4JKAA

Open and closed forms of r1865a human prp8 rnase h-like domain with bound co ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
b'LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkaA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkaA01
4JKBA 3ENBA 3SBTA 4JKEA 4JKHA 4JKGA 4ILHA 4JKAA 4JK9A 3E9LA 4JKDA 4JK7A 4JK8A 4ILJA 4JKGB 3E9PA 3E66A 4ILGB 4JKCA 4JKFA 3E9OA 3SBGA
chains in the Genus database with same CATH superfamily
3VA0A 1Q18A 1S1WA 1LCUA 4LH4A 1NU0A 1SV5A 3TARA 4F2RA 1B92A 4FJNA 5M1PA 1TKTA 2ZM6K 2KW4A 2Q0RA 3MXJA 3QFUA 3DAWA 5AQHA 4BC2A 1NGIA 2F9TA 4CF9A 5KGXA 1T3VA 1NGFA 1HBKA 4JI2K 4BACA 4FZZA 2Y1JA 4AH9A 1TAUA 2AA4A 4F2SA 1W97L 3E66A 1EQYA 3LDOA 3VA3A 1RBTA 2YHAA 4DLGA 5JS2A 4IOCL 4CZHA 3WQUA 4CZIA 2PFUA 4CJVA 4AF1A 1T44A 1WSGA 3VF4A 5KPZA 2WTUA 4DSJA 1QVFM 3LDPA 3OYEA 3OYFA 4M3RA 3O4NA 1YVNA 4CHYA 3DJCA 1XC9A 4C8OA 1NJZA 3LPUA 2QWNA 5JMVA 3IAYA 2E2QA 3MXIA 2KFZA 4IFEA 4H5NA 4C8LA 5FPNA 4CIFA 1DEJA 1TVRA 2ASOA 3L8BA 4N41A 4DS5A 5C10A 3OYNA 4H5WA 2BUPA 5C25A 3AVGA 2KQ2A 2P9SB 5FPMA 2NRHA 2IDOA 4K43A 5C12A 2R82A 1ZXOA 3OBYA 4O55A 3NGIA 3CCEN 5AQNA 3HTVA 4IO9L 1JXEA 3DYAA 4M7XA 3IKMA 2F9WA 4ZTJA 4H5VA 4WCEL 3DLGA 5FPDA 1K8KB 3PV8A 3MEEA 1GOCA 5CZ1A 5JICA 2IIRA 2YVCA 3T1AA 1CLQA 3RMDA 3AVFA 3O9RA 3KIOA 2P1JA 1VQLN 4BE0A 2CGJA 3HI0A 5CR4A 3IG1A 2QKBA 4B3OA 2QW9A 3E9PA 4B1YB 3D45A 4K42A 2QXLA 2OA8A 1XI1A 3IMXA 4Z4HA 3G9WA 4BVOA 4C1NK 3RRGA 2WOMA 1U4BA 4DR2K 4JS5A 5AQGA 2Q36A 3KZBA 1T05A 1ATNA 1JXBA 1HB8A 4C8NA 1QQOA 5KRSA 3CYMA 4A5BA 3I33A 4BG9A 4M63C 2J4RA 3ZSWA 3MN7A 1SGHA 4ELTA 2P9LA 1G99A 3VQ9A 3P1GA 2D5RA 4FWLA 5HP1A 3ZETB 2RN2A 3KK2A 4L8RB 5DM7L 1UA0A 2FBVA 3VQQA 3PX4A 5AQUA 4JKHA 1U6ZA 4I6MA 3VQ7A 4KI6A 2XO7A 3DOLA 2E1ZA 3LWLA 3IFRA 3C7NA 3MWPA 3O9QA 3HPHA 4QS7A 1BI4B 3LPTA 1BHLA 1P90A 3WNGA 3BZCA 4CIEA 3EE9A 1SZ2A 1S1VA 3JAMO 3CJ7A 4H03B 4KB0A 1NJIO 1YVUA 1KC8O 4PHTX 2FF6A 2D0CA 1XHZA 1U49A 4QOZB 5BN8A 4EZ9A 5FRMA 4CJ7A 4AHUA 3SNNA 3M8QA 2NRVA 3OBWA 4X62K 1BISA 3VF2A 3CHWA 3MX2A 3J7ZO 3QIPA 4B9MA 1NOYA 3BP8A 3PSIA 1LAWA 3UKRA 2X0SA 1E4FT 3ZT1A 3QEIA 1DTTA 4V19S 3D2FB 3KWGA 4CFDA 3K58A 1VQMN 4DV3K 1D8YA 4FZYA 3J7AP 2Q2RA 5BPNA 1VSLA 4DUZK 4JHDB 1KAZA 4BE2A 3PY8A 1D5AA 3L6QA 3OJSA 3ZSVA 3GL1A 1Y97A 1T6DA 5BPMA 2VG6A 3C6AA 4H5TA 1NK4A 4ELUA 2P5OA 3FFIA 4GY2B 2E6MA 3O6WA 4CEZA 4B8CA 1EKEA 3HOTA 4DSKA 4BWMA 3VQ5A 5AQRA 3H08A 4FWOA 4MQ3A 1XUPO 4JD2B 1C0FA 3QIOA 4F3TA 4YOVA 4DHYA 5GIOA 1QTMA 3DRRA 1WSFA 5I42A 2I7PA 5JS1A 2RKIA 4GNIA 4CGFA 4CZFA 1C1CA 2IOCA 3BZKA 3TSQA 5BREA 5AQXA 2NNWA 4HDOA 4PKHA 1XMQK 4M3WA 3C0BA 4OO1J 4Z4IA 1RDWX 4FWPA 1NBWA 3B6PA 5E84A 3VQAA 2HMIA 2X78A 1HR0K 1KXPA 1X3MA 3RR7A 1TK8A 1WAFA 3NGYA 1NVLA 3D2EA 3EN9A 4MFBA 4KB1A 3KLFA 2GBZA 3WNFA 5JVHL 4FJHA 1DTQA 4LH5A 3ASMA 4AQYK 1VSMA 3MN5A 1GLFO 3UKUA 3O3HA 4LFAK 1SKSA 3RWUA 4H0YB 3RMBA 3RR8A 4H8KA 4B3SK 1VRUA 4ZRIA 3C95A 1IO2A 2VG5A 3FE1A 2OPRA 5FRNA 1XNQK 4ICLA 2UU9K 2PY5A 4KBOA 2BANA 1SL1A 1K73O 1QQCA 4FK0A 1YJ9N 4B1XB 3MN6A 4ZRJA 4Y0WA 4DU3A 3FZMA 4ISFA 3ZLJA 4WE1A 4CK1A 4PA1A 4BC5A 1SL0A 4YOXA 4I2PA 3ZSRA 4CBXA 2D2QA 2LBBA 1VSEA 1NLVA 1KLMA 4RW9A 3K0SA 4FLUA 5C2FA 1P8ZA 5AQSA 3CCSN 2WFBA 4DR6K 2I5JA 1S3XA 1RBUA 4CI6A 1A5VA 4BRGA 4IWVA 4JS4A 4KH4A 3ALYA 4Q5VA 3K5OA 3DRPA 3AVAA 3CCVN 1KQSM 1XQSC 5C2DA 3LZIA 4H0XB 4JRQA 2O8BA 3ZSZA 2FSJA 3ENOA 1VSFA 1M1KO 3ENHA 4CZGA 3CC4N 4FZXC 2X6NA 5JVGL 4QAGA 4JKGB 3ATUA 2UXDK 3IDHA 4FWRA 4W5QA 4FJJA 2ASMA 3VEWA 3K59A 4CZMA 1S9EA 1XNRK 4B9UA 3QEVA 2O8FB 3CCQN 3LANA 1O13A 2UYTA 3B6OA 1JLQA 3AU5A 1ASWA 3KD5E 3ZT2A 3BF3A 4CHOA 2ZGYA 4KHUA 2GWKA 3HT3A 2RE2A 4DWIA 1C1BA 1B9FA 1N8RO 1MU2A 3TU5A 4CFAA 4B9NA 1Y19B 2XY5A 3CM6A 3L2QA 2RHKA 2A5XA 4OKEA 5IWAK 1FJGK 3F2KA 2UUCK 1ILYA 2UUAK 4GVMA 3PSFA 3G6EN 3DWLA 3FZHA 1YI2N 1KBLA 3IRXA 2JGUA 2P9UB 1VAZA 1EF1A 3CFPA 4IFVA 1HYVA 3O4QA 5C0YA 5AJ3K 2GTDA 4DV5K 1UAXA 2IVNA 4KHQA 4DSFA 5KI6A 4CJRA 4CHQA 4ISGA 3AGRA 4EZ6A 2P9KB 4IDKA 3VGLA 1HRHA 5AZJB 3K9JA 1WB9A 3O08A 2P9NA 4I9LA 3J7YP 4KV8A 1KFSA 3LAKA 2Z1GA 3CFRA 2FLOA 4B9LA 3V4IA 1OVYA 4K0KK 1CXUA 4NXNK 2PBDA 4UQGA 1QSLA 3CJAA 1VQ9N 2KZZA 3SQ0A 3M5RA 1V4SA 2KHOA 2WBNA 3EE8A 3CMEN 4FLVA 1VQ8N 3O8MA 4YDUA 4EP5A 4DV2K 1YTUA 1QSSA 2HHXA 4BRIA 2A40A 1FW6A 4DKWA 1YUWA 1WOQA 1VBGA 4BR7A 4OPHA 3OHRA 2FSKA 1RTDA 4Z4GA 1RDBA 4BROA 3WEEA 1HX1A 3QLHA 2D0OA 1SL2A 3WNEA 3SCXA 4DB3A 1YAGA 3KLIA 4DTSA 3EKSA 3BY5A 2W6LA 5F1XA 1DLOA 3VOVA 1C0UA 2E2OA 5M1OA 1NGDA 1ASUA 4E19A 3SUOA 4KHYA 3R3LA 4BRMA 2O8CA 2GX9A 4FK2A 1B9DA 4OGEA 4X64K 4A57A 5E26A 2HNDA 4CJUA 1HNWK 1S5JA 3VEOA 4I9QA 3VQBA 4Z4EA 2CH5A 3PZDA 4N56A 3V9XA 1VSIA 2H3GX 5HRRA 3WNHA 4ZHRA 2Q1NA 5GINA 3CG7A 3DM2A 4CZKA 3C6UA 2O8DA 4QS9A 3BDPA 1C0GA 3U9DA 1U45A 1A5XA 3ZSQA 5HBMA 5FROA 3TI0A 5CYMA 3OVNA 5CE3A 2P9IB 3RMAA 3O80A 1RT7A 3V1OA 4B1ZA 5I3UA 2P51A 1XC3A 4ILJA 4BDPA 2G8FA 4DQ8A 1HB6A 2ZQBA 5AQQA 5AZIB 4DSLA 4FLYA 3DLRA 4CJSA 3LAMA 2HVIA 4NCAA 1OH5A 1JLEA 4B8AB 4L3QA 2G8KA 3OYBA 1BG3A 2KKZA 3NFAA 3HPGA 1UWBA 3NHGA 1RDDA 2OPSA 1SKRA 1J54A 1HUXA 3ZX3A 2B6AA 4FPBA 3VPZA 4IOAL 3NDKA 3LP1A 4MO5A 1WSEA 2E8AA 4HUGA 3KLHA 5HRNA 1LV5A 3SAHA 4JI8K 1ZBIA 1MWMA 3NVKA 1MIZB 4K41A 4GMJB 3DXMA 2VYPA 5SZTA 4B1VA 5DM6L 4F8RA 2GUIA 3WXJA 1HQEA 3DXKB 3P39A 2JWKA 2D0BA 3SUQA 4M45A 2F8SA 3TSPA 3CQYA 4CHNA 4DR4K 4PKGA 3LP0A 2YJFA 4CK2A 5AFUA 1NKCA 4CJLA 4DS4A 4CZEA 1X9MA 3LZJA 4Z94A 2VWBA 3AVNA 2ZGZA 3PO4A 3M8SA 1ATRA 3I0RA 5E41A 1ISNA 3ZSOA 2P9PA 1VBHA 3QIJA 3SMSA 1GOAA 4HTLA 4LF6K 1Z6RA 4FK4A 3PO5A 3L2RA 1S72N 2I7NA 3ULDA 2E4LA 3N4QA 4CGHA 3LM9A 2DFHA 5J2QA 5TKWA 4DTUA 4A61A 1NK0A 2W42A 2OYQA 4BG8A 2HRJA 5D3GA 3THWA 2YHXA 4CEAA 3ZEUB 2D1KA 4EAHD 4PUOA 4F4KA 3TTDA 4MDAA 1EWQA 4AHVA 3OYCA 2FJ9A 1RT5A 2IAJA 2IGIA 1MK7B 3KLEA 2ITMA 3EZWA 5C15A 1U04A 1GGOA 4CF8A 3QINA 3RVCA 4CF0A 1TAQA 2XY8A 1IH7A 3OYHA 4QCLA 1Q8IA 1VQ5N 3AA3A 4BWJA 1KSPA 3U3YA 1EP4A 1VQPN 3RSEA 1U2VA 2OPPA 3AO4A 4NXMK 1S22A 4CF2A 3AGKA 3LP3A 1S1XA 5AQOA 1ZYQA 1JLFA 3CPWM 4MLEA 4J2EA 3R9PA 3ZYYX 4A2AA 3HM9A 4PQUA 1QVGM 5AQTA 2COPA 5AQJA 4AM6A 2EMSA 4IO8A 4DSEA 1BCMA 2QKKA 4BRFA 4CJWA 1RTJA 5AQWA 1S1UA 4K8XA 4DFPA 3H3NO 5M1FA 3VESA 2PYLA 4HUEA 4B3MK 4LFCK 5IT9O 3NF6A 4DV6K 4KKOA 3LDQA 5HLFA 2D11A 4P7IA 3LDLA 3O3GA 1N33K 2G8IA 4BGBA 2NRRA 4BGAA 1O1WA 4DU4A 1GLLO 1KAYA 1KVBA 3LP2A 3QEXA 3CCMN 1K6YA 3DOKA 3CIPA 4X66K 1KFDA 1BA0A 4C1NI 3PX6A 3FGUA 3THXA 2OZMA 1JL2A 1NK6A 3BGRA 3H46O 3AO1A 4CFCA 4H5RA 4DU1A 4FM1A 4ILGB 1NMNA 4BR9A 3VQDA 3H45C 3CMAN 3M3ZA 4CEDA 4W5NA 1NGHA 3NBPA 2VG7A 1EWRA 3VERA 3I55N 5BN9A 3AA4A 4DFMA 1IBMK 1CZBA 4YDUC 3KTQA 3O9UA 1TUYA 3WXLA 2YHWA 3KK1A 5DK5A 1M90O 4E0DA 2YNIA 3J8AA 1N32K 1W2BM 1K8AO 4B1WB 4Z4FA 2FDQA 1IKWA 1RFQA 3G25A 3ID6A 3ITHA 1IV0A 3VTIA 4DQRA 4NYNA 4M3XA 2KZMA 4DV4K 3GE1A 3C6HA 4YOTA 3OY9A 3OYAA 4LSNA 2I1KA 2HHHK 4RCHA 4A62A 4HHTA 4FJGA 1L3UA 3QNNA 2QEXN 3KD1E 3ATVA 1H1VA 3TAEA 2HMPA 3T7ZA 2CB8A 3SMPA 2F8TA 3OJUA 3OYLA 1WUAA 2QWQA 3NGZA 3VQ4A 1GLDG 3G71N 3K5LA 1LW2A 3HVTA 1XMOK 3C6TA 2PYJA 1OH6A 4H4MA 4LF8K 4CGIA 3U3GA 5AQKA 4KRFA 5LMNK 3AVBA 4FVMA 4H4OA 1VQNN 4GW6A 2O4IA 4Y1DA 1T7PA 4GKJK 3V81A 2A3ZA 4FWMA 1U47A 1LWCA 2P9SA 3MCPA 3TAQA 5CZ2A 4BRCA 4EFHA 4J2BA 1YXQA 4KREA 1BO5O 4HDQA 1Q86O 1BCOA 4ID1A 5HRPA 2HHVA 4HCBA 4M7YA 5J2NA 4RW8A 1MIXA 5CY4A 1NG9A 3KK7A 3VEZA 5M1KA 3BF1A 1J6ZA 1K8KA 3ULEB 3K57A 1C6VA 3SI6A 1KAXA 4EKUA 3WXMB 3SYZA 1SQKA 2FXUA 3W3DA 1KD1O 1IG8A 1HQUA 1HNVA 3O3FA 3HOSA 3MAQA 3MEGA 5A2QO 4LF9K 2DTUA 1QE1A 5LMUK 5AQIA 1FXXA 3LDSA 1TYQB 3CD6N 4DTJA 4LF7K 4FWSA 5C42A 4F3OA 1ASVA 1VK0A 3OYGA 3E01A 2IVPA 4M42A 1HKGA 4DV0K 1YT3A 5LJVA 4KH6A 1TK0A 1WSIA 4BR4A 4A5AA 1Z26A 3T19A 1A5WA 2QWPA 3HJFA 1RILA 2KLAA 5EX5A 4DQPA 1WBBA 3SZ2A 4QS8A 3MN9A 3ZETA 3TSUA 4BR5A 3QERA 4BDYA 1CXQA 2VQFK 4XH5A 1NJXA 3SAGA 4BRLA 1RDUA 2HHQA 1VRTA 2QK9A 1NKEA 2V52B 4CERA 3LL3A 4JN4A 1REVA 4M3YA 3V9ZA 4FSVA 1BL3A 3VQEA 3OS2A 3I56N 5KQ8A 2HF4A 1NGEA 4OVLA 2A42A 3VETA 3CJ9A 4B9SA 1TL3A 1YJWN 3QDKA 1NGAA 1KVAA 2EX3A 3V9SA 4NCBA 4ZRKA 2XRIA 1ESVA 4CBWA 4BE1A 3D2FA 4BC4A 2DY4A 3J81O 2YX6A 4JHDA 5ADXA 3VENA 1RNHA 1Q81O 3TANA 2YKNA 4WF9L 4FJMA 3VQ6A 2ETJA 3P38A 4WYBA 1DGKN 1GC7A 3H1QA 3AVCA 3R6MA 5IJMA 1X3NA 4IJNA 5AFUH 4N5SA 1L3VA 4J2DA 3HYFA 4LF4K 3H3OB 2FBXA 4OX9K 3EY1A 2G8UA 1U48A 4JKDA 1VQ7N 1VSKA 4HUFA 3ZSYA 3CCUN 4FJ7A 4LF5K 3CQ8A 3MWTA 2WUSA 4IBNA 3THYB 4JD2A 4CEOA 1JDEA 4HVJA 5GAGP 3O4WA 3NCIA 4KAZA 3AVIA 3OYKA 1ATSA 4K8ZA 3AVLA 3AA5X 1FKPA 2NLXA 1F21A 3CQXA 3TTFA 4KO0A 4CZJA 4FM2A 4JV5K 3F9MA 3KJVA 2BH1A 2E1YA 5JLFA 1IKYA 1TKDA 4GV3A 3SAFA 2D0PA 1LW0A 1VSJA 2YNHA 3OS0A 3SQ1A 1TV6A 3PVLA 1Z25A 2NRXA 1W0HA 2BE2A 3VMFB 4JNEA 2ZD1A 1RT1A 2CGLA 3E1YA 1ZBHA 4FXDA 3K2PA 3HL8A 1RBSA 3S3MA 5HRSA 2VWKA 2ZE2A 5BRDA 3S9HA 4BQLA 1NKBA 5BPLA 3BINA 4ILHA 4JKAA 1GLEG 2LSNA 3OYDA 3VEXA 1QHAA 1BWFO 3D0PA 3MECA 4TKNA 1JLAA 4E3SA 4KTZA 3RMCA 2HOEA 5GAHP 3O9SA 1J5EK 3JXUA 4N76A 2NZTA 4E1NA 1ZBLA 4XH1A 5MLCQ 1W7AA 1CZ9A 3SBTA 5KQDA 4YOYA 4CYEA 4OLBA 1QZ5A 1TL1A 4IKFA 2F7TA 3LALA 2DFEA 3W0LA 3GDQA 4KTWA 4RW4A 4FCYA 2EWSA 3C94A 4NO7A 2FBYA 4KHPK 3AY9A 3L4IA 4PL7A 5TKYA 2OTLN 3N4PA 1T6CA 4BRAA 5BRHA 2HBLA 1OH7A 1C0TA 3AO2A 3OW2M 4FJ8A 2PAVA 2XHBA 2QWLA 4RW7A 4FVUA 3ISNC 4EIAA 4JKEA 4YFUA 1JCFA 3FR0A 4DF8A 5FLXO 4OGCA 1DT9A 1IKXA 2KFNA 4E1MA 4YOWA 3CCRN 1JCGA 2Q97A 1JJ2M 3I8BA 3M8RA 4ISEA 1S1TA 3NH1A 2VGNA 4DFKA 2A41A 4N47A 4JI7K 3ENBA 1I39A 3KK3A 3HRGA 4BRHA 2EHGA 2QI2A 1L3SA 4DQQA 4WQ4A 4EHTA 4JKGA 3OYIA 3QETA 4CEQA 3V9WA 3LWMA 1JL1A 2O8FA 5LY3A 4ELVA 4NY0A 4JI1K 4AILC 1BQNA 4NCGA 4E7LA 2HBKA 4AM7A 4CE9A 3WQTA 4JKFA 1TGOA 3P31A 1EO1A 3ID8A 3K5MA 3VEYA 2PZSA 1QHTA 4U7BA 3CFOA 4MLHA 1JLBA 2HSTA 5EVZA 3HSTB 3P83D 2GELA 3VQPA 1BU6O 3KVGA 4HWIA 4DTOA 4O4GA 2VCPA 4JI5K 1HNIA 2Z1HA 1WN7A 4NYFA 2G8VA 2DPNA 3EEQA 2HHWA 4YHHK 4X65K 3SBGA 3DRSA 3H6EA 4B08A 3OYMA 2YCHA 3K5NA 2B5JA 3V1RA 4FL9A 2P9UA 4DCHA 5J2PA 3VF6A 1KLNA 3QMLA 1NGGA 5M1NA 2V7ZA 3I0SA 1TKXA 2EMTA 2V7YA 3I8DA 1N34K 3SV4A 4B3RK 1IG9A 1HJOA 3P5JA 3QESA 3KLGA 4FYDA 3WT0A 2YI1A 2FSNA 3WA0A 2P9KA 4DR3K 2A1SA 5AZJA 2A6AA 1S6QA 3HZ6A 1RBRA 1VQON 4CK3A 3SK3A 4CD3A 3AU4A 2NRZA 4W5OA 3M1FA 2P9LB 3AAPA 5HL7L 4BRNA 4BREA 2HB5A 3PUFA 5AQYA 4C8KA 5KRTA 4GKKK 3TAGA 3MX5A 3RRHA 3LM2A 3U8ZA 1X9JA 3FZFA 4E89A 5HROA 2ZJQL 3M6GA 1L5UA 3R1XA 1ZBUA 4FJLA 5FDLA 1MK9B 3TAPA 1UA1A 5BRFA 4I6MB 2RF2A 5HOOA 4ZTFA 3VQCA 3OS1A 3C7NB 3IUCA 4E1JA 1KC7A 3EO3A 1JLCA 4DV1K 3NF7A 5SWMA 1X9WA 2HNZA 4IXCA 3HP9A 4DTPA 4E7IA 4JEPA 3HXMA 2V51B 3ZX2A 4YNQA 2HNYA 2HBJA 3EPYA 1GLCG 3IVFA 3MMVA 5CHIA 3T69A 1EXQA 3RTVA 3TR8A 4CJEA 4AHRA 3QEPA 1Z05A 4BRPA 4CCHA 1VQ6N 3OA9A 1NGCA 4H0PA 4B9QA 2Z1JA 5LL6Z 3EYZA 1I94K 4CJQA 1YF5L 4RG8A 2GV9A 3UKRB 3CPEA 4KPYA 3AARA 4CHZA 1G15A 4O8KA 4KH5A 4FW1A 2A1RA 3DLBA 2O8EA 2J0KA 2FBTA 3FZKA 1T8EA 2CGKA 5J2MA 5EXWA 4BDZA 1J5OA 4FJ9A 4FJKA 3GG4A 1OKJA 3L2VA 4H0VB 4JKBA 4FWKA 2G8WA 1RDCA 1NK8A 4DSIA 2IC3A 3L3UA 4CZLA 3F5TA 2P9IA 2E6LA 4CW7B 2OCEA 3SPYA 2Q3SA 2HF3A 1X9SA 1Q82O 1W9HA 2ITGA 3F9KA 4HCCA 5EU7A 5AZIA 1VQ4N 3CETA 4JK8A 4RW6A 1DIKA 4WQ5A 1RGIA 1S6PA 4DR1K 3V9UA 4F9OA 4FLXA 3QNOA 3T1YK 1E4GT 3G0ZA 3D6RA 2R7YA 3VGMA 4BR0A 2YJEA 3U4LA 4OPAA 4UY8O 1WNSA 1RTHA 3L2UA 4DTRA 4FWQA 2HHTA 1BDGA 1HPMA 4C8MA 3D2EB 3CJBA 3DMJA 3JSMA 3VQ8A 3PX0A 3O1WA 3U9ZA 5JLHA 1EETA 2P5GA 4FJ5A 4EP4A 3CI5A 3O9TA 3UKUB 2AEHA 2KTQA 2DFFA 1TKZA 3P4IA 3DXKA 4EHUA 2NUBA 3CF5L 3CJCA 4H0TB 4PKIA 2Q31A 3OTOK 1C0MA 1ZBFA 3UIQA 5ADXH 3S3NA 3TABA 5ELZA 1MWKA 1Q7YO 2UXBK 1VSHA 4B3TK 1QS4A 3ZSXA 2X6SA 4BRQA 1NK9A 4DTMA 4TSXA 3VTHA 1YTAA 3C65A 3IS9A 4G1QA 2W41A 3A0IX 5LJWA 4JI0K 1Q9YA 5AQVA 3NMUA 1NGJA 1RT2A 2CH6A 2VWJA 4PWDA 4OLAA 1BIUA 3AVHA 3QEWA 4PY5A 1ZBSA 3G10A 1JKHA 1NOZA 4JI6K 1RTIA 2ZPYA 3HSCA 2UUBK 4BC3A 4WFAL 4M3TA 3S3OA 3QBWA 1LAVA 5T7BA 1N36K 1VSDA 4FWNA 4DQIA 4CECA 3HPOA 3ZT0A 2FC0A 1NJWA 3SV3A 1JCEA 3BUZB 4CEBA 3FP5A 4CJ3A 3ZEUA 1WLJA 2QM1A 4KI4A 4BY9C 1GG3A 3WXIA 4Z4CA 2OTJN 4GVEA 5K14A 4OKKA 4F7GA 4JK9A 3KHYA 3CCLN 2O8BB 4IOXA 4WQ4C 1HLUA 4CGGA 3Q7CA 3OYJA 5B8HA 4JLHA 1V4TA 5F0XA 2E5LK 4JI3K 3DLKA 2E2NA 4LSLA 1Y64A 2AJQA 4Q0BA 4FLWA 3MEDA 4FOIA 4K25A 3EZ5A 4CVNE 1LWEA 4JRPA 3B8AX 4FLTA 3TWHA 2E2PA 3T1HK 1FK9A 2GEMA 3AO5A 3L0QA 2QTDA 3NF8A 1Q9XA 4KHSA 4O5FA 2QWOA 3QO9A 4DMNA 1ACAA 4CGJA 3CC7N 2HE7A 3MXMA 2OPQA 4MO4A 4DQSA 1C1AA 1HYSA 1JLGA 5EY4A 3D7EO 1BOTO 1KVCA 4DTNA 4FO0A 4R79A 1IKVA 4PL8A 3A5OC 4CJ5A 3O1BA 3AVKA 3NF9A 3AO3A 1HKCA 2Q0UA 3FFKB 3QFPA 1OVQA 4Z0UA 3L2WA 3A8YA 2ZJRL 4O44A 4M41A 1NK7A 4FW2A 1HPZA 2CQUA 4CJTA 4XH4A 1S9GA 2P9NB 1YITN 1QZ6A 4B9TA 1D9FA 4IDHA 4C23A 4A59A 3HO1A 4DFJA 1NWKA 4FOEA 4RWTA 3GBTA 4IG3A 5I9EB 2B4JA 3M8PA 4LC9B 5CYQA 4JI4K 3JYTA 4GV9A 2ATQA 3DLLL 1IJJA 4RTFD 4BRDA 4I7FA 5JVLA 2I1JA 1NI2A 3MK6A 4CJFA 5AQLA 2VQEK 1WSJA 4H0OA 2WONA 4XEIA 1E5WA 1J19A 2D4WA 1XHXA 5GAEP 1BI4A 3AVJA 1QQNA 4LD0A 3V6DA 4YOUA 3L3VA 3WEEB 5AQPA 3SJJA 1GLJO 4J8FA 3SQ2A 1RCHA 4M3UA 2ZF5O 2YNGA 4DXAB 3JS6A 2NRWA 4G9ZA 5H1SQ 4DV7K 1TK5A 2GWJA 2O8CB 1E3MA 4OJRA 3E9LA 1WBDA 3QBXA 3SUNA 2BDPA 2ZJPL 4YORA 3ZT3A 4CGDA 2RPIA 2HW3A 3LDNA 2W40A 3AVMA 5AQFA 3CC2N 4CJPA 3DLHA 3A5LC 4B1UB 4AHSA 3S41A 3NVMA 1VHXA 2RQ1A 4CIGA 4DR7K 2O8DB 2HVHA 1N5YA 3CM5A 3TAFA 4CHPA 4KFBA 3H1VX 1OH8A 2UXCK 2YHYA 3EKUA 3U7DA 1NJYA 2NRTA 4KHWA 3X23A 4CD1A 1WSHA 2E20A 3NAEA 1NM1A 3SUPA 4WQ5C 1J53A 2ABDA 3TPQA 4KTQA 1RT3A 1N6QA 1QSYA 1BUPA 5AQZA 4NLBA 2OANA 3EL2A 3SLCA 3J80O 4CJKA 3WXKA 3ULEA 3NE6A 1ZC6A 1X1PA 3SQ4A 5DMRA 4WFNL 3SPZA 2E88A 4YL8A 2O4GA 2J0MA 2QXFA 3KKRA 2GUPA 4XIUA 4DR5K 1ITGA 4CJ4A 3ZDTA 5KGWA 1NNEA 1HMVA 1HYZA 2YKMA 4IJAA 1MA9B 2G8HA 1KRPA 3DXMB 4DLEA 4BQZA 2FF3B 4NB4A 4IZ9A 2F4VK 4DF4A 5M1QA 3HVRA 4O0JA 1TYQA 4CEEA 1SS6A 2BGGA 3UB5A 4HTUA 4JKCA 3G4SN 4JYAK 5KTQA 3WUHA 1XWLA 4U67L 5AR0A 1QQMA 4LFBK 5AQMA 4R5PA 3PIPL 2J0JA 1RBVA 2YV0X 4JAXA 4OKJA 4W5RA 3FLVA 3L4QA 2P9PB 4W5TA 1UOCA 3CJ1A 1RT6A 2D0AA 4Y1CA 4BVPA 2Y1IA 4GXBA 3VGKA 3HK2A 1BGXT 4A2BA 4O5BA 1I3AA 3AAQA 2BTFA 4E7KA 1GLAG 4IFYA 4DG1A 1D9DA 3AV9A 1DKGD 3HP6A 5F2RA 3MCAB 1GC6A 3CERA 3PIOL 1HNZK 1RT4A 1YIJN 4YY3K 4OPKA 1NK5A 3PLAA 3THWB 3VEVA 1TUUA 4BR2A 1IBLK 2WH5A 3TAMA 2XY6A 2YNFA 5GIPA 3NH2A 3FLCO 5FPEA 5J1EA 1FKOA 2ZWHA 3DLEA 2QWRA 5C24A 1J9AA 4ID5A 1HKBA 1NGBA 3A5NC 3AA2A 1T03A 4J2AA 1RDAA 1ST7A 3KKSA 5EOYA 2O8EB 3DI6A 3MDQA 1BIZA 4E7HA 2QA4N 4DTXA 5BR9A 1CZAN 4KHNA 2QWMA 3HBTA 3VN5A 4I2QA 3U6FA 4CFBA 1L3TA 1LWFA 4IEIA 4CEFA 4B9VA 4FLZA 1HJRA 1MDUB 3UE5A 2XY7A 3KWIA 3RSEB 1U2VB 1NMDA 4AHTA 1VQKN 4NLCA 1R0AA 3SJHA 4M3ZA 1HNXK 5KPTA 4IG0A 1R59O 1SUQA 4CESA 4CBUA 5KPRA 4FJIA 1IBKK 3QB0A 4OPJA 3THYA 4JK7A 2F96A 2YHBA 2ASPA 1K9MO 1LOTB 4MDBA 5GADP 4E7JA 2D10A 1KTQA 2W6KA 3HM8A 1YHQN 2IS3A 3E9OA 3QICA 4FPAA 4WFBL 1WAJA 3CXCM 4FM0A 4LY7A 2JLEA 4GV6A 4CF1A 2HBMA 3F73A 3ZT4A 4O0IA 1D4XA 3Q7BA 3V1QA 1SKWA 2HHSA 3CCJN 1YJNN 2X74A 3A2FA 1GOBA 1NTIA 3ZCMA 5BR8K 2IVOA 2VGMA 3TTCA 2Z1IA 3T3FA 3A5MC 2WC9A 4O8UA 1KCFA 3ZX0A 3THXB 3U8XA 4DUYK 2AL6A 2AP1A 3O5BA 4AHCA 4FJXA 1BQMA 1BA1A 1SAZA 3K9KA 4IEEA 2DIKA 2OZSA 3R8EA 1GLBG 3FZLA 3THVA 1H4RA 2HHUA 3GOIA 1EX4A 2JWLA 3NH0A 4BRKA 3BEXA
chains in the Genus database with same CATH topology
3MN9A 3ZETA 3TSUA 4BR5A 3CMEN 1Q18A 1LCUA 1VQ8N 3O8MA 4YDUA 5M1PA 3VTHA 2Q0RA 3QFUA 4XH5A 3SAGA 3C65A 4BRLA 3DAWA 5AQHA 1RDUA 4BRIA 2A40A 2W41A 4BC2A 1NGIA 2F9TA 1YUWA 1WOQA 4DKWA 1VBGA 3A0IX 4BR7A 5LJWA 1T3VA 5AQVA 1NGFA 2V52B 3NMUA 1NGJA 3LL3A 1HBKA 3OHRA 2FSKA 4OPHA 2CH6A 4JN4A 4BROA 3WEEA 1HX1A 1ZBSA 2AA4A 2D0OA 4DB3A 1YAGA 1W97L 3EKSA 4FSVA 3E66A 1EQYA 2ZPYA 3LDOA 3HSCA 4BC3A 4WFAL 3I56N 5F1XA 3VOVA 5KQ8A 3QBWA 2HF4A 2E2OA 4FWNA 1NGEA 5M1OA 1NGDA 2A42A 3VETA 3CJ9A 1JCEA 4IOCL 3BUZB 4CZHA 3R3LA 3FP5A 3WQUA 4BRMA 2GX9A 2PFUA 3ZEUA 4AF1A 3QDKA 2QM1A 4CZIA 1YJWN 1T44A 4A57A 4BY9C 1GG3A 5E26A 3VF4A 3WXIA 5KPZA 1QVFM 2OTJN 4GVEA 1NGAA 3LDPA 3VEOA 4F7GA 4JK9A 3KHYA 3CCLN 4ZRKA 1ESVA 2CH5A 3PZDA 4CBWA 1YVNA 2H3GX 3D2FA 4IOXA 1HLUA 2Q1NA 3DJCA 4WQ4C 4BC4A 5GINA 3Q7CA 5B8HA 2QWNA 1V4TA 5F0XA 5JMVA 2YX6A 2E2NA 4JHDA 4CZKA 5ADXA 2E2QA 3VENA 1Y64A 4QS9A 1Q81O 4IFEA 4H5NA 5FPNA 1C0GA 4FOIA 3U9DA 4K25A 4WF9L 1DEJA 2ASOA 3P38A 4WYBA 1DGKN 1GC7A 5C10A 3H1QA 3R6MA 5IJMA 1X3NA 3B8AX 4H5WA 4IJNA 5AFUH 2BUPA 2P9SB 2E2PA 3H3OB 2P9IB 5FPMA 5CE3A 3O80A 2GEMA 4B1ZA 4JKDA 2NRHA 1VQ7N 1XC3A 4K43A 4ILJA 3L0QA 5C12A 2R82A 2QTDA 3CCUN 1ZXOA 3OBYA 4DQ8A 3CCEN 1HB6A 3HTVA 4O5FA 5AQNA 5AQQA 5AZIB 4IO9L 2QWOA 2WUSA 3MWTA 1ACAA 4JD2A 1JDEA 5GAGP 4M7XA 2HE7A 3IKMA 3CC7N 3O4WA 4MO4A 2F9WA 4H5VA 4WCEL 5FPDA 1ATSA 1K8KB 4L3QA 1BG3A 2KKZA 2NLXA 5EY4A 3CQXA 3TTFA 4CZJA 3D7EO 3F9MA 5JICA 2BH1A 1BOTO 2E1YA 5JLFA 2IIRA 4GV3A 3SAFA 1HUXA 3ZX3A 2YVCA 2D0PA 4FO0A 4FPBA 3VPZA 4IOAL 4R79A 3O9RA 1VQLN 4PL8A 2CGJA 3HI0A 3PVLA 4MO5A 3A5OC 2E8AA 2NRXA 3O1BA 5CR4A 3VMFB 2QW9A 3E9PA 4B1YB 4K42A 2QXLA 4JNEA 3SAHA 3IMXA 2CGLA 1HKCA 2Q0UA 3E1YA 3G9WA 3FFKB 3QFPA 1MWMA 3NVKA 3A8YA 4BVOA 4C1NK 2ZJRL 1MIZB 4K41A 3DXMA 2VYPA 4B1VA 5AQGA 5DM6L 2CQUA 2Q36A 4XH4A 5BRDA 3WXJA 3KZBA 2P9NB 4BQLA 5BPLA 1ATNA 1YITN 3BINA 4ILHA 4JKAA 1GLEG 3DXKB 3P39A 2JWKA 1HB8A 1QQOA 1QZ6A 3VEXA 4IDHA 4C23A 1QHAA 1BWFO 4A5BA 3I33A 3TSPA 4A59A 4BG9A 3CQYA 4M63C 4TKNA 2J4RA 1NWKA 4FOEA 4PKGA 3MN7A 1SGHA 4RWTA 2YJFA 2P9LA 3GBTA 2HOEA 5AFUA 5I9EB 5GAHP 1G99A 4CZEA 3O9SA 3JXUA 2NZTA 4LC9B 4GV9A 4Z94A 4XH1A 5MLCQ 2VWBA 4FWLA 2ZGZA 3ZETB 3DLLL 1IJJA 4RTFD 4BRDA 5JVLA 2I1JA 1NI2A 3SBTA 1ATRA 3MK6A 4CYEA 5AQLA 5KQDA 5DM7L 4YOYA 1ISNA 5AQUA 4JKHA 1U6ZA 2P9PA 4H0OA 4I6MA 4XEIA 1VBHA 1E5WA 1J19A 2D4WA 3QIJA 3SMSA 5GAEP 1QZ5A 4HTLA 2E1ZA 2F7TA 3IFRA 3C7NA 3MWPA 1QQNA 1Z6RA 3GDQA 3O9QA 4YOUA 3W0LA 4QS7A 2EWSA 4NO7A 1S72N 2I7NA 3AY9A 3L4IA 3WEEB 4PL7A 1P90A 5TKYA 3N4QA 5AQPA 1GLJO 1SZ2A 3EE9A 3N4PA 1T6CA 4J8FA 2OTLN 4BRAA 5BRHA 3CJ7A 3LM9A 2HBLA 4H03B 3OW2M 5TKWA 1NJIO 1KC8O 4PHTX 2PAVA 2FF6A 2ZF5O 4DXAB 2QWLA 4FVUA 5BN8A 4A61A 3JS6A 2NRWA 4CJ7A 4BG8A 4EIAA 4G9ZA 2HRJA 4JKEA 5H1SQ 2NRVA 1JCFA 2GWJA 2YHXA 3FR0A 3OBWA 3ZEUB 2D1KA 1DT9A 3VF2A 4EAHD 3E9LA 3CHWA 3MX2A 3J7ZO 4YOWA 3CCRN 3TTDA 3BP8A 3QBXA 4MDAA 2ZJPL 1JCGA 2X0SA 1E4FT 2Q97A 4YORA 3UKRA 1JJ2M 3I8BA 3LDNA 2FJ9A 4ISEA 2W40A 1MK7B 3D2FB 3KWGA 5AQFA 2ITMA 1VQMN 3EZWA 2VGNA 3CC2N 3A5LC 2Q2RA 4B1UB 5BPNA 2A41A 3S41A 5C15A 3NVMA 1GGOA 3ENBA 2RQ1A 1KAZA 4JHDB 3HRGA 4BRHA 2QI2A 3L6QA 3RVCA 4WQ4A 3GL1A 4JKGA 3H1VX 4EHTA 1T6DA 5BPMA 1VQ5N 2YHYA 3C6AA 3EKUA 4H5TA 3U7DA 5LY3A 2NRTA 4NY0A 4GY2B 1VQPN 3X23A 4CD1A 3RSEA 3O6WA 2HBKA 2E20A 1U2VA 4AM7A 3WQTA 1NM1A 4JKFA 3P31A 3HOTA 1S22A 3AGKA 4WQ5C 3ID8A 1EO1A 2ABDA 5AQRA 3VEYA 5AQOA 3CPWM 4MLEA 4FWOA 3TPQA 4U7BA 1XUPO 4JD2B 1C0FA 3R9PA 3ZYYX 4A2AA 4MLHA 4YOVA 4DHYA 1QVGM 5GIOA 1BUPA 5AQTA 2COPA 2HSTA 5AQJA 5AQZA 2I7PA 4AM6A 2EMSA 5EVZA 4IO8A 4NLBA 2OANA 4GNIA 2GELA 3EL2A 4BRFA 4CZFA 3SLCA 1BU6O 5AQWA 3TSQA 3WXKA 5BREA 3H3NO 3KVGA 4HWIA 2NNWA 4HDOA 5AQXA 3ULEA 3VESA 4PKHA 5M1FA 2VCPA 1ZC6A 3C0BA 4OO1J 1RDWX 4FWPA 1NBWA 2DPNA 4WFNL 3LDQA 2E88A 4YL8A 2D11A 2J0MA 5E84A 4P7IA 2GUPA 3SBGA 3H6EA 3LDLA 1KXPA 1X3MA 4BGBA 2NRRA 2YCHA 1NVLA 4FL9A 2P9UA 3D2EA 4BGAA 4DCHA 1GLLO 3VF6A 3ZDTA 3EN9A 1KAYA 3QMLA 3CCMN 1NGGA 5JVHL 5M1NA 2V7ZA 3CIPA 4IJAA 2EMTA 2V7YA 1MA9B 3DXMB 1BA0A 4C1NI 4BQZA 3FGUA 2FF3B 4NB4A 4IZ9A 1HJOA 3H46O 5M1QA 3MN5A 3WT0A 2YI1A 4H5RA 1GLFO 3WA0A 1TYQA 2FSNA 2P9KA 3UKUA 1SS6A 5AZJA 2A6AA 4H0YB 4ILGB 3HZ6A 3UB5A 4JKCA 3G4SN 4BR9A 1VQON 3H45C 3SK3A 3CMAN 3M3ZA 4CD3A 3AU4A 2NRZA 1NGHA 3WUHA 4ZRIA 3M1FA 4U67L 2P9LB 3VERA 3I55N 3AAPA 5HL7L 5BN9A 4BRNA 4BREA 5AQYA 5AR0A 1QQMA 3FE1A 5AQMA 3MX5A 3PIPL 3LM2A 3U8ZA 2J0JA 1X9JA 3FZFA 3O9UA 1TUYA 4YDUC 3WXLA 4JAXA 2ZJQL 2YHWA 4KBOA 3FLVA 3M6GA 1M90O 3L4QA 3R1XA 1K73O 3J8AA 1MK9B 1YJ9N 2P9PB 4B1XB 1W2BM 1K8AO 5BRFA 4I6MB 4B1WB 3MN6A 5HOOA 3CJ1A 4ZRJA 4Y0WA 4BVPA 2FDQA 4GXBA 3VGKA 1RFQA 3G25A 3ID6A 3FZMA 3C7NB 3IUCA 4ISFA 4E1JA 1KC7A 3EO3A 4A2BA 4BC5A 4YOXA 4IXCA 3VTIA 2D2QA 2LBBA 4CBXA 3AAQA 1NLVA 2BTFA 1GLAG 4JEPA 2V51B 3ZX2A 3GE1A 1DKGD 2HBJA 5F2RA 3MCAB 1GC6A 3C6HA 3CERA 3PIOL 5C2FA 3EPYA 1GLCG 1P8ZA 4YOTA 2I1KA 3IVFA 1YIJN 5AQSA 3MMVA 5CHIA 3T69A 3CCSN 2WFBA 4RCHA 4A62A 3PLAA 1Z05A 4BRPA 3VEVA 1VQ6N 1S3XA 3OA9A 1NGCA 1TUUA 4H0PA 2QEXN 4CI6A 4BR2A 4B9QA 3ATVA 1H1VA 4BRGA 2WH5A 4IWVA 4KH4A 2HMPA 1YF5L 2CB8A 3T7ZA 3SMPA 5GIPA 3UKRB 3FLCO 5FPEA 3CPEA 2ZWHA 2QWRA 3AARA 1KQSM 3CCVN 1WUAA 2QWQA 4O8KA 1XQSC 4KH5A 5C2DA 1GLDG 3G71N 2J0KA 1HKBA 1NGBA 4H0XB 3A5NC 3FZKA 2FSJA 3ENOA 1ST7A 5EOYA 2CGKA 3MDQA 1M1KO 3ENHA 4CZGA 3CC4N 2QA4N 5BR9A 1CZAN 2QWMA 5JVGL 5EXWA 3HBTA 4JKGB 4IEIA 3ATUA 5AQKA 3IDHA 4FWRA 2ASMA 3GG4A 1OKJA 3VEWA 1VQNN 4CZMA 1MDUB 3UE5A 3CCQN 3KWIA 4H0VB 1O13A 2UYTA 3RSEB 4JKBA 4FWKA 1U2VB 2A3ZA 1NMDA 4FWMA 1VQKN 3AU5A 4NLCA 3SJHA 2P9SA 3MCPA 3F5TA 2P9IA 4CZLA 3BF3A 4BRCA 4EFHA 2ZGYA 1R59O 1YXQA 5KPTA 1BO5O 4HDQA 1Q86O 4CBUA 2GWKA 2HF3A 2RE2A 5KPRA 1Q82O 3QB0A 5AZIA 1VQ4N 1N8RO 4M7YA 3CETA 4JK7A 4JK8A 1MIXA 3TU5A 1DIKA 4WQ5A 1RGIA 1Y19B 2ASPA 1K9MO 1LOTB 4MDBA 5GADP 2RHKA 3KK7A 2A5XA 3VEZA 3BF1A 5M1KA 1J6ZA 1K8KA 2D10A 3HM8A 3ULEB 4F9OA 3F2KA 3QICA 3E9OA 4FPAA 1YHQN 4WFBL 1KAXA 1E4GT 4EKUA 3D6RA 3CXCM 3WXMB 1ILYA 3VGMA 4BR0A 2YJEA 1SQKA 4GV6A 3G6EN 2FXUA 3W3DA 3DWLA 3U4LA 2HBMA 1KD1O 4OPAA 4UY8O 1IG8A 3FZHA 1YI2N 1KBLA 1D4XA 3Q7BA 4FWQA 3CCJN 1BDGA 1YJNN 1HPMA 3HOSA 2P9UB 3D2EB 1VAZA 1EF1A 3CJBA 1NTIA 2IVOA 2VGMA 3TTCA 3O1WA 3U9ZA 3A5MC 5JLHA 5C0YA 2WC9A 4O8UA 2GTDA 3ZX0A 3U8XA 2IVNA 5AQIA 3CI5A 2AL6A 2AP1A 3O5BA 3O9TA 3AGRA 4ISGA 1TYQB 2P9KB 3UKUB 3VGLA 3CD6N 2AEHA 5AZJB 3K9JA 1BA1A 2P9NA 3O08A 4FWSA 1SAZA 3P4IA 3DXKA 3K9KA 4IEEA 2DIKA 4EHUA 3CF5L 3CJCA 4H0TB 4PKIA 2Q31A 5ADXH 2IVPA 2FLOA 1OVYA 5ELZA 1HKGA 3R8EA 1MWKA 1Q7YO 5LJVA 2PBDA 1GLBG 4KH6A 3CJAA 1VQ9N 4BR4A 3FZLA 4A5AA 1H4RA 3M5RA 2QWPA 1V4SA 3GOIA 2JWLA 2KLAA 5EX5A 4BRQA 2KHOA 4BRKA 2WBNA 4QS8A 3EE8A 3BEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKB A;  3ENB A;  3SBT A;  4JKE A;  4JKH A;  4JKG A;  4ILH A;  4JKA A;  4JK9 A;  3E9L A;  4JKD A;  4JK7 A;  4JK8 A;  4ILJ A;  4JKG B;  3E9P A;  3E66 A;  4ILG B;  4JKC A;  4JKF A;  3E9O A;  3SBG A; 
#chains in the Genus database with same CATH topology
 3VA0 A;  1Q18 A;  1S1W A;  1LCU A;  4LH4 A;  1NU0 A;  1SV5 A;  3TAR A;  4F2R A;  1B92 A;  4FJN A;  5M1P A;  1TKT A;  2ZM6 K;  2KW4 A;  2Q0R A;  3MXJ A;  3QFU A;  3DAW A;  5AQH A;  4BC2 A;  1NGI A;  2F9T A;  4CF9 A;  5KGX A;  1T3V A;  1NGF A;  1HBK A;  4JI2 K;  4BAC A;  4FZZ A;  2Y1J A;  4AH9 A;  1TAU A;  2AA4 A;  4F2S A;  1W97 L;  3E66 A;  1EQY A;  3LDO A;  3VA3 A;  1RBT A;  2YHA A;  4DLG A;  5JS2 A;  4IOC L;  4CZH A;  3WQU A;  4CZI A;  2PFU A;  4CJV A;  4AF1 A;  1T44 A;  1WSG A;  3VF4 A;  5KPZ A;  2WTU A;  4DSJ A;  1QVF M;  3LDP A;  3OYE A;  3OYF A;  4M3R A;  3O4N A;  1YVN A;  4CHY A;  3DJC A;  1XC9 A;  4C8O A;  1NJZ A;  3LPU A;  2QWN A;  5JMV A;  3IAY A;  2E2Q A;  3MXI A;  2KFZ A;  4IFE A;  4H5N A;  4C8L A;  5FPN A;  4CIF A;  1DEJ A;  1TVR A;  2ASO A;  3L8B A;  4N41 A;  4DS5 A;  5C10 A;  3OYN A;  4H5W A;  2BUP A;  5C25 A;  3AVG A;  2KQ2 A;  2P9S B;  5FPM A;  2NRH A;  2IDO A;  4K43 A;  5C12 A;  2R82 A;  1ZXO A;  3OBY A;  4O55 A;  3NGI A;  3CCE N;  5AQN A;  3HTV A;  4IO9 L;  1JXE A;  3DYA A;  4M7X A;  3IKM A;  2F9W A;  4ZTJ A;  4H5V A;  4WCE L;  3DLG A;  5FPD A;  1K8K B;  3PV8 A;  3MEE A;  1GOC A;  5CZ1 A;  5JIC A;  2IIR A;  2YVC A;  3T1A A;  1CLQ A;  3RMD A;  3AVF A;  3O9R A;  3KIO A;  2P1J A;  1VQL N;  4BE0 A;  2CGJ A;  3HI0 A;  5CR4 A;  3IG1 A;  2QKB A;  4B3O A;  2QW9 A;  3E9P A;  4B1Y B;  3D45 A;  4K42 A;  2QXL A;  2OA8 A;  1XI1 A;  3IMX A;  4Z4H A;  3G9W A;  4BVO A;  4C1N K;  3RRG A;  2WOM A;  1U4B A;  4DR2 K;  4JS5 A;  5AQG A;  2Q36 A;  3KZB A;  1T05 A;  1ATN A;  1JXB A;  1HB8 A;  4C8N A;  1QQO A;  5KRS A;  3CYM A;  4A5B A;  3I33 A;  4BG9 A;  4M63 C;  2J4R A;  3ZSW A;  3MN7 A;  1SGH A;  4ELT A;  2P9L A;  1G99 A;  3VQ9 A;  3P1G A;  2D5R A;  4FWL A;  5HP1 A;  3ZET B;  2RN2 A;  3KK2 A;  4L8R B;  5DM7 L;  1UA0 A;  2FBV A;  3VQQ A;  3PX4 A;  5AQU A;  4JKH A;  1U6Z A;  4I6M A;  3VQ7 A;  4KI6 A;  2XO7 A;  3DOL A;  2E1Z A;  3LWL A;  3IFR A;  3C7N A;  3MWP A;  3O9Q A;  3HPH A;  4QS7 A;  1BI4 B;  3LPT A;  1BHL A;  1P90 A;  3WNG A;  3BZC A;  4CIE A;  3EE9 A;  1SZ2 A;  1S1V A;  3JAM O;  3CJ7 A;  4H03 B;  4KB0 A;  1NJI O;  1YVU A;  1KC8 O;  4PHT X;  2FF6 A;  2D0C A;  1XHZ A;  1U49 A;  4QOZ B;  5BN8 A;  4EZ9 A;  5FRM A;  4CJ7 A;  4AHU A;  3SNN A;  3M8Q A;  2NRV A;  3OBW A;  4X62 K;  1BIS A;  3VF2 A;  3CHW A;  3MX2 A;  3J7Z O;  3QIP A;  4B9M A;  1NOY A;  3BP8 A;  3PSI A;  1LAW A;  3UKR A;  2X0S A;  1E4F T;  3ZT1 A;  3QEI A;  1DTT A;  4V19 S;  3D2F B;  3KWG A;  4CFD A;  3K58 A;  1VQM N;  4DV3 K;  1D8Y A;  4FZY A;  3J7A P;  2Q2R A;  5BPN A;  1VSL A;  4DUZ K;  4JHD B;  1KAZ A;  4BE2 A;  3PY8 A;  1D5A A;  3L6Q A;  3OJS A;  3ZSV A;  3GL1 A;  1Y97 A;  1T6D A;  5BPM A;  2VG6 A;  3C6A A;  4H5T A;  1NK4 A;  4ELU A;  2P5O A;  3FFI A;  4GY2 B;  2E6M A;  3O6W A;  4CEZ A;  4B8C A;  1EKE A;  3HOT A;  4DSK A;  4BWM A;  3VQ5 A;  5AQR A;  3H08 A;  4FWO A;  4MQ3 A;  1XUP O;  4JD2 B;  1C0F A;  3QIO A;  4F3T A;  4YOV A;  4DHY A;  5GIO A;  1QTM A;  3DRR A;  1WSF A;  5I42 A;  2I7P A;  5JS1 A;  2RKI A;  4GNI A;  4CGF A;  4CZF A;  1C1C A;  2IOC A;  3BZK A;  3TSQ A;  5BRE A;  5AQX A;  2NNW A;  4HDO A;  4PKH A;  1XMQ K;  4M3W A;  3C0B A;  4OO1 J;  4Z4I A;  1RDW X;  4FWP A;  1NBW A;  3B6P A;  5E84 A;  3VQA A;  2HMI A;  2X78 A;  1HR0 K;  1KXP A;  1X3M A;  3RR7 A;  1TK8 A;  1WAF A;  3NGY A;  1NVL A;  3D2E A;  3EN9 A;  4MFB A;  4KB1 A;  3KLF A;  2GBZ A;  3WNF A;  5JVH L;  4FJH A;  1DTQ A;  4LH5 A;  3ASM A;  4AQY K;  1VSM A;  3MN5 A;  1GLF O;  3UKU A;  3O3H A;  4LFA K;  1SKS A;  3RWU A;  4H0Y B;  3RMB A;  3RR8 A;  4H8K A;  4B3S K;  1VRU A;  4ZRI A;  3C95 A;  1IO2 A;  2VG5 A;  3FE1 A;  2OPR A;  5FRN A;  1XNQ K;  4ICL A;  2UU9 K;  2PY5 A;  4KBO A;  2BAN A;  1SL1 A;  1K73 O;  1QQC A;  4FK0 A;  1YJ9 N;  4B1X B;  3MN6 A;  4ZRJ A;  4Y0W A;  4DU3 A;  3FZM A;  4ISF A;  3ZLJ A;  4WE1 A;  4CK1 A;  4PA1 A;  4BC5 A;  1SL0 A;  4YOX A;  4I2P A;  3ZSR A;  4CBX A;  2D2Q A;  2LBB A;  1VSE A;  1NLV A;  1KLM A;  4RW9 A;  3K0S A;  4FLU A;  5C2F A;  1P8Z A;  5AQS A;  3CCS N;  2WFB A;  4DR6 K;  2I5J A;  1S3X A;  1RBU A;  4CI6 A;  1A5V A;  4BRG A;  4IWV A;  4JS4 A;  4KH4 A;  3ALY A;  4Q5V A;  3K5O A;  3DRP A;  3AVA A;  3CCV N;  1KQS M;  1XQS C;  5C2D A;  3LZI A;  4H0X B;  4JRQ A;  2O8B A;  3ZSZ A;  2FSJ A;  3ENO A;  1VSF A;  1M1K O;  3ENH A;  4CZG A;  3CC4 N;  4FZX C;  2X6N A;  5JVG L;  4QAG A;  4JKG B;  3ATU A;  2UXD K;  3IDH A;  4FWR A;  4W5Q A;  4FJJ A;  2ASM A;  3VEW A;  3K59 A;  4CZM A;  1S9E A;  1XNR K;  4B9U A;  3QEV A;  2O8F B;  3CCQ N;  3LAN A;  1O13 A;  2UYT A;  3B6O A;  1JLQ A;  3AU5 A;  1ASW A;  3KD5 E;  3ZT2 A;  3BF3 A;  4CHO A;  2ZGY A;  4KHU A;  2GWK A;  3HT3 A;  2RE2 A;  4DWI A;  1C1B A;  1B9F A;  1N8R O;  1MU2 A;  3TU5 A;  4CFA A;  4B9N A;  1Y19 B;  2XY5 A;  3CM6 A;  3L2Q A;  2RHK A;  2A5X A;  4OKE A;  5IWA K;  1FJG K;  3F2K A;  2UUC K;  1ILY A;  2UUA K;  4GVM A;  3PSF A;  3G6E N;  3DWL A;  3FZH A;  1YI2 N;  1KBL A;  3IRX A;  2JGU A;  2P9U B;  1VAZ A;  1EF1 A;  3CFP A;  4IFV A;  1HYV A;  3O4Q A;  5C0Y A;  5AJ3 K;  2GTD A;  4DV5 K;  1UAX A;  2IVN A;  4KHQ A;  4DSF A;  5KI6 A;  4CJR A;  4CHQ A;  4ISG A;  3AGR A;  4EZ6 A;  2P9K B;  4IDK A;  3VGL A;  1HRH A;  5AZJ B;  3K9J A;  1WB9 A;  3O08 A;  2P9N A;  4I9L A;  3J7Y P;  4KV8 A;  1KFS A;  3LAK A;  2Z1G A;  3CFR A;  2FLO A;  4B9L A;  3V4I A;  1OVY A;  4K0K K;  1CXU A;  4NXN K;  2PBD A;  4UQG A;  1QSL A;  3CJA A;  1VQ9 N;  2KZZ A;  3SQ0 A;  3M5R A;  1V4S A;  2KHO A;  2WBN A;  3EE8 A;  3CME N;  4FLV A;  1VQ8 N;  3O8M A;  4YDU A;  4EP5 A;  4DV2 K;  1YTU A;  1QSS A;  2HHX A;  4BRI A;  2A40 A;  1FW6 A;  4DKW A;  1YUW A;  1WOQ A;  1VBG A;  4BR7 A;  4OPH A;  3OHR A;  2FSK A;  1RTD A;  4Z4G A;  1RDB A;  4BRO A;  3WEE A;  1HX1 A;  3QLH A;  2D0O A;  1SL2 A;  3WNE A;  3SCX A;  4DB3 A;  1YAG A;  3KLI A;  4DTS A;  3EKS A;  3BY5 A;  2W6L A;  5F1X A;  1DLO A;  3VOV A;  1C0U A;  2E2O A;  5M1O A;  1NGD A;  1ASU A;  4E19 A;  3SUO A;  4KHY A;  3R3L A;  4BRM A;  2O8C A;  2GX9 A;  4FK2 A;  1B9D A;  4OGE A;  4X64 K;  4A57 A;  5E26 A;  2HND A;  4CJU A;  1HNW K;  1S5J A;  3VEO A;  4I9Q A;  3VQB A;  4Z4E A;  2CH5 A;  3PZD A;  4N56 A;  3V9X A;  1VSI A;  2H3G X;  5HRR A;  3WNH A;  4ZHR A;  2Q1N A;  5GIN A;  3CG7 A;  3DM2 A;  4CZK A;  3C6U A;  2O8D A;  4QS9 A;  3BDP A;  1C0G A;  3U9D A;  1U45 A;  1A5X A;  3ZSQ A;  5HBM A;  5FRO A;  3TI0 A;  5CYM A;  3OVN A;  5CE3 A;  2P9I B;  3RMA A;  3O80 A;  1RT7 A;  3V1O A;  4B1Z A;  5I3U A;  2P51 A;  1XC3 A;  4ILJ A;  4BDP A;  2G8F A;  4DQ8 A;  1HB6 A;  2ZQB A;  5AQQ A;  5AZI B;  4DSL A;  4FLY A;  3DLR A;  4CJS A;  3LAM A;  2HVI A;  4NCA A;  1OH5 A;  1JLE A;  4B8A B;  4L3Q A;  2G8K A;  3OYB A;  1BG3 A;  2KKZ A;  3NFA A;  3HPG A;  1UWB A;  3NHG A;  1RDD A;  2OPS A;  1SKR A;  1J54 A;  1HUX A;  3ZX3 A;  2B6A A;  4FPB A;  3VPZ A;  4IOA L;  3NDK A;  3LP1 A;  4MO5 A;  1WSE A;  2E8A A;  4HUG A;  3KLH A;  5HRN A;  1LV5 A;  3SAH A;  4JI8 K;  1ZBI A;  1MWM A;  3NVK A;  1MIZ B;  4K41 A;  4GMJ B;  3DXM A;  2VYP A;  5SZT A;  4B1V A;  5DM6 L;  4F8R A;  2GUI A;  3WXJ A;  1HQE A;  3DXK B;  3P39 A;  2JWK A;  2D0B A;  3SUQ A;  4M45 A;  2F8S A;  3TSP A;  3CQY A;  4CHN A;  4DR4 K;  4PKG A;  3LP0 A;  2YJF A;  4CK2 A;  5AFU A;  1NKC A;  4CJL A;  4DS4 A;  4CZE A;  1X9M A;  3LZJ A;  4Z94 A;  2VWB A;  3AVN A;  2ZGZ A;  3PO4 A;  3M8S A;  1ATR A;  3I0R A;  5E41 A;  1ISN A;  3ZSO A;  2P9P A;  1VBH A;  3QIJ A;  3SMS A;  1GOA A;  4HTL A;  4LF6 K;  1Z6R A;  4FK4 A;  3PO5 A;  3L2R A;  1S72 N;  2I7N A;  3ULD A;  2E4L A;  3N4Q A;  4CGH A;  3LM9 A;  2DFH A;  5J2Q A;  5TKW A;  4DTU A;  4A61 A;  1NK0 A;  2W42 A;  2OYQ A;  4BG8 A;  2HRJ A;  5D3G A;  3THW A;  2YHX A;  4CEA A;  3ZEU B;  2D1K A;  4EAH D;  4PUO A;  4F4K A;  3TTD A;  4MDA A;  1EWQ A;  4AHV A;  3OYC A;  2FJ9 A;  1RT5 A;  2IAJ A;  2IGI A;  1MK7 B;  3KLE A;  2ITM A;  3EZW A;  5C15 A;  1U04 A;  1GGO A;  4CF8 A;  3QIN A;  3RVC A;  4CF0 A;  1TAQ A;  2XY8 A;  1IH7 A;  3OYH A;  4QCL A;  1Q8I A;  1VQ5 N;  3AA3 A;  4BWJ A;  1KSP A;  3U3Y A;  1EP4 A;  1VQP N;  3RSE A;  1U2V A;  2OPP A;  3AO4 A;  4NXM K;  1S22 A;  4CF2 A;  3AGK A;  3LP3 A;  1S1X A;  5AQO A;  1ZYQ A;  1JLF A;  3CPW M;  4MLE A;  4J2E A;  3R9P A;  3ZYY X;  4A2A A;  3HM9 A;  4PQU A;  1QVG M;  5AQT A;  2COP A;  5AQJ A;  4AM6 A;  2EMS A;  4IO8 A;  4DSE A;  1BCM A;  2QKK A;  4BRF A;  4CJW A;  1RTJ A;  5AQW A;  1S1U A;  4K8X A;  4DFP A;  3H3N O;  5M1F A;  3VES A;  2PYL A;  4HUE A;  4B3M K;  4LFC K;  5IT9 O;  3NF6 A;  4DV6 K;  4KKO A;  3LDQ A;  5HLF A;  2D11 A;  4P7I A;  3LDL A;  3O3G A;  1N33 K;  2G8I A;  4BGB A;  2NRR A;  4BGA A;  1O1W A;  4DU4 A;  1GLL O;  1KAY A;  1KVB A;  3LP2 A;  3QEX A;  3CCM N;  1K6Y A;  3DOK A;  3CIP A;  4X66 K;  1KFD A;  1BA0 A;  4C1N I;  3PX6 A;  3FGU A;  3THX A;  2OZM A;  1JL2 A;  1NK6 A;  3BGR A;  3H46 O;  3AO1 A;  4CFC A;  4H5R A;  4DU1 A;  4FM1 A;  4ILG B;  1NMN A;  4BR9 A;  3VQD A;  3H45 C;  3CMA N;  3M3Z A;  4CED A;  4W5N A;  1NGH A;  3NBP A;  2VG7 A;  1EWR A;  3VER A;  3I55 N;  5BN9 A;  3AA4 A;  4DFM A;  1IBM K;  1CZB A;  4YDU C;  3KTQ A;  3O9U A;  1TUY A;  3WXL A;  2YHW A;  3KK1 A;  5DK5 A;  1M90 O;  4E0D A;  2YNI A;  3J8A A;  1N32 K;  1W2B M;  1K8A O;  4B1W B;  4Z4F A;  2FDQ A;  1IKW A;  1RFQ A;  3G25 A;  3ID6 A;  3ITH A;  1IV0 A;  3VTI A;  4DQR A;  4NYN A;  4M3X A;  2KZM A;  4DV4 K;  3GE1 A;  3C6H A;  4YOT A;  3OY9 A;  3OYA A;  4LSN A;  2I1K A;  2HHH K;  4RCH A;  4A62 A;  4HHT A;  4FJG A;  1L3U A;  3QNN A;  2QEX N;  3KD1 E;  3ATV A;  1H1V A;  3TAE A;  2HMP A;  3T7Z A;  2CB8 A;  3SMP A;  2F8T A;  3OJU A;  3OYL A;  1WUA A;  2QWQ A;  3NGZ A;  3VQ4 A;  1GLD G;  3G71 N;  3K5L A;  1LW2 A;  3HVT A;  1XMO K;  3C6T A;  2PYJ A;  1OH6 A;  4H4M A;  4LF8 K;  4CGI A;  3U3G A;  5AQK A;  4KRF A;  5LMN K;  3AVB A;  4FVM A;  4H4O A;  1VQN N;  4GW6 A;  2O4I A;  4Y1D A;  1T7P A;  4GKJ K;  3V81 A;  2A3Z A;  4FWM A;  1U47 A;  1LWC A;  2P9S A;  3MCP A;  3TAQ A;  5CZ2 A;  4BRC A;  4EFH A;  4J2B A;  1YXQ A;  4KRE A;  1BO5 O;  4HDQ A;  1Q86 O;  1BCO A;  4ID1 A;  5HRP A;  2HHV A;  4HCB A;  4M7Y A;  5J2N A;  4RW8 A;  1MIX A;  5CY4 A;  1NG9 A;  3KK7 A;  3VEZ A;  5M1K A;  3BF1 A;  1J6Z A;  1K8K A;  3ULE B;  3K57 A;  1C6V A;  3SI6 A;  1KAX A;  4EKU A;  3WXM B;  3SYZ A;  1SQK A;  2FXU A;  3W3D A;  1KD1 O;  1IG8 A;  1HQU A;  1HNV A;  3O3F A;  3HOS A;  3MAQ A;  3MEG A;  5A2Q O;  4LF9 K;  2DTU A;  1QE1 A;  5LMU K;  5AQI A;  1FXX A;  3LDS A;  1TYQ B;  3CD6 N;  4DTJ A;  4LF7 K;  4FWS A;  5C42 A;  4F3O A;  1ASV A;  1VK0 A;  3OYG A;  3E01 A;  2IVP A;  4M42 A;  1HKG A;  4DV0 K;  1YT3 A;  5LJV A;  4KH6 A;  1TK0 A;  1WSI A;  4BR4 A;  4A5A A;  1Z26 A;  3T19 A;  1A5W A;  2QWP A;  3HJF A;  1RIL A;  2KLA A;  5EX5 A;  4DQP A;  1WBB A;  3SZ2 A;  4QS8 A;  3MN9 A;  3ZET A;  3TSU A;  4BR5 A;  3QER A;  4BDY A;  1CXQ A;  2VQF K;  4XH5 A;  1NJX A;  3SAG A;  4BRL A;  1RDU A;  2HHQ A;  1VRT A;  2QK9 A;  1NKE A;  2V52 B;  4CER A;  3LL3 A;  4JN4 A;  1REV A;  4M3Y A;  3V9Z A;  4FSV A;  1BL3 A;  3VQE A;  3OS2 A;  3I56 N;  5KQ8 A;  2HF4 A;  1NGE A;  4OVL A;  2A42 A;  3VET A;  3CJ9 A;  4B9S A;  1TL3 A;  1YJW N;  3QDK A;  1NGA A;  1KVA A;  2EX3 A;  3V9S A;  4NCB A;  4ZRK A;  2XRI A;  1ESV A;  4CBW A;  4BE1 A;  3D2F A;  4BC4 A;  2DY4 A;  3J81 O;  2YX6 A;  4JHD A;  5ADX A;  3VEN A;  1RNH A;  1Q81 O;  3TAN A;  2YKN A;  4WF9 L;  4FJM A;  3VQ6 A;  2ETJ A;  3P38 A;  4WYB A;  1DGK N;  1GC7 A;  3H1Q A;  3AVC A;  3R6M A;  5IJM A;  1X3N A;  4IJN A;  5AFU H;  4N5S A;  1L3V A;  4J2D A;  3HYF A;  4LF4 K;  3H3O B;  2FBX A;  4OX9 K;  3EY1 A;  2G8U A;  1U48 A;  4JKD A;  1VQ7 N;  1VSK A;  4HUF A;  3ZSY A;  3CCU N;  4FJ7 A;  4LF5 K;  3CQ8 A;  3MWT A;  2WUS A;  4IBN A;  3THY B;  4JD2 A;  4CEO A;  1JDE A;  4HVJ A;  5GAG P;  3O4W A;  3NCI A;  4KAZ A;  3AVI A;  3OYK A;  1ATS A;  4K8Z A;  3AVL A;  3AA5 X;  1FKP A;  2NLX A;  1F21 A;  3CQX A;  3TTF A;  4KO0 A;  4CZJ A;  4FM2 A;  4JV5 K;  3F9M A;  3KJV A;  2BH1 A;  2E1Y A;  5JLF A;  1IKY A;  1TKD A;  4GV3 A;  3SAF A;  2D0P A;  1LW0 A;  1VSJ A;  2YNH A;  3OS0 A;  3SQ1 A;  1TV6 A;  3PVL A;  1Z25 A;  2NRX A;  1W0H A;  2BE2 A;  3VMF B;  4JNE A;  2ZD1 A;  1RT1 A;  2CGL A;  3E1Y A;  1ZBH A;  4FXD A;  3K2P A;  3HL8 A;  1RBS A;  3S3M A;  5HRS A;  2VWK A;  2ZE2 A;  5BRD A;  3S9H A;  4BQL A;  1NKB A;  5BPL A;  3BIN A;  4ILH A;  4JKA A;  1GLE G;  2LSN A;  3OYD A;  3VEX A;  1QHA A;  1BWF O;  3D0P A;  3MEC A;  4TKN A;  1JLA A;  4E3S A;  4KTZ A;  3RMC A;  2HOE A;  5GAH P;  3O9S A;  1J5E K;  3JXU A;  4N76 A;  2NZT A;  4E1N A;  1ZBL A;  4XH1 A;  5MLC Q;  1W7A A;  1CZ9 A;  3SBT A;  5KQD A;  4YOY A;  4CYE A;  4OLB A;  1QZ5 A;  1TL1 A;  4IKF A;  2F7T A;  3LAL A;  2DFE A;  3W0L A;  3GDQ A;  4KTW A;  4RW4 A;  4FCY A;  2EWS A;  3C94 A;  4NO7 A;  2FBY A;  4KHP K;  3AY9 A;  3L4I A;  4PL7 A;  5TKY A;  2OTL N;  3N4P A;  1T6C A;  4BRA A;  5BRH A;  2HBL A;  1OH7 A;  1C0T A;  3AO2 A;  3OW2 M;  4FJ8 A;  2PAV A;  2XHB A;  2QWL A;  4RW7 A;  4FVU A;  3ISN C;  4EIA A;  4JKE A;  4YFU A;  1JCF A;  3FR0 A;  4DF8 A;  5FLX O;  4OGC A;  1DT9 A;  1IKX A;  2KFN A;  4E1M A;  4YOW A;  3CCR N;  1JCG A;  2Q97 A;  1JJ2 M;  3I8B A;  3M8R A;  4ISE A;  1S1T A;  3NH1 A;  2VGN A;  4DFK A;  2A41 A;  4N47 A;  4JI7 K;  3ENB A;  1I39 A;  3KK3 A;  3HRG A;  4BRH A;  2EHG A;  2QI2 A;  1L3S A;  4DQQ A;  4WQ4 A;  4EHT A;  4JKG A;  3OYI A;  3QET A;  4CEQ A;  3V9W A;  3LWM A;  1JL1 A;  2O8F A;  5LY3 A;  4ELV A;  4NY0 A;  4JI1 K;  4AIL C;  1BQN A;  4NCG A;  4E7L A;  2HBK A;  4AM7 A;  4CE9 A;  3WQT A;  4JKF A;  1TGO A;  3P31 A;  1EO1 A;  3ID8 A;  3K5M A;  3VEY A;  2PZS A;  1QHT A;  4U7B A;  3CFO A;  4MLH A;  1JLB A;  2HST A;  5EVZ A;  3HST B;  3P83 D;  2GEL A;  3VQP A;  1BU6 O;  3KVG A;  4HWI A;  4DTO A;  4O4G A;  2VCP A;  4JI5 K;  1HNI A;  2Z1H A;  1WN7 A;  4NYF A;  2G8V A;  2DPN A;  3EEQ A;  2HHW A;  4YHH K;  4X65 K;  3SBG A;  3DRS A;  3H6E A;  4B08 A;  3OYM A;  2YCH A;  3K5N A;  2B5J A;  3V1R A;  4FL9 A;  2P9U A;  4DCH A;  5J2P A;  3VF6 A;  1KLN A;  3QML A;  1NGG A;  5M1N A;  2V7Z A;  3I0S A;  1TKX A;  2EMT A;  2V7Y A;  3I8D A;  1N34 K;  3SV4 A;  4B3R K;  1IG9 A;  1HJO A;  3P5J A;  3QES A;  3KLG A;  4FYD A;  3WT0 A;  2YI1 A;  2FSN A;  3WA0 A;  2P9K A;  4DR3 K;  2A1S A;  5AZJ A;  2A6A A;  1S6Q A;  3HZ6 A;  1RBR A;  1VQO N;  4CK3 A;  3SK3 A;  4CD3 A;  3AU4 A;  2NRZ A;  4W5O A;  3M1F A;  2P9L B;  3AAP A;  5HL7 L;  4BRN A;  4BRE A;  2HB5 A;  3PUF A;  5AQY A;  4C8K A;  5KRT A;  4GKK K;  3TAG A;  3MX5 A;  3RRH A;  3LM2 A;  3U8Z A;  1X9J A;  3FZF A;  4E89 A;  5HRO A;  2ZJQ L;  3M6G A;  1L5U A;  3R1X A;  1ZBU A;  4FJL A;  5FDL A;  1MK9 B;  3TAP A;  1UA1 A;  5BRF A;  4I6M B;  2RF2 A;  5HOO A;  4ZTF A;  3VQC A;  3OS1 A;  3C7N B;  3IUC A;  4E1J A;  1KC7 A;  3EO3 A;  1JLC A;  4DV1 K;  3NF7 A;  5SWM A;  1X9W A;  2HNZ A;  4IXC A;  3HP9 A;  4DTP A;  4E7I A;  4JEP A;  3HXM A;  2V51 B;  3ZX2 A;  4YNQ A;  2HNY A;  2HBJ A;  3EPY A;  1GLC G;  3IVF A;  3MMV A;  5CHI A;  3T69 A;  1EXQ A;  3RTV A;  3TR8 A;  4CJE A;  4AHR A;  3QEP A;  1Z05 A;  4BRP A;  4CCH A;  1VQ6 N;  3OA9 A;  1NGC A;  4H0P A;  4B9Q A;  2Z1J A;  5LL6 Z;  3EYZ A;  1I94 K;  4CJQ A;  1YF5 L;  4RG8 A;  2GV9 A;  3UKR B;  3CPE A;  4KPY A;  3AAR A;  4CHZ A;  1G15 A;  4O8K A;  4KH5 A;  4FW1 A;  2A1R A;  3DLB A;  2O8E A;  2J0K A;  2FBT A;  3FZK A;  1T8E A;  2CGK A;  5J2M A;  5EXW A;  4BDZ A;  1J5O A;  4FJ9 A;  4FJK A;  3GG4 A;  1OKJ A;  3L2V A;  4H0V B;  4JKB A;  4FWK A;  2G8W A;  1RDC A;  1NK8 A;  4DSI A;  2IC3 A;  3L3U A;  4CZL A;  3F5T A;  2P9I A;  2E6L A;  4CW7 B;  2OCE A;  3SPY A;  2Q3S A;  2HF3 A;  1X9S A;  1Q82 O;  1W9H A;  2ITG A;  3F9K A;  4HCC A;  5EU7 A;  5AZI A;  1VQ4 N;  3CET A;  4JK8 A;  4RW6 A;  1DIK A;  4WQ5 A;  1RGI A;  1S6P A;  4DR1 K;  3V9U A;  4F9O A;  4FLX A;  3QNO A;  3T1Y K;  1E4G T;  3G0Z A;  3D6R A;  2R7Y A;  3VGM A;  4BR0 A;  2YJE A;  3U4L A;  4OPA A;  4UY8 O;  1WNS A;  1RTH A;  3L2U A;  4DTR A;  4FWQ A;  2HHT A;  1BDG A;  1HPM A;  4C8M A;  3D2E B;  3CJB A;  3DMJ A;  3JSM A;  3VQ8 A;  3PX0 A;  3O1W A;  3U9Z A;  5JLH A;  1EET A;  2P5G A;  4FJ5 A;  4EP4 A;  3CI5 A;  3O9T A;  3UKU B;  2AEH A;  2KTQ A;  2DFF A;  1TKZ A;  3P4I A;  3DXK A;  4EHU A;  2NUB A;  3CF5 L;  3CJC A;  4H0T B;  4PKI A;  2Q31 A;  3OTO K;  1C0M A;  1ZBF A;  3UIQ A;  5ADX H;  3S3N A;  3TAB A;  5ELZ A;  1MWK A;  1Q7Y O;  2UXB K;  1VSH A;  4B3T K;  1QS4 A;  3ZSX A;  2X6S A;  4BRQ A;  1NK9 A;  4DTM A;  4TSX A;  3VTH A;  1YTA A;  3C65 A;  3IS9 A;  4G1Q A;  2W41 A;  3A0I X;  5LJW A;  4JI0 K;  1Q9Y A;  5AQV A;  3NMU A;  1NGJ A;  1RT2 A;  2CH6 A;  2VWJ A;  4PWD A;  4OLA A;  1BIU A;  3AVH A;  3QEW A;  4PY5 A;  1ZBS A;  3G10 A;  1JKH A;  1NOZ A;  4JI6 K;  1RTI A;  2ZPY A;  3HSC A;  2UUB K;  4BC3 A;  4WFA L;  4M3T A;  3S3O A;  3QBW A;  1LAV A;  5T7B A;  1N36 K;  1VSD A;  4FWN A;  4DQI A;  4CEC A;  3HPO A;  3ZT0 A;  2FC0 A;  1NJW A;  3SV3 A;  1JCE A;  3BUZ B;  4CEB A;  3FP5 A;  4CJ3 A;  3ZEU A;  1WLJ A;  2QM1 A;  4KI4 A;  4BY9 C;  1GG3 A;  3WXI A;  4Z4C A;  2OTJ N;  4GVE A;  5K14 A;  4OKK A;  4F7G A;  4JK9 A;  3KHY A;  3CCL N;  2O8B B;  4IOX A;  4WQ4 C;  1HLU A;  4CGG A;  3Q7C A;  3OYJ A;  5B8H A;  4JLH A;  1V4T A;  5F0X A;  2E5L K;  4JI3 K;  3DLK A;  2E2N A;  4LSL A;  1Y64 A;  2AJQ A;  4Q0B A;  4FLW A;  3MED A;  4FOI A;  4K25 A;  3EZ5 A;  4CVN E;  1LWE A;  4JRP A;  3B8A X;  4FLT A;  3TWH A;  2E2P A;  3T1H K;  1FK9 A;  2GEM A;  3AO5 A;  3L0Q A;  2QTD A;  3NF8 A;  1Q9X A;  4KHS A;  4O5F A;  2QWO A;  3QO9 A;  4DMN A;  1ACA A;  4CGJ A;  3CC7 N;  2HE7 A;  3MXM A;  2OPQ A;  4MO4 A;  4DQS A;  1C1A A;  1HYS A;  1JLG A;  5EY4 A;  3D7E O;  1BOT O;  1KVC A;  4DTN A;  4FO0 A;  4R79 A;  1IKV A;  4PL8 A;  3A5O C;  4CJ5 A;  3O1B A;  3AVK A;  3NF9 A;  3AO3 A;  1HKC A;  2Q0U A;  3FFK B;  3QFP A;  1OVQ A;  4Z0U A;  3L2W A;  3A8Y A;  2ZJR L;  4O44 A;  4M41 A;  1NK7 A;  4FW2 A;  1HPZ A;  2CQU A;  4CJT A;  4XH4 A;  1S9G A;  2P9N B;  1YIT N;  1QZ6 A;  4B9T A;  1D9F A;  4IDH A;  4C23 A;  4A59 A;  3HO1 A;  4DFJ A;  1NWK A;  4FOE A;  4RWT A;  3GBT A;  4IG3 A;  5I9E B;  2B4J A;  3M8P A;  4LC9 B;  5CYQ A;  4JI4 K;  3JYT A;  4GV9 A;  2ATQ A;  3DLL L;  1IJJ A;  4RTF D;  4BRD A;  4I7F A;  5JVL A;  2I1J A;  1NI2 A;  3MK6 A;  4CJF A;  5AQL A;  2VQE K;  1WSJ A;  4H0O A;  2WON A;  4XEI A;  1E5W A;  1J19 A;  2D4W A;  1XHX A;  5GAE P;  1BI4 A;  3AVJ A;  1QQN A;  4LD0 A;  3V6D A;  4YOU A;  3L3V A;  3WEE B;  5AQP A;  3SJJ A;  1GLJ O;  4J8F A;  3SQ2 A;  1RCH A;  4M3U A;  2ZF5 O;  2YNG A;  4DXA B;  3JS6 A;  2NRW A;  4G9Z A;  5H1S Q;  4DV7 K;  1TK5 A;  2GWJ A;  2O8C B;  1E3M A;  4OJR A;  3E9L A;  1WBD A;  3QBX A;  3SUN A;  2BDP A;  2ZJP L;  4YOR A;  3ZT3 A;  4CGD A;  2RPI A;  2HW3 A;  3LDN A;  2W40 A;  3AVM A;  5AQF A;  3CC2 N;  4CJP A;  3DLH A;  3A5L C;  4B1U B;  4AHS A;  3S41 A;  3NVM A;  1VHX A;  2RQ1 A;  4CIG A;  4DR7 K;  2O8D B;  2HVH A;  1N5Y A;  3CM5 A;  3TAF A;  4CHP A;  4KFB A;  3H1V X;  1OH8 A;  2UXC K;  2YHY A;  3EKU A;  3U7D A;  1NJY A;  2NRT A;  4KHW A;  3X23 A;  4CD1 A;  1WSH A;  2E20 A;  3NAE A;  1NM1 A;  3SUP A;  4WQ5 C;  1J53 A;  2ABD A;  3TPQ A;  4KTQ A;  1RT3 A;  1N6Q A;  1QSY A;  1BUP A;  5AQZ A;  4NLB A;  2OAN A;  3EL2 A;  3SLC A;  3J80 O;  4CJK A;  3WXK A;  3ULE A;  3NE6 A;  1ZC6 A;  1X1P A;  3SQ4 A;  5DMR A;  4WFN L;  3SPZ A;  2E88 A;  4YL8 A;  2O4G A;  2J0M A;  2QXF A;  3KKR A;  2GUP A;  4XIU A;  4DR5 K;  1ITG A;  4CJ4 A;  3ZDT A;  5KGW A;  1NNE A;  1HMV A;  1HYZ A;  2YKM A;  4IJA A;  1MA9 B;  2G8H A;  1KRP A;  3DXM B;  4DLE A;  4BQZ A;  2FF3 B;  4NB4 A;  4IZ9 A;  2F4V K;  4DF4 A;  5M1Q A;  3HVR A;  4O0J A;  1TYQ A;  4CEE A;  1SS6 A;  2BGG A;  3UB5 A;  4HTU A;  4JKC A;  3G4S N;  4JYA K;  5KTQ A;  3WUH A;  1XWL A;  4U67 L;  5AR0 A;  1QQM A;  4LFB K;  5AQM A;  4R5P A;  3PIP L;  2J0J A;  1RBV A;  2YV0 X;  4JAX A;  4OKJ A;  4W5R A;  3FLV A;  3L4Q A;  2P9P B;  4W5T A;  1UOC A;  3CJ1 A;  1RT6 A;  2D0A A;  4Y1C A;  4BVP A;  2Y1I A;  4GXB A;  3VGK A;  3HK2 A;  1BGX T;  4A2B A;  4O5B A;  1I3A A;  3AAQ A;  2BTF A;  4E7K A;  1GLA G;  4IFY A;  4DG1 A;  1D9D A;  3AV9 A;  1DKG D;  3HP6 A;  5F2R A;  3MCA B;  1GC6 A;  3CER A;  3PIO L;  1HNZ K;  1RT4 A;  1YIJ N;  4YY3 K;  4OPK A;  1NK5 A;  3PLA A;  3THW B;  3VEV A;  1TUU A;  4BR2 A;  1IBL K;  2WH5 A;  3TAM A;  2XY6 A;  2YNF A;  5GIP A;  3NH2 A;  3FLC O;  5FPE A;  5J1E A;  1FKO A;  2ZWH A;  3DLE A;  2QWR A;  5C24 A;  1J9A A;  4ID5 A;  1HKB A;  1NGB A;  3A5N C;  3AA2 A;  1T03 A;  4J2A A;  1RDA A;  1ST7 A;  3KKS A;  5EOY A;  2O8E B;  3DI6 A;  3MDQ A;  1BIZ A;  4E7H A;  2QA4 N;  4DTX A;  5BR9 A;  1CZA N;  4KHN A;  2QWM A;  3HBT A;  3VN5 A;  4I2Q A;  3U6F A;  4CFB A;  1L3T A;  1LWF A;  4IEI A;  4CEF A;  4B9V A;  4FLZ A;  1HJR A;  1MDU B;  3UE5 A;  2XY7 A;  3KWI A;  3RSE B;  1U2V B;  1NMD A;  4AHT A;  1VQK N;  4NLC A;  1R0A A;  3SJH A;  4M3Z A;  1HNX K;  5KPT A;  4IG0 A;  1R59 O;  1SUQ A;  4CES A;  4CBU A;  5KPR A;  4FJI A;  1IBK K;  3QB0 A;  4OPJ A;  3THY A;  4JK7 A;  2F96 A;  2YHB A;  2ASP A;  1K9M O;  1LOT B;  4MDB A;  5GAD P;  4E7J A;  2D10 A;  1KTQ A;  2W6K A;  3HM8 A;  1YHQ N;  2IS3 A;  3E9O A;  3QIC A;  4FPA A;  4WFB L;  1WAJ A;  3CXC M;  4FM0 A;  4LY7 A;  2JLE A;  4GV6 A;  4CF1 A;  2HBM A;  3F73 A;  3ZT4 A;  4O0I A;  1D4X A;  3Q7B A;  3V1Q A;  1SKW A;  2HHS A;  3CCJ N;  1YJN N;  2X74 A;  3A2F A;  1GOB A;  1NTI A;  3ZCM A;  5BR8 K;  2IVO A;  2VGM A;  3TTC A;  2Z1I A;  3T3F A;  3A5M C;  2WC9 A;  4O8U A;  1KCF A;  3ZX0 A;  3THX B;  3U8X A;  4DUY K;  2AL6 A;  2AP1 A;  3O5B A;  4AHC A;  4FJX A;  1BQM A;  1BA1 A;  1SAZ A;  3K9K A;  4IEE A;  2DIK A;  2OZS A;  3R8E A;  1GLB G;  3FZL A;  3THV A;  1H4R A;  2HHU A;  3GOI A;  1EX4 A;  2JWL A;  3NH0 A;  4BRK A;  3BEX A; 
#chains in the Genus database with same CATH homology
 3MN9 A;  3ZET A;  3TSU A;  4BR5 A;  3CME N;  1Q18 A;  1LCU A;  1VQ8 N;  3O8M A;  4YDU A;  5M1P A;  3VTH A;  2Q0R A;  3QFU A;  4XH5 A;  3SAG A;  3C65 A;  4BRL A;  3DAW A;  5AQH A;  1RDU A;  4BRI A;  2A40 A;  2W41 A;  4BC2 A;  1NGI A;  2F9T A;  1YUW A;  1WOQ A;  4DKW A;  1VBG A;  3A0I X;  4BR7 A;  5LJW A;  1T3V A;  5AQV A;  1NGF A;  2V52 B;  3NMU A;  1NGJ A;  3LL3 A;  1HBK A;  3OHR A;  2FSK A;  4OPH A;  2CH6 A;  4JN4 A;  4BRO A;  3WEE A;  1HX1 A;  1ZBS A;  2AA4 A;  2D0O A;  4DB3 A;  1YAG A;  1W97 L;  3EKS A;  4FSV A;  3E66 A;  1EQY A;  2ZPY A;  3LDO A;  3HSC A;  4BC3 A;  4WFA L;  3I56 N;  5F1X A;  3VOV A;  5KQ8 A;  3QBW A;  2HF4 A;  2E2O A;  4FWN A;  1NGE A;  5M1O A;  1NGD A;  2A42 A;  3VET A;  3CJ9 A;  1JCE A;  4IOC L;  3BUZ B;  4CZH A;  3R3L A;  3FP5 A;  3WQU A;  4BRM A;  2GX9 A;  2PFU A;  3ZEU A;  4AF1 A;  3QDK A;  2QM1 A;  4CZI A;  1YJW N;  1T44 A;  4A57 A;  4BY9 C;  1GG3 A;  5E26 A;  3VF4 A;  3WXI A;  5KPZ A;  1QVF M;  2OTJ N;  4GVE A;  1NGA A;  3LDP A;  3VEO A;  4F7G A;  4JK9 A;  3KHY A;  3CCL N;  4ZRK A;  1ESV A;  2CH5 A;  3PZD A;  4CBW A;  1YVN A;  2H3G X;  3D2F A;  4IOX A;  1HLU A;  2Q1N A;  3DJC A;  4WQ4 C;  4BC4 A;  5GIN A;  3Q7C A;  5B8H A;  2QWN A;  1V4T A;  5F0X A;  5JMV A;  2YX6 A;  2E2N A;  4JHD A;  4CZK A;  5ADX A;  2E2Q A;  3VEN A;  1Y64 A;  4QS9 A;  1Q81 O;  4IFE A;  4H5N A;  5FPN A;  1C0G A;  4FOI A;  3U9D A;  4K25 A;  4WF9 L;  1DEJ A;  2ASO A;  3P38 A;  4WYB A;  1DGK N;  1GC7 A;  5C10 A;  3H1Q A;  3R6M A;  5IJM A;  1X3N A;  3B8A X;  4H5W A;  4IJN A;  5AFU H;  2BUP A;  2P9S B;  2E2P A;  3H3O B;  2P9I B;  5FPM A;  5CE3 A;  3O80 A;  2GEM A;  4B1Z A;  4JKD A;  2NRH A;  1VQ7 N;  1XC3 A;  4K43 A;  4ILJ A;  3L0Q A;  5C12 A;  2R82 A;  2QTD A;  3CCU N;  1ZXO A;  3OBY A;  4DQ8 A;  3CCE N;  1HB6 A;  3HTV A;  4O5F A;  5AQN A;  5AQQ A;  5AZI B;  4IO9 L;  2QWO A;  2WUS A;  3MWT A;  1ACA A;  4JD2 A;  1JDE A;  5GAG P;  4M7X A;  2HE7 A;  3IKM A;  3CC7 N;  3O4W A;  4MO4 A;  2F9W A;  4H5V A;  4WCE L;  5FPD A;  1ATS A;  1K8K B;  4L3Q A;  1BG3 A;  2KKZ A;  2NLX A;  5EY4 A;  3CQX A;  3TTF A;  4CZJ A;  3D7E O;  3F9M A;  5JIC A;  2BH1 A;  1BOT O;  2E1Y A;  5JLF A;  2IIR A;  4GV3 A;  3SAF A;  1HUX A;  3ZX3 A;  2YVC A;  2D0P A;  4FO0 A;  4FPB A;  3VPZ A;  4IOA L;  4R79 A;  3O9R A;  1VQL N;  4PL8 A;  2CGJ A;  3HI0 A;  3PVL A;  4MO5 A;  3A5O C;  2E8A A;  2NRX A;  3O1B A;  5CR4 A;  3VMF B;  2QW9 A;  3E9P A;  4B1Y B;  4K42 A;  2QXL A;  4JNE A;  3SAH A;  3IMX A;  2CGL A;  1HKC A;  2Q0U A;  3E1Y A;  3G9W A;  3FFK B;  3QFP A;  1MWM A;  3NVK A;  3A8Y A;  4BVO A;  4C1N K;  2ZJR L;  1MIZ B;  4K41 A;  3DXM A;  2VYP A;  4B1V A;  5AQG A;  5DM6 L;  2CQU A;  2Q36 A;  4XH4 A;  5BRD A;  3WXJ A;  3KZB A;  2P9N B;  4BQL A;  5BPL A;  1ATN A;  1YIT N;  3BIN A;  4ILH A;  4JKA A;  1GLE G;  3DXK B;  3P39 A;  2JWK A;  1HB8 A;  1QQO A;  1QZ6 A;  3VEX A;  4IDH A;  4C23 A;  1QHA A;  1BWF O;  4A5B A;  3I33 A;  3TSP A;  4A59 A;  4BG9 A;  3CQY A;  4M63 C;  4TKN A;  2J4R A;  1NWK A;  4FOE A;  4PKG A;  3MN7 A;  1SGH A;  4RWT A;  2YJF A;  2P9L A;  3GBT A;  2HOE A;  5AFU A;  5I9E B;  5GAH P;  1G99 A;  4CZE A;  3O9S A;  3JXU A;  2NZT A;  4LC9 B;  4GV9 A;  4Z94 A;  4XH1 A;  5MLC Q;  2VWB A;  4FWL A;  2ZGZ A;  3ZET B;  3DLL L;  1IJJ A;  4RTF D;  4BRD A;  5JVL A;  2I1J A;  1NI2 A;  3SBT A;  1ATR A;  3MK6 A;  4CYE A;  5AQL A;  5KQD A;  5DM7 L;  4YOY A;  1ISN A;  5AQU A;  4JKH A;  1U6Z A;  2P9P A;  4H0O A;  4I6M A;  4XEI A;  1VBH A;  1E5W A;  1J19 A;  2D4W A;  3QIJ A;  3SMS A;  5GAE P;  1QZ5 A;  4HTL A;  2E1Z A;  2F7T A;  3IFR A;  3C7N A;  3MWP A;  1QQN A;  1Z6R A;  3GDQ A;  3O9Q A;  4YOU A;  3W0L A;  4QS7 A;  2EWS A;  4NO7 A;  1S72 N;  2I7N A;  3AY9 A;  3L4I A;  3WEE B;  4PL7 A;  1P90 A;  5TKY A;  3N4Q A;  5AQP A;  1GLJ O;  1SZ2 A;  3EE9 A;  3N4P A;  1T6C A;  4J8F A;  2OTL N;  4BRA A;  5BRH A;  3CJ7 A;  3LM9 A;  2HBL A;  4H03 B;  3OW2 M;  5TKW A;  1NJI O;  1KC8 O;  4PHT X;  2PAV A;  2FF6 A;  2ZF5 O;  4DXA B;  2QWL A;  4FVU A;  5BN8 A;  4A61 A;  3JS6 A;  2NRW A;  4CJ7 A;  4BG8 A;  4EIA A;  4G9Z A;  2HRJ A;  4JKE A;  5H1S Q;  2NRV A;  1JCF A;  2GWJ A;  2YHX A;  3FR0 A;  3OBW A;  3ZEU B;  2D1K A;  1DT9 A;  3VF2 A;  4EAH D;  3E9L A;  3CHW A;  3MX2 A;  3J7Z O;  4YOW A;  3CCR N;  3TTD A;  3BP8 A;  3QBX A;  4MDA A;  2ZJP L;  1JCG A;  2X0S A;  1E4F T;  2Q97 A;  4YOR A;  3UKR A;  1JJ2 M;  3I8B A;  3LDN A;  2FJ9 A;  4ISE A;  2W40 A;  1MK7 B;  3D2F B;  3KWG A;  5AQF A;  2ITM A;  1VQM N;  3EZW A;  2VGN A;  3CC2 N;  3A5L C;  2Q2R A;  4B1U B;  5BPN A;  2A41 A;  3S41 A;  5C15 A;  3NVM A;  1GGO A;  3ENB A;  2RQ1 A;  1KAZ A;  4JHD B;  3HRG A;  4BRH A;  2QI2 A;  3L6Q A;  3RVC A;  4WQ4 A;  3GL1 A;  4JKG A;  3H1V X;  4EHT A;  1T6D A;  5BPM A;  1VQ5 N;  2YHY A;  3C6A A;  3EKU A;  4H5T A;  3U7D A;  5LY3 A;  2NRT A;  4NY0 A;  4GY2 B;  1VQP N;  3X23 A;  4CD1 A;  3RSE A;  3O6W A;  2HBK A;  2E20 A;  1U2V A;  4AM7 A;  3WQT A;  1NM1 A;  4JKF A;  3P31 A;  3HOT A;  1S22 A;  3AGK A;  4WQ5 C;  3ID8 A;  1EO1 A;  2ABD A;  5AQR A;  3VEY A;  5AQO A;  3CPW M;  4MLE A;  4FWO A;  3TPQ A;  4U7B A;  1XUP O;  4JD2 B;  1C0F A;  3R9P A;  3ZYY X;  4A2A A;  4MLH A;  4YOV A;  4DHY A;  1QVG M;  5GIO A;  1BUP A;  5AQT A;  2COP A;  2HST A;  5AQJ A;  5AQZ A;  2I7P A;  4AM6 A;  2EMS A;  5EVZ A;  4IO8 A;  4NLB A;  2OAN A;  4GNI A;  2GEL A;  3EL2 A;  4BRF A;  4CZF A;  3SLC A;  1BU6 O;  5AQW A;  3TSQ A;  3WXK A;  5BRE A;  3H3N O;  3KVG A;  4HWI A;  2NNW A;  4HDO A;  5AQX A;  3ULE A;  3VES A;  4PKH A;  5M1F A;  2VCP A;  1ZC6 A;  3C0B A;  4OO1 J;  1RDW X;  4FWP A;  1NBW A;  2DPN A;  4WFN L;  3LDQ A;  2E88 A;  4YL8 A;  2D11 A;  2J0M A;  5E84 A;  4P7I A;  2GUP A;  3SBG A;  3H6E A;  3LDL A;  1KXP A;  1X3M A;  4BGB A;  2NRR A;  2YCH A;  1NVL A;  4FL9 A;  2P9U A;  3D2E A;  4BGA A;  4DCH A;  1GLL O;  3VF6 A;  3ZDT A;  3EN9 A;  1KAY A;  3QML A;  3CCM N;  1NGG A;  5JVH L;  5M1N A;  2V7Z A;  3CIP A;  4IJA A;  2EMT A;  2V7Y A;  1MA9 B;  3DXM B;  1BA0 A;  4C1N I;  4BQZ A;  3FGU A;  2FF3 B;  4NB4 A;  4IZ9 A;  1HJO A;  3H46 O;  5M1Q A;  3MN5 A;  3WT0 A;  2YI1 A;  4H5R A;  1GLF O;  3WA0 A;  1TYQ A;  2FSN A;  2P9K A;  3UKU A;  1SS6 A;  5AZJ A;  2A6A A;  4H0Y B;  4ILG B;  3HZ6 A;  3UB5 A;  4JKC A;  3G4S N;  4BR9 A;  1VQO N;  3H45 C;  3SK3 A;  3CMA N;  3M3Z A;  4CD3 A;  3AU4 A;  2NRZ A;  1NGH A;  3WUH A;  4ZRI A;  3M1F A;  4U67 L;  2P9L B;  3VER A;  3I55 N;  3AAP A;  5HL7 L;  5BN9 A;  4BRN A;  4BRE A;  5AQY A;  5AR0 A;  1QQM A;  3FE1 A;  5AQM A;  3MX5 A;  3PIP L;  3LM2 A;  3U8Z A;  2J0J A;  1X9J A;  3FZF A;  3O9U A;  1TUY A;  4YDU C;  3WXL A;  4JAX A;  2ZJQ L;  2YHW A;  4KBO A;  3FLV A;  3M6G A;  1M90 O;  3L4Q A;  3R1X A;  1K73 O;  3J8A A;  1MK9 B;  1YJ9 N;  2P9P B;  4B1X B;  1W2B M;  1K8A O;  5BRF A;  4I6M B;  4B1W B;  3MN6 A;  5HOO A;  3CJ1 A;  4ZRJ A;  4Y0W A;  4BVP A;  2FDQ A;  4GXB A;  3VGK A;  1RFQ A;  3G25 A;  3ID6 A;  3FZM A;  3C7N B;  3IUC A;  4ISF A;  4E1J A;  1KC7 A;  3EO3 A;  4A2B A;  4BC5 A;  4YOX A;  4IXC A;  3VTI A;  2D2Q A;  2LBB A;  4CBX A;  3AAQ A;  1NLV A;  2BTF A;  1GLA G;  4JEP A;  2V51 B;  3ZX2 A;  3GE1 A;  1DKG D;  2HBJ A;  5F2R A;  3MCA B;  1GC6 A;  3C6H A;  3CER A;  3PIO L;  5C2F A;  3EPY A;  1GLC G;  1P8Z A;  4YOT A;  2I1K A;  3IVF A;  1YIJ N;  5AQS A;  3MMV A;  5CHI A;  3T69 A;  3CCS N;  2WFB A;  4RCH A;  4A62 A;  3PLA A;  1Z05 A;  4BRP A;  3VEV A;  1VQ6 N;  1S3X A;  3OA9 A;  1NGC A;  1TUU A;  4H0P A;  2QEX N;  4CI6 A;  4BR2 A;  4B9Q A;  3ATV A;  1H1V A;  4BRG A;  2WH5 A;  4IWV A;  4KH4 A;  2HMP A;  1YF5 L;  2CB8 A;  3T7Z A;  3SMP A;  5GIP A;  3UKR B;  3FLC O;  5FPE A;  3CPE A;  2ZWH A;  2QWR A;  3AAR A;  1KQS M;  3CCV N;  1WUA A;  2QWQ A;  4O8K A;  1XQS C;  4KH5 A;  5C2D A;  1GLD G;  3G71 N;  2J0K A;  1HKB A;  1NGB A;  4H0X B;  3A5N C;  3FZK A;  2FSJ A;  3ENO A;  1ST7 A;  5EOY A;  2CGK A;  3MDQ A;  1M1K O;  3ENH A;  4CZG A;  3CC4 N;  2QA4 N;  5BR9 A;  1CZA N;  2QWM A;  5JVG L;  5EXW A;  3HBT A;  4JKG B;  4IEI A;  3ATU A;  5AQK A;  3IDH A;  4FWR A;  2ASM A;  3GG4 A;  1OKJ A;  3VEW A;  1VQN N;  4CZM A;  1MDU B;  3UE5 A;  3CCQ N;  3KWI A;  4H0V B;  1O13 A;  2UYT A;  3RSE B;  4JKB A;  4FWK A;  1U2V B;  2A3Z A;  1NMD A;  4FWM A;  1VQK N;  3AU5 A;  4NLC A;  3SJH A;  2P9S A;  3MCP A;  3F5T A;  2P9I A;  4CZL A;  3BF3 A;  4BRC A;  4EFH A;  2ZGY A;  1R59 O;  1YXQ A;  5KPT A;  1BO5 O;  4HDQ A;  1Q86 O;  4CBU A;  2GWK A;  2HF3 A;  2RE2 A;  5KPR A;  1Q82 O;  3QB0 A;  5AZI A;  1VQ4 N;  1N8R O;  4M7Y A;  3CET A;  4JK7 A;  4JK8 A;  1MIX A;  3TU5 A;  1DIK A;  4WQ5 A;  1RGI A;  1Y19 B;  2ASP A;  1K9M O;  1LOT B;  4MDB A;  5GAD P;  2RHK A;  3KK7 A;  2A5X A;  3VEZ A;  3BF1 A;  5M1K A;  1J6Z A;  1K8K A;  2D10 A;  3HM8 A;  3ULE B;  4F9O A;  3F2K A;  3QIC A;  3E9O A;  4FPA A;  1YHQ N;  4WFB L;  1KAX A;  1E4G T;  4EKU A;  3D6R A;  3CXC M;  3WXM B;  1ILY A;  3VGM A;  4BR0 A;  2YJE A;  1SQK A;  4GV6 A;  3G6E N;  2FXU A;  3W3D A;  3DWL A;  3U4L A;  2HBM A;  1KD1 O;  4OPA A;  4UY8 O;  1IG8 A;  3FZH A;  1YI2 N;  1KBL A;  1D4X A;  3Q7B A;  4FWQ A;  3CCJ N;  1BDG A;  1YJN N;  1HPM A;  3HOS A;  2P9U B;  3D2E B;  1VAZ A;  1EF1 A;  3CJB A;  1NTI A;  2IVO A;  2VGM A;  3TTC A;  3O1W A;  3U9Z A;  3A5M C;  5JLH A;  5C0Y A;  2WC9 A;  4O8U A;  2GTD A;  3ZX0 A;  3U8X A;  2IVN A;  5AQI A;  3CI5 A;  2AL6 A;  2AP1 A;  3O5B A;  3O9T A;  3AGR A;  4ISG A;  1TYQ B;  2P9K B;  3UKU B;  3VGL A;  3CD6 N;  2AEH A;  5AZJ B;  3K9J A;  1BA1 A;  2P9N A;  3O08 A;  4FWS A;  1SAZ A;  3P4I A;  3DXK A;  3K9K A;  4IEE A;  2DIK A;  4EHU A;  3CF5 L;  3CJC A;  4H0T B;  4PKI A;  2Q31 A;  5ADX H;  2IVP A;  2FLO A;  1OVY A;  5ELZ A;  1HKG A;  3R8E A;  1MWK A;  1Q7Y O;  5LJV A;  2PBD A;  1GLB G;  4KH6 A;  3CJA A;  1VQ9 N;  4BR4 A;  3FZL A;  4A5A A;  1H4R A;  3M5R A;  2QWP A;  1V4S A;  3GOI A;  2JWL A;  2KLA A;  5EX5 A;  4BRQ A;  2KHO A;  4BRK A;  2WBN A;  4QS8 A;  3EE8 A;  3BEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...