4JJOA

Crystal structure of apo-clavibacter michiganensis expansin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLDLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of wild type and D78N mutant clavibacter Michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis
molecule tags Sugar binding protein
molecule keywords cellulose binding protein
total genus 41
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jjoA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4jjoA02
3X2GA 3CZBA 3SULA 4FG2A 2JNZA 1OA9A 3SUMA 3FT9A 4FG4A 2HCZX 3ENGA 4JP7A 3SUJA 1HD5A 3X2LA 3X2MA 4ZM7A 1WHOA 3D30A 2PNWA 3X2JA 4ENGA 4JP6A 4JCWA 3X2IA 4JS7A 3X2HA 2AE0X 2ENGA 3X2NA 3X2KA 2KQAA 4JJOA 1L8FA 5GLXA 5GLYA 5GM9A 2G5DA 4AVRA 1BW4A 1BW3A 1BMWA 2PICA 4FFTA 2BH0A 2PI8A 2PJJA 2GAEA 1WC2A 4L48A 3SUKA 1WHPA 2VXQA 4FERA 1OA7A 3X2PA 3FT1A 1N10A 2G6GA 5H4UA 3M3GA 3X2OA
chains in the Genus database with same CATH superfamily
3BWZA 2ZXEB 3O2WH 3MJ9A 3S35L 2AXFB 2QPFA 1IBZA 2PO6C 3BH4A 4PD4K 3PPEA 5T1KD 1RVFH 1FNHA 3QJHA 5HP5A 5CD3A 3IJHA 3SUJA 4PRAB 3LN5B 3SZ6A 4LVNB 4BQ6A 1D9KB 1NGXA 4NKDB 4UT6A 4HJIA 5L7XH 3TZVB 5EH1A 4H5SA 4KZDH 4OFVA 3ZDZF 2VXUL 4HJ0D 1DVYA 2Y5EA 4OKVA 3WJMB 4Q56A 1QOKA 4WKZA 1XSJA 2ROYA 4LP5A 4OQTL 5ETUA 5F9OH 1WAEA 4NKQB 5AB2A 4I3GA 3VD5A 2WWMD 1TZIB 2CHZA 2VYRE 5EBMA 3RX8A 5AOJA 3X14B 1PKQA 3H7BB 4I89A 4MAUH 4ODXB 5DHYA 1L5GB 1S7XA 5CU5A 4P9HH 4GBXD 4JFDA 3NH7L 3P0VH 3FO0H 3H55A 4P99A 3K8MA 1BVKB 4ZMNA 1UXWB 1Z9PA 4K5LA 4I4WA 5DUPL 2YD5A 3KWVA 3TBCA 2QADB 4N0FA 1CZ5A 2XWBB 3LHAA 1BQSA 2RHEA 5KSAD 2W9LA 2VDRB 3QK0A 1QZNA 5I0VA 1CICC 4NWUL 4Q74A 4P04A 2R2HB 5LNGA 2AQNA 2P8PA 4YDLB 3QA3B 3VFUB 4G9FD 1N0LB 3II1A 2OTUA 1CQKA 2VDMH 3RGVD 5HPMB 3KPQA 3BWAB 3QUYD 1BPLB 4J5VA 1JD7A 3GSVA 2WQ8A 3PV6B 1IZKA 5TE6L 1A8JH 2ZCZA 4KZCA 2GI0A 4KQ0A 4G3YL 3PS6A 2YC1B 5JQIB 5C2BL 3OZ9H 4JQIL 4FFYA 1CQYA 4IU3A 5LDSA 5C07B 1NIDA 5ITFB 1HHIB 3VFSB 3H4HA 2HX8A 4NPJA 4P57A 2OMTA 3JWNG 1JGDB 2X4UB 1F2QA 4WHCA 3W39B 2VDLL 4FZEH 2ERJB 4KU1A 4X7SL 3MBEC 4JKKA 3PWVA 1CF8H 5CINH 1A7PL 3L9RB 1U58B 2X4PB 1HINH 1OHZA 1UURA 1KTKE 2BJMH 1S46A 2YOAA 4N5ED 4OLWL 4XPHL 3VFMB 2YLHA 2CJUH 1HZHL 1I7UB 4ALAC 1HYSC 5D1QB 1G9MH 2A83B 3HCVA 1OA9A 1NIFA 4LCWA 5F0LB 4ZTEA 3IS0X 4LIQL 4QHUA 4OT1L 4XWOC 1BVLA 2V9UA 2MHAA 1I9RL 3NZSA 1IKOP 1F4YL 4KUCF 9PCYA 2X4RB 1U33A 5E6ID 3LRMA 4M03A 1R3LA 4U1KB 1SUHA 3QUMH 2DTMH 3Q2WA 4FL4B 2A9BA 3OKOA 4RISH 5AKVA 3FCTB 3V9CA 1HJBC 3G6JE 3R7QA 1NCUA 4JRLA 1U92B 4L29A 1L7IH 2P5WB 1GYWA 2I69A 3QHZH 3U0PA 1TYEB 4NRZB 4W9HC 1VKXB 4PS4H 4WFGD 1P7KB 1M7XA 3GPSA 5GISL 5A2JH 3DX9A 4Z7WA 5IROC 3SDXF 5J13C 5KS9B 1ZRUA 3L3HA 2OQJA 1KLFA 1WSST 5A6LA 3MYJB 4YXKL 3QJUB 1WZAA 1C5BH 1NGZB 4FD0A 3C2AL 4EZKA 1A4JB 1LNUB 4IBSA 4U6YB 4Z3FA 2R1YB 2TSAA 3BPCA 4CAGA 1B2YA 1GYCA 3B8YA 3G5YB 4FQ2L 4YZWA 3V0GA 1DQLH 1Y1VA 1EHXA 1KGCD 2P9RA 4KVPA 1K9TA 2AW2A 2PXYD 2ROXA 5BRZE 4RMRA 3UG4A 1TSHA 4CW1A 1JNLL 1BEYL 3RY5A 2A9ML 3VE0B 2HJKA 3QPQD 3P3YA 4LQ1A 5LB1A 1HJCA 1LEGA 5F6HI 3KGUA 1CFVL 3PY9A 2QQLL 4AJVA 5FOBB 4M43H 1C5DB 3ARZA 5EU5B 4MMZC 4L8DA 4M61B 4AVJA 1QRKA 4XCYA 4JKNA 2EVFA 5AVWB 1ULVA 2ZZUT 4JO4H 4YSTA 5F9WC 5JLZA 4GQ9L 3LIUA 5F7MC 3WKMH 1T0NB 1AHMA 2Q9OA 4ETYA 4K9EL 1DQDL 4ZNEA 5J57B 4XC1H 3B9EA 1T4WA 1FH5L 1HI6B 2BNQD 2QDWA 3JUZA 1A9VA 4Z7OF 4I0PC 3E8VA 2YQ2A 1AIFA 3QYNA 3UYPB 3T77B 4KOCA 2LLNA 5IOPB 4OCYL 2WINB 1OAQL 2GBTA 2HVJB 3V52H 1G6RA 1RUKH 4E41E 2QSQA 1KGUA 1MHCB 3AADB 4XCCH 4KC3B 5DO8A 2CUIA 2VLKE 3FO0L 2ZKXA 1JPGA 2V5RA 2FGZA 4KTEH 4CILA 5ICXA 4K73A 1W8EA 4N1CA 3NSXA 2MCG1 4CUCA 5CZVL 2HT2C 2XJLA 2J3SA 3B2DC 4N0CC 2BIOA 5CEZH 4U3CA 3UP1A 3WKNA 1MW2A 4IYKA 2J8UF 2WBJB 5FUCE 4KMLB 4IRJD 4XPBH 5CKGA 3SE9L 5I1DA 4BKTC 5AVTB 2X9XA 4KK8C 2OW6A 1GSKA 2NPLX 2WTRA 3D9AL 4WFFD 1M05A 5JA9A 1USZA 3MRLA 4YUEH 5BS0A 2R2BA 5GGRA 5JHDD 5CN1A 2X4QB 4KH9A 2Y0SA 4LSQL 1T6BX 3CIAA 1GPOL 1MFCH 4A2LA 1MCEA 4GLRH 4H25B 1S7RB 4JRYE 2YZ1A 2WLIA 1JZ5A 5FM5M 4QRRB 4HULB 4LQFL 3ESPA 2DLEA 4KTDL 5DR5H 5I18L 3L4XA 3MKKA 4WJ5A 2EUVA 4Z7AA 1JHKH 2ZP0T 4OLUL 1MAKA 1WV7T 4JY4A 2VDLH 1J0IA 5IVXB 1IAIH 2QSVA 1JVKA 3R06A 4A7TA 1S5HA 1FL6B 1T2JA 5GS3A 1A6UL 4NZRH 4M6OH 1IBFA 3A21A 3C8KA 4Z78B 3HW7A 1XF2A 1ZA6B 4EN3B 3T3MF 4JQIA 5DZ9A 2CK2A 1YY8A 5BUGA 4MJ6A 2P4AB 3MVSA 2B8OT 2X5PA 3IDMB 2K70A 1EJ8A 3BQUB 4LASL 5J6GA 5F7FA 3UTSB 3MRNB 4LHUA 2K6WA 2I5YH 1HT6A 2K7PA 4ZUUB 1TNMA 4IOFD 2VUYA 4L1BA 1S6NA 2FGWL 4XO8A 1A6TB 4AGLA 4DOHB 2Y69B 1CFBA 3ZW3A 4KI1A 4ZAKD 1YEIL 1M53A 3T6VA 2IAAC 3S4SB 2JKNA 2AANA 3IFPA 1DVSA 3UTQA 3S88L 2Q3AA 3QJSB 5GM9A 3H3PH 4FTVE 1ECYA 2BNQA 3BVNA 3HN8A 2R7EA 3KLAB 4HPHA 4GSDL 5DXWA 4L48A 1RU9H 5IOPA 2MFNA 4WUUE 4W93A 3ARGA 5D7IA 1AIFB 2BP0A 2WNXA 5DJAA 2ZCHL 4LKCB 4GRLD 4XODA 1Z9SB 4L4TA 4LHUG 3WU1A 1OF2B 1R24B 1QBAA 5A40E 1QUPA 4YJZL 2EIZB 3G08A 1YYMH 4ELDA 5IJKC 4S1QL 2VN4A 4X4KA 1WLFA 4MNQD 2ARJQ 4JY6A 4F3FA 5JW5B 4PJIA 5IM7A 4QRRD 1PJ9A 3NRQA 4L8DB 5DFAA 2E27H 4YDIH 4Z6AT 2NY0B 4MMZA 3MLSL 1CF8L 2FQDA 4XMTA 1ES0A 3E6FA 3H1ZA 3X3GH 1HNGA 2DQTH 3P73A 3VM5A 4R7NB 2J21A 4TPRH 4AV0A 4X5QA 1XTLA 1E65A 2H7WA 3DYMA 2GT9B 2FJGA 1OPGL 3KVDD 4I3RL 4JP7A 3GMMA 1KTJA 1XGPB 2UUDK 3VTAA 1BAFH 5FA4A 3PGCA 2HN7B 4NQCA 1U4EA 1A7NH 1IEAB 1RZKL 4KROD 4PCKA 1RZKC 2EKJA 3Q8AA 2ZCKH 4H20H 1SYVB 4BK8A 4TTDD 3D39B 4FXKC 3VJ6A 5DJ2A 4D9LH 4EXPX 4TNEA 2KLRA 1V10A 3VXTB 4HA1A 3T0EA 1FHNA 2WBJD 5DLLA 1FFOA 4KFZC 4YZFF 1BEXA 1HKLH 3TJEL 3FT4A 1IT9L 3DX9B 1UCBL 4L3ED 4Z7WB 3VH8A 3V79C 1QW9A 1P7KA 3LQMA 3M1OA 2XYBA 3O41A 2VDQL 4GB9A 5I15H 3N85H 2HRGA 2ICWI 4LAQL 1WVZA 3HG1A 4U31A 5EC1B 1GOHA 4GW4B 2WXIA 3V52L 1A6WL 1ZV2A 4OAWB 3K72A 2C9XA 4BK5A 1K4DA 4QJ4B 3FBKA 4F5CE 5I1IL 4WW2B 5JTWA 2XZCH 1U2YA 3QUZD 2FHFA 3JWOC 5KJRL 3BH9B 1U95B 1BG9A 4MAUL 4MB3A 4XXCA 2DQHL 1TWFA 5A16B 1CDUA 4UQ3A 1URIA 3KVQA 4KWUA 3N44F 4HJEA 1QPPA 4YE4H 3HB3B 5DQDH 2XIDA 2PR9A 1QBMH 1S7SB 2VN5A 3V6BR 2EH7H 2OL3A 4S11A 1TZ8A 4CMMB 4AZDA 3RDTC 4URTB 1ED3A 3C60A 3JWDC 4YDJA 4E9RA 3ULUC 1NC2D 3DTXB 3AQDA 3CN1A 3G5WA 1U8OB 5IW3A 5EBLA 5HHMD 2R29L 3MPCA 3QWRD 4AYFA 1ML0A 3GS4A 4ORGB 1MSPA 1C7SA 4O4YL 4OZIE 1B4LA 4X99A 4HMCA 2PXYB 1D2PA 1WS8A 3MA9H 2C4FU 4WQOA 4UQ2B 4YFLF 2Z8WC 4YHPB 4Z0BH 4IS6A 2V3VA 3Q1SH 1T20B 2F1AA 4HUXA 1Q9OA 4WO4A 5D1ZI 5FM5O 5FIEA 3GXFA 1R5IB 4JPWH 4NCC2 5LBSA 4HS6B 1A3LL 4PTUB 5LGJB 1DVFD 5D2NB 3PFUA 1T0MB 5L2JB 4MNGA 4NO0A 4LSVH 3HKZA 4NZJA 4YSRA 2VTFA 2XN9D 1NBZB 1PQFA 3CCHB 2J4WL 3RYMA 4E41B 2MPVA 4TKWA 1F4AA 2PYEA 1GZHC 3GSXB 1ED3B 3NIFE 4YDJB 4ESKA 2DJSA 1T5XA 3VU2A 4K8RC 2XXCB 3VNYA 5HSFA 1HSBA 4FFVC 3C5SA 3ZHDA 3L16A 1CD1A 3JWNC 1N8ZA 2OK0H 4JPSA 2VZ1A 2QVTA 4HIJA 4JHWH 3AITA 2Y72A 4ONFH 4MWFB 3FQUB 4UQ3B 4X9BA 4RCAA 4WW2F 4ETQB 1FYTB 3ARED 4X5WA 3DNKA 1L5GA 4BZ2L 5DCCA 3IMTA 3TO4D 1AHWC 5C0CB 4UT9A 1CC3A 2ZUUA 4YHLL 4JDVA 1WISA 4I9WD 3X14A 4AE0A 1IC4H 1QNIA 1OV8A 3FRPB 4XNMB 3UL4A 2BVUA 3K72B 5TDOA 1CFSA 3BFWA 3JWNE 5AKTA 5HGHA 4YE0A 4YXLH 1PLGH 4JG1H 3H8NA 3FCSB 1BQLL 12E8H 1PG7H 4IJ3C 4IW4C 4OCYH 4F33B 1PD0A 3US0A 3VFRB 4AGMA 5ANMA 4YHIB 3UZEA 3Q5TA 2HVKA 1MUJA 3IJHB 3QORB 1VCAA 3SKJH 4QTHA 5JOPE 3ULVF 1A6AB 5KG9A 1NPJA 3FB7A 1XGTB 4F33A 4Q97A 4JFHD 4BQ9A 4DN3H 4I77H 3AWFA 3B2UD 1W15A 3H42L 4L3CB 2JA7A 1FPTH 2PPEA 4AOKB 3RGVB 4FJ6A 4KKLD 5JHBA 2DLIA 3MLVL 5JIMA 1QO3A 1KXTB 2GAZA 2VUOA 1FIGH 1K8DB 4ZUVA 4N86A 2H6PA 5FYLH 2PR4L 3FXIC 1PZUB 1F90L 1EZVX 5I66A 2NW2B 1Y7VA 1A6ZA 2KZBA 2JQAA 4K3EH 3B3BA 4U4BA 1N10A 4OJEH 4YC2C 5B1AB 4KUCD 3BRFA 1TJXA 2WZPA 4DN4H 2XQYK 1WZMA 3EJJX 2YXVA 4AM0A 1V05A 2LTQC 4OFQA 5TPWL 3G08B 2YD3A 3CLEH 4MJ2A 3RI5K 4I85A 1I3RB 5CSBA 4YFDB 2AV7A 4K9EC 3CVHA 4NUPA 5IMMA 1HL9A 1OF2A 1Z9SA 4L4TB 5F93C 1C9SA 3EJTA 5CN2A 1QBBA 1CVSC 4LPVA 4UOQA 5F8QC 4BSWA 5JUEH 2YMOA 1MOEA 4XO5A 5GSRB 2BVEA 1CGUA 1UZ8B 3IS1X 1XGYL 3MNVA 2WOBA 4LRIA 5D2LA 1ZLSH 4EBQL 2JCCF 3VGHA 1YEEL 5LCVA 1AZCA 2P8LB 3UXFA 4Y1AE 3WNIA 2ODIA 1FDLH 1ACYL 5FKAB 4GSUA 1HVXA 4OGXH 5T1KB 1OPGH 5F6IC 2ESVE 1JV2A 3Q3GA 3RL2B 3BQUA 2V5TA 1AO7D 2XTLA 3FCGA 4FXGB 4JM2F 1ZK9A 2F68X 3AZUA 4NFCA 4WGKA 3MCLH 3S5LB 3KHOA 3MRQA 4GKZB 3W56A 5KVGL 4GQQA 5FGSA 3WJJA 1KTDA 1CGYA 1PMYA 3WHXA 4XNXL 4XGZA 2X44D 4EKJA 3ENEA 3Q1SL 2ADFH 4N6QA 3T0AA 1EZUA 2JVUA 4MNQE 4W9JC 2G60H 3ULAB 3T0ED 3QIBA 2VRAA 3OSKA 1GAFL 2CHWA 4JMXA 1AG6A 3U4BL 3QQ9D 3N85L 1U3JA 3ILDA 3NBNA 2VAAB 4LAQH 1U95A 2YBRA 3DI2B 4FQXB 5KOVC 4WW2A 5FWRA 4DGVH 2CUHA 1J5HA 2WLIB 4X98B 4NAJA 3NYKA 3PQYE 4R90H 4K8RD 1K4DB 2OYPA 3F7YB 2IC2A 3DX8B 2JA5A 3MLXH 4HCGA 1G7JB 3SE8L 3N40P 3EOTL 3GTMA 4P07A 4LF3B 3QE5A 5C70A 4PVMA 5AL8A 2WWKT 5E8OB 4TSAL 2EDTA 4PJAE 5E24E 2WTRB 1XDTT 4IJTA 2YEQA 2V17H 3CSGA 1Q0YH 2CLVA 1QP1A 3VU1A 1WA2X 1H3TA 3QYCA 1BXUA 5D1ZD 4E5XA 1I9EA 4DEWA 4TRPL 4CADA 3SJVD 5HHQB 4HCRA 1A9BA 4MKMA 4OFYD 2F1BA 2RIKA 1RI8A 4XP5L 1PQZA 3VXME 3IB4A 3GZPA 4OCRL 4J3SA 2WB7A 1AI1H 1IEAA 2PO6A 4XAWL 2L7JA 4HGMA 1MZYA 2CU9A 4RZCA 3BPOC 3WNPA 3NP3A 3C60D 3LNIA 2VLRD 4P5SA 3RPKA 1U2CA 1EAPA 1EWHA 1UATA 2VQ1A 4C83B 2DMBA 4PB9H 12E8L 5I17A 3O6FA 4NJAH 1IM9A 5SX5K 2Q6WA 3P73B 2K78A 3O6LH 3BRDA 2Z65C 2RH0A 3KLQA 1GRWA 3OXSA 4Y4KB 5DHXB 3IR6A 3ULSB 5EEVA 3BO8B 4E5XG 2EO1A 2OS7A 3SCMC 5JLZB 5I0DA 3RFZB 1FG2A 5GRJH 4M7JH 5IM7B 5C07D 1JJUA 1OO2A 2FL5A 4GRMA 4PJIB 3V4PB 3VGEA 5H8DA 5TH2B 1HHJA 5T33H 2FUQA 4X6EB 1EHLL 1Q9WA 5T8IA 3Q6GH 2AK4A 3M6DA 2V9QA 2AQ3A 1CDHA 1ZEAL 4HAFA 1Z9LA 3MREA 4PP2A 5DQDL 2FSEB 3IFNH 4F2EA 2OR7A 2FO4B 5IK3A 3HHMA 2DQTL 2VWEC 1PPIA 1WFUA 1ZSDA 3P77A 3QPXL 4HHWA 4PJXF 5F71A 1ZVSA 4B3VA 3UPRB 1FGVL 4P46A 5CS7A 2OSWA 2ARJB 3BCFA 1OOWA 4PTTB 1PBYA 3DIDA 3G04B 2ZOUA 3SPIA 2WKOA 5LDUA 5ENWA 4AYBA 3TM6A 2EKSA 3V5HA 3WIAA 1D5RA 3CDZA 4AAYA 4YHOL 5J0BA 3ELQA 3X2HA 3LN4B 3Q43A 1A4JA 1LNUA 5ICYA 1F41A 2DQJH 2QVKA 3QXVA 5ICYB 2UXVA 1J11A 3HS0B 5KSBA 2BVOB 2OQJB 3T2NH 2ZXBA 3S34L 1IC5H 4PJEF 2YAHA 3MBEB 5ADPH 3FH5A 3EZ8A 3NESA 1OLLA 2NVXA 3X11B 2VZVA 1YRKA 4TLUA 5TF0A 2MKLC 3FHQA 4NAMA 4JG1L 3HMWL 1X5IA 3U0PB 4JPKL 4Q6YA 2MOQA 3MBXH 4R2GD 3MNDA 2ATKB 5KS9E 2NZIA 1A7QL 3S5YA 2BIIA 2A68D 4BM7A 5JHLA 1G7HA 3VWKC 1LD9B 1NCHA 3MREB 3H85A 3C8KB 1BFVH 2D9CA 1H5BC 2X4RA 2X12A 4HPYL 4N2NA 4Z78A 3L54A 5EA0L 3K2KA 2JIOA 1KC5L 2AK4B 2EXWC 2I24N 2WBXA 2QKIA 2KMWA 3GWJA 4G11A 2QTVA 4GKSA 4OQTA 3UG5A 3V0FA 4ZMQA 1FRGH 5AAWC 2ATAA 2QLVB 4GI8A 2VM9A 2EDLA 3IDXL 4JY4B 2ETWA 3WFCL 4MBOA 4KI5C 4Y19D 4Z3IA 3REVA 3HLAA 4LLYA 2GBAA 2V2WB 4EDWL 4KO9A 3D39D 4N28A 5E1HB 1YCSA 4AGOA 5GGSB 4BSVA 2WP3O 4ZW7A 1N9PA 3ARDB 4HD5A 1S7RA 1NH6A 3HUJB 1NCCH 4IIQA 4J8QA 4MXWL 2GABA 1AXTL 1YY9C 1MRFH 2VQ1B 2A1WL 4NERA 4WHTB 4AYID 5B3SB 5KYYA 4RIRA 1BF8A 1OM3H 5BNXD 5DDHA 2ENSA 1XGRB 2R2BB 5HVGB 4ODHH 3ZE0F 2UYLB 1K72A 3J07A 3MRMA 3TIEA 1WDAA 2QTEA 4FULA 2V33A 1DLHA 2W92A 4MMYB 3GTKA 2EXYC 2B2XH 4XE5B 4B97A 4FADA 3NJMA 2XDHA 3BDYL 1T2XA 4YDKH 4IMLA 1PG7L 3PWLB 4TNGA 4BFOA 5B1BB 2I60L 4HKZB 4JUSA 3GMQB 2AEIT 4U2ZA 4AVRA 1AJ7L 1DP0A 5DHVA 3NFPB 2BSSA 3O8XC 4PCYA 3GTTA 2GSIA 2UYLA 3EAKA 3TIEB 1CFNB 4IGBC 5CZKA 4NENB 3N06B 5F7EL 4LF3A 2WC7A 1CK0H 4KJYA 4K7PH 1IEBB 2ZYHA 1DBJL 5G5DB 1R6VA 3HC4L 4P3CH 4UQAA 4P2QD 2LLGA 5F3BB 2ZWSA 4I5BA 2NUTB 3F12B 2VAAA 5C09A 5EC2B 2IWEA 3FKUS 1GZQB 2VDKL 5DVNA 2DDQH 4XP6L 4S1RH 2VXTH 4HG4J 2QQQA 3HJEA 3NEOA 5H94B 4ZS7L 4F5CA 1TZGL 2XQYA 3PDGA 1GC1C 2A74C 4Q6IB 4HWEH 3N41B 3I02B 4M93B 4UQIM 2VMDA 1RZJC 2IQAB 2ZX6A 4JQVC 4E68A 5E9DE 2X2YA 1LEGB 7TAAA 2XVBA 2Y4SA 3ULVE 4PY8J 25C8H 2K0RA 4IDJH 1SFOA 2BVTA 2CG9X 4P2OA 3GSRA 4K94L 3O3DA 2ADFL 1SNRA 1KIQB 4JFED 4KRNA 1BOGA 4RMQA 1N3NB 3D50A 3MBEA 3TV3L 5CJBA 5CSZA 3DV6B 5JW3H 3VAEA 1XZ0A 5T5FL 2Z93B 1S9XA 1IQWH 4GMTL 4NKDA 4R7DB 5DT1H 5HHXL 4ZYKB 2XQYG 2Z8VC 1BQ5A 4LEXH 1DDHA 1MF2L 1FVEB 3J2PA 3K6IA 4Y9EA 4BFRA 4NRXB 2WLKA 4I9XA 2EXWD 1KPRB 5JXEA 4UB0L 1CYGA 2FWUA 4X6BA 3DTDA 1EJ6A 3H2WA 2R4RL 3LEVL 5F1SA 1KQFA 5GSRA 5HHVL 4U05A 1MCOL 5BQ7A 1FGVH 1QBLL 1XAKA 1NC2A 1T22A 4N90E 4HFUH 1CGSL 4EDXB 1A2YB 2BHYA 2VERN 1I3RA 3CZUB 1BQRA 1HHHB 1TVDA 4CVZA 3WS6A 4G7VL 1JK9A 2NY1B 2AJVH 3WG7B 1Q9WB 1UWYA 4CDGC 1S9YB 4AQ1C 3BPNC 4X7TA 4M56A 1IGTB 3LZFH 4BZ1L 1E9QB 4NKIH 3X3FL 3IRPX 1U8CB 2F54D 4LCWB 1ILSA 3Q01A 4HEPG 4XNUH 3U25A 4ZQKA 4AW7A 4G1MB 1FG2B 1GJIA 2WCGA 4H44C 4PRPE 4XAWH 5E8PB 2QKIC 3RWEB 1A6ZB 2X10A 1KCSH 4Y4KA 3RY4A 5IHLB 5AVQB 1DZBA 3QDJE 4KKQA 2EIJB 2I25N 3X17A 5HDBF 1CGTA 2DQFB 4ZZKA 3UC2A 1EUTA 2BHZA 4LGSB 5D4QA 4OF0A 4P5TC 1JTTA 3HNVH 5DZJA 3MGOA 1FNSH 4QO1B 3AGVA 2JKWA 4Z3TA 3FRPG 3L17A 3QG7H 2KI8A 3IJSA 1P7QD 3CZFA 4CRZA 2CA3A 3RVVC 3ZL2A 4NYLB 4CJ1A 5EN2B 3HMXL 4EXKA 5KJ7E 2G4GA 3GGWB 5IUSA 1FE8L 1MIML 1TQWA 5AALA 2CCWA 5JW4M 2Y7SA 1KTRL 1HHIA 3OX8B 1WJ3A 1R0AH 4LSPH 4WV1C 1ZEAH 2W9DL 5FW7A 4DGYH 3CVIH 5DA4A 1MCQA 2Y1YA 5CAYB 3Q7JA 3ULUF 4H0LC 2E6PA 4U6TA 3X1GA 5BXFA 4YSDA 3MRIA 2MNJB 1CTNA 1U2HA 4Q9BA 1VRSA 2YPLD 3QEQE 4KKNA 5TDNA 5I8KH 5HDLA 5LHDA 3GHBH 4PJ8C 3OKDA 3RBGA 2QQLH 3HLKA 4RFOL 2D3VA 3KCWA 4X7DC 5TDOB 4G8EB 3FRPA 4XNMA 2P8PB 3QRLA 2D31A 3QS3A 3LIZA 3MCLL 4OUUA 4CL7A 4NI3A 1FORH 4LLDA 2D7TL 2L3BA 1D6EB 2IAMC 1ADWA 3VXSB 1BVKA 1JMXA 2HT4C 4GI6A 4LCVA 4OFKA 1D6EA 3VM7A 1ID2A 2OCCB 2K4WA 3ARVA 4PH8A 1F8TL 1P7QB 3C5SB 4UT7L 3UTPD 4ANKA 3BSZL 3QT2A 4JHUA 5B39B 1EO8L 4OU3A 1DBBL 1CK0L 4Q58C 5ESAB 2OAAA 3WIFA 3D87B 5J3HC 4XMLL 2YJQA 1AE6H 2BOBA 3WSQH 1IW7D 3HNSL 5E08L 1E4HA 3GBML 2EDKA 4KPHL 5T1KA 4PTUA 1KGJA 2PW1B 2V7HA 2FEEI 5D2NE 4Y16D 4AL8C 1JERA 4OLVL 4K3JH 3D52A 1YMHB 2X4OB 2PICA 1Q9LB 3HZYB 4FTVA 1DN2A 2D0FA 2F54B 4WFGE 4X5LA 1IMHC 3CSFA 1FLRL 4YXHH 3CXFA 4E9SA 2DWXA 1K5WA 2CBOA 3WE6B 5FK9A 1NCWL 2H9GA 1T66D 1KG0A 2NOYA 35C8H 3WTTA 4O5LL 2VDRL 4DVBB 4HHGA 2KI6A 3U2JA 2ZXQA 4HOMA 2WCSA 4HETA 1TETL 2UWEB 2CK0H 4YH6A 1UGNA 4PRPD 4CC0A 2RCSL 4HU8A 1M7IB 1OAJA 5DGQA 1MHEB 2AEWA 3PWPA 5SV4A 1KCRH 5E03A 2Y1VA 3AXIA 2G30A 2GJPA 1FN4B 1EFXD 3B9KD 5DC2A 2NXYB 3IDYC 4GFTB 4KY2A 5DWUL 2JB5L 4B27A 4YSPA 4HKXB 1FC1A 2P3YA 1T89A 2WJ5A 3QEGH 4HS3A 1T1YB 2Q8AH 3ZOAA 5A16A 3BW9A 1WD8A 3FQWA 1K2DB 1YEHH 4N22A 1P4IL 1E2VA 1DBMH 2QGDA 5IB3A 1E8XA 4G7SB 5GHWH 1OAZL 4MD0A 3IEAA 3VYOA 2QPEB 3L08A 2HX7A 4CMHC 3ZU8A 1G0DA 5JO5A 4G82A 4D0DA 2C1OB 3MRPA 1BEYH 3MV7D 3VFVB 1NGPH 5FS5A 4OI8A 4BE5A 3FRUB 4ES8A 4PB0H 1LXMA 3W2DH 3BEWA 5FDWA 1PEZA 4I2XA 5DZNA 4CSZA 5C09D 5EEYA 3FT4B 4JLRA 3HKFA 3EFDH 4GBXA 2OMNA 4UAOB 4ZYKA 2E75C 1DFXA 1YEGL 4KKBD 3VJ6B 4I13B 3JTSB 2BOCB 4UANA 4PIRF 5LAXB 1QFPA 3N40F 1OHQA 4Z3JA 1QLEL 1IBYA 1NGYB 1LTXA 5CCKH 1QUNB 2VISB 4RFNB 1A3RH 2EDOA 4FX5A 4N20A 2JKLA 5B22A 2B4CC 3SE4A 5DD0L 2CDFA 3GK8L 1OSEA 2ZUTA 2NXYC 2JJVA 3IDYB 5FYKD 4ZNCD 4AGPA 5K9OA 1YECH 3WY1A 2QGBA 2W5PA 3JWDL 2J1KA 5DQJB 3KWWB 5K39A 3LVTA 1RJCA 1SF5A 4GMTH 5K5YA 5EEUA 4LBAA 1PGRB 4M9OA 4Y2OB 4JRYD 3VO0A 5H94A 4JE0A 1BZ9B 5GLXA 1WIUA 3B9AA 5DYOB 3CSYA 4U7SA 2IH1A 2VDOL 1N8ZB 1TEGA 3OKNA 4HLZH 5SWSA 1T2QL 4TUOB 3MRCB 4J6RH 5DJDB 4JM2C 3HMXA 2NUTA 5JXED 2E7CA 4I5BB 5J7CC 4Z8FH 3VFWA 2Y22A 3MI6A 3PHQA 3S8WA 4CC1A 3QIUC 3QIWC 3BN9C 4JO1H 3PYCA 1D5IH 2ITDA 1Z3GL 1N4XL 3ARGB 2AMUA 3DO3A 2R7EB 3M46A 2NDGA 2SEBA 1V7ML 4NHCH 2MCPL 5DD6B 1CFNA 1RP9A 5K9KA 5JIQA 5H37H 1FFTB 4P2AA 3NJLA 2ZNWA 4U1LA 3NFPA 1R5IA 2CM6A 4GKNA 5DWPA 3IKCA 2NQCA 8FABB 5FF6B 2XWDA 4WO4B 1KCSL 1CFQB 1OPOA 2J12B 1CS6A 3S2CA 5IBTL 1AD0B 3FO2A 1RURL 2R29A 2Z4QB 3M45A 4IMLB 3M3GA 4QRQB 1AGFA 3D48R 4PLOB 4M5ZH 1UXMA 5D7LD 4A66A 5I6MA 4IRSC 2W07A 4AVKA 2BY0A 4BFJA 1LK3L 2X1PA 5J6GB 3WSQL 3ZKND 2A77L 3VWJC 4FFZL 1Z5HA 3II2A 4JDTL 3RJOA 2CRIA 1H6TA 3CFMA 4OGQC 5ALCH 3ABMB 2Y06H 3HUJA 4IIQB 1HHGB 4X6CA 3O9WC 5EUOB 4R0LC 3SYAA 2E6JA 1MREH 1UWEH 1J5IA 3G5ZA 4LLYB 5IVXA 4ZMWA 5CIPH 4RNRA 3KJ6L 1QBML 1JS4A 3DROB 4A2GA 1V27A 3T2QA 2IGTA 3K91A 4F2MB 3ECVA 1OP9A 4UINH 1KJ3L 3EHBD 2ENYA 3BH9A 3HB3C 3P4MA 3V7AG 4LLQA 3A23A 1PQHA 3EYSH 1CB4A 4HIPA 5IVNA 1HKLL 1MKFA 3EBAA 4H25A 1Y6NR 3GMLA 5DRXA 3DVGA 3CVBA 2AGJL 4L23A 5KWYC 1CZ4A 4P3WA 2JIMA 2BSCA 2DQIH 3R7RA 4MCMA 5EOTA 1U8MB 3GKWH 3H53A 3MLUH 3QUZA 1CLYH 1H8LA 3SDXE 3ME0A 2CO2A 3ZKSD 3HC3L 1D7BA 3FT9A 3NCYS 2BVOA 5D71H 1ZOXA 5L88L 5EF1A 1E5BA 2CIKA 1E4JA 3IXAB 4NI6A 4N2HA 3SDCD 3MRFB 4KQ3H 4U1IA 3VWJB 1KFAH 1MEXH 4WU7B 1X6LA 2XWRA 3ZPDA 3QIUD 4B9ZA 5E70A 4ODWA 2LVEA 4XR8C 3TBSA 2FNBA 5FA4B 3QEUA 5BV7C 4UNIA 1CFTA 4GRWH 2R27A 1B0RB 5I19L 1DQQB 1Q16A 1GOGA 5A2BA 4MXVE 2XN9A 3SDDD 1JFHA 1C08B 4G9FA 2V45A 1BREA 5AAMA 1ZSDB 3P77B 2IAMD 3RUGE 3PP3K 1QLRA 4NO2A 3PRZA 3S37H 3HZMB 3GJFK 2YKKA 4RQQA 5FTJA 1RZGA 1AP2A 3ZE0E 3WDIA 4LCUB 3IVKA 1BQKA 3VG9B 5DEGB 5EDXA 4K71C 3ZXAC 1JZ4A 2PNWA 4CU6A 2Y24A 3P9MA 3TM7B 4NN7B 4AVIA 3V4PA 3NZHL 4ZPTA 2PETA 4Z0BL 3IJ9A 4UU9A 4NS0A 4HIHB 1KBKA 1IGYB 3OXSB 4YVUA 3F83A 1R24A 4RQQB 2F19L 1YEDA 1KB3A 3HZMA 3IGUA 2LE9A 2NY6C 2Q8BL 4NNXA 5D7IB 1TWHA 2N7BA 2VLLB 2XN9B 3ESNA 4HJJL 1AQDB 4WEMB 4ZUWA 2VQUA 2XN0A 2ED7A 2HPTA 3QEHA 4XAKE 4NUGH 4MDRA 1UH2A 1NMBH 3H0GA 2IV8A 5D7JD 2Q8AL 4BZYA 2HLAA 4WHDA 3MRFA 4U1IB 4WO4D 1TTUA 4JVWA 1G7IB 4U6HB 3ILQC 2QSCH 2Y1AA 2CIKB 3MYJA 4WGWB 3N43F 2H0JA 2GIXA 3QORC 4F7TA 5T1LD 4UIKL 3T6ZA 4CSTA 3IMWA 3L3DA 1X5MA 2VCOA 4YLBA 1EGJA 4JO1L 3PIQB 4GAFB 5DEJA 4JCLA 3BD4A 3AREC 3TCLA 2ZUSA 2EUWA 5AVXB 2YAOA 4ENGA 4M6AA 4XP9L 2EAEA 2H3KA 3HN3A 4N2FA 3LNFA 3TWCL 5FFOA 1R3LB 4AQ8C 1R3JA 2R29H 4JM2A 4U1NA 3WNOA 2OCJA 5BOPA 3BKCL 3CQZA 2DQDH 4ORZC 1E7VA 3LSOA 4RAVB 4QHUB 1WZ1L 4F93B 3WDJA 1ZVYA 1DANU 3HBQA 5CHNA 4MJ5B 1T4KB 4WFEE 3NIDE 1RHFA 4PJDF 3U46A 4F58H 5D4HA 5HYFA 1WC7B 5ID1B 3AS2A 3G5ZB 3PUUA 5IJKA 4MJIE 4BK4A 5H35A 1A02N 4KZEH 1P1ZA 4JRYB 1WT5C 4ZFZA 1FFPA 2I32A 1SOQA 1BF5A 1YPZF 4OGYL 2OZ4H 3SE8H 1OARL 3T6XA 5DRZB 2H6UA 1ZAGA 2IAMB 3K0YA 3QIBC 3CDYA 1ZV9A 3AABA 3GLZA 4XXCC 4YWGL 1CD0A 4ZX4A 3TEUA 1BW3A 1SVBA 2DL9A 1ZLSL 2GTQA 5FDYA 1KT2A 1KEMH 4TNWF 4YDIL 2R69A 2ZAHA 5AUMA 1A7BA 2WBJA 3FUHA 3FO2B 3IU4H 5E2WH 3S35H 4MCYA 4Q89A 4M7LT 1IRAY 2XUWA 4UM9B 4KJWD 1IL1B 4NKOB 3NDZE 5CM1A 1U41A 1RULL 3ISWA 3MTXA 4XCEB 2GQHA 3SN6N 5FA3A 2AGJH 1G6RB 4XMXA 4DN4L 5LLIC 1RQ5A 3SPVB 2OTUB 5B1JA 1O7DE 1I8IA 3PWPE 2UWEF 4QWWC 4YHLH 3T9WA 1YZZA 3QDMB 2HT4D 2EZ0D 4UV4L 2H32H 3GSUB 4G3YH 4K0OA 2AV7B 3KBHE 3LCYA 4ZJ9A 1FJ1A 1S7VA 1WF5A 1ESOA 2ZX8A 1EH9A 1UM6L 4MNQA 4NNYA 2G0KA 1XX9C 1JZ7A 1SOXA 1ZE3H 2IPUG 3L4TA 5IMLA 5D4JA 5FOJA 2ICWB 3MV8D 3TU6A 1SMDA 1H6FA 1R9TA 5DQJA 3CHQA 1OVZA 2N1KA 1RJLA 1KMGA 3FOMA 3WFBL 3V0WL 1YNKH 3BE1H 5C0CD 1WYJA 1LEIB 3W9EB 1NGQH 2W9EL 1NFIB 3L9YA 3DXAE 4KNTA 4M7ZC 1WBZA 1ZVHA 4ZD3L 1B4RA 1WRFA 5HGAB 4JANB 3OC8A 2R1YA 4UINL 1BYNA 1IKFH 1TJGH 1VFBB 2AXJA 3QORA 3T0EE 1TVHB 2WKOF 3TFBA 4PWHA 5EEXA 2FTAA 1AI1L 3DPBB 2CDEA 1MLCA 3QXWA 1KB9K 4L05A 2G60L 4OZHE 3CXDH 1EQWA 3DRTA 3AM8A 5IROA 2VXUH 1YG9A 3ZRCC 3A6CH 2OL3H 4KKZA 4J8RA 1UB5A 4LPWA 3RFRA 2WBJC 1MY5A 4PRHA 2BVQB 1DBKL 4ZM7A 3GXPA 3KL3A 5AOZA 4GO9A 4N9OB 5F44A 3WFEH 1S9WA 4C58B 5L8JB 4KQ4H 3KXFB 1WIPA 5HGBA 2F7IA 1JNNH 1UH4A 5I0ZA 4FQJL 4NSKB 1FRGL 1L6PA 2VZ3A 1B4TA 2OP4H 3T2OA 1T1ZB 1E5VA 4NC1C 4X5WB 4PJIF 1H3UA 3MDJA 2E6QA 3G5XA 5FLUA 3ZJAA 1MY7A 3KYOB 1U91A 4R2GC 2NYZA 2CALA 3TF4A 2GC4C 1ZT4B 4G7RB 3UACA 3HI5H 3VH8G 3ZZQA 4UMGA 1C5CH 1A4CA 1ACXA 2E7DA 2FEJA 4DQOL 1F45A 3NZ8B 1E8YA 2BCMA 1T5XB 1OCWH 1H8OA 2KYIA 4W9CC 4ODUB 4ZAKC 1NBZA 3CCHA 5HYIA 3F84A 3TZVC 3PWVB 3HE6A 5JNYB 4P46D 4L4TD 1IM9D 2B4CL 1SJHB 4NXSA 1IGIL 2BNUA 3PF2A 2BSEA 4DVBA 3L4ZA 4M5YL 3LKNB 2AJZA 2KUTA 4ANVA 5LGJA 1L7IL 1EAQA 4R4FH 2NYAA 3IKKA 3U48A 5I76B 4B95C 4IRSB 3WE6A 2OZ4A 2BE5D 4IEFB 4O2FB 2XTJE 5L8LB 4P5TB 2WB1A 1PZAA 2EDJA 4MA3B 3HC2A 2GTWA 4JQVA 5CEYB 3IJ7A 1QG3A 3I3EA 1BD2B 1SYSB 1I31A 5HPMA 1YN7B 2A9DA 2L0DA 2OTWA 3OJ2C 2QELA 3SKMA 1N26A 4EI5A 1F6AB 3KXFD 3QULA 5EBLB 1R9FA 4Z7OB 1NCOA 3MLXL 4HAGA 4WI8A 4LVEA 3GB7B 4MYPA 1THAA 2YSSB 3MXWH 4LHUD 5E7BA 4ZS6D 4U1SB 3ROLA 3ZE1F 2A9NL 4DGWC 2BZ7A 3MBED 2OL3B 3LB6D 3MCG1 3NPSB 2IPTL 4NHUB 2LU3A 4KHTL 1AZRA 4XX1E 3VXUD 1NCAH 4DIXA 2AC0A 5HY9A 2JELL 5I6LA 2D3LA 3OUGA 1JSYA 1AQKL 3OSVA 3BUBA 2FLBT 5GZNC 5I1JH 5BO1H 1OAYH 4A6YB 2DB8A 1A7OH 3O6KH 1ECZA 4OV6F 5DHYB 4OUUB 2AABH 5IVOA 3ZZLA 1MFEH 1XTMA 2WLYA 3KYNB 3V9FA 2Y5QA 1GPOH 2H1PL 2Y36L 1IC5L 3D5OF 5DMIH 4NRYB 1DQDH 4PFEA 2FB4L 3HE6D 1JHLH 5IFHH 3QDGD 4PGZA 2ADGB 2IPKB 5IEKB 3L5WA 4QCIB 4XOBA 1JYNA 1NJ9B 4RGND 4WKZB 4PQXA 2Z8SA 1E30A 4N8CL 1OAUH 3FQNA 1WCBA 3E1ZA 4YHNB 1QD0A 3QQ7A 3O41B 1QACA 3V2AR 4IJ3B 5MEOA 1IQWL 4L37A 2BP5M 2BPBA 1M42A 1IARB 4MLSA 4WHYG 3UPAA 4XRCB 3ARFB 4LEXL 2F0CA 5CFAA 2VDML 2PCFB 3BUPA 3V4UL 5C86A 3LB6C 5EN2A 3WFDL 1JGVL 4Y16B 4L9LB 3TJPA 1Z5LB 3UJIL 4GT0A 4FNPA 3AWGA 3UZQA 4C56B 1M71B 3PGDA 5SWQA 3P11H 1FSKC 3AT0A 4J3OG 2Z7YA 4XWGH 3RVUC 4B9JA 3AUWB 3TVMB 2P28B 1CICA 3E8UL 4Z76B 5I5RA 4APXA 5JIDA 5JHAA 3HVNA 3F00A 2Y5TB 3TBWA 4PJCA 4M6NH 3ZQXA 2VXTL 1SOSA 5IWLA 3RWEA 3QCUH 1UM5L 2CLZA 1IIKA 1PEWA 3P0YH 3RL1B 4G1MA 3SJVB 1XGZA 3SUKA 1BGXL 3A4FA 3CAFA 2ZKHL 1E9QA 3PAYA 3AU1A 4PRDB 5AW4B 4C8XA 5TK2A 5D7LA 3UJTH 5HDWA 2MTPA 2FD6H 4OGZA 4I1PA 4WWID 2L7UA 2Y7LA 3M1CA 4LKCA 4NJ9H 4NZTH 5T5NF 4D94A 1G4RA 4YGAB 4ZX6A 1K3ZA 5DVMA 3J8F7 4LIQH 1H3PL 1HX0A 3IXTA 4X9GA 3HZ3A 4DP8X 4GG6B 4X6BB 3WV0A 1OGYA 4JCMA 5IB4A 1OK0A 1XAUA 2GTZB 2RMNA 3GJEB 4GXVH 1DJHA 1MCCA 1M6OB 3CN0A 4UUJA 4LL4A 4HXBH 3WLBA 3QNZB 1MWAH 4ZO8A 1MF2H 3G9AB 2WLLB 1DN0A 2MQ0A 4ONHB 1FSKB 4ZUTA 4TUJA 5E2TL 3EDEA 1NAMB 4FFWC 1XH1A 4UIMB 1FWXA 4AENA 1OGAE 4YZFE 1QASA 1NINA 3U1SL 5CIPA 4LHUB 4N2LA 4G1EB 3T0EC 1ORQB 2DYPA 3ULVD 4WTQA 2ZQKA 5IP4A 2I07B 1XF5A 4BCXA 4AVHA 1JCVA 1G9NL 1H5BB 1YHPA 3FSVA 2AERT 1ZXKA 4U3HA 1GW6A 4U2YA 5DC0A 4AMKH 4EN3A 2J5WA 2LOEA 1W80A 3LPGA 4PY8I 5JZ7D 3CVHL 3LMJL 2X70B 3K4AA 2ITCB 1UCBH 4MA8H 1ZIBA 3SGKC 3SBWC 1IM3B 2V5SA 3FUKA 3ARRA 4OZHF 3ILPA 3QO0A 2Z7WA 2HWZL 1UM4L 1GGCH 1NTDA 4A55A 5LG6A 1SDYA 3CFKA 3RBSA 2WVVB 4KROB 2NY1D 5DT1L 5HHXH 2LVCA 2AK4D 2G4EA 5E4IA 3PWUA 3VXOA 1DUZA 1UQSA 4TSCL 5CU9A 2AQ2A 2OZ4L 2QHLA 2WTPA 3FSWA 3D85A 1LO2H 4N90D 1T89C 4OF3A 3UEQA 4ZDHB 4ZNEE 1I53A 3W9DB 1G5GA 4P05A 3W57A 4URKA 3MNWA 3V0WH 3GMPA 4PJDE 4R6UA 3WS3B 3KD4A 4E2OA 1X7SA 5I0YA 2CR0A 3K46A 1ZD6A 1GC1L 3GMQA 1M2OA 4P2RB 2J57A 1MQKH 5IHWA 2FQGA 3BEVB 3KCPB 4RMVA 1MJUL 2DV6A 3KH3A 1BM7A 1KJMB 2X28A 4Z3GA 1NC4A 1R5WA 2X1XR 3L3JB 4HQQL 5EFIB 1TQCB 2C9AA 2VJ8A 3LQAH 1AGBB 4DOHE 2ZUQB 1JPSH 1MIEH 2YWZA 4U7KA 1B0WA 3WTWA 1JXGA 4W9DC 1IFHL 2FECI 1C7TA 3LH2H 2ZP8A 4K5OA 4ODVL 3HR5A 3IDIA 2DMKA 2ZF8A 2X42A 5KBPA 1EX0A 1YAIA 4CRYG 2HVBA 1X4XA 5L9DH 2E74C 2V2WA 1T0NA 1ZT1B 4JJOA 1EDYA 2W88A 1KXQA 1QI5A 4EAEA 4KFMA 1KJ2H 5C1MB 2K1MA 4DP1X 3VMOA 3OGCB 2AZUA 1YYCA 2LQRA 5I5JA 2YPLE 4AG4H 1LD9A 4GRWE 1RUPH 1ZHKA 3PL6D 1NLBL 3HG2A 2R2EA 1BFVL 2XCMC 3CLFL 3CFCH 4HPYH 4AH2A 1JHKL 3PWNB 5BZWA 2FT7A 3WMPA 3BYTA 4JFYA 1I1YB 1QHQA 2J43A 4ADJA 4OZGB 3LRSA 2M1KA 4LZKA 5EU4B 2DZEA 2XLLA 3LXBA 3VMNA 2FEEL 4WNSA 5CJ8A 4F20A 4FEIA 4ODSL 5EZLA 3UTZA 4Y5YB 3ZHKA 4G8IB 2G5RA 3QZLA 4N0UB 1NCCL 2FH8A 4FXGC 1JGEB 2HKFH 5K9JH 2W60B 1AOHA 1I1FA 3W0WA 4IHOB 2CCLA 2XN2A 3CGTA 1OM3L 3Q2CA 1JZ3A 5F1OB 2CGYA 2J6WA 4KXDA 3TJHD 5E94A 4E0RA 2FSDA 2FGWH 2V2TB 1U92A 1OAUL 2RALA 2Y6TE 4Z5RB 2PPFA 3FCTA 3BIBX 3WAKA 3GSNB 1F4WH 3CFDA 1ZWIA 5DWUH 1JZ2A 2XTSA 5AOLA 4U1KA 3F7LA 1KYFA 5DFWH 1AY1H 4JFFE 1JZHA 3VXRE 3DO7A 4UM9D 5KYWA 3V4LA 2IFFH 5E2VL 2C9QA 4MA7H 1UA3A 1M4KA 3AACA 3VTTA 1V3LA 2PTTA 2BSTB 2F7OA 5DRWA 3K4ZA 5DO2C 1FGNL 2Q76A 5AYTA 5FCUL 1PVHA 5FV1L 1A1NB 2JJTA 5CUSL 1WAPA 2CO1A 3DO7B 3HZVB 2COVD 3QQNA 3SB3A 4P5KB 1KLGA 3K1DA 5HJ3A 2WCPA 4KRMB 5C0AA 3VYPA 35C8L 3QC5X 4JZJB 4PJXA 1KBVA 3RX5A 2PYED 4XMPH 3ESUF 2YMXL 5BUPA 5CEXA 2IQ9L 4AIZA 3VGGA 3QCVH 5IJVB 3I9GH 3Q1EA 3CMGA 5F1KC 1YMME 3ZKQD 3F7VA 1UJ3A 1VGKB 5MENB 4IRZL 5ABDE 3ULUD 2YAEA 4N2BA 3MN8A 1JF1B 4ODBD 1QX1A 2OYKA 4NN5B 3VB8A 4WRLA 1U3NA 4J28A 2WQWA 3RA7H 1EMTH 4XPGH 3IAQA 4U1JB 3W11C 5JUEL 2PJJA 4LLVA 3BWAA 4UT7H 1KZYA 3VI3F 5DGRA 5KVFL 3GF8A 1TFHA 2PW2B 3CQPA 4MZIA 1HCYA 2EINB 2ZWKA 1PKOA 4NFDA 4QHLB 5CJOL 4CBPA 4EN2A 5BZWB 3F7YA 3PHSA 3C5XA 2Z0BA 2G5BB 3O6FD 4X8XA 5CLZA 1WA1X 5FGRA 3UDWC 2R2HA 2UZYA 4TQ8A 3BWUF 4MA1C 1LEKA 3U0TB 1NCIA 4AWJC 3U4EB 1NFDA 1KEGL 3SEPA 1K6QL 2DWDA 2WIMA 1BFOB 4KKAC 1P5UB 1UKQA 3I6KB 2EDHA 1I9IH 3EJRA 4MNHA 2GJ6A 3KPPA 2JELH 5D7JB 2UZXA 4BWWA 3VGFA 4GIOA 4U1GB 2NAPA 3MMEB 2YRLA 1AKPA 4GKZA 2L7QA 3CVCA 3S96B 4E42B 3NJGA 1JHTB 2GJZA 2A74A 2PWHA 4TQEH 4ACPA 5KANI 1A8ZA 3A4AA 3B3IB 5AOIA 4MAZA 3A3YB 5MEQB 3QYMA 3NCMA 3R0NA 5FKPA 3RL2A 3RTQD 5I8EA 3VW3H 4DP4X 3NSJA 1QEWB 3DMMD 1SN0A 5HDQL 4LSTH 4MA8L 4FMKA 4Y5VC 2R2CA 4PJ7B 3KR3H 3RIKA 5CCGE 2PCXA 4ZPVB 5FGBA 2EYSB 2CKBL 1H0DA 4FQCH 5LN4A 4AXWA 4F9LC 3TZVA 4R7VA 1NC4B 1R5WB 3E3QC 1HAUA 3LPFA 3TNNA 3ARYA 1YEKH 4F27A 4GOSA 5IB5A 1G94A 2E4FA 2RFXA 1YEEH 1U6AH 4P5MA 4KY1L 2G3MA 3OAYH 2ZAGA 3OB0K 1HQ4B 3TS8A 4YHYC 4M3HA 2EQDA 5ISZB 4RA0C 1G7PA 4JGUA 4BELD 3UBGA 3EIFA 3P11L 3PP3H 3TO4B 2NRDA 2CD0A 2VERA 4D9QD 1E43A 2PP9A 3MX0B 4XN8A 3KLHD 1UQSB 5AKRA 4ADIA 1FYTD 3DHPA 1R5VA 5FYLL 4JW3A 3KPOB 1WEJH 2HKHL 3NSYA 3DGGA 4EUPH 3AREB 1I4FB 4HZAA 3UO8B 1PFCA 1VC3B 5IW1B 4DESA 3PNRB 2JIRA 2WMPB 3ARSA 4RGMC 2GITB 4LVHB 5DJZA 5IGXH 5DZAA 4ZFOA 1SQMA 2K7QA 4R26L 2QBWA 5DYGA 4OFPA 3IF1A 4DPAX 1QKZH 2GAZB 5D7KE 3BH8B 5IR1A 5D1XA 1ETB1 3TFKC 5AENA 4AQ8A 4KK5C 1WCMA 1JPTH 3REWB 5E5MA 5FYJL 2UY7A 4L3CA 1PX3A 4X8JB 1M2VB 4GQRA 1AKJA 5K69A 1H19A 4M7JL 5IVZA 3S8FB 3RPIB 1N6UA 3STLB 5DVLA 4UIMA 4I18B 2VW7A 4GKOA 1ACCA 2P1YA 3FTGA 1C16A 4GUPA 4GUOA 1A3LH 5EZOL 2I9TA 1FDIA 5ESQB 2AQTA 3MFFA 4YHIA 1W6WA 5ANMB 5CN3A 1CGWA 2I26N 3ZDYB 3RZCD 5TD4A 2WXOA 5ELIA 4E36A 4PJ6A 2VIRB 2NY4D 3V0VA 4GFXA 4WENB 1KIUA 5T5ID 3UGUA 3LEXA 5I9QB 4GG6A 1OP4A 2WXJA 3QZWB 3L4CA 2BCKB 1S3RA 2CRZA 2HX9A 4G9FE 3RDTA 2ICES 2OYMA 3OLGA 4RISL 1AW8B 4UMSA 1RFDL 1LWRA 2G75A 3PREA 3S97C 2CLRB 2FO8A 4FNRA 3F8UB 1BVNP 4BZ2H 1J1PH 5A7BA 3C09C 4GUQA 3FQUA 3NGBC 2IXQB 4FXTA 4HBCH 1NGWA 4XZUA 1RZPA 3QHFL 1EAOA 4FL4C 5GSVB 4TQPA 4ZFFA 3NUKA 4LSUL 5ICZB 1KV3A 4QHPA 1FIGL 2F19H 1A64A 5ILTL 2EDYA 1WAAE 2O6DA 2CM5A 4H88L 1J18A 4JZNA 5EU3A 4NCDA 4R7XA 1J0ZA 4NO3A 1ERNA 3GTQA 2FWLB 4IRZA 5EO0A 1JG9A 4DNLA 5MERA 2HCZX 4PRPA 3NCCB 3UG3A 3LDBC 4R7LA 3DPDA 4NO0B 4N25A 4S1DD 4AITA 2BWDA 1BBDL 5TPWH 4P3DB 3OJDA 5C0JA 3CLEL 1PG7W 4K07A 4OCXH 3DETC 2OMVB 4RX4A 2E7HA 2MH4A 3DGCR 1DVTA 1UWEL 4JPIB 2AAAA 4R4ND 1LO0H 4RFEA 1HE7A 1OE1A 1OKEA 1QZ1A 1UYWL 1CXEA 1Z3RA 5AYUL 2DQJL 5K9QG 1LO5A 4XOCA 5IT2L 4WW1B 1WCBB 4YHNA 1SXZA 4RGNC 1D9KC 3BPNB 4L1DA 4AYFB 5F6IB 2P8MB 1HC1A 1FLTX 4AX3A 3VW3L 1MELA 1RVFL 4R96B 1P1VA 2F74B 4JFEA 4MHHG 4EIBA 5J06A 4NRYA 3MO1B 3OWEA 4CMMA 5INCA 1NCNA 1U8HB 5DMGC 3KYNA 4H0GA 1J8HA 3CDGA 5C92A 2N0MA 2XA8H 1T7ZA 1U42A 4P4RA 3PNWB 4K9JA 3WTXA 2X6CA 4P4RB 4WEBH 1OM9A 1PYWB 2JCCA 5I73C 3DOIA 1U6AL 2ZSWB 4FNTA 2YGPA 3EYOA 3KJ4C 3NCYP 5E9AA 4I0PD 2NR6D 4AK1A 5GRVK 5T1DL 1KN2L 1ZLUK 5KVGH 3G6AB 2VSDA 3COOA 3QJTB 1F56A 3EJQA 3T3PE 4RVBA 2G9KA 3WN6A 5J9PA 2YSSA 2XZZA 1NGQL 4GW4A 4LFHG 5BZDB 2WLMA 4AQEB 3I2CH 3Q6FB 4Z7NB 4IQHA 4ATWA 1BM3H 4BFEA 3O5AA 1XR9B 2X4SA 5EUKA 1TOXA 1YN7A 2E76C 2VDOH 2P5EB 1DMRA 1FDLL 4X8GA 3NTCL 3DXAA 4UT9L 1XIWC 3ATEA 3MRHA 3GEFA 4ODTH 4PI2A 5AD0A 2F7RA 3VX1A 3OAWA 3GI8L 3QRGH 5ECJE 1U8PA 3Q48A 2XICA 1KJVA 3D4GA 2FX9L 3D39A 3MR9A 4B6ZA 5EBWA 2XPGB 1JWSA 4BFGA 3ETBF 4RFNC 1L9SA 4S1SH 3T0WA 1BJ1H 4ZXBC 3CG8A 4K7PX 5E5UB 1SJHA 2BNQE 3WEMA 3F65A 3HE6B 4WTZA 4Z77B 4O02A 1WFNA 3OMAB 4ELMF 1FZJB 4S1QH 2Z34A 3RVXD 5GS0D 2A6KB 2XV6B 3S48A 4JO8A 3RG1C 2RGSA 2BFGA 4KDTC 3VXNA 1CBJA 2XWCA 1H3WM 3D1MC 2WWMC 1I1AD 15C8L 4Z3HA 1CZ8H 1GTNA 1MHHB 3VXRB 1LVEA 4EZJA 3IU4L 2ZF9A 2A99A 4P2RD 5E2WL 5E1GA 1UD4A 2EIZA 1NDGB 2IH3B 4EDWH 4ZS7H 3NIGF 3WUWB 2OMYB 2EEOB 4XBGB 2YUVA 3KBFA 4WTZG 2OCFD 4FG2A 2MSPA 2YN3A 5TF1L 3STBA 3ZGIA 4DAGH 1RZKH 1ZE3C 4RDQG 5DHVH 3U6XA 4FMFA 4OFDA 4OR1A 5K9QI 1KYOK 2E9BA 5EEWA 1HXYB 2PF6A 4YQXH 3OG6B 4N26A 3IFLH 4M29A 4P5TD 2CIIA 5I1KL 1U8IA 3DPBA 1Y0LB 2IADB 2VZSA 2PN5A 4NQDE 4JRWA 3PXJA 3PAUA 4U3SB 4N8VG 4M8VA 4WJKB 4YLQT 1UZGA 1LE9A 4JQXA 2EEAA 4W9ZA 1IB5A 1BJMA 1EVTC 2QLYA 4X8JA 3W3BA 1KB5B 3HG1E 5KBDA 1T3FA 3AG4B 4P2OD 3QJFB 4X9HA 1EHKB 4NPYA 4W81A 4WNJA 4XO4A 4KDIA 3X13A 1DE4A 2YPLB 3ETBJ 4O51A 4YXKH 3NJFA 3LS5H 3PWPD 5IQ9A 3ZUCA 1ZS8B 1EZLA 1CT8A 1QRND 1RIHL 2IH8A 1ZVNA 3V4VL 4WI0B 2G3ZA 2W9DH 4DGYL 3ECQA 4FQIH 5HHPB 2FT6A 1SFDA 3NCJL 4NGHH 3MV01 1MW3A 3GMOB 3LKRB 2EH7L 2YUJA 3WKYA 3CHPA 4OVVA 2NY3D 2ZXWB 1BMZA 4XP6H 4N8VA 3TEWA 2AJ3B 3UAJA 3S2AA 1F13A 5AB0A 4QXGH 3V8OA 4L8CB 1R5VB 1P6FA 4H0HB 4BDVA 1XEUA 5L0QB 3PHAA 1JPFB 3TA3D 3F58H 1X5XA 3IBOA 1RFDH 3HC0A 1DTUA 3A6CL 3US1A 2X4TB 4WI6A 1HILA 3UBHA 1I8IB 1M05B 3ZTJG 4NQVA 4RMTA 1AKJD 1XXFC 2YD7A 3L1OL 1Q94A 3V4PH 3SDXA 3VI3B 2GBVA 2HZHA 4XCEA 5FGCE 4LGRB 2O30A 2VE6B 3VFTA 4NT6B 4ZK8A 4LEOB 3MRRA 1MDAA 3BPOB 3GPEA 1BXAA 4U33A 1JTPA 4G59C 1N5YH 3SE6A 1KSRA 1H0DB 1SY6A 2JA6A 3NOIA 1N5AA 1WBXB 1NL0L 3BMVA 3KPRA 1KDIA 1AGEB 1UACL 5KSVB 1NUDA 2J1XA 2QSTA 2WINA 4LT7A 4NQVB 3FQXA 1M3IA 5JPMB 3E8UH 1ZIAA 4P2RE 4X6CE 4Z0XA 1I1RA 1I7TB 3M17A 4XNYH 4GBXC 2QSCL 2DY2A 4Y19E 5AB1A 3A4EA 3N1PC 1GGUA 5DMJB 4X5XA 4NM4L 4H7VA 4N8VB 2WXLA 5HHOA 1ETJA 1WICA 3GSQB 1T4KA 2FQEA 4G8GE 1KNOA 3TO4C 5FO8B 1OGTB 4N9GB 2EXYD 5CBEA 5CCJA 2GJRA 2I5YL 4KI5E 5I2IB 4NJ9L 3TN0B 3E6HB 4WWNA 4U1NB 4OZ4B 1ZANH 4XC3L 3RKDC 2QZ5A 2BZDA 2J72A 2HJKB 4GP5B 2OKMA 3SPCA 5B8CC 1ETA1 1PZ3A 2AXGA 2VITA 5CNHA 1GKEA 4APQA 4LLVB 2CO6A 3BPCB 3OPZL 3LNHA 4IOSA 4U3SA 3L3KB 3UJIH 2Y7NA 5BRZA 4M7KL 1JRHL 3VCLA 1LQBC 2EDFA 2XTJD 2ZUQC 3HJ0A 4Q7DA 2CO6B 2QR0B 1N0XL 4YSCA 2NY5C 1NMAH 4JKWA 3QEHB 1DBAH 2XWJA 4HGWB 1UOKA 2BVPB 1ZHNA 3RWCB 4PB0L 1KN4H 2PR4H 2HRHA 5IESH 4JFTA 1L7TL 1YEJL 2O4EA 2OV0A 3AXLB 3DMMA 4O9HH 5T3ZD 4K23H 2EDBA 1LHZA 5D1QE 3KL5A 1AR1D 3ML9A 3IFLL 2MHAB 4GA6A 1L9NA 2ZX7A 4PJCE 3IE4A 4OGAC 5CGTA 3SYCA 5BVJA 4KXBA 5HHVH 1CDCA 2P26A 2VO5A 4IU2B 2D7QA 3OJVC 4X0NA 4AKPA 1TXKA 3LEYH 5LBSH 1A3RL 4TL4A 2W91A 1XF4A 1O6VA 1NKRA 1ZTMA 1DVZA 3QDJB 3UAJD 3O2VL 4LE8A 1S7WB 4FNUA 4DF9A 4LCUA 2FK9A 1RZGB 1GGTA 3K6NA 2XNAB 3B2PA 4A7VA 1D2OA 2A6KA 1EA9C 5CGBA 1WIOA 3IBEA 4G6JL 1CBVL 4NO2B 4N0YL 4V33A 5IZ7A 3ZDXE 5H4ZA 2V2TA 2DJMA 3BZ4A 1YQ2A 5ISZE 2MCAA 5I30L 1KXHA 4GIPD 4MS8C 4QTIH 5GJTL 4BBWA 4NN6B 5F9AC 3IMUA 2P46B 4HK3N 1OB1A 3ZK0A 1MAJA 3W39A 3IAGC 3BC9A 3W0WB 5D2LE 2BC4A 4Q8BA 2EZ0C 4BA8A 1LQSR 5C07A 1A7RL 2J73A 3DA0A 5T1LB 4UTAH 1JXKA 3DV4B 5ACLA 4BIKA 2D03H 1N59B 1T5KA 3SDAD 4NT6A 2F2HA 3EH2A 3MLTA 4V11A 4PJAB 3RILA 2HT2D 2O6FA 5IQ7L 1AVAA 3O8XB 3SGDH 3B37A 2NY5L 3MNZB 1IFHH 1Y4ZA 5DQ9A 3RGVC 1N0LA 1Q90A 1TIUA 4U0RC 1LO3H 3BGFB 3KPTA 4RH4A 4YNYB 3IJEB 4M1DL 3Q6FA 4OLYH 2KH2B 3HC0B 1INEL 4AM0Q 5HVHC 1JHLL 1XXDC 4NIYE 2EVIA 5CGYC 3VRLF 1DL7H 1H5NA 2IG2H 3L1GA 2EILB 5LO7A 3CFUA 1MQ8A 2NY7H 1YUHB 2YARA 4G6AD 2CO7B 4HJGA 4UI2A 5LWYH 3QDJD 5G4MA 3WIHA 3RVWD 3OAZK 1FO0H 4N2AA 3L6FB 3EG9A 4HKJA 2EIEA 3EF7A 4PJBF 3AXHA 1F6FB 3D05A 5J1SC 1VFAB 4FNLL 4E9VA 1BWWA 1A66A 1RUPL 4ODXA 2FYYA 2F7PA 5KVEH 4OLEA 5TQ2H 3FS9A 1LO2L 1QFHA 4WEUD 3P3UA 3RX9A 1TZIA 1S7TB 5E99H 1K83A 4I2XE 4PJEE 2NVYA 3SO5A 4HT1H 1MIMH 4NPYB 5HYJE 3GXUB 1AZNA 1X5YA 3WMQA 4HS8H 4Z7NF 4ZMXA 1BD2E 2AK1H 2JB6A 1UD2A 1J0HA 2X9ZA 3PXLA 3HZKB 5F1IB 1HXMB 4DKAA 2R0LL 4PRIB 2CRMA 4AYMC 4RA3A 5HJBA 4QRQA 1WGOA 3EKCA 4LHJB 5DD1H 4DZBB 5LNDA 3IMVA 4WU5B 5L4FA 4RFEB 3LN5A 3IU3B 2FRGP 3QG6B 4QF1A 3PXHA 3SDCB 3VXMA 1GZPA 4GKNB 8FABA 1GAFH 3U4BH 3MNWB 4ENEC 2Y2TA 4JFVA 5EO1A 3AY2A 3JWOH 2B4CH 4ZODA 1BVNT 5D70L 1MVUA 2RBLA 4XHQA 5C0AD 1RPUA 2ZCLL 4X6FA 1XCWA 3ATBA 3LXAA 3MTRA 5C0BD 2XZQH 1REIA 1ZDSA 2DIBA 3ARFC 4LBEA 1UZ6F 32C2B 4DFHA 4QUOA 2XQBL 4YDVB 4O00A 3FQ2A 2WUCL 4FQHB 4PD4J 4JFXB 4PJ9D 1VCBC 4RMWA 2BNRA 4WI9A 5BS0E 1MCKA 3DSNB 3IFOB 3IWVA 2H3NB 3DDFA 1DJWA 2VDQH 4JHZA 3DVFA 4OUOA 3A6OA 1VFMA 1QSED 1BZ9A 5C9JA 2IWKA 3TT1L 3VDCA 1QWUA 1TPXB 1V54B 3OC5A 2H8PA 4L8SB 4UBDD 4GAGH 1PZBA 2G75B 2ZXAA 4LSDA 4N1EA 3FDWA 4UTBL 4E9WA 3BUQA 2BDNH 3KWWA 1L7TH 1TZAA 4B9KC 4O9HL 3X12A 3NA9H 5F7YC 2BCKA 4D9RE 4KHXH 4NZFA 1YEHL 3CD4A 3GQFA 3NCWA 5E8NB 3VRIA 5A43C 2C3XA 3DJ9A 3EBIA 3QUMB 2BMKB 5AYQA 4LARL 4I77L 1OAYL 3S37X 4P4KA 4KJQC 4AYSA 3Q13A 1TG8A 4PJ5E 5LAXA 1LO4H 3QXUA 3JTSA 1HDMA 4PJAF 4OM0L 3LIZH 1RLWA 2WXKA 3V0HA 1M6OA 4KDWA 3NIFF 3LY6A 4C55A 5SWZE 1HQRA 3PJNA 2FZ3A 2VM3A 3STLA 5SWZA 1KUMA 3OZLA 4NQDB 3SGJC 3MXVL 4JFPB 2XX0A 3PL6A 1AKJB 1G9HA 4FG6C 2ZYIA 4K3EL 5CJXC 4AYGA 4F1ZA 1I8LC 4AIOA 2FIRT 3UTTB 3STZA 2K3HA 4OB5H 3CFQA 3V95A 5IVXE 5ESVA 3FTUA 3QQXA 1S78C 5HXMA 2QQNH 4F7CA 2VMEA 2FIKB 2AJSL 4M48H 2YA1A 3IF1B 1X5JA 4P48A 3VVVA 2KKQA 3ARWA 4WSJA 1DYZA 4XBEL 3B83A 3Q0HA 3CHRA 3L3GA 4ZFOB 5IJDC 5IOKA 4W70A 2Z91B 4HLEA 1N0XH 3G6DH 2ZWYA 4HS3B 1T0OA 4FZ8H 2QFRA 2VH5L 2VSCA 4LCCC 2DWTA 4TL5A 4L5FH 1J0YA 3BKML 1KN4L 3CDGB 4TQEL 5DRNA 3L95A 4ZTPH 3MX0A 5DK2B 4TVPD 5GS0C 1VLXA 4TSBH 4LBEB 4M02A 2DLFH 1UM5H 4MDJA 2B2XL 5I8CA 2N7AA 1W72B 4WWKA 4WW1A 4GS7C 2ZWNA 1GZHA 2MPAL 3QNYA 3SDAC 3ZUNC 2XVKA 3T1FB 4A7GF 3HG0A 3BD3A 2Q7YB 4H8UA 3S3SA 1D5IL 3QDME 2WNKA 3F6JA 5GRUH 3U6RB 2NX5B 1OP5H 2Y3NA 3HA0A 5C08B 1YMHA 1U93B 1HXMA 4D7PA 4EI6A 3H9SE 1GJWA 5GS1B 3R19A 2JB6B 1N8OE 2HTKC 5I8CB 4WI5A 1TQTA 2DI7A 2EYRB 3FAXA 3O3UN 1AGCB 3TPKA 5IEKA 5I8EB 1U30A 4AEFA 4ERSH 4KZDL 1DUYA 4PRIE 5MERB 3SDDB 4FA8A 2F7QA 3FFOA 2IDFA 5C3IA 2MWCA 2R0LH 2VDNH 2BHFA 3JTTB 4UBDC 4WI4A 5IREA 3KWUA 4MB4A 2NCMA 3B2UC 2GEEA 1P7HL 4LPYA 4NZUL 1MG3C 4FS0A 5DJ0B 3QWNA 4K7FA 5I26A 3EOTH 2XWTB 4X4XB 4D9RD 3O3EB 1A4BA 2E7LA 3WN5A 2DIAA 4XZUB 1ODUA 4CN1A 1I8LA 3S8GB 1JPST 1RUAL 2J8UB 1IE5A 4ZO7A 3BCDA 4BWUA 2BJML 2A0LD 2W0PA 2BSBA 4LLDB 3ZKMD 1AR1C 1UFUA 2ADJB 4FHBD 3T2NL 2CLRA 1TUPA 2DQCL 1R3IL 3LD8B 4N6RB 4DWHA 4FKHA 1KLUB 4QHKJ 3RY6C 4CKVX 5ES4B 4OZIF 1R3HA 3GSWB 4MHHI 1NUNB 3GJFH 5B4MD 4BUGA 1PT1A 2VRKA 5TDNB 1XGUB 4GS7B 4Y5VB 1JXDA 3K7UA 3U1QA 1ADQH 2O5ZL 4IDLA 3ASWA 5BXFB 4FQ1H 1W72L 5DO2D 1E3XA 3DUSB 1DJZA 4MS6A 1HOEA 3TA4D 3DV4A 1QFUH 2HH0H 1TQUA 1ASQA 4RWHA 4CN6A 4BA0A 1MNNA 1AA6A 3EJSA 2C4FT 3FTGB 3WY4A 4XCFH 1E5UI 5HI5D 3KEDA 1U3HB 3SE9H 3UBXG 5IVZB 4HT1L 2VQTA 2LLLA 5BZZA 3OZ9L 5FEBA 5E8NA 5EBGA 1IUZA 5E4EC 3T8XB 5JNYA 4WFFE 5I74C 5LG1A 3T3MB 1ZPLA 3SDCC 1UEYA 5KAQF 2CGRH 5SX4I 4Z7QB 2R0WH 4PWEA 4CVXA 2NNAB 5BO0D 4LSQH 5CBAA 3U1PA 4JZJA 4PJXB 1KY7A 3PGFL 1TT6A 4HV8B 4L1SA 4MJJA 1S9VB 2PJHB 1YEJH 4D7BA 4EZMA 1HEJC 1KLGB 4FG6D 4QRAA 5HJ3B 3HI6L 4G6KH 1WFJA 3EYUL 4KAQL 5DJZB 4DQAA 2YAQA 3TV3H 4DKEH 3OXRB 2NX5D 2HFEA 3CX5J 4JG9A 2K45A 2CE6A 3JWOL 2F53D 3LN9A 1T1ZA 1WAAF 1KIRA 1ZGLA 2UWEE 3IK2A 3GLAA 3DURB 4FFYH 1JPTL 3F6LA 3GXDA 1VPOH 4KJPD 3D12B 3O6LL 3O6FC 1A2YA 1ZWIB 3BD5A 3DGDA 1D6VL 1MRDH 1T1XA 1I7RB 3IMSA 4ATTA 4C4BA 3FUIA 3WFBH 1XIWB 1FL3B 2X2IA 3DRTB 3QUML 4LSPL 3WAJA 2Q20A 2VOTA 3QJOA 3MKGA 3G6DL 3O0RL 4KXCA 3NK4A 4M6MH 4FZ8L 3EFOA 4HUMB 3GXMA 5CP7B 3SGDI 5B4MC 3JWNH 2YRPA 3BAYA 3RE0A 5IT2H 3HS0C 1AD9B 5EZLB 4JANA 2HMID 2B39A 2NZ9D 2MIZA 4EPSA 3DWTA 1HL4A 3ECWA 1Q0YL 3GIZH 3S3CB 4BWTA 4XPHH 5KBLA 3D0VA 1C5BL 2O1AA 1I1YA 3BT0A 3FUJA 1TDQA 2JJWA 1IBDA 1LILA 2WO4A 2XFXA 5D7HA 4PV8B 2DYSB 1VFOA 1EK3A 1S7QA 4R97B 1RUQH 3P54A 4UIKH 3IRCA 5DHEA 4YSOA 3HG5A 4U1HB 3O9WB 4PREB 5DTFA 1SGKA 2D7OA 3QI9D 3MLZH 4X9FA 1NCGA 4QXUH 1KNOB 1YYML 1I9JL 3BP4A 5FO8A 1E5YA 2KQAA 1MCIA 3DVIA 3EG9B 4HKJB 1G7MA 2C26A 1FH5H 3R4DA 5I0WA 2WGNB 3I6KA 1T7XA 4XP9H 1MFMA 4HUVB 3BN9D 2FX7L 1AYOA 1Q4NX 5EZOH 5FYLE 4HWZA 4LCWD 2ICEB 1KULA 2WIIA 4MYWB 4FC3E 4ZOBA 2HFTA 1EU1A 5GISH 5GZND 4Z7OE 2OR9L 1T5WB 2R4RH 3U9UA 4Z9KB 2XFXB 3FQYA 3QJVB 2XWZA 2PW2A 2J88L 4NENA 3TTYA 1ZDQA 3IDXH 3MNZA 2OMZB 3QZBA 2QQKL 4YBLC 5KSVA 2AK1L 2GSIB 4XWOD 3JZ7A 4HCIA 2D2OA 1GGIH 1RMFL 3B5GA 3BJLA 4OLXL 1OARH 5EFIA 1FO0B 2Z31A 1NM4A 4F8PA 3AS0A 2IMNA 1BA9A 1KJMA 3EFOB 5IMOB 4PCTA 2E2HA 1VFUA 3KPNB 3ZT6A 4KGLA 4KTEL 2R7ZA 2ZWLT 3TWCH 1EFXB 1DLHB 4ODHL 4DETA 3GMPB 2N01B 3P2DA 4P23C 1WHOA 2DLFL 4JVUA 3BZ4B 4AEEA 1HILB 2PPCA 4AIZB 1XGRA 1WCQA 5F8RC 4ZDHA 3I74A 1UTDA 1V3MA 1XBDA 2ZIDA 4BKLA 3RWFA 2MOVA 5TFSL 4BXVA 1E50A 3PWUB 4HUWA 4NQTA 4WFED 1FFPB 2XA8L 1T21A 2ILLA 3U9WA 2KPNA 3DURA 3CBKB 3KGTA 5CKAA 1INQB 3GBMH 5GGSA 4JRYA 4BSVB 3N43B 1ZGLB 5GZOD 3LPWA 2BX5A 1K8IA 4LSSH 4ZQTA 3INOA 3OG4B 4OLZL 3NCFB 3VXTA 1T0PB 3FTXA 5F7WC 3WFHA 5HYJD 2ICEC 5J3HD 1DQKA 1N68A 1Y18A 3D69A 5IWLC 1LO0L 3WFZA 1TYJA 1EGJH 2WKGA 1NAML 3G6JF 2HT3C 1TMOA 1S9VA 4AJ0A 1A22B 3E7JA 3BLKA 3LZRA 1F4XH 4TVPE 4EN3C 3GSNA 3DIFA 4KRPD 3TCLB 4L0YA 1K6QH 1F86A 4HGWA 2ITFA 4FA6A 4NZRL 3MLSH 1OAKH 1RZ8B 5H2BA 1EBPA 5CIPB 5EPMA 5C08D 4ZOEA 5DZPA 3FPYA 5AVRB 2Z31D 1Y6KR 4JGMA 4ZW8A 4DKEL 4TPRL 1I1FB 1BPVA 2AQPA 4IKJA 1DJXA 1DQJA 3FO1A 3WEXA 2ITEA 1NUFA 3GBLA 2JWYA 1OE2A 3LOWA 1KTBA 4DUWA 4P9ML 3OQRA 4D0CA 1H6UA 3FQRB 3NAAL 2VITB 3BVXA 3NVQA 1IC0A 4ELMB 4FYTA 4P46B 1ZA3B 3IXTB 5E00A 5MEPB 1AQDA 2HP4A 3UJJH 4MAYC 5FO9A 3PWNA 5D7IE 4BQ8A 5I1EL 2Q0ZX 2WKLA 2WXFA 4GRWB 5IV2A 4DEPB 4JN1H 1KQGA 4KVNH 2DBLL 3T8MA 3DX2A 4LO9A 3UTOA 1QA9B 3JUYA 4TYUA 1M7DB 4WAFA 4GSDH 3BUDA 4JFDE 2ZJSH 3M1BA 4G72B 4KK8D 4FTVD 2OMXB 4PS8A 2QPUA 4TLTA 2JI3A 3GHEH 4XCFL 3X2KA 1THCA 2BNRE 2NR6A 3P9MB 1BQUA 1KB5H 3QCUL 5A1AA 3L2MA 5DJ0A 1ND0B 5CJXA 2AXHA 1ZT1A 2L7EA 2ADYA 4PMEA 3TBWB 1I85C 1LE5B 2ZYRA 4UDUB 1I7TA 4XP1H 1BBJA 1ROCA 2JLLA 3O6FB 4PJ5D 4W4NA 4HLZG 2JIPA 1JUFB 2IBZY 5JQ6H 4FMVA 1TZGH 2XXMB 4FXKA 2X41A 1PLGL 1AGEA 1DSWA 4TTDC 3VXPB 3KVPA 1AGBA 3EO0A 4NQCE 1UHDA 3QWZA 1HESA 2BY3A 3JVGA 4XCNB 1ASOA 3FU7A 4LLWB 4IOSD 5JMRA 4BFBD 1ZLVH 4KRPC 3IXAA 1A9BB 1RU9L 3LZLA 3OTTA 4BFNA 3ARFA 3DETD 1OTSD 2Q7YA 2A6DB 2KDYA 4XNDA 2G3NA 2YRBA 4JN2A 5MEND 1JFQH 3D7PA 4ZO6A 3GIVA 4D9LL 4KQ4L 4LK4A 1SBSL 4KX9A 4PVNA 3ML1A 1ZLWK 1JGVH 4KUZL 1OTTC 1T2QH 3APCA 2X4TA 1J05B 1HCVA 4TUUA 1F1AA 1X44A 2RJMA 4PRHD 5D7SL 3BAEL 2P52A 1A1MA 1JNHB 2B9AA 3S3DB 5FUOH 3VB9A 2HSIA 5I1LB 1SY6L 2EDNA 2D73A 4L18A 3AS1A 2YGQA 3NFNA 2OMWB 2DQEH 4HSCX 2E3VA 5HI3C 1CCZA 4TQIA 1XCQA 5F0JB 1GVIA 4H8WC 2B5IC 3GTNA 4A6YA 1QCSA 5E2JA 3GMOA 3LKRA 3LQAL 3PNWA 3DROA 5DJCB 1JWUB 5FO7B 5HY9B 3K6OA 1FZKB 2BRRL 3CFEB 5MHSE 4V2BA 3VD0A 1OXYA 1FIEA 3KS0H 5IROD 2IJ0C 1BZEA 2WQVA 2KERA 2OR8A 1FH2A 2BW4A 2DJUA 4ADGA 1I75A 4PGJA 4FFYL 3MA9L 5I1AA 3QDMD 1T3FB 3R18A 3PJSA 4FCHA 2P8MA 5F0PB 4G1EA 1LL1A 1OCRB 3SKMB 2N4IA 2V2XB 3NFSH 2GJJA 4LSUH 4AQAB 3L4WA 2C1PA 1H15A 1HQRB 2ZUXA 3BUTA 5JXAH 3DYOA 5J13B 2NMSA 5CGYD 5ERWB 4Y9CA 3S36X 3UZVA 2Z4QA 2CKNA 2Y7QB 1KJ2B 2WLLA 3TEYA 4O2FA 4G42B 4Y1AD 4N8CH 4JCWA 2JXMA 5DUPH 4RESB 3B9KB 4PY7A 5BV7L 1O6SA 2P44B 5I1HH 3MNVB 4NP9A 1II4E 3HMXH 1IKNC 4M1CC 4CC4C 1MFBL 4M5SA 2CO3A 2BNUB 4GW5B 3WCYA 1DJGA 1VJSA 4KXAA 2ED6A 2W0FA 2B59A 4BEIA 3B2MA 4HC1L 4Z7QF 4Y7OC 4G80A 5TF1H 1YNTB 1KF9B 4QRBA 1QFWM 3L7EB 2HTLD 2IGLA 5EU3B 4QOKB 2XPYA 4JG0H 4I0CC 1YPZB 4PSPA 5SWSB 4X7EC 4AC4A 1UHEA 1JVLA 2VQ4A 2IH1B 4UTAA 1S3KL 1VDGA 1NC4D 5C9JB 3HAEB 2IPUK 3E80A 1E27B 1BV8A 1U91B 1FAKT 4N5UA 1V55B 2CLZB 1WGVA 1XT5A 5I5MA 1OSPL 3JYCA 4HAKA 5JIKA 2VXSH 4FLQA 3IGLA 5JZ7C 3EYQD 5AL0A 2A6IA 4S2SA 1MEXL 4WTXA 3CN3A 4EIGB 4RLDA 5D7LE 3UGEA 1Q1PA 5HGBB 1RY7B 4UWQB 4JO2H 2D4FA 1XHHA 2Z6FA 1D7DA 5BOZG 5E8DH 2W0FB 5F88B 1KBWA 3WHE1 4JJ5B 2VZUA 3K4DA 1E5CA 1NSNL 1MVUB 4NUMA 5EIVA 1W16A 1JZ8A 3ALWA 3N1GC 3HPJB 4Y16A 3IJYA 3BZEA 2JXMB 4AONB 1A7RH 5F1NA 4ZUSB 3Q06A 2AKRA 2OX5B 3WIHH 5KSAC 1A14H 2QQKH 4G42A 2GFBA 3N41F 4TVSa 3HS8A 3QG6A 5DD5L 1MLCB 5I6NA 1T1WB 4FLHA 4ALAH 3NCJH 1KGIA 3NCEB 3Q9QA 4NGHL 2GW5A 5IQ7H 1AE6L 2JMRA 1JDDA 5AD0B 1TWCA 2G9HA 3AB0C 1I1AC 4E9LA 3ALXA 3MV7E 4TOYL 4I2XB 4XWGL 3ORJA 4QHNB 3UH8A 4NQXA 4AQAA 2B0SH 1EERB 4YL9A 3FRUA 4TUKL 1GS7A 4AQEA 1I50A 3REWA 4MD4B 4HIIA 2VDNB 1WWCA 4LP4A 5CEZE 5JO5B 1ZANL 4XC3H 5E8EB 4RGMB 1EEZA 3WN5C 3DI3B 3G9VA 3FOLB 5EOCH 4X50A 2VXQH 2LR4A 1RPQA 1UD5A 4H13C 4I1RA 2P5WE 3ET9F 3U1SH 4QT5A 4OKDA 3QZMA 3UIZA 2ZSWA 1JWUA 5FO7A 4R3SA 3QJQB 3BP5A 3OKEA 4K3DH 4OF7A 1TTCA 2NSMA 1BCIA 4GT7A 5HYJA 4PLKD 3C6SA 2CO7A 1K3IA 2PP7A 1FJ1B 1S7VB 3D4ZA 3JWDH 4YHML 1AR1B 3W5MA 1MFDL 4M3KB 4XNZB 2XKSA 1EVUA 3A4DA 3RHWF 4TQHA 4JO3H 3ROLB 2PYEB 5D6DA 1TQBB 2VLRA 2BINA 2DBLH 2YD2A 4E41A 1OQOA 2B08A 2NQDA 4NC1E 3IJEA 1CDJA 1TVBA 4QRSB 1F6AA 3GDBA 4OM1L 2YQGA 2CRYA 4N2KA 5ISZA 3T65A 1ILUA 1T0MA 2EE0A 2YA2A 4MRCA 4M7ZB 5FA3B 5TGBB 2C9PA 4JN2B 3X2QB 2NYYD 2N3JA 3VXRD 2NY6B 2XA3A 1QSFB 2FCBA 1Q9OB 4UNTA 1SEQL 5C71A 2Z1PA 1KY6A 1CLOL 5LQBL 3FMGL 4X7FC 1CVRA 4FI6A 4GQ9H 5AZEL 5FGBC 2WK2A 3ES6A 3IM1A 3LV3A 1A25A 2MOGA 3KPMA 4LDCA 1DL7L 2WUCH 5JW4N 2R59A 5DHDA 4Z7UA 4KKRA 4ZOAA 1A5FH 5D93C 2Y6SC 3AS3A 3KPLB 3WIFB 4OT1H 2BVYA 3C60B 1LE5A 1D5MA 1FZOB 4D0BA 4IOIA 1P7QA 4WWKD 3P69A 1X5KA 1S7SA 2X3AA 3KPPB 1KEML 5CLWA 5JPNB 1L9MA 3OVUB 2HKAA 1JAEA 3Q8BA 3I85A 4DH2A 3TWYA