4JJOA

Crystal structure of apo-clavibacter michiganensis expansin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
202
structure length
202
Chain Sequence
b'MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLDLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulose binding protein
publication title Crystal structure of wild type and D78N mutant clavibacter Michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis
molecule tags Sugar binding protein
total genus 41
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jjoA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4jjoA02
3X2GA 4FG4A 2ENGA 1WHOA 2KQAA 3FT9A 4JP7A 5H4UA 1L8FA 3CZBA 4JJOA 2AE0X 4ZM7A 3X2JA 3X2IA 3X2HA 4JP6A 2G6GA 4FERA 3X2MA 1BMWA 3M3GA 2PI8A 1HD5A 3SUJA 1N10A 1BW4A 3FT1A 3ENGA 2JNZA 4ENGA 2VXQA 2PJJA 1WC2A 3SULA 3D30A 5GLYA 1BW3A 3X2LA 2PICA 1WHPA 2HCZX 3SUMA 1OA7A 2GAEA 4FFTA 4AVRA 3SUKA 4FG2A 3X2KA 2BH0A 4JS7A 1OA9A 5GM9A 3X2PA 3X2OA 4JCWA 3X2NA 2PNWA 2G5DA 4L48A 5GLXA
chains in the Genus database with same CATH superfamily
4Y4KD 1DP0A 3TV3L 3BSZL 2E7CA 4M7LL 2CCVA 1FO0A 4MJIE 4XNQB 2F58H 3BMWA 4PV9A 1KGYE 5ICZA 3CFCH 1CR9L 2XKUA 1PDKB 3DTUB 1S9YB 4A7QA 4NC1C 5ETUA 3LMJH 2JIXB 1CYWA 1YEDB 2AC0A 4NQVA 2ZWYA 3VFUA 3BKJL 2DL9A 3SEPA 3W9EA 1NC4B 1RFDL 3WUWG 3LNHA 1D7BA 1RQ5A 2E47A 4OCXL 3LIUA 4KK5D 2YGNA 4XMTA 4AUJA 1CDCA 1MNNA 2VPXA 3VXSA 3WEOA 3MYZA 5IFHH 5C0RL 2GUYA 2V5RA 2VERA 4U0RC 2Q7NA 4UQ2B 3QZBA 4Z7UA 3GSOA 3FNKA 2FWUA 1CS6A 3TPUB 1SN5A 2P80D 3FO1B 3GWJA 3VXQA 5F96H 3RDTC 3HUJA 4PRHA 1IB5A 2Z6FA 3G6AA 3QCUL 3LKQB 5D7LE 5KZCD 4BRJA 2DQEL 5JIMA 1B2WH 3BUYB 3QR2A 4ODWB 4WJ5B 3Q13A 1JWSB 1HWWA 1QBML 2VE6B 4K55A 4F27A 2DH2A 2C26A 2F18A 1MZZA 2VH5H 3TNNA 5HVWA 2R2HB 2A9ML 3H42H 4N24A 4JFDE 5DS2A 3VXRA 3FB5B 4P04A 4KVPA 3D2UB 3L81A 2GIYA 4ECNA 2J20A 1NC2D 3K6DA 5AKSA 4F15B 4Y5YC 1REIA 4FNLL 1CDIA 3MO1A 4UOW0 3ZDYF 2DLFH 1Y1WA 1MFUA 4TQPA 4EI5B 3FT3B 1J1PH 2YEZB 3U36A 4Y8AA 4XNZB 1IAII 3BT2H 1NJ9A 4RMQA 3UACA 4CMMA 4F8OA 1AIFA 3ZO0A 5DJXA 1OCOB 2IEPA 5AB0A 2LTQC 4MLSA 1RPUA 2DYPA 4FABL 1P4IH 2X6MA 3IMTA 5E94B 2W5PA 4DO5A 3CFJA 5D7IB 2OTUA 1BEYH 1E61A 2QPEB 4P57B 1AS6A 2W07A 2H2PC 2VSKB 3NACL 3KPPB 3O3UN 4YAQA 4ZFFB 4LNRB 4IGBA 3RWIA 1NMCB 1WFOA 2F1AA 2P46B 3EYOB 2OPCA 3FQ1A 4BZ1H 4Z7OE 1LEGB 2BJML 5FECA 2JK5B 1WBZA 4X5XB 2EH7H 3U4EB 1K3ZA 3GXTA 3ZK0A 3S36H 1IGMH 1IJNA 3VXOA 2G3MA 2OSXA 4MQXD 2UXGA 5KYXA 4UAHA 3C09B 1E4WL 5I75C 4PRDA 1EEYA 2YGVA 3GMRA 4GXVL 1TMQA 4QRPD 2JV6A 2CBOA 3QIBC 2M2DA 5C3LD 2XTSA 4P5MA 1MWAB 4UQEA 4X7DC 1J8HA 3V55A 2Y24A 2FT6A 3PYCA 3RNQB 3BH9B 5ISZB 4APXB 1HWGB 5BPPA 3UEZA 1EX0A 1GRWA 4KQ0A 4FA6A 3PWNA 5E6YA 2ADJA 4L0YA 4FCAA 3G5ZA 4QTHB 5DK2A 1FNSH 2MJWA 5FYJE 4N2NA 1TF4A 4NJ9H 3ATBA 1L9RA 3PQYD 2VZUA 2PR4L 2X09A 4DKFH 4GG6F 4HCIA 3WKQA 3COOA 2FT7A 1AANA 3LZLA 1TXKA 3U6XA 3WY1A 2H6PB 5CBEA 3D5OF 5TE6L 3VFOA 2LVCA 2ED8A 4B27A 4PJGE 3DX4A 4JRYE 3I6SA 1L9NA 2PWGA 2GAZB 5AYQA 5B7FA 3SOBL 3RBGA 2R15A 5IB3B 4FNSA 1R0AL 1P4BH 1FZKA 1GHFL 1TOXA 1UD5A 3RDJA 4I5BB 1Z9LA 1C16A 1YY9D 3B56A 4XPTH 4WTZA 3B2MA 4XBPA 3LQMA 3WN5A 1JVOA 4WO4D 2UY6A 3O3DA 1NOAA 1AGEA 1HHKB 2XWDA 2DF3A 3KD4A 4WI3A 5H35B 1EJOL 4J23A 2Q7YB 3FF7A 3ULUH 3RWFB 1A1OA 4HJEA 5AL0A 5L0QC 1TMOA 1J0YA 1XCTB 5CMAA 5DK3A 4B9FA 5E4AA 5CZVH 4AQAB 2EUXA 4U2YA 2GFBA 2XPGB 5B7EA 2DMKA 1KIQB 1IU1A 3HBZA 3OXSB 1WT5A 4FFYL 3W38A 3RHWF 4YR6B 1LM8V 2EKJA 2VDOB 2XYBA 5I8EB 2HJKA 2OMXA 3W0WB 3CN2A 5LCVH 1SXBA 2G5BB 2PMZA 3FO0L 4GUPA 1AKJA 3BWAA 4RAVA 1G1CA 4XNMB 3SDXB 4W9FC 4AV4A 3O5AA 4TMPA 1OF2A 5CHNA 2H1LM 2ORBH 4NYLA 4FTVA 1PY0A 2HKAA 2X2YA 4LSUH 2K9FB 3BAKA 3X3FH 4U3SA 1ZLEA 4PWJA 3GQFA 4NHCL 4YSDA 1I9IH 1ZHKA 4UBDC 2A74C 2EZ0C 3CFIC 5FS5A 2GJ6D 2AJXH 5FM4A 4JY6B 1CFTA 1LNUB 4QJ4B 3RZCB 2Y6SC 4Z6AT 1AY1L 3NIGE 4DP7X 5TDOB 1PKQA 4G80B 3WFBL 4PJXB 3V0JA 5DJYA 4BFJA 2C7UA 4HT1H 3KDMB 4AENB 1DJWA 4HZLB 3MGAA 2LW3A 4LL9A 4WSGA 4W6WB 4KDLA 4X6DE 3QCVH 1MUJB 1YEEH 3CDGA 1SXZA 1XGZA 5EZLA 4MXWH 1G6VK 3PY9A 1DBKL 4HUWB 4PWEA 4UAOB 4EI6B 3GTNA 3GZOA 1Y4ZA 1YY8B 1AJ7L 3BZEA 3HCVB 2JKTM 4DUVA 3TN0B 4L8SA 3SPCA 4P2QA 4RFNB 1PG7W 3LKOB 3QUZA 2J56A 3SOTA 5T3XD 1XGRB 1KJ3L 1R5WB 2YZ1A 4NRXB 2FIKA 3WNPA 4XHJC 2X4RA 2H0JA 3BUBA 1NEUA 2IGFL 3ARFC 3OWEA 4DJMA 1OD9A 2V2XA 3UXFA 4Y19A 2HJFB 5IJCC 1THAA 3OB0K 3EZJB 4PP2A 1NAML 2BSED 1EU1A 1ID5I 4P3WA 5B3JF 1XDTT 4H88H 1TZIB 3QAQA 3N85L 5CCGE 3THML 2BSBA 2AF2A 3VYOA 1DQVA 4D94A 4OZIF 4OLUL 1HZLA 2O30A 1A21A 2E7LC 4OD2B 5D1XA 2IDUA 5EBMA 3ZTJG 4MDIB 5J6HA 2ZF8A 4XMKL 1EFXB 4AZUA 1MCHA 2EDBA 2EIMB 2KS0A 3G6DL 2OW7A 2D3NA 1T1ZA 4XN9A 1KV3A 1YNTB 1A3ZA 5T5FA 2VN4A 2BNQD 2OYKA 3MLSL 2XT1B 4BQCA 1QTYT 2YKLL 2GT9A 1J9QA 1SF5A 2E8YA 1T6BX 2DQCH 4TQ8A 4NQCA 3QNYB 1DBJL 3ASNB 4PG9B 4KROD 3VDBA 4DW2H 3QI9B 3QDMB 4N0CC 3MV01 1ULVA 2KERA 3WGVB 3QFJD 3A5VA 3TJHD 4JMNA 2G60L 2COQA 2IDSA 2R1WB 3SKOB 3IVKB 2OYLA 1S3KL 2Z1PA 3MFFB 1V55B 5D7JB 4C56E 1KTDB 1F90H 4K94L 1J9TA 2CUAA 4ZFOA 1CFVL 3HI5L 1KIRA 2R2BA 2ZKWA 2NY0B 3D50A 2Z34A 4AITA 1QAWA 1FNGA 2KI6A 2WNKA 4HFWA 5DK0B 3H9SA 3VRIA 3CBRA 4K94C 5F88B 4HDIB 1NGZA 4YVNA 3GTVA 1WZ1L 4N8CH 5FCSH 3MOQA 2R0LH 2YN3A 3PJNA 3UYRL 2YAQA 3GBDA 2UYLB 3PWPD 4UQAA 3VYPA 3WO4B 2NQCA 4O02L 3ZKXC 5AWNL 2VDQL 1PU0A 3EFOB 3LXCA 5BXFA 3VSUA 4A6YA 4N0FB 1AGFA 2W94A 2XN2A 5CUSH 4HZ1A 3EZ8A 1HCYA 5DJAB 3MBEB 3WSQL 3HHSA 1A7PL 4CRYG 1QW9A 1RU9H 4ABVA 1KELH 3CD4A 2AEQL 1YNJD 1JGEB 4CRPA 3CHQA 5HGAA 3K0WA 3BP5B 2HWZL 4ENGA 4UDTA 4YDVB 4U1KB 3I6KB 5H37H 3ZDZF 4HIIB 1QLFA 2ENPA 3LH9A 4GO6B 1H5BC 1X9LA 3MOBL 3LY6A 1RSFA 2WVVA 3L45A 3EO9H 2X4OB 3P3UA 4PJ5B 5BNXD 3D25A 3LKNA 5GJTH 1G8JA 4JFPB 3S3JA 1LL1A 6PAZA 3EYVA 4HIJA 1MXDA 4NFCA 4HUXA 1JPTH 3FQTA 4H1LG 5FYLD 2NW3A 1HXMA 1TG8A 4D0DB 1VKXB 3QCTH 1DCEA 4N2IA 4GFXA 2RA1A 3RI5K 1MIMH 4WKZB 1QA9B 4PRPA 3TYGH 1RZJH 3QQ4B 4QHKJ 3C87A 5JPNA 4HEME 3W3BA 3ARBA 1PLAA 5DMKB 1DUYB 2YD1A 3U0TA 1D5XB 1YO4A 3G08A 2RAMA 4QHNA 3U4BL 4LHQB 1INEH 1TZOA 2WLHA 3F84A 4PJEF 4XMLL 2X6VA 1S5IH 2J2ZA 1YAZA 4B60A 5HDBF 1PCSA 4UILH 3C60C 1LP9E 3K8LA 4YZFF 3DX9B 5KW9L 2IOOA 3MTXA 2VIRB 4RDQF 1OT1A 3DOIA 5GGVY 1U8MB 3L7FB 4L4TA 3CXHK 2HTLC 2MTAA 3CDCA 3Q2NA 4DMRA 1AC0A 1CT8B 3TT1H 1AXTL 5LAXB 1WCMA 1MCLA 1UZ6E 3C5ZD 1HE8A 5AD0B 3H85A 4LLDB 4NZUH 4R5TA 5IVXB 5JNYA 3L4VA 1PPIA 3ELQA 3NK3A 1MFBL 4PG2A 5IHHA 2CGRH 2VNCA 4B9GA 4F37F 1FGNL 1MRCL 1NEPA 1Y7VA 4U3XA 1W8EA 4UDUA 3VXTA 1CF8L 1QABA 3C9NA 4N28A 4B3EA 3TASA 5I5MA 5L8LB 2HKHL 1OB1A 1TQCC 1BAFL 4GQQA 1SBSL 3H3PL 2OMUB 4JY5L 4JK0D 3GMQA 4U1GB 3V4LA 4A39A 4R84A 4JKPH 4JB9L 4RAUB 4YXHL 3LZPA 1IGFL 4KHTH 3C5SB 2X2IA 2XHNA 5KN5A 4XCYA 3QBTB 2YR3A 4QRPE 3S5YA 1ND0B 3BHBB 2UWEF 5EPMA 2FJGB 2O5ZH 1Y1UA 2HVJA 1JHKL 3L3GA 4GMSH 3B3IA 3EGXA 3ESOA 1UCTA 4WLCA 1TCRB 5IHZB 1UM5H 4LRIC 1FCCA 4DGVL 2DQFA 4HJIA 1QLEL 1CBJA 3QORD 1SMOA 4QRFA 3IJEB 1ESOA 1T3FB 3VVVA 4MAYD 4GSDH 5BRZA 3FT2B 3ENGA 1DQMH 3V5DA 1FHNA 3OG6B 1MQKL 1HAWA 2D7OA 3PWJB 4PCYA 5IBUG 5C0BD 5T3ZL 5B39A 4KRPB 4JM2B 1FCGA 1FN4B 3FH8A 3MNWA 5GRUH 3K0YA 2BVOA 1N70A 2WUCH 4ZFGH 3ELAT 4DP2X 2XVGA 3U82B 1FLRL 4YHYB 5HI5C 43C9A 5F9JB 2BSRA 5GGQL 5DHVA 3V9EA 5HHOA 1A6PA 1YCSA 4KMTL 1RUKH 3SY0B 2R1YA 2VLME 4MX7B 2X9ZA 1THCA 3K72A 1AD9B 1JGDB 2QJDA 1GZPB 4WV1C 5D4IA 3DETC 1CICA 4D8OA 5ACZB 1UVQA 1B4LA 3KXFD 2HPTA 3HG4A 2NY2D 3V2AR 4G1EB 4P2RD 1C1EH 3KVQA 1GOHA 2AJYL 4QJ5B 2VKWA 5LXVA 2NSXA 4Y1AB 3HI6H 2GUOB 2OCCB 4FQHA 4JRLA 2OK0L 3TM6A 1GGBL 2CKBB 2B39A 1HL8A 4M62H 2WCPA 4BFOA 5HTSA 2IAMB 5LLIC 2F68X 3VCLB 1D5MA 1V3LA 4YFDB 4XAKE 1P5VA 4FNTA 1XCXA 4KNTA 3HMXA 2DQJH 3U46B 4KJPD 5M95B 5EF2A 3RA7H 4NKIH 4X9YA 3R06A 4OGYH 4LCWB 3RB7A 5IHWA 5KBDA 4HKJB 1KGXA 4P23A 5CS7A 1P6FA 4BZYA 3VXUD 2WLMA 3BH8A 1SJMA 2F7QA 3VI3E 5F72S 2MOVA 1JI1A 3U0WH 3GMNA 2GJ6E 3QPQC 5BW7C 4N2CA 1FFNB 5SWZD 3L1OH 5LXGL 1QCSA 4MMXA 4W93A 2J6EA 4FQ2H 4J3OG 4A7SA 4FQPA 5EH1A 3VE0B 3VFWA 3UH8A 1P7QB 1M6UA 1XSIA 3ZTNL 3DX3A 1FA4A 4L3FA 4LLYB 1R3KA 4GIPD 3JWNC 3L2MA 4MMZB 3N1FC 1FZJB 5I23A 3AG3B 2WSDA 5EN2B 3F7RA 5B3SB 3BZ4A 3FTSA 4Y5XB 4MTMA 4UV4H 5INDB 5K69A 4GBXD 3HBPA 4W9KC 1QHOA 4IHBA 5BVPL 2ZG3A 3VSVA 3S98A 2PJHB 3CN1A 4FNPA 2DIAA 3QDAA 4ZMOA 3NCJL 2F54A 1OGPA 4IDJL 5DRWB 4PY8J 3QQ3B 3GNMH 4Y16A 5TJWK 1M7IA 3GXUB 3VFSB 4LDEB 2YGOA 4M3JA 2PO6A 4NWTH 4AC2A 5T3XE 5HD8C 1HHIB 2DV6A 4BQ6A 4CMHB 2CIIB 3VI4E 2WCSA 1AGCB 3AG2B 1T0PB 4FAAB 5D1QA 4G7YL 4NO0B 3ISWA 2A2QT 3CNKA 3RL2A 1OE3A 3SBRA 1D9KA 3DDFA 3ARDD 4HJJH 3BP6B 2GVYA 2PWFA 5I15L 2QSVA 5A2AA 4OLXH 2ZNXA 3WV0A 3HLAA 3JBG7 4M7ZB 1C5CL 1NCHA 2R56H 5DWUL 4Z7OF 1JK9A 1YUKB 4L8BA 4P3CH 4DUXA 2N7BA 1AS7A 2JELH 4HS8H 1RVFH 4IMKA 5JPMC 4K5NA 1OAJA 2C9SA 3U1PA 1IX2A 4NWUL 4FYRA 4OZFG 1A0QL 1XGTA 4ELMB 2DY2A 3OZ9H 2BNQE 2XJKA 1KXTA 3U7YH 4D9LL 5L7XH 1OGYA 2WO3B 1BLNB 1NH6A 1Q0XL 2NRDA 3MRKB 3FHAA 2YRLA 5D7IE 2CLZA 4HS3A 3GRBA 2OL3B 3VFTB 2KQNA 1GTNA 4M3HA 4LSVH 4HIEA 1RZKL 4QOKB 4R0LA 1HILB 2WWKT 4MZIA 5EBLA 3NRQA 1NCAL 4OLVL 2R39A 2Q5BA 1M7DA 2IQAA 5DD6A 3APCA 1MFNA 1AQHA 3R7RA 4MA8H 1BXAA 3AAZB 3HN8A 4PSPA 1RZKC 3EFDL 4IU2A 3J07A 4KHXL 4HWUA 1F58H 4RIRA 1JWUA 4NNXB 4ZSOE 2JKLA 3NIDB 1AE6H 2EC9T 3H7BA 1AHWA 4U6YB 1MW3A 3QT2A 3HZMB 3CSPA 5DLLA 1FL5A 4IJ3B 3BZDA 5C08D 1QATA 1MCCA 1U4FA 3L1FA 4HHAB 3MGTA 1U91B 4ES8A 2KBGA 4J39A 3AXLB 3DA0A 1ZV9A 1TKWB 3MOAH 1WAAA 5DYIA 1IBZA 3WS3A 3SE9H 1N5AB 4N9GA 2YXVA 43CAA 2XWJB 1TEFA 4I85A 3RL1A 5ISZE 3HZYA 3RGVA 4DGUA 1HSBA 3OG4B 3QGVA 1B0RA 1ONQA 1JBJA 3VG9B 2VERN 5EUOA 2AFNA 3UTZB 2D7TL 4OCRL 1QRNA 3QUYC 1EHNA 2YSSA 2ZUWA 3Q5TA 4ZYKA 2RMNA 2DJUA 2JTDA 2DKUA 3SDAD 2N56A 1MF2L 1UKTA 4DGIH 4MSWA 3QAZB 2Z9TA 2W38A 2NXYB 5KVDL 3Q2CA 4AYFB 4QHKI 3NTCH 4WWOA 4WEMB 3HNVH 3NCMA 4O00A 1F97A 4XB8A 5KSAD 1T03L 1P53A 1QKZL 2XNAA 2ZYHA 3H4FA 4TOYL 4ZUUA 3RWEB 4XX5A 1NCCH 1OE1A 4ALAL 1BVOA 1K4DA 5GPRA 1ZLVH 1BGXL 2E3VA 3VGAC 5I1GL 4F2FA 4I0CC 1XGPB 3H2QA 3TO2B 4FMKA 3CUPA 1TVBB 1G6RH 2QKIA 2X38A 5EC2A 1FPTL 2PXYB 1WZMA 3MR9A 2Z91B 3QPXL 4OFYA 4UQ9A 5D70H 4PREB 3FSOA 4FQCH 4XPGL 4KTGA 4PMFA 4RMRA 3O0LA 2C9RA 1R27A 4BH7B 1KBGL 3TLRA 3OAZK 2XQBL 4AGOA 4MQTB 4FQLL 2Y7QB 2OZ4L 4NP4L 1CYGA 4EN2A 3X13B 5M7QA 3D18B 3NIGF 4FI6A 2E7HA 3A4FA 4G6JH 1DQKA 2ITFA 1AI1H 4O4YH 1C9SA 2HT3C 1N67A 3W0WE 2X4SB 1KC5H 1N6QL 1C08B 1F1DA 3FB6A 4XBGA 3WIIH 4ZMVA 5IR1A 5DQ9A 3F3HA 3QR0A 1DBBH 3HHRB 2WTRB 3RJDA 5TE4L 5FTJA 2FL5B 5KVDE 2ED7A 3X2HA 1YMMA 2J5WA 3AM8C 5FUZH 5IM7A 1N7ML 4FZ8L 2IPKA 3P2DA 3STLB 2JJUA 4XWGH 4PS8A 5ES4B 3OF6A 5B8CA 2CDGA 5IW6B 4M6OL 4JFEA 3TZVA 1QEWB 4LEEA 1P9MA 2ROXA 5FA3B 3CN3A 3TBWA 2AXGB 3VRJB 4QKTA 2WUBL 5DUPL 2E7BA 1UURA 2IWFA 4HUMB 3UTQA 1WBXB 4JDEA 4HK0A 1KB5B 2NY4B 3WAKA 1J0IA 2A68D 2QEJA 4PJXE 5E7FA 4KVNL 4AK2A 1PT1A 3Q2LA 1CQYA 4DPCX 4DP5X 1JV5A 5I1LA 3P0VL 2D7QA 2GABA 1HHHA 3BVXA 3MLXL 3TV3H 4ERSL 3BSZH 3S5LB 5CJOL 2WSKA 2B9BA 2X1QA 2BM3A 5ITBL 1BOGA 1RK0B 3DRTB 1JE6A 2AXFB 4XMXA 3HW7A 1XSJA 2XV0A 3GGWA 2X4PB 1E18A 2HFFB 5FOBA 2FO4B 2C1PB 1OZTG 4MZRA 1RFDH 3II2A 4NQED 4OCXH 3MKKA 3MLTA 1NEZG 3O9WD 4WHTA 5F7DA 3C6SA 5MEQA 3LN5A 3VWKB 3P4NA 4MCYB 1WIOA 1T0MA 3HNTL 3PWVB 3WE6A 5C0RH 1F4HA 3UP1A 2CO4A 2O26U 3DIFB 4BFKA 5HYJA 5CGYD 4OUUB 4UI2A 2GC7C 3ZRSA 4MXQD 3BYYA 5JW4N 1N10A 5DO2C 4JY4B 1AFVH 5C3IA 2N7AA 2L7EA 3QCUH 3MV8D 4XVJL 5D9SA 5FW6A 1KFGA 2EEOB 2KPWA 3IWUA 5KSBA 1JGUL 3LQAC 3MRLA 5BZDA 2V8MA 4L23A 1Q0YL 5CD3B 1D5BA 3FUKA 3KJ6H 2ZAHA 4WJG3 4G9FA 1SJEB 1O6SA 1QBMH 4DEWA 5LGJA 4R5VA 3B2DC 2NY0C 1QHQA 2BLFA 2YLKA 3MXVL 4WI6A 3D85A 1A47A 3I02B 4BQ8A 2AEWA 4PV8A 3F62A 2A9MH 2AQSA 3MLZL 4ZDHB 4M43L 4GSRA 3LZFL 3AQDA 2FCBA 4ZQKA 1GJUA 3AQXA 4AIXA 1K5WA 3KXFE 4R7VA 3FYEB 4B53A 3RTQA 1R3IL 4OF8A 4YZWA 5I19L 5JQHC 4XI5C 2VRQA 3CFTA 3V4UL 1BXVA 2ICEC 2JIRA 3RNKB 4FFTA 4E0RA 1DQLH 3IN0A 2BIOA 3MZGB 4N1CA 5FFGA 1J8KA 3RLSA 5DC2A 1ORSB 1H8NA 2EEFA 1YC8A 4FG0A 5F71A 3OQ3B 4CDGC 2DKSA 3CZUB 3QDME 2CLRA 4E41D 4FABH 1QR1B 3OKDA 4JZNB 4X98B 3ILQD 1L6PA 1QVOB 2YD8A 3K6SA 5AZUA 3UG4A 4ZX5A 3KPRA 1BYOA 1E4XI 5HVGB 3IJ7A 1KJ2A 5ESQB 4QY8A 1ES0A 4GAAA 4UB0L 2VQ4A 1XHHA 1RJYB 2HT4C 2L7JA 2BJMH 4YS4A 1WQVT 1J0HA 3EJUA 3TF4A 3KR3L 2ZWSA 4I4WA 1A6AA 2AP2A 2DLIA 1HEZB 2X5PA 4KFMA 1E7UA 4LSPL 3QR1A 3DPDA 1W9XA 3UDWC 2AK1H 1SFHA 3V6FB 2I7SA 1ETA1 4MD4B 2A77H 4NQSB 2QQLH 4NNPH 3S9DB 4ZNEA 1U3HB 2J4WL 3PUCA 3ZGHA 1E4WH 2N1TE 5A7BA 1LK3H 3B2PA 2BP5M 3TA3C 4QPEA 4NFBA 4TVPH 1M1XB 3DDGA 4M5ZL 5IEKA 1G43A 2XVBA 3QZWG 2J1YA 2XWZA 3G5XB 3K6NA 4NO2B 1IGYA 5AOMA 3CDYA 5D7KD 1PYUB 1F00I 4ATTA 2EDQA 5EBGA 3X2NA 4RZKA 3DJSA 5DJ6A 2P7TA 2IBGA 1VESA 4HV8A 2V9TA 1ACZA 4YHPA 3VWJC 4AAYA 3B6SA 3D69B 4E68A 2GCYA 2ZOWA 5EZJA 2PR4H 1LP9F 2UZYB 4RETB 2A0LC 2CA4A 3O6KH 2BNRA 3LZRA 3NIFE 4HJGB 4V1DD 1I1FB 3ULVD 2FWOA 2ID5A 3MJ9A 3WIHA 4FFVD 4KDIA 1L3NA 1UYWH 4WHYH 5D4HA 1BM3L 5EFIB 3D30A 3PV6B 1HOCB 1BD2B 4A2FA 1UZ6F 4RWYL 3KYKH 3Q9QA 1IGTA 4H5SA 3SOBH 3DTDA 1W0WA 4JPSA 2CHXA 3Q2VA 3R18A 3SJVD 1GHFH 3GXPA 4GSXA 2KC0A 3DLQR 3EJYC 1L6ZA 1YHPA 4M6ML 4GG8A 2QLYA 3ZQ9A 3QIUA 1C5DA 1CUOA 5E03A 5HJDA 5EULV 3ZYIA 4BCXA 4M1DL 1EJOH 5IW1A 1XR8B 4F1ZA 3V0DA 2YN5A 3RPBA 2QELA 3BGFC 4FL4B 4DFHA 2ZUVA 1SXNA 4XAWH 1D7DA 4NOHA 3QIWB 3N6YA 2P3YA 4I8DA 4GRWB 4XE0A 4X8XA 2X4NB 4FFYH 3B9KB 4ETQA 1U21A 3FQUA 4L9LA 1UWGH 3DNKA 4J3UA 1P4LA 2HRGA 5DRNA 1WC7B 3FO0H 2ZCLH 3MCLL 3ZMNA 5C0EA 4GG6A 4CN1A 5AVSB 4AT6B 4Z7NF 4FEIA 1E3ZA 5DUBA 1G4RA 4EJ1C 5CU9A 3MUJA 4HBCL 4PVBA 1TO4A 5DURB 1Q9OB 4LVOB 1JPGB 4NHCH 2V2WA 3DUSB 5I8KL 5I1JL 2ADYA 3SYQA 1JVKA 4N1EA 1IC1A 1OSPL 3FBKA 4MJ4A 1LK2B 2HP4A 3QXDB 3P77B 4Z0XB 4HWBL 3UBFA 5DDHA 1IFGA 1EGJH 1ZS8A 5EG6C 1LO0L 3FTWA 4Y2DA 3IDYB 4L1DA 3WFBH 2WWKO 3D4GA 3MRDB 4LVHC 1IGCH 2EE3A 1K8IB 1OAZH 4KUCD 3TEUA 2FH8A 4NQXB 1TQSA 2RALA 2ICWJ 4NUMA 4X6CB 5BZXA 1PW3A 4CA4A 2F53A 1Q94A 3SPVA 2W59A 5DI8A 3UPCA 2FEEI 5J89A 4UTBL 1PZDA 3FQNB 1DBKH 1U8JB 3RP1A 4OLZL 1PJ9A 1WD8A 4A7UA 3P30L 3PJSB 4JKKA 2NOYA 5HVHC 1KQFA 1KBVA 4XX1E 1U2YA 4MD0B 3X2GA 1G7MA 4HH9A 1E6JL 4GRMB 1QFPA 3CZKA 5IBLC 5C0JA 3WHE0 3MYJA 5CEYB 1KJ3H 3UTTD 4J3SA 4EUPH 4KH9A 2Z35A 4NM8H 5DZAA 4MB1A 4P46D 3ROOB 4ZUVB 2BK8A 2YAPA 3HC0A 4WDIB 3M8OL 2V45A 1HXYB 3IJSA 2KLSA 3P54A 2ZUXA 1KG0A 3EHBC 4HQQL 4M4RA 4WENB 1KBWA 3FTVA 3Q7JA 3DJZA 3MCG1 3N85H 2CHZA 3THMH 3PWLA 1CURA 4H0HB 4OLUH 3KGRA 4Y4FC 1NPNA 2DBJA 2QQNL 2Z3FA 5C0DB 3E8UH 4WGKA 1SMDA 1BZ9B 3VI3F 3L5JA 3QUHA 3FUJA 4JFFD 3QUGA 4LIQL 3S3CB 3F7VA 4AMWA 3WOVA 4JQIH 2DQUL 4Y1AE 2BP0B 3HG2A 3KBFA 3ZRCC 3A6BL 3G6DH 1FHGA 1MIEL 3WG7B 4EEEA 4E5XG 2AHIA 2X9YA 3FOMA 5T5NG 5CILL 5HI3D 1KXVC 1E3XA 3MLSH 4PRAA 4CADA 2YKLH 2EXTA 2VC2L 3M7OA 4R90L 5JHLA 5TQ2L 3RFZB 1GZHA 4JPVH 1WFTA 5IQ9A 1DBJH 1W8OA 1MFMA 2YZ8A 5DJ8B 1J5HA 3TYFB 4LCWE 1RJLA 4G6KL 5L4MA 1EHLL 3G9VA 1CFNB 3GIVA 1SVBA 1LTXA 2BXYA 2G60H 5KS9A 3UZQB 3VFMA 4CMHC 4EIZC 1Q90A 1SM3H 1S3KH 1EH9A 1IUZA 4K94H 3Q06A 1HC1A 1CFVH 2QDWA 1P1ZB 3HI5H 3HFML 3VI4F 3ZZQA 2GIXA 3LNIA 4AVRA 4YBHA 1JCKA 2FR4B 1O75A 1FSKB 4XXWA 4Z78A 1Z3RA 4MQSB 2F08A 3DOSA 4G6FB 3V4VH 4OZIA 1BFVL 3L7EA 3UYRH 5FWRA 3K1DA 5ANMB 5GGUB 1FNLA 3UGEA 1Y07A 2E27L 5E70A 4YLBA 1G8KA 5FGCB 3HG3A 5DJ2B 5AALA 4FHJA 5A43C 2JKNA 5CFAA 5DVKA 1K8DA 3LKRA 2OL3L 3CFBB 3GBML 4Q9RH 2Y36H 2AEQH 4JFHE 3FRPA 2NY3D 2LR4A 2V2TA 3ATAA 2YBRA 1YN6A 1GAFL 4L3ED 3L5XL 5DVMA 3ULAB 1Y1DA 2CHDA 3BP4A 1RLBA 3MOBH 5FKAB 2I32A 4PJDF 1YLEA 5EU3A 5D7IF 2J8UB 4XN7A 3GIZH 4R7NB 2BFVH 3MV8E 2JCCB 4BJLA 2J43A 1GPOL 2YA0A 2IANB 4L4VB 5CIPB 2NY6D 5H37G 5AAPA 4KNSA 3LD8C 4AZDA 4LVNB 3QHFL 1PYWB 2C3XA 1XSOA 2TRYA 4N2EA 2RCSL 2H9GB 4Z5RA 3WMQA 2YOAA 2J8HA 5ID1B 1QW8A 4NKMB 4TTDD 4IHOB 1SLUA 2QHRL 2W0LA 4IJ3C 3OR6A 4DZ8A 4K7FB 5HHMB 4ELME 2MPAL 1XIWA 4N0YL 2NY7L 5E8NB 4AKQA 2EEXA 4X0KB 3IR5A 4XMLH 1DVUA 4WW2B 1U0QA 4LPTA 4ZZKA 2JMRA 4GLRH 2JJTA 3HI1B 3RVUD 4RGMC 5CLZA 1IEAA 4K0OA 4ZW3A 2Z8SA 3EDDA 2EDOA 4LESA 4PCTA 3X12B 4OF5A 5AW4B 3L4YA 4QOKE 4JDVB 3U9UA 2V0AA 4L5FE 1AXTH 1MFDL 1OHZA 3RQ3A 4X5WA 5D6CB 1AW8B 3GINA 1W91A 5E6ID 3CFKB 5F89A 1YLBB 1O9WA 4FG4A 1L7TL 5DC9B 3V9CA 4ZD3L 2H3NB 3NIDE 4HC1A 2C3WA 4F9LA 1CTMA 1FGNH 1MJJA 1MRCH 1QSEA 2ZKXA 1M4KA 1FNEA 3DXAD 1EMTL 3QJXA 2XICA 4PJIB 3L3OA 3EBHA 4XTRC 3VFVB 2VN7A 3DRQB 4XNXL 2FVNA 4XP5H 5D1ZC 4CU7A 3BFQG 3TVMC 4JY5H 1BAFH 3RG1C 1SBSH 3H3PH 4FXKC 3I2CL 3CXFA 2PXYC 5DD1L 5DTFA 5B22A 4YXHH 4TNVK 3L6FA 3RWDA 2NZ9D 4UM8A 4UTAA 1SF3A 1QI5A 4N2MA 1OK8A 2LLLA 1JPFB 2VLJB 4FCHA 5I9QB 3BO8B 3WFEL 4AMKL 4PLKD 1BEXA 2KPNA 3ILEA 3HE7A 5SX4I 2CO2A 3M7FB 4PJAF 1OANA 3QDGB 4I0PD 1EK3A 3BKCH 5HBBA 1F3RB 5CBAA 1BG1A 1MVUB 2ZCKL 1UJ3A 4ZPVB 1GS7A 3HE6B 2A9DA 3WIFB 2EC9U 1MH5A 1QLEH 4J5VA 3ZIYA 3EG9B 2DQMA 1LEKB 4C4UA 2CZNA 1IKNC 4V33A 2VDNL 1HDMB 5AUMB 1EIBA 1S7QA 3ZSTA 2MOGA 1BP3B 3V7AE 2JQAA 4EXKA 3B9DA 4PWFA 2KZBA 1DL7H 5KYUA 3OKEA 1MQKH 3MUGB 5T3ZH 3VM5A 2UUDK 1OKEA 3KDPB 4V1DE 3TXAA 2DYRB 1CFBA 3L9YA 4ONGH 4I9WE 3ARED 5HHPB 1M71B 4ZTEA 3BSHA 1P7KA 2FLMA 1RUAL 1ZHBA 1CMOA 3CSBA 5IV2B 3BVDB 3O4LB 3SJVE 4JFYA 2J73A 2ZYSA 4UT6A 3S2AA 2PCXA 4FXGB 2CK0L 3GJFH 5GGQH 4G43A 2XFXB 5DFAA 2DJMA 2Y5TA 4G11A 5HHNB 3X2OA 3MRPB 1M7UA 3KLQA 4POUB 3TL5A 2B9AA 4MD5B 1VZGA 1YN7A 2BNUB 3SDCA 4RGND 3QUKB 1J1OL 2PPDA 4WK4B 4PGCB 3VNZA 1OCCB 2B2XH 2J1WA 2EXYC 1FUNA 4PJXF 1MCOL 2XWRA 4R2GC 2VXQL 1H15B 4HF5L 5I6NA 1N68A 3BE1H 1J8RA 2VMEA 2WLNA 3IDXL 3PAUA 3WXVL 1BJ8A 4GXUN 2AJYH 5CLTA 7TAAA 1JZ2A 3IMWA 4B7LA 4L05A 1NCGA 1HSAA 4QO1A 2G0LA 4J1UB 2OK0H 3OSKA 5FUOL 4B9CA 1IAMA 2GITA 2GI7A 4PSRA 3GSNB 1E8XA 3VWKC 3KYOB 3FSAA 2XV2A 2YAHA 3SSGA 3P11L 4LGRB 2JJWA 2AMUA 3QULB 3ZLQC 1T89A 3QNZB 3HNSL 2A6KB 5DHYB 2FATL 2IMMA 2BSSA 4H40A 4FOMA 3GKWH 1H3GA 1GYWA 4R26H 2PYFB 2ICWI 2KZWA 4OCWL 4LL4A 4PU2A 4XVUC 5I17B 2WKLA 1MW1A 3ALPA 4XPFL 3JWNH 1NCJA 2ATKB 2GTZA 4BSWA 4X4ZA 1Q9LB 4PW3A 5IOPA 4HCRA 1OSZB 3UTPD 3ZTNH 2YPLB 4NENB 1EWHA 1V7ML 3GMMB 5IB1B 4R7XA 4XZUB 3DHPA 5DD5L 5J11C 1ZAGA 2ZAIA 3SKUD 5F7EH 2XG4B 1F18A 5C07B 1BF2A 4UIMA 4B9KC 2J25A 4FKEA 5MERB 3DX8B 5KBPA 3IJ9A 1F6FB 4FGMA 4MRBA 4WK0B 3ZKSD 1YPZB 1YNTF 3QUXD 3RPKA 1F1AA 2VITB 3JT0A 1BVLA 3K6OA 3DO4A 2AAAA 5IB5A 3BZFB 4OB5L 1IM9D 3WEXA 3WN6A 4NZTL 1A1MA 1T6WA 1QNIA 2C3VB 3RE0A 4ELKB 1X5JA 4N4YB 1ZTMA 5MENA 1OV8A 1TU2B 4H1LB 1R1CA 3ZT6A 3K1KC 4XT1C 4H26A 1N5YL 4AYBA 4P2AA 1JZIA 4G7YH 4LEXL 4TUOB 4WWKB 3N40F 3AFLA 1CLYH 4FYQA 3CU1A 4Y5VB 1WZLA 2FJHB 3RX5A 4RQQB 5I15H 2DTMH 1RPKA 2GK0B 4GI8A 5E9DB 2EAEA 4F7EA 2ZKHL 3FUDA 3H9HB 2H6UA 1FZOB 1C5CH 15C8L 1YVLA 2FYVA 1J5OL 5DWUH 4LT7A 5CSZB 1XSKA 2A3TA 3LIZH 3VXSD 1MCIA 4W9JC 1UFGA 5D7LA 1OPGH 1PQFA 1KGWA 3K4DA 4YFLF 1HZHL 1SDDB 1HAUA 2NNAB 2IDFA 3MLVL 1XEUA 2JJVA 1AZZC 5T1MA 1A0QH 1ZK9A 3I75B 2B5IC 3BWUC 4PS7A 4PRHD 5BRQA 1WFUA 3QPKA 1AGDA 4LHUB 3W9DA 1H0HA 1KNOA 3FUEA 2R59A 2DWDA 5HJBA 3N44F 3NSJA 1Q0XH 1OGTA 4JFDA 4MDJB 3VTTA 3FO2A 3IEAA 3BSZA 1BZ8A 2VYRE 3IAQA 4M93C 3IDJB 1HH6B 5H94A 4MA7L 1DDHA 1RZKH 3INUL 2BC4B 1K4CA 1WHPA 3QEUA 4YXKH 5IQLA 1VADB 4J4PC 2HVBA 3VXNA 2R9HD 5B38A 2CDEB 4KODA 1KPUB 1NCAH 3QYNA 3VXRD 5TTRA 3WDJA 2KZKA 4RNRA 2WMPB 5ADPL 5BMFL 3UTSB 2NDFA 3HRZC 1R19A 2NNCA 2DM7A 3D1MC 2CRYA 3QWOA 4OFIA 1ZKAA 4W70A 1WCBB 3CK0L 1K2DB 1BPVA 3SE4C 3HAEH 4KK6D 4X99B 1KYOJ 3T4YB 3NIFF 1HIML 3C2SA 3PXLA 5LGKA 3X3GH 3UTOA 4D0CA 1HYSD 3CVHA 2Z93B 1T80A 4JHVA 2PABA 3H8NA 5ESAA 2DYPD 1I3VA 3FB7A 3SYPA 4ELDA 5CEZH 4Z8FL 4HKBB 1A7QL 1LQBC 4NOFA 1XL6A 1HWHB 2ZOUA 3BKML 3NOIA 3DSNB 3QK0A 4OCSL 4OGAD 5ADOL 4AQ1C 3T2NL 2APBA 4AG4H 2DTSA 3WS6A 3Q1EA 4IGBD 5IBUB 3BPNB 5C0CA 5EZPA 3KL5A 2D0HA 3IXAB 3RIAK 5IB2A 2LLNA 5L9DL 4L3EE 2UY7A 3IETB 3P9MA 1I9RH 4XO4A 3SCMB 1MF2H 3KPOA 1AZCA 4AH2B 3KYNA 1UUNA 3QXUA 5JW4R 1MCBA 2FO8A 3FTZA 2NT1A 1ZLWK 4YNYA 3PWUB 1Q8MA 1N4XH 1RZGA 3FBQA 4JO4H 4APQA 4AMXA 3UPRB 1BD2E 1T03H 1BBJB 2WKGA 1QKZH 5I0WA 3FQRB 4NP9A 4W9EC 1W72A 4TOYH 2R23A 4ZW7A 1MI5A 4Y7OC 4XP4H 1B0GB 1N8OE 5I1GH 1HTYA 5C0AB 3FTUA 3O6FC 3MMEB 1OARL 1HT6A 1J8HD 1NOLA 1FPTH 3QPXH 3UZVB 3IWVA 1MLCA 3O2VL 1DUZA 1SFDA 2VR8A 1O5DT 2WINB 1GVIA 3WJMA 2OULB 1PZUB 2F7RA 3FU5A 3FHQA 2MNJB 3QEGL 3V95A 1KBGH 2JB5H 1UT1A 1XTMA 2XQBH 4PJGA 4GW4B 4JRYA 1DFBL 1U30A 4FQLH 4U05A 3WCYA 4KK5C 4LPXA 1CGTA 2OZ4H 4ZODA 2GQHA 1NL0H 4NP4H 1YQVL 4GRWE 1GGTA 4OGQC 3P9LA 4BFRA 2ITDB 5K5YA 4HS6B 3H53A 1WFMA 5F8QC 3UG3A 3OXRB 4LMQE 4Q6IA 3PL6B 5DJZB 3KPMA 3Q8AA 4HD5A 4TUJA 4X6EA 1A2YA 2UZPA 5DQJA 5JZ7C 1N6QH 5E00A 5IQNA 2Y7SA 3D09A 2WO2B 2Y7OA 3MRGB 1M2VA 4LPCA 4PRBB 4B0MM 1Z66A 2E6QA 1CDBA 5TE4H 2G5RA 1BQUA 3WD5H 4A2LA 1F4YL 3QRFM 4EQ2A 4UZUA 2XJLA 3I3EA 2X89A 1EZVX 3UAAA 3U9WA 4F2MB 4XP6L 4JM2F 4M6OH 1CI3M 2OX5A 4NDMA 3FMGL 4IS6A 3O4OB 4P2OB 3P0GB 1CXEA 3G9AB 4BWWA 3HBGA 2WUBH 1PG7X 3ALWA 5DUPH 1V54B 5IVZA 3RX9A 3OKKA 4WI9A 4ESKA 4KVNH 4Y4HB 2OV0A 4X9BA 4TRPL 4G6MH 3T6XA 3KWWA 4X6CE 2G75B 2QFRA 1PQZB 1CPUA 3IXTB 5CJOH 3VGHA 3VJ6A 3MV9D 4XN8A 1WYJA 5ITBH 4GQRA 2WKOF 3VH8G 1DO6A 2XKNA 4KXCA 4XMZA 2PPFA 2UVFA 1AKJD 2YD2A 1DLHB 4IRSB 3IKCA 4FTVD 5CKAA 4LBEB 5DWPA 1PBYA 4P4KB 1RLWA 4IBQA 2FLRT 4JZOB 1I8KB 1NZRA 1I3QA 1VJSA 4ZOAA 4CILA 1T1XB 5DEZA 2VWEC 4KOBA 3KPQA 2BWDA 4LOFA 4X6DA 1GR7A 5DD3L 3LQAH 3L3HA 3E6FA 4JKWA 3NYKA 2V8LA 3WNLA 4UM9A 2CMRL 1I3GL 5I1AA 2YPVA 4CC4A 1OW0A 2CG9X 2XC8A 3ZX1A 4Z7VB 5GGRA 4XVJH 1ZEAH 2FD6L 4FFYA 3GPSA 5KYNA 1HI6A 4MQXC 1UOKA 5GZOA 1Q0YH 4M6NL 5I76A 4XMPL 4H25B 4QXUH 4GLRI 2ZD0A 5INCA 1XR9A 3MXVH 4XODA 2CM5A 5B4MC 5CJXA 2DQDL 3MLZH 4CGTA 3CQQA 4M43H 4RGNE 5KBLA 4PVNA 1Z5LA 1U8OA 3LZFH 3RAJH 3IAGC 4HWEL 4OGXL 2D3JA 3GSUA 4P2QD 1ASQA 3BQUB 3QUZD 3Q3GB 1H8SA 5JDSB 1R3IH 3T5WA 2HFTA 5I19H 3V4UH 4EN3B 1MOEA 1KTKE 2EDLA 3DVGB 5CFHA 2AV1A 4QXTA 4AQZA 3F65A 4XOCA 4PBWD 2ALWA 5CP3H 4XGZB 4OCNC 4F7CB 5DEFB 3S37L 3W56A 4QT5B 3EJRA 5IMMB 1BMZA 1BFOA 2ZX7A 3RKDC 3S2CA 4IDLA 2XG5B 5E1GA 1WCQA 2PPCA 3DYMA 4ZT1A 1WZAA 5BZWB 1EZVY 3ESVF 1GYVA 3S88L 1I7TA 3N43B 3FOLA 2VTFA 2K1MA 5D1XD 4XCNA 2XY2A 1KPVA 3O3EB 3SUKA 1BX2A 3C8HA 3IJ8A 3JZ7A 2XWXA 4UB0H 1HHJB 1SLWA 3C6LA 5GGVH 1U8QA 3SHSA 3ZMEA 1HU8A 3GFUA 3ZO9A 5IKCA 1YY9C 3AQZA 4IBSA 4GYBA 1Z6JT 1F56A 5T1KB 2Y7LA 3IE4A 3KR3H 5PAZA 2KDYA 5BQ7B 1S7WB 4WHCA 1AO7B 4LSPH 4MB4A 3QEHA 2OMNA 1CN4A 1LMIA 1CU4L 3WJLC 4YBLC 4NM4L 1RP9A 2APVA 2QADB 2H41A 5FGCE 2DH3A 4LF3B 1U3JA 4NQCD 5F7NC 5D8JL 3U6RA 1WK0A 2Q76A 4UUJB 3MLRH 4UNVA 2JKSA 5DJ0A 3CAFA 4ZBJA 5EO1B 1NAMA 4PWKA 1FWXA 1BQ5A 4M5ZH 1Q9WB 4QRTA 5D96B 1IBDA 2VDKL 3AABA 3EF7A 3BEVA 4LAQH 2DZEA 2JKWA 4ELMF 5L4FA 4Y4KA 3IR7A 4YX2L 3P0YL 1TENA 2K9UA 1AA6A 5C70A 4TUKL 4AYDC 2FO1A 2IAAC 1FYTA 1KXQA 1R24B 2H5UA 3H9SD 2YPKA 3OC5A 5GS0D 1SQMA 2MKLC 3CCHA 2IANE 4L4VE 1AC6A 2UVEA 3PXJA 1WIPA 5GRJL 5HPOA 4HIHA 5L2KB 4I18A 4OQTL 3CMGA 2XIBA 3ABZA 4KKQA 1BM3H 4B3VA 3M86A 3ECUA 4M00A 4ZAKB 4TSAH 2IXQB 2EIZB 3BN9D 3OJVC 4RWYH 4R96A 1BZ7B 3BCDA 2KLRA 3EYSL 4ZZFA 1YEGL 2P80A 3EADA 4I87A 5FO7B 1XZ0A 3LEVL 2VQ1B 3R0MA 3BJLA 2CCLA 3FUFA 3NIDF 3Q5YA 3T65B 1NGXA 3VXSE 1NFIB 5DRXB 3QNXB 1NQBA 3TBTB 2UXTA 3UMTA 3SQOH 4N8VA 1FL6A 1D6VH 4WGVB 4NUJA 5ABZA 4CC0A 2V7HB 4M1DH 2V3VA 5HGDB 5F9WC 4OZ4A 1WBYB 1MCWW 4PMEA 1LGVA 1SHWA 4FLSA 4F3FB 1WWCA 3QQ9D 4PJ9A 1FL3A 4J6RH 5F3HB 3MV7B 2CD0A 4HEMA 1QLRB 5FIEA 1E3FA 4HULB 2JWYA 4ZUWA 5I16A 2J1XA 4DESA 5IIEB 1HL9A 4JRWA 4O02A 1KZQA 5IJKC 1RZPA 2DW5A 4YPJA 5JLZB 4PRPD 1Y18A 5AAWA 3RWGA 2JNZA 3ARBD 3QQDB 5GGSY 2HTKD 1ZLVK 2OQJB 1LP9A 4LKCB 1GL4B 1DSWA 1E9OA 1A6TB 1I7RB 4X83A 3TWCL 4UIKL 1S9XA 2AV7B 4HAKA 5DSCA 5MP6H 5C8JA 5I1JH 2AJSL 2QGEA 2WYTA 3HU2A 3AQYA 3O2WH 3WKPA 5FB8B 5HHQA 1OSPH 1E0OB 4F9PC 4JQVA 4HWBH 4U6TA 1CQKA 1A4JB 3TJEL 2AGJH 4L4TD 5HYSG 3BP7B 3O11A 3UJJL 3CFDB 4K5MA 3NSXA 5IB4B 3QDGE 1P6AB 4BK5A 1E67A 5TFSH 2RACA 1U8PB 3ZY7A 1ET5A 5HYFA 4HJ1A 1ZA6A 5IMLB 3KLHD 1VFAA 4XOEA 4UTBH 4WFED 4MNHA 4EDWL 3BRFA 4KROC 1B0WA 1B90A 1YNLH 3GSNL 5I1DB 1L9SA 2AJVH 1AD0B 2NQDA 4H8UA 4OLZH 4A2GA 4L1BA 3P30H 1E9PA 1LVEA 3NT0A 1U36A 4QRPA 3TJHC 3ES6A 3F8UB 5ESVA 3VFRA 3U7AA 2P1YA 3NG5A 3TBSA 1VEMA 4R7DA 4BDVB 1E6JH 2VUKA 5E1AB 1PSKH 2CBQA 1DVFB 2V7NB 3EO1B 1MCQA 3CF2A 1FFPA 2AZAA 3B4NA 5C09B 3KEDA 3LAFA 3M8OH 4Z3GA 1JNHA 4NHUA 3O8XB 2R27A 3KG5A 4JG9A 3TIEB 2X10A 3FCSB 5GHWH 4F8LA 2H3XC 4UMGA 1CXLA 4EZLA 3MRJB 5E8DH 4ZS6D 4M9OA 1LYQA 2QQNH 4IEFB 5BRZD 4BM7A 1JHTB 3U30C 2WJ7A 1R9TA 4YO0A 4LIQH 2FH6A 4DF9A 1NMAL 2YMXH 4XCEA 1G7QB 4O2FA 4LCIL 4PEEA 3BXNA 3M1BA 1QOKA 4J3XA 4R9HA 4QAWA 2VLLB 5ABAA 5IGXH 2WVUA 1OAXL 3QC5X 1AR2A 1S9WB 3EBGA 2VC2H 2R0ZL 4R90H 5FYLL 1IEBA 2P5EB 5TQ2H 5JR1L 4ZK8A 5KVGL 4RA3A 4KKBD 3RBSA 4WTXA 2GSMB 4Y89A 1ED3A 5T5ID 3ZVVA 3WTSA 3K91A 3WXWL 5HHOD 1S7TB 4G6KH 2WZPA 4W9DC 4F7PA 4G82A 4WVRA 4F8TA 3AY2A 1EHLH 1G84A 4BFFA 2VLKB 2FJSA 3GF8A 4YEEA 5BO0D 5C92A 2A6DB 1CICD 1YMHB 4NO5A 1M1SA 1URZA 4XXDB 1URIA 4DEPC 2SODB 1ZCRA 5E8OA 3G6JB 5JO5A 1OB0A 2NZ1A 2VUMA 4FFZL 1RV6X 2WLLB 2OMTB 3HFMH 3Q1SL 1AKPA 4BKSC 4CDHA 4PTTA 1TJGL 2YPLE 3CBJB 3JWOC 1QQDA 5DFWH 3DMMB 2C8NA 2W91A 3QJSB 2CO3A 2EYRA 3E2HB 3BPOC 3QZWB 3QUMA 2E4TA 4XNYH 2DLGA 2OXHB 1BFVH 1DQJB 1PL3A 3CLFL 3MV9E 3OHXA 5C07E 5HYIA 1EO7A 1KIUA 1JNLL 2J5LB 3VI3A 5JYMA 2DBLL 1QTPA 1CB4A 2APSA 3UMNA 3KW7A 3KCPA 1YPZE 2X4TA 4YGAB 1I82A 4N25A 4UOQA 3H54A 4AIZB 2OL3H 4ZMXA 3GBMH 1QDNA 3MHZA 4XNQA 3C5ZC 3IM1A 4P23D 2A9AA 4PGJA 4ODVL 4FLOA 1X5YA 4I3GA 4ZS7L 2EEAA 1S9YA 1XX9C 3VTMA 2D7MA 1SOQA 1YEDA 1GAFH 1NLDL 2P8PB 2JIXA 3T08A 5I18L 4K4KA 1NC4A 4RMBA 1A4BA 3L9BA 3HPJB 1PKQE 4FYSA 1XQ4A 1OTTD 5I74C 2A73B 1S5HB 3PREA 1KGIA 4JAMA 1QO3B 4UQ2A 5E9DE 1GPOH 1WTLA 2MCAA 2F8XC 5D6DC 2IPTH 3TPUA 4H20L 2KH2B 2DD8L 4RSVA 2OMWB 5CSBA 3QHFH 1IQWH 3FO1A 4GFTB 5IK3B 2RCSH 3OPZL 4S1RL 5DRZB 5IHBA 1A7OL 2WBJB 2W80C 4JG5A 3LKQA 2ZOLB 1UH4A 3VI4A 3CU7A 5DFVC 5FW8A 3QZOA 3BUYA 4UMSA 2CQVA 3HU3A 1CXFA 2QHRH 3KYMB 4R8WL 4WJ5A 4HOXA 2EEBA 2F54D 5KAQG 1JWSA 2BCMA 4Y16D 4K9JA 2XLLA 5D72L 2JQZA 2VE6A 1Z3GL 2WYIA 2PO6D 1H3PH 2NY7H 3QORC 4N0YH 4NBZB 2NMSA 4MAYC 2R2HA 5C2BL 3FB5A 2BZDA 3B37A 3FFOA 5BCAA 5D1QD 4JDZB 2D31B 4KBPA 5KOVC 2VM4A 4CU6A 3E1ZA 4PP1D 2VR3A 2GSGB 4TPRL 2E7MA 2WB1A 2X1XR 4FX5A 2XCMC 4JRXB 5F70A 4EI5A 3FT3A 3H9ZA 2VOTA 2YEZA 1AXSB 3HZKB 1KCBA 1MFDH 2JJSC 3RY5A 3EW3B 3UTSE 3PHQB 4Y2OB 3BKYH 2BNQA 1VACB 2FBJL 1L7TH 5T5MD 4DN3L 4JFXB 4ZD3H 1BF8A 1MHCB 3M3GA 4W68A 5DMJB 4E9TA 2NW2B 5E94A 5D7IA 2ENSA 1J05B 3PHAA 5A2LH 3Q5OA 4GRLB 3T2QA 1KCVL 5AW9B 5J12B 1B3JA 4DK3A 3UZEC 4P57A 2BMKB 5KVMC 1E27A 4ODSH 4XNXH 1JAEA 4DT2A 4ZFFA 1TZGL 1OAYL 4XOBA 1D5IL 3EYOA 1CL7L 1SHSA 5KVEL 2GBVA 3I2CH 1LEGA 3KLAB 2JK5A 2WJ5A 5DD1H 3SGJC 4DP0X 1XVSA 2NY2C 1HCZA 5DMIL 1PNDA 2R4SH 3CZJA 4O2CB 4WU5B 1OL0A 4X5XA 3IYLW 1IILE 2VO5A 1G7LB 3BUTA 3WFEH 1AQKL 2L8AA 4ZSOA 5DMGC 3CHRA 3IRZA 3W82A 5DVLA 3AITA 3BEWB 1ZDQA 2NY1D 5E4IA 3F01A 5E6ZA 5GRWA 1T83A 2VDNH 1MWAA 4KJPC 5MI0B 2YEVB 2JI1A 4LP8A 4GRWF 3BH9A 5DD0L 2C1OB 5GRXG 4IK7A 5ISZA 4JGUA 4APXA 2IO5A 4KQ4L 1DLFH 2FUQA 1DEEB 4L2LA 4WY7L 3AT8A 4QTHA 3UO8B 5C0AE 3K8MA 2VDMH 4JQXA 1NOFA 2M8XA 1JDCA 4ZXBB 3P4LA 3RGVD 4AONB 1D7CA 3OGOE 4J2QA 2H6PA 5EEUA 1CVRA 2CK0H 1KDJA 4N0RA 2EDMA 4X6FA 1QRND 1NDMB 4IOIB 2A6HD 3QZNA 3GJEB 4ACPA 2GAZA 1ZGLP 5IB3A 1F41A 2A4ZA 1J1OH 3HG0A 4I5BA 3FSWA 1MCOH 3F64A 4HF5H 2NYYD 2VR9A 5TGBB 4PJ8B 2AVFA 4WRLA 1OVZA 1IC4L 3WXVH 4MCMA 2WBKA 3JQOB 2ZP0T 1SJVA 5AG9A 1XGUB 5H35A 1G7PB 2DS4A 1R5VB 2WAHA 4NKDB 5J7CC 1G9ML 2Q7YA 4P4KC 4P5TD 3RWFA 3DBSA 1NCUA 5DS8B 4OFYD 1XCTA 2F2HA 2EDYA 1K5NB 2A7BA 4NN7B 4AQAA 5A3ID 2A1WL 1WHOA 1WLFA 1D5ZB 2XPGA 3P11H 4O9HL 1DHKA 3ARDC 1KIQA 3OXSA 2EXWC 1CGSL 4YR6A 3HNSH 1CGYA 4FQXD 2FATH 5SWSB 5I8EA 4JL2A 3W0WA 1B6DA 1ZA3A 3IF1B 5FYKD 3TO4B 3GMLB 5HDQH 5JW3L 3SDXA 2X87A 3T0BA 4XNMA 4D7BA 4OCWH 4YDJB 2GHWB 4U3CA 2H1PL 3QHZH 4X7EC 2ZWLT 2X6BA 2EDWA 3EJTA 3IDGB 4L4TE 4LOVA 1FVDB 1MCNA 3X1NA 5GSVB 4KKAD 2R8SH 3NVQA 1G0XA 4QRAA 4FZEL 3SDDB 3BQVA 4J3WA 1V7MH 1CLCA 3F58L 1OCRB 2VM9A 4JY6A 5ICYB 1LNUA 5HDOA 3RZCA 4JHUA 2YSTA 1N2RB 1YMMD 3T8VA 5I1EL 2FAUA 3L4TA 4HUUB 4N2BA 5KWYC 5TDOA 4G80A 1JDAA 5DEGB 3U7WH 3VU1A 4PJXA 4KGJA 1S9VB 2BIQA 4K8RL 3NJGA 3OF6D 4O5LL 3V4PH 3MKGA 4AENA 4HZLA 4JFED 3TZVD 3VQMA 1Y5IA 2W81C 3AY4A 3D9AH 4XRCB 1QSVA 1MUJA 5BS0B 3D4ZA 4GQ9L 3N1QC 4NZTH 4DQOL 4EI6A 4HUWA 4X80H 2R92A 3PPSA 4HZAA 1DN0A 4Z7VE 1KTRL 4MQ7B 1YY8A 1K83A 3HCVA 4NUPA 5TDNA 1IC7L 4ZUTB 3TN0A 1HJCA 4QAMB 2W1NA 1Z7JA 4LEXH 2G9HB 1FZMA 2JKRM 5JMOC 3LKOA 1NUNB 2G3ZA 3KPSB 1XGRA 1R5WA 2XRAL 3GHPA 4OZGE 4WNQB 1H3TA 2ZKHH 4F92B 5CGMA 4YHIB 1LO4L 2MKWA 1M53A 1F1GA 4WCYL 1J5OH 4ORZC 2RTTA 3ENEA 2P5WB 4ABUA 1P5UB 2HJFA 5DZ9A 1E30A 1XAUA 5DHMC 5HY9B 1TZIA 4BFEA 4HCFA 1L8FA 4Q7DA 1TT6A 3J27A 3MLVH 1E4KC 3DMRA 4OD2A 3SZ6A 2CO1A 1RH8A 3SDAC 4RZCB 3N0AA 3O2DL 4MDIA 1P0SE 3B43A 1EFXA 1ZT7B 3LRSB 1RMFL 4GO8A 2ZKMX 2A4EA 2F5BH 1YNTA 5KSAC 1JHLL 2HLEB 1CGWA 1I8UA 1OTUC 4G9FD 3W39B 4JO1L 1CDJA 1ORQB 3FN9A 5DA0B 4ZMPA 3D85D 3C08L 3V6OE 1D7FA 1KGCE 4PTUB 5BMFH 3QNYA 1BQHB 1CE1L 3QQXA 3C5JB 2VCOA 4PG9A 3L3IB 2MCPL 3BVVA 3RTQD 3QI9A 3QDMA 3CK0H 2CO6B 3AMKA 4ZX4A 3ZGIA 2H0PA 4BZ2A 4G8GB 2ZICA 2R1WA 3GRWL 3SKOA 3IVKA 3L9RB 4K7PX 3T77B 3MFFA 5D7JA 1MFCL 1KTDA 1E5BA 5D93B 1E65A 3ZHNA 3GLEA 2LOEA 1Q38A 3CZNA 3T0AA 1XCQB 5I0YA 4GA6A 4YL4A 1KCLA 3M6DA 3T1FB 1I4FB 1T0OA 4Z8FH 2AKRB 3HAEG 5DK0A 5K33A 2NXZB 4L8CB 1J11A 3KPRD 4HDIA 1FG9C 1G7JB 4OCSH 3TONA 3ZE0F 1JPST 2EE2A 2XTJD 4ZMAT 4I89A 4XB3A 3NESA 5T1DL 1D6EB 2UYLA 4HKZB 5EO9A 1GZQB 3T2PA 2UV3A 3MU3A 4B97A 3EFOA 4WW2F 5KTEL 2ENJA 2CJTA 2W65A 4N0FA 4JX0A 5EU6B 5E95B 1S8DA 2V33A 5DJAA 3MBEA 3SE3A 1KTLB 4YXLL 5L2KE 1PX4A 1JGEA 2JLPA 4GBXA 2MQ3A 4OQ1A 3BP5A 5D2LB 1KDIA 2ICES 2W9DH 3E1F1 2NUTB 3I6KA 4U1KA 3VU2A 3IJHA 4HIIA 3BLKA 2WXLA 3GI9L 4LZKA 2FGWL 3GMOB 3P02A 3WY4A 4RMTA 1IZJA 2X4OA 4PJ5A 4UNUA 4P5RA 3BRDA 4IBLT 1A4KA 3OB0H 4PI0A 4JFPA 5MHSE 3WTVA 3NGBC 1Y6MR 4DP4X 2F7PA 3RILA 4EKJA 2VQTA 4XVOA 3OZLA 4DKAA 1YUHB 2ERJB 3SO5A 2NTSP 4HAFA 1QYGL 2WQ8A 1U9KA 1C12B 5F2FA 4D0DA 4U1HB 1VKXA 2FK9A 1USQA 3QXWA 3LMJL 3IFLH 1CZ5A 4WKZA 5EEVA 1QA9A 4HGWB 3KBHE 3O9WC 3QQ4A 3MV7E 2B59B 2BNRD 4M7JL 3EIFA 1MCDA 1TITA 1YQVH 5DMKA 3VX0A 1DUYA 2ADIB 5D1QE 3EYFA 3SQBA 1HQRB 1D5XA 3U2JA 2OSLB 1ETZB 1PT0A 1J5CA 4M56A 4IMLB 3PAVA 3RTLA 1ROWA 2VB5A 4UZGA 1FC1A 1W0VB 4IBYA 4TQHA 4ZW8A 1JZ4A 3RVWD 3DX9A 4LKXA 3CLEH 2VIRA 3CC1A 4O58H 1U8MA 2NYZA 1JZ3A 2AMGA 1T7WA 4L48A 2WZ0A 1W16A 5LNGA 1E7VA 4NQDD 4XE5B 1B2WL 3QIUD 1CT8A 4NCDA 1G0YR 5LAXA 5JQIB 4XP6H 5AZ2H 3CGTA 4K7PY 3Q9PA 3FAWA 3RY6C 5AD0A 2WXFA 3JWDC 5F3FA 2VMDA 4JPIA 1JTTA 5FHBH 1U92B 2VH5L 4KTYA 4P99A 4U1NB 2O6EA 3H42L 5HYQA 3LHAA 4TRPH 3TU6A 3O0RH 2XI9A 1ETB1 4LLVB 5K1JA 4PR5B 4BH8A 3VD4A 5E4EB 1RK7A 2BP8B 2DLFL 3FQ4A 3J8F7 2OMUA 1J1PL 2RJMA 3LPGA 4JO5A 4X9GA 3ARGB 3MROB 4MBRA 3C5SA 4C4BA 1XV8A 3BT2L 1NSNH 4X5RA 2E86A 5LG6A 1ND0A 3BHBA 5H4YA 2GG1A 2FJGA 4CSTA 1MHEB 4LVEA 3ZQXA 5HJGA 1FO0B 1MCRA 1BEYL 1TCRA 4X7CC 2VUYA 3PJLA 4ANVA 1TZHB 4GSQA 2C34A 3NJVA 1XF3B 5FGRA 1T3FA 1TSHA 2P44B 5C09E 4Y2DD 3FT2A 1ZD6A 2CMRH 4G72B 1I3GH 4UTCA 3EOBB 4AYEC 1R34A 3L3KB 4OIFA 5CKGA 3ZTEA 1ZGLB 3IMSA 4GW1B 2EH7L 4BUGA 2FD6H 3PWJA 4TLSA 4F33B 3S36L 1IGML 1OIOA 4JM2A 1K85A 3V52H 4N6RA 2W60B 2XZAH 5LGHH 3D39B 3Q44A 4XMPH 5E2TL 5L8KB 3GHBL 3IGFA 1JF1B 5EU5B 4PV1C 4MNQD 2Z8VC 2X7LB 1T2QL 1A3RH 2RBLA 5AW5B 4XO3A 3T4AC 4OGXH 5F9JA 5M94B 2ETWA 4G1MB 5GSRB 4BSJA 1SN2A 4WUUB 3SY0A 1ZOXA 4MX7A 3ULVL 3L4ZA 4K5OA 1AD9A 1MPAL 1JGDA 1MSPA 4HWBA 5DZJA 3AT0A 5HHVL 5ICXB 5A16B 1GZPA 3PIQB 5ACZA 4JFOA 3S37H 4D2NA 3OX8B 3V0WL 3X1BA 4G1EA 1YEHL 4JE0A 3ULVC 4DKFL 4MNGB 2VLKE 2ZYIA 4FFVC 4Y1AA 3KLKA 2GUOA 3WDHA 4FG2A 1BWWA 2V4LA 4OV5B 2R29H 4PCSA 2CKBA 5D2NE 5AAMA 2AANA 1M56B 2IAMA 3G6JE 2R51A 1ZIBA 2CSPA 1AYRA 1T4KB 2ZX8A 4PI2A 3VCLA 5D7SL 4HJTA 5LKNA 1C5BH 1QI4A 2JCWA 1P4BL 2A99A 3FAXA 4GT7A 3U46A 3P3YA 3EXLA 3ISYA 4M8RA 3D3VB 3LPFA 3ARPA 4LCWA 5J56B 1ADWA 2P8MB 4HKJA 1JYXA 3SKJH 1CU4H 4KKRA 4NM4H 4LQ1A 1IVTA 1R3HB 2X41A 1XH3B 2JVUA 5D8JH 4AIOA 3HG1B 1KB9K 4OVUA 3ULUL 3VXMB 2AAVA 4Z9KB 1A64A 2QLVB 4YDKH 1G1KA 3VE0A 1P7QA 5GS1B 2L0DA 4H8PA 4LLYA 1OPOA 2VDKH 2WXHA 3O3AB 4IIQB 1I1AB 1YAIA 2H32H 2HMID 4NZJA 1MLBA 1G1YA 4MMZA 1FZJA 4WFGD 5T1JA 1IIIA 1T0NB 4X5PA 3P0YH 5EN2A 2MOQA 3JTSA 4LE8A 1E43A 2X2UA 4Y5XA 5INDA 3WBDA 2OJ1A 4RRPA 4M1CD 1ID2A 4NFDA 2ORBL 3WHE1 3AW5A 5GRJH 2ZCHL 2YD3A 4FQJL 2Q86B 5FM5M 5DRWA 2K6ZA 3QQ3A 4OQTH 4ONHB 3VFSA 1I9IL 4MJHA 1T22B 2E6PA 3GXIA 3PWNB 4QXWA 3VFNB 2Z1KA 5J8OA 1HHIA 2B3RA 4YWGH 1JN6A 3S3DB 2CIIA 4NN5C 3WJJC 2LU3A 4HJSA 1CLVA 3I85A 3TIWA 4BK4A 3FU3A 1G6RB 1YEGH 4PVLA 4NO0A 1E90A 2QZ5A 3D0VB 4FQIL 3LEVH 4KZCA 4UYPA 2OJZH 2EKSB 3BP6A 3CIQA 4PJCE 2EDDA 1B9ZA 1OM9A 3SO3C 3QCVL 1A4AA 1JXGA 4B41A 3WNJA 2FRGP 5DJDB 3ULUE 4KO8A 1P2CB 2VO8A 1XMWA 5T3XH 3R4DA 4MXWL 2XOTA 1H3VA 4TLKA 4GQPH 1X4ZA 3T0EB 3I6LD 4X4XB 4JRXE 4BHUI 3V6ZB 4AKPA 5L88H 5JHDB 3T3PB 4ELMA 3QDJB 1AQ8A 1EXHA 4ZX6A 3R8BB 4P46C 1BLNA 3D0LB 5MI0C 4JANB 3MRKA 4GW5B 4YSQA 1H8LA 1UASA 4HOWA 1JXFA 4GAYB 3VFTA 3ZTJH 3KZ8A 1XIWD 3FF8A 5CU5A 4L3CB 5E6UB 1H6FA 4QOKA 4UIKH 2FHCA 5HGBB 1EO8H 1HILA 2E75C 1ZLSL 1XO8A 4ZW6A 2AJSH 4H88L 2WC7A 1JYWA 4LK4A 1ITBB 3VH8B 5LBVA 4LCUB 4JO3L 1XCWA 3AAZA 2DJ4A 4PJ6A 3TJEH 4NYLB 4NNXA 2C9VA 4OM0L 4PJHB 2DDQL 4U6YA 5DCCA 3HZMA 1ZHKB 3BAYA 4LSSH 2F6AA 5HI3C 4AGMA 2AJZB 2AEPH 3D4YA 3HEIB 4HHAA 2HUEA 1U91A 4XMUA 3AXLA 4M3KB 1TKWA 4NPJA 4I88A 1N5AA 2P47B 4U0RB 4EDWH 1QSED 4PWHA 2XWJA 3GSNH 4FFWD 1C7SA 4FLQA 3VAEA 4BCZA 3CX5K 4L18A 2C7UB 1WWBX 3K81A 5IFJB 3MUHL 3RDTB 4AYGA 2XPZA 3N3EA 1KACB 4RCAA 2XETA 1L0XA 1ZHNA 4KI5D 3MNZA 3ZU8A 1E60A 2O6CA 4M1GL 5ECGA 3WYRA 1IM3D 2OKMA 4RFEB 3X1FA 2VABB 3HE7D 1QFWI 3EF4A 4GP5B 1OOWA 4AYFA 3TBYB 1YEIH 1J18A 5DHEA 3RWEA 2ZXCA 35C8L 4R83A 1E28B 4V1DA 1GSMA 5LJYH 4K71C 4NIYE 4Y5YB 2Y06H 1VA9A 2QSCL 3BVWA 5D4QA 1NM9A 1XGPA 4RDQG 5BZZA 3QJHA 3MCYA 3TO2A 1TVBA 4H44C 2RR3A 2X05A 2Z91A 5KYYB 5CUSL 2P24B 3VD1A 4OM1L 4PREA 1MCFA 4Y19B 1NMAH 1ZVSB 1JG9A 4PP2B 4ZMWA 2CJ3A 1HL4A 4LCIH 4QRRB 4BH7A 2LTQB 1PEZA 2PP9A 4MVBD 5T1LB 4XP1L 4R4BB 4L37B 2EVFA 1OAXH 2Y7QA 4Q2ZA 2ZXQA 3QC8A 3ME0B 3KMDA 2R0ZH 3NQKA 5FYLH 2G2PA 3HS0C 3OQRA 4H1LH 4NOBA 3D18A 3X13A 5JR1H 5KVGH 3EO9L 3HC2A 4HVBA 2K8QA 5SWSE 4H8HA 2NY6C 3B5TA 3P73B 4NQDE 1C08A 2BY2A 1A3LL 1XXDC 3BIAX 3SDCD 3JWOH 4YE4L 3RHWK 2V9UA 1QR4A 2WTRA 1FV1B 4LFHD 4KQ3L 2FL5A 1S2EA 5FA4B 1G7IA 3AROA 3L2LA 3STLA 3FT9A 4FFZH 4V2BA 4Z7VF 3Q1SH 3TYGL 1RZJL 2KDGA 5I75B 1TJGH 1XD1A 3K5SA 3Q43A 2YD6A 2MCMA 5IW6A 1QEWA 1AOHA 5FA3A 3VRJA 2AXGA 3FUIA 3QIBB 4KXZH 4LPWA 1WBXA 4DNLA 1KB5A 5LQBH 3QFGA 2IDQA 3MX0B 3RVUC 1T04B 3FYIB 3UERA 4AQOA 1JNLH 3HLKA 4OZGF 1X5MA 1Q4NX 2DBLH 2FEJA 4UQDA 4AM0A 2VSCA 5JIQA 1OAQH 4HAGA 3D6GA 5KVFH 4BBWA 3MQIA 3S5LA 4DH2A 2FGZA 1RK0A 3DRTA 3SODB 3TT1L 1X5AA 5E6IC 4ZS7H 2NVXA 1DJYA 2X4PA 1NLDH 2HFFA 2IC2A 2ZUQC 1WWWX 2C1PA 2VXQA 2CGRL 3EOAB 1M9SA 5E7BA 3VWKA 4MCYA 1SHXA 4FYTA 3PWVA 3VQ1C 3K7UA 5F8RC 3QH3B 2G2RB 3N43F 1E9QB 4KJQD 5TH2B 1X9UA 3DIFA 4OJFL 4H20H 4OUUA 2EYSB 2W0PA 1JFQL 1ECZA 4JY4A 2NZ9C 3OPZH 2P5WE 4JKPL 4D9RD 3GB7B 5GGTA 2EABA 2FIRT 4PLKC 1UXWB 4BHUA 4MNQE 1QFUL 2Q20A 1JMZA 4I0PC 5CD3A 4HIJB 1T66D 3GEWB 1SJEA 4L1HA 3B7SA 4XVSH 1KLUB 4OI7A 4C4KT 5MEND 2ITCB 2VDRL 3MJ8B 4ZDHA 5C2BH 3EYUL 3M17B 1NCTA 4QHPA 3RWJB 4X9HA 4YPGB 4B9ZA 4AJWA 4JRFA 2CRIA 1LO5B 1DQML 3S4SA 3SBWC 3ARXA 1MAKA 1R3LB 3AREC 3KCWA 3ZIMA 3RNKA 8CGTA 2VAAB 3TT3L 4GKNA 3CZEA 1ORSA 4DO4A 2K3HA 3APMA 2FBJH 1Z1WA 4JR9L 2A74B 2WW8A 1VEOA 4DN3H 4F8NA 5D7LD 2R0KH 1QR1A 4JZNA 4G8GE 2CA3A 2G5UA 4X98A 5HYSB 3VX1A 3T0WA 1KCVH 1HKLL 3AS1A 2FHFA 1BXXA 4UQIM 2E6JA 3NEEA 3CV5A 3KLSA 5ESQA 4DEUA 1TZGH 1OAYH 2DLTA 1D5IH 1VFUA 2XVKA 1CL7H 5KVEH 1RJYA 4N87A 2V5YA 4HUVB 4JFDD 4JFUA 5DMIH 2NQ3A 3SKNB 1QZNA 3B7TA 4NLAA 4FS0A 1HEZA 3DJ9A 2V6HA 4OKVB 1AQKH 5I1KL 4U2ZA 2Y9RT 3ZKND 3I6GB 4MD4A 4AQ8A 1GYAA 3PNRB 4NQSA 2P28B 1U3HA 1KULA 3ECVA 3PHOB 4HUKB 4NS0A 5EU6E 3ZZLA 2CH8A 2FX8H 4GS7C 5LNDA 3BCFA 4ENZA 1SLVA 1HJBC 4ODHL 1M1XA 4OSUL 4B5ZA 4KI1A 2XBDA 3NN8B 5D2LE 3RYMA 3G5XA 4JN2B 5DD0H 5CEXA 4NO2A 2CKNA 3ARFB 4KQ4H 4NKIL 4NJAH 3RA7L 2B77A 5G4NA 1XBRA 1NIEA 1RZIB 4EUPB 1AR1D 4FHBD 1ZLUK 5HJ3B 3D69A 5CN2A 3MXWH 2X1WL 3T0VA 2UZYA 1AQDB 4HJGA 1I1FA 4XN4A 3T6WA 4DKEL 5I71B 1JK8B 3FS9A 1SVZA 3FONA 4H0GA 5LB1A 1ZPLA 3MUY1 3PV6A 3SE4A 5C0CD 1HOCA 1BD2A 5E1QA 3NZ8B 1N64L 5DGQA 1KJMA 4L29B 3SGDH 3DKHA 4A38A 1VLXA 1IIKA 4CS0A 2RQEA 3L17A 5AEAA 3IGAB 1JZJA 2VLRB 3UYOD 4UV4L 3I9PA 3QUXC 2J1ZA 2VISB 1R9FA 1PYQA 1IC4H 3F6LA 3I6LE 1FO0L 1MI5D 3QJZA 3GT6A 5TPWL 3GUTB 2R1YB 1E8ZA 1XGYL 5FYJD 3S7GA 4DN4L 4NWTL 2AERT 3QEQB 1UVQB 4ADJA 5I28A 3F2LA 3QIWA 4L1TA 4YLCA 1YA5A 1B6UA 3X1GA 2A1WH 4I13B 4NKOB 1EA9C 4O9HH 2C4XA 1SNRA 2X4NA 3CDZB 5B1JA 3B9KA 1ACXA 4ODBD 1CGSH 5IQ7L 2ZSVB 4H8VA 4N5ED 2X2JA 4JRYD 3L1EA 4MMYB 5FC9A 3X2PA 3DTXB 5JOPE 1WC7A 5JW3H 2CWRA 4OZFH 4FQQB 4AT6A 1MFEH 2H1PH 3CC5B 4PLNC 5FXCH 1PAMA 3CG8A 3HKFA 4UT9H 1L5GA 1Q9OA 1OGSA 1JPGA 4F37K 4HS8L 3B7UX 4K15A 1PG7H 3DUSA 1EEZB 4FZEH 2E9BA 2Y2YA 3V4VB 4A7TA 3QXDA 3H2PA 5DUML 3P77A 5EUOF 4Z0XA 3R8QA 3GMNB 2D7PA 3U7YL 5HGHB 5L7XL 4JPQA 3RVTD 1I85A 2AQNA 3VB8A 4D9QD 1AZUA 2X89D 3MRDA 2D7NA 4O5LH 4S11A 1OT2A 1K8IA 4GJTB 1H5BB 2R9HC 4NQXA 4X6CA 3K4ZA 4XBEL 3BPCA 1FDLL 2W92A 1DQDL 4GQ9H 3ZTDC 4Q9BA 4DQOH 3FQNA 2AI0L 1U8JA 4XPAL 4KI5E 4GXFA 3E3QC 4MA8L 3D87B 1JPEA 1NUDA 2FQGA 3PJSA 5FTMA 4KK6C 1IC7H 5HDLA 3ZZSA 4MLIA 5EORL 3JZYA 1F58L 3I3BA 2W0KA 4E42B 4MD0A 2CDFB 5DQDL 1ZYRD 1NANH 1AE6L 2Z31B 5I0DA 3D39E 1HYSC 4EDXB 5CEYA 1U8LB 2XRAH 2Q87A 6FABH 1YNKH 4TLTA 3S96A 3ROOA 3G6JF 1LO4H 1VGKB 4ZUVA 5A6LA 4WDIA 4WCYH 1HXYA 4OGAC 4L0PB 2LHAA 3KJ4B 4G5AA 4WUUE 1PJWA 5D71H 5EU4B 4CW1B 2XQ0A 1D9KB 1FNAA 1O9VA 4IGBC 3C60B 1PZ5B 2BS8A 4ZI8A 1MELA 2ADFH 5I24A 1SY6A 5C0DA 3K4AA 1M2OA 1DDTA 1BZ9A 3LXBA 1IL1B 4UM9D 1XD0A 1QMUA 1XZWA 5FDWA 3O2DH 4MNGE 2IALB 4R4FH 1IGIH 2BP0A 1RMFH 4DGIL 3B3BA 1JWMB 5LVEA 1U8HB 2WAQA 4Y2LA 3HNVL 4PYHA 3ZT5A 4WI7A 1AZBA 1HL5A 1WZKA 1NCCL 3C08H 3EJPA 5GRVK 3RFZA 1E5CA 2XSKA 1WLHA 2L3BA 3AC0A 2Y6TE 3QJFB 3PV7A 4IRZL 5DXWA 2F0CA 5DJ8A 1TQCB 2OTWA 4Q6KA 3ARUA 3TYFA 3FTGB 4EBQH 2JLLA 1DBMH 2JKIS 4KRMB 2BRQA 3U9PL 5ACMA 2X3AA 3SGEH 2JE8A 3C2AL 2ZOKA 3QXVA 3UZQA 5AW2B 3GRWH 1H6TA 5EBLB 3DSFL 3FQWB 2GJJA 1MFCH 1J5IA 1M7DB 3HG1E 1S7RB 4FMFA 3VXME 4P9ML 2CRMA 3N42B 1P1ZA 4U7MA 3X2IA 2FR4A 4RIRB 2WXRA 2K8MA 3P1VA 1DQIA 1QSFB 4G6JL 4O4YL 3ZKQD 4ANXA 1O7DE 1KC5L 4EPSA 2H2SD 1VB9A 1XXFC 1A8ZA 3C6LD 3NJKA 4PJCF 4B9IA 5ANMA 5GGUA 2ARJQ 4TLUA 1DBBL 3ULUF 1TUPA 1YYCA 3OJDB 4KX8A 3K2IA 3M1OA 4N9GB 1UM4L 43CAB 3WN5C 2EILB 4YXLH 1WD9A 1URLA 3LS4H 3DOHA 3ULSB 4XWGL 1CXIA 5EEZA 4UINH 1R3JA 1BXUA 4HMCA 4BQBA 3QJQB 4AI7A 4RAHA 1GYUA 3FT4B 4ZYKB 32C2B 4YSSA 4X9FA 2Z0BA 5FKAA 3GI9H 1OE2A 3IPEA 2FGWH 2WXNA 3FC8A 2AQTA 1WT5C 2WGXA 3AUVA 1OA9A 2J8UA 5AENA 1BHGA 4D9RE 4R7NA 2JCCA 4W9HC 4WV1B 2IANA 2OMYA 3F6IA 3GJFB 4L4VA 5CIPA 3ZW3A 4DHLA 3UJTL 2APWA 1G94A 2I27N 1PYWA 1QYGH 4U1LB 2VZVA 3TBVB 2H9GA 5MENE 1T21B 2V3DA 1FYTD 5ID1A 3GXDA 5ICUA 3T0EE 3B7RL 4NKMA 4IHOA 4M7JH 4EZKA 3MFGB 3NQIA 3F00A 1QACA 4JFQB 1AMYA 2JTYA 4K7FA 4A04A 5JHDE 3T3PE 4PBVC 5C7XL 1CD1B 3G5VA 1RHHB 2BO0A 1TTRA 2XN9D 1MAJA 2Q2EB 3GSWB 4X0KA 3CSFA 4Y2NA 5IROA 4HW6A 3V8CA 4WW2A 1KMGA 4U6HB 1FYHB 4IRJB 1ZLDA 3HI1A 4N2AA 5ITFB 5TDPB 1U4EA 3QYMA 1AFVL 3JWDH 5KBNC 4MJ6B 2OMZB 4JDVA 4MRCA 1H6EA 4LDCA 1JRHI 1KPRB 1FVCA 1MCJA 4KXZI 5D6CA 1H19A 4ZOBA 3IGUA 3FB6B 4XBGB 3KJ6L 3CFKA 5DQ9B 4G42B 5IR1B 1BFTA 4DO6A 3HG5A 4W9CC 5IEHB 1WITA 4L8SC 4PJ9D 4NC1E 4PJHE 2IPKB 5K93A 2JA7A 3V0EA 3PRZA 3QUZC 5I2IB 1IMHC 1U8NB 4N9OB 4PJIA 1RZQA 3MNVB 4NGHL 3DRQA 4Y1TA 3WNOA 5EEWA 2H26B 4Z3TA 1HQ4B 4KJWD 1PAZA 2NTFB 1DQLL 2LV4A 1VPOL 4AY0A 2QQQA 2VLJA 3JTBA 5D5MB 3BO8A 4PPTA 4YHNB 3A0OA 2DMCA 4UANA 3PDOB 1QI3A 2ZXBA 3OD3A 4KAQL 4TUUA 5T5FL 1BOGB 1HHGB 3QDGA 4N2LA 5D1XC 5C6TL 1K3IA 1MVUA 4ZPVA 2CO7B 3HE6A 2GW5A 3WIFA 3GGWB 2QGBA 1SLXA 3EG9A 4N68A 2DIBA 4KX7A 1LEKA 1HEHC 2HB0A 5AUMA 3AB0C 3US9A 4ES9A 2QQKL 1OK0A 1UKQA 4FF9A 1UQSA 4BELD 1YEFL 2NLJB 5FM5O 2PP7A 3MRBB 3MUGA 2CALA 1MDTA 2XX1A 4JREC 1I8IB 5E1HB 5HHPA 3WFCL 2AK1L 1M71A 2NYAA 2JB6B 2A77L 3P69A 5HYJB 2QQLL 4NNPL 4ABWA 3GTGA 5C0CE 5E2TH 5JPMB 3GHBH 1IKFH 1FH2A 1TQUA 3B8YA 4IKIA 5IV2A 3O4LA 5D9SB 1LK3L 1IVLA 1T2QH 3E7JA 3EDFA 1O0VA 5KSBB 4QRRE 4FXGA 4H8WL 3HB3D 4TVPL 5BZDB 5GS0L 1I3UA 2IG2L 5D7EA 2HT2D 2XFXA 1UD3A 3ULVH 1DANT 5HHNA 5LGJB 3MRPA 4Z7AA 1MI5E 1X44A 1MPAH 2BNUA 2AK4B 3MA9H 4MD5A 5HHVH 3US1A 3QUKA 4KZDH 3WFDH 3QG6B 4PGCA 1J9RA 3SE8L 4H8WC 2XZCL 5JMRA 1U93B 4A6YL 3WLWC 1T4WA 4HALA 3V0WH 1INDL 1H15A 2PPAA 5GS0C 1YEHH 3IFOB 5FHAL 4WGWB 3O6KL 1IFHH 5E56A 3FFDB 5I8CB 1KZYA 1PZ2A 4LGSB 4UQ3B 3S8FB 2NR6A 4J1UA 1UYWL 3BN9C 3VA2C 1CL7I 3QXAB 4AQEB 3PLXB 4JJOA 4U1MB 1TQBC 3RY4A 4AEFA 3GSNA 5D7SH 3W5NA 1H0DB 3KYOA 3KYKL 4MCZB 1PLGL 1QFHA 4K07A 1JCVA 3NCFB 3NSCA 1PFCA 1KGUA 1WV7T 3QNZA 4HGKC 2A6KA 5DHYA 1E42A 3K6SB 3HAEB 4Z95H <