4JJOA

Crystal structure of apo-clavibacter michiganensis expansin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLDLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulose binding protein
publication title Crystal structure of wild type and D78N mutant clavibacter Michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis
molecule tags Sugar binding protein
total genus 41
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jjoA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4jjoA02
2G6GA 3X2LA 3SUKA 2ENGA 5GLXA 3X2HA 4ZM7A 4FERA 4JCWA 3X2GA 3ENGA 3SUJA 3X2NA 4JP6A 4FG4A 2AE0X 3FT9A 1WC2A 3D30A 4FG2A 3X2KA 3X2JA 5GLYA 4JJOA 1L8FA 2KQAA 2GAEA 2HCZX 2PICA 1HD5A 3SUMA 4AVRA 1BW3A 2PJJA 1N10A 3X2MA 2G5DA 4JS7A 2VXQA 4JP7A 1WHPA 1OA9A 2PNWA 5H4UA 4ENGA 4FFTA 4L48A 3SULA 2JNZA 3FT1A 5GM9A 3M3GA 2BH0A 1OA7A 1BMWA 3X2IA 3CZBA 1WHOA 3X2OA 1BW4A 3X2PA 2PI8A
chains in the Genus database with same CATH superfamily
5FA4B 3S5ZA 5I18L 4HFWB 3EHBD 5DUBA 1DMRA 1R5WA 5MEPA 2A83B 3K8KA 4RGOH 5BVPL 3PABB 5H37A 4WTWA 2CLVA 4IRZA 1ORSA 5I73C 3IKCA 5IQ7L 4MJHA 3VQ1C 2WKLA 3C8KA 1U95B 1YNLL 3TPUB 4K94L 4TL5A 4OM1L 4L1BA 3QJFA 1SHMA 1OT1A 2DBLL 3RHWF 1OAQL 5CGBA 4JRFA 1LWRA 5F1IB 3PHAA 1E0OB 5HGDB 5K1JA 2QQLL 3CSYA 1P84J 4IKNA 1T89A 5CEYB 1G5AA 2WD0A 4GQ9L 2DQIH 2GSGA 3NCJL 3IDGB 2R0ZH 3LZFL 4XX1E 3P02A 2C7UA 1X5XA 5F9DC 4JCMA 4KDTC 4RISH 2GT9B 3ZL4L 2MKLC 5DMIL 4JJOA 3KPLB 4MCZA 4N8CL 5LAPA 3S97C 1KXVC 1R3KA 2P24A 2OMYB 3H3PH 4PGBB 4FA6A 3WU1A 2B4CC 3ILDA 5KVFE 4LHUD 1CN4A 5T3XE 1JTTA 3KJ4C 5CIPH 2VDRB 3HKZA 1S3RA 1EEZA 1TQSA 5FF6B 3VDAA 1FRGL 1M7XA 4DHLA 1A6ZB 4ODTL 4F2MB 4WEUD 3ZKMC 2VXSL 3C6LC 2VR5A 4XN1A 1K8DA 2JJVA 4JM2A 5E2VL 4AIZA 5K9JH 3U4EA 1JPTL 2NY5C 2X6UA 3QUXC 2EE0A 3WLBA 4YHNB 4NXSA 4M8VA 5SWZD 1JHTB 1U3HC 1M42A 2Y3NA 2Y1ZA 1XF3A 5BRZA 2YGPA 2YIHA 3QFJE 1DR9A 4N5ED 2E6JA 4OB5L 4NZTL 4UT6L 4Y4KB 4R6UA 3BUIA 2O5YL 1FFQA 1VIWA 4AQOA 2CKNA 2K6ZA 1XB3A 5AQ0A 2CM5A 1MH5A 1FDLH 4PJ9D 5KTEL 5AVWB 1DVYA 3PRZA 4HXBH 4OCWL 2DQGL 3PG2A 5FKPA 4X5XA 3VFVA 4NQCA 5T1MA 4AX3A 4OGAC 3HHSB 1YMME 5SV4A 1NC2A 1OAYL 1BVOA 4HCRH 4JG0L 3FQRA 3TO2B 5LGYA 3M1BB 3ENGA 3GBLA 4BM7A 3DSNA 2J2ZB 3I02A 1EXGA 5GGRA 5E8OA 3GK8L 3VFPB 1KPVB 4QGYA 2UZIL 2OL3H 4NO0D 1GHFL 2FO4A 3T3MB 2CWRA 1FV1B 1MFAL 1AMXA 2VC2L 2WVTA 5KVDH 1MPAH 1OSEA 4KRNA 1UT9A 2P5PA 5EBLB 3HS8A 3K4AA 1ZHLA 3V5HB 4C47A 1RLWA 3RX7A 1DBAH 2Y06L 1VFBB 3QEHA 5IFHH 3RGHA 1LO2H 1N6QL 1VGKB 3UC0L 3FN0L 5EU6E 3FULA 5IMLA 5T3ZD 2VSMB 2F53D 2VDQB 3U2JA 5DEFB 1CGSL 4DP6X 2Y7SA 4FRWA 2V2XB 3NDYE 4AJVA 4L9LC 2OMZB 4WW2A 3VI3E 2YQGA 2P8LA 3FQ1A 4FG0A 4P04A 1IEAB 3I84A 2NPLX 2VLRA 5F7NC 1VCBC 4JPKH 5DURD 5E00A 1J5OL 3MV9E 1NUNB 1DL7L 3BD5A 1XGUB 3R7QA 5I8EB 3LXBA 2EUWA 2ZF8A 1E9OB 3IFPA 1K2DA 1KPUA 4C56A 3SDAD 3S9DB 5IB1A 4LLWB 3MU3A 1ZCRA 1DUZA 5F7MC 3O2WH 3I85A 1UHVA 4Q6YA 1PZAA 5DJXB 5C0CB 4JRXA 3CQQA 2APVA 4AYGA 3X13A 2VIRB 1HINL 3HC0B 2EDMA 3T6XA 3IMRA 4NC2B 5DGRA 3L95B 4X5QA 4QR7A 4V1DA 3KPNB 1XO8A 3CGTA 1MCLA 5C0RL 5CGTA 4JRYA 1MRCH 4JMNA 1S7UA 5AVZB 3KR3H 3IJHA 4HFUL 4TULL 4HUUA 3QRBA 3APMA 4NQVA 4EI6B 3RUGF 3HPJB 3ZE1F 2CKBH 1OCWL 2VZ1A 3HRZA 3BD4A 3S6CA 3GHBL 3D69A 4XWGH 1UJ3C 5KZCB 4P99A 4JP6A 3QEGL 3GUFA 1W8NA 3QS3A 2AJ3B 5J6HA 1U8CA 2NY2B 4GSRA 2YUJA 4BK4A 2R2EB 4ZO7A 1R4XA 3VD2A 1PQFA 1UOKA 3BKCH 4Z3JA 2PO6D 1NGZA 5C07E 5D4IA 1BAGA 1MIML 3U30C 3RQ3A 5ID1B 5DZPA 4FA8A 3CVIH 5MHSE 3VI4E 5JHAA 3CZSA 1MKFA 3EYVA 2HN7A 1ZTMA 3FQYA 1ZLWH 1EPFA 4DGWC 3U9WA 1Z0MA 4P5SA 3ZYZA 2Y07H 3VXQB 2HA1A 3V5KA 3ORJA 2X4UA 1EEQA 2NY6B 1GJWA 4ODXB 3VFUB 3FTZA 4EUPH 3JTSB 3QC5X 1NGWA 1EUUA 1LWHA 4PGZA 2WKGA 2N1TE 4LEOA 3SODB 4K5OA 1MCPH 4WSGA 3QFGA 5GRWA 1QSEE 3E9UA 2Y1AA 2PW1A 3QO1A 1OSPL 5GIRB 3FTSA 4OLWH 1ACCA 1G1CA 1G9MH 4R4BB 5KYUB 4X6CB 1RVFH 1FL5A 1U93A 3FCGA 1I8MA 2F54E 1GGCH 4YPGA 5HSFA 3PWUA 4YC2C 4Z7QB 4HMCA 2DEXX 1G7IA 3P4OA 1G7LA 4IDJH 2YD6A 3L5WA 1TZIA 3LVEA 5L4FA 3HUJB 2A9MH 3TFBA 2OJEB 3GMMB 6PAZA 1G9NL 3S5LB 3A4AA 1J5CA 1OTSD 2H0FA 1BVKB 1JNHA 4PS4H 3KHQA 2YUWA 5GQBA 2F8IA 3U0TB 4ORGB 1MCSA 5ADOH 1ED3B 1PKOA 4MVBD 5CUSH 2GJRA 4W81A 3CVHL 4AONB 2BOBA 4Y4FB 3QXAA 2XTJE 3Q6GH 1UM6H 3QQ8A 3L3HB 5C2UB 2VW4A 3ZL1A 3RVWC 1SEQH 4BFGA 5C7XL 1KWKA 2BE5D 4NGHH 1NOFA 3D12B 4L4VA 4KO9A 4LSTH 4NUGH 4UQBA 3S88H 4N2LA 1KTDB 2GCYB 5HHVL 5EOTB 1BM7A 2IV9A 3VWJB 1HHGA 4B9JA 1MCFA 1SRDA 4HOXA 5E99L 4TV3A 1T6WA 5FHBH 4BZ2A 4L29B 4R7NA 2BC4A 2D9CA 3II3A 4QRPE 2X2JA 1S4IA 4W9EC 4ZO9A 5ALCL 4HIJB 1CLZL 4G43A 4R4NC 1IGTA 5AWNL 2BJML 5BV7B 4HW6A 3FAWA 4GQPH 3UAJC 2WQXA 4G1MB 3RB5A 2IVFC 1TWHA 3EYSH 3WY4A 3BZ4A 4OH2A 4BKTC 3PLYA 3HG2A 1R0AL 4OV5A 3QDGD 3QAZC 5EU4B 3WIIL 4Z3EA 6TAAA 2WZ5A 3FT9A 1Q0YL 2E7LC 2EXWC 4ZW7A 5J9PA 3Q3GB 5SX4H 3C5SB 2APXA 1RZKL 2QMJA 2X2UA 1X5MA 3FOLA 2XXFA 4HIHA 4OIAA 5B1BB 1M53A 2EIKB 1Y1WA 1AOZA 4FD0A 4UUJB 1TEFA 5CZXC 3TTYA 2HRPH 4LSUL 2GK0B 1XZ0B 4XCCL 1J0ZA 3C2AH 1CR5A 3HHMA 3FU0A 5LBSH 1WISA 2MNUA 1MWAL 4U1MB 4XPBH 4L1SA 1KLFA 4DQAA 3DRQA 1MQKL 1OARH 1JDDA 4J3OG 2NLJB 4DUXA 4UOW0 1U3ZA 1PG7L 2UVEA 5EOQL 5C9KA 5HGHA 2HFFB 1PKQE 2QSTA 2NNFA 1EFQA 2R9HC 2IANB 3LZNA 2AXJA 3D05A 4HHGA 3UZEA 4Z7WF 2VDKL 4UIMA 4FQJH 4PRID 4XOBA 4JZOA 4P05A 1J18A 2AEQH 4IIQC 2CM6A 3SCMA 1E9PB 1RJLB 1JZ6A 1BOYA 4P46C 4GO6B 2FE0A 4HWNA 1BQKA 2NZ9C 5IUSA 1BVZA 5DK0B 3QFDB 5IJDC 1DJIA 4P2OB 3L3KA 4KZEL 4OZFB 1YUHB 3L7FB 4MA3B 2LQRA 2ZOKB 4IBSA 4R0LB 1DUYA 2ZXWB 3FMGL 4K07A 3LD8B 3ECBB 4CNIB 6PCYA 4PJDF 3DO3A 2IDSA 2RR3A 2EEXA 2WZ6A 5IK3B 1T0MA 3OPUA 4PTTA 1DN0A 5HDQL 1QUNA 1RERA 1U8HA 2QQKL 3B3IB 1R9FA 1SBSH 4YSUA 2IH9A 1JV5B 2BNUB 2OL3B 3A21A 3HNTL 3LKSB 5HYQA 1L9NA 2BW5A 4MD4B 1JPSL 3MLSL 3GB7B 2YZ8A 1WK0A 3D33A 2X0UA 1P7KB 3QUZA 5MEOB 1P4UA 3BVXA 4QEGA 2HYMA 1QQDA 3A6BL 2ALAA 2DD8H 2WLIA 4DKDC 2X41A 1K8IA 1ACZA 4XBPA 3KD4A 3DX0A 4M4RA 1LO0H 5FM5O 5J13B 2MOQA 5CD5C 2VW7A 4MJ5B 2Y5TB 1PS3A 5C7ZA 3FT3A 4MMXC 1U8LA 2JJSC 1AE6L 1A7NH 3EJYD 3LS4L 4ZZFA 3EG9B 2IEPA 4TNGA 2JIMA 3O8XA 1C08A 5I74C 2C3HA 4I77H 3DWTA 1LO3H 4A39A 3LNIA 1BD2B 1H3UA 4NJ9H 4P06A 4JFED 2QVIA 1H19A 3WFDL 1AGBB 2E7CA 3T4AB 1MNUL 3NGBC 3RGVD 3P0VL 4M1GH 5D2NE 4IGBA 1L6XA 1ZHBA 1CMOA 1MVUB 2BP8A 3P4NA 2VAAB 2RACA 3N1GC 2R59A 2YUVA 4GAGH 4QJ3B 1IGYB 2W91A 2WUBH 3KPRA 1FG2A 1NIFA 1YEEH 3KLHC 1W2KT 3N42F 3ASOB 1UWFA 3DJZA 3AY4A 3BSZA 2YBGA 4OLXH 1JZIA 3CC1A 5HHPB 1KJ2L 1KFAL 3NIFF 2OMNA 4QHLA 5DO2D 3RP1A 3T3PF 3IETB 5E6RB 5BQDA 5CLWA 2WSDA 2PCPA 1RL1A 1ACYL 5F9AC 1YYCA 3FB8B 2O1AA 5GSRB 3RDTC 3F7RA 1ZV5A 2HKHL 3BAXA 4JY5L 1A4JB 4ZBJA 4HKBB 1LK2A 5T3ZH 1ZDQA 3ZDZE 1T20A 3MA7A 1AIFA 4L8SB 1GR7A 3N1QC 3GBNH 3P30H 1DVQA 3X2IA 1HHKB 4GXFA 3VUAA 4FCHA 5TDPA 2ZXDA 3RWHB 4N0CC 1P1VA 1GPOL 1USZA 1UACL 1XXDC 1IVTA 4EUPB 3CN3A 3FSOA 1TEGA 4KY1L 4APQB 1KMGA 2AEPH 3SKUD 1PZBA 2FIKB 2WXHA 3MRRB 3OPZL 1TEYA 3CUPA 4WW1B 1GL4B 1D3CA 3NJJA 1H9VA 1LL1A 5B22A 2NAPA 1OE2A 2WXQA 2IALB 3Q05A 2OI9C 3ARQA 5D2LE 3WUZA 5K9KA 4OY9A 3BZDA 1OD9A 3LKPB 1OM3L 1QSFA 5ENWA 1KXTB 5DJAA 2X70A 1LJMA 1X5AA 3RUGB 5AZEH 5GS1A 4PG2C 1JSYA 1WE5A 1M05B 1B0RA 3HN5A 4X9IA 2FTAA 4XVTL 4OUUA 4F33A 4H1LA 3TYFA 1P1ZB 3OUGA 2CDGB 2HLAA 3QDME 4N8VA 4XCYA 2Q3ZA 5DS1A 4PJCA 4UZUA 3IJ8A 5DT1H 3OLEA 1YQVL 1OCRB 3MLXH 3P0YH 4ZODA 3ILQD 5AZ2H 4NZUH 4YHIB 4LOUC 4RRPA 2YRPA 4FI8A 4WDIB 1QWHA 2HRGA 1DBJH 3B2MA 3FU7A 4TLUA 4UMSA 5AVXB 4WHDA 3QQ9D 1I9EA 3ZQXA 1RULH 1REIA 3RWCB 2WXMA 1RURL 4XCEB 5HGGS 1FYTA 3QIUC 4UQEA 3MNWA 3VM7A 1VEOA 4AAYA 4HJGB 3VFNA 3BC9A 5I1IH 4I3RL 3T1FB 2B7DT 3X2JA 4YDNA 3WEOA 1C12B 3F7LA 3QC8A 2VPZA 1XAKA 3I9IA 4JHUA 4QRTB 5EU7C 1GC1L 4ILDA 4JPWL 3FU8A 4TLKA 2EVIA 1WHPA 1AGDB 2N0MA 4TL4A 3SE3C 4EN3D 3BN9C 1PL3A 3BRFA 1PT0A 1O9WA 2WLJA 1QNZH 2DQTL 3OHXA 4L1HA 3O4LA 1W0WB 1WGVA 5F9JB 2MEJB 2Y25A 3IFNH 4Q4IA 3GRWL 2DJUA 2QFPA 1IGMH 3MRLB 4XBMA 2VDLL 1FN4B 3AM8A 3FUNA 4JQIL 3LKRA 3QZNA 1KYUA 1HCFX 4U1HA 3A0OA 1I85C 1TTRA 2IGTA 4JPIB 5DMGD 3ZJAA 1U33A 1FFNB 3O3DB 4LLAA 2MNJB 4NSKB 5B8CA 1QI3A 3MZTA 4CVZA 3KWXA 5F96H 3VM5A 1JDAA 2ZOLA 2BIPA 5HHOB 2H2SC 4JFHD 5CN1A 4A66A 5FYKL 1TTAA 4OQTL 5DD1L 1TKWA 1I7RB 5IMOB 2R2HA 2CJSA 4CADA 3CFCL 4MQSB 4NOBA 3RY6C 4A2EA 4MBRA 5DWUL 1QKZL 5AYQA 1JPEA 4P5KA 3DXAE 3EO1B 3PQYB 1WICA 3ZPDA 3MRJA 3Q6FB 1E2WA 1GYCA 1KENL 1ZLUK 3H9SD 1TVBA 1FGNL 1WEJL 1ADQH 1W15A 2ZWNA 5F93C 2A9DA 2BPBA 2BK8A 1ZGLP 3G7TA 5I0XA 3BVNA 3HE6C 3TF7C 3UPRA 4CDHA 2BIOA 1F5WA 4PRPA 4HJSA 3C75A 3CSFA 4ZOAA 5JPMA 1IC4H 3N85H 4XCFL 2Z1KA 3LS5L 2PXYC 2YZ1A 1P4LA 1UADC 4GG6A 3LXCA 4KZDH 2Z1PA 5DHXB 5I1EL 1X5YA 2NNCA 4GSDH 3KWWA 3RBSA 3D5OF 4D9QD 2QJDA 4Y5VB 4LARL 4EI5A 4A2GA 4MZIA 2XG4B 4JFFB 2P5EE 4K7PX 2CW0D 4WVRA 3BP4A 1U8QB 1A6UL 1YNJD 3H3BC 2KC0A 3HS9A 3JWDL 3MGTA 2I60L 2XPGA 4Z3GA 4EPSA 4AG4H 3QCTH 3IDYB 1J1OH 3W1ZA 1MREH 1TFHA 4JFYB 5B3JE 5MENA 3MRQB 1VB9A 4KDLA 2H32A 3HC2A 3D09A 3W0WD 4NENB 4KRPD 1J7VR 4M8QB 4Z7WB 4OZIE 1QRNA 4M6AA 5JXED 3GMQB 5EO1B 3QH3B 4MD0A 1CLCA 3ZN6A 5DUML 3BD3A 2X2YA 4N4YB 3DX2A 4KQ3H 4WFED 3VXOA 1AGCA 4OCYH 4GPVA 3Q44A 5C0ND 4UF7C 4QLRA 3TCTA 4BH8A 4YUEL 3CVBA 5JYLA 2VLKA 2Q6WA 1IQDB 4FGMA 4U7SA 3A6OA 4P3DA 4KXCA 3WKML 4IRJC 4FNTA 3VFTA 1L3NA 4KHXL 4KJYB 4TNWF 5IB5B 3RWIB 4KKBD 4PJDB 4PJXB 2E3VA 2OFQA 5JO5B 1LEIB 3D4ZA 3SE6A 2RJMA 1VLXA 3PNWB 4ELMA 1WH0A 3KHOA 3KYAA 4OKVA 5CGYC 3UDWA 2O5ZL 4YE4L 1V10A 4ENGA 1UXSA 3FT1A 3NRPA 4PLOB 1Q4NX 1S9YB 1JHKL 5I17A 2E7DA 3HR5A 4DP0X 2OZ4H 1O6SA 1IT9H 4PRHD 1HC1A 2BO0A 2WXKA 4QXWA 2BHYA 3ATBA 1RUMH 4X2UA 4OI7A 3JVFC 1KZYA 3IN2A 2J1WA 3PHOB 2VOTA 4ZUTA 1ECZA 1T2JA 3WTXA 1J8HD 3IU3B 5E51A 2YPVH 4N0UB 2VMFA 4TNFA 5AB0A 4S1SH 1QO3B 3D2UD 2EXYD 1CLYH 1E90A 1AD9A 1Q9LB 4I7ZC 2VMCA 2WXLA 3O9WB 4WI8A 5BZWB 1ECYA 5D5MF 2CO4A 1JPGA 5I1GL 3NA4A 3O41A 5DD6B 4U6HB 1DDTA 3NIGB 4UB0H 4ZPVB 2X38A 3BH4A 1KBKA 2OMUB 2XXGA 4K2UL 4O4YL 4Q8BA 2OKMA 4NM8L 4FFVD 1R5VA 3HHRB 1NCNA 2MFNA 5D7JD 2NQDA 4TXVB 4Y5XC 3ZQWA 1D6EA 2X4SA 3AW5A 4JM4H 1N0XH 3TA3B 4GINA 5GISL 2CMRH 4KO8A 2YC1B 1FNSH 2BVOB 2V2TB 2QFRA 4Z77B 2A9AA 3FRUA 2OX5B 4BFOA 3MLWH 5GGSA 1N6UA 4PJ5D 1B0WA 4Z95L 1NM4A 3F62A 1XGTA 2CUMA 3SDXF 4F1SA 5DD5L 2FQFA 1NANH 2JKRM 4WUUE 3T0EE 4UNIA 4LCCB 3HBGA 2ESVA 3F00A 4PWJA 4G8GD 1UHDA 2AJZA 5L88L 5CXPA 3E2HC 4H88L 2Q1EA 4P5TA 5EB9A 1JL8A 1ITCA 3QHFH 3T3PB 1N5AA 3EW3B 4LL1A 2G30A 4EVNA 5JW3L 3IR6A 3HRPA 4JO8A 2F1EA 3TFKC 1DE4A 1J9TA 4DZBA 5HHME 4K0OA 4M7LL 1I7UA 3K72B 1NLDH 4BHUA 1DBML 1B0GA 1N4XL 4WI6A 4HZLA 1RZJH 3GZPA 4FHBD 4OFYD 4GKSB 5AENA 5JMOC 1U58B 3L4XA 3C5ZB 2VTFA 4OTXL 4WNQA 2MPAH 1FHNA 3ATEA 3EH4B 4Y5YB 3V7MA 1P5UC 1NEZA 1FZMA 1I9RL 2NSQA 2YPKB 2JQZA 1Q9WB 1TQWA 2R4SL 4Z3TA 3OGCB 3LPWA 2VKXA 3TZVB 4PWGA 2PO6B 4Z7VA 1CGWA 4ONFH 3TBTA 3STBA 5F89A 3UC2A 2FBJH 1AYRA 3DOSA 3KPSA 1N64H 2ENYA 5F7DB 1KJVB 4KGLA 2R56H 2JKJA 2YEZA 3CU1A 1QFWM 3PV6B 5TK2A 5LKNA 1I1FA 3NBNA 2ICWA 1KG0A 3QZWB 5LGHH 3WMSA 1U30A 3KS0J 5IHUH 5HVHB 3CD4A 3HC4L 5I75C 4J4PC 2KDYA 5TDNB 1QW8A 3R8BB 2NY0C 3W3BA 1WC7A 3PFQA 3WXWH 2WXGA 5HYJD 5JOEA 3QG7H 1CZ4A 3QO0A 1GCFA 1QFUH 2VSCA 4JHBA 1ZLWK 4Q6IC 1E4KC 4JM0A 3KPRE 4YK4B 5GGVL 5B1AB 1UB6B 4I9WD 1D6VH 1GMIA 2ZYSA 5IHZB 2G60L 2QR0A 1OF2A 2MHAA 4HWBA 2E8ZA 2V37A 3KPOB 4JFTA 3WOVA 4KNUA 1ZA6A 4A7UA 2I5YL 4ANUA 3FB7B 1FO0A 2G4GA 3PL6C 4OV6F 2BSBA 3TESA 1KOAA 4WJ5A 3KLAB 2VLLA 4G6AD 1MELA 4QGTA 4AGOA 3HU2A 1MHPL 1UXWA 1SJMA 2HUHA 4X9YA 3S3JA 5IJKC 5KSVB 2Z7UA 1SN2A 4P4KA 4ZNEE 1CXIA 4QI3A 3DPDA 3IJYA 1IL1B 3CQFA 1WC2A 1MCEA 1LP9A 1BDYA 3CCHA 1DLFL 3L3DA 4HDIB 1XGPB 4U1NA 1IAOB 2CHWA 3CDZB 4CKQA 5IV2A 1X4YA 2OMVA 2R1YA 2FGZA 3LNGA 3QEUA 4YHLH 1W0YT 3ARGA 2FBOJ 5I16A 4U1KA 4I9XA 2X89D 1NPUA 1YPZE 2JIOA 2EKSA 4AC2A 5CZVH 3TLRA 5AAWA 3M17A 4RAVB 3EO9L 5I71B 4OJFL 5D7SL 2YR3A 4BFEA 2BRRL 2ZJSL 4R5TA 4CW1A 1CE1L 1X44A 3RX9A 3KG5A 1OPGH 1W91A 4M6NL 5AALA 3QVAA 1QSFE 5E1AA 2W0LA 4ZYKB 1PDKB 3LRGA 2B20A 4MNGB 4ZSOE 5I0DA 1GY2A 3JV0A 1ZV9A 4TSBH 1JNLL 4TUJB 4XNUH 4HWBL 5CNHA 4JZNA 5EF3A 5IQNA 4G9FA 3KGRA 5DFVD 2PP7A 3ARED 2EE9A 3NJXA 3FO9A 4HH8A 2F8OA 5I82A 3WFHA 4N86A 3VXUD 3FYIB 4N2GA 1NM9A 4HC1H 2BFVL 4H8HA 4XNQA 2KUTA 3N2JA 1BOGA 4Z7UF 3QDGB 4GW4A 2J8UF 3FO0L 1ZMYA 3UAFA 3GUTB 4PJEE 1GH7A 5JUEL 4YHOH 2BSDA 3D2TA 1DANU 1T0OA 1AS7A 3DX4A 3JV4B 4NKMA 1GKOA 3DUSB 4PJGB 3IJEA 1K83A 2NXYB 1AHMA 3SPHA 2OULB 1AZZC 1HJBC 3RVUC 1BCIA 1WUNT 3D39B 3L7EA 3UTTA 4M5YH 2AVGA 3TN0D 2JKWA 2ADJB 2CLZB 3SDDD 1JTOA 4A7VA 3TIEA 5T3XL 4E9SA 5C0DA 4UAOB 4LPWA 1BQLL 2OSYA 4FMKA 5IHWA 2EH8L 2LLGA 2O26U 3QC6X 1CL7L 3C6EA 2XWDA 4OJYA 5E2WH 4XMLH 5DHVH 3EYOA 4AGNA 2KL6A 4XVUC 2A74C 5I1AB 2JK5A 1EAOA 1SVBA 2Y36H 3TGXA 3SDCA 7PCYA 4ZMPA 2BNRA 3ZHLA 3LX9A 4ODBD 3TBBA 2Q76B 3ME0A 4ZTPL 4QF1A 2BHFA 4Q4EA 1G1YA 4N2OA 2ZSVB 1P4IH 1AQKH 2NVYA 2A1WL 2IPKA 3QJHA 3S34H 5IVNA 1E28A 5LG1A 3LN5B 5FX3A 2VR9A 1JWSA 4UT9A 3PWJA 3VTTA 3PIQB 5ECJE 1AXSB 4CBZA 4LRIA 3N3EA 1PLAA 5DWPA 1OLZA 1QHPA 2HH0L 3F7YA 3TCLB 5I5IA 3GHPA 2WQAA 2KHAA 1ERNA 3L3OB 2AV7B 3HMWH 3ULUL 1NLBL 1M6OB 4LDOB 5ILTH 1A1MA 1QWUA 4QRRB 1R3HB 1ZVYA 3MNVA 4M61B 4Y89A 4L8CA 2GTZB 2KLRA 3MXWL 3N50A 5F7EL 2J57A 3G5VB 2YKLL 4D7BA 2OS7A 3L81A 1EHXA 4D0BA 5I8CB 1QAWA 3FHQA 3KJ6H 2GEQA 3VFSA 1E60A 1CD1B 1D9KC 2OMXB 1TYEB 2DWEA 4G7QB 2XA8L 4PLJC 4N9GB 3V4PB 5EU3A 1XHHA 1IC1A 3QJOA 3NCEB 4XAWL 3LN9A 4N2BA 4J8RB 3S3CB 1A65A 1FAIL 4WCYH 4OFVA 3WXVH 2BS71 1BFVL 1Q72L 5F3BB 1BEXA 3B83A 1E5UI 2JKNA 3G6JF 4MMZC 4G5ZL 2CIKB 1U2HA 4K23H 4LSRL 4X6DF 4JFEB 1H3PL 3BH8B 4XPTL 3ZKNC 5LWYL 4GRLC 4GG6E 1AQMA 3DI3B 1IFGA 4HHWA 5IM7A 4G6JH 3D48R 4NN6B 3MX0A 3MFFA 2NXZD 4E68A 5CD3B 2DWYA 3ZTEA 1U6AH 3BH9A 4BKSC 3GS7A 4YDVA 5D5MB 4JAMA 2EEOB 2COQA 2WVSA 2XN9D 4X9FA 1NMBH 4PS3A 3DROB 2CGZA 4PYHA 2BNQA 4TVPE 4MDJA 5GS3A 4L3EB 5MENE 3MV7A 3UOAB 1AKJA 2QSCL 4EIBA 4F7TB 5JW4R 1CLOH 5MERA 3N40F 5IKCB 2XV6B 1X9QA 2IMNA 5DS8A 4IBQA 1QRNE 3OZLA 2OK0L 1HI6A 2DMBA 2GSIA 2J20A 2VQ1A 4YDIH 3ZTCC 2HG5B 3MBED 4Y1SA 5IBLC 5LCVA 4XTRC 5JQIB 4XP6H 4PGEB 1F00I 5K59E 2FZ3B 2G2PA 2BVPA 5IB3A 1WWCA 2A77H 4M7JL 4AEIL 1SYVB 3P77B 4PW4A 1RK0B 5C0GA 1QSED 1S5IL 2DLIA 1CJYA 4ODSH 3SHSA 1BF2A 5L2KA 5C8JA 3SKNA 4E41E 1XR9A 1M9SA 1GZQA 5JQHC 4JFSA 5IGXL 2AXFA 2YD9A 3O6FD 4U3HA 4X98B 1JBJA 3A4EA 4KK8C 2NYKA 1NJ9A 3AB0B 4ELME 1Y18A 5IOKA 2CH8A 3VU1A 1SJVA 5D1ZA 5BXFB 4UQ3A 1KIRB 5EPMB 1B90A 1E5ZA 4FYSA 1ULVA 3CVCA 3V52L 1ZKAA 3V6OA 2DWDB 3ALXA 1IX2A 2ZCLL 3NFSL 2N4IA 1B2WL 3H6AA 4R5XA 1LGVA 1JOIA 4LZKA 4MA1C 4NHUB 4Q97A 4M8UA 1NMCC 2JTYA 5KSAA 4PJHE 4HUNB 3ARBD 2FT7A 3QIBD 1Y5IA 1K72A 5EOCJ 4XZ4A 1MVYA 1A3RL 3BMWA 1R24A 2COVD 5AVRB 2ZICA 4NNXB 1XH3B 3G5XB 4WTZA 5E70A 1EHAA 2R1XA 3GSQA 5A7EA 1S9WB 4HOZA 1A25A 2XQYA 1YDPA 4WEBL 1E9QB 1NAKH 3L17A 4IHBA 4NAJA 4FG4A 2H1LM 3KPQA 3W82A 3WNPA 3C60A 2KQAA 3FHEA 4N2IA 3SGEH 4DETA 1MXGA 4N0YL 3WIHH 3KMDA 3ZDYF 5I8KH 3OV6A 1DVTA 1UWEL 1G7MB 2VN6A 4HAKA 4AQAB 4Q9RL 4XHJC 4JPVH 3TBWB 2VZTA 1T1XA 4OBSA 4XP9H 4PIRF 5T5NF 3FL7A 1QLFB 5B3SB 3US0A 5ISZA 1AHWA 1NCOA 4EZJA 2R39A 1JE6A 4GKLA 3CV5A 1OHZA 4XC1H 3DMMC 3QQ4A 4A6YA 4GAJH 2KZWA 4OF8A 4Q9QH 1KNOB 2YBRA 3LRHA 1KCVL 1PZ2A 2ESVE 1DYZA 4LIQE 4IJTA 3W9DA 4AM0A 4FQQA 3FTYA 2NW3B 2D03L 4PY7A 1HYSC 1IKFL 2IGFL 2V8LA 3N44B 1XTMA 3CBKB 3WTTA 1MAML 5JNYB 4U6XB 3GMPA 2F5BL 3BIBX 5CLTA 4NEHB 1NKRA 3ELAT 1BQHB 3ARWA 1NCBL 1UH3A 4TSCH 1XR8A 3UZVA 1KGYE 4Q6KA 3MREA 2CZNA 3FDWA 4OUOA 3JBG7 3K2UH 4RIRA 4HEPA 5FS5A 4EIUA 2RB8A 2G3XA 1INQA 4MTMA 3GIZL 3RG1C 1F90L 3L5JA 4ZMTA 1OA9A 5B1KA 3B9DA 1L0QA 3O3BA 3QUMB 4R8WH 4JFXB 4HPYH 4B9ZA 4Q58C 5C09A 4KDWA 2N01B 5AKSA 25C8L 4Z7VE 5FO9B 3INUL 4FL4C 4S10A 3E6HA 4IU2A 4PHXA 1KN2H 5DVNA 2XSKA 4L0YA 1SNRA 3KPSE 4EDXB 1J12A 4HUWA 2QVFB 1VPOL 3ARTA 4ONOA 4NI3A 1EGJA 2Y2YA 4OIFA 5CWSB 3LAFA 3NTCH 1DQDL 3LV3A 2OMWB 4KTDH 1U8MA 5CBAA 4FQLL 5DHVB 5D1QA 4AQ1A 1J9QA 3L1FA 3QJQB 3AC0A 5FWQA 1FUNA 4FQXB 4JHAH 4F5CA 2WBJD 3UBXI 3X1BA 1Q9OA 1Z5HA 1TMCB 3TU6A 4I2XB 2F7QA 1C1EL 4OSUL 2L8AA 5TD4A 1RCYA 3MUGB 1MLBA 3MJ8B 4PMEA 1JCKA 1CR9H 4GXVL 2Y7NA 1S8DB 3PWNB 5KVFH 3QEQB 4AYFA 1HKLH 4PRAA 2XC8A 3S4SA 4X6EA 4LE8A 3VGDA 5KVGE 3RNQB 5E4EB 4OCXH 3RX5A 1QLRB 4DEUA 2OYPA 2C9SA 2QKIC 5FUCC 4QTFA 2J7LA 2CUHA 1I1AA 3BZ5A 4F80A 1PZUB 3GMNA 4D9RE 4KH2A 3GMLA 4HKZB 4JJ5A 1DLHB 4CJ0A 5AW9B 5D1XB 4PGDB 5F70A 5IR1B 5A3IC 1TTCA 2HFEA 1CTMA 1OTUC 1YMHB 3FC8A 4KI5D 2RHEA 3H9HA 1EJOL 3QNZA 5DMKB 3MV11 3KL0A 5IMKB 4RMVA 2GTWB 4NRZB 2D7TL 3F5WB 3FUMA 3UG3A 5CGMA 2A83A 4XP4H 2ZPKL 3VWKC 5EUOB 3O6LH 2DLTA 3EHBC 3PABA 4OM0H 1VENA 2J4WH 4KOBA 1FZOB 4WFHD 1GZPA 5KOVC 3UYRH 5MEQB 3HE7A 1U95A 3TPUA 2HTLC 3VRJB 2MSPA 4WU7A 4YXKL 2DY2A 3U25A 3GTPA 1XGRB 2VSDA 5DMJB 3T1WA 3LOWA 5AKVA 5FPIA 2Q0ZX 1TETH 1N26A 2HX7A 3UTOA 3U2IA 2JB5H 1EXUB 3SPCA 2JI3A 1QLEB 3IDGA 2EXSA 4OF0A 3QS2A 4PRHB 3S0PA 3L08A 4AV0A 4MA7L 4GYBA 5GS2D 1NA8A 3KPLA 1VESA 3PJSB 1XB6A 2D2OA 3DKHA 3ARDA 2OMYA 3FBQA 3GT6A 1CFVL 1OVZA 1HXYB 4JO2L 3K6DA 1E3XA 1AANA 9CGTA 1YNKL 2XY1A 3X2PA 4AYSA 1J8HB 1E27B 4BSWB 5EEYA 5B39B 3BX7C 2E46A 3MJ9H 3T0WA 2NTSP 4WK0B 1ITBB 3D2UB 3MXVH 4QT5B 3MV8B 2DS4A 5FF6A 1OHQA 1A6ZA 2YA0A 5BRZD 4F2MA 4ZW5A 5I6XC 5LBGA 3NP4A 4G42B 3DV4A 3GXPA 3IBEA 3GFUA 1I9JL 2BLFA 3MCLH 4GMSH 1MCRA 5EZOH 5FUZL 2JKSA 2ARJB 3SE9L 4DMRA 3G6JB 3KDMA 5FYJE 3LH2L 5ACZB 2VDNB 4AZ8B 1JHTA 2C3VB 4X6DB 5KN5A 1EZUA 4OZHB 3DIFB 4NQCD 4HF5L 4Y4KA 1NC2D 4EEEA 1PLGL 4U1SB 1F8TL 1TMOA 4K7FB 4N5EC 4WHYG 3NH7H 1MW2A 1RZPA 1WFTA 5L9DH 1OTTD 1K4CA 5EORL 3SDYH 3RU8H 4ADIA 4JCWA 4NRYB 2BNRE 3VCLB 3IN0A 1NGQH 3PPEA 3A22A 1T04B 3ZDXF 4HWZA 4PJ9C 3HHSA 3R0MA 5D7IE 3LJ3A 4JVWA 5CSGA 2QGDA 1WCBB 5F88A 5C0JB 4DCQB 3M1BA 3L1GA 4BZ1H 4CKVX 2J2ZA 1WA2X 2JIXB 5DYFA 1SN0A 1HZHL 2CLRA 4XE5B 1BG1A 3NZ8B 2X0WA 3VQMA 3VFPA 5GGTA 5DK2B 4QXTB 1KYFA 2VGLM 1SOSA 5F7FA 2V9RA 3EO0B 3FTGB 1C16B 2E7ZA 4O2CB 1J0IA 1FV1A 2YXFA 1AKPA 5EBLA 2X4OA 2D4FA 4ODVH 2G0LA 2AV1A 5DQ9B 1MG2C 4IHOB 1T3FB 2VLRD 1VFBA 4MJ6B 4PV8A 1AP2B 5CJOL 1KELL 1VGKA 3ABLB 3UMNA 4HOMA 2UYLB 3E8UL 4KFZC 5I6MA 3LY6A 1LE5A 3SZ6A 3F05A 5DEFA 1DBKH 2P8PB 4JFPB 2V2XA 4Z7NF 3FTUA 2OMZA 3NJMA 2AERT 4HD5A 1EH9A 1IEAA 1TCRB 3GEWB 3JTBA 5KOMC 3VFWA 4C56D 3GI8H 5FB8B 1IBFA 1G7QA 1JNNH 1QFPA 5DRXA 3HVDA 1ZGLM 4NPKA 2CHXA 4X4XB 1RSYA 4JRXD 1WPCA 3ULSA 1E9OA 5I19H 4UIKL 1HEZB 3QORC 5JDJA 4Q9CA 4AE0A 2PYEB 1ONQB 5CFAA 2YMXL 4V1DD 3CDYA 4MHHI 4LLWA 2Q7YB 4KKLD 8FABB 4WO4B 4JRYD 1HQRB 4NIKB 3SDAC 3VTAA 3AFLA 3BHBB 4JE4B 5D7LE 5DJXA 5C0CA 4UILL 2EP6A 1UT2A 3HC0A 2QGEA 4OVUA 3SGDH 3UTPD 4UTBA 2P9RA 2V8MA 3MJ7B 3KPNA 4B9CA 5HYJB 3LKNB 3IMUA 5DJCB 5E23A 3T0DA 2W9DH 3GM8A 5EN2B 2K9UA 4TQIA 4U1GB 3MJWA 5EC1B 2BNQE 1BBDH 1H5BB 3N1FC 3CC5A 3U2SA 3HPJA 3QWQB 3MV7E 5CCJA 4JO4H 2KQNA 3SQBB 2EINB 3VH8A 5TPWL 3RA7H 3RTQD 5FUOH 2Z3FA 1XD0A 1ES0B 2R2EA 5TTRA 4S2SB 3VFMA 1J5IA 2AK1L 2OJ1A 3LQAL 3NA9L 5ID1A 1WZLA 3OR7B 2J1ZA 2PO6C 3NJIA 2OTWB 1WFIA 3QSKB 2K1MA 3APFA 3SKMA 4CRPA 3FFCE 5FKAB 3VXQA 4HOWA 5L2KE 5DRNB 1A21A 1KTLB 2CBMA 1IIIA 3B37A 4ODXA 4OZGF 1FIGH 4R90H 3OJVC 1K3IA 4PD4K 1SHXA 4OLVH 3G5WA 3QCVL 5ACLA 4GUQA 2ATPB 4XP5L 1RMFH 1C7SA 4UTBL 1XTLA 1S7WB 4F3FB 2NY3B 4ZXBA 1L7IH 5GIRA 4UCFA 5HVHC 3PUUA 2J21A 2VH5L 1MHCB 4A37A 4R4BA 1A9EB 5KYUA 4X6CA 1WQVT 3NIDE 3S3DB 2ZWZA 5IVZB 4YK4C 1LQSR 4Z0BL 1XEUA 3N9GH 4MNQB 3H42L 5D9SB 3T2NL 1QNIA 3TV3L 3AREB 4GSXA 1WTGT 3C08L 4AI7A 2XQBL 2MTPA 3A6CL 3VXUB 1JCVA 1QABA 1TZGH 3CSPA 4H25B 5KYNA 3ECWA 1TVDA 2B1AH 5DLML 4TPRL 3HUJA 4BK5C 1TWAA 1GZHA 1H6UA 2OJEA 1AAJA 3GMMA 3HJ0A 4GKNB 1D5ZB 3S5LA 1GAFH 1BVKA 4PJBF 1TQBC 2IDFA 3NK3A 4ORGA 3GTQA 2IBGA 1OTSC 3CFMA 1ED3A 3OKLB 2AF2A 2CJUL 3ECVA 3I2CH 3QQDB 3L9RA 4DP4X 4L4VD 4MVBC 3GXMA 1SY6A 5DJ0B 4XGZA 1VF5C 3KEHA 5AW2B 1Z3RA 3L3HA 4JR9H 5L7XH 5LJYH 4CILA 1WAAF 2AKRB 3RL1A 1S7VB 4KHTH 1HH6A 5J6SA 5ISZE 4Y19B 3L9BA 3SDDB 3K5RA 3L3IA 3NSDA 2JB6B 4HKJA 3J8F7 5EU7E 3DBXB 1KTDA 2GCYA 5BVPH 4M48L 3CNKA 1IE4A 5EOTA 4NP4L 5K69A 4RMBA 3KWUA 3VWJA 1UKQA 3WJLC 2PP9A 4ZQTA 4U1JA 3CPLB 4IDLA 4JX0A 2YOCA 4K94H 4NYLA 1SLVA 1TYRA 1YEKH 3ARFA 4L29A 4N2CA 3MRDB 4NKQB 4KI5F 4S0TD 4PTUA 2F2HA 4HIJA 4KITB 1HU8A 3IDMB 2OXGB 3LMJL 3B2PA 2QQLH 3I6LD 3K0WA 1QEXA 1JYWA 2AJSL 3WEXB 2KLSA 1DVZA 5EU4A 3BGFB 2LT9A 5L2JA 4LGRB 4J7RA 4M56A 1I50A 3Q3GA 4FQ2H 3O6MH 1JGEA 3C5SA 1KCLA 1NMAH 2JKLA 3IE9A 1J8RA 1FP5A 1HCVA 2HT4D 2ZSWB 3FB6A 1XSJA 3OVUB 2ZX5A 3FU6A 4UUJA 1L6ZA 1NBZA 3LVTA 4JG9A 3EGSB 4CU7A 2GK0A 3RZCC 4R83A 1QX1A 1ASPA 1YJDL 4W4OC 5E6IB 1I3QA 3HZMA 1A4BA 4U1MA 5DI8B 1FRGH 2QBWA 4NN5B 3DTXB 4Z3IA 2DQJL 3EOTH 3TO4B 5I0VA 4MCYB 5H37H 3SCMD 4IRZH 3B56A 2HFFA 4JEGB 2OTUB 5EBMB 4G83A 3PREA 4JGUA 2ZQKA 3WUWA 1IGCH 4QTIL 5FOJA 1A6AB 4YO0B 3O3EB 3BP5B 4JM2F 2GIMA 4Q89A 1YEGH 2IADB 2CA3A 3B7YA 4OB5H 1ZIBA 3NRQA 4ZM7A 1RJLA 4O58L 4OW6A 3ZRSA 4YHYB 2YK1H 5A43C 4KJWD 5G55A 3S8FB 4GW5A 4LAQH 1MIEL 4EXKA 4F5CE 1UCTA 5DK0A 3QFDA 3F6JA 3CFUA 4P2OA 4GQZA 3Q8AA 1UM5L 4LCWA 3LSOA 4OZFA 1YUHA 2QLVB 4HIPA 5FOBA 1PG7W 3L7FA 4MA3A 3LNHA 2ZOKA 3G04B 4R0LA 2A4ZA 1AO7A 1RZ8B 1J0YA 4CNIA 3ECBA 4FLHA 1BPVA 3QZBA 3DA0A 4DAGL 3QUZD 5HJ3A 2CD0A 5SX5H 4YZFE 2PJHB 3LH9A 4HMDA 2IOIA 2W9EL 4R3SB 1XSIA 1JV5A 4I0PC 3GTNA 1SHSA 3LKSA 4NFDA 3HU3A 4DOHB 1NGPL 3GB7A 4NBYB 2VITB 3TH3T 5I1HL 3QXWA 5MEOA 2WMPB 1BVNP 4X8JB 1LTXA 4UTAA 1FNFA 4UTCA 1IGFH 2UXFA 3U48A 3DMRA 2VT0A 1MLCB 3VGHA 3D9AH 3I3EA 3O8XD 2CPCA 2VM4A 1CGSH 4GNKB 9PCYA 1B6DA 4MJ5A 2Y5TA 4DEPB 2B08A 3CN0A 1XVSA 2CUIA 1GIGL 2YFOA 2DM7A 3X11B 2HT3C 4WW2F 3EG9A 4P9HL 1MCOL 3NRFA 1ND0A 3SE4A 5LLIC 1SMAA 1KV7A 1E8YA 2XA3A 4IGBD 1FLRH 4NUMA 1OALA 4Y9FA 3BKJH 4AVJA 3RWGB 2VN3A 1BD2A 1P4BL 3NMEA 5E08L 1SMDA 3U46B 4CN4A 2XACC 3O6FB 1AGBA 1ZK9A 3LEVH 1BEYL 5B1CA 2H2PD 3H56A 2PCFB 3OMAB 1UCBH 2VE6B 5INCB 3U79A 1EZVY 3BEWB 3F84A 2VDOL 4DKEL 1MVUA 3RGVC 3W39B 1YAZA 4H13C 4R2GD 4GFXA 4AKOA 3ATAA 4KROC 2ED9A 3S35X 4WI2A 2A6JA 4L23A 3QBTB 4FFYA 5C0RH 1IGYA 3BP7B 3T6WA 4DW2H 5IJBC 4ZPTB 2ZOTA 3GPEA 1BM3H 5DR5H 1UA3A 1U42A 5JPNC 2FEJA 3C5XA 4S0SD 4TULH 1A2YB 4BA0A 5HHPA 1FZKB 1KYOK 1MQ8A 1DQJB 1PZCA 1CGXA 1RZJC 3ARBB 2BCKB 2YD4A 4EIZC 3GHBH 3VB8A 5F1NA 2F8VA 4CC0A 1CVSC 3FSWA 3MN8A 3IETA 5DO2C 4JFUA 2AW2A 4F2ME 2X88A 4PVLA 3FB8A 4MS8D 5GSRA 1FE8L 3MOQA 3ZSTA 1AYOA 3D18B 4OGXL 5FHAL 1A4JA 1PJ9A 4H2CA 4DTGL 1WBYB 4HKBA 4JHWH 5CJQH 4L8SA 4Y4HC 4LCYB 3ZR5A 4YHZL 2ENSA 3TEZA 5FO2A 4TRPL 2BMKB 3RWHA 1KIQB 1QSFD 4GI9A 5D7HA 2BVEA 1L9SA 1KCSL 3MBXL 1KWGA 2Q2LA 4APQA 2ADYA 1BXXA 2ZIDA 1D5IH 1YEHH 2FIKA 2P5WB 3N43F 1KGUA 2UX6A 3ZGIA 4NN7C 2FO1A 1F02I 1S6NA 1T5WA 3S2CA 4CVXB 3LKPA 4LLQB 2NYYC 4EIGB 1Z9NA 4QRBA 5J3HD 3P40A 1VADB 2IBBA 1NBVL 2XCMC 1SJEB 2DKMA 2Q8AH 1M05A 2Z93B 3KBEA 3DO7B 4IU3A 4DGIL 5F0PB 3L4YA 2XU9A 1JYNA 1T22B 1X7QA 3MRGA 3KBFA 2YAEA 1E8WA 4KX9A 1MFBL 1J87A 3T3ME 3GSUB 3ILPB 2C4FU 1CXKA 4NNYA 5T1LB 2I26N 3AUVA 1G9NH 1DANT 3RJQB 1FYTD 1M2VB 3MLRL 4GB9A 4A7GA 3ILQC 3MV01 4WDIA 1KCKA 4YAQB 5H4YA 4X9GA 5AW5B 4RBPK 2X2IA 3EJQA 1ORQB 3RWCA 1SZNA 1KIUB 3CIAA 1NIDA 3QQ9C 4XCEA 1T83C 4FOMA 3CDGB 3RY5A 5FDYA 4W9HC 4JK0D 1PYWB 4J6IA 5E8NB 3OQ3B 3TX4A 3WS3B 1I3GL 1JJUA 2R27A 1ZEAL 2WO3B 3ESPA 3OKYA 2AABL 4K3JL 5EO9A 3T1FA 1FORL 3O4LD 1G84A 1C12A 3ABMB 4QRTA 3MI6A 5HHVH 5CU9A 1YEJL 1AGDA 5FTLA 1V54B 3I74A 4H8WL 4QWWD 3E6FB 3MZGB 4EN3C 5A2JH 4R5VA 2UZXA 4NIYE 4MD5B 1W0WA 5F9JA 4HVBA 3QHZL 5JW4Q 1M71B 1I9IL 1WITA 1E61A 2J88L 1D5XB 1FN4A 5T1KB 4JS7A 4J3SA 4G7VL 3EIFA 5DD0H 4KO7A 4PJBB 5EWIH 3PUCA 1VGEL 2JA5A 4I48B 2P42B 3ZKQD 3SGJC 4JG1L 4MHHG 2H41A 3CPUA 3GJFB 1Q0YH 4JPIA 4KWUA 3HZVB 2E9WA 1FFNA 3EH3B 3O3DA 5HYSA 5DMGC 3I9GL 1OAUH 3TPKA 3OKDB 5MP6L 1FVEA 2I7OA 3B6SB 3FT4B 1QA9B 2MQ0A 4DGUA 5EA0L 5HHOA 3QR1A 5L0QC 3NPSB 4XCCH 2FATH 5EBGA 3GI9L 3MYJA 5CINL 1I7RA 2B1OA 2VLJE 4L8BB 4P4RB 4YSRA 4YFDB 4POZC 5DZJA 1R5WB 5T1DL 1PG7H 1MFCL 3EO1A 1X4XA 3PQYA 4WTXA 3IKCB 4PRPD 3Q6FA 1QBLL 2P1YA 2N3JA 1UZ8B 5ESVB 1RZGA 2VDKH 2ENGA 4BZ2H 2C5DC 3SN6N 3WSQL 3QJFB 2XWXA 2DQHH 2OAAA 5AYUH 3PLXB 2IGLA 4XPHH 3AADB 2HVBA 3JWOC 3V0WH 1NDGB 4EI5D 4W4NA 3CSYB 3V55A 2WJ5A 2W59A 2XYBA 4N2KA 5EFIA 1IC7H 2DJ4A 3AY2A 4X6CE 2IFGA 3C6LA 1SXSA 1A66A 1RLBA 3NCCB 1RUKH 4CBPA 4ERSL 4BSVB 5GPRA 4OLYL 4Z7QE 1AA6A 2WK2A 4Y5VA 5BQ7A 1CD8A 2VCOA 4MCZB 1OE1A 4OJCA 4M9OA 1R3KB 4JFFA 2OSLB 2WXRA 5MEND 5E9AA 1IM9B 2XWEA 4GIPD 5GRVK 4JE0A 2HJLA 2J6EA 4A63A 3QCUH 4PBWD 1U8QA 4RZCA 1AH1A 1F45A 1QRND 4HMEA 3ZTJG 5C86A 3O3UN 3J7HA 3HNTH 2E7BA 3MKKA 2VC2B 4OLZH 1SEBA 4JFYA 3V4VA 3MRQA 4LSVH 4XAKD 2ITCB 4AT6A 2X28A 3GTJA 4NENA 1K8DB 3MCG1 4M8QA 3A6BH 3S37X 2VLKD 1PMYA 1KJ3H 3GMQA 1LD9B 2LABA 4KRPC 2F7PA 5EO1A 3UGEA 2ZUTA 3QH3A 4KTEL 4J39A 5JXEC 3AACA 2ZX7A 1XF3B 2Y2WA 4BDVA 1UWGL 2HLFD 2B4CL 4QRFA 4XNMA 3FCSB 3VAEA 4HT1H 5I6PA 1KGCE 1H6EA 2DYPD 5J7CC 4KK9C 5INDB 1IQDA 3CLWA 5HYFA 3I6SA 3LS4H 1QRKA 1SQMA 4LCVA 4AGPA 3HG0A 3NJKA 3MRPB 5KEZA 1HX0A 5F9WB 1A1NB 4X5XB 3ZE0F 4NQCB 5T1MB 4KJYA 4RFNB 3RWIA 4PJXA 5LNDA 3T2OA 5JO5A 2V3VA 2XWBB 5BO1H 2NY5L 1FC2D 2V17L 4KKBC 2FGWL 3X1GA 1JFQH 5FYKU 3DSNB 2YD2A 4JL2A 4KKZA 1MNUH 1PPIA 5J89A 3P0VH 4I89A 4L18A 2WGXA 4C8XA 5GGRB 1UXLA 3CK0L 5E8OB 4QOKB 3R7RA 1S9YA 1NC4D 4JY6B 2ZXAA 3CXHK 5F44A 5FA3B 1PSKH 5K39B 3Q13A 1JUFA 4E9WA 3IXTB 5GGRY 3V4VL 4BCZA 2R2CA 5BRQA 2I85A 1QI4A 3PHOA 4FS0A 2HPOA 3GTMA 3CZNA 5ECGA 3BT2H 3OAYH 3QHTC 5DRWB 2K4WA 2Y72A 3FUJA 4AUYA 5IMMB 1MFEH 3CMOH 1G8JA 1FHGA 1QO3A 4FQ1L 3HG1E 1TQCB 1Q9LA 4YOKA 4ZFGL 5BZWA 3O9WA 1OK8A 2P8LB 3PP3H 3BUPA 4YVNA 4ZAKB 5FGSA 2VLRB 5J57B 1BGXL 5E00B 2ZKHL 3F12A 3FAXA 4MAUH 5DD6A 4U6HA 2JIQA 4YJZL 1MNNA 3BQUB 2C45A 1KDJA 1USQA 3OMZA 2OMUA 4JUSA 4G7RB 2O30A 4WUKL 3ZE2F 2IANE 4QAWA 4PBDA 2YN3A 4CU8A 5KVEL 4FFVC 1CTNA 4C56B 5D7JC 2YAFA 3TA3A 3N41F 5IB1B 2Q8BL 5HVFB 2YC1A 4DESA 1DUZB 2PTUA 2V2TA 2OX5A 4FXTA 4TUKL 3BPOC 4FXKC 4JRXB 4CRZA 3A24A 1UJ3A 5CHNA 4P5TD 2D73A 5FGBC 4M43H 4XMZA 4E2OA 2E27L 4F37F 5KS9E 1F6AA 3TCXA 5HI5C 2X12A 3TM6A 4HG4J 5KJRH 1XDTT 3WD5L 4F7MB 3BSZH 3MRKB 4IMLB 4XVTH 4HJIA 5LN4A 3AITA 4FKKA 1VCAA 3O0RH 2MOVA 1AXTL 2CDEB 4GIOA 4DO5A 3D69B 4JMXA 1CBJA 3U82B 4B6ZA 5F3FA 4ABQA 5KVDE 5EMYA 1HOCA 2UUDK 2HFTA 4IBUA 1YQVH 4GKSA 4PJAB 3C5ZA 4PJCF 1NAMA 1NZRA 1XSOA 2NDFA 4CC4A 1Z1WA 2R1WB 4Y5YA 3QGVA 5A6MA 2VXTH 1KZQA 3EYVB 4MJJA 3BLKA 3CVHB 2YPKA 3NACL 3KPSD 15C8H 1Q9WA 3DYPA 3P3YA 4GRMB 3RTQB 4LB8A 1PCSA 3TZVA 4F27A 2DIJA 4FP8H 4X99A 2QQQA 4F24A 4M5SA 1IJNA 2H3NA 4AY0A 1SF5A 4OKDA 2A9NH 3AJ7A 3HTLX 4I3RH 3RVTC 3IPBA 5CF3A 1TPXC 1NCGA 3RIKA 4QLWA 5F7DA 1E6JL 2FT6A 1KJVA 4Y2DB 3O2DA 4O02A 5LXGL 1BD2E 3OZ9L 1IBHA 4JHVA 1QATA 2WLHA 3BAIA 3FT0A 1U93B 4TS6A 4RA0C 2DQTH 2E47A 4H1LH 2EDQA 4R96B 4YPGB 3X3FH 5A2BA 3FT2B 2ZXQA 2DQ6A 3MLVH 5TDNA 2E7HA 2Z92B 5HDOA 3P4OB 1XT5A 1G7LB 5C6PB 3HAEA 3FZUD 5AG9A 4AV5A 1NCWL 1HVXA 1PZ5B 3GINA 3M1CA 1K85A 2YXVA 1Q90A 3TYGL 4JKPL 4LVOC 1NAML 4LCUB 5IHZA 2WINB 4P4KD 2IH3B 2I9LB 2M1KA 4NKDA 3KPOA 2TAAA 4XXCA 3V0JA 4HGWB 3WNIA 4F2FA 3FB7A 2Y1VA 1FPTL 1FH2A 4QJ4B 2BOBB 1A5FH 2GBVA 3DURA 3KLAA 5AB2A 1U91B 3CN1A 2DH3A 2G2RA 2HPTA 3ARGD 5AG8A 4Z7OB 5I2IA 2DM2A 2OBGA 5KS9B 5KSVA 1FNEB 3WY1A 4N2AA 4AJWA 4HUKB 1IL1A 3SBQA 4K3DH 2QELA 1CDJA 1S78D 5DD1H 3UAJA 1LE9B 4HDIA 1MWAB 1XGPA 2XNAB 1IAOA 3NQKA 3CDZA 4L4VB 3CE1A 3O2DL 4O02L 1T0NB 4HXAH 2RCSL 5TE7H 4F15C 2DF3A 5D93C 1FQ9C 4U1LB 1MCIA 2MNWA 1L7TL 1AR1C 1HHGB 1QYGL 4K7PL 3S8WA 5F6HJ 2EC8A 4M5ZL 4RAVA 4MQ7A 2VDKB 5BUAA 1WEJH 3GTVA 4OD1H 1MSPA 1GMEA 4HQQH 3VGEA 3W57A 4G9FD 1DQTA 2ITDB 4NQQA 4YQXL 3PF2A 1NCIA 5GGQH 4GUOA 2GW5A 3VMNA 2J1KA 1IM3B 3EUUA 1RV6X 3ZMRA 4CAGA 5L8KB 4ZYKA 3L4WA 1PDKA 1RIVL 2QVMA 1KEML 4MNGA 4NKIL 3RUGE 2GJ6B 3ZE1E 4TUJA 2WLLA 5IHLB 3DV6B 3MTRA 4GT0A 1KN4L 4P59H 4LARH 3D52A 2X40A 4ZUSB 3TASA 4GG6F 4D8PA 3IMSA 4HIHB 1WS8A 1SYSB 3TBVA 2ZWYA 1OAZH 5SX4I 2AK4B 4IIQA 3U4KA 2DLGA 3ULUD 3NEXA 2R29L 1GXEA 1R3LA 3UTTD 3JV4A 1TQVA 5DJZB 5KSBA 1KLFB 3FPYA 2WSPA 4QXUL 4PJGA 1AW8B 1BQSA 4FTVA 4OLUL 2XQ0A 1PYUB 4GXUM 5AOLA 1CI3M 3GLZA 5FYJD 1XGYH 4YHML 3RIAF 5GRJH 1KFGA 4I18B 1BAFH 4E0RA 3D39A 3FCBA 3FB5B 3O45B 3K2MC 4OJDH 2ZG3A 2WLZA 5AOMA 4B5ZA 2ADJA 4MSWB 4MAYB 5CBEA 2CLZA 2XTSA 2VN7A 3TN0C 3K2KA 2EH7H 2WNWA 1MW0A 4NWUL 1RJZA 2IAMB 2X3AA 3SDCD 4F8NA 1I8LC 3SDDC 4FNPA 2BNRD 3ULVE 1UYWL 4XXDA 5K59F 4X4YA 3DJ9A 2WWOA 5I6LA 2NYZA 2JXMA 2P80A 2VYRE 4UI2A 2JWYA 4IK6A 2XY2A 2EEAA 3MKGA 4KHXH 1N8OE 4KZ0A 4PI0A 4DERA 2XN1A 3VMOA 4FTDA 1AMYA 5T1JA 4RSVA 4LKXA 3TBYB 3NAAH 1DUYB 3WAKA 5HDBF 2ZUQC 2I27N 4N85A 5BZXA 4NC1E 5F7HA 5BS0B 4P9ML 3VO0A 4I1NB 4YE4H 1WVZA 1DN0B 4NCC2 4ELMF 1QUNB 1UM4L 1JHKH 2Z35B 2ZSVA 4ATWA 5HYQB 5IREA 4NQSB 3PIQA 3SD2A 2D31A 2DI7A 1AXSA 2ODHA 3TCLA 2H32H 3QUZB 5FYLL 1LNUB 1I82A 1PAZA 3RB7A 1VAHA 2AV7A 1T66D 2JIPA 3A3YB 1M6OA 3REVA 2EIDA 3KM1A 5FUCE 4QRRA 1R3HA 1RZFH 1YSOA 1KJ2B 4M61A 4XBPB 1A9VA 4M4RB 3G5VA 3MROA 1PX8A 4Z23A 5F21B 4QD2E 4LFHD 5GS0D 3ZHDA 3FT3B 3PWPA 3X17A 2B0SL 2ROXA 1CD1A 2ZCHH 2OMXA 5HGBB 5I15L 4EOWH 4ZNCD 4LSSL 4N9GA 3V4PA 2Z8WC 4PI2A 1UWXH 5HJDA 2WWMD 1T21B 4IIZA 4L05A 2E4TA 4PREB 2H0JA 5BOPA 1P84K 2WAHA 5GISH 4MLSA 1SOXA 2ATKA 3IS1X 4IGBB 1EO7A 3GMRB 2E9BA 4NBXB 3P2TA 3CQZA 2CK2A 4N2NA 4E42B 2ZTBA 5DD5H 2CIKA 3RDTA 4JFEA 3BH8A 3Q8BA 2A5UA 5EEVA 1XF5B 3VX1A 4BK8A 1D5RA 4WLCA 4PB0L 2ENPA 3PP4L 2A3TA 2BNQD 2DQCH 5CD3A 5L88H 3MOBL 4JFFE 3QJVB 4R2GB 3K5SA 2AMUA 1AKJD 2NXZC 1NCUA 4EBQL 4MFHA 5CKAA 3MMEB 5EIIB 1F4HA 4G6ML 4QHLB 4L0ZA 4OD3L 1MAJA 5EIVA 4M7LH 3DROA 1NCTA 3F04A 4YXLH 1N4XH 4L3EA 4WHCA 4UOZA 2X6VA 4U6YA 2AEOA 2YEQA 4K3EL 4F7TA 1BFSA 1QHQA 1I53A 5JDSB 3O5AA 3NJHA 4OTXH 4Z7WE 3QQXA 3D0LA 3LRSA 3N41B 2DAVA 2FD6H 5E1GA 5L2KD 2HG5A 4P2RB 1I9RH 4R4FL 5J11B 4MB5A 5FO7B 5B38A 2V2WA 4PGEA 3MBEC 2Y4SA 4JQVC 1CG9B 5IB4B 1O5DT 1H6FA 3P77A 4KKAD 3GD1C 5D1ZD 4G6KL 4Z7VF 5SWZE 1NSNH 1SLXA 2ZXBA 1NFIA 3NZHL 2Y23A 4LP8A 5D71L 2VMDA 4PJDE 2ENJA 2X70B 2Z8VC 5F7LB 4A67A 1MCDA 3FUKA 2QTEA 5K33A 3S36X 4AQZA 4OUUB 4H1LB 4MXWL 4LEEA 5KSAD 3V95A 3ESVF 4DN3L 2ICEB 3P3RA 4XCYB 2VDLB 3DUUB 1BMWA 4PJCB 2G2NA 1MUJB 5GGVH 4QHPA 1KULA 1EBAA 5E0QA 5F3HB 3U0WL 4K5NA 2E7MA 3BPCB 3MODL 1YEIH 1BYOA 4HPOL 4OI9A 3C60D 3SYPA 1LHZA 3UL4A 3HS0C 1EWHA 4N0UE 3QIBC 4G8EB 1LDPH 4NNXA 3G5XA 2CA4A 2VQ4A 5DVKA 1BIHA 3UTSA 3U4BH 5EDXA 1P53A 4XXWC 2XTJC 4GBXC 2QSVA 3NJNA 1U41A 3EKCA 3VG0L 5KBLA 5ISZD 3NIGE 4GQQA 3UJIH 4WWOA 5T3ZE 1Z0NA 1BJMA 1DLFH 2F53E 2OPCA 3OLGA 3T8XB 4F7PB 1BLNA 1G7MA 4ZMNA 2H6PA 4AQAA 3W5NA 1ASQA 2R23A 1LP9F 2WWNA 3TBWA 1ZDSA 2JF1A 2R15A 1O9ZA 1HJCA 3VFGL 1V3MA 1A47A 1QLFA 2C1OB 3OHXB 3O4LB 4FZ8L 4OJFH 4Y1AA 1G6RA 4Z6AT 2BRRH 3K8MA 4WWKB 2ZAIA 1FH5L 5D7EA 2WZ0A 3ZRFC 1B2YA 1CE1H 1E65A 1O75A 2DM3A 3RTLA 1KNOA 1IAIH 3MRHB 5EOCL 4L4TB 4M6NH 4L2YA 4HHAB 5F7UA 3MLPA 4PVBA 2BY1A 3FCUB 3HNVL 1DFBH 2PR4L 3N55A 2H0PA 3HLKA 4DVRH 4XNYH 4G8IB 1N6VA 1CBVL 4ONHA 4XO9A 4HWBH 3LQMA 3EJCA 3T3PE 4LQFL 5JNYA 3BFWA 4Q0XL 4RGND 5I8OL 1FO0H 5KVGH 3L4UA 1HEJC 3I50L 1Z3GH 1BQHA 2BSSB 2FJGA 5F7KC 5L6YL 2H6UA 1NQBA 5SWSB 5DGQA 3BDYH 1J05B 4G7SB 4ZD3L 5BZZA 2HT2D 3FO0H 5C09D 2XWCA 5JUEH 4MNHA 2CAKA 5AUMA 1A3LH 1KTCA 1SDYA 4KVCL 5TFSH 4CADB 1JMZA 2BY3A 3FU3A 3QUMA 3V7AG 4E9TA 3C5JA 1I1YB 5KYXB 4AXWB 4RFEA 1XL6A 5FO9A 2YGOA 5C1MB 3L5XL 4G3YL 4KUCD 2AQ3A 1G6RL 3R18A 4G11A 5GHWL 3B9AA 5D1QD 4ENED 4ZX3A 3ES6A 5JXAL 4EDXA 1JGVL 3RL2B 4YDJB 1JF1B 2GFBA 3PJLA 5J1AA 1PD6A 3H2QA 5A6LA 2B5IC 1BQLH 3WTYA 5JPMB 3EDJA 2OMWA 4GW1B 3DGDA 3S3PA 3IFOB 1UC6A 5T5ID 2G6GA 4FFZA 4FQXA 5CMAA 3QXVA 1HEHC 4EI5B 4F57L 5LGJB 4ICXA 2CUAA 1ZAGA 2P52A 3L8QA 3WJJA 2WBJC 2DB8A 4WHTB 4I2XA 3V0EA 4EUPG 2X1OA 5ITFA 5F6HI 1WUZA 1P2CB 3MUGA 2AAAA 4O51B 3MGTB 1KY6A 4R97B 2VLME 3MACL 1UOLA 1NGYA 3MJ8A 4MBOA 4UT7L 3NJVA 3ZZ1A 1R9TA 1FWXA 1S8DA 1MWOA 3WE1A 5HD8C 5JIPA 3KBPA 3QEQA 3B5HA 4IRJA 1PGRB 2M8XA 3D0VB 4BRVA 2ZYRA 4HJTA 3RNQA 1B4JH 2JKXA 4QMEA 3Q8FA 4ODHL 4UM9A 4E5XG 4M00A 2BIIA 1R7RA 3WNKA 3GXTA 3HVNA 5F7EH 5EEWA 2Q86B 1BYNA 3VXOB 3D08A 1WZAA 1ZJBA 4HKZA 3OSKA 4HBQA 5E5RB 4HK3N 3DBSA 5FYJH 3S3SA 2VLKB 1A7PH 3H54A 1UUSA 5D1XA 4PGDA 3BCDA 5IR1A 7CGTA 3FQ4A 3HE7D 5HDBB 5IMKA 1J1PL 1ACXA 2GTWA 3NT0A 4KI5C 3QDJA 1DJWA 3F5WA 4U6TA 3W2DL 1IBDA 1OOWA 1PQZB 3CXDL 1C8PA 3LYRA 1MRDL 4UQ2B 2FUTA 5EUOA 2DYPB 3VDCA 1FAIH 1NDMB 4OKVB 2YOAA 2RA1A 3HLAB 3KYNA 1BFVH 1Q72H 5MEQA 2Z31C 1JRHI 5D2NC 5HHXL 5ERWB 5KBPA 3BAEH 4FF9A 4FADA 4ODWB 5FK9A 2E8YA 3IRCA 1IKNA 1UD2A 1XGRA 4MNGE 4G5ZH 3C6SA 4HYTB 3GTGA 4G2AA 4UT9H 2B3IA 5GSVB 4L5FL 3QISA 2F58H 3AXLB 3ARDD 3ZTDC 2FAUA 4ZUTB 3UROR 4Y5XA 1EXUA 1NC4B 1OGAA 4RMSA 1ZIAA 3QDGE 3COOA 4YX2H 1INEL 1XF4B 5DC4B 4I0CC 4PVMA 4KRMB 2YPLB 5JLZB 1HXYA 2NX5B 5CP3A 4L8DB 4C83A 2QSCH 2R7ZA 3O41B 4IM8A 1E27A 3WHE0 3ZUCA 5GGUB 4JM2C 5B39A 3U6XS 3DJSA 4DPCX 1CDIA 2IG2H 3LZOA 4QT5A 3MV8A 1KYOJ 2D9QB 1GTFA 4MLIA 5JHLA 2HWZL 1IBGH 3D39E 2GK2A 4G42A 5BW7A 2H7WA 3QG6B 5GS0H 2WBWB 3LEYL 3UTQA 2R69A 5AZUA 4HJUA 4X5PA 3V0VB 2GABA 2ID5A 2ARJA 3FRUB 5E2JA 4M7JH 4OI8A 5ACZA 1ET5A 2Q5BA 3AQXA 3FQNB 3P2BA 4OZHA 3U9PL 3DIFA 1XGTB 4HWUA 4C57C 4H44C 3OAYK 2BOLA 2QHRL 3TURA 4K7FA 5IGXH 4MJIB 1JPST 2EDHA 1BG9A 3VGAB 1N0LB 4QUOA 3VCLA 1P5UA 2AJZB 1URIA 1NANI 1OTTC 3PP3K 3GBDA 4KPHL 4P5TB 1F6LL 4XN5A 1WCBA 1R19A 1Z9SB 3V52H 3DHUA 5C0JA 4DCQA 2A9BA 4JY4A 4FLSA 3S96B 1MAKA 2JIXA 2MOGA 3OXSB 4BCXA 2A9CA 3GNML 4JKKA 4HZLB 4KVNH 4F7CB 5K1VA 2J5LC 5DK2A 4QXTA 3BZEB 2F18A 3FTGA 5IW6B 1AC6A 4D3CL 1RD6A 4O2CA 5I5MA 4LASH 2NUPB 4MCNA 1A3RH 5GGVY 1GA2A 5ITBL 1V7NL 1QD0A 5LCVH 2QEJA 5DQ9A 3W5MA 3T8VA 4DSYA 2VM3A 4IHOA 5DYIA 2R69L 4MJ6A 1ZVSB 3KGUA 4WW2C 2DWSA 5AW0B 1SVZA 3RX8A 1AP2A 3CFKB 2MJWA 2X53A 3EYFB 1IFRA 3BN3B 2UYLA 2IPTL 4XPFL 5AVQB 5BUGA 4HSCX 2LTQC 2P8PA 4JFPA 4Q6IA 3NCMA 1DQLL 3D25B 3PS6A 1IILE 5FB8A 1F58H 4LDLB 3WIFB 4Q9RH 1S7QA 2W92A 2P49B 2IH1B 4LHUG 3ZSSA 4X4XA 1DSFH 2FB4H 5C0CD 4AVRA 1RPKA 3N0AA 3SEPA 2EIJB 3X1FA 1KG0B 1LLAA 1HEZA 4FQCH 4OCRL 2AJXL 2PYEA 1ONQA 2WHVA 5E2UL 3UPCA 4B53A 5IJKA 2Q7YA 8FABA 3UGXA 5ADPH 4WO4A 4YH6A 1W80A 3MQIA 2M26A 4JFEE 3BHBA 4KKLC 3B7TA 4S1DD 2FSEB 3M46A 1WBXB 5IBTL 2JELH 5F6IB 1IAMA 3GJEB 4NX0A 2YS4A 4XPGL 3KLDA 4JDVA 3NUKA 3OLDA 2QR0B 1BZEA 2MHAB 3Q5TA 2IGFH 3F58H 5ABZA 4YSDA 1ZOXA 2GIXA 1ZA6B 5DA0B 5FCUH 1WD8A 2WW8A 5D5ME 3HRZC 1X5KA 4LEXL 3PGFL 4LVHC 1EIBA 4XO4A 5EN2A 1VZHA 3CHRA 1KGWA 3H1ZA 1UFUA 3QYCA 2ICES 2FJHB 4P4KB 2PKDA 1Y1VA 1G9NC 4AZUA 4RMTA 3VXMA 2B8OT 1AZNA 3GIZH 1TLKA 2D7OA 4RX4A 1ES0A 1F0LA 1IQWH 3KBHE 3B2DC 3ARGB 3VYOA 4U7MA 4F92B 5IW1A 4ZFFB 4H2AA 3L1OL 1TJIH 4JL1A 1CZ8H 2L7JA 1KBGH 2BW4A 2OTWA 2WKOA 4GP4B 4BXVA 1RAMA 2DI8A 5FKAA 2R0KH 2C9AA 3EGXB 4WTQA 5DRNA 4ZXBD 4A6YH 1KTLA 4CW1B 3QQ7A 4C4BA 4GRWF 5CN3A 5JORB 2P44B 1HCZA 4NHCH 1OY3B 3EJSA 4W9CC 3IXAB 3BLPX 1DQDH 4MYWB 4OF5A 2PI8A 2ATPA 1TJXA 1S7WA 4F3FA 4MB1A 4PMFA 4P2QD 1RUAL 4JZNB 2XVGA 4G9FB 4U4IA 3O4OC 4KUCF 1SJXA 4Y2LA 1RZ7L 2FNWA 3CN2A 3WFHB 1MHCA 4BGDA 1MFUA 4JN1L 5E8DH 4DGVH 5IROA 4ZG1A 1E18A 3SE8L 1BOGB 2CO2A 4K9JA 3LHAA 1Y7VA 5IJVB 4PYGA 4MNQA 4X4ME 5C1BA 1C5BH 3QR2A 4XI5D 2WPGA 5D9SA 1MJ7H 5D96B 5B21A 5DQJB 2VSKB 3HC3L 3DNKA 5DEJA 2WUCH 3ZMNA 2VDML 4GKNA 3IJEB 1D5ZA 1UD4A 5E2TL 4XNZB 4D7PA 2Y6SD 3D4YA 1L9RA 1VACB 5AOKA 4GMTL 4G6FD 4OCMC 3I9AA 3OKLA 3DDGA 2V3FA 4PWFA 1ZANH 3QQDA 4GRWH 1HD5A 4UINL 4DP2X 4LRNH 5HDLA 3TIEB 2WP3T 3CFNA 3D7PA 3BPLB 2FT8A 2HUEA 2FX8L 1PW3A 3VWJD 2EVFA 4XBEH 1EGJH 1ZSDB 3AT0A 2AKRA 1B4TA 1S7VA 3V6FA 5J12C 4XOEA 1KGIA 1T5KA 3ARFD 2ZX8A 3DX7B 4Y19A 3HCVB 1OO2A 4WZ9A 2J44A 2ZPKH 3ZHKA 1WIOA 3DBXA 3SDCB 3F7PC 3ATFA 4IOFC 3CLEL 4DQOH 4EXPX 3CPLA 1AC0A 2OCCB 2BS9A 3VI3B 3WO4C 4YXKH 3MRDA 2IPKB 3KLSA 1HHHB 1E28B 5F9OH 3US1A 4QRUB 1MZYA 4G1EB 4KKNA 4IMKA 1JWSB 3IDMA 3PWJB 4J3TA 4RGOL 5A2FA 2K7PA 1H0DB 4Z78B 1H9DA 4XVSH 3LKQB 4ZOEA 3WEXA 5LVEA 2ADFH 3FU9A 3TS8A 3QZWG 2Y7OA 3GXIA 2A99A 3MNVB 2JKIS 1Z66A 1A64A 1AGFA 2EKJA 3CAFA 1N59B 2PPEA 5EF2A 3F2LA 3HNSH 2C3XA 1LILA 2FVNA 4H20L 4O2FA 3WG7B 4MMZA 4TMPA 3EBHA 2DQIL 1YNKH 3EGSA 3MOAH 4P3CH 3X3GH 2AP2A 4JFHE 1A4CA 5E6IA 1NOAA 5DI8A 1NFDB 2PPCA 3DTXA 2BS8A 3TO4A 3UZEC 2OW7A 4IOSA 4MCYA 4BA8A 3WTVA 2GUOB 4JBSA 3SCMC 2XFGB 1A6AA 4YO0A 2XI9A 3BP5A 3RIAK 2BM3A 4P2OD 4I3SH 4LCWD 4OCNC 1ILUA 3H9SE 4LU5H 1HFUA 3VA2C 5E8EB 1QFWL 1AO7D 4PJ8B 4UBDD 5DYOA 4E36A 5C07B 1A14H 5IM7B 5EORH 3VI4B 4KJWC 1UG9A 4XOAA 2J8UE 5SWQB 4I2XE 3TVMC 4BFJA 4AGMA 3G04A 3EF4A 3EH1A 4JAMB 1RZ8A 1B9KA 4TQ8A 1DCEA 1Y1DA 1UWXK 4TNVF 4YDKL 1FDLL 3ZKXB 4D9QE 2GITB 1A8ZA 2QSQA 3ZUNC 3H2WA 4YBLB 3TWYA 5AW6B 4HXBL 1UGKA 3MUZ1 5MERB 1HWHB 1OV8A 3I6GB 2VXQA 4HCRL 2Y7QB 2PTTA 2VITA 3ZY7A 3EJTA 5HGAB 2WMPA 4K9EH 5DYGA 3DHMA 3KXFA 2WV3A 2F54B 1Z9PA 4X8JA 5DVPA 4LO9A 5I1KL 4OU3A 5EG6C 3W0WE 1MLCA 1HXKA 5AKTA 2CBPA 5I26A 1BZ9A 4I1RA 1ZTXH 5D1XE 3BW9A 3SQOH 4CA4A 5KVDL 3GDCA 5C8JB 1OSZB 2FJFB 3O8XC 3M7OA 3C8DA 4WFEE 1DBAL 4LLYB 4HBCL 5EUOE 5IFHL 2BIHA 4K8RH 1NJ9B 1A4KB 5JZ7D 2E86A 4ES9A 4XH2A 5D1ZB 3GSOB 4UQ3B 2XKSA 3BVWA 3GXNA 2YEVB 4IGBC 4L1DA 3EJRA 1MZZA 4LMQI 4N25A 3U46A 2FEEI 1J9CT 2UWEA 2WXIA 4XPAH 4W9KC 2EYRB 4LEBA 4JPKL 3OJMB 3BI9X 4O2EA 4ZS7H 1WCQA 3P11H 2EO1A 4H0GA 5INCA 4Y2NA 2H2PC 2EIEA 4UILH 2H26B 2Z9TA 5GGTH 3FH7A 4NFCA 4CN1A 1RP8A 1PNDA 2DH2A 4U0RC 3V8OA 3VXSD 5LG6A 2EILB 3AY4C 4MJ4A 3U36B 5I6KA 4R2GC 1ETJA 4LPXA 4NQTA 2K78A 3BP7A 2WXOA 1OPOA 2XUWA 4PRHE 4XC3H 4ZPTA 1E7VA 4OIBA 2YXMA 2ADIA 3MUHL 1XCWA 4YBQC 3RBGA 3P2DA 2YSSB 5EV7A 1FZKA 3DMMA 1JZ8A 1O7SA 2J73A 2K6YA 4ODUB 1EBPA 2BCKA 3C60B 2JIRA 1J8HE 4M3JA 4NM4H 4QCIB 4Y8AA 1MRCL 1J11A 2DWXA 2ERJC 3NPZB 4MYPA 2RBLA 4HJEA 1FNLA 4RWYH 3U4AA 3BDXA 2BVQB 4MS8C 2ZUYA 1WBYA 3ZZQA 2K3HA 5GZNC 2CKBL 4LCYA 3G6JE 5BPPA 3T5WA 4X6DE 4XWGL 3IFLH 3TT3H 3T0BA 1KIQA 1HSBB 3B2UC 1CK0H 1YNTB 2WXFA 3EYUH 3T4YB 3EOAB 4O5LH 3BKCL 1MJUL 1YN7B 1W8EA 4K71B 4XCNB 4LMQE 2P5WA 5GS1C 3CVIL 4PJ5E 1GGIL 2BWIA 4UTBH 2X4QA 4PS7A 2VABA 5DZVA 4CVXA 1L9OA 2Y07L 4N8UA 1PKQB 1VADA 3QIWB 1SJEA 3GBMH 3QNXB 4NBZB 5C08A 3HMXA 2Z93A 5J3HC 4V33A 5IB2B 1XR8B 2XRAH 2F68X 3MREB 4JNXA 1MCPL 1T22A 2W60B 1CLVA 5C18A 1DJZA 4H0IA 4RIRB 3H42H 3GKWH 3UYPB 4KZCA 3PDOB 3TV3H 4YSAA 2AQ2A 4RGNB 3C08H 4AQEB 3GSUA 4Z7QF 3GSRB 4OLWL 3TT1L 3AGWA 4DP7X 3U7AA 4BJLA 3DOHA 1WRFA 1RVFL 5T1LA 2R8SH 1CI5A 3D30A 1GGCL 1QVOB 4FAAB 3HUJF 5HHNA 4IU2B 1CWVA 4YAQA 5EZJB 3WELA 4D2NA 5DC0A 4IDJL 2LLLA 4A2MA 1ETB1 1NCCH 1ORQA 3VXNB 2CGRH 3ULVD 2A9ML 3CDGA 4HH9A 5JQ6H 4LVNB 3FFDB 4BUGA 5E8NA 2J8OA 4PS4L 3WS3A 1FSKB 1VDGA 3LV3B 1X9LA 3CMGA 5ADOL 5CUSL 3T6QC 5H2BA 5D1QB 2WP3O 2HXAA 2ZT9C 2J43A 1UZGA 3ZO0A 1BP3B 3BFQG 4FG2A 3ENEA 3WI9A 2GG1A 4Y9BA 3Q6GL 4NP4H 2F6AA 1CC3A 1UM6L 4Y7OC 2VZ3A 2VRQA 1SEQL 3AM8C 3I6KA 4MD5A 1GVIA 3OF6A 4NGHL 1UJTA 2IDCA 2V5YA 1P9MA 2G9KA 4NUGL 1M71A 3S88L 2Y0SA 1YO4A 4AMWA 5T1KA 5HYJE 4AYFB 3O0LA 4PRAB 4EN2A 1OF0A 2OSXA 4I48A 4E9RA 3RPBA 2VL5B 5B8CC 5JHMA 3AS2A 3GJFA 5HHOD 2DIAA 4I9WE 3S3BB 1ETZB 4OQ1A 1GGBL 3HZVA 2B77A 4WWNA 1FCCA 3OKDA 1SY6H 3IWVA 3FT4A 4NRXB 2G5UA 2C1PB 4Z9KB 1QA9A 2VJ8A 3EYSL 4JREB 3PQYD 2HFEB 2Q2EB 3THMH 4LT7A 3ET9F 2W94A 5KJ4A 3NVQA 1Q1PA 1XH1A 4NAQA 3KNBA 4P4RA 1DVXA 2BIMA 1JVOA 2P45B 2DI9A 1GGYA 3C09C 4NOFA 2DQJH 1PJWA 1U8PB 4HWEH 5BOJA 4LOVA 2E9IA 4GO9A 1DZ0A 4PAZA 2FX9H 2Z91B 3GC3A 1GZPB 2HRPL 1CU4H 3HE7B 4QTIH 4URTB 3C2AL 2EEFA 1UZ8A 3K8LA 2YXWA 5ESVA 3ZKMD 2PYFB 5EUKB 5LBSL 4WU7B 4XPBL 3C6LD 2XZCH 4UT6A 1U0QA 1OARL 4GEIA 4UMGA 4O58H 1ZJAA 5BV7H 1NDGA 3ETTA 1V5JA 3MAWA 4KQ4H 3WCYA 1MIEH 4LNVA 4GS7B 4JFFD 5L4IA 3V0AC 1MCJA 5JIHA 1LVEA 1E5AA 5EO0A 4ACPA 2WAQA 1B9ZA 3WFEH 4FQJL 4AE1A 1G0YR 3PHQB 5IBUG 3OAZH 4BSVA 2AEQL 2WO2B 1S7RB 4NOHA 4YXHL 3ARDB 2OSLA 5ICXB 4DAGH 1IM9A 1TZAA 2OP4L 2YGQA 3VXUE 4AUJA 4OGAD 1WYJA 4CMHB 4LSPH 4WO0A 2I24N 4KXAA 1CDBA 3QWOA 4H8VA 4YDLC 1OA7A 1P7BA 1Q0XH 5F72S 4HIXL 4RDBA 3ZYIA 2D0FA 4DFHA 3AWFA 4JDTH 1UENA 2ITCA 3DV4B 4C55A 4ABVA 5DK3A 1OCCB 4QHUB 5GLXA 3B9VA 4PW9A 4X7DC 1LD9A 1SBSL 2GHWB 3KDMB 2KKQA 2V3DA 5I0WA 5KN5B 3LDBC 3Q1SL 4FLRA 3KVPA 3OMNB 3FCSA 1TSHA 3Q48A 4IBTA 4ONGH 3S35L 4ZI8A 2I7SA 1A7OH 4NZDA 4Y16B 4PRNB 1GIGH 2LVEA 4Y19E 5INDA 1MW3A 2AQQA 3GQFA 3LXUX 1K4CB 2DD8L 5GM9A 2CBOA 3EJJX 3TNNB 4C4KT 5F8QC 5HYEA 2GC4C 3MRPA 5FW8A 3UDWC 1A1NA 2QQNH 4PR5B 4HWZB 1LO0L 1EEYA 4HULB 4OZFH 3HB3B 4ADJA 2ZXCA 3DJRA 1T5XB 4DGYH 2XWBA 1P4BH 2A6HD 3ZHFA 5F88B 5C0FA 4FXGB 4LLDB 1BEYH 1MEXL 3UYOD 5J06A 2CLRB 2WWKT 1A7NL 4N26A 1KB3A 5EU5A 1OAJA 4AQ8C 1X5LA 4QOKA 1EVUA 4HX1A 4JY6A 1LO3L 3RJDA 1GW6A 5FA3A 5K39A 3CZEA 3GO1H 2L7UA 5E6ZA 4HS6B 2X4OB 3IXTA 3IR5A 1A7QH 3AS1A 2ZXGA 4JQXA 4NZJA 4RNRA 4TNEA 3NEOA 5ALBH 4PJ6A 5FTKA 3O9WD 2AV1B 4IRSB 3WGUB 1N19A 4TSAH 4M1GL 4UTAH 4P23C 3D3VA 4PV8B 4YL4A 5LQBL 4LP4A 4U6VL 4WK4B 5DRWA 3EBAA 2LGNA 1N68A 3SGKC 1BIIB 1LE5B 5IMMA 3W81A 3Q2VA 4TUUA 3AG4B 2QPFA 4GAGL 5F7WC 5I9QB 1YEEL 3FH5A 3VFWB 4ZAKA 4XMTA 3ZHNA 3TA3D 4AW4A 2V7NB 1G7QB 4ANXA 2ILLA 4OGXH 5DRXB 3BQUA 3GBEA 1N9PA 1UH4A 3ULSB 2Z7WA 1FFOB 1F3RB 1X6LA