4JJOA

Crystal structure of apo-clavibacter michiganensis expansin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLDLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulose binding protein
publication title Crystal structure of wild type and D78N mutant clavibacter Michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis
molecule tags Sugar binding protein
total genus 41
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jjoA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4jjoA02
2PI8A 3X2OA 1BW4A 3FT1A 3FT9A 2JNZA 2AE0X 4JCWA 4FFTA 2KQAA 3SULA 2HCZX 2PICA 3SUJA 5H4UA 3X2MA 4AVRA 1WHOA 2VXQA 4JJOA 4FG4A 4FERA 4FG2A 3SUKA 4JP6A 1OA9A 3CZBA 1N10A 3X2JA 3ENGA 1WHPA 1BMWA 1HD5A 2PNWA 2ENGA 3SUMA 2PJJA 3X2HA 4JS7A 1OA7A 5GM9A 3M3GA 3D30A 4ENGA 3X2GA 5GLXA 3X2LA 3X2IA 2G6GA 2GAEA 3X2PA 4ZM7A 1BW3A 2BH0A 2G5DA 1L8FA 1WC2A 5GLYA 3X2KA 4L48A 4JP7A 3X2NA
chains in the Genus database with same CATH superfamily
3DKHA 4HUXB 2CPUA 1ID5I 2F53A 1CYXA 3B83A 8CGTA 5C18A 4ZOCA 3UO1L 5DFVC 4G72B 2BMKB 3FU7B 5DJ8B 2R93A 1OANA 2JF1A 4H8HA 1Z9OA 4O5LL 2GQHA 5CIPB 3L5HA 2LOEA 1JZDC 4CBZA 4KNQA 3CV5A 1AO7B 2B59A 1HCVA 2VQ1A 2XKUA 4I85A 2H2PC 4K2UL 4OD2A 3ALPA 4K8RL 4NO2B 4YAQA 4XP5L 2AEWA 1DLFL 3TA4D 4DTGH 2VL5B 4OFYA 4FQ2L 1IEAB 2JQMA 4BUHA 2PCPA 1T5WB 2BIQA 3FB6A 2XIDA 2EDYA 5E1GA 3UZVB 4N8PA 3WIIH 2RD0A 3KPNB 4KRNA 1GCYA 3FQ4A 3RPBA 5EN2B 3GF8A 4EDWL 1CWVA 1YO4A 3GBNL 3L5XH 2BWDA 2YUWA 4BFIA 4X5QA 4ANWA 5I6KA 3FN0H 4LRIC 5IMOB 1TZGL 1Y4ZA 3PGFH 2WXRA 3K8LA 3AS0A 5F7AA 1UOLA 2VXUH 5IEKA 4UT7H 4ZFGL 3HS8A 3ILQD 4HKBB 4B41A 3QI9A 3QNYB 4FFYA 1J0YA 4M6NH 1YMHA 3RVVC 3CIAA 3K72B 3SDAB 3G5ZA 3TO4D 1Z3GH 1H3VA 3BPOB 4GT0A 2X4SB 1U33A 2Z93A 4KX7A 2DTML 4FQHA 4M7ZC 3K6NA 4YIQB 1N7ML 4FF9A 1JDAA 1U8NA 1SMYD 4P46A 4YHKH 2CLZB 4DF9A 4Z3FA 2X9WA 4GAJL 4OGXH 4CU7A 4B96A 1QLFB 4Q6IC 1F4XL 3ARUA 1N0LA 2BMKA 3FU7A 4FTVB 5HGAA 5LAXB 1ODAA 1U36A 3VD1A 5CIPA 5AVVB 3VFMB 1SDAB 4PJ5D 5ID0A 2W91A 1AO7A 4N1HB 1ORSB 1MRCH 1UKTA 9PCYA 4MFHA 4PRDB 5TFSL 2FUTA 3H8NA 4EN2A 2B8OT 1CICA 2FIKB 1P0SE 2WLIA 3AW5A 3OPZH 5DUML 1VEMA 1FFOB 3ESMA 4DK3A 1BX2B 1IM9D 1H5BB 1BHGA 1UVQB 1T66D 4NUQA 5FM5O 3UZVA 4LOUD 4JFYB 4X5WB 1I8UA 3TO2B 1WYJA 1OIOA 4X9IA 2GK2A 2N7SA 3KPNA 4WFHD 4IGBD 4W9CC 2GTZB 5EN2A 5FO8B 4Z5RB 3O41B 1OPGH 1TQCB 4YXLL 3JWNH 4ZFOL 2VW4A 2UZIL 5GHWH 4E9LA 3VGFA 5KSUB 4PB0L 5J1AB 2ZX9A 2CCLA 2ADFL 1WZMA 3POCA 2QPEB 4LCIL 1G87A 4I4WB 4Z78B 4FXGB 3ZYJA 1ZS2A 3H53A 4HKBA 1XCTB 2WPGA 3QRGH 4L3ED 3C6LB 3CE1A 3K72A 3SDAA 5JXEC 3VG0L 5F6IC 4QHMB 3VJ6B 5GZNC 3UJTH 4P0DA 2JSFA 1NIFA 1PJ9A 2AXFB 2X4SA 4RGMB 5FYJL 1CXFA 3HZVB 3BC9A 4P4KC 2PNWA 4HIJB 2CA3A 4GAYB 1FYTE 4YIQA 1ZK5A 3RIFK 1E4XH 5JMRA 3IBOA 1IE4A 4KROD 2CLZA 4DPCX 3MV8B 4B9FA 5I9QB 5F0LB 4LOEA 2BP8A 4IIQC 2J12B 2Z31A 3CC5B 2G3XA 5FA4A 2IMNA 3NFPA 1A7NH 1AQDA 2KS0A 4CVUA 1R9FA 1CDJA 4FG0A 5LAXA 1RUKH 5I1IL 5E08L 3CHQA 4CMHC 3CU7A 3VFMA 3SEPA 3HHMA 3SBWC 3KXFA 4HLZG 4X6CF 3FBQA 3T6ZA 3RIFF 5FV2A 2FIKA 2PYED 4XX1G 3T04D 2SODB 4HCFA 1R19A 1FFOA 2AAAA 4URTB 4AH2B 3ME0B 12E8H 1BX2A 4P99A 1H5BA 5TK4A 4QJ3B 1YYLH 1E3XA 4JFYA 1IZKA 4X5WA 3O4LB 4LHUA 5EZJB 1V55B 4HJTA 3TO2A 3OHXB 2WNKA 4JRLA 1OT2A 4V1DE 1RY7B 2A6DA 5GJSH 4I1RA 4I8DA 2GTZA 2W60A 1X6NA 5BW7C 5FO8A 4Z5RA 1UFGA 2H45A 3RWHA 5IHZA 3DMRA 3QS2A 5I1AA 3OKDB 3EH4B 2HFGH 3BD3A 1A7OL 5KSUA 5J1AA 1XMWA 5EIIA 1SXCA 1UHDA 4I4WA 5F6HJ 4HWUA 4FXGA 3G9VA 3EGDA 2YKLH 3HB3C 5H37H 3QDGD 2D7OA 5DC2A 4TQEL 3FU6A 3HI5L 5ICZA 1WK0A 4TNEA 1XGZA 2AXFA 2LQRA 4NBYB 1L9OA 3HZVA 2DZEA 4HIJA 4N2IA 3VFTB 3QZBA 4FN0A 4GAYA 1KB5H 1NOLA 3AWEA 3JV6B 3MV8A 4QNPE 3CC5A 1I7TB 3N43B 2WCGA 4N90D 4WKXA 2DWYA 4QKTA 1FRGH 1I3GH 4JM4L 1DVUA 4U6XA 43C9A 1RULH 3MQIA 1Q9KA 4JANB 2IMMA 4KAQL 4NWUH 4DGUA 2BVUA 3APNA 3D30A 1I8LA 4EIBA 4G8EA 3GTMA 2MNWA 4G9DB 3W56A 2XA8H 3DRQA 4QD2E 4X5RA 4IOSD 1BVOA 3D05A 3L45A 4ZSOE 3D1MC 3TJEH 2Y24A 3ME0A 4OT1L 1Q94B 4BKSC 1JJUA 3Q3GB 2OSXA 5CU5A 3QUKA 3U1SL 3O4LA 5EZJA 3DVIA 5GS0D 3OHXA 1E5YA 1I3QA 3OGOE 2FEEL 1MHEB 4DGVL 3V4VH 3B9AA 5C9JB 2BHYA 1LDPL 5E6IC 1NFDF 1URLA 3A6BH 1OD9A 4AE1A 1A1OB 4HUWA 4OFQA 1GTNA 1R27A 1TJXA 3OKDA 4ZOBA 1S78D 3WNIA 3R06B 3CXFA 3VG9C 4QXUL 3RBSA 5DMIL 3H2PA 3UTTD 3JV4B 4I3RH 4R7NA 1U4EA 1D3CA 1F45A 1TZIB 2DM3A 3RDJA 1F4HA 2AK4D 2RAMA 2OR9H 3MC0A 5A2CA 3W39B 1F3RB 4OM1L 2EADA 3EDKA 2BIPA 2XVGA 1RZGB 2FJGB 3AADB 4KTGA 5CD5C 4XGZB 3VFTA 3BE1L 1HHHB 3L3HB 1W91A 3L4UA 4C47A 2DMRA 5E1QA 3JV6A 3CX5J 5I0YA 1KGCE 3QQXA 4YDMA 4URKA 4MRCA 2LAGB 1BZOA 3UADA 4TQ8A 5G4NA 4OD1H 3TM7B 5GGRB 3ARDB 1BJ1H 2MFNA 4OJYA 3HC4L 4NHCL 3VRIA 4JANA 4EXPX 2CU9A 4LSVH 3ULVL 5HHXL 1Z9NA 5D7LD 4JNXA 1IT9H 2RH0A 1XGYL 2IBBA 2OZ4L 3V79C 4UT9L 1QBLH 3TFKC 1QFUL 1IM3D 3BX7C 3ZLQC 1NUFA 3Q3GA 1F1GA 4GSDL 1IBDA 4ZO7A 1PPYA 1WGOA 4JFHD 1BBDH 4GIOA 4ZK8A 3VRJA 1J8KA 1NIDA 1RKRA 1KTRL 4KX9A 4AI7A 4OB5H 2R59A 3P69A 4U1KB 1JF1B 3FAWA 5C9JA 1J11A 1NAMB 3T6VA 4KXZH 2H6OA 1OTTC 2P8MA 4PRIE 4LGPB 3R06A 4N0UB 4F8OA 2Y23A 3AQZA 4F8QA 1FE8H 3F04A 1DTUA 3JV4A 5I30L 1UWGH 4YC2B 4PJ9C 1ACYH 1FDOA 1TZIA 2CALA 3CFJA 5D7IB 3DHUA 5FM5M 1NAKL 1CLCA 3MFGB 3WO4B 1CZ8H 1AR1B 1H8OA 3W39A 4N2KA 3HU2A 2MHAB 2QGDA 1G7JB 4XO3A 4AW7A 3VRLE 3CSTA 4AL8L 1TWHA 1ULVA 3VM7A 5A2AA 4IM8A 5JNYB 2BIOA 1ZVNA 3L3HA 1HHHA 1Q72H 2VIRB 3BDYH 2DQHL 4PJEE 1MW2A 3QQ3B 3MOBL 3GKWL 1KCUL 1R3IH 3HA0A 3SO3B 4MMXB 4BQ9A 4YX2H 1DO6A 4OFIA 5GGRA 3RU8H 4HJ0C 3SGDH 3TZVC 2AK1H 3PHAA 2NPLX 2ZCLH 1J8HD 1ZLUK 5JHDE 4N0YL 5JDJA 2BJML 2QGBA 1U8IB 3Q43A 5D7KD 4M1DL 5K93A 2MQCA 1OEZW 2BFVH 2H3NA 4A68A 2CK0L 3HE6D 3PWPE 4NUMA 4IRSA 1BVNT 4XXWA 3VFOB 3WELA 1HXYB 2ED8A 1V8HA 4IRZA 3D34A 3NH7H 3ZKNC 1IQDB 1HHGA 2PR9A 4OLWH 1KUMA 3S88L 4YVNA 1KBVA 3OUGA 1OCWL 2A77L 5HHMD 2BXYA 3EJZD 1T3FA 1EVTC 2DKSA 5CINH 3NCEB 2VNCA 1AA6A 3SJVE 4NP4L 3FOLB 2Q7YB 1MFBH 5D5MF 3FQUB 4U1KA 1JF1A 3F62A 2I60L 4H20H 1DBMH 1NAMA 1QNZH 2FWUA 3OLEA 5D2LF 3BUBA 3O6ML 2ALWA 4NNXB 4G7VL 5C0FA 4JN1H 3D18B 1JZ3A 5T5NG 2CO3A 1BP3B 2X1OA 4P2QD 1F41A 3IFPB 4JFXB 2WB1A 5AD0B 4TOYL 3LV3B 3ZDWA 4KY1L 8FABB 4HW6A 2KUTA 5D7IA 5GS2D 1OCZB 2MCAA 2BVPB 1FNSH 3KBFA 3O2DL 4F7PA 5C0NC 4IOIB 1XGUB 5HJBA 3VMOA 1G7JA 2VN4A 1EJ6A 1HOCB 3TN0D 4HWBH 1CGWA 4G8IA 2ZUYA 3B2DC 2IAMD 5HGDB 5DEZA 2VIRA 1HWHB 4MDRA 2APFA 1BBJA 4J3BA 5FV1L 4XMVA 3QJSB 3QIWD 2WSPA 2MTPA 4FE9A 4JY5L 3MUY1 2EUWA 2CRZA 2YA0A 4Y5XC 4KDIA 5SX5K 2HUEA 4IBUA 3ENGA 3RI5K 4L0ZA 5J6GA 2FVNA 2NY4D 1CYWA 2WBJC 4J3OF 4DUXA 1V10A 1OP4A 2CM5A 2O5YH 3VFGL 4A04A 1U8IA 4LLVB 1KTJA 4G6AD 1DCLA 3WNNA 4JP7A 3TO4B 1HYSC 3VFOA 4A6YH 1HXYA 1DBAH 1G7LB 2HTLC 3WFBH 5TE7L 1IQDA 3L3GB 3RI5F 5HYQB 1DMSA 5T3XH 4PJFB 5GGQH 4JFDD 3Q8AA 1ZHBB 5EMYA 1BYOA 3FOLA 2Z1PA 1CE1H 1UXWB 3FQUA 4KBPA 4MQXD 4WI2A 4EI5D 3WCYA 1Q9OB 5EBWB 2R23A 2XHNA 2J73A 5LG6A 3UGUA 2DEWX 4PJ5B 1BVLB 4KI1A 1T0NB 3HZMB 3QRLA 2PN5A 3D18A 4KVNH 3RX9A 5K9KB 4PV1C 2O5XH 4FNSA 5CFHA 1QPXA 2FQDA 3AB0C 1VPOL 3DTXA 3IFPA 3P4OB 5AD0A 4LOFA 5BOJA 4Z7UA 5DD1H 8FABA 1TDQA 2BVPA 4FFTA 3NDYE 5EH1A 2WZ5A 4IOIA 2YOAA 1XGUA 3GEWB 3O2WL 3WU1A 1HOCA 1U91B 5D93B 4Y2LA 2VC2H 5LG1A 2PUQT 3VH8A 2P5EE 5HGDA 1BZQK 1U0QA 4IGBB 2HJKA 1I1AC 1NCWL 4PB9L 4XP1H 2HPTA 4YHZH 4PJ6A 2ZUVA 2ARJA 1YC8A 2WXLA 1JNLH 5DJYB 2OTPA 1X5GA 5D72L 3MRJB 4YQXH 3B2VH 3HG4A 5KVEL 3CN0A 3OWEA 1UCBL 4RGOL 1C08B 3QHZH 2RQ8A 1Y1UA 2PPAA 4OLXH 5FGCE 4LLVA 3VXRA 3RKPA 4M5YH 4L3EB 1LDSA 3OKEB 4LSRH 3ZTCC 3TO4A 3U6XA 2X0WA 5I1EH 1SZNA 4A39A 1VZGA 3LKRA 3BPNB 5DHDA 1G7LA 3ZDYB 2LFEA 3QZPA 2W80C 4JGJA 1N6QH 5L2KE 2GFBA 3L3GA 4KROB 1PFOA 2BCMA 4KITB 3BKJH 4W6XB 4PJFA 4DZBA 2YQGA 4I2XB 1ZHBA 2IAAC 3X17A 2V3FA 1B4TA 2W0KA 1TU2A 4IRJD 4KI5C 1Q9OA 5BJTA 2VXQL 5EBWA 1KGXA 1LP9F 2Z1KA 1X9LA 1NBYB 4PJBE 4XPBH 1T0NA 3H2WA 2WB7A 1NLDH 2EXWD 1W72H 4K9EC 3Q13A 1CLZL 4XC3L 4ZO9A 3P4OA 2JA6A 2PYEB 2WANA 3KYKH 2MIZA 3C8KA 3OZ9L 4XWGL 2WWOA 3P30H 1P9MA 1IKOP 1DQKA 1U91A 2CO1A 2AS5M 4OZIF 2K6ZA 4ENEC 1QQDA 4AVHA 4IGBA 4MJJA 2P80D 1A6UL 4R4FL 3UEQA 2K1MA 1LL1A 1EJOL 5AVWB 3DA0A 3ZHLA 2ATAA 3HLAB 3MRJA 3WN6A 4UI2A 1INDL 1XTMA 1C08A 3BAKA 1HSBA 3SDXB 2LW3A 4IRZL 2NNCA 3Q44A 4HIEB 3HE7B 3OKEA 3FQRB 3D4CA 2EDLA 2HP4A 5LCVA 5ACLA 4HUVB 1U58B 1LTXA 1LWHA 1BW3A 2QHRH 1ZCRA 3N2JA 1MJJA 3QH3A 3WOVA 1TTCA 4LF3A 2RJMA 3I6GA 2H0PA 4TL5A 5LWYL 4I2XA 3MRQB 2C1PB 2CHNA 4C56E 1OGAE 4FOMA 3SQRA 1VACA 3QJQB 4GLRH 3LZPA 2IPTL 3T71A 4M62H 4QXTB 3MRNB 1KZQA 2EECA 4XO9A 1NBYA 2EYRB 4TTGA 1Y1WA 4XCNA 5BZWB 3DHJA 4NT6B 3AMLA 3IR7A 1HINH 3GGWB 3MRGA 2PYEA 3E2HB 4BCYA 2BS9A 3E80A 3K74B 4BINA 1N59B 5ITBH 1PL3A 4GXUN 1J9TA 4RDQF 3TONA 4NQED 3LNDA 1Q0YL 2W0LA 5I1GH 1FFTB 2I25N 4N2DA 4BZ2A 4MCMA 4BA8A 2J6WA 3EAKA 1QABA 4FCHA 2A6JB 1NA8A 4BQBA 2MNJB 1RURH 3FSVA 3SE3C 4BYHA 3AABA 4R83A 2EKJA 4E0RB 3R8BB 3HRPA 3B3BA 4XMTA 4LSPH 4S0SD 3FCTB 1JZEA 1S7VA 3H7LA 4HIEA 3HE7A 1K5NB 2AK4B 4WWKD 4ZFFB 4GRWE 3UTQA 1CFBA 2BOCB 4M8RA 1U58A 1JHKL 2EDFA 1KBKA 4I18C 4WTZA 5BCAA 1ED3B 1PSKH 4LESA 1IC7H 4ODUA 4MCZB 3MJ7A 1R75A 2VITB 3F65A 5E9DE 4MJ2A 1IGTA 3DO4A 3TL5A 3WFHA 2W07B 3ZO9A 2C1PA 2KPWA 5J11B 2EDQA 3QUZA 2QVKA 2NYAA 4YUEL 4WAFA 3UXFA 5E2WL 5JHMA 1KYUA 2C9PA 2GUOB 3BKYH 3K1KC 3MRNA 3NOIA 4H0HB 1IAOB 4QXTA 4YE0A 2EYRA 2X3BA 5E2VL 1JNNL 3EGXB 1D9KD 3IMTA 2FTAA 5D7LB 3O6KH 5BZWA 5KVDL 3IDUA 4NT6A 4JFED 4XNBA 3BD4A 3GGWA 3N41F 3EZJB 3HNTL 3T4AC 4IOSA 1KN2H 2R0KL 3WEBA 2R69H 1IM3B 3MFFB 1N59A 2H5UA 3EO9L 3JWDL 5CSZA 3OJDA 2F8OA 2FJHB 3UAJD 3M46A 4H8WH 2OW7A 1AZUA 3K6IA 2DIAA 3UAEA 3WY3A 3PWNB 5FS5A 5DD5L 1WFOA 4KV5E 4WWOA 3OR7A 4R5XA 5EORL 1OAZL 5JW5B 5ID1B 2AP2A 4HPYL 4D9RE 3FFDB 2X2YA 2A6JA 3PHOB 4Q58C 4JPIB 5FDWA 2GKIA 4UV4L 5LDSA 1G84A 4AVJA 5KTEL 2VR9A 3VU2A 3UPAA 3WGVB 3TCTA 3GI9L 4DKEH 2X4TB 1EFXD 2AK4A 4F33B 2BOCA 4XBGB 1NJ9A 1ED3A 3TEZA 1X4XA 2XNAA 2YSSB 2WTRB 4MCZA 2VITA 3L4VA 3QSKB 4Y4HD 3S4SB 2XWDA 2PABA 4ZOAA 1G8JA 2W07A 2NLJB 3MZTA 2OM5A 2DQGL 3QHTC 5I66B 1ZHNB 1NUDA 4EUPA 4X6BB 1A7PH 1WLFA 1TTAA 2GUOA 1KBPA 1J8HB 4XX1E 5GZOC 4PLOB 4PJXB 3ZU8A 5DK0B 5D7LA 5TE4L 3KLHC 2JJTA 4ALAC 4NZ8A 3HE6B 4CVZB 3SKNB 4XVJL 4ZPTB 1JN6A 3GSWB 2X6AA 3GUFA 4UILL 3V6OC 1CF8H 1PAZA 3H85A 4R5TA 4MJID 4LSTL 1DANU 5E2UH 2FJHA 1E5CA 1L9QA 5HHMB 3MLYH 4KH2A 3TNNB 5AG8A 4ZMAT 2R8SL 3VXUD 2E27H 4U6VH 3FTSA 2B15A 1F90H 5CM1A 3C5XA 5IJDC 2VZVA 2WVVB 5JQ6H 3KNBB 3HJ0A 1XF5B 2BIHA 5JW5A 4GQ9L 3FFDA 3LJ3A 3P0GB 3X11B 2HMID 4OM0L 3ZZSA 1H9DA 1OAUH 3BJ91 4ELKA 4PV9B 5KBMA 5JIIA 1P2CA 2X4TA 3MXWL 2APSA 3IJ9A 4FXTA 4F33A 1L9RA 5ICUA 2XN2A 4LPYA 4O4YL 1MCQA 2VDPB 3GSNL 4FNLH 3EJRA 4XBGA 3TN0B 1T21B 3RTQA 1C8QA 3QARA 2YSSA 4U3XA 2IAMB 2WTRA 2D3JA 2NT0A 3BZDA 2C5DC 4K0OA 3LIZH 4PJ8D 3N1PC 4XP6L 3RY6A 3S4SA 3BLKA 3QIWB 4P9ML 3O3EB 4FD0A 4Z0XA 4YS4A 5I66A 1ADWA 1ZHNA 4ZD3L 3S96B 2ZXBA 1MREH 3IU4H 1HK6A 3BKMH 4X6BA 2QVFB 2A7BA 2NY4B 4YXKH 4JG0L 4PJXA 4B50A 4PPTA 3IGFA 4W9LC 4YXHL 1GYCA 4NQTA 3HE6A 2CO7B 1P6FA 2Y07L 5DD3H 3SKNA 3F7VB 1KV3A 1P4BH 1KLFA 1MCWM 4NNYB 3GMLB 2PCFA 4NQSA 3KWWB 2EEBA 1HKLH 4XNYL 4BZ2L 2WN2A 5H2BB 1HHKB 3BZ5A 4YDIH 4JFDB 3VFRB 3RAJL 2R9HD 1XB3A 4EI5B 4TNWK 1LE9B 3S0PA 5E94B 3KNBA 3H4HA 3MBXL 4LARL 4S2SA 3II3A 2Z4QA 4QTFA 1FVEB 1RPUA 3X11A 3DTUB 4ZAKA 5LO7A 1PZ3A 1QFPA 2I9LB 3EBHA 2FYYB 4QNPF 1DEDA 3A0OA 5ETUB 2VLJD 4KLNA 1LILA 2AI0H 4JPWL 3K8MA 3W9EB 4PV9A 1UJ3A 2IH1B 1JGEB 3OMAB 3ZMEA 3SBQA 2OK0H 3BAEL 3EHBC 4JM2D 1CFTB 2PP9A 4H0LC 1DJIA 4LCWE 5C0IA 4K07A 3TN0A 1RZFL 3GZQA 2CJ3A 3QORC 4WTWA 5IB4B 2DQDH 2WK2A 2IAMA 3PL6C 5FYKU 1FUNA 4LL1A 2EYSB 4FQLH 2EEDA 3QIWA 3V4PA 3O3EA 3SPCA 3TEXA 3V6FB 4CGUB 1YEKL 2APWA 2YZ8A 1AQ8A 1QATA 1BQUA 3GRWH 3KGTA 1IC0A 2V7NB 2QKIB 1N0XL 4X4ME 3TVMD 3LD8B 2NUPB 1C5BL 3TH3T 2WAQA 3VD5A 3FUNA 3HUJB 3A21A 2GIYA 2XG4B 4HWEL 1JMZA 1RUMH 1AZCA 5AEAA 2CO7A 2MRYA 2BE5D 4FYQA 1UA6L 4UTBL 5I1JL 3BWZA 4OGZA 5LAPA 4IBVA 4ZNEA 1FNGB 2UXTA 3GMLA 3ARGD 3KWWA 3HI1B 3QJOA 5BZZA 4KUCF 3UAFA 1RIUH 4CMMA 5H2BA 4LCVA 1MCSA 1HHKA 5DU7A 2FBOJ 4P23D 4AGNA 3U9WA 1ZEAH 4ODVL 1HVXA 1OT4A 3CZEA 4JFDA 4XVSH 5B7EA 3SE8H 3VFRA 5CN3A 1XF1A 3ESPA 5FUZL 3ESNA 1HDMB 3TBCA 2H1LM 1BW8A 3UP6A 4DETA 4EI5A 2PP8A 4JRYE 4IRJB 4PUBL 4GKZA 1D7BA 1TMQA 1B2WH 1RXLA 4AX3A 2DQUH 1E32A 4FYTA 3EH3B 2I9LA 1PX4A 5LNDA 4IBWA 2FYYA 5I18H 2D4DA 1DBJL 3LPPA 3ZHKA 1AE6L 2EH8H 4JE4B 3B2UD 3UZEA 1YYML 4R0LA 2IH1A 1JGEA 1BFOB 3F7RA 3O3DB 4MD5B 4XXCC 4YBLB 1L6PA 3RWFB 1RZIB 1CFTA 3C60C 2XQ0A 5HDQL 3C09B 2YU9A 1NBCA 2J20A 3BDBA 3N44F 5AG9A 3FZUC 4GO9A 1R5VB 5DA0B 1T0PB 4ILDA 4B9ZA 4R90L 2WKOF 1N8ZA 1RJLB 1RERA 1UENA 5ESAB 4D2NA 1JUFB 1N19A 1ZLWK 2JNZA 5DZ9A 1MF2L 3NFSH 4W9DC 3IJYB 2K45A 2XTJE 5IVXB 1X5KA 1QFHA 2V7NA 2QKIA 2J88L 4U1JB 3LN5B 4ALAH 4HOWA 3RTLA 1G0YR 2AQPA 2NUPA 2W95A 3AZUA 4EQ3A 4JZJB 1FFRA 3HUJA 4DUWA 4I7ZC 5ECJE 2RFXB 3RJOA 2WN3A 2F8VA 1J5CA 2GAEA 1FNGA 4OF8A 1WC2A 1JAEA 5DT1H 1E3ZA 4JDZB 3ZYIA 1JRHI 3BGFB 4FZEH 1G94A 1PZBA 1CTNA 5IBUB 2NDGA 3WFZA 1HDMA 3WDIA 3VRLF 4IRJA 1MCPH 2CBOA 4M3HA 3NCYP 2FE0A 4MJHA 4J3OH 4PJEF 2IV9A 2AQ2A 2NRDA 2BHFA 3IF1B 3QDMD 3BDXA 4UAOB 5JIQA 4PWFA 3DO3A 4EO5A 5C0RL 2A74C 5J3HC 1Y5IA 3O3DA 1BFOA 3Q2NA 4MD5A 5F9OL 2UWEB 1BW4A 4G82A 1RZIA 2BSCA 1SYVB 4H88H 5SX5H 4NQEB 3C6EA 5IMMB 5IQNA 4AVRA 1F8TH 4YHOH 4L4TD 2EVHA 4I3SH 3HMXA 5ESAA 1P53A 2P80A 1I85A 3QDHA 3FCBA 3WIIL 3SDDC 3IJYA 3F12B 5CEZE 1MRDH 1TMCB 35C8H 2F18A 4JG1H 3L5XL 3MHZA 4GH7B 2AC0A 1TWCA 2OL3A 4JZJA 4FQIH 1EZSA 3ARBC 2ZWLT 4WWKB 4TQIA 3PGFL 1UQSB 1OGTB 2VKWA 4LBEB 3G5VB 1I1FB 5DUBB 4KO5A 2VRAA 2XKSA 1BG9A 4FG6D 2DJMA 1TKWA 5DZOA 4FMVA 4DN3H 1XDTT 1Z3GL 1G9NC 1TZOA 5CKGA 3G5XB 4OFPA 2D7QA 4X7SL 5IBLD 2XN1A 3PGDB 3BWAA 3MOAH 4BH7A 1R1CA 4ONHB 4Z18A 2E2IA 2WMPA 4A67A 4YHKL 1JCKA 3T3PE 4JGMA 4OGXL 5I6NA 1DN0B 4C4BA 1D9KB 2HTKD 1BA9A 4DZ8B 3HFFA 4Z7NE 1QG3A 2WXMA 3HMWH 5T1JA 4JFEB 3IF1A 1WFNA 2JCWA 1A4CA 4WFGE 4JY6B 1GYVA 5FCUH 3SCMD 4A7SA 2UWEA 4MDJB 1LM8V 2X05A 1SYVA 5T5FH 4UNVA 3W5NA 4NQEA 2FK9A 3DXAE 4UZGA 5IMMA 1D5XB 1M7XA 2ZCZA 5L0QC 3K6SA 4IHOA 4YHLL 1CPUA 4ZG1A 2J8UB 1JZ2A 2Y1AA 3CSGA 1PZDA 3OG6B 2C9RA 4M4RB 4XXDB 3MX0B 4PAZA 2GT9B 3NIGB 1WIUA 2XFXB 2X40A 1CGTA 1OPGL 3V5DB 1NMCB 2PYFB 1WT5A 2VSCA 2WGNB 1MZYA 1A9VA 1QEWA 1EFXB 2IFFH 4Y0GA 2WAHA 5HI4C 3PWUB 4EZJA 4POZC 3W11C 2F54E 3CFNA 1UQSA 1OGTA 7PCYA 4LBEA 2FEDC 3G5VA 2UZXA 2Z7WA 3QPKA 1I1FA 2M1KA 4KK5C 1W15A 3QRGL 4Y4HB 3EKCA 1XCQB 3N50A 2JLLA 5BRQA 4DOHE 4YHPB 1JPSH 4FL4B 3SZ6A 2Z7ZA 4QLRA 3RJDA 1MCFA 3G5XA 4L3CB 1A47A 2R4SH 2KDGA 2BNQB 2R56H 3A6CH 4U0QB 3U30B 1E4XL 2AVGA 4P4RB 1KY7A 3HPLA 1B2YA 4HJGB 4EE2A 4JM0A 3DJZA 3C5ZC 4X9FA 1A7NL 1D9KA 1H8SA 4ZMTA 4JFEA 3WMQA 4N87A 5DR5H 2H4EA 1RUKL 4JO3H 4JY6A 2QFRA 1UOVA 2GI7A 4MNHB 2JCCB 4MDJA 4MJIB 1F11B 4YEEA 3KJ4B 4HGMA 4Y9CA 3AS2A 4CU6A 3UAJA 1D5XA 3OLIA 2V9RA 3RQ3A 12E8L 4ZTPL 1ZXKA 1MCRA 4ISVA 4RRPM 5F7NC 5ICXB 4XXDA 4L9DA 3VDBA 2H3XC 5GJSL 1YMMD 2GT9A 3GMNB 1ODUA 4RFNC 5DYOA 3U1PA 3ZKXC 1D5RA 4WFEE 1FDLH 3V5DA 3P4MB 2HFGL 5J56B 4XPHH 1FPTH 4PJBF 4OLEA 3C12A 2OV0A 2PI8A 3CXHK 1KQGA 3H7BA 3O2VH 3OZLA 4JDTH 2F74B 4PJ8B 4Y4HA 1UGKA 1XCQA 3UH8A 4B9CA 4Q52A 4GW4A 4TSAL 4XWOD 4NOFA 1VFMA 2NYYD 3BSHA 3F5WA 3TU6A 4BGLA 2BNQA 3NPSC 1KB5L 1HQ4B 1JV2B 1KCSL 2VABB 2MCG1 3C5SB 1PIGA 4GOSA 4P4RA 4GRLC 3ULAB 4HJGA 2F58L 4BZ1H 2EE6A 4TKWA 4DVRL 3GTNA 3APDA 5CJQH 1TWFA 4CN6A 1I3GL 3DOHA 1AI1H 5F7EH 2J25A 1M42A 5IB2B 3OAZK 4MWFB 2D4FA 1EO7A 3ECVA 3NYKA 4MNHA 4NBZB 2JCCA 1OSYA 3PP4L 4MJIA 5DFAA 2JWYA 3UDWC 4BHUI 1KCBA 3H3PH 4RGND 2XA8L 2HLAB 4ENZA 3GBLA 3I9PA 1E4WH 3TJEL 3UTSD 1YPZB 4FQQB 5SV4A 4P2AA 5J12C 5IF0A 1MJ7L 3QNFA 2A4EA 1OW0A 3KHQA 4Y2DD 1UHVA 2OL3L 1E27B 1ZS8B 3E3QE 5ICXA 5FUCE 1NBVL 1MCLA 4GI9A 3V4VL 4WHDA 2PXYD 3F6LA 2JIXA 2VLJB 3A6BL 2MPVA 1XF2B 3O6LH 2EDNA 4WTZG 1RUAH 2VDLB 1GZHC 2YD5A 1Q9LB 4Y9GA 3RWIB 5EC1B 1T2XA 4JM2B 2J1WA 1SMOA 5E03A 2ZOTA 5DJZB 1FQ9C 3VYOA 5F3HA 4I3RL 1BM3H 4Z7WB 4JPVH 5CKAA 1AO7E 2F74A 5FCSH 1SY6A 2OR9L 5AKSA 3D9AH 1JPEA 4ZW5A 2XWBA 3KWVA 5HYIA 3K1DA 4QHNB 3S37H 1XAKA 4K7FB 2A6ED 4ZS7H 3AG4B 5FYLH 3TIWA 1S9XB 3WTYA 1G6RH 2WQAA 3MLVH 1HQ4A 1JV2A 3TF7C 3TVMB 1DVTA 4AC4A 2Z8RA 2EYTA 1RH8A 3MLTA 4HZ1A 1E8XA 1JXJA 1E30A 3QRBA 1ZPLA 4L5FE 2JLPA 2XICA 4OD1L 2XPGB 1L6ZA 2ITDB 4M6MH 4XVUD 4FNQA 3PNWA 4KQ3H 4L9LB 4YDVB 3T8MA 5IB2A 4MWFA 2X70B 2ITEA 1OKEA 1UA3A 3ARGB 5EBGA 5C0EA 4TXVB 4LKXB 3R1GH 5JHLH 5DJXA 4U7MA 4P23B 1WUNT 2VJXA 3X1FA 5IK3B 4BD4A 2FBRA 4GRWF 1QBLL 4FQQA 1ROWA 4U0RB 1I31A 3FH5A 2I07B 1UUNA 2BIMA 1OTUC 2E4FA 2CGZA 2VLLB 3LYRA 3WTWA 1BBDL 3GZKA 4ZUTA 1ZS8A 4JVPA 1GIGH 2Z35B 4NLAA 4O2FA 1XX9C 4UQIM 4XMUA 5D1XD 4J1UB 4OB5L 4V11A 2OJZH 1FZMB 2VLJA 1E43A 2XA3A 3KYOB 4BM7A 1XH0A 3W38A 2ZG1A 3OG4B 3RWIA 4R26H 3GXNA 1ADQH 4FI7A 4FTVE 1FE8L 4JQIH 2LTQB 4UNUA 1DQMH 25C8L 1UWGL 1L7TL 5DC9B 1SBBA 1ACYL 3IRPX 5KW9H 4MLIA 2YPLD 1CZ8L 4PJDB 4YWGH 4RMUA 4EUPG 3GJFK 4MQSB 1SJHA 3RJQB 3A4AA 3WS3B 4QHNA 1DSYA 2VN7A 4K7FA 5EV7A 4IU3B 4WWPA 3C2SA 1Q0XH 1Q72L 2GEEA 5EU5B 3UJJH 1TETH 1ORQB 3O0RH 3TVMA 1KXVA 3QJUB 5CJXA 1C5CL 4ONFH 1IKFH 1UYWH 3EJPA 4KV5F 4YX2L 3X2HA 1KFAH 3RU8L 3R18A 1V27A 2DD8L 3V52H 4E9RA 3B7TA 1NM9A 2KHAA 2HH0H 2ZCLL 4JY4B 4L9LA 3OBAA 4K23H 4YDVA 3VQLA 2X70A 2OI9B 3KDMB 4MYPA 2FUQA 3ARGA 3H9YA 1VDGA 4HP5A 3RVXD 3PXHA 5E6ZA 2BFVL 1HTYA 2OCFD 4DGWC 5IK3A 5D8JH 2YAPA 1HCYA 4HH9A 3NH7L 1MI5D 2R29H 5A6MA 3HI6H 4OLWL 1A7QH 5C6TH 3NN8B 1WWWX 2VLLA 4EZMA 5CINL 3OGCB 1KB9K 1LO0H 4GPVA 3SGKC 4HC1H 4J1UA 1QLEB 1MFBL 2B9BA 2ICEA 1RI8A 2NX5D 3EFOB 1HIMH 1L0YA 4AZ8A 5DVPA 1XIWC 4H20L 1DBML 2CUMA 3CVHH 3KYOA 3QDMB 4JUTA 3VD7A 3MV8E 1KBBA 4D9QD 1QNZL 2AJZB 5MERA 3N0PB 4ZXBA 3Q2WA 3QR2A 4X5XB 2FQEA 4B95C 5CMAB 5I6XB 3PWJB 2CKBB 3S4SG 5KSBB 4O2CA 5DQ9B 1NDMB 3X12B 3QJHA 4L4TB 4H8PA 2HT3C 1FNSL 4PJDA 2ZUQB 5DS8A 1W6LA 3KR3H 1X9RA 4I0CC 4P04A 4APQA 2E46A 3U36B 4HWBL 3WS3A 5AAWA 5IG7B 4LIQE 1G9EA 1WHPA 2JK5B 4IU3A 4AM0Q 1NEZB 3O6FD 5BS0D 3N55A 5FKAB 5EU5A 3CFDA 1ORQA 4YHYB 5I17B 2QQQA 3DK2A 1J10A 5JIHA 4MS8C 1K2DB 3O4LE 3L9EA 2VQTA 3LVEA 3L4CA 2BY3A 2DM2A 4DP9X 2ZICA 5K9JH 4JR9H 4Q74A 4BK5C 1LEGB 4JY4A 1UT9A 2KZWA 1MWAB 4ZS6D 2O5YL 4UYPA 1CGYA 1UADC 2QHLA 2QSQA 2DLGA 4I13B 3VMNA 4AITA 1ZSDA 2JFCA 3QUHA 4NNPH 4A6YL 5MHSE 3AUWB 2PR4H 2ZOUA 3D85D 4TNGA 1DBAL 4H0IA 4M4PA 4U6HA 4MA8H 1DVSA 2XX0A 3NJXA 2VE6B 3NN8A 2HT4D 3WNKA 2C7FA 3H9SB 3OGCA 5GGQL 1IUZA 4MMZB 5T3XL 3WN5C 1NCDH 3GXFA 1CE1L 1T6WA 3UIYA 2GG1A 1KCVH 2AJZA 4F9PC 4JX0A 1BFTA 4N9OB 4EBQH 2EVFA 3SCMB 4X5XA 1FG9C 5T1LD 4EEEA 1A6TA 4KVNL 3B9EA 3WUWB 5CMAA 1SY6L 2O5XL 3PWJA 1IGJB 5KSBA 3EO1B 5DQ9A 5A3ID 1AQMA 3X12A 5DD1L 3ECWA 3QFJB 3J27A 2DN7A 3DJTA 4U1IB 2H8PB 2LLNA 1PG7L 3G04A 3IJHB 1A5FH 3AM8C 3PHQB 4KMLB 3LZQA 2LVCA 2I85A 3U36A 2YJLA 5IG7A 1QUNA 2JK5A 2IAND 1NEZA 4PRAB 4R3SA 2WKGA 4JPQA 5E1AB 5LBSH 1A4KB 1IFHH 2H32B 4XP1L 3RE0A 1TJHH 3BSZA 4YHZL 4AQZA 1JNLL 4OD3H 4PI0A 4YQXL 3B2VL 3D06A 1NGWB 4PLKD 4AGOA 3IDNB 1MWAA 4KDTA 4NKDB 3QHZL 4OLXL 1DN2A 3STZB 4M5YL 4HOZA 3S34H 1G9ML 1SLVA 3JVGA 5LXGH 2GBAA 3QAZB 1FO0B 4HJUA 4HJ1A 5I1EL 5MEND 1LXMA 1NGPH 4Y1AD 3T4YB 1QVOB 4O58H 5K5YA 1N6QL 1NWPA 3VSVA 2B3IA 2VE6A 1OK8A 3WKML 1HEZB 3BKJL 3H9SA 1AGBB 1SJVA 2FWSA 5LGYA 5KSAC 1B6UA 1P84J 2Z64C 4HDIB 1ASPA 4S11A 4FFVD 1HD5A 4QAMB 4IU2B 1MAKA 4JFWA 3SCMA 4XPBL 2BC4A 3PIQB 4G3YH 2G4EA 4J4PA 1A64A 2Q76A 2R0LL 2WQSA 3WUWA 1A14L 1A65A 1NLDL 3K2KA 1W72L 2Q3XA 3EYSH 3ILEA 4HUUB 4K7PY 3EO1A 2R4RH 3U9PH 2E8ZA 1UXMA 1N3NB 2NY3D 3QFJA 3T6WA 4ZZFA 2H8PA 3NCXA 3MYJA 2X9YA 3TH2T 5IESH 3ARQA 3X2MA 4JFFB 3HZKB 3MDJA 1G7PB 4GY4A 1S3KH 3EZ8A 4PRAA 1YMMB 5C0AD 3UROR 1P5UB 1A4KA 5EOCH 2VDKB 3KPMA 1PT1A 2BVOB 3CD4A 5EPPA 4D3CL 4ADJA 3AWFA 3CZLA 5I73B 4WO0A 1DVYA 3CK0L 3IAQA 2I7OA 4ZMVA 4X9GA 2E9JA 1T6VN 1NFKA 1NGWA 5DRXA 2X4OB 2Z3FA 5C70A 3O9WD 1AYOA 4NKDA 3MCG1 2DLEA 3MLUH 3STZA 2Z8SA 2BZ7A 4N0UE 3WD5H 4DKTA 1E9PB 3DUSB 4JQVA 1FO0A 2QLYA 5KS9B 3FQNB 2QHRL 3QZNA 4UINL 5FR3A 3T4YA 5D7IE 1QVOA 1P1VA 1T1ZB 1ICTA 1SGKA 3P2BA 4OFKA 2UUDK 3DI2B 1CD0A 4LHQB 1HEZA 1AGBA 1JHLH 1EGJA 4Y16A 5E00B 5D55A 4KKCD 4MZ3A 5AL8A 5FFOA 5BVJB 3MV9D 4HDIA 3LEYL 3H3KA 1PZAA 4IU2A 3IU3B 5DK2B 1NC2A 2AQ1A 2LU4A 3VD9A 5EZOL 3EYOB 4M8UA 1CG9A 4HUUA 4MX7A 1HINL 2A0LC 4RGNB 3RGVD 3TBSA 1UKSA 4E9XA 3ALWA 3UTSB 2NY0C 2BOLA 4HGKC 5AFAA 5ITBL 2YD3A 4LT7A 4TVPE 4DKDC 3EUDA 4Z95H 1RZKC 4JFFA 2JQAA 3HZKA 1AS6A 3DOIA 1G7PA 4Y2DB 5GGSY 4JPKH 1E2ZA 2G60H 2HA1A 5FO9A 5I1GL 4UBDC 1IQWL 1YMMA 2WQXA 2FH6A 1P5UA 1DQJB 1BPLB 3DUUB 4I0PC 1AZRA 4PMEA 2PXYB 2BVOA 5EFIB 3RFZB 1SRDA 3ZGHA 2QEJA 4JB9H 3OKYA 5T5NF 2ZCKL 1AJ7L 4NKMA 1T0OA 2YSTA 2YD2A 3A4EA 3F7PC 1RURL 2VTFA 3DGCR 3HS0C 3N9GH 4HKXB 5F21B 5I5IA 4N22A 4P2CG 4YHMH 4M1GH 3WKYA 5IBUG 1VCBC 3X1EA 2ZF9A 3QC6X 1YHPA 3ES6B 2P47B 4KUZH 5DUPH 2DM7A 1E9PA 3VGAB 1FC2D 3OKLA 2FD6L 4G11A 2BVTA 5KS9A 4N2HA 5MP6H 1PSKL 4KQ4H 1IC7L 3CZKA 4YL4A 1CD9B 2UY6B 3QISA 2DEYX 3LSOB 3KPRD 3BUIA 3QEQD 2DIBA 1TPXC 5E00A 2CUHA 3E9TA 3T0XA 1O6VA 5BVJA 1AC0A 4ELMB 1URIA 3K71B 1AOZA 3UCQA 4KFZC 3BKYL 3AS3A 4JHWH 4GUOA 3SE4C 1LWRA 3MAWA 3B43A 1HZHL 3M7OA 5M95B 2UXGA 1NCGA 3EYOA 1XTLA 3O6KL 3QDJD 1PY4A 2DLHA 2ZXQA 5IR1B 2C3XA 5JR1H 3CHXA 3G6AA 1JOIA 5L8KB 3UTSA 1O7DE 5J06A 2R69L 3T09A 4U7SA 3ZTJH 1WD8A 5FECB 4YDJB 3NCMA 2F19H 2N56A 2HT2D 4N0FB 4Y2DA 4H8WL 4U2YA 4X8XA 2WVTA 5D1XB 3DMMC 1YEIH 2XWCA 2ITCA 5L8LB 2ZXWB 1CO1A 3RFZA 3DUUA 4AK1A 2PXYA 1BZDA 3ULSA 2X6BA 1JBJA 4F2MB 4PCTA 2E7HA 1X3DA 4PJFE 2YGVA 2QSCL 4OLVH 3HN8A 1EAJA 5AZ2H 3T3PF 3VXNB 4B9JA 3CHOA 1SM3L 3PDOB 5KVGE 1H3XA 3N40F 2ZIDA 2PO6C 4FJZA 4Z7NF 1HZKA 2A9NL 4PJ5E 1XGQB 4DKEL 5DGQA 2NR6D 2YPLB 3ES6A 1U92A 2ICWJ 4XPFH 3D8MA 3SDCD 3QULA 1UD5A 3MSPA 4ODWB 3RL1B 1SF5A 3BQUC 2G5RA 2UY6A 1LK3L 3LH8A 1JXFA 4HWNA 2L3BA 3MUUA 3V10A 3CSPA 1DJGA 3MV7D 3LXAA 2BDNH 2XBTA 5DMGC 2CIIB 4ELMA 1A7PL 1VFAA 1MQKH 1R24A 1NLBL 2QTVA 5FHBL 4Z8FH 2WWMD 1CURA 5IFHH 4B60A 2NNRA 2WNGA 3BLBA 1HWWA 4OZFB 2CLVA 4GXFA 3LZOA 4YOKA 5IMKB 4D7ZB 1YC7A 1WCQA 4HMEA 4H26B 4FFWC 1CF8L 1EDHA 1MI5B 5L9DH 1Q38A 2JJSC 1YSOA 2O6DA 4L3EE 5CUSH 4YDJA 4BHUA 3L48A 5FECA 1BV8A 4K9JA 1RHHB 1L0QA 2JV6A 2XJKA 4N0FA 4X5PA 3MLYL 3V9CA 1DBBL 1QMUA 5D1XA 4CS0A 2E27L 4KJQC 4DO4A 5D1QD 2NX5B 1AQHA 4LCCC 1DUZB 1F90L 2WLJA 5F96H 3VXMA 4LCUB 2B08A 3FU9A 4QR7A 5JQ6L 3MROB 4LCYB 3R7QA 3NFNB 1ITBB 4I2XE 2MCPH 5A2LH 5IB5A 4UNTA 4LMQE 3N1GC 3GBEA 2HUHA 3VXNA 3LEXB 1UWFA 1KNOB 1OAUL 3QQNA 5MEQB 1WISA 2MNUA 2LR4A 1I9JL 4LVEA 1A6WH 3FU5A 2YPLA 1G1KA 1BFSA 4ANUA 4PD4K 2E3VA 3IFOB 4FNLL 4RAUB 4DQOH 5A2JH 2PYEE 5DFVD 1OAKH 5FGBC 4WW1B 1EGJL 3O6FB 4GXUM 5BS0B 1E5UI 3LIZL 3RL1A 2H9GA 1JGVH 1TTRA 1RZJC 1YEGH 5D96B 1TEYA 4GUPB 1KXTB 2N4IA 1V7ML 3MNMA 5F7UA 2H2PD 4QRPD 4NAMA 2EIEA 2ZG2A 1MREL 5CZVH 1E40A 3EO0B 3BKML 2CIIA 1O7VA 5D1ZC 1EO5A 1IL1B 2NW2B 3KDPB 2BSED 1U93B 2QV2A 1SEQH 2XSKA 5IQMA 3B9KA 5HY9B 2WZ6A 2YEVB 3QEHB 4OJCA 3WIHA 2JJVA 4DH2A 5KEZA 4U33A 5IMKA 5C3IA 3V95A 5DD3L 4TM9A 1NTDA 4JO4H 5IY5B 4M5TA 4ZYKA 4JO5A 3UERA 2JI2A 4B9YA 1RZKH 4AC2A 2DM4A 3D85B 4NN6B 4JFZH 5FGRA 3MRKB 1HKLL 2CWRA 2ID5A 1UZ6E 3L2LA 1M4KA 4YDIL 2YBGA 4Y5YB 5BMFH 3GTLA 2FZ3B 3GBMH 1FVCB 1TJGH 2QPUA 4K7PL 3AXIA 2NX5A 1DUZA 1QUPA 4KK8C 5TTRA 4LCYA 3WEAA 4MKTA 4AV0A 3NFNA 2X88A 5AVYB 4WNQB 4N90E 3DIFB 3B5GA 2AJVH 4EMZA 4OVUA 4U4IA 3LEXA 5F1KC 3UPRB 3CQZA 3HAEB 1KNOA 2AI0L 2E4TA 1ET8A 2IPUG 1QTYT 4YLBA 3FHQA 2YHGA 2ZCHH 4GRWH 5CU9A 5KN5B 1EHLH 2Z4TA 3BO8B 5AKTA 1L9TA 5DJDA 1DFBH 4WW1A 2DQDL 2IANB 1VKXA 3O6FA 2UY7B 3RFRA 4DT2A 3R8QA 3VXQB 5JXAH 4ZRGA 4FQLL 1KC5L 1KXTA 3HKFA 4LL9A 5F8RC 3NP4A 2ODHA 1F4WH 4FAAB 1MY7A 3IR6A 3JTSB 4OUUB 3NJVA 5AVRB 3EO0A 3GRWL 3V7AG 4WW2B 2NW2A 1IL1A 2XZQH 1U93A 5EDXA 3OAYK 3GNMH 4NAJA 4UZUA 4M7LH 3FB7B 1RPQA 3EFDH 1PQEA 1IAKB 1QA9B 3QEHA 3BVWA 3FRUB 4KPHH 1RUML 1NL0H 4M6OH 4HYTB 2FYVA 5BZDB 1HESA 5MENB 1BZ9B 5I6OA 3DROB 3EOAB 4Y1AB 2XZAH 5E2JA 5F44A 2AK4E 2FO8A 1RIUL 5I0WA 4TULH 4XN9A 4F9LA 4MLSA 3DRTB 4HCRA 2H47C 3CMOH 1ZEAL 3SE8L 2FZ3A 4XVSL 5DJ6A 4UTAA 1IIKA 4LDLB 5JZ7C 2BP5M 1I75A 3VGGA 2QR0B 3U7WL 3A4FA 3TA3C 4XNXH 3N42B 5ADOH 1KCKA 4KJPC 3APCA 1B2WL 4XB3A 3HFMH 4K3EH 3GJFH 2DQUL 3GT6A 4WNQA 3DIFA 5GZND 5BV7C 5JXED 3NRFA 2O30A 5JOPD 3UPRA 4DEPC 3HAEA 3RVTC 3CXDH 4P4KD 4Y19A 2NY3B 1OM9A 4RRPA 4GJTB 5FOBB 1LWJA 3H9ZA 6PAZA 5D7LE 5KN5A 1XD1A 3FH8A 3ZJAA 2QGCA 1CDBA 2IANA 2FCBA 1DQDH 2UY7A 1IAIH 3I75B 3VXQA 1WS8A 5C0AB 2F7OA 5C71A 1R5IB 3RVWC 3QG6B 4H8QA 4YO0B 2Y5TB 4JFHE 2K7QA 1P7QD 3V0EA 3JTSA 1E6JL 4HLZH 4GG6B 4OUUA 5DO2C 4WW2A 3QUMA 1TQBC 3B4NA 3O9WB 3SOBH 5HJGA 4FI6A 1IAKA 1AZVA 1MXDA 1QA9A 4I9WD 4ODSH 5IBTH 3TYGH 3GTPA 1ZYRD 3FRUA 3NGBB 5CSBA 1BMGA 5E51A 1T89A 2ZX7A 4PIRF 2IALA 3G7TA 3GYRA 4JVWA 1PZ2A 4HULB 4W9JC 5BZDA 1BZ9A 5IQOA 5MENA 3DROA 4Y1AA 1ZTXL 4CUCA 3PDGA 4NKQB 1PLCA 2GVYA 2ORBH 2Q86B 1QI4A 5HVHC 2ZYIA 3HG5A 1VERA 2VDMH 4ZUUB 2Z6FA 4FLQA 2QR0A 2G0KA 1ZWIB 3CFKB 3FB5B 4IBYA 3HBPA 3MV9B 4U4BA 2FX9H 1QKZH 4K3GA 2E6QA 5C1BA 4ECNA 5ALBL 1J88A 4FEIA 1D6VH 1K8IB 3VXSA 3DETD 3PWLB 4HXBH 2KQAA 3U2SB 1CGXA 5T1KA 3WI9A 1J8HE 3D2UD 3RGVB 3MXVL 4PJXE 3FSZA 4R8WH 4JHAL 5D7KE 2OLDA 1IC4L 2VM3A 4LPWA 4KKLC 4BFJA 5E24E 4H88L 4KTDL 5TF0A 1N2RB 1LMKA 1F8TL 4YHOL 4XVOA 3I75A 4I3SL 3LNIA 5C0AA 3IJEB 3NSDA 5HHME 2Y5TA 4APXB 2DQJL 3IDMB 2QVIA 2BY1A 4GG6A 2D9QB 2WJ7A 1MRDL 5KJRH 35C8L 4JG1L 3WENA 2VMCA 1UT2A 1V54B 3O9WA 3STLA 4FQIL 4LQFH 3FN9A 5CBEB 1UXSA 1X5LA 4OKVA 1L5GB 5HYSB 3BRFA 1A0QH 3I3BA 4GAFB 4XMLL 3UGEA 4RBPH 4AXWB 1NICA 4U1NB 1XSJA 2VW6A 2VO8A 4NM4L 4Q0XH 1CGVA 5IROA 3ZK0A 4ENGA 5E6ID 5T3XD 1XB6A 2N0KA 1H3GA 5CZRA 4DN3L 5FIEA 4HJSA 3X2NA 3I84A 2EEXA 1O7SA 32C2B 3KPRB 3BOVA 5JPNC 3QEQB 5DJAB 1PGRB 3HTLX 3P0YH 4ZUUA 3KPSD 3LKQB 3MOAL 3LKPB 1ZWIA 3FB5A 1CFVH 1N26A 3MV9A 2LHAA 4Z77B 3ZZLA 1RK1B 2G0LA 1SOXA 5IWLC 1XL4A 1NMAH 2XQBH 2XV2A 3D39A 1K8IA 4B27A 3PWLA 3QDJB 5BUAA 3HMWL 3U2SA 5CR1A 1R3JA 5CD5D 2AW2A 3NJNA 4M03A 3RGVA 3CX5K 5FCUL 5C0BD 1S9WB 1NEZG 2D31B 4ERSH 2K9UA 4QIRA 4HMDA 3WJJC 5T5FL 2J3SA 5FWRA 3UZQB 5EBLA 5AW2B 5IHUH 1U3YA 3ZUCA 1T2JA 2AE0X 4ZNEE 4LLUB 4OCRH 5DD0H 4W4OC 5LBVA 2BSRA 2PPEA 3IJEA 5B1BB 3X3FH 4KKBD 1G43A 2EE9A 2ZONA 3F7LA 2VSKB 2QJDA 3IDMA 3NIDB 4JFDE 1CXKA 1CDYA 4WCYH 1J8RA 1GGYA 2DBLL 1SN2A 4MDIB 1NEPA 1FG2B 4ODHL 4PYGA 4QF1B 5I75B 3BUYB 3TFKD 4YZWA 3LH9A 4AONB 2VPWA 2VKXA 5EBMB 1A6VL 1L5GA 2RBLA 3TBVB 4Y5VB 5HYSA 2FATL 4AXWA 3F7YB 3N43F 3IDGB 3SDCB 3KW8A 3GHPA 4D7BA 2D0GA 4GNKB 1M7DB 4GW5A 3QXVA 4IW4C 3C6SB 5FLUA 5J4MA 1OTTD 4X83A 2CLRA 1UD3A 2I9TA 1JPSL 3KPRA 3QEQA 5DJAA 3AACA 3KCPB 1SF3A 3GRBA 3MV7B 4P5TA 3VGDA 1DVFC 4LP5A 5TK2A 2R4SL 3A6CL 2R56L 3LKQA 3LKPA 3WUWG 3VSQA 5BV7H 1K3ZA 5CP3H 4MNGB 4Z77A 1AR2A 4LVNC 1GY2A 1E2WA 2G5BB 4LVHB 3FQYA 4OJDH 4QRTB 5ECGA 1OB1B 2J4WH 3GKZA 4OIIH 4FABH 4D0DB 3QDJA 3LZRA 4OIBA 2VL4A 4R5VA 1ZXQA 2X3CA 5A43C 1GOGA 3PAYA 2BWQA 3VD0A 1A4JB 3ELAT 1CL7H 3HUJE 1S9WA 3IXAA 2D31A 1TVBB 3SUJA 2WW8A 5FHAH 3VVWA 1G0DA 3V0DA 2WCSA 3E8UL 1YNKH 3TZVD 1Z3RA 4LLUA 1T22A 4HMCA 5D1QB 5ABAA 3ZXAC 3TS8A 4DKAA 4DK6A 3QUML 2B3RA 1W6WA 1JYXA 2WQWA 3NAAH 1QSZA 1S9YA 1FNLA 1ZDQA 2XYCA 3OSVA 1QHQA 4M29A 3MJ9H 4MDIA 1A2YA 1FG2A 4PY7A 3OD3A 5D6CB 3SGEH 3VWKC 5B3SB 3BUYA 4NCDA 3ZKND 4HALA 1Z9LA 3FU3A 2UUDH 1Q0EA 4LAQH 3TBVA 3FFCD 3W9DB 4Y5VA 1RLBA 3NESA 2DICA 2AQRA 4XPHL 3IDGA 3SDCA 3CAFA 3QQ9C 3IWVA 4ZZKA 3O2VL 4JDTL 1M7DA 3IMVA 3C6SA 4N5EC 1BF8A 1FH2A 2AJUH 4XAKD 2DMGA 5C0JB 2VJ0A 5HHQB 2PJHB 4QRPB 3KCPA 2A73B 3B2XA 3MV7A 1WA1X 3CVIH 4GS7C 4MSWB 4L8DA 3RHWF 5T5ID 4HZLA 2YXVA 4TV3A 4MNGA 4Z23A 1DLHA 2G5BA 4FA6A 4KJWC 4HJJH 2A9MH 4QRTA 3VI3B 5C0ND 3BFOA 1OB1A 5KANI 5SWQB 4D0DA 3A3YB 5CJQL 5IVXE 1BEXA 4R97C 4KDVA 1AI1L 4H4NA 5GISL 4PRHD 1KF9B 1A4JA 5E8DH 4CRZA 4X7TA 3JQOB 3V6BR 5IW1B 2CBPA 3MODH 4EDWH 5DGRA 1J48A 1B4JL 4BUQA 4BXVA 1AD0B 3WSQH 3EJYD 2I32A 1E4WL 5D1QA 2WBJD 2YO3A 5CEYA 1MCKA 5HJDA 1EEZB 4LPVA 1FFQA 1GSKA 2ED9A 3WMPA 5GXBB 5D7IF 2B1AH 5CD3B 4KKAC 1C1EH 4ZSOA 3S35X 4XB8A 5D4HA 3SYOA 3QI9C 1GXEA 1XSKA 4BA0A 5EFIA 5CEZH 4OZGA 2VRQA 5D6CA 2ZKHH 2HTLD 2QLVB 4M7ZB 4XPGL 3WLWC 1RUAL 4JBSA 3TXAA 3W9DA 4WSJA 5IJCC 3FW6A 1Y18B 3TBWB 4AGLA 4P46C 1N7MH 2M2DA 4L8CB 1YUHA 4K5MA 5AOJA 4XN7A 3STBA 1BM3L 2VWEC 2X4UB 3KVQA 3O4OB 4JPVL 3WKQA 2UWEE 1F4XH 3D9AL 2DI7A 5IOPB 1ZT4B 3EJSA 5ACZA 5C0JA 1KJ3H 4NQEE 4QRBA 3S37L 2A73A 1NINA 1HH6B 2BCKB 1ETA1 4HHAA 4MSWA 4L8SB 4ZS7L 3L3IB 5FYLL 1FLTX 1G6RL 2VYRE 1DQIA 4W1TA 3MLVL 2Y2WA 3O8XA 1CICC 5TFSH 2BSEA 5C2UB 1TR7A 5CGYC 3MPCA 1VRSA 4KXAA 3L1FA 5SWQA 4XBPA 1EZLA 1Z0NA 5DUMH 2VAAB 3EUUA 3FQTB 3T1FB 3ZE1B 1UM4H 4YSEA 1I1AD 2RR3A 3BP4B 2L7QA 4RQQA 3TLRA 3NCFB 3U7YL 3FUDA 3R1GL 1EUTA 5JHLL 1XWVA 2WXGA 1A8JH 1VF5C 4LQ1A 3OJVC 1AD0A 5A2BA 2WQUA 3VFSA 1OQOA 4JZNB 4WI8A 1S7TB 3NIFB 1EEZA 1FNEB 1UZGA 3NACH 7PAZA 2I26N 2WKOA 5IP4A 5CD3A 2QQLL 2EDJA 2DY2A 3FQ1A 3TIDB 1GIGL 2BY2A 5F6IB 2J6EH 3KYNB 3SDAC 2H26B 3GTKA 5EOTA 2YZ1A 2OJZL 2APXA 3VG0H 5CZKA 4P4KB 1XH2A 1JNHA 3L8QA 4QYOB 4I5BB 1NGYA 1Y0LA 3TBWA 2BSTB 4PW3A 2OMTB 4NS0A 1ADQL 3TYFB 2GY7B 4IIQB 1JMXA 4JFEE 2Z31C 4L37B 4M00A 4OFVA 3IGKA 2W9LA 3KEDA 4L0PB 2X4UA 3LNHA 4KI5D 3BCFA 5KW9L 5EC2B 1RIHH 3SO5A 1U3HD 1N10A 4YWGL 1DJSA 1ZT4A 5IOPA 5I1KL 3D3VD 5H4YA 3BUQA 1MHHB 4IBZA 5I1IH 5E08H 3BVDB 1I7RA 3QFDB 3GLAA 1P7QB 2F5AL 1D5ZB 1HH6A 1KIQB 3FYIB 3JT2A 4L8SA 3BFWA 1Q0XL 3L3IA 4X4KA 2C4FT 1HH9A 5IKCB 3AT8A 1TETL 3UJJL 2J8UE 2L04A 3O0RL 1QWHA 4P3CL 3QWNA 3WY2A 2FT7A 3BYYA 4ONFL 1IKFL 1UYWL 3DVGA 5F1IB 3U1QA 7FABL 3IRZA 1CFSB 3FQTA 1KFAL 1QSFD 4X42A 4F7MB 4PJFF 3NIGE 4ENED 2HH0L 4X7FC 4JKNA 4K23L 3QPQD 4QRRD 1CZ4A 2CHXA 3UC2A 3BP4A 4D94A 1NM4A 2A6IB 3MCKB 4H5SB 5EOCJ 1V7NH 5L7XL 3Q01A 1T1YA 4JZNA 3ZT5A 2R29L 3EJUA 1S46A 3HI6L 4EKXA 1OE1A 2K9FB 2WLMA 3T0EC 5C6TL 2F68X 4FXGC 1IFGA 3LPWA 4QOKD 4ZX6A 3K2MC 3S2CA 1LO0L 5GZNA 3UIZA 3INUH 2H26A 5AKVA 2BNQE 2HFFB 2R2CA 3B7RL 1U8JA 3NA9L 2EDXA 4EZKA 5KVFE 4XI5C 4BFRA 3D2UB 4QYOA 4X8CA 4I5BA 4J28A 3CC1A 4DO6A 3L6FA 1CDHA 3TYFA 1GMIA 4IIQA 4NZFA 1JK9B 4WZ9A 4L37A 2YWZA 3K4DA 4HK0A 3MRCA 4G6FB 2JKNA 2JCCE 4OH2A 4MJIE 5KVMC 5EU7E 3HZYB 3KR3L 4MMYB 4OY9A 5AZEL 1MHHA 1CR5A 5C6WH 4KAQH 4GKSB 4ZUVB 3VE0A 2OMBA 1D5ZA 1I8LC 1KIQA 1U3ZA 3TOPA 4E5XB 4OZFG 2DBJA 1Y6NR 1NDGB 4NQDD 3VA6A 3ZZ1A 2NCMA 3RRQA 1L9SA 1I7UB 2K6YA 4IDJH 3GIZL 4A6YB 2KZBA 4OT1H 4JR9L 5K9JL 4NPYA 2Y1VA 3RIKA 2V9QA 1RJYA 3OHXC 2PW2B 6PCYA 3OKNA 2G75B 5E6IB 1T2QH 5F9JA 4WK2B 5BW7A 2C3VB 2EC9T 4LO9A 3KBEA 4B0MB 4H5SA 1NGXA 5ENWA 3VG9B 4NNPL 2DOCA 2PR4L 4A2HA 1IRAY 4M7JH 3H56A 4QXUH 4FFYH 1FN4B 3KPSB 4MA8L 3DURA 2UX6A 4PJHB 3K6DA 1QX1A 4PVNA 1F00I 3QXTA 4X8JB 3X3GH 4AJYV 1T4KB 1NCDL 4WI5A 3QJXA 4KHXL 1WAPA 2HFFA 4KGJA 4NI6A 4CA4A 1JYVA 3V0VB 5IQ7H 3QYMA 1MW1A 4AMKH 5AW7B 1NFIB 4LLDB 4RSVA 3D2UA 3V5KB 1SXSA 1C16B 5C0BB 3X2LA 2VC2B 4ZMNA 1KGWA 3UBXI 3P2TA 1AY1L 5C0CD 4AGPA 4HISA 2EIJB 5CIPH 4YDZA 5CLTA 4FX5A 1MFUA 3VFNA 4YPGA 3GSVB 1GZQA 4K55A 1FJ1B 3OAYH 2OYPA 1WF5A 2P5PA 3V7AE 1A5FL 3HZYA 4F1SA 1BWMA 4BSJA 5C7XL 5JOEA 4NHCH 5B22A 3S7GA 3L16A 4GKSA 2Q2LA 2X4QA 4N6RB 2GCYB 1XXDC 3Q1SL 4AM0A 3OKMA 2I5YL 4E5XA 1YPZE 1NDGA 4EDXB 3EW3B 5LBSL 2XWTB 1OA7A 1IFHL 4BFFA 4Z3HA 2QADC 3EH5B 1JI2A 1TJHL 4FS0A 1I7UA 1XFPA 1G6VK 4UT9H 4L5FH 2HN7B 1H6TA 3PQYD 4OD3L 4PFEA 2VLKA 3QE5A 4MXQD 5FTMA 2VLJE 3VYPA 2BHUA 4NO0D 4FI8A 9CGTA 5E6IA 1J1PH 4R4NC 2C3VA 4NRYB 5INDA 3S34L 3CLEL 4JFOB 5IW6B 2JKTM 5LXGL 4H44C 3BN9C 4KKRA 4W9EC 4NUGH 4WI3A 4Z7WE 1BQKA 3KPSA 1ONQB 1B0RB 1FIEA 3RX7A 3K8KA 1USZA 1ZIBA 3MRFB 3HAEG 5A6IA 2TSAA 1VFBB 2RHEA 4X8JA 4RRPG 1ETZB 3MLRH 5C97A 3NQIA 1PLGH 1NAKH 3KJ6L 5L2KA 1HILA 1GPOH 3V0VA 5B4MC 1NUNB 2AZAA 1NFIA 2DL9A 4LLDA 3V5KA 1R5WB 5C0BA 4G3YL 1XGTB 4FHKA 1JZJA 3EYSL 3MOBH 4TUOB 5FM4A 2WLKA 2R4RL 3GKWH 3PJLA 1KCUH 4XX5A 3SE6A 4DNLA 5LQBH 3TZVB 5I1LB 4PJBA 1V3LA 4TL4A 2DKUA 3GSVA 1FJ1A 3UJIH 5I23A 2GSMB 4XNZB 5GZOD 3IMBA 4WHTA 5IESL 4Z3JA 3MV01 3IDIB 1MCOL 3AQYA 3EH2A 4N6RA 2EDKA 3KLHD 1XB8A 4N0YH 1S3KL 2DQ6A 4PYHA 4XODA 1ES0A 1RJCA 4IRSC 3N1MC 2XWTA 5EOCL 4XXWC 3VXPB 4ONGH 2WJ5A 1WFJA 2O5ZH 3I6SA 3FFCB 2HN7A 4YSOA 2AABH 1QCSA 4N3UA 5C8JB 1T1XA 3GC3A 2XLLA 4KKNA 4TQHA 2NY7L 4J39A 3IB4A 3ECQA 3KD4A 3BW9B 4ZUSA 1OV8A 5AOMA 3SPVA 4QT5A 3X1GA 4EVNA 3MLUL 1U8QB 2P44B 5EO0A 2H41A 1KG0B 4FZ8H 5IW6A 2WYHA 1G7HB 3CXHJ 4JFOA 2KL6A 2CO4A 3NSCA 4PJ7B 4NC0B 1OALA 1JXDA 1B0RA 4PJDE 4YC2C 3I02B 1J0HA 4KC3B 4DP4X 4RV0A 1VFBA 2QSTA 4YDLC 3WO4C 1ETZA 4WDIB 5IMLB 3UG3A 1JPFA 4PRPD 1BYNA 5A2KH 4PRHB 4FMKA 5HDOA 1R5WA 2D0HA 3P3SA 4KMTH 5E8OB 5HVWA 4CVXA 5CBAA 5F7DA 3T2LA 5PAZA 1LO2H 4JFVA 4TUOA 4Y5XB 5I1LA 1PU0A 1TWGA 1SLUA 2PWFA 2F6AA 1JGLH 2VLMD 4TNFA 4WTQA 4OCNC 2WBJB 4UQDA 4GUQA 2ERJB 3IDIA 3GJEB 4LNVA 3WNLA 4HU8A 2VUKA 4HIXL 3ZDXB 3OAWA 4JPKL 2G60L 3QJFA 3B9DA 3B1TA 2C34A 5TDPB 3VXPA 4F2FA 3ET9F 1QRND 5F1SA 4JB9L 1N6VA 1ZVYA 1Q16A 3FFCA 1V5JA 1SXBA 5E1HB 5HI5C 3N9GL 2X89D 3V2AR 1GGIH 3QDME 1BQ5A 3NABH 3L95A 3BW9A 3FMGL 4M1GL 3TIEB 4YHML 2QFPA 1U8QA 2CGRL 3KPQB 1PCXA 1KG0A 3FSOA 4KUZL 2R51A 2CBTA 3HG3A 1UEMA 3MNWA 5KSBE 4PJXF 3MMEB 3SYAA 5MI0C 4IEFB 3V0WH 4FQXA 2VERN 5MP6L 3OLGA 4KQ4L 4L4TE 4PJ7A 3AB0B 2EDRA 2K78A 3I02A 3ABMB 1HFUA 3MZGB 1A1MB 1Z9MA 5IMLA 1L9PA 5AOKA 1BMZA 5IHHA 1YEDB 1E50A 3QORD 4MAYA 5J6SA 3O2WH 1ZHKA 3PL6D 3BHBB 2VT0A 4JHWL 1K4DB 4IOFD 3FT2B 1I1AB 3P3RA 5E8OA 2WXFA 1AXTH 3OX8B 5FYKH 4PB9H 2W1NA 2GAZB 4GFXA 4RISH 5JR1L 1PNDA 5EA0H 1M2VA 4PWHA 2WBJA 3D08A 2MQ3A 3HG0A 4AYFB 3WTTA 1CJYA 3FTZA 2ZWKA 3PS6A 4MJ4A 3RWEB 2DMCA 3BQVA 1MNUL 3GJEA 4NFDA 4F15B 4S1RH 1YEIL 2PPDA 5HYSG 2X2UA 3F7QA 3TO4C 1X9UA 4WI7A 4LLYB 2VQUA 1XZ0B 5LGJB 3H9SE 3ESUF 1XR8A 4CRPA 1DE4A 1CN4A 1PYWA 4I87A 4CN4A 4LZKA 3LS5H 2AQQA 3NZUA 2ED6A 3QCUH 1U8PB 1VLXA 2B77A 4EOWL 3ATFA 1Y6KR 3U46A 5E6SB 3I3EA 3KPQA 1IGYB 1W2KT 1U3HB 2ZUTA 4XPFL 3VFVB 3D3VB 4ZW3A 3MMEA 2C9VA 4IEFA 3QFJE 4KO9A 1MCHA 3VD3A 1NEUA 3OAUH 3ZHDA 2OTUB 4WI6A 3UC0H 3MYZA 1AS8A 4R7LA 4XC3H 4IIZA 4NN5C 4JG9A 3V4UL 1A1MA 3C60D 5LB1A 3OZ9H 1P9MC 2EC8A 1YEDA 4LOUC 1QSFB 4K71B 5CAYB 1ZRUA 2L7UA 3KZ8A 1MQKL 4ZI8A 3BHBA 4GMTH 2VDNB 1K4DA 3L3OC 1RZ7H 3P2DA 4QRRB 4X7CC 1HX0A 3IS0X 1NCAH 3JWNG 1E9OA 3OX8A 1NWOA 4QHKI 4TUUA 4R4FH 2GAZA 4F8LA 3FN3A 1YN7B 1L3NA 2ESVD 3ZTEA 1WIPA 5L9DL 1KTKE 3PAVA 2W9EH 4GQQA 1SFHA 5CUSL 2V2WA 4AYMC 3RWEA 1BAGA 2NXYC 3NJLA 4QOKB 2NQCA 4G1MA 1A4AA 4IRZH 2Q3ZA 5F96L 1KB9J 1T20B 1XZ0A 3MKKA 4LDEB 3RL2A 4ZDHA 1MLBB 4N2AA 1CLYH 4L8BA 5T8IA 4HIQA 1EEQA 2B1HH 4DP5X 1NAMH 4G42B 5FPIA 3BWUC 5C92A 1FNFA 5HHPB 5LWYH 3KGRA 5FLVA 2W0PA 3ZKSD 4XO8A 1IGYA 2CR6A 1U3HA 2IPTH 1QFWI 3VFVA 3HUJF 2J43A 3SOTA 4DQOL 5I16A 2ZSVA 1OAKL 3FTVA 1WAEA 3R4DA 2VMEA 4Y4KA 2DYPD 3LQZA 2OTUA 1T4WA 4JAMB 3Q05A 4IQHA 4NQDB 2YUJA 4OFDA 4F7EB 1HHJB 5J3HD 1YEGL 2X1QA 4JFFE 2XETA 3OXSB 1U42A 4NC2B 4CU8A 3A23A 4DSYA 1YMME 3X2JA 4B9GA 5CZVL 4YSTA 3US9A 4WK4B 3Q5YA 4X0KA 4XN4A 4L2YA 5LVEA 1SEQL 3MBEA 5FOJA 4ZPVB 1CB4A 1Q0YH 2FECI 2ZWYA 5I8EB 4QRRA 3OVUB 3KVPA 2WSKA 5JQIB 1J1XH 2MKLC 1CS6A 5HI3C 1RMFH 3SDDD 4RLDA 4HS3B 4OF0A 1FL5A 2HX9A 4PG2C 1YN7A 3TV3H 1RZKL 1EXHA 4JFZL 3IM1A 1TTFA 5DXWA 1DSWA 1UH2A 1Z66A 3N04A 3ARBD 3BISA 3PJSA 1IIIA 5BMFL 3UPCA 3FSWA 5KS9E 1WP6A 3BESR 3HE7C 2QMJA 5DCCA 1TJGL 5DMJB 3GLDA 3GSQB 1EJ8A 2OTWB 2YUXA 3QB7C 4HIPA 4WWNA 4F1ZA 1YNTB 1T5XB 4YVUA 4RX4A 1T20A 3K4ZA 4NKOB 2FQGA 1JHKH 5B7MA 1MLCB 5J7CC 2YD6A 1MLBA 1IJ9A 3VD2A 2AJVL 3L1GA 3EJQA 4FA7B 2FRGP 5HHPA 5C0CB 4DFIA 2NTFB 1TZHA 1J5OH 2DRUA 5IVXF 1A25A 3QUZC 2QDWA 5A16B 1R4XA 2ZCHL 5FYLD 3NTCL 4YUEH 1E9QA 4Y8DC 1CLOH 2V7HB 5E2WH 1I1YB 4RGNE 1DFBL 3V5HB 1X5HA 4OI9A 5E2VH 5EEWA 3UTSE 3CFBB 1NQBA 3LKNB 4NQDA 1UM5H 3E2HC 1WH0A 1EANA 3MBWA 4LHJB 3HNTH 4M8QA 4PEEA 4TPRH 5F72S 1F4WL 4F7CB 1AHWC 3EO9H 3PQYB 2V2XB 1EK3A 2XZQL 4UIMB 2BNRB 5AW9B 4JGNA 3EYVB 4A7VA 3GNML 4ZPVA 4MA7H 3T6QC 4M7LL 3EFDL 4JW3A 3E8VA 4KPHL 4M6OL 4X4MA 1EAQA 2Q3AA 4HS3A 3K81A 1OAZH 4G83A 1S78C 1NCNA 3K2UH 4HPYH 5D6DA 4HEPA 2E6JA 3SE3A 2XZAL 5AALA 4JKPH 1PF3A 4ANXA 4GINA 3CFEB 5DRZA 4AIXA 4ABWA 3ASOB 2OR7A 4KXBA 3KPPB 4XHJD 2UWEF 4FA8A 4POZD 3W11D 4GRMA 3WIFB 3GSQA 2OTWA 4LSSH 3CBJB 3VAEA 1YNTA 1T5XA 2FEDD 5IVZB 2EE0A 3SQBB 2CO6B 5ADOL 4NKOA 2G2PA 3BD5A 1ITCA 3VFWB 1MLCA 2FHFA 4MNQD 3QWOA 2ATPA 2Y4SA 2FSDA 3BYTA 2XRAH 4ELME 3CXDL 3DX8A 5KVGH 2NTFA 1JZGA 1JTPA 3IE4A 4GEJA 1VJSA 1I3RA 3BVXA 3NJIA 5A16A 1MH5B 4W9HC 5B3JE 2DWDA 3UBXB 4LSUH 1F0LA 5DVKA 4P2RD 2Y2YA 3TURA 2IDSA 3V5HA 5KUMA 2JJTC 1DQDL 1IAIL 3CFBA 3LKNA 4WNJA 1TNNA 1WWAX 5ELIA 2E7LA 4PLJC 4J6RH 4JHZA 4XVJH 2DLFH 1AGFA 5D1XE 2B5IC 2V3DA 4RAVB 4F7CA 2FNBA 2XOTA 4LSTH 3L4WA 4MCYA 3KH4A 1OP5H 2BNRA 3TT3L 1L4IA 4LSQH 3SOBL 5HJ3B 4F2ME 1Q9WB 4YFLI 2R8SH 2V8LA 5ADPH 3Q6FB 3TYGL 5IBTL 4PWJA 3W37A 3ZO0A 3KEHA 1JIBA 5FUOH 4HA1A 4NB7A 2CMRL 2YPLE 3QBTB 3CFEA 2EXYD 3BAYA 4W68A 5LCVH 3ETSA 4A2FA 2ORBL 4ZMWA 3KPPA 3ECBB 1OP9A 2XN9D 3WIFA 5FGSA 1KEGL 1PQFA 2VDML 2AEOA 4M5SA 4A2LA 5IVZA 1JZ6A 2CO6A 4PRPB 4FFZL 3QZLA 4M3KB 2OZNA 2FX9L 3RTQC 1QKZL 2QBWA 3NZSA 1FHGA 1EVUA 3DV4B 3SUMA 2J8UF 3RY6C 1D6VL 5C08D 4HXBL 4QRSB 1EV2E 2P5WD 1F97A 1J0KA 2G3ZA 5AWNH 2AKRB 1WS7A 2XTSA 3HBZA 4N1EA 2WWKO 4G9FD 3T6XA 4PSRA 4QRQB 3B8SA 1MH5A 2DH3A 3D2TA 3NIGF 4R8WL 2IWEA 3ARFD 3UBXA 4DESA 1OZTG 1OF0A 1D5BA 1SFDA 3JUYA 3OMIB 4M1CD 4JG0H 2OQJB 2XXGA 3AUVA 2E7DA 1MI5E 5EPMA 3V0GA 3TESA 2DYRB 3I6KB 2Y7QA 3LKSA 1QRNB 4HEMA 1HEHC 3SODB 4PMFA 3LHAA 4RAVA 5GRYA 3VUAA 4BZ2H 2NX5E 5KJRL 3FF8A 4GAAA 1AP2B 2BVYA 4P8QA 4D9QE 3QZMA 1Q9WA 4LQFL 3II1A 3Q6FA 2OP4L 3SDYH 3TCLB 2X1WL 1HS6A 5ABDE 5DWUH 3FRPB 4C57C 4Q0XL 1OF2B 4ZAKC 5EULV 1MELA 5DZNA 1OSZB 5INCB 4FHBD 2OMYB 3GMQB 1ZT1B 2R1XB 1N5YH 3LNFA 4M61A 3RVUC 3T77B 5IB1B 1UJ3C 1G7MB 3G5WA 3LDBC 2JCCF 5F3BB 3ZL2A 3P0YL 5BS0E 2Y3NA 1UFUA 1YQVL 3AU1B 3BAEH 2OKMA 3QORB 2TSBA 4PRPA 4BQCA 1GGBH 3PL6B 1KJ2B 3BAWA 2IAMC 3SBPA 3CZGA 2EJ1A 3B7YA 1NMAL 3GMPB 5CN1A 3QIWC 5JPMB 1JCVA 1OCRB 1F3DJ 2V33A 2QV4A 3MNDA 1YEKH 4J3XA 2C9XA 2WXIA 4C54A 4QRQA 4D0CB 4ERSL 4E5XG 2KDYA 3RURA 2NY4C 2PF6A 2IPUK 2F1AA 2Z91A 2JELH 4QKXB 5KBKA 3QUYA 4N25A 5IHUL 5I8KH 4G6AC 4OCRL 2OQJA 3ZVVA 5DSCB 4DN4H 1AKJD 3I6KA 3DXAA 5AAMC 1QRNA 1ZLSH 4AZDA 3U4BH 5F0JB 5AW8B 4WCYL 1MIMH 4CAGA 1FWXA 1JVOA 2TRYA 4X6DB 2Q6WB 1AP2A 4HVBA 1FSKB 5E0QA 1BIIB 2H6PB 5DC4B 4EI5C 1OTUD 1MAMH 1TXKA 3MGTB 5FUZH 2MCMA 3TCLA 1AMYA 3WFEL 1WBYA 4PUBH 2GC7C 3MGOB 1EHNA 1OF2A 1NZRA 3JYBA 2IJ0C 4DP7X 2OMYA 2E2HA 3GMQA 1ZT1A 2R1XA 1CFNB 3UZEC 1BQLL 3T77A 4R0LC 1G7MA 3MUZ1 1JZ5A 1PIFA 4F80A 1H6FA 3C60B 3S97C 2IANE 2P7TB 4XMZA 2K6WA 5A7EA 4U1LB 1CK0L 1YRKA 3AU1A 4FC3E 5BV7L 1T83A 1KJ2A 2O6EA 5C6PB 1YPZF 3OJMB 5AVTB 2J4WL 1ZV2A 3GMPA 2ZE0A 3LRSB 4OIIL 4FABL 2A83A 5I0ZA 5IHBA 5JPMA 4XN8A 4EUPH 4RVBA 1JXKA 1IGMH 5L4JA 4S1QH 5B39B 2QPFA 2ESVB 1CL7L 2QKIC 2OMXB 5JIPA 5E4EB 1IKNA 4GSRA 3SGJA 1OB0A 5F7WC 5EB9A 3PU7A 4J8RB 5MENE 3CJJA 2R1WB 4GIAA 4JM2F 4Y1AE 2R1YB 4D8PB 2AJ3A 5EHFA 2WLLB 4KZDH 4D7PA 3OB0K 4Z7WF 1K85A 4Q9CA 1N68A 3WE6B 1ZOXA 4XCEA 2LU7A 3NAAL 3BP5B 4L1BA 3MJ9L 5DDHB 1AG0A 5H94B 1YDPB 4UQ2B 2F61A 2P46B 3JBG7 3PWPD 1BIIA 3D7PA 2H6PA 4JRXD 3PABB 4LAQL 1ECZA 3BAIA 4B7LA 4OR1A 4XMKL 1KPVB 2FIRT 1MW0A 3MGOA 2IBZY 1XIWD 2EXWC 3CF2A 3GO1H 2DYPB 3F58H 4PD4J 1YEEL 5GS3A 2DQFB 1A9EB 2AJUL 4XXCA 5C0RH 2BSBA 5BOZG 4WQOA 1HU8A 1RZ8B 2P7TA 4LSDA 3CVIL 5F9OH 4U1LA 4CDHA 5C0AE 2FH8A 2Z34A 1ID2A 3C2AL 2VDRB 4HJJL 4DMRA 2A9ML 4J27A 2MTAA 4JDVB 1A4BA 2PTVA 4GG6E 1EXGA 4F7TA 2LFGA 4HBCL 5M94B 3DPBA 4FP8H 3SDDB 4AIOA 4YGVA 5B39A 5E8DL 2WY3B 2ESVA 3D0VB 1UD2A 5E4AA 2OMXA 2WV3A 3QIUB 4MS8D 3SULA 3MODL 3QWZA 3F00A 3TBYB 2QPSA 3ARBB 4JZJC 2IG2L 4J8RA 5E9NA 3WSQL 1K4CB 2F9BT 4K3DH 2CDFA 3MLSL 1QBAA 1BDYA 2WLLA 2ZUXA 3ZKMC 3DX7B 5BXFB 1X7QB 4JKMA 2B1AL 3RA7H 1C1EL 5I8CB 3HHRB 2VISB 1QSED 4PJDF 1BOGB 1B3IA 3BP5A 5CEZL 4UT6A 3BGFC 3IFNH 3ML8A 5H94A 2YAFA 2ZKHL 3MV9E 2V8MA 3P9WB 2RACA 3QO1B 4JL1A 3UOAB 1QW8A 2WWKT 3FT9A 3PABA 4LMQI 4X7SH 2WSDA 3D5OF 3PAUA 3D39E 2Q7NA 1KPVA 1ZANL 4RFEB 6FABH 1ZLDA 3GMOB 4HUXA 2YC1B 3NCYS 4W81A 2DYPA 1IC5H 1MVUB 1U2CA 4UAOC 4J23A 2OYLA 4NP9A 4PGCB 2DQFA 4IMKA 5DJ8A 3T2QA 1A9EA 4J3VA 4CADB 3M3GA 1KJ3L 2XVBA 4LP4A 1RZ8A 1ZHLB 3LXUX 3E0GA 3L4ZA 1CBJA 3W2DH 5EU6D 1A7RH 4NO2A 5I26A 4B9PA 5L0QB 3V4PH 2OBGA 2VL5A 1IEAA 1SEBB 4BCXA 1T5WA 4ADIA 4F5CA 5AYUL 2QVTA 2XVLA 5EWIH 4JCWA 4JDVA 4YHLH 3TEUA 2D7NA 1S8DB 4LEOB 3SDDA 4X4XB 3PV6B 3LNGA 1UM4L 3D0VA 2AXJA 3QIUA 3HC3L 2PTTB 4NXKA 2BRRH 5B3NA 3TBYA 4LPTA 1OZUA 4NI3A 3ARBA 2IOMA 2ETWA 1WT5C 5J6HB 3PE9A 5KOMC 5TPWL 1ZIAA 3U4EB 5IMOA 4EN3D 5KSBF 3LEVL 3DIDA 3NACL 3DX7A 3KPOB 1M56B 5IJVB 5I8CA 3KPRE 2JTDA 4QHKJ 3QEQE 3E6FB 1BOGA 2J6EL 4MNQB 3QNYA 5E5MB 1F4AA 1UEYA 4XNMB 3RG1C 4CDGC 2VUOA 3QO1A 4JE0A 4FNRA 3TWCH 1RUQH 4PGEB 1J9SA 4YJZL 4A7GA 3QDJE 4RFEA 3VM5A 3FB8B 4P2RB 3VTTA 1P84K 3BFQG 3GMOA 4R96B 3W5MA 2JKIS 2B63A 1PKOA 2QDVA 2YC1A 4RA3A 1QLFA