 1YJ9Q 1XQHA 3I55Q 1I4K1 1VQ8Q 5EC7A 2HQEA 3EH2A 2X4YA 1JXOA 2CKKA 3GBQA 4MMLA 1D0XA 3LX7A 1VQ5T 2DO3A 4OMNA 4RUGA 4X9DA 2MWPA 2AT1B 1AT1B 2FEIA 3EAEA 4HCZA 4KUIA 1WFWA 4RTWA 3M59A 2ED1A 1JEGA 3FJPA 2KY9A 2GQVA 2KRSA 2VKNA 1J3TA 1VQ9T 2DD5A 2FB7A 2PVDB 1VYTA 2HEQA 2XIDA 3CD6T 3QG1A 2HNIA 2LP5A 1HJDA 1G3SA 2CH4A 1M1KC 1SEMA 3VRZA 4PKCC 2QDLA 4QW2A 1QKXA 2PNIA 3CCEQ 1CKAA 2L3SA 1T3SA 3C4SA 1M3CA 3X25B 1X75C 1WHHA 1GRIA 3HKSA 1PC0A 4M78C 3VV0A 2EJFA 2OTLT 5C0MA 2DVEA 5D6XA 1ZA1B 4M77D 4QVDA 2DBMA 2QA4A 2RF0A 3H9NA 2V8KA 3MEUA 5GAN4 3I5RA 1WHKA 4DBRA 5GMKj 2HKQB 4FM4B 4J83A 4QVZA 2DE0X 3ZFJA 1D1AA 4PLIA 5IHNA 5IHIA 3V7SA 4MMKA 1QVFS 3FJ5A 4FYXB 3I56Q 2VUBA 4M77B 3QZ9B 5FW9A 3EGXB 2VGNA 3OMGA 4FT2A 3OYEA 4PJLA 1SG5A 1YJNT 2RH2A 5I22A 1VQ7T 2EBPA 2VV5A 2A28A 1AWOA 5HY6A 4M7AG 3NFCA 2R58A 4C92G 2KNBB 2VASA 3CC7T 1K0XA 4BE1A 1KJWA 2X4WA 4A4KA 4M75G 3LH0A 5IXFA 2LNVA 3CPWP 2JTFA 1GFCA 2LJ3A 1QCNA 3CC2Q 4DA4A 1RAIB 2AZSA 4TVRA 5CKFA 2CZ6B 3CC4Q 3OA6A 2KT1A 2A08A 3H0FA 2ROLA 4BB7A 1IZ6A 2LNHB 4J6WA 2A0FB 1C1AA 2AKKA 1WJRA 3EG2A 4M7AE 1NYGA 3RBBB 1PRLC 4QQ6A 2E6ZA 4JZ3A 2F2VA 1BK2A 1BU1A 2JZ2A 4MZMA 4JRPA 2A3LA 2DEUA 3M4YA 1AOJA 1PKTA 3EG0A 1GBRA 3CCJQ 3OYGA 2JT4A 4M75E 2J6FA 4Z88A 4Y91A 4A54A 1WIEA 5IAYA 4F7UB 1Q7YR 3J80E 2BZXA 4JRIA 1YJWA 4LD9K 4GLMA 4MZPA 4A4FA 2ZPIB 3VKIA 3QYGB 4BD3A 4HVVA 4IIOA 2BUDA 4KRTA 1R0BG 2R5AA 1EIFA 1TOVA 2KRNA 1RLPC 4QQGA 1R0CB 2VYTA 2V26A 4NL2A 3TEEA 3RDVA 3TSZA 2RK1A 1NPRA 1YITT 3CPFA 5CKHA 2KXDA 5LJ3g 5GAOr 3RMSA 5DLOA 1K73R 4KGZB 3A8HB 2WSFE 1OULA 2FRWA 3TCJA 5FLXE 4FSSA 4ZGEB 1EFNA 1KC8R 3JCMP 1YHQA 2FHDA 4ZNXA 1FMKA 2DJZA 2E12A 1TUDA 4C0DB 2HAXA 1B7TA 2PUKB 1IGQA 4M7DG 2XICA 5LJ5j 1D09B 1QWFA 2JW4A 3CCVT 4ZGDB 2RI5A 4M7AF 1G2BA 4ZTFA 2E70A 1UE9A 4DBQA 2XK0A 3TVTA 1B07A 1NZ9A 4KGVB 3AHUA 1KK7A 3BFMA 1VQPA 1BIAA 3PVQA 2DTIA 1M2VA 4EDUA 2L3PA 1UJ0A 4RMOA 2CP7A 2O01E 2YRDA 1E6GA 4M75F 3L2ZA 3H6ZA 1VQOT 1WGSA 3CMET 3O5ZA 2AIRB 3MP8A 3QZ5B 2JVVA 1W6XA 1I5LA 3FDRA 3FB9A 1SRLA 3UPUA 4RKUE 1W70A 3CPWS 4LDWA 2O88A 2K57A 4F16A 3I55T 1Y7XA 1VQ8T 1UHFA 3CCLA 4QKUA 2ZGWA 1FX7A 5LJ3e 3CBOA 4DQ2A 5ECAA 2XDDA 2CYZB 2XDBA 1GFDA 4KGXB 2EYWA 3CXCS 3PMIA 3X26B 2F69A 1I0CA 1GCQA 4AFZC 1FWZA 4LNPA 1WX6A 4AG2C 2W10A 2YHTA 2LT1A 3WXMB 1PM3A 1MMGA 2V1RA 2YUQA 4M7AD 2LCCA 2VXEA 5KE2A 1YIJT 1JU5C 1QVPA 4C92D 3M57A 5A0GA 4DOVA 4ZTJA 3CCET 1AWJA 4OMMA 3OYNA 1OOTA 2K3YA 2MMPA 2RQVA 3LYIA 1NG2A 2CS7A 4EMKB 4M75D 2YLBA 2IVWA 3UA7A 3MCAB 1D3BB 1ZBXA 1G3YA 2O4XB 3AT1B 3QUIA 1U8RA 4C92B 3G71Q 1AWXA 4OMLA 1O75A 2AK5A 1OEBA 3EHQA 4N0AA 3GF5A 5AT1B 3QWXX 3FC3A 4N4IA 1UUEA 2KBTA 2RI2A 3M5AA 1Y96B 5KCOA 2PQWA 4BDZA 2KGTA 2EQJA 1VA7A 4JLIA 4ANJA 4C0ZA 2QAZA 8AT1B 4E7ZA 2H3EB 4CC7A 3EGDB 2M1HA 3JB9F 4M77A 1FMWA 3EGXA 4JJCA 1HD3A 5KYUB 4XK8E 3F70A 2CZ0B 4PJOG 2YUPA 5I11A 3ZL7C 1UGPB 3GNGA 1Q81U 5KCHA 4OMQA 3CMAA 2K7AA 2LQWA 2IIMA 1QVFA 2G3RA 2RHUA 3M56A 1FXXA 1GCQC 1QVGP 2RHYA 3OMCA 1AZGB 2GNCA 3SWNB 1ABQA 4RCCA 2DL7A 2OTJQ 2YWWA 3C95A 2CUBA 2F5TX 1VQ5A 3PE0A 3CC4T 2DM1A 4WTOB 5HCKA 2CREA 3QWYA 5CQXA 3PIPA 2QASA 5GAN3 5GMKh 2QTXA 1VQ9A 3CD6A 4XQ3A 2KQWA 4XTWA 2P4TA 5LJ5f 2QK0A 2MPXC 4OVAA 1VQ4Q 3CBMA 1XNIA 3FRNA 2RI3A 2E64A 1X6BA 4C8QE 2RO0A 2NLUA 3NTIA 2D9TA 3CCJT 2DA9A 2VVKA 1M27C 2KR3A 5GANg 2LQNA 2CT4A 1QLYA 4Y28E 1G8XA 2OTLA 2EYQA 5I21A 3JCMd 2JN0A 1QVFP 1RAGB 2HL5C 1OZ2A 1KG1A 4M7DD 4ORZA 1G5VA 3E9FA 4F7UA 4M77C 1GBQA 3SB2A 4F17A 4LXCA 3RUXA 1K76A 4II1A 4J7FA 3NTKA 3A8OB 4L6V5 2X51A 5DM7R 2KE9A 1YCYA 4UC4A 3OYFA 2M0OA 4AMCA 3QIIA 2ZPHB 4M7DB 3M0TA 3CCRQ 1PHTA 3QKJA 3HPWA 1UGRB 2NUTB 4PJNA 3HRSA 2JTEA 1S1NA 2PVGB 4EMGA 2D1XA 3CCMQ 4J6XA 2L89A 3C94A 2L0AA 1QP2A 3BE3A 2LQKA 2O9VA 1M8VA 1ZQ1A 2E10A 1WA7A 2QA4Q 1F1BB 4XU1A 3EG9B 3DKMA 1N6AA 5GAN6 1IHWA 4PFOA 4FU6A 2EVRA 3OYAA 1WLPB 1NEGA 4PJJA 2DXCA 1X69A 2F2WA 3GIBA 3I9QA 9ATCB 3VS5A 1XTDA 5IT9E 1PG5B 5EG2A 5IXBA 2MOXA 1NJIR 1M90R 2EGAA 3EHRA 4C8QF 2C0TA 3HHTB 4LDYA 5GANe 1NLPC 3R6OA 1RI0A 3ZEHA 4AFSC 2ESWA 1X6OA 1YWOA 3JCMb 2DBKA 1RLQC 2L8DA 3A5ZB 3GLXA 1T3LA 2AZVA 4FL6A 1KIKA 4JLGA 1KFZA 1UEBA 3MP6A 4B6MA 1HXDA 2DRMA 4BUGA 2HSEB 1M1KU 1QVGS 2GTOA 5DLQE 3DLLA 4ZN3A 3GPLA 2XG8D 3OYJA 4CC2A 3I5SA 1H641 4CC4B 4QQDA 1VQLA 3C0CA 2DVJA 1RABB 3JCMJ 1WQ7A 5LJ5h 2DD4A 1VYUA 1UGQB 4IUTA 1Y71A 1OZ3A 3I35A 2GCXA 2OX7A 1YITA 1OU9A 1RAAB 1HSQA 4M78E 3CPWA 3V7RA 5KYXB 2HL3A 1B34B 2L2PA 7AT1B 2AHJB 3OYCA 5GMKm 1OPLA 3MHXA 4OB0B 4PJOD 4HCBA 3N5BB 4WF2A 3VRYA 4LDXA 3OYLA 2FL7A 1NYFA 2EPDA 4C0DC 1BIBA 1VIFA 4MZTA 3EG3A 2FO0A 1RAHB 3CXCA 3DB3A 1ZSZC 2WSCE 1ZUYA 2RQUA 2QEXT 2ZZDA 2QYZA 4FCYA 2JMCA 4EMKA 4PJOB 2EW3A 1D3BA 3VU3C 2H8HA 1NPPA 2IPOB 5CO7A 3G71T 2Y4XA 3GP8A 1KC8U 2K79A 2PZ1A 3CCVA 1ZHIA 2RJFA 2O4XA 1QQJA 4NS5A 3M0PA 3SHWA 4X9CA 4C92A 1K73C 1MMAA 5GAMg 1U5SA 1AD5A 4OP0A 2QQRA 3PNWC 4IIMA 3RMQA 3OQ5A 1B3QA 1KC8C 1U3OA 2CP5A 1Y96A 1N27A 4PL6A 2QDYB 4E47A 3JCMc 4BI4A 1YHQQ 4GLKA 3OS0A 5A2QE 3EGDA 2PVOB 4RCBA 1LVKA 5CIUA 2EWNA 2QQBA 1JBMA 5KYUA 2DXTA 1OU8A 3PFSA 1X43A 4F14A 4C0FA 1NE8A 2B8AA 3CXCP 1N5ZA 3I55A 3VS3A 2EQKA 3KXTA 4DEYA 2RNAA 2E5QA 1ZA2B 5M9OA 1R8OB 2XI9A 3J81E 1BBZA 1H92A 2OTJT 2V8JA 1VQPQ 5FU6B 2I2LA 3HL8A 2I0NA 4RG8A 2P84A 4M78F 1D1BA 1WZOA 2D0NA 3SWNA 1T0JA 1T0HA 3ASKA 5GAOm 2DERA 2J7IA 3LGFA 3BY7A 3OW2S 2M16A 2JM9A 4HCCA 4XTYA 1WHJA 1MGQA 1WHGA 1X01A 2BKDN 3HRUA 5GMKl 2CP0A 2KYMA 2V8IA 3QDRB 4EMKC 1VQ6Q 1YIJA 3VYHB 1MMNA 1OQKA 2E4HA 1VQ4T 1JJ2S 1ZSGA 2OI3A 3A8LB 4Z02A 3CCEA 4IKFA 5GAOp 4C92C 4IUQA 2COYA 1WDXA 5I2SA 3CCUQ 1XOVA 3CCLQ 3KFVA 1R77A 2JS0A 2KVQG 3WVEB 1NEBA 5GAMe 1YN8A 4L5GA 4NL3A 1PWTA 3G6EQ 2BTTA 1PSFA 1AHJB 1V76A 2MIOA 2JOYA 4FW2A 4EMHA 1S72Q 2B86A 3L42A 1JB0E 2LTOA 3S3NA 2OAWA 3A1PA 1BI1A 3NTHA 2EAYA 1K4US 3VJPA 3UT1A 2KK4A 2KMTA 3CCRT 3X20B 3JB9G 3M4GA 2HMAA 4M7DA 3X24B 4JS4A 4J9CA 1M2OA 1K1ZA 3EFSA 5D6WA 2X3XD 3CCMT 1HK9A 2HCKA 2NUTA 2JMAA 2VGMA 1ZSZB 3SWNC 2QA4T 2JJ9A 2YDLA 2RD1A 2NWMA 4C5EA 5CK9A 2VWFA 2E5KA 4KT0E 3RKXA 5IH2A 3G4SA 4C5GA 3EG9A 3L2QA 3WVDB 2JTMA 1M9SA 1X6GA 4OB1B 2ZAEA 3CC4A 2RHXA 1E7OA 4E7LA 3GOXA 2JNGA 2RHIA 2GBQA 5CKDA 5CAIA 1BCMA 4N4HA 1EX4A 2CP3A 1W2BS 5L23A 2E6NA 2QGGA 5LJ3f 3E9GA 2ATCB 2DRKA 3SFMA 4ELZC 2EFIA 4PJMA 3UF4A 1M30A 2RK2A 2E3HA 2ZCFB 2J05A 5GAOq 1VQNQ 2K4YA 2DL3A 1LPLA 4CI0C 4EPCA 1UJYA 1YJ9T 1KHCA 2EIFA 2XKOC 1PSEA 2OJ2A 2NUPB 4FYWB 2X35A 4J9HA 4A53A 3VS1A 2J6KA 2HDAA 1VQ5Q 1WI7A 3QSUA 4J7IA 1OYXA 2EYXA 3CCSQ 1UGVA 1WNLA 2JS2A 1BI0A 5GMKe 3JAME 1Q82R 2CSQA 3NPFA 4M7DC 4LE9A 4HVWA 5LJ3d 5KE3A 5IN1A 1VQKA 4L59A 2V1QA 2DZCA 3L2WA 3SEMA 3OSSC 3VS2A 2F2XA
chains in the Genus database with same CATH topology
4LUDA 3VRZA 2LJ0A 4ORZA 1OV3A 2EGEA 2QDLA 1QKXA 2PNIA 3M0SA 1GBQA 4HXJA 1CKAA 1FYNA 2G6FX 2L3SA 1T3SA 4F17A 4QT7A 1M3CA 1K76A 2DL5A 2GGRA 1NLOC 1GRIA 1QWEA 2KE9A 2BZ8A 1AZEA 2DBMA 1E6HA 2RF0A 3M0TA 3I5RA 1YCSB 3REBB 1PHTA 4HCKA 1H8KA 4WCIA 2O31A 1X27A 2DE0X 1M3BA 2JTEA 5IHNA 1S1NA 2ABLA 5IHIA 3H0IA 3VS6A 2D1XA 2O9SA 3FJ5A 2K6DA 1Z9ZA 2L0AA 3EG1A 1I07A 2O9VA 1ZUKA 1MUZA 1YP5A 5FW9A 2P4RA 1WA7A 1M3AA 4J9DA 1MV3A 5I22A 1CKBA 2EBPA 2A28A 1AWOA 2CT3A 4CC3A 1MV0B 1H3HA 2EVRA 1WLPB 1ZUUA 1NEGA 2KNBB 2J06A 1X69A 2F2WA 1K0XA 3I9QA 2JXBA 1KJWA 2JM8A 3VS5A 1JO8A 4JPBW 5IXFA 1SSHA 5IXBA 2MOXA 1AVZC 3REAB 4J9IA 1GFCA 2EGAA 2LJ3A 2M0YA 2X3WD 2KRMA 3EHRA 4E6RA 3CQTA 1ABOA 4LN2A 2C0TA 5FWBA 2AZSA 1A0NB 1NLPC 2C0OA 4D8KA 4AFSC 2ESWA 1YWOA 3UA6A 1YWPA 2DBKA 2KT1A 2A08A 1RLQC 3H0FA 2ROLA 2J6OA 2LNHB 1T3LA 2AZVA 5GJVB 1KIKA 1PKSA 1KFZA 2RPNA 2AKKA 2DJQA 3EG2A 1NYGA 3RBBB 1PRLC 2D8JA 2DRMA 2CH4W 4JZ3A 2F2VA 1AEYA 1WXBA 1BK2A 2ENMA 1BU1A 2A37A 2GTOA 2C0IA 4CC2A 1AOJA 4RTZA 1PKTA 3EG0A 1G83A 3I5SA 1GBRA 4JJDA 4J9GA 3M0QA 4CC4B 2JT4A 4Z89A 2J6FA 4Z88A 3UATA 4HVUA 4J9EA 1WIEA 1QKWA 1X2KA 3C0CA 4X1VA 2DVJA 4M4ZA 4RTXA 2KROA 1IO6A 3IQLA 2BZXA 4K11A 1VYUA 4GLMA 2DILA 4RTTA 3THKA 3I35A 3U23A 2YUOA 1HSQA 2EYZA 2L2PA 4HVVA 4IIOA 2GTJA 1OPKA 4KRTA 1OPLA 2KXCA 3TSWA 3VRYA 2KRNA 1NYFA 1RLPC 2EPDA 1I1JA 1X2QA 2YT6A 3EG3A 2FO0A 2CDTA 3TSZA 1K9AA 1ZUYA 2RQUA 1Y57A 2FPEA 2KXDA 2W0ZA 2EKHA 4Z8AA 1ARKA 3NHNA 4J9FA 2JMCA 2EW3A 2ECZA 1UG1A 2AKLA 2FRWA 2H8HA 1GL5A 1NM7A 2K79A 2FPFA 2HSPA 2PZ1A 4FSSA 1ZLMA 3VS0A 1EFNA 3M0PA 3SHWA 1AWWA 4ZNXA 1FMKA 1U5SA 1AD5A 1TUDA 2ROTA 4IIMA 4AG1C 1B3QA 1M8MA 1K0SA 1U3OA 1QWFA 2JW4A 4OMPA 3RNJA 3M0UA 3A98A 2DNUA 1G2BA 1UE9A 3TVTA 1B07A 1VYVA 2LMJA 3PVQA 4RTUA 1WXTA 1PNJA 1SHGA 2KT8A 2L3PA 1UJ0A 2CSIA 4F14A 1X43A 1E6GA 2PTKA 2K3BA 3NMZC 1N5ZA 3ULRB 3VS3A 2XMFA 3O5ZA 4DEYA 3EGUA 2RNAA 1WXUA 2YSQA 1JXMA 1ZBJA 1BBZA 1H92A 1W6XA 2I0NA 1WYXA 1SRLA 2SRCA 2D0NA 1T0JA 1T0HA 1W70A 3JV3A 2J7IA 1PRMC 2O88A 2DYBA 4ESRA 2O2OA 4F16A 2FRYA 2JM9A 4Y92A 1QCFA 1UHFA 1V1CA 4RTVA 5GJWB 2KYMA 3PVLA 5ECAA 1YNZA 3H0HA 1GFDA 2EYWA 1ZSGA 2OI3A 3H41A 1I0CA 1GCQA 1SHFA 4AFZC 4D8DA 4LNPA 4R0KA 1WX6A 4OMOA 4AG2C 2W10A 1Y0MA 1WDXA 2D8HA 2V1RA 1XOVA 2YUQA 2GQIA 3KFVA 3VS7A 1UTIA 2L3QA 2JS0A 1NEBA 1YN8A 5IHKA 1JU5C 2KEAA 1PWTA 2BTTA 2A36A 1BB9A 2MIOA 2CUDA 1AWJA 5FWCA 1U06A 4OMMA 1OOTA 2RQVA 2B86A 1NG2A 3UA7A 2LZ6B 4LUEA 1LCKA 2LJ1A 2OAWA 1W1FA 2DLPA 4A63B 2EYYA 1K4US 1AWXA 2MCNA 4OMLA 2RN8A 1Z9QA 1CSKA 2AK5A 4J9BA 1OEBA 3EHQA 2NUZA 1TG0A 3QWXX 2RMOA 4J9CA 1K1ZA 1UUEA 2KBTA 2X3XD 2DF6A 2HBWA 1UECA 3NGPA 1GCPA 2DL8A 2HCKA 2JMAA 2KGTA 2DMOA 1VA7A 2K9GA 4JZ4A 1RI9A 2YDLA 4CC7A 4DEXA 2NWMA 2VWFA 4JJBA 4JJCA 1HD3A 2SEMA 2E5KA 5IH2A 2YUPA 5I11A 3ZL7C 3M0RA 2KYBA 1X6GA 4OMQA 2RQRA 2K7AA 1UFFA 2FG0A 2LQWA 1E7OA 2IIMA 2RQWA 2K2MA 4EIKA 1JQQA 1GCQC 4RTYA 4AFUC 2GBQA 1AZGB 2DX1A 5L23A 1TUCA 2GNCA 4GBQA 2DRKA 1ABQA 2DL7A 1SPKA 2CUBA 3UF4A 1M30A 3PE0A 2J05A 1KSWA 2RQTA 2DM1A 2DL3A 5HCKA 2DL4A 1ZX6A 3LH5A 2CREA 3QWYA 1UJYA 1UHCA 2EQIA 2OJ2A 5EC7A 1UDLA 1JXOA 4J9HA 3GBQA 2LCSA 2YUNA 3VS1A 2J6KA 2HDAA 1WI7A 4OMNA 4RUGA 2FPDA 2EYXA 3R6NA 3VS4A 1UGVA 2JS2A 1X6BA 2M51A 2FEIA 1WFWA 4RTWA 1SRMA 2CSQA 2DA9A 4AFQC 2ED1A 1JEGA 2VVKA 3NPFA 4LE9A 1M27C 1RUWA 4HVWA 2KRSA 2KR3A 2VKNA 2LQNA 1J3TA 2BZYA 1QLYA 2CT4A 2LX7A 1VYTA 2HEQA 2V1QA 2ED0A 2EGCA 2LP5A 1HJDA 2CH4A 3SEMA 3VS2A 2F2XA 1SEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUD A;  3VRZ A;  2LJ0 A;  4ORZ A;  1OV3 A;  2EGE A;  2QDL A;  1QKX A;  2PNI A;  3M0S A;  1GBQ A;  4HXJ A;  1CKA A;  1FYN A;  2G6F X;  2L3S A;  1T3S A;  4F17 A;  4QT7 A;  1M3C A;  1K76 A;  2DL5 A;  2GGR A;  1NLO C;  1GRI A;  1QWE A;  2KE9 A;  2BZ8 A;  1AZE A;  2DBM A;  1E6H A;  2RF0 A;  3M0T A;  3I5R A;  1YCS B;  3REB B;  1PHT A;  4HCK A;  1H8K A;  4WCI A;  2O31 A;  1X27 A;  2DE0 X;  1M3B A;  2JTE A;  5IHN A;  1S1N A;  2ABL A;  5IHI A;  3H0I A;  3VS6 A;  2D1X A;  2O9S A;  3FJ5 A;  2K6D A;  1Z9Z A;  2L0A A;  3EG1 A;  1I07 A;  2O9V A;  1ZUK A;  1MUZ A;  1YP5 A;  5FW9 A;  2P4R A;  1WA7 A;  1M3A A;  4J9D A;  1MV3 A;  5I22 A;  1CKB A;  2EBP A;  2A28 A;  1AWO A;  2CT3 A;  4CC3 A;  1MV0 B;  1H3H A;  2EVR A;  1WLP B;  1ZUU A;  1NEG A;  2KNB B;  2J06 A;  1X69 A;  2F2W A;  1K0X A;  3I9Q A;  2JXB A;  1KJW A;  2JM8 A;  3VS5 A;  1JO8 A;  4JPB W;  5IXF A;  1SSH A;  5IXB A;  2MOX A;  1AVZ C;  3REA B;  4J9I A;  1GFC A;  2EGA A;  2LJ3 A;  2M0Y A;  2X3W D;  2KRM A;  3EHR A;  4E6R A;  3CQT A;  1ABO A;  4LN2 A;  2C0T A;  5FWB A;  2AZS A;  1A0N B;  1NLP C;  2C0O A;  4D8K A;  4AFS C;  2ESW A;  1YWO A;  3UA6 A;  1YWP A;  2DBK A;  2KT1 A;  2A08 A;  1RLQ C;  3H0F A;  2ROL A;  2J6O A;  2LNH B;  1T3L A;  2AZV A;  5GJV B;  1KIK A;  1PKS A;  1KFZ A;  2RPN A;  2AKK A;  2DJQ A;  3EG2 A;  1NYG A;  3RBB B;  1PRL C;  2D8J A;  2DRM A;  2CH4 W;  4JZ3 A;  2F2V A;  1AEY A;  1WXB A;  1BK2 A;  2ENM A;  1BU1 A;  2A37 A;  2GTO A;  2C0I A;  4CC2 A;  1AOJ A;  4RTZ A;  1PKT A;  3EG0 A;  1G83 A;  3I5S A;  1GBR A;  4JJD A;  4J9G A;  3M0Q A;  4CC4 B;  2JT4 A;  4Z89 A;  2J6F A;  4Z88 A;  3UAT A;  4HVU A;  4J9E A;  1WIE A;  1QKW A;  1X2K A;  3C0C A;  4X1V A;  2DVJ A;  4M4Z A;  4RTX A;  2KRO A;  1IO6 A;  3IQL A;  2BZX A;  4K11 A;  1VYU A;  4GLM A;  2DIL A;  4RTT A;  3THK A;  3I35 A;  3U23 A;  2YUO A;  1HSQ A;  2EYZ A;  2L2P A;  4HVV A;  4IIO A;  2GTJ A;  1OPK A;  4KRT A;  1OPL A;  2KXC A;  3TSW A;  3VRY A;  2KRN A;  1NYF A;  1RLP C;  2EPD A;  1I1J A;  1X2Q A;  2YT6 A;  3EG3 A;  2FO0 A;  2CDT A;  3TSZ A;  1K9A A;  1ZUY A;  2RQU A;  1Y57 A;  2FPE A;  2KXD A;  2W0Z A;  2EKH A;  4Z8A A;  1ARK A;  3NHN A;  4J9F A;  2JMC A;  2EW3 A;  2ECZ A;  1UG1 A;  2AKL A;  2FRW A;  2H8H A;  1GL5 A;  1NM7 A;  2K79 A;  2FPF A;  2HSP A;  2PZ1 A;  4FSS A;  1ZLM A;  3VS0 A;  1EFN A;  3M0P A;  3SHW A;  1AWW A;  4ZNX A;  1FMK A;  1U5S A;  1AD5 A;  1TUD A;  2ROT A;  4IIM A;  4AG1 C;  1B3Q A;  1M8M A;  1K0S A;  1U3O A;  1QWF A;  2JW4 A;  4OMP A;  3RNJ A;  3M0U A;  3A98 A;  2DNU A;  1G2B A;  1UE9 A;  3TVT A;  1B07 A;  1VYV A;  2LMJ A;  3PVQ A;  4RTU A;  1WXT A;  1PNJ A;  1SHG A;  2KT8 A;  2L3P A;  1UJ0 A;  2CSI A;  4F14 A;  1X43 A;  1E6G A;  2PTK A;  2K3B A;  3NMZ C;  1N5Z A;  3ULR B;  3VS3 A;  2XMF A;  3O5Z A;  4DEY A;  3EGU A;  2RNA A;  1WXU A;  2YSQ A;  1JXM A;  1ZBJ A;  1BBZ A;  1H92 A;  1W6X A;  2I0N A;  1WYX A;  1SRL A;  2SRC A;  2D0N A;  1T0J A;  1T0H A;  1W70 A;  3JV3 A;  2J7I A;  1PRM C;  2O88 A;  2DYB A;  4ESR A;  2O2O A;  4F16 A;  2FRY A;  2JM9 A;  4Y92 A;  1QCF A;  1UHF A;  1V1C A;  4RTV A;  5GJW B;  2KYM A;  3PVL A;  5ECA A;  1YNZ A;  3H0H A;  1GFD A;  2EYW A;  1ZSG A;  2OI3 A;  3H41 A;  1I0C A;  1GCQ A;  1SHF A;  4AFZ C;  4D8D A;  4LNP A;  4R0K A;  1WX6 A;  4OMO A;  4AG2 C;  2W10 A;  1Y0M A;  1WDX A;  2D8H A;  2V1R A;  1XOV A;  2YUQ A;  2GQI A;  3KFV A;  3VS7 A;  1UTI A;  2L3Q A;  2JS0 A;  1NEB A;  1YN8 A;  5IHK A;  1JU5 C;  2KEA A;  1PWT A;  2BTT A;  2A36 A;  1BB9 A;  2MIO A;  2CUD A;  1AWJ A;  5FWC A;  1U06 A;  4OMM A;  1OOT A;  2RQV A;  2B86 A;  1NG2 A;  3UA7 A;  2LZ6 B;  4LUE A;  1LCK A;  2LJ1 A;  2OAW A;  1W1F A;  2DLP A;  4A63 B;  2EYY A;  1K4U S;  1AWX A;  2MCN A;  4OML A;  2RN8 A;  1Z9Q A;  1CSK A;  2AK5 A;  4J9B A;  1OEB A;  3EHQ A;  2NUZ A;  1TG0 A;  3QWX X;  2RMO A;  4J9C A;  1K1Z A;  1UUE A;  2KBT A;  2X3X D;  2DF6 A;  2HBW A;  1UEC A;  3NGP A;  1GCP A;  2DL8 A;  2HCK A;  2JMA A;  2KGT A;  2DMO A;  1VA7 A;  2K9G A;  4JZ4 A;  1RI9 A;  2YDL A;  4CC7 A;  4DEX A;  2NWM A;  2VWF A;  4JJB A;  4JJC A;  1HD3 A;  2SEM A;  2E5K A;  5IH2 A;  2YUP A;  5I11 A;  3ZL7 C;  3M0R A;  2KYB A;  1X6G A;  4OMQ A;  2RQR A;  2K7A A;  1UFF A;  2FG0 A;  2LQW A;  1E7O A;  2IIM A;  2RQW A;  2K2M A;  4EIK A;  1JQQ A;  1GCQ C;  4RTY A;  4AFU C;  2GBQ A;  1AZG B;  2DX1 A;  5L23 A;  1TUC A;  2GNC A;  4GBQ A;  2DRK A;  1ABQ A;  2DL7 A;  1SPK A;  2CUB A;  3UF4 A;  1M30 A;  3PE0 A;  2J05 A;  1KSW A;  2RQT A;  2DM1 A;  2DL3 A;  5HCK A;  2DL4 A;  1ZX6 A;  3LH5 A;  2CRE A;  3QWY A;  1UJY A;  1UHC A;  2EQI A;  2OJ2 A;  5EC7 A;  1UDL A;  1JXO A;  4J9H A;  3GBQ A;  2LCS A;  2YUN A;  3VS1 A;  2J6K A;  2HDA A;  1WI7 A;  4OMN A;  4RUG A;  2FPD A;  2EYX A;  3R6N A;  3VS4 A;  1UGV A;  2JS2 A;  1X6B A;  2M51 A;  2FEI A;  1WFW A;  4RTW A;  1SRM A;  2CSQ A;  2DA9 A;  4AFQ C;  2ED1 A;  1JEG A;  2VVK A;  3NPF A;  4LE9 A;  1M27 C;  1RUW A;  4HVW A;  2KRS A;  2KR3 A;  2VKN A;  2LQN A;  1J3T A;  2BZY A;  1QLY A;  2CT4 A;  2LX7 A;  1VYT A;  2HEQ A;  2V1Q A;  2ED0 A;  2EGC A;  2LP5 A;  1HJD A;  2CH4 A;  3SEM A;  3VS2 A;  2F2X A;  1SEM A; 
#chains in the Genus database with same CATH topology
 4LUD A;  3EFO B;  2LJ0 A;  1OV3 A;  3QDF A;  3M0S A;  4HXJ A;  1FYN A;  1QMC A;  1QVG A;  3VUZ A;  2ZPF B;  1TTH B;  4QT7 A;  2DL5 A;  4KH0 B;  2YRV A;  4E7J A;  1LJO A;  4M7A B;  1QWE A;  1WJS A;  3TU4 K;  5KYX A;  1RAE B;  1AZE A;  1VQM Q;  1B34 A;  4F04 B;  1K8A U;  1E6H A;  4HA8 A;  4HCK A;  1YI2 Q;  2GFA A;  2O31 A;  3P8H A;  4M75 B;  5FRM A;  4DOW A;  1M3B A;  3OBY A;  4XU2 A;  2ABL A;  3I56 T;  2K6D A;  1Z9Z A;  4BI3 A;  1I07 A;  1ZUK A;  1MUZ A;  3QHS A;  1K8A C;  2P4R A;  2E41 A;  2H3J A;  1M3A A;  1K9M R;  3MEW A;  4PJO A;  3CCQ Q;  1OI1 A;  3LWH A;  3BDU A;  4ZN1 A;  1H3H A;  5LJ5 g;  1OX8 A;  5CQY A;  4HKE A;  1ZUU A;  2RA2 A;  3OYH A;  4C8Q G;  2COZ A;  3O8V A;  2DEQ A;  3MEA A;  1M90 U;  1JO8 A;  4JPB W;  1SSH A;  1YHQ T;  1AVZ C;  3REA B;  4J9I A;  3CC2 T;  2M0Y A;  3URG A;  3ER0 A;  4E6R A;  3CQT A;  1ABO A;  1PD0 A;  4RG2 A;  5FWB A;  4XU3 A;  1A0N B;  3JCM f;  1IHV A;  4D8K A;  3ME9 A;  1NJI C;  1M90 C;  1TWB A;  5FRO A;  4V2S A;  2LT4 A;  1Y07 A;  2X9H A;  2RB6 A;  5GJV B;  1BYM A;  1PKS A;  1HYO A;  1PD1 A;  2RPN A;  1SSF A;  5LJ3 h;  4BE0 A;  2DJQ A;  2CH4 W;  1WXB A;  3M53 A;  2YRC A;  2A37 A;  5KH6 A;  2C0I A;  1I8F A;  4RTZ A;  3JCM X;  1G83 A;  4JJD A;  4CRI A;  3M0Q A;  4FYV B;  2QQA A;  3JB9 D;  3UAT A;  4HVU A;  4J9E A;  1QKW A;  1X2K A;  1VQ6 T;  2MK5 A;  2HQX A;  4M4Z A;  4RTX A;  2KRO A;  4M77 E;  3IQL A;  5GAN 7;  1EZZ B;  5KYW B;  5FU7 B;  4PJO C;  4ELY C;  4OGE A;  3M55 A;  3U23 A;  2QEX A;  3HFN A;  2DXU A;  2EYZ A;  3OW2 A;  3CCU T;  3CCL T;  2GTJ A;  5LL6 S;  1VQL Q;  1U1S A;  4P5N A;  2PUO B;  3LLR A;  2DIQ A;  1MHN A;  1U1T A;  2OAU A;  3TSW A;  1IRE B;  4E7S A;  3G6E T;  5LJ5 e;  3G71 A;  5HK0 A;  1Q86 R;  1I1J A;  1X2Q A;  2XU8 A;  2YT6 A;  2EJ9 A;  1VIE A;  1YJN A;  3RR6 A;  1VQ7 A;  1JJ2 A;  1K9A A;  1S72 T;  2GFU A;  3QBY A;  2COW A;  2W0Z A;  4JRK A;  2HBP A;  4Z8A A;  1ARK A;  3S6W A;  3NHN A;  4FT4 A;  3QO3 A;  3CC7 A;  1UG1 A;  1NM7 A;  2HSP A;  2R57 A;  4ME7 A;  1ZLM A;  2E1H A;  4A4G A;  2BE7 D;  3OS2 A;  2D0Q B;  2ROT A;  5GAN f;  2VXF A;  3EFR A;  1RL2 A;  3QJ6 A;  4DBH A;  1VUB A;  1M8M A;  3QPH A;  5FU6 C;  2CZ7 B;  2DTH A;  1TS9 A;  2DNU A;  3GNF B;  4C0G A;  4N4G A;  1ZSZ A;  4XU0 A;  3OW2 P;  1N9S A;  1N8R R;  5FRN A;  1MMD A;  3L2V A;  2LMJ A;  1PNJ A;  4PNO A;  4F7U E;  5A0L A;  3OYY A;  4M78 G;  1Q81 R;  1JJ2 P;  4BY6 B;  2XMF A;  1I81 A;  4C5I A;  4M77 F;  3EGU A;  1JXM A;  1ZBJ A;  5GAN d;  3E1S A;  3S3M A;  2LX9 A;  3BDL A;  4VUB A;  3LGL A;  3JCM V;  2MYS A;  1WYX A;  1VQN T;  2SRC A;  3JCM h;  3JV3 A;  2D6F A;  2DYB A;  4ESR A;  5J3B A;  2XDP A;  2FRY A;  4Y92 A;  5GAO n;  1WHL A;  4Q5W A;  2M02 A;  4FW1 A;  5HKC A;  4MDW A;  1IRX A;  2LQ8 A;  3C12 A;  4RTV A;  1Q7Y U;  2K5I A;  5GJW B;  5DY9 A;  3QXE B;  1W2B A;  3PVL A;  2NUP A;  3OY9 A;  4PLL A;  1YNZ A;  3H0H A;  4JJN K;  1H3Z A;  2DK3 A;  5CCA A;  2FZC B;  3CCS T;  2C06 A;  2A7Y A;  1SHF A;  5D6Y A;  4OMO A;  1PCX A;  2RJD A;  1Y0M A;  3JCM Q;  3V8L A;  3LWI A;  5I2M A;  1Q7Y C;  3VS7 A;  1GXI E;  1KD1 R;  2DKG A;  2MF2 A;  3MJX A;  3INZ A;  2DAQ A;  1YIJ Q;  5IHK A;  2VB6 A;  2KEA A;  2A36 A;  1BB9 A;  3CCR A;  1YJW Q;  4C8Q D;  2CUD A;  4ZGJ B;  4OMF B;  5FWC A;  1U06 A;  3G7Z A;  2XD0 A;  1TH7 A;  3EFO A;  2K5F A;  1K73 U;  1TU0 B;  4IUV A;  2QQS A;  1WHM A;  3CCM A;  5LJ3 j;  1LCK A;  4FSX A;  1W1F A;  2DLP A;  1VQM T;  1O9S A;  4A63 B;  6AT1 B;  4LDU A;  4M7A A;  1Z9Q A;  4KH1 B;  1CSK A;  4PFZ A;  4C8Q B;  1TXQ A;  1YI2 T;  4O5V A;  2FZG B;  2LRQ A;  2NUZ A;  4F7U F;  3JB9 J;  2FYK A;  1P92 A;  2DZ9 A;  2R5M A;  1W2B P;  2DF6 A;  2HBW A;  3A8G B;  3NGP A;  1GCP A;  4HT9 A;  1G3W A;  2DL8 A;  4AT1 B;  4M75 A;  2FVU A;  3E19 A;  3FIF A;  4ATO A;  3MPU B;  1D0Y A;  2K9G A;  1RI9 A;  3CCQ T;  1M1G A;  1KHI A;  4JRQ A;  1VQO A;  3CME A;  4JJB A;  3OSV A;  2P0Q A;  2SEM A;  2ZPE B;  4A4H A;  3M0R A;  1KQS S;  4YTL A;  2EQU A;  2KYB A;  4X34 A;  2RJE A;  5GAN h;  2RQR A;  2X4J A;  2K2M A;  4EIK A;  4RTY A;  3OYD A;  1YJ9 A;  3JB9 I;  1VQ8 A;  5KYN A;  1TUC A;  4KBM B;  5J39 A;  3G4S Q;  4C5H A;  3QJY A;  3OYM A;  1ACM B;  2DL4 A;  2QTV A;  2CZ1 B;  2EQI A;  3RIR A;  2DTO A;  1KQ1 A;  4OB2 B;  1UDL A;  5KYY B;  5GAM f;  3D7S B;  3ZBD A;  3MEV A;  2LCS A;  4J5Y A;  2YUN A;  1D0Z A;  3RKW A;  3M9Q A;  2FPD A;  2LCL A;  4M7A C;  1Q82 U;  4C92 E;  2CP6 A;  3R6N A;  3VS4 A;  5J26 A;  2M51 A;  2EKO A;  2YLC A;  5L8R E;  1M1K R;  3OS5 A;  1SRM A;  1FMV A;  4AFQ C;  1RUW A;  3JSC A;  3HSB A;  2BZY A;  2LX7 A;  1M5Q 1;  2ED0 A;  2EGC A;  4M75 C;  4A4E A;  1Q82 C;  2EGE A;  2IG0 A;  3A8M B;  2G6F X;  2QQ9 A;  5KYW A;  2GGR A;  1NLO C;  3TQ7 P;  1VQL T;  5GAM d;  2KSS A;  1VQK Q;  2BZ8 A;  3I56 A;  3L1A A;  1IGU A;  4E2F B;  2RJC A;  4IUR A;  4BAC A;  1YCS B;  3REB B;  4M78 D;  1H8K A;  1YFN A;  2KAF A;  4WCI A;  1X27 A;  1RAC B;  1SKU B;  4O6J A;  3H0I A;  3VS6 A;  2O9S A;  4KUL A;  1K9M U;  2HQH A;  3EG1 A;  1C0M A;  1YP5 A;  4J9D A;  1MV3 A;  3JB9 H;  1CKB A;  4M78 B;  1LOJ A;  2WSE E;  2CT3 A;  4HT8 A;  3M58 A;  4CC3 A;  3CC2 A;  1MV0 B;  3G1J A;  2KI7 A;  2P0K A;  1WQW A;  2J06 A;  1K9M C;  2JXB A;  5GAO l;  2JM8 A;  3UWN A;  2LC4 A;  1WPY A;  2M9U A;  2YXY A;  3JRZ A;  3MP1 A;  5HK3 A;  1RAD B;  5CKE A;  3J7A F;  2X3W D;  4C92 F;  1N9R A;  2KRM A;  3MKD A;  4NOY A;  4LN2 A;  3T9N A;  5D7U A;  3M54 A;  2C0O A;  4R56 A;  3CMA Q;  2MI6 A;  4E7K A;  2FZK B;  3UA6 A;  3V8K A;  1YWP A;  3OYI A;  1MNE A;  2J6O A;  3X28 B;  3CCJ A;  5FU7 C;  3V7C A;  2QXF A;  1V29 B;  4JUV A;  1VQ6 A;  4QVC A;  2D8J A;  2MWO A;  3VUB A;  3Q1J A;  1AEY A;  2X4X A;  3PT9 A;  2ENM A;  2LDM A;  4PK4 A;  2Z0W A;  4IUP A;  4M7D E;  1SF9 A;  4XTZ A;  4BDY A;  4GY5 A;  2MAM A;  4J9G A;  3CCU A;  4Z89 A;  2KDS A;  4OF1 A;  1VQ9 Q;  5GAN 8;  3CD6 Q;  5GAM h;  5GAN j;  1DJ7 B;  4X1V A;  1BKB A;  3G6E A;  1TSF A;  1IO6 A;  4K11 A;  3V8J A;  2DIL A;  3KUF A;  1C6V X;  4RTT A;  3THK A;  2EQM A;  1S72 A;  2YUO A;  4BI8 B;  3OYB A;  4D6W A;  3CEY A;  3OBW A;  1OPK A;  1Q86 U;  2KXC A;  5GMK i;  3QYH B;  2OTL Q;  5A0D A;  2WAC A;  1VOM A;  3OYK A;  1YJW T;  1JRI A;  4B9W A;  2CDT A;  4JS5 A;  1Y57 A;  2RHZ A;  2FPE A;  1W4S A;  2XHC A;  2QEX Q;  2EKH A;  1Q86 C;  3JCM g;  3S3O A;  1M1F A;  4J9F A;  3MO8 A;  2ECZ A;  2AKL A;  3HP9 A;  1GL5 A;  1LNX A;  2FPF A;  2K5L A;  3PTA A;  3VS0 A;  3FEO A;  1I5O B;  2RM4 A;  4LD6 A;  1YJN Q;  1VQ7 Q;  2HD0 A;  1AWW A;  4C8Q A;  4BE2 A;  2DPP B;  4MDX A;  2DIG A;  3E2U A;  3P8B B;  4BY6 C;  4AG1 C;  2JUF A;  2L3R A;  3L2R A;  3CC7 Q;  1K0S A;  2CP2 A;  1NJI U;  4OMP A;  1N8R U;  3RNJ A;  3M0U A;  3A98 A;  1VYV A;  3L2U A;  4M77 G;  4M7D F;  4RTU A;  1WXT A;  1SHG A;  2KT8 A;  2Y4Y A;  1VQN A;  4PFP A;  5CKB A;  2CSI A;  4E7H A;  2F1L A;  2K3B A;  2PTK A;  3NMZ C;  3PMT A;  4IUU A;  3PIO A;  1N8R C;  3RES A;  3ULR B;  1IXD A;  2QGF B;  1WXU A;  2YSQ A;  3G4S T;  1VQP T;  3EH1 A;  1XJW B;  3BW1 A;  1KQ2 A;  1Q81 C;  3OB9 A;  1QP3 A;  1KQS A;  1NBE B;  3CCS A;  1PRM C;  3HRT A;  2ZPB B;  2O2O A;  3P8D A;  2DFU A;  1QCF A;  2E65 A;  1V1C A;  2NYS A;  2K3X A;  4JDS A;  4PJO E;  1YBY A;  5KYY A;  3JCM e;  4R55 A;  2QI2 A;  3H41 A;  1BI2 A;  3RER A;  4D8D A;  2DXB A;  4R0K A;  4N0A C;  5AYF A;  1KD1 U;  4C8Q C;  8ATC B;  2D8H A;  2GQI A;  3CBP A;  1UTI A;  2L3Q A;  1VQM A;  3DLM A;  3MET A;  1M4Z A;  3VYG A;  4FYY B;  1BCO A;  5CR2 A;  4FIB A;  1YI2 A;  5CVI A;  2BIV A;  5C6S A;  1TUG B;  1YIT Q;  1KD1 C;  2CGH A;  2LVM A;  4F7U G;  2LZ6 B;  1VQK T;  4LUE A;  5LJ5 d;  2LJ1 A;  3H8Z A;  2HKN A;  3TRE A;  1KQS P;  2VC8 A;  2QG9 B;  2EYY A;  4XTX A;  2EJG A;  2MCN A;  3FLG A;  2RN8 A;  3CCQ A;  3DB4 A;  4J9B A;  1K8A R;  4XTV A;  1TG0 A;  2RMO A;  1BI3 A;  2K2V A;  1RAF B;  4LDV A;  1UEC A;  1UGS B;  5GAM j;  3SDZ A;  4XTU A;  4B9X A;  2DMO A;  2PU9 B;  1D1C A;  4DBF A;  4JZ4 A;  1QW1 A;  3UDC A;  2BE9 B;  4DEX A;  4OGC A;  3OS1 A;  3CCV Q;  3KBG A;  1M2V B;  1OX9 A;  2DYI A;  4XAX B;  1WJQ A;  1Q95 G;  2OTJ A;  4M78 A;  1IB8 A;  5GAN 2;  1UFF A;  2FG0 A;  2L5Q A;  2RQW A;  2HZY A;  1UB4 A;  3SD4 A;  1JQQ A;  4J8O A;  1VQO Q;  3HFO A;  3HTR A;  4AFU C;  4PJO F;  3CME Q;  3JCM W;  1G3T A;  2ZPG B;  1QCO A;  2E3I A;  3PGG A;  3LW5 E;  2DX1 A;  4J6Y A;  2DET A;  2GF7 A;  3RKY A;  4GBQ A;  2F5K A;  4E7I A;  1SPK A;  3CMA T;  4KUD K;  2Y90 A;  1VQ4 A;  1KSW A;  2RQT A;  1ZX6 A;  3LH5 A;  2P0P A;  1MND A;  5GAN 5;  4OB3 B;  1UHC A;  1YJ9 Q;  1XQH A;  3I55 Q;  1I4K 1;  1VQ8 Q;  5EC7 A;  2HQE A;  3EH2 A;  2X4Y A;  1JXO A;  2CKK A;  3GBQ A;  4MML A;  1D0X A;  3LX7 A;  1VQ5 T;  2DO3 A;  4OMN A;  4RUG A;  4X9D A;  2MWP A;  2AT1 B;  1AT1 B;  2FEI A;  3EAE A;  4HCZ A;  4KUI A;  1WFW A;  4RTW A;  3M59 A;  2ED1 A;  1JEG A;  3FJP A;  2KY9 A;  2GQV A;  2KRS A;  2VKN A;  1J3T A;  1VQ9 T;  2DD5 A;  2FB7 A;  2PVD B;  1VYT A;  2HEQ A;  2XID A;  3CD6 T;  3QG1 A;  2HNI A;  2LP5 A;  1HJD A;  1G3S A;  2CH4 A;  1M1K C;  1SEM A;  3VRZ A;  4PKC C;  2QDL A;  4QW2 A;  1QKX A;  2PNI A;  3CCE Q;  1CKA A;  2L3S A;  1T3S A;  3C4S A;  1M3C A;  3X25 B;  1X75 C;  1WHH A;  1GRI A;  3HKS A;  1PC0 A;  4M78 C;  3VV0 A;  2EJF A;  2OTL T;  5C0M A;  2DVE A;  5D6X A;  1ZA1 B;  4M77 D;  4QVD A;  2DBM A;  2QA4 A;  2RF0 A;  3H9N A;  2V8K A;  3MEU A;  5GAN 4;  3I5R A;  1WHK A;  4DBR A;  5GMK j;  2HKQ B;  4FM4 B;  4J83 A;  4QVZ A;  2DE0 X;  3ZFJ A;  1D1A A;  4PLI A;  5IHN A;  5IHI A;  3V7S A;  4MMK A;  1QVF S;  3FJ5 A;  4FYX B;  3I56 Q;  2VUB A;  4M77 B;  3QZ9 B;  5FW9 A;  3EGX B;  2VGN A;  3OMG A;  4FT2 A;  3OYE A;  4PJL A;  1SG5 A;  1YJN T;  2RH2 A;  5I22 A;  1VQ7 T;  2EBP A;  2VV5 A;  2A28 A;  1AWO A;  5HY6 A;  4M7A G;  3NFC A;  2R58 A;  4C92 G;  2KNB B;  2VAS A;  3CC7 T;  1K0X A;  4BE1 A;  1KJW A;  2X4W A;  4A4K A;  4M75 G;  3LH0 A;  5IXF A;  2LNV A;  3CPW P;  2JTF A;  1GFC A;  2LJ3 A;  1QCN A;  3CC2 Q;  4DA4 A;  1RAI B;  2AZS A;  4TVR A;  5CKF A;  2CZ6 B;  3CC4 Q;  3OA6 A;  2KT1 A;  2A08 A;  3H0F A;  2ROL A;  4BB7 A;  1IZ6 A;  2LNH B;  4J6W A;  2A0F B;  1C1A A;  2AKK A;  1WJR A;  3EG2 A;  4M7A E;  1NYG A;  3RBB B;  1PRL C;  4QQ6 A;  2E6Z A;  4JZ3 A;  2F2V A;  1BK2 A;  1BU1 A;  2JZ2 A;  4MZM A;  4JRP A;  2A3L A;  2DEU A;  3M4Y A;  1AOJ A;  1PKT A;  3EG0 A;  1GBR A;  3CCJ Q;  3OYG A;  2JT4 A;  4M75 E;  2J6F A;  4Z88 A;  4Y91 A;  4A54 A;  1WIE A;  5IAY A;  4F7U B;  1Q7Y R;  3J80 E;  2BZX A;  4JRI A;  1YJW A;  4LD9 K;  4GLM A;  4MZP A;  4A4F A;  2ZPI B;  3VKI A;  3QYG B;  4BD3 A;  4HVV A;  4IIO A;  2BUD A;  4KRT A;  1R0B G;  2R5A A;  1EIF A;  1TOV A;  2KRN A;  1RLP C;  4QQG A;  1R0C B;  2VYT A;  2V26 A;  4NL2 A;  3TEE A;  3RDV A;  3TSZ A;  2RK1 A;  1NPR A;  1YIT T;  3CPF A;  5CKH A;  2KXD A;  5LJ3 g;  5GAO r;  3RMS A;  5DLO A;  1K73 R;  4KGZ B;  3A8H B;  2WSF E;  1OUL A;  2FRW A;  3TCJ A;  5FLX E;  4FSS A;  4ZGE B;  1EFN A;  1KC8 R;  3JCM P;  1YHQ A;  2FHD A;  4ZNX A;  1FMK A;  2DJZ A;  2E12 A;  1TUD A;  4C0D B;  2HAX A;  1B7T A;  2PUK B;  1IGQ A;  4M7D G;  2XIC A;  5LJ5 j;  1D09 B;  1QWF A;  2JW4 A;  3CCV T;  4ZGD B;  2RI5 A;  4M7A F;  1G2B A;  4ZTF A;  2E70 A;  1UE9 A;  4DBQ A;  2XK0 A;  3TVT A;  1B07 A;  1NZ9 A;  4KGV B;  3AHU A;  1KK7 A;  3BFM A;  1VQP A;  1BIA A;  3PVQ A;  2DTI A;  1M2V A;  4EDU A;  2L3P A;  1UJ0 A;  4RMO A;  2CP7 A;  2O01 E;  2YRD A;  1E6G A;  4M75 F;  3L2Z A;  3H6Z A;  1VQO T;  1WGS A;  3CME T;  3O5Z A;  2AIR B;  3MP8 A;  3QZ5 B;  2JVV A;  1W6X A;  1I5L A;  3FDR A;  3FB9 A;  1SRL A;  3UPU A;  4RKU E;  1W70 A;  3CPW S;  4LDW A;  2O88 A;  2K57 A;  4F16 A;  3I55 T;  1Y7X A;  1VQ8 T;  1UHF A;  3CCL A;  4QKU A;  2ZGW A;  1FX7 A;  5LJ3 e;  3CBO A;  4DQ2 A;  5ECA A;  2XDD A;  2CYZ B;  2XDB A;  1GFD A;  4KGX B;  2EYW A;  3CXC S;  3PMI A;  3X26 B;  2F69 A;  1I0C A;  1GCQ A;  4AFZ C;  1FWZ A;  4LNP A;  1WX6 A;  4AG2 C;  2W10 A;  2YHT A;  2LT1 A;  3WXM B;  1PM3 A;  1MMG A;  2V1R A;  2YUQ A;  4M7A D;  2LCC A;  2VXE A;  5KE2 A;  1YIJ T;  1JU5 C;  1QVP A;  4C92 D;  3M57 A;  5A0G A;  4DOV A;  4ZTJ A;  3CCE T;  1AWJ A;  4OMM A;  3OYN A;  1OOT A;  2K3Y A;  2MMP A;  2RQV A;  3LYI A;  1NG2 A;  2CS7 A;  4EMK B;  4M75 D;  2YLB A;  2IVW A;  3UA7 A;  3MCA B;  1D3B B;  1ZBX A;  1G3Y A;  2O4X B;  3AT1 B;  3QUI A;  1U8R A;  4C92 B;  3G71 Q;  1AWX A;  4OML A;  1O75 A;  2AK5 A;  1OEB A;  3EHQ A;  4N0A A;  3GF5 A;  5AT1 B;  3QWX X;  3FC3 A;  4N4I A;  1UUE A;  2KBT A;  2RI2 A;  3M5A A;  1Y96 B;  5KCO A;  2PQW A;  4BDZ A;  2KGT A;  2EQJ A;  1VA7 A;  4JLI A;  4ANJ A;  4C0Z A;  2QAZ A;  8AT1 B;  4E7Z A;  2H3E B;  4CC7 A;  3EGD B;  2M1H A;  3JB9 F;  4M77 A;  1FMW A;  3EGX A;  4JJC A;  1HD3 A;  5KYU B;  4XK8 E;  3F70 A;  2CZ0 B;  4PJO G;  2YUP A;  5I11 A;  3ZL7 C;  1UGP B;  3GNG A;  1Q81 U;  5KCH A;  4OMQ A;  3CMA A;  2K7A A;  2LQW A;  2IIM A;  1QVF A;  2G3R A;  2RHU A;  3M56 A;  1FXX A;  1GCQ C;  1QVG P;  2RHY A;  3OMC A;  1AZG B;  2GNC A;  3SWN B;  1ABQ A;  4RCC A;  2DL7 A;  2OTJ Q;  2YWW A;  3C95 A;  2CUB A;  2F5T X;  1VQ5 A;  3PE0 A;  3CC4 T;  2DM1 A;  4WTO B;  5HCK A;  2CRE A;  3QWY A;  5CQX A;  3PIP A;  2QAS A;  5GAN 3;  5GMK h;  2QTX A;  1VQ9 A;  3CD6 A;  4XQ3 A;  2KQW A;  4XTW A;  2P4T A;  5LJ5 f;  2QK0 A;  2MPX C;  4OVA A;  1VQ4 Q;  3CBM A;  1XNI A;  3FRN A;  2RI3 A;  2E64 A;  1X6B A;  4C8Q E;  2RO0 A;  2NLU A;  3NTI A;  2D9T A;  3CCJ T;  2DA9 A;  2VVK A;  1M27 C;  2KR3 A;  5GAN g;  2LQN A;  2CT4 A;  1QLY A;  4Y28 E;  1G8X A;  2OTL A;  2EYQ A;  5I21 A;  3JCM d;  2JN0 A;  1QVF P;  1RAG B;  2HL5 C;  1OZ2 A;  1KG1 A;  4M7D D;  4ORZ A;  1G5V A;  3E9F A;  4F7U A;  4M77 C;  1GBQ A;  3SB2 A;  4F17 A;  4LXC A;  3RUX A;  1K76 A;  4II1 A;  4J7F A;  3NTK A;  3A8O B;  4L6V 5;  2X51 A;  5DM7 R;  2KE9 A;  1YCY A;  4UC4 A;  3OYF A;  2M0O A;  4AMC A;  3QII A;  2ZPH B;  4M7D B;  3M0T A;  3CCR Q;  1PHT A;  3QKJ A;  3HPW A;  1UGR B;  2NUT B;  4PJN A;  3HRS A;  2JTE A;  1S1N A;  2PVG B;  4EMG A;  2D1X A;  3CCM Q;  4J6X A;  2L89 A;  3C94 A;  2L0A A;  1QP2 A;  3BE3 A;  2LQK A;  2O9V A;  1M8V A;  1ZQ1 A;  2E10 A;  1WA7 A;  2QA4 Q;  1F1B B;  4XU1 A;  3EG9 B;  3DKM A;  1N6A A;  5GAN 6;  1IHW A;  4PFO A;  4FU6 A;  2EVR A;  3OYA A;  1WLP B;  1NEG A;  4PJJ A;  2DXC A;  1X69 A;  2F2W A;  3GIB A;  3I9Q A;  9ATC B;  3VS5 A;  1XTD A;  5IT9 E;  1PG5 B;  5EG2 A;  5IXB A;  2MOX A;  1NJI R;  1M90 R;  2EGA A;  3EHR A;  4C8Q F;  2C0T A;  3HHT B;  4LDY A;  5GAN e;  1NLP C;  3R6O A;  1RI0 A;  3ZEH A;  4AFS C;  2ESW A;  1X6O A;  1YWO A;  3JCM b;  2DBK A;  1RLQ C;  2L8D A;  3A5Z B;  3GLX A;  1T3L A;  2AZV A;  4FL6 A;  1KIK A;  4JLG A;  1KFZ A;  1UEB A;  3MP6 A;  4B6M A;  1HXD A;  2DRM A;  4BUG A;  2HSE B;  1M1K U;  1QVG S;  2GTO A;  5DLQ E;  3DLL A;  4ZN3 A;  3GPL A;  2XG8 D;  3OYJ A;  4CC2 A;  3I5S A;  1H64 1;  4CC4 B;  4QQD A;  1VQL A;  3C0C A;  2DVJ A;  1RAB B;  3JCM J;  1WQ7 A;  5LJ5 h;  2DD4 A;  1VYU A;  1UGQ B;  4IUT A;  1Y71 A;  1OZ3 A;  3I35 A;  2GCX A;  2OX7 A;  1YIT A;  1OU9 A;  1RAA B;  1HSQ A;  4M78 E;  3CPW A;  3V7R A;  5KYX B;  2HL3 A;  1B34 B;  2L2P A;  7AT1 B;  2AHJ B;  3OYC A;  5GMK m;  1OPL A;  3MHX A;  4OB0 B;  4PJO D;  4HCB A;  3N5B B;  4WF2 A;  3VRY A;  4LDX A;  3OYL A;  2FL7 A;  1NYF A;  2EPD A;  4C0D C;  1BIB A;  1VIF A;  4MZT A;  3EG3 A;  2FO0 A;  1RAH B;  3CXC A;  3DB3 A;  1ZSZ C;  2WSC E;  1ZUY A;  2RQU A;  2QEX T;  2ZZD A;  2QYZ A;  4FCY A;  2JMC A;  4EMK A;  4PJO B;  2EW3 A;  1D3B A;  3VU3 C;  2H8H A;  1NPP A;  2IPO B;  5CO7 A;  3G71 T;  2Y4X A;  3GP8 A;  1KC8 U;  2K79 A;  2PZ1 A;  3CCV A;  1ZHI A;  2RJF A;  2O4X A;  1QQJ A;  4NS5 A;  3M0P A;  3SHW A;  4X9C A;  4C92 A;  1K73 C;  1MMA A;  5GAM g;  1U5S A;  1AD5 A;  4OP0 A;  2QQR A;  3PNW C;  4IIM A;  3RMQ A;  3OQ5 A;  1B3Q A;  1KC8 C;  1U3O A;  2CP5 A;  1Y96 A;  1N27 A;  4PL6 A;  2QDY B;  4E47 A;  3JCM c;  4BI4 A;  1YHQ Q;  4GLK A;  3OS0 A;  5A2Q E;  3EGD A;  2PVO B;  4RCB A;  1LVK A;  5CIU A;  2EWN A;  2QQB A;  1JBM A;  5KYU A;  2DXT A;  1OU8 A;  3PFS A;  1X43 A;  4F14 A;  4C0F A;  1NE8 A;  2B8A A;  3CXC P;  1N5Z A;  3I55 A;  3VS3 A;  2EQK A;  3KXT A;  4DEY A;  2RNA A;  2E5Q A;  1ZA2 B;  5M9O A;  1R8O B;  2XI9 A;  3J81 E;  1BBZ A;  1H92 A;  2OTJ T;  2V8J A;  1VQP Q;  5FU6 B;  2I2L A;  3HL8 A;  2I0N A;  4RG8 A;  2P84 A;  4M78 F;  1D1B A;  1WZO A;  2D0N A;  3SWN A;  1T0J A;  1T0H A;  3ASK A;  5GAO m;  2DER A;  2J7I A;  3LGF A;  3BY7 A;  3OW2 S;  2M16 A;  2JM9 A;  4HCC A;  4XTY A;  1WHJ A;  1MGQ A;  1WHG A;  1X01 A;  2BKD N;  3HRU A;  5GMK l;  2CP0 A;  2KYM A;  2V8I A;  3QDR B;  4EMK C;  1VQ6 Q;  1YIJ A;  3VYH B;  1MMN A;  1OQK A;  2E4H A;  1VQ4 T;  1JJ2 S;  1ZSG A;  2OI3 A;  3A8L B;  4Z02 A;  3CCE A;  4IKF A;  5GAO p;  4C92 C;  4IUQ A;  2COY A;  1WDX A;  5I2S A;  3CCU Q;  1XOV A;  3CCL Q;  3KFV A;  1R77 A;  2JS0 A;  2KVQ G;  3WVE B;  1NEB A;  5GAM e;  1YN8 A;  4L5G A;  4NL3 A;  1PWT A;  3G6E Q;  2BTT A;  1PSF A;  1AHJ B;  1V76 A;  2MIO A;  2JOY A;  4FW2 A;  4EMH A;  1S72 Q;  2B86 A;  3L42 A;  1JB0 E;  2LTO A;  3S3N A;  2OAW A;  3A1P A;  1BI1 A;  3NTH A;  2EAY A;  1K4U S;  3VJP A;  3UT1 A;  2KK4 A;  2KMT A;  3CCR T;  3X20 B;  3JB9 G;  3M4G A;  2HMA A;  4M7D A;  3X24 B;  4JS4 A;  4J9C A;  1M2O A;  1K1Z A;  3EFS A;  5D6W A;  2X3X D;  3CCM T;  1HK9 A;  2HCK A;  2NUT A;  2JMA A;  2VGM A;  1ZSZ B;  3SWN C;  2QA4 T;  2JJ9 A;  2YDL A;  2RD1 A;  2NWM A;  4C5E A;  5CK9 A;  2VWF A;  2E5K A;  4KT0 E;  3RKX A;  5IH2 A;  3G4S A;  4C5G A;  3EG9 A;  3L2Q A;  3WVD B;  2JTM A;  1M9S A;  1X6G A;  4OB1 B;  2ZAE A;  3CC4 A;  2RHX A;  1E7O A;  4E7L A;  3GOX A;  2JNG A;  2RHI A;  2GBQ A;  5CKD A;  5CAI A;  1BCM A;  4N4H A;  1EX4 A;  2CP3 A;  1W2B S;  5L23 A;  2E6N A;  2QGG A;  5LJ3 f;  3E9G A;  2ATC B;  2DRK A;  3SFM A;  4ELZ C;  2EFI A;  4PJM A;  3UF4 A;  1M30 A;  2RK2 A;  2E3H A;  2ZCF B;  2J05 A;  5GAO q;  1VQN Q;  2K4Y A;  2DL3 A;  1LPL A;  4CI0 C;  4EPC A;  1UJY A;  1YJ9 T;  1KHC A;  2EIF A;  2XKO C;  1PSE A;  2OJ2 A;  2NUP B;  4FYW B;  2X35 A;  4J9H A;  4A53 A;  3VS1 A;  2J6K A;  2HDA A;  1VQ5 Q;  1WI7 A;  3QSU A;  4J7I A;  1OYX A;  2EYX A;  3CCS Q;  1UGV A;  1WNL A;  2JS2 A;  1BI0 A;  5GMK e;  3JAM E;  1Q82 R;  2CSQ A;  3NPF A;  4M7D C;  4LE9 A;  4HVW A;  5LJ3 d;  5KE3 A;  5IN1 A;  1VQK A;  4L59 A;  2V1Q A;  2DZC A;  3L2W A;  3SEM A;  3OSS C;  3VS2 A;  2F2X A; 
#chains in the Genus database with same CATH homology
 4LUD A;  3VRZ A;  2LJ0 A;  4ORZ A;  1OV3 A;  2EGE A;  2QDL A;  1QKX A;  2PNI A;  3M0S A;  1GBQ A;  4HXJ A;  1CKA A;  1FYN A;  2G6F X;  2L3S A;  1T3S A;  4F17 A;  4QT7 A;  1M3C A;  1K76 A;  2DL5 A;  2GGR A;  1NLO C;  1GRI A;  1QWE A;  2KE9 A;  2BZ8 A;  1AZE A;  2DBM A;  1E6H A;  2RF0 A;  3M0T A;  3I5R A;  1YCS B;  3REB B;  1PHT A;  4HCK A;  1H8K A;  4WCI A;  2O31 A;  1X27 A;  2DE0 X;  1M3B A;  2JTE A;  5IHN A;  1S1N A;  2ABL A;  5IHI A;  3H0I A;  3VS6 A;  2D1X A;  2O9S A;  3FJ5 A;  2K6D A;  1Z9Z A;  2L0A A;  3EG1 A;  1I07 A;  2O9V A;  1ZUK A;  1MUZ A;  1YP5 A;  5FW9 A;  2P4R A;  1WA7 A;  1M3A A;  4J9D A;  1MV3 A;  5I22 A;  1CKB A;  2EBP A;  2A28 A;  1AWO A;  2CT3 A;  4CC3 A;  1MV0 B;  1H3H A;  2EVR A;  1WLP B;  1ZUU A;  1NEG A;  2KNB B;  2J06 A;  1X69 A;  2F2W A;  1K0X A;  3I9Q A;  2JXB A;  1KJW A;  2JM8 A;  3VS5 A;  1JO8 A;  4JPB W;  5IXF A;  1SSH A;  5IXB A;  2MOX A;  1AVZ C;  3REA B;  4J9I A;  1GFC A;  2EGA A;  2LJ3 A;  2M0Y A;  2X3W D;  2KRM A;  3EHR A;  4E6R A;  3CQT A;  1ABO A;  4LN2 A;  2C0T A;  5FWB A;  2AZS A;  1A0N B;  1NLP C;  2C0O A;  4D8K A;  4AFS C;  2ESW A;  1YWO A;  3UA6 A;  1YWP A;  2DBK A;  2KT1 A;  2A08 A;  1RLQ C;  3H0F A;  2ROL A;  2J6O A;  2LNH B;  1T3L A;  2AZV A;  5GJV B;  1KIK A;  1PKS A;  1KFZ A;  2RPN A;  2AKK A;  2DJQ A;  3EG2 A;  1NYG A;  3RBB B;  1PRL C;  2D8J A;  2DRM A;  2CH4 W;  4JZ3 A;  2F2V A;  1AEY A;  1WXB A;  1BK2 A;  2ENM A;  1BU1 A;  2A37 A;  2GTO A;  2C0I A;  4CC2 A;  1AOJ A;  4RTZ A;  1PKT A;  3EG0 A;  1G83 A;  3I5S A;  1GBR A;  4JJD A;  4J9G A;  3M0Q A;  4CC4 B;  2JT4 A;  4Z89 A;  2J6F A;  4Z88 A;  3UAT A;  4HVU A;  4J9E A;  1WIE A;  1QKW A;  1X2K A;  3C0C A;  4X1V A;  2DVJ A;  4M4Z A;  4RTX A;  2KRO A;  1IO6 A;  3IQL A;  2BZX A;  4K11 A;  1VYU A;  4GLM A;  2DIL A;  4RTT A;  3THK A;  3I35 A;  3U23 A;  2YUO A;  1HSQ A;  2EYZ A;  2L2P A;  4HVV A;  4IIO A;  2GTJ A;  1OPK A;  4KRT A;  1OPL A;  2KXC A;  3TSW A;  3VRY A;  2KRN A;  1NYF A;  1RLP C;  2EPD A;  1I1J A;  1X2Q A;  2YT6 A;  3EG3 A;  2FO0 A;  2CDT A;  3TSZ A;  1K9A A;  1ZUY A;  2RQU A;  1Y57 A;  2FPE A;  2KXD A;  2W0Z A;  2EKH A;  4Z8A A;  1ARK A;  3NHN A;  4J9F A;  2JMC A;  2EW3 A;  2ECZ A;  1UG1 A;  2AKL A;  2FRW A;  2H8H A;  1GL5 A;  1NM7 A;  2K79 A;  2FPF A;  2HSP A;  2PZ1 A;  4FSS A;  1ZLM A;  3VS0 A;  1EFN A;  3M0P A;  3SHW A;  1AWW A;  4ZNX A;  1FMK A;  1U5S A;  1AD5 A;  1TUD A;  2ROT A;  4IIM A;  4AG1 C;  1B3Q A;  1M8M A;  1K0S A;  1U3O A;  1QWF A;  2JW4 A;  4OMP A;  3RNJ A;  3M0U A;  3A98 A;  2DNU A;  1G2B A;  1UE9 A;  3TVT A;  1B07 A;  1VYV A;  2LMJ A;  3PVQ A;  4RTU A;  1WXT A;  1PNJ A;  1SHG A;  2KT8 A;  2L3P A;  1UJ0 A;  2CSI A;  4F14 A;  1X43 A;  1E6G A;  2PTK A;  2K3B A;  3NMZ C;  1N5Z A;  3ULR B;  3VS3 A;  2XMF A;  3O5Z A;  4DEY A;  3EGU A;  2RNA A;  1WXU A;  2YSQ A;  1JXM A;  1ZBJ A;  1BBZ A;  1H92 A;  1W6X A;  2I0N A;  1WYX A;  1SRL A;  2SRC A;  2D0N A;  1T0J A;  1T0H A;  1W70 A;  3JV3 A;  2J7I A;  1PRM C;  2O88 A;  2DYB A;  4ESR A;  2O2O A;  4F16 A;  2FRY A;  2JM9 A;  4Y92 A;  1QCF A;  1UHF A;  1V1C A;  4RTV A;  5GJW B;  2KYM A;  3PVL A;  5ECA A;  1YNZ A;  3H0H A;  1GFD A;  2EYW A;  1ZSG A;  2OI3 A;  3H41 A;  1I0C A;  1GCQ A;  1SHF A;  4AFZ C;  4D8D A;  4LNP A;  4R0K A;  1WX6 A;  4OMO A;  4AG2 C;  2W10 A;  1Y0M A;  1WDX A;  2D8H A;  2V1R A;  1XOV A;  2YUQ A;  2GQI A;  3KFV A;  3VS7 A;  1UTI A;  2L3Q A;  2JS0 A;  1NEB A;  1YN8 A;  5IHK A;  1JU5 C;  2KEA A;  1PWT A;  2BTT A;  2A36 A;  1BB9 A;  2MIO A;  2CUD A;  1AWJ A;  5FWC A;  1U06 A;  4OMM A;  1OOT A;  2RQV A;  2B86 A;  1NG2 A;  3UA7 A;  2LZ6 B;  4LUE A;  1LCK A;  2LJ1 A;  2OAW A;  1W1F A;  2DLP A;  4A63 B;  2EYY A;  1K4U S;  1AWX A;  2MCN A;  4OML A;  2RN8 A;  1Z9Q A;  1CSK A;  2AK5 A;  4J9B A;  1OEB A;  3EHQ A;  2NUZ A;  1TG0 A;  3QWX X;  2RMO A;  4J9C A;  1K1Z A;  1UUE A;  2KBT A;  2X3X D;  2DF6 A;  2HBW A;  1UEC A;  3NGP A;  1GCP A;  2DL8 A;  2HCK A;  2JMA A;  2KGT A;  2DMO A;  1VA7 A;  2K9G A;  4JZ4 A;  1RI9 A;  2YDL A;  4CC7 A;  4DEX A;  2NWM A;  2VWF A;  4JJB A;  4JJC A;  1HD3 A;  2SEM A;  2E5K A;  5IH2 A;  2YUP A;  5I11 A;  3ZL7 C;  3M0R A;  2KYB A;  1X6G A;  4OMQ A;  2RQR A;  2K7A A;  1UFF A;  2FG0 A;  2LQW A;  1E7O A;  2IIM A;  2RQW A;  2K2M A;  4EIK A;  1JQQ A;  1GCQ C;  4RTY A;  4AFU C;  2GBQ A;  1AZG B;  2DX1 A;  5L23 A;  1TUC A;  2GNC A;  4GBQ A;  2DRK A;  1ABQ A;  2DL7 A;  1SPK A;  2CUB A;  3UF4 A;  1M30 A;  3PE0 A;  2J05 A;  1KSW A;  2RQT A;  2DM1 A;  2DL3 A;  5HCK A;  2DL4 A;  1ZX6 A;  3LH5 A;  2CRE A;  3QWY A;  1UJY A;  1UHC A;  2EQI A;  2OJ2 A;  5EC7 A;  1UDL A;  1JXO A;  4J9H A;  3GBQ A;  2LCS A;  2YUN A;  3VS1 A;  2J6K A;  2HDA A;  1WI7 A;  4OMN A;  4RUG A;  2FPD A;  2EYX A;  3R6N A;  3VS4 A;  1UGV A;  2JS2 A;  1X6B A;  2M51 A;  2FEI A;  1WFW A;  4RTW A;  1SRM A;  2CSQ A;  2DA9 A;  4AFQ C;  2ED1 A;  1JEG A;  2VVK A;  3NPF A;  4LE9 A;  1M27 C;  1RUW A;  4HVW A;  2KRS A;  2KR3 A;  2VKN A;  2LQN A;  1J3T A;  2BZY A;  1QLY A;  2CT4 A;  2LX7 A;  1VYT A;  2HEQ A;  2V1Q A;  2ED0 A;  2EGC A;  2LP5 A;  1HJD A;  2CH4 A;  3SEM A;  3VS2 A;  2F2X A;  1SEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...