4JKAA

Open and closed forms of r1865a human prp8 rnase h-like domain with bound co ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
b'LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkaA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkaA01
3SBTA 4ILHA 4JKAA 4JK7A 3E9PA 4JK9A 4ILJA 3ENBA 4JKEA 3E9OA 4JKBA 4JKFA 4JKDA 3E66A 3SBGA 4JKCA 4JK8A 4JKHA 4JKGB 4JKGA 3E9LA 4ILGB
chains in the Genus database with same CATH superfamily
1KXPA 4X66K 4FLVA 3MCPA 1ASUA 3CCVN 1P90A 3TSQA 4CESA 1NK8A 4IOXA 1QVGM 4XH1A 3U3YA 3L2WA 5KRSA 3R9PA 4K43A 1OH5A 3VN5A 5AZIB 3DWLA 4B8AB 1MU2A 2FF6A 1QS4A 2WC9A 3EKSA 2OZMA 3PIOL 4CHOA 4JKFA 4H0OA 1W2BM 4FOIA 3QFUA 4BRLA 3C0BA 3CJ7A 4FK0A 4DQQA 4DSFA 2HHQA 3K5NA 3LPUA 4JI0K 5AQQA 4FWLA 1DEJA 1TK8A 1RFQA 2FBXA 2UXCK 4FM2A 2Q0UA 4KTZA 4PY5A 4FJ9A 1RBSA 1OVYA 4DV0K 3CJ1A 4GV3A 3SUQA 1T7PA 4CZHA 2O8CB 3ZSRA 4ISGA 5LY3A 4TKNA 2XY8A 1KAXA 3TAQA 3NVMA 5BR9A 5HL7L 2XY5A 4CK3A 4IKFA 1Y64A 3UKUA 3VA3A 4MO4A 4W5RA 2D4WA 3VQ4A 2COPA 1TGOA 4CK1A 4MO5A 3U9ZA 3LANA 4LFAK 3LZIA 1KSPA 1WLJA 3O9SA 2IOCA 5AFUA 1QQNA 3H3NO 4CZMA 4CFBA 3BF3A 3QFPA 3H08A 2E1YA 4DTOA 1ATNA 4H0XB 3TTCA 4B9TA 3LZJA 2ASMA 2VWJA 2YHAA 2CGLA 2Q2RA 4JI8K 3HPHA 4ID5A 2EWSA 1S22A 2NRTA 5FLXO 4CFDA 3SYZA 1BOTO 2P9SB 4WYBA 4FLYA 3S41A 4JI3K 1BGXT 1S3XA 2A41A 4EP5A 4DR5K 3TR8A 1RDBA 4I7FA 1IG8A 1WBDA 3AVGA 4H5TA 4BY9C 1RBTA 3E9LA 5LJWA 4KHNA 4KREA 3QBWA 4CZKA 1WSIA 3JXUA 2F8SA 5AQUA 5AQYA 5HRPA 3T1YK 4H0TB 2DFEA 2YVCA 5SZTA 4RG8A 4J2EA 2HVHA 4FCYA 1RDAA 4YY3K 3MWTA 3EO3A 5AQMA 1FJGK 5A2QO 1X3NA 3LDOA 2HF3A 3U3GA 4EP4A 3PLAA 4CD1A 1NOZA 4BRNA 3O1WA 3CCSN 4FK2A 4LH5A 4KTWA 3ZYYX 1VQMN 4OKJA 4Y0WA 5JMVA 3KLEA 2A6AA 4EHUA 1NU0A 2CQUA 1W97L 3D45A 3UB5A 3VGKA 1D8YA 3O3FA 1K6YA 1HNVA 3LAMA 2J0JA 3QIPA 3THXA 2G8IA 5CHIA 2D0CA 1HLUA 1KQSM 4DF8A 4BRGA 3NCIA 3SQ2A 4PA1A 4BR2A 1HJOA 3FZLA 4CF8A 1CXUA 5AZJA 4E89A 2IC3A 1NGGA 5LL6Z 4DFMA 4ID1A 4DLGA 4OLAA 5AQSA 5JVGL 3BGRA 3DLEA 3L3VA 4B3MK 3WXIA 3L0QA 4MQ3A 5LJVA 1DTQA 2QKKA 3ATVA 4JK8A 4MDAA 4IDKA 1QSLA 4KH5A 2OTJN 3L2UA 3IS9A 3AVHA 4KHWA 1C0TA 2PY5A 3NGZA 1YUWA 4NCGA 5AQVA 4E1MA 4H5NA 3ZX0A 1BA1A 3MEGA 4Z4HA 3SZ2A 1SS6A 3QB0A 4FJNA 1BISA 2UUAK 4IOAL 4NY0A 3DJCA 3U4LA 1KD1O 2V7YA 4FSVA 4KPYA 2KZZA 3KJVA 3CXCM 3G0ZA 3QESA 3AGRA 4Q5VA 4DHYA 3ZEUA 1S9EA 2YHWA 1VSLA 2IS3A 4BC3A 3M8RA 5C10A 4BRPA 1RTDA 3N4PA 3P83D 1X1PA 4BRQA 3C6HA 3SAHA 4JD2B 3L3UA 2HB5A 3RSEA 1S1UA 4DR1K 2KZMA 3UKRB 4FWSA 4PL7A 3V1RA 4HCBA 5EVZA 2F7TA 1RDUA 4JKEA 1RDDA 2VWBA 3VQBA 2UUBK 2QWLA 4C8MA 2HOEA 1T05A 1EXQA 4DTXA 3S3NA 1KVCA 3VEVA 3DXKB 3I56N 3D2EA 1WSHA 2A3ZA 4IZ9A 1JLBA 1TUYA 4ISFA 1WSEA 3QO9A 1MIZB 2E88A 1Z26A 4OX9K 4LH4A 1RDWX 4B1WB 3F73A 1WOQA 3ZSVA 3HVRA 2O8DB 3ID6A 3ZETB 2P5GA 3O6WA 3R1XA 4CHZA 5AQTA 5M1KA 2P9UA 1GC7A 3NF6A 4CJFA 3AU5A 3K59A 4AH9A 3TWHA 3CG7A 4ZRIA 1N5YA 4JHDB 4FLUA 3A5NC 3NHGA 4KRFA 2CH6A 5C25A 4AF1A 5FPDA 1WSFA 1SKSA 1JL2A 5FROA 1UAXA 2P9KA 2W6KA 3GBTA 4BC5A 4WFBL 3O1BA 3WQUA 4BQZA 1TVRA 4FWPA 4CGIA 3HO1A 3WQTA 4YORA 2VGMA 3ALYA 1VQLN 1MK9B 2F9TA 4JI1K 5JICA 5M1NA 3GDQA 3CD6N 3MXMA 2P9LB 1NK0A 5C42A 2DPNA 4HCCA 1U4BA 3CHWA 1HMVA 3O08A 4IFEA 3V9ZA 4JKBA 3MN6A 2XY7A 1HYVA 4H5WA 4O5FA 4B1XB 3O80A 5M1PA 3CC2N 1QZ5A 5GIPA 3NE6A 2G8KA 2EHGA 1VQKN 4AHCA 3ULEB 3FLCO 3OYKA 2UXDK 2HF4A 3V6DA 2OPPA 3NFAA 2E2PA 4W5TA 3QINA 2HHXA 2Z1JA 3VOVA 3JS6A 4OGEA 4HUFA 4BRFA 3CJCA 2CB8A 2BUPA 1VHXA 5BR8K 1E4GT 4JKAA 4IWVA 4AHTA 5IWAK 1EF1A 2HVIA 3SQ1A 2LSNA 3QBXA 3TAPA 2BH1A 4M3XA 4KHQA 2OYQA 1FKOA 2UXBK 4DSKA 3C95A 1JXEA 2D5RA 1JXBA 3CF5L 1C1AA 4B9LA 3MWPA 3KIOA 3AVNA 2OTLN 1WAFA 5LMNK 1A5XA 4JRQA 1YXQA 3EPYA 4K8XA 1GLBG 3P5JA 4JN4A 3HPGA 5C2FA 1BQNA 4DS5A 3VA0A 5AFUH 4GNIA 1X9MA 5AR0A 2HW3A 2KHOA 1REVA 1GLJO 2RN2A 3ZDTA 4DXAB 1NVLA 1U2VA 4NLCA 4N5SA 2A40A 4LF4K 4E7KA 3ENHA 3KK7A 1BI4A 2FXUA 3AVFA 1NBWA 5K14A 3DXMB 4M7XA 4YHHK 2NRXA 4FWQA 1JLEA 4QOZB 3A5MC 5TKWA 4GMJB 4KB0A 2E2QA 1GLEG 5KRTA 1HYSA 2FSJA 3ZT3A 4FJJA 1XNQK 3VESA 4DSIA 3O3GA 2KKZA 3V9SA 1IKXA 1QHTA 1MDUB 5HLFA 4Z0UA 2HBJA 1U04A 3LPTA 1S6PA 1YI2N 1J54A 2F4VK 2HHHK 1F21A 2GWJA 1V4SA 3TAEA 3PIPL 3TAGA 1RT7A 3J8AA 4IJNA 1XUPO 3EN9A 3IKMA 3VEYA 2KW4A 3IAYA 2X78A 1RBUA 3PVLA 1JJ2M 2YNFA 2VG7A 3FR0A 3ZLJA 2KLAA 3EYZA 1S6QA 3AV9A 2PYJA 4H0YB 3G71N 3FFKB 4JS5A 3F9MA 4H4OA 2O4IA 3FFIA 3HSTB 3SAGA 4FJ5A 2X74A 4BR5A 1EWRA 1KFDA 3KLGA 4I6MB 3K9KA 1J53A 2QKBA 3SJJA 4B8CA 4F4KA 4BDYA 4KH4A 5HP1A 3EE8A 3OJUA 2FF3B 1XNRK 1IH7A 1QTMA 2A1RA 3OYFA 3QIJA 1BIZA 1YIJN 4OPKA 2I1JA 3UKUB 3VERA 3G25A 5HROA 2P9PA 2D2QA 4HDQA 4CZEA 4K42A 3AGKA 4JK9A 4EFHA 3GL1A 4H4MA 3A2FA 4CJ4A 1W0HA 3SMSA 1EETA 4BREA 4W5OA 4FLWA 1TK0A 4LF6K 2P9NA 1MIXA 2JLEA 1NLVA 1ZBUA 2E6MA 3OHRA 4KTQA 1VBHA 4JAXA 2D10A 3B6PA 5HOOA 1ZBHA 3NH1A 1YJ9N 2BTFA 4CJ5A 3R3LA 2HHUA 1NJIO 4DV3K 4FVMA 4LSNA 1LWCA 3EEQA 2FC0A 5AQLA 4Z4IA 2YNIA 2F96A 3K5OA 1NKBA 3E9OA 1GGOA 4RCHA 3AO1A 4CF0A 4YDUC 1XMOK 1VQPN 4O0JA 4HUEA 3VQDA 4DG1A 3VQ5A 3AO5A 5KPRA 3LWLA 4NCBA 4ZTFA 2FSNA 4Z94A 3ITHA 1NG9A 4MLEA 1S9GA 2IVNA 4AM6A 2WTUA 4M63C 4U7BA 2HNYA 1VQ6N 3LDPA 4DTRA 3VQQA 5ELZA 4A57A 1UWBA 3QNNA 4W5QA 3LDQA 4YOTA 5AQKA 1DTTA 1S1TA 4G1QA 3K0SA 4AQYK 1C1BA 3SLCA 1VQ9N 4F2RA 5GAEP 3HI0A 3I0SA 4CHYA 4BE0A 1G99A 5DM7L 2W41A 4NYFA 4KB1A 1ST7A 2QWQA 3BP8A 1NJYA 1H1VA 3THXB 4CEDA 3NGYA 1SAZA 4KHUA 3QLHA 4NB4A 4DTMA 4PQUA 3EKUA 3P39A 5AZJB 4M45A 2I1KA 1BL3A 3LWMA 4FZZA 1WUAA 5BREA 2HRJA 1LW0A 4BC2A 3QERA 1TYQB 5EXWA 2HNZA 4DV5K 1EWQA 1OH7A 1YITN 1DLOA 4CVNE 2Z1HA 2ZJPL 1VQON 3T1AA 4I6MA 3ZSOA 3O9RA 1JLGA 3FE1A 3P1GA 3DLHA 3PSFA 4B1ZA 4CJRA 2Y1JA 2VG6A 3SQ4A 2FBTA 1D9FA 4BVPA 2E20A 1S1XA 4YFUA 4DR2K 2IAJA 3VQPA 3H1QA 4FL9A 3QETA 4NO7A 4DUZK 4PWDA 4BG8A 1J5OA 3RR8A 1IBMK 3ZEUB 2QEXN 1VSFA 2ITGA 1J5EK 5AQRA 1DGKN 3T19A 3IG1A 1IO2A 4QAGA 3RSEB 4J2AA 4YOWA 3OJSA 2G8FA 4CF1A 4IG0A 3MN5A 1YJWN 1O1WA 1YAGA 3PO5A 4DF4A 4M41A 4DV4K 1K9MO 4CJ7A 1VRTA 2Q97A 1KAYA 1UA1A 4A59A 1QHAA 3UE5A 4IJAA 3RTVA 4I2PA 4M42A 3SUNA 4BRIA 3KKSA 2I7NA 3QEWA 1NWKA 3C6UA 3D2EB 4B1VA 4BR7A 5CE3A 4DQ8A 1BUPA 3W3DA 3O3HA 3M1FA 2NNWA 5KPTA 2WUSA 3SQ0A 4A62A 4BDPA 3AO2A 4ILJA 3MX5A 5F2RA 2WH5A 3G4SN 3WXLA 4NLBA 1UA0A 3HL8A 3V4IA 3A8YA 2ZM6K 1D9DA 5B8HA 4DR4K 2P9UB 3AA3A 3BY5A 3CQXA 4H5RA 4WQ5A 1VRUA 4BR9A 4Z4EA 4B9SA 2P51A 1ZXOA 4K0KK 2Q31A 4FJKA 5M1FA 4IDHA 4YOUA 3OYCA 4A5AA 2ZF5O 4IG3A 4BR0A 3TAFA 2P9KB 3ZSYA 3BDPA 2KQ2A 5FRMA 3I8DA 4JLHA 3BZCA 5FDLA 5JS1A 5BRHA 2O8EA 3V9XA 1NKEA 4QS9A 3DI6A 1RT5A 4KI4A 3OTOK 3AVIA 2HMPA 3HM9A 1TL1A 1QSSA 1Y97A 1SGHA 1D4XA 3LL3A 3AVLA 2B4JA 2QXFA 1Q86O 4FJIA 1YTAA 1TYQA 3H45C 4C8LA 1BG3A 1CZBA 1CZAN 3EL2A 4MFBA 5KTQA 4DQSA 4N47A 3OYDA 5DMRA 1GLDG 3TANA 3IUCA 1N36K 5D3GA 3S3MA 3FGUA 2VYPA 2QWNA 4PUOA 1T8EA 4W5NA 3RWUA 2AJQA 2D0BA 1VSDA 3F2KA 3JAMO 2YHYA 2W6LA 2E8AA 2IVPA 3DLBA 4FZXC 2O8BA 3R6MA 2YV0X 3U9DA 5CYQA 5AQWA 4LFBK 4NXNK 5BRDA 3CPWM 3CCLN 1S1VA 3CCJN 4YL8A 4J8FA 3PY8A 1HPMA 4H5VA 1SKRA 3BZKA 1LAWA 4V19S 1N33K 2PAVA 4GV9A 3TPQA 1JLQA 5E41A 3H1VX 4N56A 4KHPK 4KHYA 2ZWHA 1NMNA 5CZ2A 2QA4N 4IBNA 3VEOA 2GELA 3L4QA 3AVBA 3O4WA 1E4FT 3VQAA 4CYEA 2UYTA 2HE7A 1TL3A 1IBKK 2XY6A 5EY4A 3E1YA 2AA4A 2YHXA 3T3FA 4CJ3A 3CM6A 4OO1J 4IO8A 1VK0A 4FVUA 1Y19B 4CGHA 5BN8A 4CEBA 5LMUK 3M6GA 1U2VB 3LP2A 4JKGA 5EOYA 1XQSC 4ISEA 1BI4B 3FLVA 3J80O 1RILA 3O9QA 3TABA 4ICLA 4M3RA 4O5BA 3CQYA 3MXIA 3SUOA 2ZJRL 4IEEA 3PO4A 1P8ZA 1HNXK 3VENA 1B92A 3SV3A 4BQLA 5AQXA 3G6EN 4EZ6A 2GWKA 1GOAA 3PZDA 1MWKA 2EMSA 3WEEA 1U48A 1NJXA 4DLEA 2QW9A 1JCFA 1WSGA 3OVNA 4OKKA 3HPOA 3BUZB 1E3MA 4CF2A 3ZX3A 2YX6A 1EO1A 4OVLA 2YJFA 3SMPA 4DTUA 2DY4A 1CXQA 4BC4A 1NGJA 4M3YA 4KO0A 3SNNA 1FXXA 4FM1A 2QWMA 5KI6A 1KFSA 1YHQN 1C0UA 3DRRA 4X62K 4FK4A 1HB6A 4O44A 4F3OA 3KLFA 4X64K 3D2FB 1OH6A 3ZSZA 2OZSA 4FWNA 4FJXA 1FW6A 1BWFO 4CFAA 5CY4A 1NK9A 4L8RB 4M3ZA 4JEPA 3NF7A 4QS8A 2OCEA 3KD5E 1U47A 1C0MA 2E5LK 1GOCA 1SL1A 4DB3A 4CIEA 4M3TA 1K8AO 4HTUA 1LCUA 3M8QA 2WONA 3VTIA 2Z1IA 1FKPA 1HQUA 3WUHA 1VSHA 3DLLL 2P9PB 3L6QA 3D6RA 3HK2A 1N32K 2QWPA 3MAQA 4B9VA 5J1EA 1NNEA 1ZBIA 4E0DA 2P9NB 4ZRKA 1L3UA 5BPLA 1N6QA 3QMLA 2QTDA 3RR7A 5T7BA 3NDKA 2G8HA 4BRHA 1WBBA 1VQ7N 4FXDA 3CC7N 1RT1A 2RHKA 4XEIA 4XH4A 4CZFA 1NK6A 1XHZA 1QQOA 3A0IX 1WB9A 3L4IA 2PZSA 3VETA 1S1WA 3D7EO 2UUCK 4I9QA 4DUYK 3LDLA 3C6TA 2GX9A 4JNEA 3WNHA 4HUGA 2F9WA 1RT4A 4YOYA 3CFRA 5FPNA 4ILGB 3TTFA 2NRVA 4DQIA 1HJRA 4CZJA 4O8KA 2D0OA 4H03B 4CJUA 3CCMN 5FRNA 1V4TA 3CCRN 4OJRA 4KI6A 3RVCA 1DKGD 4NYNA 2BANA 4JV5K 4CZLA 2FJ9A 2Y1IA 3DRSA 3T1HK 4ELTA 3L8BA 3E66A 4JKCA 4Z4CA 3AVMA 2DIKA 3KK1A 1ZC6A 5BPMA 2HNDA 4DTNA 3B6OA 1J9AA 2NRWA 2E4LA 3J7YP 5IJMA 4KKOA 3KTQA 3UIQA 2A42A 4C23A 2JGUA 4JYAK 2Q1NA 2FLOA 3DM2A 1JLCA 4NXMK 4CEOA 4CD3A 3OS1A 3VGMA 3CFOA 3WNGA 3CCEN 3QEXA 1L3VA 1B9DA 3V9UA 1M90O 4JKDA 3IMXA 2P5OA 3U8ZA 3MEEA 3PUFA 3H46O 3AO4A 3E01A 2IDOA 2NZTA 4Q0BA 4CFCA 4WF9L 3D2FA 4OLBA 1IV0A 2OPSA 3SAFA 4CGDA 2CGJA 4O4GA 4AHRA 4CERA 2HSTA 1GLAG 4LF7K 3HP6A 3CI5A 4CHQA 2X6NA 3NMUA 2EX3A 1IG9A 4JI4K 3SCXA 5SWMA 1Z6RA 3GOIA 3ZSWA 1NI2A 1JL1A 4DFJA 3PV8A 2IVOA 2O8FB 3QEIA 3QNOA 4KH6A 1LAVA 4CHNA 4M3UA 3VQEA 1TKDA 1TKTA 5GINA 4DQPA 4FZYA 1I39A 1RCHA 4Z4GA 1ZYQA 1LW2A 3ZCMA 4DR6K 4E7JA 3OYBA 3MMVA 1L3SA 2JWLA 3O8MA 1Q9XA 3VQ8A 3QICA 3VF6A 4YNQA 3OS2A 1KTQA 1QVFM 3MDQA 4JI6K 4RW9A 4FLZA 2OA8A 4L3QA 3O9UA 3DLGA 1HRHA 3KLHA 2YNHA 2HBKA 3QDKA 4WFAL 3J7AP 2R82A 4N76A 4HTLA 3P4IA 2GV9A 3QEPA 5H1SQ 1Q82O 3V81A 2FDQA 1ATSA 2KTQA 3VGLA 3TSUA 3AA4A 2AL6A 2D1KA 1JCGA 1YVUA 2OANA 4DR7K 3VQCA 1RDCA 1SUQA 1OH8A 4B9NA 4CJEA 1ILYA 1GC6A 3LALA 4CJTA 1RGIA 1U45A 1Q8IA 1EQYA 4RW6A 1BQMA 3VF4A 4BG9A 3SUPA 2QXLA 4LSLA 4RW4A 2E6LA 3QIOA 5AQPA 2X6SA 2ZGYA 3MEDA 3T7ZA 4FLXA 3HJFA 1QQMA 3THYA 3WNEA 3JSMA 1T3VA 1TKXA 2PBDA 3C6AA 4UY8O 2DFFA 3HT3A 4MLHA 1U6ZA 3KZBA 3CJAA 1WNSA 3LM2A 4CF9A 4H8KA 3ISNC 1SQKA 1IKWA 1X9JA 4Z4FA 3ENBA 1Q18A 1SV5A 3U6FA 4IO9L 1X9WA 2AEHA 1T03A 1JCEA 3RMAA 1YF5L 3H6EA 4OKEA 4DTJA 3HXMA 2O8EB 1JDEA 4CEFA 2DTUA 1R59O 1N34K 4DV1K 2KFZA 4FJGA 4CJLA 3MX2A 3VMFB 3VEZA 2RQ1A 4DFKA 2EMTA 3LP0A 3NGIA 1ACAA 3GG4A 3THVA 3VF2A 5CR4A 3K57A 1MWMA 3AVAA 3I33A 1O13A 5C12A 3SV4A 1VQNN 3AY9A 2YCHA 2NUBA 2Q3SA 1NGAA 5KPZA 1ITGA 4KFBA 3IRXA 2GUIA 3ZT0A 4GVEA 3AAPA 3FZKA 4CW7B 2J0KA 5AQJA 1B9FA 3WNFA 1A5WA 2ZQBA 4Y1CA 2QWOA 2X0SA 1ZBLA 4CE9A 5DK5A 5HRSA 3AAQA 1XC3A 3V1QA 1WAJA 2O8FA 1TKZA 1BDGA 1ASWA 5F0XA 4B3RK 4BRDA 5ADXA 4J2DA 3DYAA 4JRPA 1Q7YO 3VEWA 3OYHA 1TUUA 1SL0A 2O8BB 3M8PA 2CH5A 1VSIA 3DRPA 1NGFA 1RTHA 4LD0A 2G8UA 4B3TK 1K8KA 1GOBA 3J81O 1HX1A 4E3SA 1RNHA 2RE2A 2FSKA 4FW2A 3THWB 3HSCA 3O9TA 1QSYA 1HKBA 3DMJA 3BEXA 4BRCA 3KWGA 4A61A 4JI7K 3L2RA 3HRGA 3JYTA 4A5BA 3C65A 4MDBA 1QQCA 1JKHA 2GTDA 3C7NA 3CYMA 4P7IA 4GY2B 2I5JA 4RWTA 5DM6L 2PFUA 4AHSA 4OPAA 5TKYA 2E1ZA 5AQNA 3KD1E 2D11A 4CJWA 1E5WA 1NGIA 1IKVA 1NK7A 1YTUA 1H4RA 5EX5A 1KAZA 3J7ZO 2VCPA 2ZE2A 4CJVA 4CHPA 5J2MA 2I7PA 3SK3A 4WQ5C 2ASPA 1I3AA 4RTFD 1Q9YA 4JKGB 1XMQK 2HHWA 1T44A 5IT9O 4CBWA 4CZIA 1ASVA 4DWIA 1Z05A 2B5JA 3K5LA 1YT3A 5KQDA 3KK3A 3RRHA 4PL8A 1J19A 4AM7A 5AQIA 4K41A 4OPHA 4BE2A 1HYZA 2P1JA 4DQRA 3CJ9A 1L5UA 4C1NK 5M1OA 4CGJA 3MECA 3SPYA 4DKWA 3MN7A 4QCLA 1X3MA 3HTVA 3CMEN 1KC8O 3L2QA 1SKWA 2P9IB 1IKYA 3M8SA 4J2BA 2ATQA 4DCHA 1J6ZA 5AQGA 3WEEB 2VQFK 1NGHA 3HZ6A 1LOTB 5JVHL 2UU9K 4CJQA 3W0LA 4F2SA 4OPJA 2E2OA 4HVJA 4AILC 1NM1A 3CERA 1MA9B 5E84A 4CJPA 5AZIA 1NGDA 3SI6A 5GIOA 4DSEA 3F9KA 3Q7CA 1YJNN 1VQ4N 4WQ4C 3DOLA 3EY1A 4LY7A 3NVKA 3SPZA 1TK5A 3WXKA 4WQ4A 2V52B 3VQ9A 4H0VB 1VQ5N 4C8KA 3CC4N 1Z25A 3BF1A 5I9EB 4HHTA 4XH5A 4ZRJA 3DLRA 2YI1A 1KLMA 3PX4A 2NRHA 4FWKA 3OYJA 4DV6K 3OYMA 4BVOA 3L2VA 2XRIA 4RW7A 4CZGA 1WN7A 3AVJA 2NLXA 4C8NA 3TSPA 3PX0A 2O8CA 4KBOA 5AQHA 1KC7A 3IFRA 1EX4A 2AP1A 3A5LC 3DLKA 4X65K 3OBWA 1TV6A 4RW8A 4Y1DA 5E26A 3PX6A 3ATUA 1NTIA 1X9SA 4FYDA 4FO0A 3TTDA 1JLFA 3THWA 3LP1A 3U8XA 1VQ8N 4PHTX 1IBLK 2DFHA 1TAQA 3EZWA 2D0AA 1KRPA 3VQ6A 2Q36A 3MN9A 3HOSA 4FWRA 2QI2A 4BWJA 3AU4A 3NAEA 5JLFA 3TAMA 1LWEA 4CIGA 5BN9A 2IGIA 4B08A 5FPEA 4BACA 4PKGA 5I42A 3H3OB 2NRRA 4FJLA 3N4QA 4BE1A 4BRMA 1LWFA 4FPAA 2A5XA 2F8TA 3ZT1A 2P9SA 2ASOA 3HYFA 2HMIA 1HKGA 4EIAA 4FW1A 2ITMA 3OYIA 1NK4A 1NJZA 4PKHA 4LF9K 3VPZA 4QS7A 2XHBA 4FPBA 3RMDA 3OYNA 3KLIA 4FM0A 1BIUA 2YHBA 1RTIA 4K8ZA 4KHSA 3FZMA 2VG5A 2VQEK 2YKNA 4GKKK 4IXCA 4CEEA 3ULDA 1HQEA 3M5RA 2ZD1A 2A1SA 3ZSQA 5I3UA 2VGNA 2JWKA 4ZTJA 4IOCL 1HNIA 4O55A 1HPZA 4BGBA 4JKHA 1NGEA 1NGCA 4JS4A 2P9IA 5FPMA 3EZ5A 4B9QA 4CIFA 4CGGA 5JVLA 1KVBA 2LBBA 3Q7BA 1XHXA 1VSJA 3IVFA 3F5TA 4GV6A 4AHUA 1XC9A 1KBLA 1BO5O 2Q0RA 5C15A 4FJ7A 2B6AA 4BRKA 3LP3A 1W7AA 4KAZA 1ESVA 3A5OC 3AVKA 5GADP 4TSXA 3KVGA 1C0GA 2HBMA 1A5VA 3KKRA 4JI2K 2GBZA 3K9JA 2QM1A 4CEZA 3ZT4A 3OY9A 4JK7A 3OYLA 4DV7K 3P38A 1VSKA 2BE2A 3ZX2A 3T69A 2HBLA 4PKIA 3P31A 4F3TA 4O8UA 1GG3A 1RT2A 1VAZA 1GLLO 4LF8K 3D0PA 2BDPA 5HRNA 1VSMA 5GAGP 2RKIA 3G10A 1BA0A 4A2AA 4LFCK 4WCEL 2BGGA 3CMAN 1NOYA 1C0FA 3LDNA 4CJKA 1JLAA 1HNZK 2WBNA 3G9WA 4GVMA 3WXMB 2HHTA 4DSLA 3AARA 5KGWA 5AJ3K 2KFNA 2PYLA 4DU1A 4FJMA 3V9WA 4FLTA 1HKCA 4DU4A 3HVTA 5F1XA 4XIUA 5BRFA 1MK7B 4FWMA 5KGXA 3OYAA 4DSJA 2O4GA 4E7IA 4CGFA 4JD2A 3K58A 1Q81O 4B3OA 5ADXH 3UKRA 4CEQA 5AQOA 5J2NA 1BHLA 4K25A 4R79A 4ELUA 2HHSA 5C0YA 1HB8A 3WXJA 1U49A 1SZ2A 3KWIA 1KLNA 3S3OA 1QZ6A 2GUPA 1RT3A 3ZSXA 1C1CA 2E2NA 3RMCA 3TI0A 3I0RA 3X23A 4M7YA 4EKUA 3I55N 4F7GA 1RBVA 3R8EA 4B1UB 3SBTA 1M1KO 4LC9B 3DXKA 3HM8A 5C2DA 2G8WA 2CGKA 4EHTA 3AA2A 1ZBSA 1BCMA 3CJBA 4BR4A 2HHVA 1OVQA 4O0IA 1S5JA 3M3ZA 4NCAA 3VTHA 4C1NI 3TARA 3I8BA 3FZFA 4B9UA 5AQFA 1HUXA 2YNGA 3CIPA 5JLHA 4M3WA 3ZETA 3ASMA 2O8DA 1EP4A 4DTPA 4FWOA 3THYB 1HNWK 3WT0A 4CK2A 3K5MA 1T6CA 4YOXA 4B1YB 4ELVA 2QK9A 1GLCG 4DU3A 1XI1A 4WFNL 5MLCQ 4B3SK 1ZBFA 1DIKA 4JHDA 1DT9A 2R7YA 4U67L 4EAHD 1W9HA 4KV8A 3VEXA 4YOVA 2YKMA 2YJEA 5KQ8A 5J2QA 3U7DA 3MXJA 3SBGA 3CPEA 3TU5A 4GW6A 1UOCA 1HR0K 1BU6O 3NH0A 1T6DA 2V7ZA 1RBRA 3B8AX 4G9ZA 4IFVA 3ENOA 3KHYA 1K73O 1RTJA 4CI6A 1RT6A 1C6VA 3CM5A 2OPRA 5J2PA 2G8VA 4JI5K 1LV5A 2P9LA 3MK6A 3GE1A 5AQZA 3AO3A 4BROA 4E7LA 1NJWA 3O4QA 5CZ1A 3CQ8A 3QEVA 2XO7A 1NMDA 3BINA 4B9MA 4E7HA 1IJJA 3KK2A 3MCAB 2OPQA 2V51B 1CZ9A 4FJ8A 1ATRA 2RPIA 3NH2A 4HWIA 3V1OA 3ULEA 2IIRA 1OKJA 3NF8A 2QWRA 1S72N 4H0PA 4DMNA 4GKJK 1NGBA 4N41A 3O4NA 3HBTA 4EZ9A 3OS0A 1TAUA 1XWLA 2H3GX 1QE1A 1SL2A 4E19A 3AVCA 3WA0A 4CECA 1N8RO 2ZPYA 2GEMA 3RRGA 2FBVA 1K8KB 3LAKA 4I9LA 4OGCA 3EE9A 1KCFA 2ZJQL 4BWMA 4F8RA 3CCQN 4ILHA 4DTSA 4ZHRA 5C24A 4CJSA 3E9PA 3OW2M 4I2QA 1EKEA 3CCUN 4FJHA 5M1QA 2ABDA 4BRAA 3ZT2A 3OYGA 3O5BA 3NF9A 3LDSA 1KVAA 2WFBA 3DAWA 2Z1GA 1G15A 4BDZA 3OBYA 3C7NB 2WOMA 4HDOA 4IEIA 3DOKA 1NKCA 4DV2K 3ID8A 3S9HA 1CLQA 2NRZA 4UQGA 5BPNA 2W42A 3RMBA 4FOEA 2ETJA 2RF2A 5EU7A 3CFPA 4WE1A 4A2BA 3PSIA 3VQ7A 2ZGZA 2W40A 3FP5A 1YVNA 2D0PA 1D5AA 1ISNA 3HP9A 4E1JA 1FK9A 4CBXA 3CETA 1VSEA 3OYEA 4DR3K 4CBUA 1BCOA 3HOTA 1NK5A 1L3TA 4IFYA 2J0MA 4DS4A 2J4RA 5HRRA 4YDUA 1WSJA 3OA9A 4CEAA 4DFPA 3DXMA 4LF5K 2VWKA 1VBGA 3LM9A 4F9OA 4CCHA 1HBKA 4C8OA 4GXBA 4BGAA 3C94A 3SJHA 5CYMA 3NBPA 3IDHA 1GLFO 2FBYA 3FZHA 3AA5X 4R5PA 4AHVA 5GAHP 1I94K 5HBMA 1R0AA 4E1NA 5JS2A 3K2PA
chains in the Genus database with same CATH topology
1KXPA 1NGHA 3WEEA 1YI2N 3HZ6A 1LOTB 2QW9A 1JCFA 3MCPA 5JVHL 3CCVN 3W0LA 1P90A 3TSQA 1QVGM 4IOXA 2E2OA 4XH1A 2GWJA 3BUZB 1V4SA 5C0YA 1NM1A 3PIPL 3CERA 3J8AA 3R9PA 4K43A 4IJNA 2YX6A 3ZX3A 5CE3A 1MA9B 1EO1A 1XUPO 5E84A 5AZIB 2YJFA 3DWLA 3EN9A 3SMPA 5AZIA 1NGDA 3IKMA 3VEYA 2FF6A 5GIOA 4BC4A 2WC9A 1NGJA 3EKSA 3Q7CA 3PIOL 1YJNN 4WQ4C 1VQ4N 4JKFA 4H0OA 3PVLA 1W2BM 1JJ2M 4FOIA 2QWMA 3NVKA 3QFUA 4BRLA 3FR0A 3C0BA 3CJ7A 3WXKA 1YHQN 2KLAA 2EMSA 1HB6A 4WQ4A 2V52B 4H0VB 5AQQA 1VQ5N 4FWLA 3D2FB 4H0YB 1DEJA 3VERA 3G71N 3FFKB 3BF1A 1RFQA 3CC4N 3F9MA 5I9EB 4FWNA 4XH5A 4ZRJA 2YI1A 2Q0UA 1BWFO 3SAGA 2NRHA 4FWKA 1OVYA 3CJ1A 4GV3A 4BR5A 4BVOA 4JEPA 4CZGA 4QS8A 4CZHA 4I6MB 3K9KA 2NLXA 3TSPA 4ISGA 4DB3A 4KH4A 4KBOA 3EE8A 5AQHA 5LY3A 4TKNA 1K8AO 1KC7A 1KAXA 3IFRA 1LCUA 2FF3B 3VTIA 3WUHA 2AP1A 3NVMA 5BR9A 3QIJA 3A5LC 5HL7L 3OBWA 3DLLL 1YIJN 2P9PB 3L6QA 2I1JA 1Y64A 5E26A 3G25A 3D6RA 3UKUB 3ATUA 1NTIA 2P9PA 2D2QA 4HDQA 4FO0A 3UKUA 4MO4A 4CZEA 4K42A 3AGKA 4JK9A 2D4WA 3TTDA 4EFHA 3GL1A 2QWPA 2COPA 4MO5A 3SMSA 3U9ZA 2P9NB 4ZRKA 3U8XA 4BREA 5BPLA 1VQ8N 2P9NA 3QMLA 4PHTX 2QTDA 3O9SA 1MIXA 5AFUA 1NLVA 1QQNA 3H3NO 3EZWA 4CZMA 3OHRA 3BF3A 3QFPA 2E1YA 2Q36A 3MN9A 4BRHA 3HOSA 1VBHA 4FWRA 2QI2A 1VQ7N 4JAXA 3CC7N 4CZFA 2RHKA 2D10A 3AU4A 1ATNA 4H0XB 4XEIA 4XH4A 5HOOA 3TTCA 5JLFA 5KQDA 1YJ9N 2BTFA 2ASMA 1QQOA 5BN9A 2CGLA 2Q2RA 3A0IX 3R3LA 5FPEA 1NJIO 4PKGA 2EWSA 3H3OB 1S22A 2NRTA 3L4IA 2NRRA 1K9MO 3VETA 3N4QA 4BRMA 1BOTO 3D7EO 4FPAA 5AQLA 2A5XA 2P9SB 4WYBA 3S41A 2P9SA 3LDLA 2ASOA 3E9OA 1GGOA 4RCHA 1S3XA 2A41A 2GX9A 1HKGA 4JNEA 1IG8A 4YDUC 4EIAA 2F9WA 2ITMA 1VQPN 4YOYA 4H5TA 4PKHA 4BY9C 3VPZA 4QS7A 5FPNA 4FPBA 3E9LA 5LJWA 4ILGB 3QBWA 5KPRA 4CZKA 3TTFA 2NRVA 2FSNA 3JXUA 4Z94A 4CZJA 4O8KA 2D0OA 5AQUA 4H03B 5AQYA 4MLEA 3FZMA 4AM6A 2IVNA 3CCMN 4H0TB 1V4TA 4IXCA 3CCRN 4M63C 2YVCA 4U7BA 3M5RA 3RVCA 1DKGD 1VQ6N 3LDPA 2VGNA 2FJ9A 2JWKA 4CZLA 3MWTA 3EO3A 5ELZA 5AQMA 4A57A 4IOCL 1X3NA 3E66A 4JKCA 4BGBA 4JKHA 1NGEA 2DIKA 3LDOA 2HF3A 1NGCA 1ZC6A 3LDQA 5AQKA 4YOTA 5BPMA 3PLAA 4CD1A 4BRNA 3O1WA 2P9IA 3CCSN 5FPMA 2NRWA 4B9QA 5IJMA 3ZYYX 5JVLA 1VQMN 2LBBA 3Q7BA 2A42A 4Y0WA 5JMVA 3SLCA 4C23A 3IVFA 3F5TA 4GV6A 1VQ9N 5GAEP 3HI0A 2Q1NA 2A6AA 4EHUA 2CQUA 1W97L 2FLOA 1KBLA 1G99A 1BO5O 3UB5A 3VGKA 4CD3A 2Q0RA 5C15A 5DM7L 3VGMA 3CCEN 2W41A 4BRKA 1ST7A 2QWQA 3BP8A 1ESVA 1M90O 4JKDA 1H1VA 2J0JA 3A5OC 3IMXA 3U8ZA 5GADP 3KVGA 1C0GA 1SAZA 2HBMA 5CHIA 1HLUA 4NB4A 1KQSM 4BRGA 3K9JA 3H46O 4BR2A 3EKUA 1HJOA 3P39A 2QM1A 3FZLA 2NZTA 5AZJB 5AZJA 4JK7A 2I1KA 3P38A 4WF9L 3ZX2A 3D2FA 3T69A 2HBLA 1NGGA 1WUAA 5BREA 2HRJA 3SAFA 4PKIA 5AQSA 3P31A 4BC2A 4O8UA 1TYQB 1GG3A 2CGJA 5EXWA 1VAZA 5JVGL 1GLLO 2HSTA 1GLAG 3WXIA 3L0QA 5LJVA 1YITN 3CI5A 3ATVA 4JK8A 4MDAA 2ZJPL 3NMUA 4KH5A 1VQON 5GAGP 2OTJN 4I6MA 4A2AA 1BA0A 3O9RA 3FE1A 4WCEL 1Z6RA 3GOIA 1NI2A 3CMAN 4B1ZA 2IVOA 1C0FA 1YUWA 3LDNA 2WBNA 5AQVA 4H5NA 3G9WA 3ZX0A 1BA1A 3WXMB 4KH6A 4BVPA 2E20A 1SS6A 3QB0A 3AARA 4IOAL 3H1QA 4FL9A 4NY0A 3DJCA 5GINA 3U4LA 1KD1O 2V7YA 4FSVA 4NO7A 1HKCA 4BG8A 3CXCM 3AGRA 3ZEUB 5F1XA 2QEXN 4DHYA 3ZEUA 5AQRA 2YHWA 5BRFA 1MK7B 4BC3A 5C10A 4BRPA 3MMVA 1DGKN 3N4PA 4FWMA 4BRQA 2JWLA 3O8MA 3C6HA 3QICA 3VF6A 3SAHA 4JD2B 1QVFM 3MDQA 3RSEB 4YOWA 4JD2A 3RSEA 3MN5A 1YJWN 1YAGA 3UKRB 1Q81O 4FWSA 3O9UA 4L3QA 5ADXH 3UKRA 4PL7A 5AQOA 2HBKA 5EVZA 2F7TA 4K25A 4R79A 1RDUA 3QDKA 4JKEA 4CJ7A 2Q97A 4WFAL 2R82A 1KAYA 2VWBA 4HTLA 3P4IA 1HB8A 3WXJA 4A59A 1QHAA 3UE5A 5H1SQ 4IJAA 1Q82O 1SZ2A 3KWIA 2QWLA 1QZ6A 2GUPA 2FDQA 1ATSA 2HOEA 4BRIA 3VGLA 2E2NA 3TSUA 3X23A 4M7YA 2I7NA 4EKUA 1NWKA 3I55N 3D2EB 4F7GA 2AL6A 2D1KA 3R8EA 1JCGA 3DXKB 3SBTA 2OANA 3D2EA 3VEVA 4B1UB 2A3ZA 4IZ9A 4B1VA 4LC9B 3DXKA 3HM8A 1BUPA 4BR7A 4DQ8A 5C2DA 1TUYA 3W3DA 2CGKA 4EHTA 3M1FA 4ISFA 2NNWA 1MIZB 5KPTA 1ILYA 1GC6A 2WUSA 1ZBSA 2E88A 1RGIA 3CJBA 4A62A 4BR4A 4ILJA 1EQYA 3MX5A 5F2RA 3M3ZA 2WH5A 1RDWX 4B1WB 3VTHA 3G4SN 3WXLA 3VF4A 4BG9A 4NLBA 4C1NI 1WOQA 2QXLA 3I8BA 3FZFA 3A8YA 3ID6A 5AQPA 3ZETB 5AQFA 1HUXA 3CIPA 3O6WA 3R1XA 5B8HA 3ZETA 5JLHA 2ZGYA 3T7ZA 2P9UB 4FWOA 5AQTA 4H5RA 3CQXA 3WT0A 5M1KA 2P9UA 1GC7A 1QQMA 1T6CA 4WQ5A 4BR9A 4B1YB 4YOXA 1T3VA 1GLCG 1ZXOA 4WFNL 3AU5A 2PBDA 3C6AA 5MLCQ 4UY8O 2Q31A 4ZRIA 4JHDB 4MLHA 5M1FA 4IDHA 1DIKA 1U6ZA 3A5NC 3CJAA 3KZBA 4JHDA 2CH6A 3LM2A 1DT9A 4YOUA 4A5AA 4U67L 4AF1A 1SQKA 5FPDA 1X9JA 2ZF5O 3ENBA 4BR0A 4EAHD 2P9KB 1Q18A 3VEXA 4YOVA 4BC5A 2P9KA 4WFBL 2YJEA 3GBTA 5KQ8A 4IO9L 3O1BA 2AEHA 3U7DA 1JCEA 3WQUA 4BQZA 3SBGA 3CPEA 1YF5L 3H6EA 4FWPA 3TU5A 3WQTA 1JDEA 4YORA 5BRHA 1R59O 2VGMA 1BU6O 1T6DA 2V7ZA 1VQLN 4QS9A 1MK9B 3MX2A 3VMFB 3VEZA 2F9TA 2RQ1A 3B8AX 2EMTA 5JICA 5M1NA 4G9ZA 3ENOA 3KHYA 1ACAA 3GG4A 1K73O 3VF2A 3GDQA 3CD6N 4CI6A 2HMPA 5CR4A 1MWMA 2P9LB 3I33A 1O13A 5C12A 2DPNA 2P9LA 1SGHA 1D4XA 3LL3A 1VQNN 3CHWA 3AY9A 2YCHA 3MK6A 3O08A 4IFEA 3GE1A 5AQZA 4BROA 1Q86O 1NGAA 5KPZA 4JKBA 3H45C 1TYQA 1NMDA 3MN6A 3BINA 1BG3A 1CZAN 4GVEA 3AAPA 3EL2A 3FZKA 2J0KA 5AQJA 4H5WA 4O5FA 4B1XB 3O80A 5M1PA 1IJJA 3CC2N 1QZ5A 5GIPA 1GLDG 3MCAB 3IUCA 2V51B 2QWOA 2X0SA 1VQKN 3ULEB 3FLCO 1ATRA 3AAQA 4HWIA 1XC3A 3ULEA 2IIRA 3FGUA 1OKJA 2HF4A 2VYPA 2QWRA 2QWNA 1S72N 1BDGA 4H0PA 5F0XA 4BRDA 5ADXA 1NGBA 2E2PA 3HBTA 1Q7YO 3F2KA 3VEWA 2H3GX 2YHYA 1TUUA 2E8AA 2IVPA 3VOVA 3WA0A 1N8RO 3JS6A 2CH5A 2ZPYA 2GEMA 3R6MA 1K8KB 4BRFA 1NGFA 3CJCA 3U9DA 2CB8A 2BUPA 1K8KA 3EE9A 5AQWA 2ZJQL 1HX1A 3CCQN 4ILHA 5BRDA 3CPWM 3CCLN 2RE2A 1E4GT 4JKAA 2FSKA 4IWVA 3CCJN 4YL8A 4J8FA 3HSCA 3O9TA 1EF1A 3E9PA 1HPMA 4H5VA 1HKBA 1M1KO 3OW2M 3CCUN 3QBXA 5M1QA 2PAVA 3BEXA 2ABDA 4GV9A 2BH1A 4BRAA 3TPQA 4BRCA 3KWGA 4A61A 3O5BA 3H1VX 2WFBA 3DAWA 3HRGA 2ZWHA 4A5BA 3OBYA 3C7NB 3C65A 4MDBA 2QA4N 4HDOA 4IEIA 2GTDA 3C7NA 3CF5L 3VEOA 4P7IA 4GY2B 4RWTA 3L4QA 5DM6L 2PFUA 3O4WA 3MWPA 1E4FT 4OPAA 5TKYA 3ID8A 2E1ZA 4CYEA 2NRZA 2UYTA 2OTLN 2HE7A 5AQNA 2D11A 5BPNA 1E5WA 1NGIA 1YXQA 3EPYA 4FOEA 5EY4A 1H4RA 1GLBG 3E1YA 5EX5A 2AA4A 1KAZA 2YHXA 4JN4A 3J7ZO 2VCPA 5C2FA 4A2BA 4OO1J 2I7PA 2ZGZA 2W40A 4GNIA 4IO8A 3FP5A 1YVNA 2D0PA 5AFUH 1ISNA 4E1JA 4FVUA 1Y19B 3SK3A 4WQ5C 5AR0A 5BN8A 4CBXA 2KHOA 3CETA 1GLJO 3M6GA 3ZDTA 1U2VB 4DXAB 2ASPA 4CBUA 4RTFD 3HOTA 4JKGB 1NVLA 1U2VA 4NLCA 2J0MA 1T44A 4JKGA 4CBWA 2A40A 4CZIA 2J4RA 5EOYA 1XQSC 4ISEA 1Z05A 3ENHA 4YDUA 3KK7A 3FLVA 2FXUA 3DXMB 1NBWA 3OA9A 1J19A 4M7XA 4PL8A 2NRXA 5AQIA 3DXMA 4K41A 4AM7A 4FWQA 3O9QA 4OPHA 1VBGA 3A5MC 3LM9A 5TKWA 4F9OA 3CJ9A 2E2QA 1GLEG 3CQYA 1HBKA 2FSJA 4GXBA 4BGAA 4C1NK 3SJHA 2ZJRL 4IEEA 1P8ZA 3IDHA 5M1OA 3I56N 3VENA 1GLFO 3VESA 3FZHA 4DKWA 3MN7A 4BQLA 1X3MA 3HTVA 5AQXA 2KKZA 3G6EN 3CMEN 1KC8O 2P9IB 2GWKA 5GAHP 1MDUB 4DCHA 3PZDA 1J6ZA 5AQGA 3WEEB 2HBJA 1MWKA 2GELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBT A;  4ILH A;  4JKA A;  4JK7 A;  3E9P A;  4JK9 A;  4ILJ A;  3ENB A;  4JKE A;  3E9O A;  4JKB A;  4JKF A;  4JKD A;  3E66 A;  3SBG A;  4JKC A;  4JK8 A;  4JKH A;  4JKG B;  4JKG A;  3E9L A;  4ILG B; 
#chains in the Genus database with same CATH topology
 1KXP A;  4X66 K;  4FLV A;  3MCP A;  1ASU A;  3CCV N;  1P90 A;  3TSQ A;  4CES A;  1NK8 A;  4IOX A;  1QVG M;  4XH1 A;  3U3Y A;  3L2W A;  5KRS A;  3R9P A;  4K43 A;  1OH5 A;  3VN5 A;  5AZI B;  3DWL A;  4B8A B;  1MU2 A;  2FF6 A;  1QS4 A;  2WC9 A;  3EKS A;  2OZM A;  3PIO L;  4CHO A;  4JKF A;  4H0O A;  1W2B M;  4FOI A;  3QFU A;  4BRL A;  3C0B A;  3CJ7 A;  4FK0 A;  4DQQ A;  4DSF A;  2HHQ A;  3K5N A;  3LPU A;  4JI0 K;  5AQQ A;  4FWL A;  1DEJ A;  1TK8 A;  1RFQ A;  2FBX A;  2UXC K;  4FM2 A;  2Q0U A;  4KTZ A;  4PY5 A;  4FJ9 A;  1RBS A;  1OVY A;  4DV0 K;  3CJ1 A;  4GV3 A;  3SUQ A;  1T7P A;  4CZH A;  2O8C B;  3ZSR A;  4ISG A;  5LY3 A;  4TKN A;  2XY8 A;  1KAX A;  3TAQ A;  3NVM A;  5BR9 A;  5HL7 L;  2XY5 A;  4CK3 A;  4IKF A;  1Y64 A;  3UKU A;  3VA3 A;  4MO4 A;  4W5R A;  2D4W A;  3VQ4 A;  2COP A;  1TGO A;  4CK1 A;  4MO5 A;  3U9Z A;  3LAN A;  4LFA K;  3LZI A;  1KSP A;  1WLJ A;  3O9S A;  2IOC A;  5AFU A;  1QQN A;  3H3N O;  4CZM A;  4CFB A;  3BF3 A;  3QFP A;  3H08 A;  2E1Y A;  4DTO A;  1ATN A;  4H0X B;  3TTC A;  4B9T A;  3LZJ A;  2ASM A;  2VWJ A;  2YHA A;  2CGL A;  2Q2R A;  4JI8 K;  3HPH A;  4ID5 A;  2EWS A;  1S22 A;  2NRT A;  5FLX O;  4CFD A;  3SYZ A;  1BOT O;  2P9S B;  4WYB A;  4FLY A;  3S41 A;  4JI3 K;  1BGX T;  1S3X A;  2A41 A;  4EP5 A;  4DR5 K;  3TR8 A;  1RDB A;  4I7F A;  1IG8 A;  1WBD A;  3AVG A;  4H5T A;  4BY9 C;  1RBT A;  3E9L A;  5LJW A;  4KHN A;  4KRE A;  3QBW A;  4CZK A;  1WSI A;  3JXU A;  2F8S A;  5AQU A;  5AQY A;  5HRP A;  3T1Y K;  4H0T B;  2DFE A;  2YVC A;  5SZT A;  4RG8 A;  4J2E A;  2HVH A;  4FCY A;  1RDA A;  4YY3 K;  3MWT A;  3EO3 A;  5AQM A;  1FJG K;  5A2Q O;  1X3N A;  3LDO A;  2HF3 A;  3U3G A;  4EP4 A;  3PLA A;  4CD1 A;  1NOZ A;  4BRN A;  3O1W A;  3CCS N;  4FK2 A;  4LH5 A;  4KTW A;  3ZYY X;  1VQM N;  4OKJ A;  4Y0W A;  5JMV A;  3KLE A;  2A6A A;  4EHU A;  1NU0 A;  2CQU A;  1W97 L;  3D45 A;  3UB5 A;  3VGK A;  1D8Y A;  3O3F A;  1K6Y A;  1HNV A;  3LAM A;  2J0J A;  3QIP A;  3THX A;  2G8I A;  5CHI A;  2D0C A;  1HLU A;  1KQS M;  4DF8 A;  4BRG A;  3NCI A;  3SQ2 A;  4PA1 A;  4BR2 A;  1HJO A;  3FZL A;  4CF8 A;  1CXU A;  5AZJ A;  4E89 A;  2IC3 A;  1NGG A;  5LL6 Z;  4DFM A;  4ID1 A;  4DLG A;  4OLA A;  5AQS A;  5JVG L;  3BGR A;  3DLE A;  3L3V A;  4B3M K;  3WXI A;  3L0Q A;  4MQ3 A;  5LJV A;  1DTQ A;  2QKK A;  3ATV A;  4JK8 A;  4MDA A;  4IDK A;  1QSL A;  4KH5 A;  2OTJ N;  3L2U A;  3IS9 A;  3AVH A;  4KHW A;  1C0T A;  2PY5 A;  3NGZ A;  1YUW A;  4NCG A;  5AQV A;  4E1M A;  4H5N A;  3ZX0 A;  1BA1 A;  3MEG A;  4Z4H A;  3SZ2 A;  1SS6 A;  3QB0 A;  4FJN A;  1BIS A;  2UUA K;  4IOA L;  4NY0 A;  3DJC A;  3U4L A;  1KD1 O;  2V7Y A;  4FSV A;  4KPY A;  2KZZ A;  3KJV A;  3CXC M;  3G0Z A;  3QES A;  3AGR A;  4Q5V A;  4DHY A;  3ZEU A;  1S9E A;  2YHW A;  1VSL A;  2IS3 A;  4BC3 A;  3M8R A;  5C10 A;  4BRP A;  1RTD A;  3N4P A;  3P83 D;  1X1P A;  4BRQ A;  3C6H A;  3SAH A;  4JD2 B;  3L3U A;  2HB5 A;  3RSE A;  1S1U A;  4DR1 K;  2KZM A;  3UKR B;  4FWS A;  4PL7 A;  3V1R A;  4HCB A;  5EVZ A;  2F7T A;  1RDU A;  4JKE A;  1RDD A;  2VWB A;  3VQB A;  2UUB K;  2QWL A;  4C8M A;  2HOE A;  1T05 A;  1EXQ A;  4DTX A;  3S3N A;  1KVC A;  3VEV A;  3DXK B;  3I56 N;  3D2E A;  1WSH A;  2A3Z A;  4IZ9 A;  1JLB A;  1TUY A;  4ISF A;  1WSE A;  3QO9 A;  1MIZ B;  2E88 A;  1Z26 A;  4OX9 K;  4LH4 A;  1RDW X;  4B1W B;  3F73 A;  1WOQ A;  3ZSV A;  3HVR A;  2O8D B;  3ID6 A;  3ZET B;  2P5G A;  3O6W A;  3R1X A;  4CHZ A;  5AQT A;  5M1K A;  2P9U A;  1GC7 A;  3NF6 A;  4CJF A;  3AU5 A;  3K59 A;  4AH9 A;  3TWH A;  3CG7 A;  4ZRI A;  1N5Y A;  4JHD B;  4FLU A;  3A5N C;  3NHG A;  4KRF A;  2CH6 A;  5C25 A;  4AF1 A;  5FPD A;  1WSF A;  1SKS A;  1JL2 A;  5FRO A;  1UAX A;  2P9K A;  2W6K A;  3GBT A;  4BC5 A;  4WFB L;  3O1B A;  3WQU A;  4BQZ A;  1TVR A;  4FWP A;  4CGI A;  3HO1 A;  3WQT A;  4YOR A;  2VGM A;  3ALY A;  1VQL N;  1MK9 B;  2F9T A;  4JI1 K;  5JIC A;  5M1N A;  3GDQ A;  3CD6 N;  3MXM A;  2P9L B;  1NK0 A;  5C42 A;  2DPN A;  4HCC A;  1U4B A;  3CHW A;  1HMV A;  3O08 A;  4IFE A;  3V9Z A;  4JKB A;  3MN6 A;  2XY7 A;  1HYV A;  4H5W A;  4O5F A;  4B1X B;  3O80 A;  5M1P A;  3CC2 N;  1QZ5 A;  5GIP A;  3NE6 A;  2G8K A;  2EHG A;  1VQK N;  4AHC A;  3ULE B;  3FLC O;  3OYK A;  2UXD K;  2HF4 A;  3V6D A;  2OPP A;  3NFA A;  2E2P A;  4W5T A;  3QIN A;  2HHX A;  2Z1J A;  3VOV A;  3JS6 A;  4OGE A;  4HUF A;  4BRF A;  3CJC A;  2CB8 A;  2BUP A;  1VHX A;  5BR8 K;  1E4G T;  4JKA A;  4IWV A;  4AHT A;  5IWA K;  1EF1 A;  2HVI A;  3SQ1 A;  2LSN A;  3QBX A;  3TAP A;  2BH1 A;  4M3X A;  4KHQ A;  2OYQ A;  1FKO A;  2UXB K;  4DSK A;  3C95 A;  1JXE A;  2D5R A;  1JXB A;  3CF5 L;  1C1A A;  4B9L A;  3MWP A;  3KIO A;  3AVN A;  2OTL N;  1WAF A;  5LMN K;  1A5X A;  4JRQ A;  1YXQ A;  3EPY A;  4K8X A;  1GLB G;  3P5J A;  4JN4 A;  3HPG A;  5C2F A;  1BQN A;  4DS5 A;  3VA0 A;  5AFU H;  4GNI A;  1X9M A;  5AR0 A;  2HW3 A;  2KHO A;  1REV A;  1GLJ O;  2RN2 A;  3ZDT A;  4DXA B;  1NVL A;  1U2V A;  4NLC A;  4N5S A;  2A40 A;  4LF4 K;  4E7K A;  3ENH A;  3KK7 A;  1BI4 A;  2FXU A;  3AVF A;  1NBW A;  5K14 A;  3DXM B;  4M7X A;  4YHH K;  2NRX A;  4FWQ A;  1JLE A;  4QOZ B;  3A5M C;  5TKW A;  4GMJ B;  4KB0 A;  2E2Q A;  1GLE G;  5KRT A;  1HYS A;  2FSJ A;  3ZT3 A;  4FJJ A;  1XNQ K;  3VES A;  4DSI A;  3O3G A;  2KKZ A;  3V9S A;  1IKX A;  1QHT A;  1MDU B;  5HLF A;  4Z0U A;  2HBJ A;  1U04 A;  3LPT A;  1S6P A;  1YI2 N;  1J54 A;  2F4V K;  2HHH K;  1F21 A;  2GWJ A;  1V4S A;  3TAE A;  3PIP L;  3TAG A;  1RT7 A;  3J8A A;  4IJN A;  1XUP O;  3EN9 A;  3IKM A;  3VEY A;  2KW4 A;  3IAY A;  2X78 A;  1RBU A;  3PVL A;  1JJ2 M;  2YNF A;  2VG7 A;  3FR0 A;  3ZLJ A;  2KLA A;  3EYZ A;  1S6Q A;  3AV9 A;  2PYJ A;  4H0Y B;  3G71 N;  3FFK B;  4JS5 A;  3F9M A;  4H4O A;  2O4I A;  3FFI A;  3HST B;  3SAG A;  4FJ5 A;  2X74 A;  4BR5 A;  1EWR A;  1KFD A;  3KLG A;  4I6M B;  3K9K A;  1J53 A;  2QKB A;  3SJJ A;  4B8C A;  4F4K A;  4BDY A;  4KH4 A;  5HP1 A;  3EE8 A;  3OJU A;  2FF3 B;  1XNR K;  1IH7 A;  1QTM A;  2A1R A;  3OYF A;  3QIJ A;  1BIZ A;  1YIJ N;  4OPK A;  2I1J A;  3UKU B;  3VER A;  3G25 A;  5HRO A;  2P9P A;  2D2Q A;  4HDQ A;  4CZE A;  4K42 A;  3AGK A;  4JK9 A;  4EFH A;  3GL1 A;  4H4M A;  3A2F A;  4CJ4 A;  1W0H A;  3SMS A;  1EET A;  4BRE A;  4W5O A;  4FLW A;  1TK0 A;  4LF6 K;  2P9N A;  1MIX A;  2JLE A;  1NLV A;  1ZBU A;  2E6M A;  3OHR A;  4KTQ A;  1VBH A;  4JAX A;  2D10 A;  3B6P A;  5HOO A;  1ZBH A;  3NH1 A;  1YJ9 N;  2BTF A;  4CJ5 A;  3R3L A;  2HHU A;  1NJI O;  4DV3 K;  4FVM A;  4LSN A;  1LWC A;  3EEQ A;  2FC0 A;  5AQL A;  4Z4I A;  2YNI A;  2F96 A;  3K5O A;  1NKB A;  3E9O A;  1GGO A;  4RCH A;  3AO1 A;  4CF0 A;  4YDU C;  1XMO K;  1VQP N;  4O0J A;  4HUE A;  3VQD A;  4DG1 A;  3VQ5 A;  3AO5 A;  5KPR A;  3LWL A;  4NCB A;  4ZTF A;  2FSN A;  4Z94 A;  3ITH A;  1NG9 A;  4MLE A;  1S9G A;  2IVN A;  4AM6 A;  2WTU A;  4M63 C;  4U7B A;  2HNY A;  1VQ6 N;  3LDP A;  4DTR A;  3VQQ A;  5ELZ A;  4A57 A;  1UWB A;  3QNN A;  4W5Q A;  3LDQ A;  4YOT A;  5AQK A;  1DTT A;  1S1T A;  4G1Q A;  3K0S A;  4AQY K;  1C1B A;  3SLC A;  1VQ9 N;  4F2R A;  5GAE P;  3HI0 A;  3I0S A;  4CHY A;  4BE0 A;  1G99 A;  5DM7 L;  2W41 A;  4NYF A;  4KB1 A;  1ST7 A;  2QWQ A;  3BP8 A;  1NJY A;  1H1V A;  3THX B;  4CED A;  3NGY A;  1SAZ A;  4KHU A;  3QLH A;  4NB4 A;  4DTM A;  4PQU A;  3EKU A;  3P39 A;  5AZJ B;  4M45 A;  2I1K A;  1BL3 A;  3LWM A;  4FZZ A;  1WUA A;  5BRE A;  2HRJ A;  1LW0 A;  4BC2 A;  3QER A;  1TYQ B;  5EXW A;  2HNZ A;  4DV5 K;  1EWQ A;  1OH7 A;  1YIT N;  1DLO A;  4CVN E;  2Z1H A;  2ZJP L;  1VQO N;  3T1A A;  4I6M A;  3ZSO A;  3O9R A;  1JLG A;  3FE1 A;  3P1G A;  3DLH A;  3PSF A;  4B1Z A;  4CJR A;  2Y1J A;  2VG6 A;  3SQ4 A;  2FBT A;  1D9F A;  4BVP A;  2E20 A;  1S1X A;  4YFU A;  4DR2 K;  2IAJ A;  3VQP A;  3H1Q A;  4FL9 A;  3QET A;  4NO7 A;  4DUZ K;  4PWD A;  4BG8 A;  1J5O A;  3RR8 A;  1IBM K;  3ZEU B;  2QEX N;  1VSF A;  2ITG A;  1J5E K;  5AQR A;  1DGK N;  3T19 A;  3IG1 A;  1IO2 A;  4QAG A;  3RSE B;  4J2A A;  4YOW A;  3OJS A;  2G8F A;  4CF1 A;  4IG0 A;  3MN5 A;  1YJW N;  1O1W A;  1YAG A;  3PO5 A;  4DF4 A;  4M41 A;  4DV4 K;  1K9M O;  4CJ7 A;  1VRT A;  2Q97 A;  1KAY A;  1UA1 A;  4A59 A;  1QHA A;  3UE5 A;  4IJA A;  3RTV A;  4I2P A;  4M42 A;  3SUN A;  4BRI A;  3KKS A;  2I7N A;  3QEW A;  1NWK A;  3C6U A;  3D2E B;  4B1V A;  4BR7 A;  5CE3 A;  4DQ8 A;  1BUP A;  3W3D A;  3O3H A;  3M1F A;  2NNW A;  5KPT A;  2WUS A;  3SQ0 A;  4A62 A;  4BDP A;  3AO2 A;  4ILJ A;  3MX5 A;  5F2R A;  2WH5 A;  3G4S N;  3WXL A;  4NLB A;  1UA0 A;  3HL8 A;  3V4I A;  3A8Y A;  2ZM6 K;  1D9D A;  5B8H A;  4DR4 K;  2P9U B;  3AA3 A;  3BY5 A;  3CQX A;  4H5R A;  4WQ5 A;  1VRU A;  4BR9 A;  4Z4E A;  4B9S A;  2P51 A;  1ZXO A;  4K0K K;  2Q31 A;  4FJK A;  5M1F A;  4IDH A;  4YOU A;  3OYC A;  4A5A A;  2ZF5 O;  4IG3 A;  4BR0 A;  3TAF A;  2P9K B;  3ZSY A;  3BDP A;  2KQ2 A;  5FRM A;  3I8D A;  4JLH A;  3BZC A;  5FDL A;  5JS1 A;  5BRH A;  2O8E A;  3V9X A;  1NKE A;  4QS9 A;  3DI6 A;  1RT5 A;  4KI4 A;  3OTO K;  3AVI A;  2HMP A;  3HM9 A;  1TL1 A;  1QSS A;  1Y97 A;  1SGH A;  1D4X A;  3LL3 A;  3AVL A;  2B4J A;  2QXF A;  1Q86 O;  4FJI A;  1YTA A;  1TYQ A;  3H45 C;  4C8L A;  1BG3 A;  1CZB A;  1CZA N;  3EL2 A;  4MFB A;  5KTQ A;  4DQS A;  4N47 A;  3OYD A;  5DMR A;  1GLD G;  3TAN A;  3IUC A;  1N36 K;  5D3G A;  3S3M A;  3FGU A;  2VYP A;  2QWN A;  4PUO A;  1T8E A;  4W5N A;  3RWU A;  2AJQ A;  2D0B A;  1VSD A;  3F2K A;  3JAM O;  2YHY A;  2W6L A;  2E8A A;  2IVP A;  3DLB A;  4FZX C;  2O8B A;  3R6M A;  2YV0 X;  3U9D A;  5CYQ A;  5AQW A;  4LFB K;  4NXN K;  5BRD A;  3CPW M;  3CCL N;  1S1V A;  3CCJ N;  4YL8 A;  4J8F A;  3PY8 A;  1HPM A;  4H5V A;  1SKR A;  3BZK A;  1LAW A;  4V19 S;  1N33 K;  2PAV A;  4GV9 A;  3TPQ A;  1JLQ A;  5E41 A;  3H1V X;  4N56 A;  4KHP K;  4KHY A;  2ZWH A;  1NMN A;  5CZ2 A;  2QA4 N;  4IBN A;  3VEO A;  2GEL A;  3L4Q A;  3AVB A;  3O4W A;  1E4F T;  3VQA A;  4CYE A;  2UYT A;  2HE7 A;  1TL3 A;  1IBK K;  2XY6 A;  5EY4 A;  3E1Y A;  2AA4 A;  2YHX A;  3T3F A;  4CJ3 A;  3CM6 A;  4OO1 J;  4IO8 A;  1VK0 A;  4FVU A;  1Y19 B;  4CGH A;  5BN8 A;  4CEB A;  5LMU K;  3M6G A;  1U2V B;  3LP2 A;  4JKG A;  5EOY A;  1XQS C;  4ISE A;  1BI4 B;  3FLV A;  3J80 O;  1RIL A;  3O9Q A;  3TAB A;  4ICL A;  4M3R A;  4O5B A;  3CQY A;  3MXI A;  3SUO A;  2ZJR L;  4IEE A;  3PO4 A;  1P8Z A;  1HNX K;  3VEN A;  1B92 A;  3SV3 A;  4BQL A;  5AQX A;  3G6E N;  4EZ6 A;  2GWK A;  1GOA A;  3PZD A;  1MWK A;  2EMS A;  3WEE A;  1U48 A;  1NJX A;  4DLE A;  2QW9 A;  1JCF A;  1WSG A;  3OVN A;  4OKK A;  3HPO A;  3BUZ B;  1E3M A;  4CF2 A;  3ZX3 A;  2YX6 A;  1EO1 A;  4OVL A;  2YJF A;  3SMP A;  4DTU A;  2DY4 A;  1CXQ A;  4BC4 A;  1NGJ A;  4M3Y A;  4KO0 A;  3SNN A;  1FXX A;  4FM1 A;  2QWM A;  5KI6 A;  1KFS A;  1YHQ N;  1C0U A;  3DRR A;  4X62 K;  4FK4 A;  1HB6 A;  4O44 A;  4F3O A;  3KLF A;  4X64 K;  3D2F B;  1OH6 A;  3ZSZ A;  2OZS A;  4FWN A;  4FJX A;  1FW6 A;  1BWF O;  4CFA A;  5CY4 A;  1NK9 A;  4L8R B;  4M3Z A;  4JEP A;  3NF7 A;  4QS8 A;  2OCE A;  3KD5 E;  1U47 A;  1C0M A;  2E5L K;  1GOC A;  1SL1 A;  4DB3 A;  4CIE A;  4M3T A;  1K8A O;  4HTU A;  1LCU A;  3M8Q A;  2WON A;  3VTI A;  2Z1I A;  1FKP A;  1HQU A;  3WUH A;  1VSH A;  3DLL L;  2P9P B;  3L6Q A;  3D6R A;  3HK2 A;  1N32 K;  2QWP A;  3MAQ A;  4B9V A;  5J1E A;  1NNE A;  1ZBI A;  4E0D A;  2P9N B;  4ZRK A;  1L3U A;  5BPL A;  1N6Q A;  3QML A;  2QTD A;  3RR7 A;  5T7B A;  3NDK A;  2G8H A;  4BRH A;  1WBB A;  1VQ7 N;  4FXD A;  3CC7 N;  1RT1 A;  2RHK A;  4XEI A;  4XH4 A;  4CZF A;  1NK6 A;  1XHZ A;  1QQO A;  3A0I X;  1WB9 A;  3L4I A;  2PZS A;  3VET A;  1S1W A;  3D7E O;  2UUC K;  4I9Q A;  4DUY K;  3LDL A;  3C6T A;  2GX9 A;  4JNE A;  3WNH A;  4HUG A;  2F9W A;  1RT4 A;  4YOY A;  3CFR A;  5FPN A;  4ILG B;  3TTF A;  2NRV A;  4DQI A;  1HJR A;  4CZJ A;  4O8K A;  2D0O A;  4H03 B;  4CJU A;  3CCM N;  5FRN A;  1V4T A;  3CCR N;  4OJR A;  4KI6 A;  3RVC A;  1DKG D;  4NYN A;  2BAN A;  4JV5 K;  4CZL A;  2FJ9 A;  2Y1I A;  3DRS A;  3T1H K;  4ELT A;  3L8B A;  3E66 A;  4JKC A;  4Z4C A;  3AVM A;  2DIK A;  3KK1 A;  1ZC6 A;  5BPM A;  2HND A;  4DTN A;  3B6O A;  1J9A A;  2NRW A;  2E4L A;  3J7Y P;  5IJM A;  4KKO A;  3KTQ A;  3UIQ A;  2A42 A;  4C23 A;  2JGU A;  4JYA K;  2Q1N A;  2FLO A;  3DM2 A;  1JLC A;  4NXM K;  4CEO A;  4CD3 A;  3OS1 A;  3VGM A;  3CFO A;  3WNG A;  3CCE N;  3QEX A;  1L3V A;  1B9D A;  3V9U A;  1M90 O;  4JKD A;  3IMX A;  2P5O A;  3U8Z A;  3MEE A;  3PUF A;  3H46 O;  3AO4 A;  3E01 A;  2IDO A;  2NZT A;  4Q0B A;  4CFC A;  4WF9 L;  3D2F A;  4OLB A;  1IV0 A;  2OPS A;  3SAF A;  4CGD A;  2CGJ A;  4O4G A;  4AHR A;  4CER A;  2HST A;  1GLA G;  4LF7 K;  3HP6 A;  3CI5 A;  4CHQ A;  2X6N A;  3NMU A;  2EX3 A;  1IG9 A;  4JI4 K;  3SCX A;  5SWM A;  1Z6R A;  3GOI A;  3ZSW A;  1NI2 A;  1JL1 A;  4DFJ A;  3PV8 A;  2IVO A;  2O8F B;  3QEI A;  3QNO A;  4KH6 A;  1LAV A;  4CHN A;  4M3U A;  3VQE A;  1TKD A;  1TKT A;  5GIN A;  4DQP A;  4FZY A;  1I39 A;  1RCH A;  4Z4G A;  1ZYQ A;  1LW2 A;  3ZCM A;  4DR6 K;  4E7J A;  3OYB A;  3MMV A;  1L3S A;  2JWL A;  3O8M A;  1Q9X A;  3VQ8 A;  3QIC A;  3VF6 A;  4YNQ A;  3OS2 A;  1KTQ A;  1QVF M;  3MDQ A;  4JI6 K;  4RW9 A;  4FLZ A;  2OA8 A;  4L3Q A;  3O9U A;  3DLG A;  1HRH A;  3KLH A;  2YNH A;  2HBK A;  3QDK A;  4WFA L;  3J7A P;  2R82 A;  4N76 A;  4HTL A;  3P4I A;  2GV9 A;  3QEP A;  5H1S Q;  1Q82 O;  3V81 A;  2FDQ A;  1ATS A;  2KTQ A;  3VGL A;  3TSU A;  3AA4 A;  2AL6 A;  2D1K A;  1JCG A;  1YVU A;  2OAN A;  4DR7 K;  3VQC A;  1RDC A;  1SUQ A;  1OH8 A;  4B9N A;  4CJE A;  1ILY A;  1GC6 A;  3LAL A;  4CJT A;  1RGI A;  1U45 A;  1Q8I A;  1EQY A;  4RW6 A;  1BQM A;  3VF4 A;  4BG9 A;  3SUP A;  2QXL A;  4LSL A;  4RW4 A;  2E6L A;  3QIO A;  5AQP A;  2X6S A;  2ZGY A;  3MED A;  3T7Z A;  4FLX A;  3HJF A;  1QQM A;  3THY A;  3WNE A;  3JSM A;  1T3V A;  1TKX A;  2PBD A;  3C6A A;  4UY8 O;  2DFF A;  3HT3 A;  4MLH A;  1U6Z A;  3KZB A;  3CJA A;  1WNS A;  3LM2 A;  4CF9 A;  4H8K A;  3ISN C;  1SQK A;  1IKW A;  1X9J A;  4Z4F A;  3ENB A;  1Q18 A;  1SV5 A;  3U6F A;  4IO9 L;  1X9W A;  2AEH A;  1T03 A;  1JCE A;  3RMA A;  1YF5 L;  3H6E A;  4OKE A;  4DTJ A;  3HXM A;  2O8E B;  1JDE A;  4CEF A;  2DTU A;  1R59 O;  1N34 K;  4DV1 K;  2KFZ A;  4FJG A;  4CJL A;  3MX2 A;  3VMF B;  3VEZ A;  2RQ1 A;  4DFK A;  2EMT A;  3LP0 A;  3NGI A;  1ACA A;  3GG4 A;  3THV A;  3VF2 A;  5CR4 A;  3K57 A;  1MWM A;  3AVA A;  3I33 A;  1O13 A;  5C12 A;  3SV4 A;  1VQN N;  3AY9 A;  2YCH A;  2NUB A;  2Q3S A;  1NGA A;  5KPZ A;  1ITG A;  4KFB A;  3IRX A;  2GUI A;  3ZT0 A;  4GVE A;  3AAP A;  3FZK A;  4CW7 B;  2J0K A;  5AQJ A;  1B9F A;  3WNF A;  1A5W A;  2ZQB A;  4Y1C A;  2QWO A;  2X0S A;  1ZBL A;  4CE9 A;  5DK5 A;  5HRS A;  3AAQ A;  1XC3 A;  3V1Q A;  1WAJ A;  2O8F A;  1TKZ A;  1BDG A;  1ASW A;  5F0X A;  4B3R K;  4BRD A;  5ADX A;  4J2D A;  3DYA A;  4JRP A;  1Q7Y O;  3VEW A;  3OYH A;  1TUU A;  1SL0 A;  2O8B B;  3M8P A;  2CH5 A;  1VSI A;  3DRP A;  1NGF A;  1RTH A;  4LD0 A;  2G8U A;  4B3T K;  1K8K A;  1GOB A;  3J81 O;  1HX1 A;  4E3S A;  1RNH A;  2RE2 A;  2FSK A;  4FW2 A;  3THW B;  3HSC A;  3O9T A;  1QSY A;  1HKB A;  3DMJ A;  3BEX A;  4BRC A;  3KWG A;  4A61 A;  4JI7 K;  3L2R A;  3HRG A;  3JYT A;  4A5B A;  3C65 A;  4MDB A;  1QQC A;  1JKH A;  2GTD A;  3C7N A;  3CYM A;  4P7I A;  4GY2 B;  2I5J A;  4RWT A;  5DM6 L;  2PFU A;  4AHS A;  4OPA A;  5TKY A;  2E1Z A;  5AQN A;  3KD1 E;  2D11 A;  4CJW A;  1E5W A;  1NGI A;  1IKV A;  1NK7 A;  1YTU A;  1H4R A;  5EX5 A;  1KAZ A;  3J7Z O;  2VCP A;  2ZE2 A;  4CJV A;  4CHP A;  5J2M A;  2I7P A;  3SK3 A;  4WQ5 C;  2ASP A;  1I3A A;  4RTF D;  1Q9Y A;  4JKG B;  1XMQ K;  2HHW A;  1T44 A;  5IT9 O;  4CBW A;  4CZI A;  1ASV A;  4DWI A;  1Z05 A;  2B5J A;  3K5L A;  1YT3 A;  5KQD A;  3KK3 A;  3RRH A;  4PL8 A;  1J19 A;  4AM7 A;  5AQI A;  4K41 A;  4OPH A;  4BE2 A;  1HYZ A;  2P1J A;  4DQR A;  3CJ9 A;  1L5U A;  4C1N K;  5M1O A;  4CGJ A;  3MEC A;  3SPY A;  4DKW A;  3MN7 A;  4QCL A;  1X3M A;  3HTV A;  3CME N;  1KC8 O;  3L2Q A;  1SKW A;  2P9I B;  1IKY A;  3M8S A;  4J2B A;  2ATQ A;  4DCH A;  1J6Z A;  5AQG A;  3WEE B;  2VQF K;  1NGH A;  3HZ6 A;  1LOT B;  5JVH L;  2UU9 K;  4CJQ A;  3W0L A;  4F2S A;  4OPJ A;  2E2O A;  4HVJ A;  4AIL C;  1NM1 A;  3CER A;  1MA9 B;  5E84 A;  4CJP A;  5AZI A;  1NGD A;  3SI6 A;  5GIO A;  4DSE A;  3F9K A;  3Q7C A;  1YJN N;  1VQ4 N;  4WQ4 C;  3DOL A;  3EY1 A;  4LY7 A;  3NVK A;  3SPZ A;  1TK5 A;  3WXK A;  4WQ4 A;  2V52 B;  3VQ9 A;  4H0V B;  1VQ5 N;  4C8K A;  3CC4 N;  1Z25 A;  3BF1 A;  5I9E B;  4HHT A;  4XH5 A;  4ZRJ A;  3DLR A;  2YI1 A;  1KLM A;  3PX4 A;  2NRH A;  4FWK A;  3OYJ A;  4DV6 K;  3OYM A;  4BVO A;  3L2V A;  2XRI A;  4RW7 A;  4CZG A;  1WN7 A;  3AVJ A;  2NLX A;  4C8N A;  3TSP A;  3PX0 A;  2O8C A;  4KBO A;  5AQH A;  1KC7 A;  3IFR A;  1EX4 A;  2AP1 A;  3A5L C;  3DLK A;  4X65 K;  3OBW A;  1TV6 A;  4RW8 A;  4Y1D A;  5E26 A;  3PX6 A;  3ATU A;  1NTI A;  1X9S A;  4FYD A;  4FO0 A;  3TTD A;  1JLF A;  3THW A;  3LP1 A;  3U8X A;  1VQ8 N;  4PHT X;  1IBL K;  2DFH A;  1TAQ A;  3EZW A;  2D0A A;  1KRP A;  3VQ6 A;  2Q36 A;  3MN9 A;  3HOS A;  4FWR A;  2QI2 A;  4BWJ A;  3AU4 A;  3NAE A;  5JLF A;  3TAM A;  1LWE A;  4CIG A;  5BN9 A;  2IGI A;  4B08 A;  5FPE A;  4BAC A;  4PKG A;  5I42 A;  3H3O B;  2NRR A;  4FJL A;  3N4Q A;  4BE1 A;  4BRM A;  1LWF A;  4FPA A;  2A5X A;  2F8T A;  3ZT1 A;  2P9S A;  2ASO A;  3HYF A;  2HMI A;  1HKG A;  4EIA A;  4FW1 A;  2ITM A;  3OYI A;  1NK4 A;  1NJZ A;  4PKH A;  4LF9 K;  3VPZ A;  4QS7 A;  2XHB A;  4FPB A;  3RMD A;  3OYN A;  3KLI A;  4FM0 A;  1BIU A;  2YHB A;  1RTI A;  4K8Z A;  4KHS A;  3FZM A;  2VG5 A;  2VQE K;  2YKN A;  4GKK K;  4IXC A;  4CEE A;  3ULD A;  1HQE A;  3M5R A;  2ZD1 A;  2A1S A;  3ZSQ A;  5I3U A;  2VGN A;  2JWK A;  4ZTJ A;  4IOC L;  1HNI A;  4O55 A;  1HPZ A;  4BGB A;  4JKH A;  1NGE A;  1NGC A;  4JS4 A;  2P9I A;  5FPM A;  3EZ5 A;  4B9Q A;  4CIF A;  4CGG A;  5JVL A;  1KVB A;  2LBB A;  3Q7B A;  1XHX A;  1VSJ A;  3IVF A;  3F5T A;  4GV6 A;  4AHU A;  1XC9 A;  1KBL A;  1BO5 O;  2Q0R A;  5C15 A;  4FJ7 A;  2B6A A;  4BRK A;  3LP3 A;  1W7A A;  4KAZ A;  1ESV A;  3A5O C;  3AVK A;  5GAD P;  4TSX A;  3KVG A;  1C0G A;  2HBM A;  1A5V A;  3KKR A;  4JI2 K;  2GBZ A;  3K9J A;  2QM1 A;  4CEZ A;  3ZT4 A;  3OY9 A;  4JK7 A;  3OYL A;  4DV7 K;  3P38 A;  1VSK A;  2BE2 A;  3ZX2 A;  3T69 A;  2HBL A;  4PKI A;  3P31 A;  4F3T A;  4O8U A;  1GG3 A;  1RT2 A;  1VAZ A;  1GLL O;  4LF8 K;  3D0P A;  2BDP A;  5HRN A;  1VSM A;  5GAG P;  2RKI A;  3G10 A;  1BA0 A;  4A2A A;  4LFC K;  4WCE L;  2BGG A;  3CMA N;  1NOY A;  1C0F A;  3LDN A;  4CJK A;  1JLA A;  1HNZ K;  2WBN A;  3G9W A;  4GVM A;  3WXM B;  2HHT A;  4DSL A;  3AAR A;  5KGW A;  5AJ3 K;  2KFN A;  2PYL A;  4DU1 A;  4FJM A;  3V9W A;  4FLT A;  1HKC A;  4DU4 A;  3HVT A;  5F1X A;  4XIU A;  5BRF A;  1MK7 B;  4FWM A;  5KGX A;  3OYA A;  4DSJ A;  2O4G A;  4E7I A;  4CGF A;  4JD2 A;  3K58 A;  1Q81 O;  4B3O A;  5ADX H;  3UKR A;  4CEQ A;  5AQO A;  5J2N A;  1BHL A;  4K25 A;  4R79 A;  4ELU A;  2HHS A;  5C0Y A;  1HB8 A;  3WXJ A;  1U49 A;  1SZ2 A;  3KWI A;  1KLN A;  3S3O A;  1QZ6 A;  2GUP A;  1RT3 A;  3ZSX A;  1C1C A;  2E2N A;  3RMC A;  3TI0 A;  3I0R A;  3X23 A;  4M7Y A;  4EKU A;  3I55 N;  4F7G A;  1RBV A;  3R8E A;  4B1U B;  3SBT A;  1M1K O;  4LC9 B;  3DXK A;  3HM8 A;  5C2D A;  2G8W A;  2CGK A;  4EHT A;  3AA2 A;  1ZBS A;  1BCM A;  3CJB A;  4BR4 A;  2HHV A;  1OVQ A;  4O0I A;  1S5J A;  3M3Z A;  4NCA A;  3VTH A;  4C1N I;  3TAR A;  3I8B A;  3FZF A;  4B9U A;  5AQF A;  1HUX A;  2YNG A;  3CIP A;  5JLH A;  4M3W A;  3ZET A;  3ASM A;  2O8D A;  1EP4 A;  4DTP A;  4FWO A;  3THY B;  1HNW K;  3WT0 A;  4CK2 A;  3K5M A;  1T6C A;  4YOX A;  4B1Y B;  4ELV A;  2QK9 A;  1GLC G;  4DU3 A;  1XI1 A;  4WFN L;  5MLC Q;  4B3S K;  1ZBF A;  1DIK A;  4JHD A;  1DT9 A;  2R7Y A;  4U67 L;  4EAH D;  1W9H A;  4KV8 A;  3VEX A;  4YOV A;  2YKM A;  2YJE A;  5KQ8 A;  5J2Q A;  3U7D A;  3MXJ A;  3SBG A;  3CPE A;  3TU5 A;  4GW6 A;  1UOC A;  1HR0 K;  1BU6 O;  3NH0 A;  1T6D A;  2V7Z A;  1RBR A;  3B8A X;  4G9Z A;  4IFV A;  3ENO A;  3KHY A;  1K73 O;  1RTJ A;  4CI6 A;  1RT6 A;  1C6V A;  3CM5 A;  2OPR A;  5J2P A;  2G8V A;  4JI5 K;  1LV5 A;  2P9L A;  3MK6 A;  3GE1 A;  5AQZ A;  3AO3 A;  4BRO A;  4E7L A;  1NJW A;  3O4Q A;  5CZ1 A;  3CQ8 A;  3QEV A;  2XO7 A;  1NMD A;  3BIN A;  4B9M A;  4E7H A;  1IJJ A;  3KK2 A;  3MCA B;  2OPQ A;  2V51 B;  1CZ9 A;  4FJ8 A;  1ATR A;  2RPI A;  3NH2 A;  4HWI A;  3V1O A;  3ULE A;  2IIR A;  1OKJ A;  3NF8 A;  2QWR A;  1S72 N;  4H0P A;  4DMN A;  4GKJ K;  1NGB A;  4N41 A;  3O4N A;  3HBT A;  4EZ9 A;  3OS0 A;  1TAU A;  1XWL A;  2H3G X;  1QE1 A;  1SL2 A;  4E19 A;  3AVC A;  3WA0 A;  4CEC A;  1N8R O;  2ZPY A;  2GEM A;  3RRG A;  2FBV A;  1K8K B;  3LAK A;  4I9L A;  4OGC A;  3EE9 A;  1KCF A;  2ZJQ L;  4BWM A;  4F8R A;  3CCQ N;  4ILH A;  4DTS A;  4ZHR A;  5C24 A;  4CJS A;  3E9P A;  3OW2 M;  4I2Q A;  1EKE A;  3CCU N;  4FJH A;  5M1Q A;  2ABD A;  4BRA A;  3ZT2 A;  3OYG A;  3O5B A;  3NF9 A;  3LDS A;  1KVA A;  2WFB A;  3DAW A;  2Z1G A;  1G15 A;  4BDZ A;  3OBY A;  3C7N B;  2WOM A;  4HDO A;  4IEI A;  3DOK A;  1NKC A;  4DV2 K;  3ID8 A;  3S9H A;  1CLQ A;  2NRZ A;  4UQG A;  5BPN A;  2W42 A;  3RMB A;  4FOE A;  2ETJ A;  2RF2 A;  5EU7 A;  3CFP A;  4WE1 A;  4A2B A;  3PSI A;  3VQ7 A;  2ZGZ A;  2W40 A;  3FP5 A;  1YVN A;  2D0P A;  1D5A A;  1ISN A;  3HP9 A;  4E1J A;  1FK9 A;  4CBX A;  3CET A;  1VSE A;  3OYE A;  4DR3 K;  4CBU A;  1BCO A;  3HOT A;  1NK5 A;  1L3T A;  4IFY A;  2J0M A;  4DS4 A;  2J4R A;  5HRR A;  4YDU A;  1WSJ A;  3OA9 A;  4CEA A;  4DFP A;  3DXM A;  4LF5 K;  2VWK A;  1VBG A;  3LM9 A;  4F9O A;  4CCH A;  1HBK A;  4C8O A;  4GXB A;  4BGA A;  3C94 A;  3SJH A;  5CYM A;  3NBP A;  3IDH A;  1GLF O;  2FBY A;  3FZH A;  3AA5 X;  4R5P A;  4AHV A;  5GAH P;  1I94 K;  5HBM A;  1R0A A;  4E1N A;  5JS2 A;  3K2P A; 
#chains in the Genus database with same CATH homology
 1KXP A;  1NGH A;  3WEE A;  1YI2 N;  3HZ6 A;  1LOT B;  2QW9 A;  1JCF A;  3MCP A;  5JVH L;  3CCV N;  3W0L A;  1P90 A;  3TSQ A;  1QVG M;  4IOX A;  2E2O A;  4XH1 A;  2GWJ A;  3BUZ B;  1V4S A;  5C0Y A;  1NM1 A;  3PIP L;  3CER A;  3J8A A;  3R9P A;  4K43 A;  4IJN A;  2YX6 A;  3ZX3 A;  5CE3 A;  1MA9 B;  1EO1 A;  1XUP O;  5E84 A;  5AZI B;  2YJF A;  3DWL A;  3EN9 A;  3SMP A;  5AZI A;  1NGD A;  3IKM A;  3VEY A;  2FF6 A;  5GIO A;  4BC4 A;  2WC9 A;  1NGJ A;  3EKS A;  3Q7C A;  3PIO L;  1YJN N;  4WQ4 C;  1VQ4 N;  4JKF A;  4H0O A;  3PVL A;  1W2B M;  1JJ2 M;  4FOI A;  2QWM A;  3NVK A;  3QFU A;  4BRL A;  3FR0 A;  3C0B A;  3CJ7 A;  3WXK A;  1YHQ N;  2KLA A;  2EMS A;  1HB6 A;  4WQ4 A;  2V52 B;  4H0V B;  5AQQ A;  1VQ5 N;  4FWL A;  3D2F B;  4H0Y B;  1DEJ A;  3VER A;  3G71 N;  3FFK B;  3BF1 A;  1RFQ A;  3CC4 N;  3F9M A;  5I9E B;  4FWN A;  4XH5 A;  4ZRJ A;  2YI1 A;  2Q0U A;  1BWF O;  3SAG A;  2NRH A;  4FWK A;  1OVY A;  3CJ1 A;  4GV3 A;  4BR5 A;  4BVO A;  4JEP A;  4CZG A;  4QS8 A;  4CZH A;  4I6M B;  3K9K A;  2NLX A;  3TSP A;  4ISG A;  4DB3 A;  4KH4 A;  4KBO A;  3EE8 A;  5AQH A;  5LY3 A;  4TKN A;  1K8A O;  1KC7 A;  1KAX A;  3IFR A;  1LCU A;  2FF3 B;  3VTI A;  3WUH A;  2AP1 A;  3NVM A;  5BR9 A;  3QIJ A;  3A5L C;  5HL7 L;  3OBW A;  3DLL L;  1YIJ N;  2P9P B;  3L6Q A;  2I1J A;  1Y64 A;  5E26 A;  3G25 A;  3D6R A;  3UKU B;  3ATU A;  1NTI A;  2P9P A;  2D2Q A;  4HDQ A;  4FO0 A;  3UKU A;  4MO4 A;  4CZE A;  4K42 A;  3AGK A;  4JK9 A;  2D4W A;  3TTD A;  4EFH A;  3GL1 A;  2QWP A;  2COP A;  4MO5 A;  3SMS A;  3U9Z A;  2P9N B;  4ZRK A;  3U8X A;  4BRE A;  5BPL A;  1VQ8 N;  2P9N A;  3QML A;  4PHT X;  2QTD A;  3O9S A;  1MIX A;  5AFU A;  1NLV A;  1QQN A;  3H3N O;  3EZW A;  4CZM A;  3OHR A;  3BF3 A;  3QFP A;  2E1Y A;  2Q36 A;  3MN9 A;  4BRH A;  3HOS A;  1VBH A;  4FWR A;  2QI2 A;  1VQ7 N;  4JAX A;  3CC7 N;  4CZF A;  2RHK A;  2D10 A;  3AU4 A;  1ATN A;  4H0X B;  4XEI A;  4XH4 A;  5HOO A;  3TTC A;  5JLF A;  5KQD A;  1YJ9 N;  2BTF A;  2ASM A;  1QQO A;  5BN9 A;  2CGL A;  2Q2R A;  3A0I X;  3R3L A;  5FPE A;  1NJI O;  4PKG A;  2EWS A;  3H3O B;  1S22 A;  2NRT A;  3L4I A;  2NRR A;  1K9M O;  3VET A;  3N4Q A;  4BRM A;  1BOT O;  3D7E O;  4FPA A;  5AQL A;  2A5X A;  2P9S B;  4WYB A;  3S41 A;  2P9S A;  3LDL A;  2ASO A;  3E9O A;  1GGO A;  4RCH A;  1S3X A;  2A41 A;  2GX9 A;  1HKG A;  4JNE A;  1IG8 A;  4YDU C;  4EIA A;  2F9W A;  2ITM A;  1VQP N;  4YOY A;  4H5T A;  4PKH A;  4BY9 C;  3VPZ A;  4QS7 A;  5FPN A;  4FPB A;  3E9L A;  5LJW A;  4ILG B;  3QBW A;  5KPR A;  4CZK A;  3TTF A;  2NRV A;  2FSN A;  3JXU A;  4Z94 A;  4CZJ A;  4O8K A;  2D0O A;  5AQU A;  4H03 B;  5AQY A;  4MLE A;  3FZM A;  4AM6 A;  2IVN A;  3CCM N;  4H0T B;  1V4T A;  4IXC A;  3CCR N;  4M63 C;  2YVC A;  4U7B A;  3M5R A;  3RVC A;  1DKG D;  1VQ6 N;  3LDP A;  2VGN A;  2FJ9 A;  2JWK A;  4CZL A;  3MWT A;  3EO3 A;  5ELZ A;  5AQM A;  4A57 A;  4IOC L;  1X3N A;  3E66 A;  4JKC A;  4BGB A;  4JKH A;  1NGE A;  2DIK A;  3LDO A;  2HF3 A;  1NGC A;  1ZC6 A;  3LDQ A;  5AQK A;  4YOT A;  5BPM A;  3PLA A;  4CD1 A;  4BRN A;  3O1W A;  2P9I A;  3CCS N;  5FPM A;  2NRW A;  4B9Q A;  5IJM A;  3ZYY X;  5JVL A;  1VQM N;  2LBB A;  3Q7B A;  2A42 A;  4Y0W A;  5JMV A;  3SLC A;  4C23 A;  3IVF A;  3F5T A;  4GV6 A;  1VQ9 N;  5GAE P;  3HI0 A;  2Q1N A;  2A6A A;  4EHU A;  2CQU A;  1W97 L;  2FLO A;  1KBL A;  1G99 A;  1BO5 O;  3UB5 A;  3VGK A;  4CD3 A;  2Q0R A;  5C15 A;  5DM7 L;  3VGM A;  3CCE N;  2W41 A;  4BRK A;  1ST7 A;  2QWQ A;  3BP8 A;  1ESV A;  1M90 O;  4JKD A;  1H1V A;  2J0J A;  3A5O C;  3IMX A;  3U8Z A;  5GAD P;  3KVG A;  1C0G A;  1SAZ A;  2HBM A;  5CHI A;  1HLU A;  4NB4 A;  1KQS M;  4BRG A;  3K9J A;  3H46 O;  4BR2 A;  3EKU A;  1HJO A;  3P39 A;  2QM1 A;  3FZL A;  2NZT A;  5AZJ B;  5AZJ A;  4JK7 A;  2I1K A;  3P38 A;  4WF9 L;  3ZX2 A;  3D2F A;  3T69 A;  2HBL A;  1NGG A;  1WUA A;  5BRE A;  2HRJ A;  3SAF A;  4PKI A;  5AQS A;  3P31 A;  4BC2 A;  4O8U A;  1TYQ B;  1GG3 A;  2CGJ A;  5EXW A;  1VAZ A;  5JVG L;  1GLL O;  2HST A;  1GLA G;  3WXI A;  3L0Q A;  5LJV A;  1YIT N;  3CI5 A;  3ATV A;  4JK8 A;  4MDA A;  2ZJP L;  3NMU A;  4KH5 A;  1VQO N;  5GAG P;  2OTJ N;  4I6M A;  4A2A A;  1BA0 A;  3O9R A;  3FE1 A;  4WCE L;  1Z6R A;  3GOI A;  1NI2 A;  3CMA N;  4B1Z A;  2IVO A;  1C0F A;  1YUW A;  3LDN A;  2WBN A;  5AQV A;  4H5N A;  3G9W A;  3ZX0 A;  1BA1 A;  3WXM B;  4KH6 A;  4BVP A;  2E20 A;  1SS6 A;  3QB0 A;  3AAR A;  4IOA L;  3H1Q A;  4FL9 A;  4NY0 A;  3DJC A;  5GIN A;  3U4L A;  1KD1 O;  2V7Y A;  4FSV A;  4NO7 A;  1HKC A;  4BG8 A;  3CXC M;  3AGR A;  3ZEU B;  5F1X A;  2QEX N;  4DHY A;  3ZEU A;  5AQR A;  2YHW A;  5BRF A;  1MK7 B;  4BC3 A;  5C10 A;  4BRP A;  3MMV A;  1DGK N;  3N4P A;  4FWM A;  4BRQ A;  2JWL A;  3O8M A;  3C6H A;  3QIC A;  3VF6 A;  3SAH A;  4JD2 B;  1QVF M;  3MDQ A;  3RSE B;  4YOW A;  4JD2 A;  3RSE A;  3MN5 A;  1YJW N;  1YAG A;  3UKR B;  1Q81 O;  4FWS A;  3O9U A;  4L3Q A;  5ADX H;  3UKR A;  4PL7 A;  5AQO A;  2HBK A;  5EVZ A;  2F7T A;  4K25 A;  4R79 A;  1RDU A;  3QDK A;  4JKE A;  4CJ7 A;  2Q97 A;  4WFA L;  2R82 A;  1KAY A;  2VWB A;  4HTL A;  3P4I A;  1HB8 A;  3WXJ A;  4A59 A;  1QHA A;  3UE5 A;  5H1S Q;  4IJA A;  1Q82 O;  1SZ2 A;  3KWI A;  2QWL A;  1QZ6 A;  2GUP A;  2FDQ A;  1ATS A;  2HOE A;  4BRI A;  3VGL A;  2E2N A;  3TSU A;  3X23 A;  4M7Y A;  2I7N A;  4EKU A;  1NWK A;  3I55 N;  3D2E B;  4F7G A;  2AL6 A;  2D1K A;  3R8E A;  1JCG A;  3DXK B;  3SBT A;  2OAN A;  3D2E A;  3VEV A;  4B1U B;  2A3Z A;  4IZ9 A;  4B1V A;  4LC9 B;  3DXK A;  3HM8 A;  1BUP A;  4BR7 A;  4DQ8 A;  5C2D A;  1TUY A;  3W3D A;  2CGK A;  4EHT A;  3M1F A;  4ISF A;  2NNW A;  1MIZ B;  5KPT A;  1ILY A;  1GC6 A;  2WUS A;  1ZBS A;  2E88 A;  1RGI A;  3CJB A;  4A62 A;  4BR4 A;  4ILJ A;  1EQY A;  3MX5 A;  5F2R A;  3M3Z A;  2WH5 A;  1RDW X;  4B1W B;  3VTH A;  3G4S N;  3WXL A;  3VF4 A;  4BG9 A;  4NLB A;  4C1N I;  1WOQ A;  2QXL A;  3I8B A;  3FZF A;  3A8Y A;  3ID6 A;  5AQP A;  3ZET B;  5AQF A;  1HUX A;  3CIP A;  3O6W A;  3R1X A;  5B8H A;  3ZET A;  5JLH A;  2ZGY A;  3T7Z A;  2P9U B;  4FWO A;  5AQT A;  4H5R A;  3CQX A;  3WT0 A;  5M1K A;  2P9U A;  1GC7 A;  1QQM A;  1T6C A;  4WQ5 A;  4BR9 A;  4B1Y B;  4YOX A;  1T3V A;  1GLC G;  1ZXO A;  4WFN L;  3AU5 A;  2PBD A;  3C6A A;  5MLC Q;  4UY8 O;  2Q31 A;  4ZRI A;  4JHD B;  4MLH A;  5M1F A;  4IDH A;  1DIK A;  1U6Z A;  3A5N C;  3CJA A;  3KZB A;  4JHD A;  2CH6 A;  3LM2 A;  1DT9 A;  4YOU A;  4A5A A;  4U67 L;  4AF1 A;  1SQK A;  5FPD A;  1X9J A;  2ZF5 O;  3ENB A;  4BR0 A;  4EAH D;  2P9K B;  1Q18 A;  3VEX A;  4YOV A;  4BC5 A;  2P9K A;  4WFB L;  2YJE A;  3GBT A;  5KQ8 A;  4IO9 L;  3O1B A;  2AEH A;  3U7D A;  1JCE A;  3WQU A;  4BQZ A;  3SBG A;  3CPE A;  1YF5 L;  3H6E A;  4FWP A;  3TU5 A;  3WQT A;  1JDE A;  4YOR A;  5BRH A;  1R59 O;  2VGM A;  1BU6 O;  1T6D A;  2V7Z A;  1VQL N;  4QS9 A;  1MK9 B;  3MX2 A;  3VMF B;  3VEZ A;  2F9T A;  2RQ1 A;  3B8A X;  2EMT A;  5JIC A;  5M1N A;  4G9Z A;  3ENO A;  3KHY A;  1ACA A;  3GG4 A;  1K73 O;  3VF2 A;  3GDQ A;  3CD6 N;  4CI6 A;  2HMP A;  5CR4 A;  1MWM A;  2P9L B;  3I33 A;  1O13 A;  5C12 A;  2DPN A;  2P9L A;  1SGH A;  1D4X A;  3LL3 A;  1VQN N;  3CHW A;  3AY9 A;  2YCH A;  3MK6 A;  3O08 A;  4IFE A;  3GE1 A;  5AQZ A;  4BRO A;  1Q86 O;  1NGA A;  5KPZ A;  4JKB A;  3H45 C;  1TYQ A;  1NMD A;  3MN6 A;  3BIN A;  1BG3 A;  1CZA N;  4GVE A;  3AAP A;  3EL2 A;  3FZK A;  2J0K A;  5AQJ A;  4H5W A;  4O5F A;  4B1X B;  3O80 A;  5M1P A;  1IJJ A;  3CC2 N;  1QZ5 A;  5GIP A;  1GLD G;  3MCA B;  3IUC A;  2V51 B;  2QWO A;  2X0S A;  1VQK N;  3ULE B;  3FLC O;  1ATR A;  3AAQ A;  4HWI A;  1XC3 A;  3ULE A;  2IIR A;  3FGU A;  1OKJ A;  2HF4 A;  2VYP A;  2QWR A;  2QWN A;  1S72 N;  1BDG A;  4H0P A;  5F0X A;  4BRD A;  5ADX A;  1NGB A;  2E2P A;  3HBT A;  1Q7Y O;  3F2K A;  3VEW A;  2H3G X;  2YHY A;  1TUU A;  2E8A A;  2IVP A;  3VOV A;  3WA0 A;  1N8R O;  3JS6 A;  2CH5 A;  2ZPY A;  2GEM A;  3R6M A;  1K8K B;  4BRF A;  1NGF A;  3CJC A;  3U9D A;  2CB8 A;  2BUP A;  1K8K A;  3EE9 A;  5AQW A;  2ZJQ L;  1HX1 A;  3CCQ N;  4ILH A;  5BRD A;  3CPW M;  3CCL N;  2RE2 A;  1E4G T;  4JKA A;  2FSK A;  4IWV A;  3CCJ N;  4YL8 A;  4J8F A;  3HSC A;  3O9T A;  1EF1 A;  3E9P A;  1HPM A;  4H5V A;  1HKB A;  1M1K O;  3OW2 M;  3CCU N;  3QBX A;  5M1Q A;  2PAV A;  3BEX A;  2ABD A;  4GV9 A;  2BH1 A;  4BRA A;  3TPQ A;  4BRC A;  3KWG A;  4A61 A;  3O5B A;  3H1V X;  2WFB A;  3DAW A;  3HRG A;  2ZWH A;  4A5B A;  3OBY A;  3C7N B;  3C65 A;  4MDB A;  2QA4 N;  4HDO A;  4IEI A;  2GTD A;  3C7N A;  3CF5 L;  3VEO A;  4P7I A;  4GY2 B;  4RWT A;  3L4Q A;  5DM6 L;  2PFU A;  3O4W A;  3MWP A;  1E4F T;  4OPA A;  5TKY A;  3ID8 A;  2E1Z A;  4CYE A;  2NRZ A;  2UYT A;  2OTL N;  2HE7 A;  5AQN A;  2D11 A;  5BPN A;  1E5W A;  1NGI A;  1YXQ A;  3EPY A;  4FOE A;  5EY4 A;  1H4R A;  1GLB G;  3E1Y A;  5EX5 A;  2AA4 A;  1KAZ A;  2YHX A;  4JN4 A;  3J7Z O;  2VCP A;  5C2F A;  4A2B A;  4OO1 J;  2I7P A;  2ZGZ A;  2W40 A;  4GNI A;  4IO8 A;  3FP5 A;  1YVN A;  2D0P A;  5AFU H;  1ISN A;  4E1J A;  4FVU A;  1Y19 B;  3SK3 A;  4WQ5 C;  5AR0 A;  5BN8 A;  4CBX A;  2KHO A;  3CET A;  1GLJ O;  3M6G A;  3ZDT A;  1U2V B;  4DXA B;  2ASP A;  4CBU A;  4RTF D;  3HOT A;  4JKG B;  1NVL A;  1U2V A;  4NLC A;  2J0M A;  1T44 A;  4JKG A;  4CBW A;  2A40 A;  4CZI A;  2J4R A;  5EOY A;  1XQS C;  4ISE A;  1Z05 A;  3ENH A;  4YDU A;  3KK7 A;  3FLV A;  2FXU A;  3DXM B;  1NBW A;  3OA9 A;  1J19 A;  4M7X A;  4PL8 A;  2NRX A;  5AQI A;  3DXM A;  4K41 A;  4AM7 A;  4FWQ A;  3O9Q A;  4OPH A;  1VBG A;  3A5M C;  3LM9 A;  5TKW A;  4F9O A;  3CJ9 A;  2E2Q A;  1GLE G;  3CQY A;  1HBK A;  2FSJ A;  4GXB A;  4BGA A;  4C1N K;  3SJH A;  2ZJR L;  4IEE A;  1P8Z A;  3IDH A;  5M1O A;  3I56 N;  3VEN A;  1GLF O;  3VES A;  3FZH A;  4DKW A;  3MN7 A;  4BQL A;  1X3M A;  3HTV A;  5AQX A;  2KKZ A;  3G6E N;  3CME N;  1KC8 O;  2P9I B;  2GWK A;  5GAH P;  1MDU B;  4DCH A;  3PZD A;  1J6Z A;  5AQG A;  3WEE B;  2HBJ A;  1MWK A;  2GEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...