4JJOA

Crystal structure of apo-clavibacter michiganensis expansin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLDLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of wild type and D78N mutant clavibacter Michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis
molecule tags Sugar binding protein
molecule keywords cellulose binding protein
total genus 41
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jjoA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4jjoA02
3ENGA 4JP7A 3X2OA 3FT9A 4JP6A 3SUMA 1WHPA 3X2JA 4JJOA 1N10A 2HCZX 1BW3A 2KQAA 3M3GA 3SUJA 2AE0X 2G6GA 2GAEA 5GLXA 3SULA 3X2NA 3X2MA 5GM9A 1OA9A 5H4UA 3X2PA 4ENGA 2JNZA 1HD5A 2G5DA 3CZBA 4FERA 2VXQA 2ENGA 4FG2A 3X2HA 3X2GA 3D30A 1L8FA 3X2LA 3X2IA 4L48A 1WC2A 4ZM7A 4FG4A 4JCWA 4FFTA 1OA7A 2BH0A 2PNWA 3X2KA 5GLYA 2PI8A 3FT1A 2PJJA 3SUKA 4AVRA 1BMWA 1WHOA 4JS7A 1BW4A 2PICA
chains in the Genus database with same CATH superfamily
2EXTA 3HHRB 4UM8A 4BQ8A 2PPCA 3HPLA 1JHTA 2DWEA 4NN5C 5FIEA 3GUTB 4KNTA 4PBDA 3OKMA 5CCKH 5AW8B 5E1HB 3D18A 1WZ1H 5A2LH 5F44A 4HSAC 4AVIA 4PAZA 4KI5D 1DE4B 2GK0A 1QVOA 3HUJE 4OLWL 5I73B 4KRPB 2ZOLA 5IVOA 4PRIE 4G6AD 2LGNA 4YSTA 2P1YA 1U58B 2EEBA 2ICWB 4WUUA 3H6JA 1R46A 1I7RB 3HZKA 4TQEH 3T09A 2DQDH 4G7VH 1IBFA 1RUML 2M8XA 4JQIL 2QVTA 2WINA 2EEDA 3GSUB 1W8NA 4KMLB 5KW9L 1KB5B 3O6LH 3KCWA 2AK4E 1DSFL 4J1UA 4OGYL 3QNYB 4C4KO 2PYEB 3IRPX 1WUNT 3ULSB 5EEWA 2GVYA 2W9EH 2WHVA 3MRLA 4YS4A 1PKQB 4QDGA 5HYJA 2JIRA 4I4WA 3QIUA 4PJ6A 4CU7A 1LK3H 1D7BA 4C56D 2PTUA 3EW3B 4EXKA 5LGKA 4FTDA 1OAUL 4MDJB 4XO3A 1EO8H 4Y16C 5EUKA 3TURA 1AHWA 2ADFH 2Q6WA 3CJJA 3ZRCC 3HRZA 3TTYA 1UOKA 3QEHA 5AG8A 1BG9A 4K7PL 2B1HH 1EQWA 1C1EH 1WS8A 1A4BA 4NC1C 2CIKA 1TTFA 3D05A 1AE6L 4OZFH 1GCYA 5GZNA 3OKDB 3FB7B 1IO4C 4J12A 3GXDA 4A2LA 1D9KA 3D30A 2P5WA 4FQXA 1QFUH 4LXFA 1C8PA 2VPWA 2DQTL 4NUJA 4G43A 2FX8H 2A0LD 1MVUA 5D2LE 2GFBB 1T3FB 1S7RB 1JV2A 3LMJH 4TNGA 4FTVD 1QSEA 3ROOB 5DSCA 3P4NA 3FBQA 4R97B 4BZ2H 2EINB 1JVOA 1MY7A 2R0ZH 3K8LA 4XCYB 3ZT6A 5B3SB 1A66A 2A4EA 3QQ9C 3RWCA 1QRNA 3GMOA 1LDPL 4LSPH 2LVEA 2OXHA 4J3OC 3VH8A 1FZMA 3AT8A 5I6XB 2XUWA 1BJMA 5E1AB 4XGZA 2FIKB 3VJ6B 4LOUC 2J1KA 1CVRA 1L4IA 1DQTA 1HHIA 1PZBA 2P42B 1QLEB 4PIBA 1JPST 1CK0L 4MSWB 4AUYA 2R92A 2W0FB 1OSZB 3DX6B 2YAPA 4LFHG 2NXYD 2F58H 1RIHH 4FADA 4D8OA 4X7DC 3V6OC 1RERA 1J5HA 3F83A 5C2BH 3J8F7 5I5RA 2HUHA 4O02H 1L9SA 4XVSL 4KK9D 3V9CA 3CSYA 3V4VH 5IW1A 5CZXC 4XC3H 3I2CL 3NIDE 3EGSA 4QRRA 3EGDB 2W8CA 3V5HA 4ZAKD 3A4DA 3EJUA 2OSYA 4NENA 5FYKE 1QPPA 5AVXB 4BDVB 1QASA 2BW5A 2GUOB 4LRNL 1KLUA 5I66B 4N0CD 1VESA 2XG4B 1MJ8H 4MXVF 5IEHA 2ZX8A 2DQGL 3H54A 3QEQB 1A6AB 2BSED 1UKSA 3TBSB 3PREA 1MJ7L 4UDTA 1YMME 2NNFA 3QNXB 3ZE1F 4JQXC 4AQAA 5LB1A 1RUAL 3V10A 2MSPA 4KRMB 2UWEE 3P73A 2BRQA 1KYFA 3CVHB 4J4PC 3MBXH 1A3ZA 2HTKC 2IG2H 4WW2B 1NC4D 2WTRB 1X6LA 1JOIA 4GJTB 1N8ZB 2FH8A 4WJKB 3WSQL 2VZSA 3NCEB 4K71C 3R4DA 2Z92B 5JYLA 2WAHA 2EILB 1UB6B 5I8KH 2E59A 3BCDA 1E28A 4O2EA 3SGJC 3LCYA 2DIAA 4Z7VA 2F7QA 2HP4A 2P5WD 5DJXA 4DEWA 4QF1B 5JW3L 4XNUH 1GS6X 4PY7A 2XWBA 1R3LA 3DECA 4MCYA 2E27H 4KKPA 4TULH 3FT4A 5DQ9A 5EZJA 5KBNC 3DYOA 4P07A 4XC1H 3OMIB 2FUQA 1WZLA 5HGHB 2EXYC 2X6MA 1BVNT 3P2DA 5HYEA 3QULB 5IVZA 2Z7ZA 4GEJA 2GSIB 3SQRA 2DQUL 1HILB 2YGOA 3MRJA 3MLZH 4Z0BH 3T0EE 3UPRA 1DLHA 1G0DA 2JFCA 4ERSL 4PJIB 1E9PA 4X6CA 3L45A 4LMQE 4F8LA 1N0XL 3VSUA 4J27A 1X44A 1PSKH 2D7OA 3EXJA 1RPQA 1AI1L 1MCSA 1W8OA 5GGSA 4TOYH 1A0QL 3IDJB 1HS6A 3HNTH 5JUEH 1UJ3A 2QR0B 3BT2L 4I3RH 3DX3A 5C0DB 5ID1B 3RGVD 4G7SB 2BCMA 3QZMA 3W3BA 1LE5A 4QR7A 1KLGB 2FECL 5AOMA 3GBLA 2A83B 2AW2A 4DCQB 3AC0A 5IFHH 4AMWA 4Y4HD 5I23A 4HUCA 3POHA 3T08A 2PCPB 1YYML 4PJEF 1BXVA 5DEGA 2GC4C 2ZD0A 5DJ2B 2VDRH 2VLMD 5I2IB 4K2UH 4QTFA 5F3BB 5DUJA 2N01B 2Y0SA 4EVNA 1PLCA 1CR5A 3SBPA 4LB8A 4OJEH 4WFFD 1GW6A 2P5EA 3VI4E 2NXZC 3OD3A 4I0PA 3HE6B 1CZ8L 5LGHH 4Y1AD 2VDQL 1UA6H 1GS8A 3WHE0 4ZNEA 4Z7OB 2ZONA 4I1RA 3JWDC 2E47A 4AE0A 4PGCB 4JHZA 2IC2A 2GAZB 2WQUA 4LSSH 1KEML 3HG1B 1WVZA 1I4FA 1MH5B 1NIDA 2KLSA 5EC2B 3B9EA 1BXAA 3FULA 4DO5A 4E41E 1EAJA 4HJJL 3PDOB 2NT1A 4CW1A 4O4YL 2VN3A 2JCCE 1WH0A 1BYOA 3GBNH 2IBZY 2O5YL 4TTGA 2VH5H 1JN6B 4GG6A 3IDXH 1E9OB 4ONFH 1RZKH 4GIAA 3BYYA 3VMPA 4UV7L 3S3BB 1S46A 2PP9A 3UPCA 1YYLH 1LO0L 2X70A 2JIOA 3CF2A 2A6DA 3CNKA 1KYUA 3KPSD 2XQYA 3IMTA 3JBG7 3QFDA 3I9AA 2QKSA 3DV6A 4WUKH 3WUZA 3GO1L 4EEEA 5KVDH 4L37B 3QAZB 1T0NB 3LSOA 3O6LL 3RWDB 3RWFA 4NJ9H 1JI1A 1HHGB 3P4MB 4DP7X 2P3YA 3ARBA 5F0MB 2J21A 4ANUA 1CL7L 4TVPL 2A6DB 4EE2A 2BS9A 5KYNA 5CWSA 5KG9B 3OHMB 1SOXA 1YMMB 3GEFA 1BVNP 2BVOB 4XNZC 3VVVA 3WHE1 3BVNB 5J13C 2VMFA 4EIBA 3WTUA 3VFMA 1MHHA 3B3BA 4Z18A 4OF7A 1B0IA 2DMHA 5C6TH 4MXWH 2XWDA 4GKZA 5FF6B 4UV4H 4U1KB 4XR8C 1ZWIA 4IRJA 1LTXA 4ELMF 2R29L 4UAOC 2EICA 2F19L 4JRXD 5DJAB 1CN4A 2L4OA 1T03L 4OUUA 4AQEA 4KKLD 2XN9B 4KY2A 4TYUA 5BW7A 4HUWB 1KC5L 3GHBH 2A3TA 1XGRA 3KHQA 1FPTH 1UHDA 4KV5F 1FIEA 1J1PL 5LDSA 1EAPB 3FOMB 3U79A 3UADA 3EJCA 1EHLH 3O4LD 5D1XB 4MJ6A 1X5AA 3AS1A 2GAEA 4H8WC 2H5UA 4AM0A 5IGXL 1VFBB 4AYEC 6PCYA 5EIIB 1EXHA 5TF1H 3FJTA 1MJUH 2G75B 2RB8A 2MCMA 5H35A 1UOVA 1DQMH 3QC6X 2JTDA 3RUGB 1HZHL 5EBWB 4PVBA 1DJXA 2RCSH 3SDDC 5KS9B 4QXGL 3QNZA 1IC5H 1AQDB 4ZXBA 1KJ2A 1U92B 1DN0B 3C5JA 3F7LA 3IPBA 4JFPA 4DVRL 3WCYA 2AC0A 4X6FB 3QPXH 3AY2A 1GHFH 2GJ6A 1NGYA 2VR5A 3ETSA 5HHOE 1JWUA 1TJGL 1TR7A 1N59A 5D1ZA 2WIIA 1AD0A 4G6KL 3SDXF 5B39A 2BSRB 1CLZH 3S4SA 4HH9A 4NQDB 4NAQA 2BWQA 5EU6E 1IGJA 4W9FC 3SDXA 1OANA 3RTLA 2EE3A 3L1OL 4HXAL 5HD8C 3SE8L 3WXWH 5GRWA 3FUEA 4YWGH 2CO6A 2WLMA 3IJHB 5AVSB 3FYEB 4HALA 2PI8A 3ZXAC 1OSPH 1KGIA 1MHEB 3ZVVA 3EYFB 5IEKA 1S7UB 4LBEA 4X9FA 3LKNB 5E08H 1NFKA 4LCCC 4NZRL 1U3HD 4BKSC 2YPKA 2PWDA 5CJ8A 4Z3FA 1XF4A 1B2WL 1EXGA 1YQVL 2F1BA 4G80B 5AZEL 4L4TB 1MJ8L 3BO8B 3OPZH 5JIPA 2LU5A 1HHHA 2G5DA 3VRJA 4NC2B 3VRIB 2O6EA 1UZGA 2VE6A 4Z7OF 1UM5H 1MPAH 1P7BA 4U1HB 3WS6A 2G2RB 4LQFL 4UT7L 1CDHA 1QO3A 2RFXA 1MZYA 3SDDB 3D3VB 1E28B 1IAII 3CLFH 3WE6A 5DEFA 3GXMA 3BXNA 2QTVA 3OXRA 3QH3A 3DI2B 4UQDA 1TU2B 2JKRM 4PJ7A 1AKJB 1M7UA 2JSFA 2V5MA 5IREA 4JUTA 1N7ML 5DYFA 3QRBA 5DQDH 4F3FB 1A6UL 3OAUL 1I1AA 1YDPA 4WTWA 3C12A 1HAUA 2EXSA 3FCTB 1KFGA 1CGSH 1S9YB 1IBZA 1CG9A 1ZXKA 3MRMA 5FA3B 3RYMA 3E8UL 3OAZK 4LEXH 4PV1C 5I1AA 4OFPA 1XGPB 1SJHB 1XAKA 5CBAB 4R5VA 1CDIA 1EHKB 5T1DH 3D48R 4BQ9A 3GZQA 4R7XA 1P69B 4XC1L 2ZPKL 4GKLA 5IOPB 3QNFA 5L0QB 4I48A 4EOWH 5F6IB 1DBML 1YNLL 1EEUA 4PWJA 5IQ9A 4FJZA 3B6SB 4HAGA 3DETC 4OTXL 3ZKMD 2HA1A 3BXNB 4ZW8A 1Q1JH 4K07A 4J3TA 4QWWC 3D3VA 4NZFA 2AXFA 5CLTA 4RNRB 5TGBA 4OCWH 2ITDB 3SD2A 4C54A 1QO3B 4ZNEE 2XRAL 3CZEA 5C0JA 1EDYA 4FQCH 2DYSB 1OGYA 2Y1VA 4PTUB 4TF4A 3S5ZA 3ZYOA 2VE6B 3P40A 5HDBB 3OHXA 3BO8A 5E1AA 3EGXB 3QUML 4JJ5A 2OXHB 1CFNB 3PGFH 1NDMA 1JIBA 4ZMVA 2DQEL 1JGDB 3RWCB 1OCRB 2GY7B 1CU4H 2X4SB 3CN2A 2R7EA 4N1CA 2QQKH 5HHNA 1S9WB 2H6PA 5GS3A 4IS6A 5IV2B 2E7MA 3NAAH 2KDGA 2BWDA 4WW1A 1KLFA 3WIIH 2Z8SA 5C09B 1T3FA 3PFUA 5AYUL 1L0PA 2XWJB 3H9HA 3CXHJ 3KPMA 3C87A 1NEZB 2P5WB 4LCUB 4NKIL 2X5PA 1JZIA 5DEZA 5KSAB 3IXAB 4X2UA 2CJ3A 5E8DL 4HGWB 4Z7IA 1A47A 5I74C 1I8MB 3V0AC 1Z9NA 4F7TA 3KBPA 1TTRA 5D1QB 2FLBT 3GBEA 3UBXI 4PB9L 2VXTH 5JXEC 1CUOA 3RPIA 3N85H 1PY9A 3KWXA 5E8PB 1I7TA 4IEFB 2B3RA 3GBNL 5KS9A 4MVBC 3KPSE 2ZSVA 4PJ7E 4FQJL 3CHRA 1KIPB 3IAPA 3UBFA 5DD3L 5BZWB 3DPDA 4PLJC 4Z95H 3NSXA 4UV7H 1ES0A 4W68A 4IGBA 4GSDL 3B3IB 2CBQA 3I9GH 3Q8BA 3F64A 4GRMB 3SDAA 2ENQA 3V52L 1WSST 3RIAF 4J1UB 3P0VL 2BNQD 3HBGA 3JWDH 5DVMA 3C2AH 1MCRA 3GMPA 1KCVH 3T9WA 4DTGL 1IM9B 5KVDL 3WTWA 2P5WE 4U05A 1H3PL 4JAMA 4Z0XA 4M62L 3P02A 1TZHA 1J1OL 5FKPA 1AZBA 4KH9A 4R0LB 3UBXG 4OUUB 2ICWA 4WEUD 4WUUB 4IMLA 4PJIE 2CJUH 5EEZA 2R23B 3IBEA 3DOIA 4P2OC 3MLYL 4X4YA 5KVGL 3V0VA 3BZ5A 3FN9A 4U1KA 3B2VL 1J8HA 2AMUA 2NY6C 3KYMB 3RAJH 3R19A 2YGVA 4LDEB 1HQRA 3B37A 4ZMWA 2CPUA 3BHBB 3QWNA 5KBMA 3QARA 2C9PA 4NAMA 4L0PB 4IRSC 1UH4A 5TJWK 3SGKA 1CFQB 3FPXA 5KG9A 1IQWL 2FB4L 1AP2B 1JHTB 2DWEB 4FG2A 1SDAB 3HHSA 1ZKAA 2OMVB 4GQRA 2H26B 3AXLB 4GXVH 4Y2LA 5EV7A 3SKNA 5CUSL 1CXEA 4DW2H 5I1CH 3JWOC 4DVBA 4LCYA 1GKEA 3ARFA 2HKHL 3SIKA 4QJ3B 5JW4R 2VR7A 4X7FC 2A74B 4PV9B 3WLBA 4U3XA 15C8H 4PSPA 1PD0A 4FTVB 4I85A 1FFNB 3H0TA 3VFOB 5F1IA 2C9RA 5KYWA 2D4FA 5A3IC 1IE5A 1JPFB 2ORBL 4HIQA 4JRYB 2H47C 2X9ZA 5SWSA 1MJUL 3LY6A 2ZYRA 1KCRH 2X89A 4P9ML 1PG7H 4KDVA 5FO9A 1UOLA 2VAAA 4MCNA 1R3HA 4WO0A 3HKFA 5DRXB 3MNVB 2NY2D 3SDCB 3ZGHA 2ZG1A 5C3LD 4ANXA 4ETQB 4NEHB 2P46B 3KR3L 4ELMB 1UWEL 4P5KB 5AUMA 1LD9B 1QEXA 3EO9H 1E4KA 3LN4A 3EFFA 4RQQB 1U8MA 4IRZL 6PAZA 3AACA 3FFCB 2VR3A 3VGFA 1DL7H 2LQRA 4W4NA 4R7DA 1CLZL 5ACMA 3N6YA 2WD0A 5CLYA 4JO3H 1E30A 2L8AA 1S7VA 4FFWD 4L3FA 5IT2L 2GIYA 3LIZH 4Z7WE 1MDTA 1M1XB 1SBBA 3M7OA 3WNJA 1S9VA 3L5WA 1NUDA 2UWEF 2V5SA 1B6UA 4P3CL 4LLUA 3B7RL 2AK1L 3K72B 5D7LE 1BX2A 1A1MA 4YHYC 1HAWA 1SDYA 1HWGB 5I2IA 1E65A 3EH4B 2OZNA 2WO3B 4K23L 4P9HH 3OJVC 3BH9B 4C4BA 2CXKA 2X3AA 1BD2D 5BVJB 4HUUB 3U4EA 4OF5A 3V0FA 2DBLL 3CDGB 4MMYB 4OIFA 1IM3B 2OKMA 2X53A 4HS6A 4PREA 2OSWA 4ZMPA 1ZT4A 5EBGA 3FU7A 2DWYA 2BP8B 1RIVH 4ZUVB 2FSEB 3KH3A 5JOEA 3LZRA 3ABMB 3F7YB 1M1XA 5F1KC 4I77H 2GSGA 2HUEA 4XB7A 2V9TA 2VDKL 2BDNL 4G70B 2AQSA 3D09A 5DLLA 1XZ0B 4LHUB 3C6EA 3DA0A 4GKSB 3CLWA 3CC1A 3F62A 2A9MH 4CRZA 2VL4A 1JRHL 3ATFA 4ICXA 2V37A 2GSIA 3KPRE 4P5SA 5EPMB 4F20A 3STZA 5I8OH 1FGVL 2IDUA 4AUUA 2DH3A 3QDGD 1HX0A 1BZDA 1PQHA 1ZV5A 5DQDL 3VXNA 4XMLL 3QDJE 1OE3A 5E5MA 4CSSA 3CVDA 3S8FB 3LEXB 3UAFA 4ENGA 1KEGH 4LLDB 4J3XA 1XGYL 2IWEA 4MBRA 1UJ3C 2BVYA 4AQ1A 4OLYH 3TBYA 3LNIA 5GHWH 1TZOA 3VXMB 3KBEA 3V0WL 3A4AA 5HJ3A 2KUTA 4XN2A 5KS9E 3IDGB 1AR1D 1G0XA 1UB5A 3BQUD 2ZPKH 3S2CA 1USZA 4C8XA 1QRND 2F74A 2I60L 2J56A 4V1DB 4ZJ9A 3SN6N 5FGCE 2Q86A 2XA3A 5ICYB 1NL0H 4LPCA 2FBJH 4OM0H 1ILUA 4WI4A 4S1SL 1ESOA 4MAZA 4OTXH 4WW2A 3L9RB 2WSPA 4XMZA 1J8HB 3GPEA 2E9IA 2OR9L 1ODUA 1IZJA 2CBPA 3KYMA 1UVQB 2LAAA 1T7ZA 1P53A 4FP8L 3O3DB 4YDJA 1PVHA 2J55A 1EU1A 2AK4D 2AKRB 4H13C 3ZE0B 3WXVL 1D6VH 3EZJB 2O1AA 4AYSA 5D5MF 3R18A 3IMBA 5FKPB 3O45B 4J3BA 1G7MA 1EJ6A 1XV8A 2CAKA 3OR7B 4DJMA 3GS0A 4N24A 1BM7A 4HWBL 2ZKXA 4ZSOE 4BDVA 3S34L 4HPOL 3RG1C 5FO8B 4HEPG 4H8UA 4J6RH 3V5HB 2C1OB 5DK0B 4K8RL 5IHUH 4P48A 4AEIL 1NMBH 1DHKA 2AI0L 3RB7A 1GOFA 2IDCA 2JKXA 2GUYA 4WEMB 3S98A 4F8PA 2XCMC 1YY8B 4WQOA 4YGVA 2OMTB 2WUCL 3QQ7A 4HXBH 3DWTA 1NGWA 2X4RA 2PXYC 1OPOA 1C9SA 5AKSA 3FUFA 4GFTB 1IBGH 2C9AA 4IEFA 2WNWA 1JDCA 4AE1A 1I85A 3EBHA 3IB4A 1WFMA 3AXHA 4PS4H 4DP0X 4O02B 3BPLB 1FZOA 4HKJA 4B9PA 3HG1E 4KFMA 1IARB 1CE1H 4WWKB 2WBXA 1QSEE 1FDLH 4WSJA 3X11B 1SF5A 5A16A 1R5IA 3T6ZA 1RURL 3O2WH 4FQIH 3N41B 4NM8L 3OSKA 3P77B 4Z7QF 43C9A 1YN6B 4RBPK 3RL2B 5EHFA 3T2NH 2KQMA 2ZOWA 3QQXA 2C3XA 1LP9F 3WAKA 1JZ4A 4IKNA 5DMKA 5IG7B 4L8CA 2YAFA 2AJSH 4KKBD 5DQJB 4DZ8A 2F5BH 2NY7L 1RUQH 1AFVH 1MCPL 3C5SA 3V6OA 2NNXA 3AXIA 1E0OB 2O6PA 1CK0H 1OZUA 3KGTA 3QQDA 4FC3E 3VG0L 4DZ8B 4HPYH 4WKZB 3SDAD 1WICA 2NW2B 3ALPA 1ET7A 3F84A 3KL0A 3BH8A 3JWDL 4UAOB 3CN1A 5HHVL 1UXWA 5BRQA 1ETA1 1G1CA 1V8HA 3ZQ9A 4ALAH 5ILTL 1HCZA 2CW0D 1OCWH 1H9DA 4P2RD 4YUEL 1FHNA 2GTZA 5LQBH 1LEKB 1SM3H 4NO2A 2ZCHH 3HRZB 3LRSB 5TQ2H 4P57B 4Y16A 3VX0A 5IR1A 5CINL 3ULVH 4L1HA 5FECB 4IDJH 4WRLA 5CNHA 4ZMTA 3MRNA 4HJIA 3DIFB 3RAJL 5CHNA 2X1PA 3ASWA 3IFLH 3QO0A 2OMTA 4MMXA 4PLJD 1YQ2A 1UHVA 4QRBA 1AVAA 5I9QB 3CVBA 4LVEA 5KSUA 3GLDA 3BZEA 4LOEA 4MKMA 4N85A 1T04B 4NM4H 5JHLA 3S5LG 2K0RA 1OTSD 3OAWA 4I48B 2CSPA 1S5HB 2NY4B 4UBDC 1L0YA 4G8EA 1VCBC 1U3JA 2BIIA 3LQAC 1TQVA 4P4RA 1NAKL 4BZ2A 1JMXA 1ZE3H 4UT9L 4JDTL 3ZDXF 4GRWE 1O9ZA 2DQMA 2F8XC 4N9GB 1T1ZA 4Z3TA 5DMJB 2V2WA 2JKJA 5I9QC 4JFZL 3Q1EA 3ECBB 4Y1SA 2VLLA 1HHKB 1T0MA 4JMXA 4POZC 5EU5A 2CLVB 3SPJA 4GMTL 5F7HA 2V7HB 3ZDYB 3RVUD 2ZUQC 2EXWC 3NGBB 2HMID 4ORZC 4F7EB 4PJGA 2HT3C 1ZHNB 3WFHB 3ZRSA 3EO9L 2Q86B 3ZU8A 3QH3B 4N2HA 4KFZC 3US9A 3EJPA 5FA4B 4POZD 1KCUL 4AMKL 4RFEA 3HN5A 1UXLA 3KVDD 3QJFA 3T8XA 2YRBA 2Y7NA 3VG9C 4JDZA 1A2YB 2VUOA 3O0RH 4X6BB 4H8WL 4HBQA 3Q2NA 5DS8A 4Z7QE 6CGTA 4WW2C 3OKOB 4UZUA 4Z23A 2VZUA 4Y2OA 3KPPA 5LNGA 3H3KA 2JKLA 1AI1H 1NTDA 5B1CA 4KXBA 3DETD 1VCAA 4N5UA 1KBBA 4UBDD 1G7LB 1INDL 4PJ5A 5DLMH 3I02B 5GJSH 1ZLEA 5C7XH 2ZXWB 2DTML 4QAWA 2DQCL 5JZ7C 1BMZA 4PJCF 1JWSB 1NGZB 3AZUA 3LKOA 1KTKE 4I5BB 1MHPH 4FYRA 4O2CA 1XEUA 4XMXA 1JG9A 1L6ZA 4OZIB 2XBDA 5A40E 1XZ0A 1YYMH 1NANH 2BVPB 1JDDA 3TNNB 3VWKC 4Y5VC 1WC7B 4MDIA 4Q2ZA 1MIMH 4HISA 3NTCH 4YXLL 1EPFA 1WWCA 2BSBA 5BO1L 5B39B 4NXSA 2WQWA 3M1BB 2BSSB 4A2HA 1N59B 2HJLA 2J6EH 3BRGC 4KJQD 1TMCB 4M9OA 4JFPB 4LSSL 2OYLA 3SE9L 5FCUL 4HZAA 4W93A 1KB5L 3RVXD 1R0AH 3P9MA 4O51A 3O6KL 1SPDA 2J6EA 3T3PE 1BX2B 1SXBA 3SKJL 4XNBA 1CD8A 1RPKA 4MJ6B 4AM0B 2VH5L 1T5WB 1KQFA 2DRUA 3UERA 3DX1A 1YEFL 2KPNA 2G5RA 2FQGA 1A1NB 1U42A 3U6RA 1ZSHA 2E9BA 2Y3AA 1RY7B 2CH8A 2DMRA 2QPDB 2PWFA 5I26A 1UKQA 3WHXB 1U95A 5E1QA 5ACLA 5MEPB 4KPHH 4NQCE 4XN9A 4HHWA 3DHMA 3LDBB 4JFWA 4KTYA 2APFA 2BFGA 1GGIL 2CUAA 4GKZB 4OLUH 4S1SH 2G9HA 2EKSB 5FF6A 3ZGIA 2Z4QB 1G7PA 1MHHB 1FF5A 3DYPA 3FK3A 2VWEE 2EZ0C 2Y69B 3DMMC 3FQ1A 3QDGE 1CURA 2QTEA 5D2NC 5F7DA 2JNZA 4TVPH 4X6DE 1MI5D 1DVXA 2XA8H 1KXVA 3L9EA 3ULUL 2G0LA 4S1RL 1T0OA 5HD8D 3X2HA 4UI2A 3BGFB 2H4EA 1NCHA 4X5QA 2DQ6A 5J6HB 1B9KA 5C08A 1E4KC 2JWYA 3RWDA 4PV9A 3WLBB 4L37A 2F15A 4R7LA 3CSGA 5IB4B 5C0AB 4F2ME 1MIEH 3TBWA 1R6VA 3X1NA 1VSCA 4J3VA 2ZOUA 1Q16A 1BFTA 3AG4B 3EDKA 2R7ZA 2B08A 3ZK0A 3GXNA 1XGZA 3N44F 5D2NA 4YR6A 1YUHA 3GHPA 4HKZA 4DEUA 4A7GA 4MNQB 1FNAA 1ZHBB 3REVA 4WFHD 4C56A 4OR1A 4EIGB 3SYAA 2CLZA 2APWA 4GQ9H 5ERWB 3MBEC 5TF1L 3HLAB 4KHTH 3J7HA 2R23A 3QFGA 4HLZH 3APDA 1E5ZA 2IDQA 2HFFB 1YEJH 2XKNB 4B6ZA 1T89C 4YZWA 3PS6A 2V3EA 2BSDA 4M5YH 5GRVL 4PGCA 1VFOA 4L1DA 2PW2B 2IFGA 3U36B 3CMOL 4KKNA 1XGUB 1GYAA 1EJFA 4QHNA 4Y5VA 3MJ8B 4OZGF 2LABA 3INUH 1DUYB 4HJUA 1WWAX 4IGBB 3MUY1 3IAGC 4JG0H 3WIHH 3AGWA 5H37A 4TNWK 1KIPA 2JVUA 4IOSA 1BMGA 4PRPA 4KTDH 2P8LA 5TQ0H 3NDZE 2Q1EA 5DEGB 2MRYA 3GMNB 1I7TB 1FH2A 3D0VA 4PJDA 1JNHB 1WFNA 5HHVH 3DVNA 4N8CH 5I18H 2YRZA 1S78C 3CIAA 1WS7A 3CHOA 4H2AA 4L29B 4AC4A 43CAB 1RP9A 3U0PA 2KQAA 1Z0MA 1FLRL 2ZXEB 1N67A 3H42L 1RHFA 4IKIA 3Q44A 5JIHA 3EDFA 2NQ3A 1WWBX 3NFSH 1OCZB 2YLKA 4IDJL 2ICWJ 1S7QB 2FVNA 5AZEH 1NEZA 3IFNL 4GW5B 3QJSB 4M48L 3SE3A 3W81A 2I26N 2EZ0D 5GLYA 2WCSA 3DMMD 2ZAIA 4HIIB 4RAVA 1WFTA 2R4SL 5E9DB 1K83A 1UACH 3VGAC 5A1AA 4NERA 5DDHB 3S36X 3U46B 2O61A 4JCLA 4LFHD 2VLJB 2R7EB 3H9YA 3KXFB 2JXMB 3JUYA 3VDAA 1W72A 5JORA 4GPVA 1CB4A 1UD8A 5EU6B 2G60H 5IBTH 2DIEA 3RGBA 1FH5L 5HPOA 3L3HB 1QZ1A 2CBMA 5MENB 5EEYA 1VPOL 2P43B 1PL3A 1VFUA 4ZUWA 5BXFA 3ARDA 2YQ3A 5ADOL 2VCOA 1S9KC 1JK9A 3PGCB 1MUJB 4X9IA 3F12B 4PTUA 3JXAA 3EF4A 1QLFA 2NXZD 1NKRA 1MCFA 4HIXH 2XETA 3Q6GH 1XH0A 2JJWA 4X98B 4UILL 3P3RA 1YG9A 3C75A 5I6KA 3AREA 3QIBD 2VW6A 2WLNA 4QNPF 4ICWA 2Z92A 3GEWB 4B9IA 2P48B 5FCSH 3SO3B 5JXEA 3KEHA 3G6JB 4P46D 4ZO6A 4BQCA 4M29A 5HGAA 2J5LC 1N8ZA 1HESA 4OZHF 4IBTA 2XFXB 5HGGS 2KLTA 3F5WB 4L8SB 5C0BE 4MMXC 2UZPA 4JO5A 1Q0EA 5BS0A 1AR1B 5J1SC 5MHSE 1MF2H 2PWEA 4FD0A 1SLWA 1DBMH 1YNLH 2B1OA 1EANA 3LB6D 3LH9A 4ADIA 1ZGLP 1TUPA 4QRQB 1NEPA 2HFGL 4FZEH 4Y5YB 1C5DB 2XDHA 4LSTH 1IKNC 3HG3A 4S11A 2A9DA 4A2GA 1JF1B 2IDFA 4MA1C 4XN8A 3D69B 4OCWL 4OZGE 3BQUA 5FYKL 2RD0A 2OI9B 5AVRB 3T0EC 3CPLA 5DHMC 3FONA 4KGJA 3T6QC 1JZ2A 5FYKU 5JZ7D 5HGAB 1GGYA 2L7UA 3SYQA 4XNXH 2PO6A 3BN9D 3FQ4A 3OXRB 2IANB 5CSBA 1A9EB 2JJTC 4FQQB 5JPMA 1BQHA 2VERN 3VSTA 4ZW6A 1JGUH 1PBYA 4YPGA 4HWUA 1KV3A 1UT9A 3VXSB 2PJJA 1ADQH 2JQZA 1U8HA 2A6IA 4DGVL 5KUMA 2P5EE 4P2OD 2ZWZA 2KHAA 1HHIB 3NACL 4ZMYA 4RMQA 3UAEA 1UZ6F 4OGXH 1DFXA 3FN3A 3FSWA 3L3HA 3VQ1C 1IM3D 1FP5A 3G5VB 3KCPB 3HKZA 3NJIA 5E2UL 3JV4B 1OHQA 2HTLD 4H20H 1FNSL 1RVFL 1CFVH 1MWAB 3ELAT 1T83A 2VLJA 1KJ3L 1MFDH 1RCYA 3QPQC 5F9WC 5T3XL 3KBHE 2X4TB 4ZS7L 4XO4A 4UAHA 3S6CA 4E9WA 2R0WL 1MHCA 2HTKD 1MXDA 1O6SA 5IM7A 1TFPA 2GFBA 4J4PD 5I0ZA 2J1XA 5CP7A 3DURB 4Z7UF 2DQFA 3PP4H 4NX0A 3VXSD 4W9DC 2KH2B 1FFTB 5EBLA 3HLKA 1ACYH 3OKDA 1CLYH 4RFNC 1B90A 3VXME 4F8NA 3MRGA 1IGJB 5F9OL 3TO4D 3P2TA 1BWWA 4ADGA 1MW1A 5JXED 4IJ3B 4NNYA 3FFCD 4YBQC 3IKCB 1AQHA 3QZPA 1CMOA 3DVNB 4CRYG 1U8IB 4AJWA 4X6FA 2X1OA 1BHGA 4X6DF 3KWUA 3GMNA 3JT2A 5C0CE 4RMSA 3K2MC 2WZ6A 2PF6A 5ECJE 4WTQA 3CFTA 2OTWB 4XBEL 5DD0H 3NK3A 4HIJB 3LYRA 4OZHE 3U1SL 2G75A 3MLYH 1SJVA 3I50H 1DUYA 2EDDA 4C4UA 3VFRA 3VD9A 1A6PA 2X87A 1BZ7B 3HVDA 4M3HA 4N0UA 4AW7A 2HWZH 3IJSA 5AOZA 4FYTA 4PI2A 4FQ1H 3LEYH 2QQQA 3KYOB 4KBPA 5IHZB 3QQ3B 3FQWA 1XB3A 2WINB 2R1WB 5IB1B 4KKAD 2IEPA 1EXUA 4AJYV 4ZMAT 3FAXA 3D2UA 4IBLT 5C09E 4BUHA 1GZPA 5TE7L 4WU5B 2LU4A 3H7BA 3T1FB 1WRFA 1GRWA 2QPSA 1PY0A 4JQXA 1AE6H 4U1GC 5I1IL 3VFMB 4D9QD 2DEYX 3LNHA 1YUHB 2BVOA 4HKZB 4NCC1 5F0JB 1OTTD 2XWZA 3RY6C 1NCBL 4GQ9L 4QRRD 2FX8L 4OD2B 3VI3A 5LGJB 4LSUH 4PS3A 1E50A 1H3GA 2VUMA 1CTNA 1YEJL 1JBJA 3U4KA 3V4UH 4Y4FD 4PRBB 4KROD 5EO9B 1F86A 2I5YL 3G04B 3HC4H 4YSRA 4JS7A 4NQCD 4DH2A 2B8OT 1TWFA 3NVQA 1HSBB 4HJGA 5LGYA 1PD6A 2A6ED 3RWJA 3IJ8A 2OCFD 2NW3A 4JY6B 4JG0L 3WIHL 3FTSA 3TPUB 4NCDA 2WJ7A 2D7MA 5DRWA 3HFFA 4JPIB 2ETWA 2LFEA 4PV8A 5ISZA 2ZUXA 2A9NH 5FHBH 2VDPB 4KDLA 5KEZA 2CO7A 5DFAA 1IEAA 5FOBA 5B38G 3M1OA 1KSRA 1U3NA 5D4QA 1L7IH 2L7EA 1YVLA 3BESR 4JM2F 4CGTA 5I5IA 4HT1L 4P9HL 1IIIA 2DQJL 4J2QA 4FCAA 4RAUB 1HDMA 2EAEA 1X9LA 5HJBA 2ZG2A 3FRUA 1E5YA 3VXOA 1OQXA 2MCPH 3DOSB 1NPUA 1XEDA 4I0PB 1KTRL 4Y4KD 3GRWL 1WGVA 3NCYP 5HDLA 4FFVD 1E32A 3LNDA 5C09D 1UACL 3WO3B 5IB2A 1F3DJ 1DJWA 4FJ6A 4NO3B 3TGXA 3CX5J 4I9WE 3ZYIA 3LS4L 3APFA 3J27A 5ESQA 5E94B 2VDRB 1QPKA 5D6CB 2D0GA 3L95A 5SX5K 5C0BB 1JS4A 3G08B 5IF0B 5T1LA 2EIZA 4QRPE 4R0LC 5DUMH 3GIVA 4I0PC 5TDOA 2DMKA 2JB6A 3QZNA 2NZ9D 2AANA 3TO2B 3AQDA 3EADA 2J1ZA 2VUYA 1RZFL 3T4AC 1INQA 4Z77B 2XTJC 3IDYB 3G6AA 2YC1B 4JKWA 5E56A 5C0AD 3LKOB 1DLHB 4OLVL 4TM9A 4MCZB 2X6CA 1UWGH 3HS0A 3RNQB 4MS8D 1YA5A 1RZJH 5J9PA 4Z5RB 4BFFA 3L2NA 1D7FA 1CDUA 2NDGA 3M3GA 5AOIA 3LQAL 1I9RH 1NGPL 2F53A 2ZP9A 4Z0BL 4ALAC 2FBJL 4OM0L 3D39D 3UPAA 3UYPA 4R83A 4PGBB 2ZNWA 3VB8A 2GBUA 5KSAC 4P06A 2LR4A 1N0XH 1OALA 1OHZA 1J5IA 3V6OE 5AW1B 3RDTB 1OW0A 4XAKD 2ENJA 3U2JA 1PQEA 5D6DA 3U0TB 3QB7C 4PRHA 1GGTA 1NCDL 3QIWC 4F7MA 3P30L 4CDHA 2EE9A 1ZHNA 3NSFA 4I1NB 5DJ6B 3IPFA 3LZNA 3MFFA 4HJ0D 4JPKH 4XX1G 1M6UA 5B21A 5BZXA 4DK6A 2ADGB 2IQ9H 1DUZA 5BZDA 2WTPA 3D3VD 3HNVH 5CU5A 4ZPTA 3N2JA 3ZHKA 5GGRB 4PWKA 3NCJH 4WF7A 2Z34A 4ZK8A 2V2WB 3QG7L 4XVTH 2F08A 2VRKA 1P6FA 2WZAA 2PXYB 1FV1A 4YK4B 1CZ8H 2XG4A 4CUCA 5C0IB 2DJ4A 2DN7A 1RSFA 2EKJA 1J87A 1ZY9A 5E2UH 1X5IA 4Y1TA 1URIA 2BSCA 3L2MA 5HDQH 3D07A 3BUPA 4FNLL 1PZ5A 3VD5A 3GJFB 1RVFH 3ARBD 5DK3A 1M6OA 1CGWA 2D03L 5DYIA 2BJML 3BPNB 4DP5X 5A2CA 3BZEB 2UVFA 4P2CG 4LLMB 4Q58C 4O4YH 1BEXA 2EYRA 3J07A 1W0WA 1U0QA 1YNND 2PTVA 3THMH 4XTRD 1OM3L 3GZOA 3T65B 3GXPA 3RIFK 5J7CC 3MOAL 2JK5A 1AFVL 3RI5K 5GSRB 5BOJA 3AAZA 1LO0H 3VG0H 3KJ6H 3PXHA 1NWOA 2IQAB 2JJUA 3VH8B 3FKIA 5F9JA 5H8DA 3MO1A 1XIWD 3M17B 1YJDC 1A7PL 5SX4H 2LOEA 3MV7B 5GS2H 1VF5C 2W92A 5I71C 5F7MC 3DGCR 2QGBA 3Q9QA 4MQTB 4LIQE 5DWUH 3W39B 1WZMA 1F3JB 5LQBL 1MVUB 5CEZD 4YVUA 2ODIA 4LL4A 2M26A 1E60A 1KN2L 1E4HA 3GI9L 4WHTB 1EEQA 3LEYL 3HZYA 3MREA 5EOQH 5I8CB 1TSHA 5CCJA 3MR9A 2R2HA 4PRHD 1GGCH 5AW5B 1IQDB 1KCKA 5E2TL 4F9PC 5HPMB 43C9B 4Y4HC 5A16B 1M7DA 3QUZB 4JM2A 3MRDB 4BA8A 2XN9D 2Y5TB 3AGVA 2F19H 3MJGX 5F9WB 2Y07L 4YSQA 2OPCA 4XPFL 3RGVC 3TV8A 2X41A 1JZ5A 2WLYA 3U30C 4HWZB 4DEPC 3WFCL 2X1XR 1NAKH 1NGWB 1ZIAA 3MV01 1FAKT 3L7FB 3WN5A 1F3RB 2BOBA 5I0WA 2X6VA 3VXUA 5JPNA 1NDGB 2H9GA 4MCMA 1N5YL 2PYEA 3VXQA 5C3IA 1DQML 4JPSA 2R4RH 4KO6A 4OFYA 2NY4D 1ZA6B 1OP3H 4Q89A 2DLFL 2B63A 2VIRA 4R5TA 3QUMA 5DYGA 3RVTD 3FUNA 2P24A 3MX0A 4MGXA 2HLAA 3GHEL 4GB9A 1BZOA 2I5YH 4N8VG 4KKCD 1A6TB 4NKOB 3OMZA 2OR8A 3RL1A 2CDGA 2CRZA 3BSGA 4FMKA 3SDXE 4G6FD 2NYZA 4ODXB 2ZOLB 2CMRL 1WISA 2ZWKA 3BH4A 3ZMNA 1A02N 4EKJA 1HI6A 4JY5H 3WD5L 5IMLB 5JHDA 3MACL 2AF2A 1F11B 2VDMH 5E4OA 1JNNL 4ATTA 2OMWA 1UGNA 4U1SA 1UASA 4H8WH 1MFCH 1EBPA 4HMCA 2FEJA 1TYJA 1VGKB 3RNKA 4XPHL 3ABGA 4PJEB 2VDNL 5KYUB 4JG1L 5ICYA 6FABL 4M7ZB 2LE9A 4UM8B 3RVUC 2W07B 1MCNA 1AZZC 4YDNA 2F74B 1ZT1A 4JY4A 3FT3A 1OWWA 1P5UA 3P0YH 2EDJA 5GJSL 2QHRH 1TO5A 1GC1L 1S5IL 3BWAA 4PP1C 3D06A 3PDDA 4Z7VF 3V4PA 3V7AE 5JW4N 4TVPE 3PLYA 2NY4C 2PMZA 4WTXA 1D5XA 1HQ4B 3TIDA 1X7SA 3N43B 1X5MA 1ZPUA 4AQ1B 3SPGA 2X4OB 5EU3B 1CGTA 1X9QA 3KPQB 1NOAA 5BVPH 3N40F 1VGEL 1ZTXH 4ES9A 5EULV 5IOKA 2JIMA 3AQZA 3D9AH 1HZLA 1C08A 1ZK5A 4LF3B 4IHOB 3GTLA 3GC3A 1XF3A 1R34A 4JNXA 1OTSC 2IH1A 1NGQH 4MCZA 2BXYA 4YHIB 2Q7AA 3VQLA 3VH8G 1UOWA 1K8IA 5F1NA 5HHME 1E90A 3PHSA 1CGXA 3PPSA 1LLAA 1MG3C 2ZUSA 4LEEA 1H19A 1M9SA 1Z9MA 3QRGH 1PZSA 1JWMA 3PHOA 3X13A 5CILH 5D7EA 4DUXA 2FO8A 3EJZD 4PUBL 4L18A 2WJ5A 3F7YA 5CP3H 1JGIA 1JTPA 1RU9L 2UX7A 5CSZA 3CVCA 4X42A 2E74C 2VXSH 4WFHE 3DX4A 4LOUD 4N8VA 5BCAA 2BO0A 2QV4A 3R7QA 2EIZB 2HJKB 4WV1C 4G8IA 5IUCA 3C8DA 2VO8A 4UNVA 3ZKSD 1ACZA 4HWBA 3BUYA 4JANA 1JV5B 3D7PA 2EH7L 3U7YL 4I18A 1NFAA 3I9IA 2QGEA 3DJTA 2X1QA 5IMKB 4Q4IA 4JANB 1QDNA 1E8WA 3RA7H 5BQ7A 1GGUA 2GW5A 1K8DA 4KJPD 4QRTB 1HYRC 3HTLX 4TQEL 1XBDA 4Q74A 5FO7B 1B2YA 5KVEE 3FUKA 3S7GA 3QFJB 2IOIA 1QQDA 5CSZB 2BOCB 3WDIA 2QZ5A 1S9VB 4JFED 1HDMB 1JZ6A 1OZTG 5DZJA 5F89B 4PG9B 1QI4A 4PRPD 2AQPA 3JV0A 2L04A 3MMEA 4PCKA 2IF7A 3UZEA 3WFBH 4NYLA 3VVWA 3O8XB 4XNAA 2W1NA 1AQKL 1JXJA 2VQTA 3ATDA 3L4YA 5JHLH 4D0DB 5A2FA 4F37F 4XP5L 5EUOF 3PHQB 4M8RA 3IBOA 4ETQA 4MLSA 4BGLA 2C9XA 4GG8A 3ME0A 1MIEL 2CDFB 5K93A 4NKMB 4LP8A 1G1YA 4KDTA 5I1EL 5KSVB 3CLEL 4U6VL 1VZGA 4JFQA 5FAAA 4GUOA 1YPZF 2VDQB 3BUTA 3ARBC 4YAQB 2EUWA 4AL8H 2B5IC 2EIBA 1AZCA 5FK9A 1H15B 1P2CA 4RSYA 5FUCE 2A74A 2XV3A 4YHNA 1AW8B 1E61A 5E8DH 5DZLA 4DVBB 4Y19A 5EC1A 2CU9A 4QJ4B 1CXHA 2OMVA 4ZAKB 4IM8A 4HJ1A 2P26A 4QRSB 1UD2A 4PH8A 4W4OA 3NABH 4XXWA 1E4JA 2AGJH 2AJUL 1HQRB 3CZJA 4ZSOA 5C08E 1OM3H 1F11A 3OC8A 3C5ZA 2CJTA 2D0HA 1P1ZB 4UZSA 3MLSH 4N0RA 2P8PA 2I25N 4HMDA 3KZ8A 4AIZA 1FSKB 2OSLB 3DGGA 4KAQH 2LU7A 3W5NA 3WKMH 3N43F 3MOAH 2J57A 5IB5A 3LHAA 2VL5B 3E9TA 4ZDHA 2MCG1 1U2HA 3EJJX 4HULB 3MODH 1PX4A 3I9GL 2OYMA 4G9FB 1NUGA 4NKOA 4BWWA 4QT5A 3UTQA 5B6CA 2DL9A 4PY8J 4DKAA 3P0VH 3DTXB 2QLYA 2A4ZA 3QUYD 3I84A 4UTBA 1AGBA 1OP5K 4MS8C 3G5YA 1FZKA 3V4VL 3KG5A 3SBWA 4ZFZA 1SUJA 4OUOA 4KRPC 3GTVA 5BMFH 2X89D 2BOBB 2UXTA 3K81A 1REIA 3MV9B 1V5JA 4AK1A 4HS8L 4LEBA 1KXHA 1SY6H 1KXTA 3X2KA 2DM7A 3ZE0E 2F8OA 1KN2H 1KNOA 5DR5H 1MCEA 4YHMH 5LNEA 5C07E 4F57L 4HCRH 4JP7A 4AL8C 5CD3B 3GIZL 4BFJA 1EDQA 3D1MC 3GMRA 4JFFD 4X4KA 4BSWB 4R8WH 4YLQT 2WXPA 1IGIH 1R3JA 1CIDA 1FVEB 1TZIB 2VSMB 2XG5A 1TTCA 1LMKA 3ECQA 3UJIL 4TSCH 4EIUA 1ZC1A 1B4JL 1ZHLA 2ZX7A 5E03A 4WI3A 2OMZA 3RFRA 5E2VL 2J2ZA 1JI2A 2YD6A 4JZOA 5EWIH 3WFCH 5JIQA 4R3SB 5CGBA 1FH5H 2OMBA 1DVYA 3FNKA 4N25A 3UEZA 2R0KL 5CEZL 4IU3A 2IWGA 1WD8A 1YEGH 1MHCB 4J3UA 2WXIA 5IJDC 4Y4KC 5KOMC 4OB5L 3GTMA 2HRGA 5T3XD 3KJ4B 2YAHA 3FT9A 2PYED 3V4VA 1J0IA 3BGFC 4DESA 1O6VA 4PGDB 4OQTA 3HU1A 4EPSA 4PJHB 4B53A 3QDJB 5GZOA 1T0PB 3FTZA 4Y5XC 1MVFA 1ZK9A 1G9HA 3T0BA 1KG0B 5K59E 3OHXB 3BPNC 1CCZA 2EVIA 4V11A 2MOGA 4HV8B 3LKRB 2WGXA 3F7VA 2R2EB 3N06B 1AZVA 4KKRA 4MMZC 4WSGA 4H26A 4NHCL 2W80C 3NFPB 5C0JB 3H4FA 2CMRH 5JR1H 5A7EA 1ZVYA 1FFQA 1INEL 4R97C 3CZFB 1HEZB 3BIKA 4X7TB 5I16B 2FTAA 2EYRB 1U6AH 1IKOP 2I32A 5EIQA 4KX8A 4XPHH 2Z7UA 3VFVA 4P3CH 4XP4L 2TSAA 1U8OA 4JB9H 1AXTH 4OT1L 1IEBB 3TBVB 5L0QC 4WGVB 2ED6A 1A0QH 1I7UB 2ERJC 1H9VA 1AO7B 3PYCA 3SE6A 4IYKA 2XWTA 4Q6IA 2WNKA 4PJGE 1XGQB 4DFHA 4Y5YA 3GFUA 4BKTC 1FNGA 3BP5A 4YHLH 4XWOC 3I74A 4HG4K 2OTUA 2ZX6A 3FB6B 2QQNH 3KHOA 3DDGA 3QHFL 4KKQA 4M7LL 1I1AB 1YDPB 1D5RA 3D4ZA 5BZDB 5BW7C 4PRAA 3KYNA 4CAGA 4WNQA 1NFIB 2J44A 3PJNA 2HVKA 1QHOA 1NAMB 2K3TA 1M9WA 3WLWC 4CC1A 1P4BH 1JNLH 5H2BA 2E8ZA 3AREB 1JRHH 1A7RH 4DOHE 4KV5E 2CUMA 2VKXA 3IN0A 2VW7A 3B9KC 4Y2DA 2X6BA 4APXB 3CD4A 3S3PA 3IEAA 4NZUL 2FWOA 3TJHD 3CIQA 1K72A 4PW9A 4D0CB 2HFTA 4HJJH 4URTB 4XVUD 3VU2A 3UYPB 1K5NB 3WN6A 1G8JA 3K1KC 2Z31D 5I73C 2XVBA 4RX4A 4TSBL 2O5YH 3N0AA 3VGAB 5LO7A 3RTQB 1V54B 3L1GA 2YPKB 3FW6A 2FE0A 4NQVA 4B0MM 3FQNB 4Q6IC 4G9FE 4M3JA 3B8SA 5GJTH 3G5XB 1QHQA 2O26U 1YEDB 3RNQA 2DL2A 3OMAB 4F27A 2AXGB 3UIZA 4MJIB 3RWEB 1KB9K 3ARDD 4HCFA 5FYJH 3BD3A 4HIIA 2WLIB 4WUKL 1HSAA 4JVUA 1KELH 2FBOJ 1RHHA 3MI6A 2PICA 3K8KA 4TUOB 4QRUB 3K1DA 4NNXB 1G43A 4LPUA 3GXIA 4MVBD 4MA1B 4L5FE 3TO4C 1RZGA 1DLFL 1LVEA 1N0LB 5AW0B 3EBGA 3F2LA 5DS2A 4EI5A 4BH8B 2DQIL 4NRXA 2CGRH 3KWVA 4OSUH 3MCKA 4HH9B 1XF2A 2FUTA 5E99H 3WTVA 5K1JA 3R4RA 5D1ZB 5DRZB 4GEIA 3K6IA 5D5ME 1D6VL 2BP0A 2R69A 5FYJU 5C0BA 3QI9A 1TENA 3GT6A 4MNGE 4PJFA 3MXVH 3CSPA 4IIQB 1EEYB 2BE5D 2EUXA 2BVQA 1BMWA 2BY2A 4J6IA 1PZUB 4RFOL 4IMKC 5I1EH 5IQOA 4U1JB 1CDBA 2Z31C 4Y4KA 1HHJA 2F54D 5AB9A 3MJ8A 5CZVL 3VDCA 4UQEA 4XVUC 2AJZB 4RGNB 2OXGB 5DJDB 4JPVH 2PTTA 4PGEB 3TA3A 1MWAH 4GIPD 5HHPA 4CMHB 4Z7NE 2X2HA 3V4PL 3OXSB 3CXFA 5LWYH 2XKNA 2FX7H 1SMAA 1OARL 4XZUA 3U7WH 5FOBB 2G9KA 3OWEA 3BT0A 4S0HA 1FRGL 4PJGF 3VDBA 4LOFA 3PP3H 4QWWD 3T0ED 3DRQA 2NRDA 3DBSA 5TDPA 1WEJL 2VO5A 3UJJL 2C26A 1R33A 2RR3A 3GLZA 2WQ8A 4XWOD 2NY7H 3D25A 5EFIA 1EA9C 4I0CC 4HJGB 1K4DA 4MJID 3WEXB 5L8LB 5ELIA 5C86A 4NDMA 4XMTA 3S3SA 1BJ1J 4TNEA 5F8QC 2IPUK 1RJZB 3MRPA 5DJCA 5EZOH 3DV6B 1QSVA 5KVMC 4Q6KA 2GIMA 3OGCA 5KVFH 1PZ3A 4APQC 1UWFA 2Z31B 3OGOE 3LB6C 4JRFA 4FXGB 1G7JA 2HT4D 4WNSA 1CPUA 1SM3L 4RRPA 2YUJA 2GJJA 5TDPB 3SBRA 2V9RA 1SY6L 2JKSA 3EJYC 3HIZA 3JWNH 2A9AA 4N6RA 4HCRL 1KJVA 1UZ6E 4KVNL 4F93B 4GLRH 4G7RB 1J9QA 2H1LM 2DKMA 4JHUA 3ZQWA 3NRFA 3IGLA 3MLWL 4K94H 3FOLA 4FFYH 5DMGD 4LQFH 3OKKA 5CZRA 2WXJA 4OF6A 4TSCL 3MGTA 2DM3A 4K71B 3U6XA 5IHZA 5G4NA 2ED9A 2HN7B 1YEEL 1V05A 2N3JA 1DQKA 1NCJA 2W9DH 4BFNA 2P8MA 4A63A 1DO5A 1XFPA 4KI5C 4UT9H 3D0LB 5IK3A 1UWXK 1ZVSB 2QKIA 3IN2A 3UAJA 3FB5A 3PIQA 3MNZA 1JPTH 3CSFA 5LXGH 1G6RH 1KCLA 4U1NB 2GC7C 3OAUH 1CQKA 2EUZA 5GS1A 3HR6A 2NX5A 3GSVA 1LK2B 3MAWA 2NQCA 1BF8A 3CVIL 3A3YB 1AO7D 4M5ZH 4AV5A 3UTZB 2ADIB 1A6VH 2YAMA 4Y88A 5HY9A 2XHNA 4XWGL 3KLLA 3NIFF 1U21A 4NGHL 4RAHA 2ZF9A 4M5TA 2GITB 4FXGC 1HH9A 5ETUB 1I8IA 2WYIA 1E9QB 4NRXB 2XOTA 3LTVA 3MGOB 4JKMA 1LO2H 3IDJA 4G8FA 1SLXA 3BW9B 1N0LA 1UG9A 5K9JH 4N86A 2CDEB 1TWCA 1YMMD 1NGPH 2JLLA 5DK2B 3HE6C 2ICES 1MRCL 1I9JL 3NSYA 3BP6A 1AR2A 1HSAB 4U1MB 1ZS8B 5IUSA 2AEPH 3TV3H 1S78D 2QADB 1NAMH 3L3JA 5ESVB 3WY1A 1SOQA 3EH5B 2PW1A 2C7UA 1S3KH 3AJ7A 3TEUA 1A7OH 2ESVE 4L3EB 2GB2A 5ICUA 1CFSB 2IAMC 4NQCA 1M7IB 3FS9A 3KL3A 1SFOA 4FQCL 4MD5B 1FHGA 1Z3RA 3II3A 3ZUCA 5E6ID 3QWZA 4Y2OB 2YQBA 3HE7B 4HWNA 3RJDA 2WXKA 1K6QL 1UZ8A 1RMFH 3Q1SH 4X80H 1DP0A 2XWBB 3NA9L 4HF5H 1U8HB 4PRID 4FFTA 1LQSR 2AJYH 3MRBA 1T5XA 2WW8A 3QHFH 3GI8L 1U8NB 4KQ4H 4M7LH 5HI4C 5K1VA 4PJ9A 5ACZA 3ML9A 3NAAL 4AW4A 1HT6A 5I1KH 4HEME 1T2QL 3EDDA 2XBTA 4FQQA 4A6YL 4DO4A 3U1PA 5BO1H 1N4XH 1XO8A 1IT9H 2OJZH 2H32B 3CFBA 2NY0C 3WFHA 1IX2A 4OZ4B 5ANMA 4JFFB 5BOZG 2GHWB 4NKIH 1A7RL 3MRQB 5EU5B 1FIGL 3PP3K 4MHHI 5FYKD 4FLQA 3QYNA 1IMHC 2E6JA 3HE6D 2DICA 4HX1B 3WTTA 3D08A 2R2BB 3FO0L 1DQDH 3GSRB 4P05A 4OBRA 4BJLA 1YC8A 4CC0A 2RALA 4XOEA 4F1SA 1XT5A 4GXUN 2AV1A 1WHPA 1ED3A 3M88A 1YNTB 3MLUH 5ALBL 2OMYB 3JVGA 4NN6C 3EO0A 1LM8V 3OKLB 1LYQA 3CFDA 4ZUTB 5KSUB 2YGNA 1P4IH 2VQ1A 2OK0L 4IK6A 1NC2D 4LHUG 3GTPA 2DQDL 2W88A 5B4MC 1QEWB 3T0XA 3RKPA 5E8OA 5CHNB 3HA0A 3O9WD 1GGIH 2ZOOA 1DLFH 3HB3C 4AVRA 3IJYB 2FYVA 3VFNB 3ENGA 4KKZA 4XAKE 1A9VA 3AQYA 3JWNG 1E2VA 1A14L 4HKBA 4WU7B 2CLRA 1F6LL 1V55B 4JLRB 1SF3A 1SVCP 1NIAA 3ABZA 3NT0A 1X5ZA 4N2LA 3TASA 5DSCB 2ADFL 2FB4H 1A8JH 5DDHA 3TJEL 2NVYA 2DI8A 4QCIB 2QSVA 4K7PH 5CU9A 3L3DB 4L1LA 5D1ZI 5F7WC 4Z76A 4K9EL 1J9CT 5E2WH 2LT9A 1C1EL 5EBMB 1OM9A 3MXWH 3DO7B 1YN7A 1UCTA 2WBJB 3OF6D 3BLKA 4APQD 3CBJB 4JPVL 1P9MA 5KBDA 1HTYA 2VPYA 3P77A 2H8PB 1JCKA 1R3JB 2IVFC 1MI5E 1OARH 4WWKA 3U7WL 4YDIH 5ISZE 2UUDK 1AYOA 1FZOB 1D5IH 1JYNA 2N7SA 2A99A 3ALWA 5K9OA 5I28A 4DKTA 4EI6A 4KK6C 4PRPB 4J39A 4F7KA 4KNUA 3D50A 1R5VB 3UJJH 4QYOB 5HHOA 3AU1B 3DVGA 1PKQA 5J1TC 3QFJD 4K8RD 4ODUB 4YFDB 3QC5X 3QDME 1FG2B 3MRIB 3H3BC 5GRUH 2DM4A 5TQ0L 2ZYSA 1Z9OA 2Q7NA 1LO5B 2UZYA 4PP1D 3UTQB 4KNQA 4NZJA 5KVEH 4QXUH 1GZHA 4N4YB 5CIPA 3DX9B 1I7RA 3HZKB 1UGKA 3FQUB 4JE4B 3L3OA 3RWHB 5D7JA 5FC9A 5ERWA 2F5AL 4PJXF 1GC1H 2IDTA 3B43A 4HUNB 1T21A 4QHMA 3RIAK 5IKCA 1COBA 1NICA 2BHYA 3H42H 3KEDA 1ZHBA 3P3YA 3RUGE 4HLZG 2JLPA 1SMYD 4G11A 1TMOA 4L9LB 1V7NL 1Q9OA 3MKKA 4ZFQA 4C55A 3JTSA 4W6XB 2HT3D 4F2MB 1CR9H 1X6NA 2E3VA 1FGNL 4NQTA 4BUGA 1JGLH 1G4RA 1ZHKB 4I9WD 3L5JA 4Y19B 5EC1B 4A2EA 5IB4A 2ZCKL 1SQ2N 4N68A 3BAEH 3KYAA 1D5BB 3QZWA 5G55A 3ZE2E 1DMSA 1MCJA 4HOXA 1K4CA 1IC4H 5DZNA 4FG0A 1CXLA 2XWEA 3B8YA 3HOGA 4LNRA 4QRPA 3TA4D 3HC0A 3BKMH 3AUWB 3BDYH 3IRCA 2KDYA 1FYTD 5H94B 4YNYA 2OJEA 2IALB 3N5AA 4K8RC 4YGAB 2E2HA 1XXDC 1IAIH 5DVLA 2VISB 2E7LC 5E5MB 5GPRA 2QLVB 2EDYA 3HU3A 4K3EH 4GAAA 4QJ5B 1DR9A 3BZFA 3X2GA 2ESVA 4LVOC 4HH8A 3Q6GL 3G6JE 5EPMA 1MNUH 5F7YC 4XNUL 4E0RB 1TQBC 4LLYA 4AH2A 4KO9A 4TLUA 1Z9LA 5MEPA 4M56A 2MEJB 1YUKB 4PW4A 4JHAL 5ICXB 3WIFA 4XHJD 3WNMA 4JREB 4AKOA 4GNKB 4PSRA 4EF3A 4LP4A 5FW8A 3FT2B 3RA7L 1L9OA 4YH6A 1G9MC 2FSEA 1S7WB 2X10A 1XXFC 1F6AA 1NL0L 3CQPA 1MRCH 1HD5A 3D52A 2HB0A 3HE7D 3IF1A 1X5KA 3PWPD 3CDGA 1TG8A 4J3OD 4WGWB 1IL1A 1G6RB 3WKQA 3F7RA 2V5TA 2VLRE 4DPRA 4XXDB 5BVJA 3ZDZF 4KKBC 2GABA 2G30A 4AYFB 3IGAA 2YD7A 1QYGH 1XL6A 3ARXA 2YUVA 2F8VA 3LZPA 4H0HB 3V7AG 4F9LC 5LG6A 1D5ZA 4KJWD 1OD7A 3E3QE 5JUEL 3MOQA 3WGUB 3MN8A 4QGYA 4TLKA 2IPKA 4C83B 2OS7A 1KZYA 4N8VB 3ZTNL 3TN0A 3UDWA 3ZO9A 3KWTA 2MOQA 4IBYA 4EI5D 2EO1A 2V5RA 1WC7A 1KTDA 4YMPA 1JNJA 3VWJC 4JDVB 3IFPB 1IAIM 5C6WH 3LNGA 2K78A 3KNBB 5BRZB 2XC8A 2IOMA 2QV2A 3L4CA 1BQLL 1TQCB 3VD0A 1YNKH 1PFOA 4GQQA 5DFWH 3O3UN 5FFGA 4X0NA 3V0HA 4XMVA 1J0KA 4M6NL 5D7SH 5AVZB 5KZCB 1KB9J 4LLYB 3OX8B 1KFAL 3MV8A 1XH2A 3NOIA 4NPYB 2R27A 3MCYA 4N5EC 4YBLB 4N3UA 3I02A 5DRXA 1FIGH 4X0KB 2G6GA 5FKAB 5MI0C 2VISA 4QKXB 2XTJE 3ZKXC 4PJ8D 1T80A 4W9CC 3SYCA 3GSWA 5T1KD 5EU3A 3ABLB 1G9NH 4HFUL 5HHMD 2Z93B 1A2YA 1AY1L 4X6BA 4PJ5D 1FFNA 3H0TB 4AX3A 5IESL 1W2KT 4W9LC 4FFZH 4RFEB 3I6SA 1QUNB 4ABVA 2NQDA 3HI5L 2WN2A 3MLSL 4YPJA 4K7FA 1SRDA 3MLUL 4XN5A 9CGTA 4X8XA 1XIWB 2IAMB 4YHPB 5TDNA 5I1GL 1LL1A 5GLFA 1OVZA 1YJDL 1FC2D 4C4KT 4F7EA 1G5AA 4YC2B 1CFQA 3HS8A 4Z9KB 4AYGA 1NPNA 2YFOA 4L3CA 3UP1A 2Z7WA 4G3YL 2RBLA 2V9QA 4FA7B 3ECBA 2XTLA 3ARGB 3VXRD 1LE9A 3N91A 4NAJA 1CXFA 1YC7A 2CCVA 3H9SB 3NJVA 5DUBB 4YUEH 1GAFL 3DROB 1Z3GL 4A2DA 2WLKA 5GGQH 1FBIL 1JK8A 5JXAH 2CDGB 3OKNB 2DWXA 3TEWA 3K0YA 2UVEA 4Y4FA 1AR1C 2FT7A 3D0AA 4EN3C 1MG2C 4K73A 4FQ1L 4MDRA 3IFLL 1PY4A 5CR8A 1QBML 3MRKA 4MXWL 2X3BA 4GRMA 5DJZB 1QTYT 5EB9A 4J23A 3WN5B 5TE7H 3SPVA 4ZD3H 4JHWH 4Z78B 5FDYA 3EUUA 3ERXA 3BUQA 4RSVA 3VD7A 5DC2A 1F90H 5I1IH 4D94A 4FKEA 4N0YL 4R90H 3LN5B 3ZL4L 4P2QB 3DLQR 4QXTB 5B8CB 4J8RB 1HXYA 1TVHA 1ILSA 3FFDA 4F2FA 1MLCA 4PJHE 1SMOA 1ITCA 3P9LA 1BQRA 3OB8A 4YDIL 5C0RH 3BKCL 2FWUA 2R2HB 3V6ZB 2WBWB 3IXAA 4M1GH 3VA6A 3MBWA 5EO1B 4FGMA 1G9ML 1OCCB 4WFGE 3G9VA 3GGWB 5A2AA 1J18A 1S4IA 2B4CC 1H6UA 1GHFL 1QBBA 2OBGA 2QZQA 1OF2A 5C09A 4JO2L 3I6KB 5KANG 1A5FL 3FO9B 1DO6A 2CCWA 4NHCH 2ZXAA 4QO1B 4EMZA 4L8CB 5AVTB 4RH4A 5HYJE 2E7DA 4BH7B 4UUJB 5IVXA 3SGEH 5FUZL 3QORB 2IAAC 3VXTA 3OZ9H 2H2SC 1BD2E 4E9RA 2WWMC 3MNWA 4PWGA 4JB9L 4J8RA 3EOYG 4L5FH 4BFGA 3EYQD 5KTEH 1PLGL 2D9QB 2F9BT 1DJSA 2FCBA 1Y1WA 4HT1H 1L5GB 1DVZA 3M46A 2DH2A 1W0WB 3IDNB 1JFQL 4WHYH 4ATWA 3O6FB 1C5BH 2YD4A 4XPGH 3WJMA 3QXTA 2HT4C 4BFIB 3SJVE 3H2WA 1NQBA 3KVQA 4U2YA 2XQYG 1TZAA 3QJVB 1VADB 3U4BL 1JPSH 2WP3T 2QQNL 4XPBL 5EZIH 4OD3H 1JGLL 4PU2A 1CGYA 3NQKA 5C0BD 2NY2C 2UY6B 5F97E 5IOPA 2O5NA 1ED3B 3BAEL 3IWUA 3DHUA 1MIML 2A73B 5HDWA 2C9VA 3BUIA 3TYFB 3CDYA 1AJ7H 4WWNA 3N55A 3WKNA 4Y8AA 2EECA 3FCGA 3VWJD 1DZBA 3B9VA 1BGXL 5I1AB 4CKVX 3GSRA 4KK5C 3K2IA 1LEIB 1OT4A 2AKRA 1S9YA 5MENE 2OL3L 2JIQA 1F45A 4IBUA 3ZZLA 4IRSD 4W9GC 3DOHA 1OTTC 3WN5C 2BS71 4BFOA 4A7VA 1F58H 1NBZB 4K3EL 4NP4H 3PWNA 5JNYA 4X9HA 2CBTA 5D7LD 5E95B 5CS7A 4ESKA 3Q3GB 4ECNA 3SKJH 2XXFA 1WQVT 1QLRB 4ZX4A 1KTCA 3C8HA 3TNMB 4JRLA 4HIPA 4F7MB 4P2AA 2IAMA 2YGPA 3B2MA 1FA4A 4XVOA 3GKWL 1HCVA 4ZPVB 4K7FB 3K0WA 4G1MB 1ND0B 5FEBA 5EH1A 3VXMA 5CEXA 4MQ7A 2FQDA 4FABL 4JN2B 4XP9H 3CFMA 5ESAB 5JTWA 1J8KA 3MJWA 3IDMB 5KVDE 4U1GB 4U31A 1ACXA 4MD5A 5AD0B 3DUUA 3FRPA 1O7DC 3VMOA 5H4UA 2G3MA 3HG0A 3TT1L 4BFKA 3RFZB 4NQCB 4QYAA 4Z5RA 1QI5A 32C2A 1QSFD 1DSFH 5T5NF 2WP3O 4NZ8A 5KVFE 2NY0B 2ED8A 3NJNA 5GGUA 2KL6A 1MFNA 3GJFK 3G6AB 4MA7L 4JFDB 5DZAA 3BP6B 1GR7A 4AGLA 5J6GA 3MXVL 2JJVA 2NNAA 2XQYK 1T7XA 1BIHA 1I8AA 3EFDH 3QUMH 2IH3B 4P04A 1FCGA 2ZXQA 1LEGB 4YL9A 5DHVB 1HH9B 2JB6B 3BRFA 4P0DA 4FXKB 1ICTA 4X8GA 4ZUVA 5DUPL 3TN0B 4FXTA 3S36L 2YAOA 35C8H 4B0MB 1MY5A 3OBAA 5K5YA 2X4PA 4Z3GA 3ZL1A 2P44B 2FD6L 1MWAL 4I18C 1HKLL 1ET5A 5FGBC 1BA9A 3LZFH 2FAUA 2VRQA 3ZDZB 2OMXB 5LWYL 1PQZB 4MNQE 5ENWA 4OD1H 1WT5A 4FZ8H 4NRYA 5IB2B 1BZEA 3H2QA 1DYZA 5H35B 4KOCA 3MNZB 5DA0B 1NLBL 4PN6A 1P7QA 3RI5F 1R27A 5AFAA 3HC2A 5KSBF 4CNIA 2BZDA 4GS7B 5HYQA 1DBKL 2CGYA 4N2CA 2P8MB 2B1AH 1NFDA 3N85L 5I19H 4JM0A 3THML 1UQSA 3B9KD 1I9IH 2FZ3B 2ZNXA 1MFAL 2VM4A 3UC0L 5E1IA 1TTAA 1EVTC 5DVKA 3WIFB 1A6WL 1T7VA 3WEBA 4GAFB 2R0LL 4QY8A 4JKLA 4CRPA 3D3VE 5ITBL 4A2FA 4CSPA 3X3FL 4GSDH 1I1FB 7FABH 2Z91A 3E2HC 3MV7E 4QHLB 2F0CA 5I0VA 3TO4B 3RKDD 1KMGA 4GBXA 4ZFFB 3BVNA 3VCLA 3MV9D 4WV1A 3UP6A 3UTSE 3TPUA 3BN3B 1BBDH 4M62H 3D85B 1MREL 3IAQA 4JRYA 3AUVA 1ZT7A 2GTWA 2JCWA 2BNUB 2ZAGA 5F1IB 3SJVB 4CU6A 4ZMNA 1VIWA 4FTVA 1HHGA 3IMSA 3SE4A 5IIEB 3ULUE 3G04A 1BOGA 3RP1A 3FQXB 4UT9A 5GRXG 1TJXA 3DMRA 1K4CB 1A21A 2XTJB 2DQGH 4X7SL 1NSNH 4K3DL 5D7IE 2P80D 1K4DB 5EOQL 5HI3D 2PJHB 4Q9CA 5FB8A 1K85A 5EFIB 4F8TA 1CD0A 2IBBA 1E40A 1PFCA 2OM5A 4XCEA 3B34A 1Q9OB 2G3ZA 2VB5A 3BHBA 2M2DA 4JBSA 3HZ3A 1L6XA 3A6BH 3NCWA 3TO4A 3QG6A 4F15C 4OV6F 5AOJA 3F7KA 2Z91B 4BGDA 5D7JB 2OYPA 4J8QA 4LT7A 1FDOA 1GZPB 2PYEE 3C8KB 5I8KL 5D93C 4R0LA 3V9FA 5T33H 5AW4B 3OXSA 2BWIA 5JW3H 2IBGA 4YC2C 3O4LE 2IADB 5FFLA 4M1GL 2Z8WC 3C08H 5GGTL 2OXGA 5JO5A 2ICEA 4PRDB 1AG6A 3IJSB 1FYTA 3QWOB 4LPVA 1OP4A 4RISL 1BAGA 2JJSC 3KPLA 2P5EB 2XFGB 3DVGB 5AVVB 4UQ3B 4GA6A 4WWOA 4Z7UE 5DT1L 1I1CA 5JHDE 4NP9A 1A5FH 3U9WA 1MWOA 2VLKE 1U3HC 3LKSB 5F3BA 4RV0A 1DL7L 1F2XK 2ZSVB 3CC5B 1KGYE 5LHDA 4Q9RH 1XCTA 5EZLB 3MLZL 3FU5A 4G8GD 3VNZA 2YHGA 2BP0B 3OZ9L 3GSNA 1PG7W 4NNYB 2B20A 1TLKA 4NC0B 3KLSA 4P46B 3MCKB 3S35L 2NY5H 2YD3A 3MRGB 4G7YL 4JJHA 5J56B 1ZLSL 5KTEL 4F58L 1DBAL 2Y6TE 5FO2A 4N2MA 4J7RA 1S5IH 3Q2LA 4XOAA 4ZX6A 3L6FB 4K23H 4JMNA 1WC2A 2AJVH 2J20A 2QSCH 3EOBB 3V2AR 3GK8H 1VC3B 4O9HH 2R9HD 2AABH 2CHWA 1PF3A 2JCCB 5E6ZA 2BLFA 3OM3B 4U6TA 5T5FH 1PDKB 2B2XH 1TT6A 2CKBB 5IVZB 1MFMA 4NS0A 1PT1A 2VDRL 2WVSA 3LV3A 3SPCA 3K6OA 1KGCE 1DJYA 1FAIL 5J12C 1KBPA 3E0GA 3EJQA 4HMEA 3VRLF 1YAZA 2V17L 4KJYB 5CEXB 2FWOB 2XJKA 3PE9A 4KI1A 3GTNA 1TEYA 2GJRA 4QF1A 1LXMA 3FCUB 1NCIA 4BQBA 4ZS7H 3MZGB 1PCSA 4Z7AA 1A9EA 5JPMB 3GSXA 3VXPB 4FA6A 3TVMB 4F9LA 1XGYH 4PLNC 4JO4H 1NCNA 1TQBB 2HVKB 2J4WL 1GL4B 2D8KA 3EO0B 4WNQB 2R9HC 3LXBA 1UATA 1S3RA 3CVHA 3V5KB 1U9KA 2XICA 5MP6L 5F9OH 1LP9E 2ZKHL 4AVJA 2KERA 4XHQA 1SJHA 4AQAB 2MMXA 3GMQA 2XWCA 4WEBL 4XP9L 3RE0A 3UO1H 4ANKA 1G5GA 1AANA 4V2BA 4Z7NB 4CBZA 4K7PX 3AMLA 5T1MA 2A6HD 1Z9PA 1I7UA 3WFDH 1J05B 3JSSA 4TXVB 3GZKA 1AKJA 2KLRA 2H32A 3ELQA 5C2UB 5GZOC 1VB9A 3R8QA 1E18A 2MQGA 3OLDA 3SQOH 3K71B 5DC9B 3T77B 2W60A 4MJJA 4O5LL 5I71B 1U8NA 4PVLA 3B7UX 2VZTA 2YUZA 1OSZA 1PU0A 3K91A 3DJRA 1QRNE 4U1HA 4ELKA 2RIKA 2R2EA 4UYQA 1J5CA 4HIHB 2V45A 5AEAA 3MNWB 2XIBA 1VZIA 4U0QB 2MIZA 5AYQA 4YSEA 3CHSA 1H5NA 4AEIH 5EU6A 4MZRA 4F7CA 1XF4B 3P69A 1S8DB 3HCVA 3KS0J 4KJWC 3LV3B 4UUJA 5IVXB 1CFSA 4PGDA 4TQPA 1O7VA 3X2LA 2UZXB 5I75B 4NSKB 3MQIA 1Q72L 5IGXH 4G2AA 3ZO0A 2JCCA 3KLAB 1D5IL 4U1MA 2K7PA 4G43B 4NO0B 5L2JB 2VN5A 1RURH 5TH2B 5AYTA 3K4ZA 2BW4A 3T2NL 3QEQE 1JHLH 3MGOA 1ZHLB 3B9DA 4MJ5B 5DHVH 1FNHA 2HKFH 2Y06L 4BZYA 5A43C 3UCQA 2RA1A 3WS3B 4X6EA 1EEZA 4Q0XH 1EMTH 4JREC 1DQQA 1HWWA 3FU3A 3V6FB 43CAA 4A55A 4Y4FC 4E2OA 2VRAA 1DTUA 3GSNB 1HXYB 2ZQKA 4X4MA 4BSWA 3QI9C 3HEIB 4OCLC 4L1TA 1RK1A 3D6GA 5I6MA 3D0VB 4PJDB 4G42A 5EZLA 1GZQB 2NX5B 3GSVB 5C70A 3FSOA 2C4XA 5IP4A 3ZTCC 1KB3A 5FHBL 2BSEA 3RVVC 2FX9H 1Z1WA 2E46A 4MJHA 3IR5A 2EIEA 1DVFD 1Q90A 2J8UE 3A4EA 3NYKA 1AZRA 3LXUX 2ZKWA 3PIQB 4HGMA 2ZCZA 4XB8A 2FL5A 4YN3A 4ALAL 3KDMB 5EIIA 5DJZA 4MWFB 4TQ8A 4Y5VB 1H3WM 4UT6A 4AIEA 4TRPL 3ILPA 3KBFA 3Q48A 3L3OC 1I31A 5JDSB 3H55A 4KO8A 3LEVH 2HN7A 2AQRA 4XI5D 5CINH 3UIYA 3FQTA 2OQJB 3L48A 3SO3C 1U8PB 1KIUA 4PHXA 5F0LB 4EN3A 2ODHA 3HPJB 3OPZL 3FOLB 1OSYA 4F57H 2D73A 1FGNH 2YKLH 4Z3HA 4UM9A 4UTAL 1BVKB 3LDBC 4KXZI 2VDLB 4RLDA 4AYDC 1DE4A 2A1WL 2GK0B 3PAYA 4QHKI 4Y7OC 5JHAA 1NCCL 1NBVL 4N1HB 4DKEL 4UOQA 1OAYH 3PV7A 3F6LA 3BGAA 3HMXA 4BRVA 4FXKC 2UYLB 2R0KH 1J8SA 2UX6A 5CEZH 4TVPD 5KYXA 1WAAE 5KWYC 3SGEI 3IYLW 3B5TA 4K3GA 3GMMA 4UNUA 5DJCB 3NRQA 2NTSP 2A6KB 3KPNA 4RZKA 5EF1A 1TWGA 1KENH 3DX8A 5C08B 1CGSL 4IKJA 3L4VA 1H3VA 3FU9A 4B41A 2OTPA 2VZVA 4YHKL 3SJVA 4FQ2H 4ZMXA 2X70B 4YBHA 4JN1L 1TQTA 3EYUL 1UWGL 1Z6JT 1X4YA 4X0KA 1OAQH 2QMJA 4MA8L 4ORGA 2C45A 4ZFFA 2PKDA 5JR1L 4F37K 1JN6A 3N1QC 3OJ2C 3QWQB 4KK6D 2CKBH 4NPYA 2Y7MA 1DBBL 4EOWL 3OKEA 4ZFOA 3KLDA 4AYBA 3BP4A 5F7FA 5I30L 3O0RL 4UMGA 5DVNA 4ANVA 2FSDA 2FDBP 3CWGA 4KK9C 4ZFGH 2XZAL 4N9OB 2V2TB 5DGRA 2AQ1A 3L9YA 4EJ1C 5EIIG 3TWCH 1QACA 3FQ2A 3L3IA 2GAZA 2ZX5A 4AG4L 1L6PA 1UQSB 3FSZA 5F7BA 2G0KA 1XD1A 1W0YT 2H0EA 4OI8A 1D9KD 4KWUA 1F56A 2DQCH 4RX4D 5C3TA 1SXCA 4U1JA 1KDJA 1EVUA 4XNZB 4YXKH 4DN4L 4EVNB 3N1FC 4O9HL 4U7KA 3B5HA 1F2QA 1Q4NX 2A0LC 3WNPA 2BVQB 5AB2A 2Z9TA 4J3OG 5JOPD 1WAPA 4E9VA 3C6SB 3IGAB 4MD0A 1U41A 2C1PA 1BEYL 2H3XC 3W9DB 1BQLH 1ZAGA 2AXJA 2YK1H 3C9NB 3V5DB 4HQQH 4PLOB 2DMBA 3H53A 4Y89A 4G8IB 4WTZA 3CQZA 1JGVH 1J88A 5IB3A 1FAIH 2J1WA 1N10A 1SXAA 1DDHB 3BVVA 3T6XA 5AAMC 1A6ZB 4Q2ZB 1GOGA 2QR0A 3CMGA 4Y16D 5F7NC 4UINL 3UCRA 5FCUH 4HOZA 2BVPA 3ARRA 5DURB 5J6GB 4PJ9D 3MCLL 3RHWK 3S3DB 2Y4SA 3TLRA 3VQMA 4PMEA 1I8LC 2XQBL 3PWLA 1RZKC 1KPRB 3RWEA 1QI3A 4PJXB 3FUHA 4TUJA 1HILA 3UPRB 1Q9KA 1EHAA 4KC3B 4LVHC 4FLHA 3CDCA 4PP2A 2I9LB 1KGWA 4DN3L 3OL2A 4FS0A 2GBAA 4B9KC 5DD3H 2VZOA 4HWEH 2E6PA 4NKDA 2PLTA 3NH7H 3QUHA 2WNXA 2VNCA 4WHDA 3FUIA 5JPNC 2XXCB 3WUWB 3F05A 3GUFA 5ESAA 3D51A 1DBJL 2X4OA 4YNYB 4E5XG 4L05A 4U6YA 3UO1L 4LLQA 5EEVA 4LNRB 3IT8D 3KGRA 1A7PH 4QRFA 4RDQG 2FHBA 3EKCA 2H2PD 4M8UA 1PTZA 3QSKB 3FC8A 4JRXA 4TUKL 1GAFH 4RIRA 4KK8D 1RZ7L 2E4FA 5E99L 4CL7A 3ULVE 5A7BA 1RP8A 4CN1A 2OZ4A 3QIWD 2KI8A 4P2QD 3ROLB 5IMOA 3SQOL 3TWYA 5AAWC 3KYNB 1P84K 4WJ5A 4B97A 4O5LH 1QFPA 2IH8A 3PV6B 3PABA 5HI4D 5IMLA 1WAAA 3DHJA 3KPRA 4NQED 4R96B 5INCA 1WTGT 2D7TL 5C07A 2L3BA 4NQDE 4GXVL 3ZZ1A 1N2RB 3H3PH 3DX9A 4ONGL 4FQHB 4PLKC 2HKHH 4W4OC 4YSSA 4XCNA 5CZVH 2P24B 1B3JA 3MX0B 4RGOH 5AZUA 5I66A 1FL5B 2CKNA 1QNIA 4F5CE 3QQ4A 2HJFB 2Y22A 4GRWH 3IS0X 4ZYKA 3U0WH 2ZP8A 5AB1A 3TFBA 2AEQH 3RZCB 2OJ1A 4GT0A 4BCXA 5HI5C 4WVRA 3ZDZE 2ORBH 1MFEH 2K8MA 3EGSB 4L4JA 4QRRB 3VFVB 5BV7C 1NCTA 3LPGA 2ATPB 4BFIA 1KCRL 1M56B 3II2A 1ERNA 2N7BA 1W6WA 3IDNA 3QS3A 1UC6A 4PR5A 1FRGH 3DIFA 4FX5A 5EUOE 2F2HA 4IRSA 3RDTC 2W0FA 1CDCA 1PKQE 2Y06H 2MH4A 2BCKB 3QUYC 3Q2WA 2NUTA 3ML1A 1HCYA 3ILQC 4FI7A 5HVGB 1EH9A 4Q0XL 3ZSTA 3CH1B 3OJDB 4WWKC 4YIQA 1VACA 2APSA 3ZMEA 1FL6B 1W72H 3L4XA 3AG3B 3JV6B 4V1DD 3V55A 2VR9A 1U3HA 4F91B 3BH8B 2Q87A 4G82A 3RJQB 3D4CA 2F58L 3QCUH 4LCIL 1JHKH 1RIUH 4QO1A 3PWJA 2OMUA 5T1KA 4MYPA 1MFBH 1NCOA 4BSVA 5C0FA 1EFXB 1DJZA 2H0FA 1XTMA 3HFMH 3ASOB 2KMWA 5T1KB 3P0YL 2WXNA 5KSBA 4LLWA 2APXA 4D9QE 2VZ1A 3NFSL 4XPGL 3E6FA 3LH2H 3RL2A 1FYTE 4J3OH 3TC9A 4MS6A 5KAQF 4HBCL 1GC1C 2H2PC 1MLCB 1UM4H 4FHJA 3HU2A 1A7NH 4ZOCA 3MJ7B 5B8CA 3D9AL 4O02A 2HYMA 1NIEA 2EIMB 3LN5A 1CI3M 3WIAA 2JQAA 4MDJA 3QISA 4GI8A 2QVKA 5AWNL 1NBVH 2EDBA 2NSQA 5E8OB 4DKEH 1YEEH 2HPTA 4YGVB 5C0AE 2O5ZL 3BPLC 4LLMA 4PCYA 3VSQA 3CV5A 1A1OB 1LWHA 4N6QA 4OCSL 3RU8L 1WGOA 1FZKB 1MRFH 4IIQC 4LEOB 5C0NC 1T1XA 4H88L 1G6RL 4G6ML 4GY4A 3CBKB 1XAUA 1BD2B 4OKDA 2HJFA 5SV4A 2NSMA 5DRNA 4XMLH 3DTXA 8PAZA 4XPAH 4N2IA 3GD1C 3L3GA 3OR7A 1KENL 2Y36L 4OJDH 2R1YA 1JCVA 2G5BB 1U58A 5IB5B 2J88L 4EI5C 3MBEA 4AGMA 5DUBA 2VDLH 4PYGA 4JRXE 4WJ5B 3NPSC 3DYMA 5KAQG 1F4YH 4ZSOB 3PF2A 3UTSB 5K9JL 1KJ2H 4FABH 3OB0H 1OGTA 4ZUSB 4MA3B 3G5WA 5FTLA 3HAEG 3TM6A 2P4AB 4AZDA 3NN8B 4ZQTA 5I30H 4YJZL 3HPLB 1AGDA 2AEPL 3TV3L 1SJEA 1TYEB 4LSTL 4V1DA 2Y9RT 3DJZA 4Z7NF 1PSKL 3QAZC 5AW6B 1X5JA 3HBZA 5J3HC 5EMYA 2H0JA 1IKFL 3BYTA 3SDCD 3WFBL 1ZVHA 2NY2B 2KI6A 4DAGL 1N26A 3ZW3A 5C6PB 3MHZA 3WJJC 4JFQB 3L4ZA 4JRYD 3POCA 3ZJAA 3EFDL 3LEXA 2AV7A 4ZW7A 2VN4A 3O3AB 4HF5L 1N3NB 3VXNB 4YHOH 1JGUL 3NSJA 1O5PA 4G6JH 4C47A 1ADQL 4XBMA 1N12A 1T20A 5DUPH 4CADA 3H0GA 2K4AA 3DUSB 4K8RH 3W9EA 3TVMD