4JKAA

Open and closed forms of r1865a human prp8 rnase h-like domain with bound co ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkaA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkaA01
3E9OA 3ENBA 4JKCA 4JK9A 4JKEA 3SBGA 4JK7A 4JKAA 3E66A 4JK8A 4JKBA 4ILJA 3SBTA 4ILHA 4JKDA 4JKFA 4JKHA 4ILGB 4JKGA 3E9PA 3E9LA 4JKGB
chains in the Genus database with same CATH superfamily
3OBYA 2NRTA 2OPQA 5AQWA 3CMEN 2P9IB 4JRPA 4KTQA 2BE2A 3ZCMA 1Y97A 1ZC6A 4E0DA 3JS6A 3CCVN 1QSSA 5FDLA 1WSFA 4C8LA 1IKXA 3AV9A 4DCHA 5C15A 1VSHA 2AP1A 5SWMA 1D4XA 3TAQA 3KKRA 2HHWA 3IAYA 4ILJA 4CIEA 4F4KA 2WBNA 3G71N 1NJYA 3PZDA 3ULDA 4ILHA 1LW0A 3O08A 2A5XA 4KB1A 2VG7A 3C6HA 2JWKA 4ILGB 2O4IA 1KXPA 5KQ8A 1HPZA 2E1YA 5AQSA 5J2PA 4B8CA 2V7YA 1TK0A 2UYTA 3KVGA 4B9QA 2Y1JA 3AVBA 4YOTA 2P1JA 3LPTA 1LV5A 2V7ZA 2E5LK 4DV1K 1EQYA 1NM1A 3AVLA 3VQ4A 2XY8A 3RRHA 1JLEA 4DFPA 1P90A 3VQDA 3DRSA 4DV6K 2D5RA 4E1NA 4CHYA 4IJNA 3ENOA 3WXLA 4GV3A 2HSTA 5HRSA 3BUZB 3D2EB 2E8AA 1WUAA 4CEOA 3AVAA 4R79A 5SZTA 3RR8A 2KZMA 1KD1O 1D9DA 3J80O 1SQKA 1J5EK 4H0PA 4CJPA 2D11A 5ADXH 1P8ZA 4FO0A 3J7YP 2YNGA 4BRPA 3FE1A 2E2QA 4JKBA 1T03A 3CCEN 5A2QO 3VQQA 1QQOA 4CJLA 4NXMK 3EE9A 3NDKA 3HM8A 3V1RA 4OLAA 1CXUA 2A42A 3AA5X 4I9LA 4DR4K 1MDUB 4PKGA 2FBXA 4IDHA 4IG3A 2F8TA 2W41A 3L2RA 2PYJA 1VQKN 1NJIO 2ASPA 1RBTA 2DPNA 4CJFA 4AHVA 4BWMA 3NCIA 3PIPL 1ZBIA 1E4GT 5M1FA 3SAGA 1BWFO 3KKSA 3CG7A 2CGKA 3CXCM 3CCQN 3SK3A 4FW2A 3WQTA 2ZPYA 3LANA 3DLEA 4JLHA 4KTWA 2HF3A 5AZJA 4E1JA 4WCEL 3BZKA 3TPQA 3TR8A 3ZDTA 4JI3K 4IBNA 1XMOK 4NYFA 2UUBK 1CLQA 3LZIA 4XH4A 3CI5A 3MXJA 5C24A 2VCPA 4AHRA 5J1EA 1ATSA 5JVGL 5AQGA 5HBMA 1RBVA 1W97L 4HDQA 1KAYA 1U4BA 1D9FA 1R59O 4CGFA 5FPNA 4A59A 4ZRKA 4IDKA 2P9IA 1VQLN 5AQIA 1LWFA 2XO7A 3D2FB 2X0SA 5EX5A 1UA0A 3HK2A 3VQ6A 1GOBA 1JJ2M 1Y64A 4JN4A 3SLCA 4FJXA 1VQ6N 3UKRA 5I42A 4JI5K 2KQ2A 4KH4A 2O8FA 4YOYA 2ITGA 3C6UA 3KK2A 1FKPA 2NUBA 1ZYQA 3AVCA 5KI6A 5AQZA 3K0SA 3RWUA 1KVBA 1RTJA 4CBUA 4M41A 1L3TA 3MWTA 2QW9A 1KSPA 3PO4A 2PZSA 2UXDK 1HKCA 5J2QA 3VQ9A 5CZ2A 4QS7A 2HOEA 3I8BA 4HTLA 4DWIA 1JLGA 4FOEA 4BQLA 2GX9A 3VGMA 1FW6A 4CJ4A 4QOZB 1YIJN 4BC3A 3O9RA 3QFUA 3ZSYA 4H0VB 1BG3A 4B1WB 4EHTA 3R6MA 3VEVA 2YJFA 4IEIA 4CZJA 2A40A 3CMAN 4KREA 3PVLA 4I2QA 4B1VA 1YTAA 4B8AB 3QMLA 3I8DA 3CIPA 1ILYA 3CC7N 2P9UA 3IUCA 3KK3A 4LH5A 3HBTA 4DQIA 1KBLA 1L3VA 2O8DB 2FXUA 4ZTFA 4FWLA 3M6GA 1XHZA 2IS3A 3NGZA 2DFEA 1RFQA 1GOCA 5CYMA 3PLAA 3LP0A 3O1WA 2WH5A 3OYDA 1NGBA 2P9PA 4JI8K 4M45A 3IKMA 4BRNA 2Q36A 1GLCG 2HHXA 1RBUA 2P9KA 2FSJA 3S3NA 1S9EA 3AVIA 1QZ6A 2E2NA 3K57A 2XRIA 1JL1A 3P39A 3OTOK 4WE1A 2NRRA 3DJCA 4Q0BA 4CGJA 2O8BA 4RG8A 4N76A 4K8ZA 4CGIA 2V51B 2D0CA 1IBLK 1KVCA 4CJ3A 4FWQA 5ELZA 1OH5A 5EXWA 2D0AA 3F9KA 4O5FA 3ZSOA 4FVUA 4YOVA 3KLFA 1SGHA 2HBLA 1SL0A 1K8KB 3IVFA 4FLYA 5AQXA 3FLCO 3ATVA 4CK3A 4CF2A 3KJVA 1NJWA 3QIPA 4X62K 1B9FA 3MWPA 3TAGA 1FXXA 2HW3A 3V1QA 3A2FA 3F5TA 1VQ7N 3BINA 1JCEA 5GIPA 4DS4A 4JKCA 3AU5A 2FF3B 4F2SA 4NB4A 4BC2A 1Q82O 1GLAG 1GLLO 4DSEA 4IOXA 3P38A 1ZXOA 3K59A 2ZD1A 4JI0K 1Y19B 2VQEK 3CYMA 4H4OA 2EX3A 5HP1A 2OPSA 3QBXA 1GG3A 3BY5A 1KAXA 3NMUA 4FOIA 1OVYA 4A5AA 1YUWA 4BRFA 1HKGA 2OPRA 4H0TB 4DTXA 2ASOA 3AAPA 4WF9L 1NOYA 1NK4A 3DLGA 5C12A 1QQMA 2W40A 1KRPA 2O8FB 3VMFB 4FZYA 3VESA 4IZ9A 4DFKA 1SZ2A 2RQ1A 4OPJA 3CFRA 4M42A 4FYDA 4IEEA 4EIAA 1DTQA 1QS4A 2YJEA 3D2FA 5LL6Z 4CGGA 3OYHA 3S3OA 4KKOA 1GLEG 1YI2N 1D5AA 3AVKA 3D6RA 3ZT4A 4ISGA 5BREA 3O3FA 4DQQA 3TARA 4DV4K 1K9MO 4J2BA 4V19S 4WFNL 3KWGA 1RDAA 3CD6N 3M8RA 4DFMA 2GELA 3NF8A 1B92A 1HQEA 1UAXA 1D8YA 4PUOA 2JGUA 2E88A 4H03B 1YHQN 1BCMA 2OYQA 2R7YA 3A8YA 3SQ1A 2D1KA 4KAZA 2WUSA 4KHPK 4LF5K 3T69A 3OVNA 4YFUA 1LAWA 3VF6A 1LOTB 5BRFA 3SV3A 4YOXA 3BP8A 5BRDA 3U9DA 4RWTA 3VA0A 2YHAA 3C7NB 3NFAA 3VEXA 3WXMB 5D3GA 3LP1A 2VQFK 1TAUA 4CHZA 2QKBA 2ZQBA 4FK0A 3OYIA 3NGYA 4AHCA 3M8QA 3RTVA 1V4TA 2IIRA 3L8BA 1C0TA 4CZFA 1NGCA 1SAZA 5C2FA 3N4PA 4MLHA 4CBXA 1VK0A 3CFOA 2G8FA 1IO2A 3G4SN 5H1SQ 1XHXA 1NGEA 1WSJA 1HNZK 1IKVA 3OYJA 4CGDA 1JLCA 4DR3K 3DXKA 5AQJA 1QVFM 3FZHA 3L3VA 1HQUA 1RT2A 5LJWA 5MLCQ 3CC4N 3EEQA 1DKGD 3WEEB 4Z0UA 2OTLN 2GBZA 2ZWHA 3ENBA 3VQEA 3DOLA 3J8AA 1NGGA 1O1WA 3SBGA 4BE1A 1K8KA 3ZEUB 2Q3SA 4NCAA 4CERA 4CJUA 1TKDA 4RW9A 3OYGA 4DG1A 4J2AA 4CHNA 3B6OA 2KLAA 1W2BM 1U47A 5AQQA 3OBWA 4YOUA 1RT5A 3VENA 3V9SA 4B9UA 3AVFA 4F9OA 3MEEA 1NK7A 4CZHA 2YNHA 2W6LA 2KZZA 1T44A 5AQLA 2FBYA 4DUZK 1DT9A 1O13A 2HF4A 3MN7A 3O4NA 1NMNA 4W5QA 3ZSRA 1TKTA 1RT1A 3HL8A 1QVGM 4MO4A 2G8IA 3SQ4A 2RPIA 5JVHL 3U9ZA 4DTJA 4EZ9A 2B5JA 1BHLA 2BTFA 3MK6A 5JS2A 1BQNA 3SUPA 2IC3A 4LSLA 3CJ9A 4OJRA 2PYLA 4FWSA 4BQZA 3WA0A 2FSKA 4BVPA 4KH6A 4NLBA 4H5WA 4PL7A 4IFEA 4LFAK 3SJHA 3H1VX 3VTIA 1R0AA 4JKFA 1XUPO 3C6AA 3O9UA 3FZFA 4OO1J 4RW6A 4J8FA 4E19A 5JVLA 3WT0A 4GW6A 4TKNA 3HPOA 2DTUA 5HL7L 4BRDA 3DYAA 3KLGA 5GAGP 4FM1A 3QERA 3KK7A 4BR9A 3VQPA 1VSFA 4DF4A 4XIUA 1UOCA 1KAZA 1T7PA 4NLCA 4CVNE 4EP5A 3KK1A 4IFVA 1BL3A 2QWNA 1A5WA 1VRTA 3AGRA 4O0JA 1VSDA 4DSFA 1OVQA 2G8WA 3CJBA 4FW1A 4BDPA 5AQFA 3IMXA 2HHUA 4K43A 3EN9A 3KD5E 1YF5L 5AQTA 5FPMA 1MA9B 2KTQA 1LW2A 2NLXA 4CF1A 2IOCA 3O8MA 5EU7A 2J0MA 4CEEA 1NJXA 3EKUA 3C6TA 3CJCA 3AVHA 1A5VA 3LDPA 4ZHRA 5AJ3K 1H1VA 1VQNN 3NF9A 4DTSA 3TSUA 1N33K 3FFIA 1RT3A 2D2QA 3J81O 1X9WA 2HHHK 4FJKA 4FM2A 5CYQA 3V1OA 1BQMA 1JXEA 1T3VA 5KRSA 4DUYK 3NAEA 4ELVA 3DM2A 1ITGA 3KTQA 1NOZA 4MFBA 3S3MA 4DTNA 3EKSA 4DFJA 4ZTJA 3DLHA 4PA1A 4BR0A 5AFUH 4O8KA 3VQCA 4FPBA 4DF8A 5LY3A 2HBMA 4YY3K 4GV6A 4F3TA 3QINA 3SUOA 1DLOA 5E26A 1JKHA 1RDBA 1IJJA 3TWHA 3VGLA 4DQ8A 3MEGA 4MDBA 3QNNA 2GWKA 5IWAK 3NF7A 1CZAN 4BREA 3AARA 2NZTA 2P9SB 1EWQA 2IGIA 4B9MA 1RNHA 1HNXK 4I6MB 4KHQA 3PY8A 4BR4A 3SUNA 5JICA 4WFBL 5CZ1A 5IJMA 4DSIA 5M1QA 4KO0A 1I94K 3CPEA 3DI6A 3NH2A 3CCSN 1T6CA 1QSLA 1LAVA 5BR9A 2PAVA 2YHBA 4JS4A 3ZT1A 4KHYA 2NRVA 2RKIA 3IS9A 4B08A 4CFDA 4N41A 4IXCA 5LMNK 5C42A 1V4SA 1NK8A 1ISNA 3HOTA 4WQ4A 4IKFA 1NKEA 3HZ6A 3SYZA 3RMDA 2R82A 1KVAA 3EO3A 4BDZA 5BR8K 4XH1A 1OH7A 1C0GA 4OGCA 3G6EN 2P51A 4JKEA 3A5LC 1X9SA 2IVPA 1G99A 4FLVA 2HBJA 1CZ9A 2WONA 2DFFA 3VTHA 2QTDA 2O8EA 2HHTA 3VPZA 1LWEA 3NH1A 4K41A 1VBGA 3UKUB 4PKIA 4HCCA 4NCBA 3ZETA 4CZKA 3K9JA 3J7AP 4LF4K 1U6ZA 1QHAA 3V9WA 3GG4A 1TUYA 2ZJQL 3THWB 4DR1K 2UU9K 2DFHA 3SMSA 2FLOA 3LDNA 5AQKA 3HT3A 1RTIA 4FSVA 4LFCK 1YJWN 4GNIA 2D0BA 4CJ5A 4CEZA 3U8ZA 1WNSA 2YNIA 2GWJA 5KRTA 1IG8A 3ZX2A 4E7JA 4JI1K 2HVIA 2HBKA 4LD0A 3TTCA 3G0ZA 4ICLA 4Q5VA 2HB5A 4BR5A 3OS2A 4IG0A 1XI1A 4W5RA 4CHPA 3ZEUA 1NGDA 2A6AA 3QDKA 3DWLA 3TSPA 1TV6A 3KHYA 3ATUA 3TSQA 4CFCA 4JYAK 3ENHA 4F7GA 4FVMA 1BIZA 4FJLA 1CXQA 3JXUA 1WOQA 4JI7K 1N34K 3OW2M 5AQPA 1VQ9N 3VQ7A 4BRCA 3X23A 4X65K 3F73A 2G8KA 2VGMA 3LDQA 4DV3K 3PSFA 4IOAL 4JKDA 3RSEB 3THXA 5CHIA 5AQVA 4OKJA 4G1QA 4HWIA 4BR7A 2F4VK 3E9OA 3QEIA 1Q9XA 4KH5A 3TAFA 3VF4A 1BO5O 4JNEA 3H45C 3PUFA 3THWA 3K5MA 1I3AA 4A2AA 4DU3A 4B1ZA 1WB9A 3MN9A 3C0BA 4IFYA 1QTMA 3NVKA 4H0OA 1X3MA 3O5BA 3UKUA 4N56A 3CCRN 2VGNA 2Z1IA 3GOIA 5M1NA 4NXNK 2I1JA 4JKGB 2XY7A 4B3RK 3D0PA 3AVGA 4JK9A 1TGOA 4FZXC 2OCEA 2KKZA 1RTHA 4EP4A 2NNWA 4IOCL 1KQSM 4IWVA 4O8UA 4DTOA 1UA1A 2BDPA 1JL2A 3RVCA 3O1BA 1NKBA 2HNDA 3B6PA 3HYFA 4AH9A 1S1UA 4CI6A 2H3GX 3O80A 1C1BA 3D7EO 5AZJB 4CD1A 5F2RA 4FJNA 1NU0A 3BF3A 3MXMA 4UQGA 4CJEA 3ZX3A 1W0HA 2P5GA 5TKYA 4JS5A 3QESA 1S1WA 3SI6A 3O9QA 2YVCA 4C8NA 2UXBK 4X66K 1J19A 3VEZA 4GXBA 4ID5A 3QIJA 4DR6K 3HI0A 4KBOA 2F9TA 4CEBA 3GL1A 1S3XA 5HLFA 4H5RA 4FL9A 4YORA 2I1KA 4QCLA 1EX4A 5C2DA 5JS1A 4PL8A 1DGKN 1ASVA 2YX6A 4CZGA 3QBWA 1JDEA 2I5JA 3F2KA 4CZMA 3EY1A 1W7AA 1M1KO 4IJAA 3VQ8A 3IDHA 4DKWA 2QWQA 4CEDA 5AFUA 4J2DA 2KHOA 2CGJA 4W5NA 3BDPA 4OKEA 3KLIA 4A2BA 2CQUA 3E66A 1X9MA 2X6NA 4OPHA 4JK8A 5HRNA 3CJ7A 2BUPA 4KTZA 2GUPA 2W42A 1KC7A 2D0OA 3LZJA 4FJ9A 4HTUA 3B8AX 2NRHA 1FKOA 4FK2A 3MCPA 3SJJA 1C1AA 3CERA 1NLVA 2DY4A 3TI0A 3LM2A 4AM7A 3K9KA 3H6EA 2QXLA 2ZE2A 2FJ9A 2FBTA 4ID1A 4EHUA 4ELTA 3VOVA 1HYZA 4CD3A 4JHDB 5JMVA 3CHWA 5BPLA 3N4QA 3ID8A 3CM5A 4HUGA 2QK9A 3RRGA 4LF7K 3RR7A 1XMQK 3ULEA 3AA4A 3ITHA 3VQ5A 3SNNA 2J0JA 5FPEA 1KC8O 1RBSA 4BRMA 4DSJA 4MO5A 4RW4A 1MWMA 3K58A 4B9TA 1S1TA 3PX4A 1JCGA 3PX6A 2HMIA 4G9ZA 1S9GA 3H08A 1DIKA 1NK6A 4H0XB 1TKXA 3VEWA 4CJKA 1NGFA 5ADXA 4FM0A 4B1XB 3SUQA 1HNIA 3R9PA 3CQYA 3CC2N 2BGGA 4B3SK 4CHQA 4M3WA 4NY0A 1E3MA 4J2EA 4RCHA 5M1OA 1Z05A 1ATRA 1I39A 3CETA 4JEPA 3ZSWA 4AF1A 4BRQA 1N36K 1ACAA 2HHQA 3AA3A 4CE9A 3HPHA 1U48A 1C1CA 1GC7A 4PHTX 4KRFA 1REVA 5TKWA 4IO8A 1SUQA 4B3OA 3AGKA 4BROA 4Y1DA 2ZJRL 1VSEA 4FWPA 4H4MA 1VSJA 4ZRIA 1NGIA 3E9LA 4FXDA 1YAGA 1S6QA 4CK2A 1NVLA 3LDOA 2XHBA 3WNEA 4OKKA 1J53A 5GINA 4E3SA 5HROA 2J4RA 4DTPA 4K42A 5KGWA 3OYLA 1Q86O 2ITMA 1VQ4N 1MIZB 4OX9K 3ZX0A 5DM6L 4JI6K 3FZMA 1TK8A 1T05A 5E84A 4NYNA 4NO7A 3AU4A 5CE3A 2NRZA 2E4LA 3OS0A 3T1YK 4CCHA 1SKSA 1Q8IA 1BISA 3Q7CA 3A0IX 1DEJA 4WQ5A 4E7KA 3I33A 4U67L 4B9VA 1NGHA 1HBKA 5DK5A 1X9JA 4ELUA 2O4GA 4JHDA 4M3ZA 4FJ8A 4ISFA 2GUIA 3QEPA 3HP6A 4X64K 1ATNA 4I9QA 3TAEA 3DRPA 1Q81O 4FJHA 4PQUA 3F9MA 4H5NA 3MCAB 2Q1NA 2XY5A 4KPYA 2QI2A 4BGBA 2Z1HA 4BG8A 1VQON 2A1SA 4CK1A 3O9SA 2F8SA 3AVMA 2HRJA 1QSYA 4GVEA 1RDCA 3CCMN 1NJZA 4O44A 1GGOA 4BRHA 1K8AO 2HMPA 2O8CA 1ASWA 2OA8A 1IH7A 5LMUK 1VQ5N 3UE5A 2AJQA 3LALA 4WQ5C 3HVRA 3K2PA 3CCUN 1BU6O 3MN6A 1J54A 3L3UA 2YHYA 5HOOA 4DSKA 1BI4A 4F2RA 2W6KA 4FJ5A 3OJUA 5KPZA 1NBWA 4BE0A 4PKHA 1KLMA 1VSMA 3NGIA 1VQ8N 1EWRA 4B9LA 1VRUA 4JKGA 5FRNA 4FZZA 1HLUA 2D10A 2HNYA 2J0KA 3VQBA 3G10A 3EPYA 3MMVA 3VQAA 5GIOA 1WAJA 1KFDA 1NI2A 4DQRA 4E7HA 4GY2B 2WC9A 1BA0A 2YV0X 4M3XA 2QEXN 2VWJA 3HM9A 1WLJA 1U45A 2OTJN 1VBHA 4LH4A 3SQ2A 3VEYA 4KHNA 3DAWA 4C23A 4ISEA 4WYBA 4I7FA 2ZJPL 3OY9A 4HDOA 3L4QA 5GAEP 2EMSA 4CZLA 3LDSA 3QICA 1BI4B 4BR2A 4M7YA 1Q18A 3OYKA 3NF6A 4KHUA 3OYCA 4FLZA 4FWRA 3KWIA 2GV9A 3E1YA 2WFBA 1GLDG 1EXQA 1EETA 4Y1CA 1Q9YA 3A5NC 4LC9B 3WNHA 4CIFA 1HNVA 1J6ZA 3JAMO 4M3YA 3OYBA 1WBDA 4A62A 3VN5A 4E89A 2ETJA 3ZT2A 4EZ6A 3P4IA 4B1UB 4DR2K 2X78A 1OH6A 2YHWA 2YKMA 5FLXO 4LSNA 3O3GA 2VG6A 4CJWA 3IG1A 4RW8A 3MDQA 1HB6A 3U4LA 4AHTA 5AQHA 4DQSA 4AM6A 3CQ8A 3MAQA 4M7XA 4CEAA 2VG5A 1N8RO 3S41A 2JWLA 3ZSXA 1N5YA 2IAJA 1E5WA 4O0IA 2IDOA 1HKBA 1HUXA 4CF0A 3QEXA 4PWDA 3HJFA 4GKKK 2P9NA 2AEHA 4FLTA 3JSMA 1L3UA 3BEXA 2HVHA 3NH0A 3CFPA 1K6YA 1HJRA 4DB3A 2F96A 3H1QA 5JLHA 3C65A 4W5TA 3IFRA 5HRPA 1UWBA 1VQPN 1TVRA 2COPA 1J5OA 4BRAA 4HUEA 5EOYA 4C8KA 4F8RA 4C8OA 5AZIB 2OANA 2QWOA 2O8DA 2QWPA 4OVLA 3OYFA 5FPDA 2IVNA 4YDUA 5BN8A 4LF8K 3V6DA 1U2VA 5EVZA 1MK7B 1S5JA 1HX1A 3G9WA 4L8RB 5F0XA 1MWKA 2WTUA 4Z4FA 1H4RA 3FR0A 1JLQA 4UY8O 4DV2K 4BDYA 4C1NI 4CF8A 2YKNA 1IKYA 2YNFA 1ZBHA 2UXCK 1BA1A 2LBBA 3LP2A 3NBPA 2V52B 1L5UA 3I0RA 1GLFO 2ZM6K 1BDGA 4ZRJA 3H3OB 3HP9A 3KZBA 4B3MK 1RTDA 3WUHA 3AO5A 3LAKA 4O55A 2RHKA 3VETA 4Y0WA 2DIKA 4JRQA 3SQ0A 4LFBK 4M3TA 4HUFA 4U7BA 3U8XA 1M90O 4WQ4C 1FK9A 2A1RA 1TKZA 1YJNN 5BPNA 3THYA 4E7LA 5J2MA 3W3DA 3WNFA 1E4FT 2P9SA 2XY6A 3ZSVA 3HXMA 4GV9A 1NK9A 4BRLA 4E1MA 5JLFA 4DV0K 4R5PA 4FCYA 3AO3A 4OPKA 3DXKB 1L3SA 1QQCA 4FWNA 2E6MA 2VWKA 3AVNA 3R1XA 4LF6K 1HJOA 2P9NB 3RMBA 4FWKA 4XH5A 3RMAA 1S6PA 3FZLA 1K73O 5AQUA 1GLBG 1S22A 3OA9A 1RDDA 1TUUA 3WXIA 4DV7K 5KPRA 2UUCK 1WSIA 3U7DA 1Z26A 1WSHA 2QXFA 5M1KA 4K0KK 5AQMA 2LSNA 3HRGA 3T1AA 3L2UA 3FP5A 1N6QA 4A5BA 4QS9A 1IG9A 3O6WA 3EZWA 5DM7L 1YTUA 3T19A 3QLHA 5I3UA 1XNRK 3CF5L 4CJQA 3K5OA 4CZEA 4O5BA 3V9UA 2B4JA 2OPPA 3PSIA 3DOKA 3M3ZA 2PBDA 2QA4N 4LY7A 4BC5A 3LL3A 4H5TA 1HRHA 3GE1A 1JCFA 4YNQA 4JV5K 4BVOA 4P7IA 1TL1A 3OS1A 2Q0RA 3E9PA 1HMVA 2AA4A 3LM9A 3VGKA 3LDLA 5FRMA 1EKEA 5CR4A 2OZMA 4JK7A 4JKAA 1WN7A 2ATQA 4BRGA 3THVA 4FWOA 1BCOA 3WQUA 2NRWA 2GTDA 1IBKK 1S72N 4FWMA 3LWMA 4E7IA 3A5MC 5KTQA 4BY9C 2O8CB 3E01A 3CM6A 4H8KA 5F1XA 1TK5A 3D2EA 1W9HA 2Q97A 5LJVA 4C8MA 1RT6A 5T7BA 3MEDA 5IT9O 3M1FA 3ZT3A 3DLLL 3AA2A 3MN5A 4N5SA 4GKJK 5FROA 1NMDA 1KLNA 2ZF5O 1VSIA 3Q7BA 5AQRA 3WXJA 1VSKA 3P83D 3L2WA 4K8XA 1NWKA 3IRXA 4JD2B 2G8UA 3L0QA 3OYAA 2FBVA 1DTTA 4FLUA 5BPMA 3I56N 2AL6A 4CJTA 1IKWA 1VSLA 2RN2A 4YDUC 4BWJA 1T6DA 5BRHA 3ASMA 4K25A 3V81A 4DLEA 4DV5K 1U2VB 2D0PA 4B9SA 3K5NA 2X6SA 3C95A 4BG9A 4CF9A 1RGIA 4CJ7A 3FZKA 2P9UB 1MIXA 5HRRA 4A57A 4Z4EA 2HHVA 5KPTA 4Z94A 2E2PA 2HHSA 1FJGK 4Z4HA 4OLBA 1YITN 3M8SA 3BZCA 2CB8A 1QQNA 4GMJB 3MX2A 1KCFA 4CEQA 1WBBA 1HYVA 1GC6A 3HPGA 3M8PA 3S9HA 2E6LA 5K14A 1NNEA 5M1PA 3VA3A 2O8BB 3QFPA 3AAQA 3ISNC 3AVJA 5DMRA 2P5OA 3L2VA 1BUPA 2E1ZA 3OHRA 3T7ZA 3O3HA 1HNWK 5GAHP 3M5RA 4H5VA 3SCXA 5CY4A 3QO9A 3BGRA 1IV0A 3UB5A 3VF2A 3TABA 2UUAK 3OYMA 4CECA 5C0YA 2KFNA 4DQPA 2A41A 3DLRA 1YVUA 2GEMA 3AY9A 4EFHA 1EF1A 3ID6A 3P31A 4W5OA 4B9NA 5E41A 4LF9K 3QB0A 1JLAA 1XC3A 4CFAA 5AZIA 1RILA 2Z1GA 1GLJO 4DR5K 1JLBA 4KFBA 3R3LA 3QNOA 3O9TA 3HSCA 3DLKA 2BANA 2Q2RA 3CJAA 3UIQA 3L4IA 2ABDA 4OPAA 4FJIA 2JLEA 3ULEB 3AO4A 1EO1A 1HR0K 2I7NA 1SL2A 1SKWA 1XQSC 3J7ZO 3EL2A 4HCBA 1YJ9N 3SPYA 2D4WA 1EP4A 1T8EA 4DR7K 2OZSA 4CESA 3AO1A 4YHHK 3D45A 3MXIA 2G8VA 2QWLA 4M3RA 3C94A 5J2NA 4IO9L 4CHOA 2FF6A 3HTVA 3G25A 1U49A 2ASMA 3JYTA 1NG9A 3LWLA 4DU1A 3SMPA 4XEIA 4FLXA 3LPUA 3BF1A 4CEFA 4BACA 1S1XA 2F7TA 1BIUA 3P5JA 2Z1JA 1NKCA 3WXKA 5B8HA 3CCJN 3WEEA 3L2QA 1KTQA 1C0UA 3NHGA 1NK5A 3UKRB 4HHTA 4B1YB 1RCHA 4CFBA 4Z4IA 1MK9B 1WAFA 3LAMA 1YXQA 2CH6A 4DTMA 4F3OA 3CCLN 1SV5A 1N32K 3MECA 1NGJA 1RDUA 2IVOA 3V4IA 2QKKA 2PFUA 1MU2A 3U3GA 4CZIA 2WOMA 1ASUA 4JD2A 3CQXA 3T3FA 1OKJA 5BN9A 4JI4K 3TANA 3SAFA 1C0MA 1GOAA 3GDQA 4HVJA 3TTDA 5C25A 3ZYYX 1NTIA 4JAXA 1TYQB 3SBTA 4FLWA 3V9XA 5EY4A 1WSEA 3SAHA 4KV8A 5GADP 2YCHA 1HPMA 3C7NA 1YVNA 2CGLA 2PY5A 1TAQA 3V9ZA 4AQYK 1ZBLA 4JKHA 4JI2K 4Z4GA 3HO1A 1X3NA 4KHSA 3KLHA 3QEVA 3QEWA 4CW7B 1TYQA 4M63C 4I6MA 2RF2A 4CBWA 4BE2A 3ZT0A 3EZ5A 3I0SA 1Z25A 1G15A 4BC4A 3H3NO 3I55N 2P9LB 4MLEA 3W0LA 4OGEA 4FPAA 2G8HA 1HYSA 4DXAB 1RDWX 4KHWA 1Z6RA 1ST7A 4BRIA 3DLBA 4CJSA 3PO5A 3CPWM 4BRKA 1Q7YO 4KI4A 2Y1IA 3HSTB 4CJRA 2BH1A 4CYEA 4DU4A 3T1HK 1RBRA 2P9LA 1F21A 3OJSA 4GVMA 2Q31A 2X74A 1JXBA 1XWLA 2RE2A 4AILC 1VQMN 3NVMA 4DTRA 3TTFA 4FJJA 1BOTO 3L6QA 4PY5A 4FJGA 1QZ5A 4M3UA 1RT4A 2NRXA 1A5XA 2ZGZA 4O4GA 1OH8A 3HVTA 2KW4A 1CZBA 3K5LA 4FK4A 1S1VA 1SKRA 3RMCA 1SL1A 4L3QA 3KD1E 2QWMA 1IBMK 1TL3A 1SS6A 1BGXT 2EWSA 1ZBSA 3VEOA 2VWBA 1WSGA 3KLEA 3NE6A 3MX5A 3QETA 3RSEA 3THXB 4KI6A 1NK0A 3KIOA 3ZSQA 3PX0A 1C6VA 3DRRA 2B6AA 4FJ7A 3OYNA 1YT3A 1LCUA 3QIOA 4TSXA 2P9PB 4BGAA 2FSNA 3WNGA 3DXMB 5I9EB 2QM1A 2EHGA 4DS5A 1ZBFA 4EAHD 4I2PA 3PV8A 2E2OA 4CJVA 4MQ3A 3PIOL 5AQOA 3H46O 3THYB 5AR0A 5AQNA 2FDQA 3FLVA 2FC0A 2HE7A 4AHSA 2E20A 3O4WA 1LWCA 1U04A 2HNZA 3SZ2A 4WFAL 1QHTA 4C1NK 3ZLJA 4QS8A 2CH5A 3LP3A 4YOWA 2F9WA 4YL8A 3R8EA 3FGUA 2A3ZA 4DMNA 5C10A 5AQYA 2YHXA 3ALYA 3SPZA 4RTFD 4EKUA 1QE1A 4DHYA 1KFSA 4QAGA 4CIGA 1HB8A 3VERA 3CJ1A 3DXMA 5KQDA 4N47A 3EE8A 3TU5A 4RW7A 2P9KB 4DSLA 1VHXA 2KFZA 1B9DA 4AHUA 3O4QA 5KGXA 3ZSZA 4B3TK 1JLFA 3DMJA 1X1PA 4DTUA 2EMTA 1RT7A 3TAMA 4FJMA 1C0FA 2VYPA 3A5OC 3GBTA 3U3YA 2Q0UA 2ZGYA 3U6FA 1XC9A 3OYEA 1NGAA 2QWRA 1ESVA 3FFKB 4H0YB 4KB0A 2O8EB 2I7PA 3ZETB 3SV4A 4NCGA 1VAZA 4CGHA 3TAPA 2YI1A 3HOSA 3EYZA 1XNQK 4Z4CA 4A61A 1ZBUA 3AO2A 4DLGA 4MDAA 1J9AA 3P1GA
chains in the Genus database with same CATH topology
1T44A 3OBYA 2CGJA 4QS9A 2NRTA 5AQLA 3O6WA 5AQWA 3EZWA 3CMEN 2P9IB 5DM7L 1DT9A 1ZC6A 1O13A 2CQUA 3E66A 2HF4A 3JS6A 3MN7A 4A2BA 3CF5L 3CCVN 4CZEA 4OPHA 4JK8A 3CJ7A 4DCHA 2BUPA 5C15A 2AP1A 1D4XA 2GUPA 1KC7A 1QVGM 4MO4A 2D0OA 4ILJA 3M3ZA 2PBDA 2WBNA 2QA4N 3G71N 3B8AX 4BC5A 3LL3A 2NRHA 4H5TA 3PZDA 3GE1A 1JCFA 3U9ZA 5JVHL 4ILHA 3O08A 2A5XA 3MCPA 2BTFA 4BVOA 3C6HA 4P7IA 2JWKA 4ILGB 1KXPA 2Q0RA 3MK6A 5KQ8A 5AQSA 2E1YA 1NLVA 3E9PA 3CERA 2AA4A 3LM9A 3VGKA 3LM2A 2V7YA 4AM7A 2UYTA 3K9KA 3KVGA 3LDLA 4B9QA 5CR4A 3H6EA 4YOTA 2QXLA 4JK7A 4JKAA 2FJ9A 4EHUA 3VOVA 2V7ZA 4BRGA 4FWOA 3CJ9A 4CD3A 1EQYA 4JHDB 1NM1A 2NRWA 3CHWA 2GTDA 3WQUA 3N4QA 5BPLA 5JMVA 4FWSA 3ID8A 1P90A 4BQZA 3WA0A 2FSKA 1S72N 4BVPA 4KH6A 4FWMA 4NLBA 4IJNA 3ENOA 4H5WA 3A5MC 3WXLA 4PL7A 4GV3A 4IFEA 2HSTA 3SJHA 3H1VX 3VTIA 3BUZB 3D2EB 2E8AA 4JKFA 1WUAA 1XUPO 3ULEA 3C6AA 4BY9C 4R79A 3O9UA 3FZFA 5F1XA 4OO1J 3D2EA 1KD1O 2J0JA 4J8FA 1SQKA 2Q97A 5LJVA 5JVLA 5FPEA 1KC8O 4H0PA 3WT0A 4BRMA 4MO5A 2D11A 3M1FA 5ADXH 4TKNA 1P8ZA 4FO0A 3DLLL 3MN5A 1MWMA 4BRPA 5HL7L 4BRDA 3FE1A 1JCGA 2E2QA 4JKBA 3CCEN 4G9ZA 5GAGP 1NMDA 1QQOA 1DIKA 2ZF5O 3KK7A 4H0XB 3Q7BA 4BR9A 3VEWA 5AQRA 3WXJA 1NGFA 3EE9A 3HM8A 5ADXA 4B1XB 3R9PA 3CQYA 1NWKA 2A42A 3CC2N 4JD2B 1KAZA 1MDUB 4NY0A 3L0QA 4PKGA 4RCHA 5M1OA 1Z05A 4IDHA 1ATRA 3CETA 4JEPA 4NLCA 4AF1A 4BRQA 1ACAA 5BPMA 3I56N 2AL6A 2W41A 1VQKN 1NJIO 2ASPA 4YDUC 2DPNA 1T6DA 5BRHA 1GC7A 4PHTX 3PIPL 5TKWA 1E4GT 5M1FA 3SAGA 4IO8A 1BWFO 4K25A 3AGKA 1U2VB 2D0PA 2QWNA 4BROA 2CGKA 3CXCM 3AGRA 3CCQN 3SK3A 4BG9A 3WQTA 2ZJRL 2ZPYA 3CJBA 1RGIA 4FWPA 4CJ7A 3FZKA 3IMXA 5AQFA 2P9UB 1MIXA 2HF3A 5AZJA 4A57A 4ZRIA 4K43A 4E1JA 3EN9A 4WCEL 1NGIA 3E9LA 3TPQA 4Z94A 1YF5L 5KPTA 3ZDTA 1YAGA 5AQTA 2E2PA 1NVLA 3LDOA 5GINA 5FPMA 2J4RA 1MA9B 1K8AO 4XH4A 4K42A 2NLXA 3CI5A 1YITN 2VCPA 1Q86O 2CB8A 1QQNA 3O8MA 3MX2A 2J0MA 1ATSA 2ITMA 5JVGL 3EKUA 1MIZB 1W97L 3CJCA 3LDPA 1GC6A 5AQGA 4HDQA 1KAYA 3ZX0A 5DM6L 1H1VA 5M1PA 1VQNN 3FZMA 1R59O 3QFPA 5FPNA 3TSUA 3AAQA 4A59A 5E84A 4NO7A 3AU4A 4ZRKA 2P9IA 2D2QA 5CE3A 2NRZA 1BUPA 1VQLN 5AQIA 2E1ZA 3OHRA 3T7ZA 1T3VA 3Q7CA 3D2FB 2X0SA 3A0IX 3M5RA 5GAHP 4H5VA 5EX5A 1DEJA 4WQ5A 1JJ2M 3UB5A 3VF2A 1Y64A 4JN4A 3SLCA 1VQ4N 1VQ6N 3UKRA 3I33A 4U67L 3EKSA 1NGHA 5C0YA 1HBKA 4KH4A 1X9JA 2A41A 4YOYA 4BR0A 5AFUH 4JHDA 4O8KA 2GEMA 3AY9A 4FPBA 4EFHA 1EF1A 3ID6A 3P31A 5LY3A 5AQZA 2HBMA 4GV6A 4ISFA 5E26A 4CBUA 1ATNA 3QB0A 1IJJA 1XC3A 3MWTA 3VGLA 2QW9A 4DQ8A 5AZIA 1Q81O 1GLJO 4MDBA 2GWKA 3F9MA 3MCAB 3R3LA 4H5NA 1HKCA 2Q1NA 1CZAN 4BREA 2QI2A 3AARA 2NZTA 3O9TA 4BGBA 3HSCA 2P9SB 4QS7A 4BG8A 2Q2RA 3CJAA 1VQON 2HOEA 2ABDA 3L4IA 4OPAA 3I8BA 3O9SA 4HTLA 3ULEB 4FOEA 4BQLA 2HRJA 2GX9A 4I6MB 3VGMA 1EO1A 2I7NA 4GVEA 1XQSC 3J7ZO 3CCMN 4BR4A 1GGOA 5JICA 1YIJN 4WFBL 4BC3A 3EL2A 4BRHA 5IJMA 3O9RA 3QFUA 2HMPA 1YJ9N 4H0VB 1BG3A 4B1WB 5M1QA 4EHTA 3R6MA 3VEVA 2YJFA 4IEIA 4CZJA 2D4WA 1VQ5N 2A40A 3CPEA 3UE5A 3CMAN 3PVLA 3CCSN 4B1VA 4WQ5C 1T6CA 2QWLA 5BR9A 3CCUN 4IO9L 1BU6O 2PAVA 3MN6A 3QMLA 3CIPA 1ILYA 3CC7N 2FF6A 2P9UA 3HTVA 3G25A 2YHYA 3IUCA 2ASMA 2NRVA 5HOOA 3SMPA 3HBTA 4IXCA 1KBLA 1V4SA 1ISNA 4XEIA 5KPZA 2FXUA 3HOTA 4WQ4A 1NBWA 4PKHA 4FWLA 3HZ6A 3M6GA 3BF1A 2R82A 2F7TA 3EO3A 1VQ8N 1RFQA 3WXKA 5B8HA 3CCJN 4JKGA 4XH1A 3PLAA 3WEEA 3O1WA 1HLUA 2WH5A 1C0GA 2D10A 3G6EN 1NGBA 2J0KA 2P9PA 4JKEA 3UKRB 3EPYA 3MMVA 5GIOA 3A5LC 3IKMA 4B1YB 4BRNA 2Q36A 1GLCG 2IVPA 1G99A 2P9KA 1MK9B 1NI2A 2FSJA 2HBJA 1YXQA 2CH6A 1QZ6A 3VTHA 3CCLN 2E2NA 2QTDA 4GY2B 2WC9A 3VPZA 1BA0A 3P39A 1NGJA 1RDUA 2IVOA 2NRRA 2QEXN 3DJCA 4K41A 1VBGA 2OTJN 1VBHA 2PFUA 3UKUB 3VEYA 4CZIA 3DAWA 4PKIA 4ISEA 4C23A 4WYBA 4JD2A 3ZETA 2V51B 3CQXA 4CZKA 3K9JA 2ZJPL 4HDOA 1OKJA 3L4QA 5GAEP 2EMSA 5BN9A 4FWQA 5ELZA 4CZLA 1U6ZA 3QICA 1QHAA 5EXWA 3SAFA 3GG4A 1TUYA 3GDQA 4O5FA 2ZJQL 4FVUA 3TTDA 4YOVA 4BR2A 3SMSA 2FLOA 3LDNA 1SGHA 1Q18A 2HBLA 4M7YA 1K8KB 3ZYYX 3IVFA 4FWRA 5AQKA 1NTIA 3KWIA 3E1YA 1TYQB 2WFBA 4JAXA 5AQXA 1GLDG 3SBTA 3FLCO 3ATVA 4FSVA 5EY4A 3SAHA 1YJWN 3A5NC 4GNIA 2YCHA 4LC9B 1HPMA 3C7NA 5GADP 1YVNA 2CGLA 1J6ZA 4JKHA 3MWPA 3U8ZA 1X3NA 2GWJA 3F5TA 1VQ7N 3BINA 1IG8A 1JCEA 3ZX2A 4A62A 5GIPA 3P4IA 4JKCA 4B1UB 3AU5A 1TYQA 2FF3B 2HBKA 4M63C 4I6MA 4NB4A 3TTCA 4BC2A 4CBWA 1GLAG 1GLLO 1Q82O 4IOXA 2YHWA 3P38A 4BR5A 4BC4A 3H3NO 3I55N 2P9LB 4MLEA 3MDQA 3W0LA 1ZXOA 4FPAA 1HB6A 3U4LA 3ZEUA 5AQHA 1Y19B 4DXAB 1NGDA 1RDWX 4AM6A 1Z6RA 4M7XA 1ST7A 4BRIA 2A6AA 3QDKA 1N8RO 3QBXA 3S41A 2JWLA 3CPWM 1GG3A 3DWLA 3TSPA 4BRKA 1Q7YO 1KAXA 3KHYA 3NMUA 4FOIA 1OVYA 3ATUA 3TSQA 1E5WA 1YUWA 4A5AA 4BRFA 1HKGA 2BH1A 4H0TB 4CYEA 1HKBA 2ASOA 4F7GA 3AAPA 1HUXA 2P9LA 3ENHA 4WF9L 2P9NA 2Q31A 2AEHA 5C12A 1QQMA 2W40A 2RE2A 3JXUA 1WOQA 1VQMN 3NVMA 3VMFB 3BEXA 3TTFA 3VESA 1BOTO 4IZ9A 3L6QA 3OW2M 1SZ2A 2RQ1A 5AQPA 1VQ9N 4BRCA 3X23A 1QZ5A 4DB3A 4IEEA 2NRXA 2ZGZA 3H1QA 4EIAA 2YJEA 3C65A 3D2FA 5JLHA 3IFRA 2VGMA 3LDQA 1VQPN 4IOAL 4JKDA 3RSEB 2COPA 5CHIA 5AQVA 1GLEG 1YI2N 4BRAA 4L3QA 3D6RA 2QWMA 4HWIA 5EOYA 4ISGA 5BREA 1SS6A 5AZIB 3E9OA 2OANA 4BR7A 2QWOA 1K9MO 2EWSA 4KH5A 1ZBSA 3VF4A 1BO5O 3VEOA 4WFNL 2VWBA 3KWGA 2QWPA 3CD6N 4JNEA 3H45C 5FPDA 3MX5A 2IVNA 2GELA 3RSEA 4YDUA 5BN8A 4A2AA 4B1ZA 3MN9A 1U2VA 3C0BA 5EVZA 1MK7B 2E88A 4H03B 1YHQN 1HX1A 3NVKA 3A8YA 4H0OA 1X3MA 3O5BA 2D1KA 1LCUA 3G9WA 2WUSA 3UKUA 5F0XA 3T69A 1MWKA 3CCRN 2P9PB 4BGAA 2FSNA 2VGNA 3DXMB 3GOIA 3VF6A 5I9EB 1H4RA 1LOTB 3FR0A 5BRFA 2QM1A 5M1NA 4UY8O 2I1JA 4JKGB 4EAHD 3BP8A 5BRDA 3U9DA 4RWTA 4YOXA 4C1NI 2E2OA 3C7NB 4JK9A 3VEXA 3PIOL 5AQOA 3H46O 3WXMB 2KKZA 5AR0A 5AQNA 2FDQA 3FLVA 2HE7A 2NNWA 2E20A 3O4WA 1BA1A 4IOCL 1KQSM 4IWVA 4O8UA 4C1NK 4WFAL 2LBBA 4QS8A 2CH5A 4YOWA 3RVCA 2F9WA 4YL8A 2V52B 1V4TA 3O1BA 1GLFO 3R8EA 3FGUA 2A3ZA 2IIRA 5C10A 1BDGA 4ZRJA 4CZFA 3H3OB 5AQYA 2YHXA 1NGCA 4CI6A 3KZBA 1SAZA 2H3GX 5C2FA 3WUHA 3O80A 4EKUA 3D7EO 3N4PA 4MLHA 4RTFD 4CBXA 5AZJB 2RHKA 4CD1A 3VETA 4DHYA 4Y0WA 2DIKA 5F2RA 1HB8A 3VERA 3CJ1A 3G4SN 3BF3A 5H1SQ 3DXMA 5KQDA 1NGEA 4U7BA 3U8XA 1M90O 3EE8A 4WQ4C 3ZX3A 3TU5A 3DXKA 5TKYA 5AQJA 2P9KB 1YJNN 5BPNA 1QVFM 3O9QA 3W3DA 2YVCA 3FZHA 1E4FT 5LJWA 5MLCQ 2P9SA 3CC4N 1J19A 3VEZA 4GXBA 4GV9A 3QIJA 1DKGD 3HI0A 4KBOA 3WEEB 2F9TA 4BRLA 2OTLN 2EMTA 3GL1A 1S3XA 5JLFA 3DXKB 1C0FA 2ZWHA 3ENBA 2VYPA 4FWNA 3A5OC 3GBTA 3J8AA 4FL9A 1NGGA 4H5RA 3SBGA 3R1XA 1K8KA 3ZEUB 4YORA 1HJOA 2Q0UA 2ZGYA 2P9NB 2I1KA 4FWKA 1NGAA 2QWRA 3FZLA 4XH5A 1K73O 5AQUA 1ESVA 5C2DA 1GLBG 1S22A 3FFKB 3OA9A 1DGKN 4H0YB 4PL8A 3WXIA 1TUUA 2I7PA 2YX6A 5KPRA 3ZETB 3U7DA 3QBWA 4CZGA 1JDEA 3F2KA 2KLAA 5M1KA 1W2BM 5AQMA 4CZMA 1VAZA 5AQQA 3OBWA 2YI1A 4YOUA 3VENA 3HOSA 1M1KO 4IJAA 3HRGA 4F9OA 4A61A 3IDHA 4DKWA 2QWQA 5AFUA 3FP5A 4MDAA 4CZHA 4A5BA 2KHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9O A;  3ENB A;  4JKC A;  4JK9 A;  4JKE A;  3SBG A;  4JK7 A;  4JKA A;  3E66 A;  4JK8 A;  4JKB A;  4ILJ A;  3SBT A;  4ILH A;  4JKD A;  4JKF A;  4JKH A;  4ILG B;  4JKG A;  3E9P A;  3E9L A;  4JKG B; 
#chains in the Genus database with same CATH topology
 3OBY A;  2NRT A;  2OPQ A;  5AQW A;  3CME N;  2P9I B;  4JRP A;  4KTQ A;  2BE2 A;  3ZCM A;  1Y97 A;  1ZC6 A;  4E0D A;  3JS6 A;  3CCV N;  1QSS A;  5FDL A;  1WSF A;  4C8L A;  1IKX A;  3AV9 A;  4DCH A;  5C15 A;  1VSH A;  2AP1 A;  5SWM A;  1D4X A;  3TAQ A;  3KKR A;  2HHW A;  3IAY A;  4ILJ A;  4CIE A;  4F4K A;  2WBN A;  3G71 N;  1NJY A;  3PZD A;  3ULD A;  4ILH A;  1LW0 A;  3O08 A;  2A5X A;  4KB1 A;  2VG7 A;  3C6H A;  2JWK A;  4ILG B;  2O4I A;  1KXP A;  5KQ8 A;  1HPZ A;  2E1Y A;  5AQS A;  5J2P A;  4B8C A;  2V7Y A;  1TK0 A;  2UYT A;  3KVG A;  4B9Q A;  2Y1J A;  3AVB A;  4YOT A;  2P1J A;  3LPT A;  1LV5 A;  2V7Z A;  2E5L K;  4DV1 K;  1EQY A;  1NM1 A;  3AVL A;  3VQ4 A;  2XY8 A;  3RRH A;  1JLE A;  4DFP A;  1P90 A;  3VQD A;  3DRS A;  4DV6 K;  2D5R A;  4E1N A;  4CHY A;  4IJN A;  3ENO A;  3WXL A;  4GV3 A;  2HST A;  5HRS A;  3BUZ B;  3D2E B;  2E8A A;  1WUA A;  4CEO A;  3AVA A;  4R79 A;  5SZT A;  3RR8 A;  2KZM A;  1KD1 O;  1D9D A;  3J80 O;  1SQK A;  1J5E K;  4H0P A;  4CJP A;  2D11 A;  5ADX H;  1P8Z A;  4FO0 A;  3J7Y P;  2YNG A;  4BRP A;  3FE1 A;  2E2Q A;  4JKB A;  1T03 A;  3CCE N;  5A2Q O;  3VQQ A;  1QQO A;  4CJL A;  4NXM K;  3EE9 A;  3NDK A;  3HM8 A;  3V1R A;  4OLA A;  1CXU A;  2A42 A;  3AA5 X;  4I9L A;  4DR4 K;  1MDU B;  4PKG A;  2FBX A;  4IDH A;  4IG3 A;  2F8T A;  2W41 A;  3L2R A;  2PYJ A;  1VQK N;  1NJI O;  2ASP A;  1RBT A;  2DPN A;  4CJF A;  4AHV A;  4BWM A;  3NCI A;  3PIP L;  1ZBI A;  1E4G T;  5M1F A;  3SAG A;  1BWF O;  3KKS A;  3CG7 A;  2CGK A;  3CXC M;  3CCQ N;  3SK3 A;  4FW2 A;  3WQT A;  2ZPY A;  3LAN A;  3DLE A;  4JLH A;  4KTW A;  2HF3 A;  5AZJ A;  4E1J A;  4WCE L;  3BZK A;  3TPQ A;  3TR8 A;  3ZDT A;  4JI3 K;  4IBN A;  1XMO K;  4NYF A;  2UUB K;  1CLQ A;  3LZI A;  4XH4 A;  3CI5 A;  3MXJ A;  5C24 A;  2VCP A;  4AHR A;  5J1E A;  1ATS A;  5JVG L;  5AQG A;  5HBM A;  1RBV A;  1W97 L;  4HDQ A;  1KAY A;  1U4B A;  1D9F A;  1R59 O;  4CGF A;  5FPN A;  4A59 A;  4ZRK A;  4IDK A;  2P9I A;  1VQL N;  5AQI A;  1LWF A;  2XO7 A;  3D2F B;  2X0S A;  5EX5 A;  1UA0 A;  3HK2 A;  3VQ6 A;  1GOB A;  1JJ2 M;  1Y64 A;  4JN4 A;  3SLC A;  4FJX A;  1VQ6 N;  3UKR A;  5I42 A;  4JI5 K;  2KQ2 A;  4KH4 A;  2O8F A;  4YOY A;  2ITG A;  3C6U A;  3KK2 A;  1FKP A;  2NUB A;  1ZYQ A;  3AVC A;  5KI6 A;  5AQZ A;  3K0S A;  3RWU A;  1KVB A;  1RTJ A;  4CBU A;  4M41 A;  1L3T A;  3MWT A;  2QW9 A;  1KSP A;  3PO4 A;  2PZS A;  2UXD K;  1HKC A;  5J2Q A;  3VQ9 A;  5CZ2 A;  4QS7 A;  2HOE A;  3I8B A;  4HTL A;  4DWI A;  1JLG A;  4FOE A;  4BQL A;  2GX9 A;  3VGM A;  1FW6 A;  4CJ4 A;  4QOZ B;  1YIJ N;  4BC3 A;  3O9R A;  3QFU A;  3ZSY A;  4H0V B;  1BG3 A;  4B1W B;  4EHT A;  3R6M A;  3VEV A;  2YJF A;  4IEI A;  4CZJ A;  2A40 A;  3CMA N;  4KRE A;  3PVL A;  4I2Q A;  4B1V A;  1YTA A;  4B8A B;  3QML A;  3I8D A;  3CIP A;  1ILY A;  3CC7 N;  2P9U A;  3IUC A;  3KK3 A;  4LH5 A;  3HBT A;  4DQI A;  1KBL A;  1L3V A;  2O8D B;  2FXU A;  4ZTF A;  4FWL A;  3M6G A;  1XHZ A;  2IS3 A;  3NGZ A;  2DFE A;  1RFQ A;  1GOC A;  5CYM A;  3PLA A;  3LP0 A;  3O1W A;  2WH5 A;  3OYD A;  1NGB A;  2P9P A;  4JI8 K;  4M45 A;  3IKM A;  4BRN A;  2Q36 A;  1GLC G;  2HHX A;  1RBU A;  2P9K A;  2FSJ A;  3S3N A;  1S9E A;  3AVI A;  1QZ6 A;  2E2N A;  3K57 A;  2XRI A;  1JL1 A;  3P39 A;  3OTO K;  4WE1 A;  2NRR A;  3DJC A;  4Q0B A;  4CGJ A;  2O8B A;  4RG8 A;  4N76 A;  4K8Z A;  4CGI A;  2V51 B;  2D0C A;  1IBL K;  1KVC A;  4CJ3 A;  4FWQ A;  5ELZ A;  1OH5 A;  5EXW A;  2D0A A;  3F9K A;  4O5F A;  3ZSO A;  4FVU A;  4YOV A;  3KLF A;  1SGH A;  2HBL A;  1SL0 A;  1K8K B;  3IVF A;  4FLY A;  5AQX A;  3FLC O;  3ATV A;  4CK3 A;  4CF2 A;  3KJV A;  1NJW A;  3QIP A;  4X62 K;  1B9F A;  3MWP A;  3TAG A;  1FXX A;  2HW3 A;  3V1Q A;  3A2F A;  3F5T A;  1VQ7 N;  3BIN A;  1JCE A;  5GIP A;  4DS4 A;  4JKC A;  3AU5 A;  2FF3 B;  4F2S A;  4NB4 A;  4BC2 A;  1Q82 O;  1GLA G;  1GLL O;  4DSE A;  4IOX A;  3P38 A;  1ZXO A;  3K59 A;  2ZD1 A;  4JI0 K;  1Y19 B;  2VQE K;  3CYM A;  4H4O A;  2EX3 A;  5HP1 A;  2OPS A;  3QBX A;  1GG3 A;  3BY5 A;  1KAX A;  3NMU A;  4FOI A;  1OVY A;  4A5A A;  1YUW A;  4BRF A;  1HKG A;  2OPR A;  4H0T B;  4DTX A;  2ASO A;  3AAP A;  4WF9 L;  1NOY A;  1NK4 A;  3DLG A;  5C12 A;  1QQM A;  2W40 A;  1KRP A;  2O8F B;  3VMF B;  4FZY A;  3VES A;  4IZ9 A;  4DFK A;  1SZ2 A;  2RQ1 A;  4OPJ A;  3CFR A;  4M42 A;  4FYD A;  4IEE A;  4EIA A;  1DTQ A;  1QS4 A;  2YJE A;  3D2F A;  5LL6 Z;  4CGG A;  3OYH A;  3S3O A;  4KKO A;  1GLE G;  1YI2 N;  1D5A A;  3AVK A;  3D6R A;  3ZT4 A;  4ISG A;  5BRE A;  3O3F A;  4DQQ A;  3TAR A;  4DV4 K;  1K9M O;  4J2B A;  4V19 S;  4WFN L;  3KWG A;  1RDA A;  3CD6 N;  3M8R A;  4DFM A;  2GEL A;  3NF8 A;  1B92 A;  1HQE A;  1UAX A;  1D8Y A;  4PUO A;  2JGU A;  2E88 A;  4H03 B;  1YHQ N;  1BCM A;  2OYQ A;  2R7Y A;  3A8Y A;  3SQ1 A;  2D1K A;  4KAZ A;  2WUS A;  4KHP K;  4LF5 K;  3T69 A;  3OVN A;  4YFU A;  1LAW A;  3VF6 A;  1LOT B;  5BRF A;  3SV3 A;  4YOX A;  3BP8 A;  5BRD A;  3U9D A;  4RWT A;  3VA0 A;  2YHA A;  3C7N B;  3NFA A;  3VEX A;  3WXM B;  5D3G A;  3LP1 A;  2VQF K;  1TAU A;  4CHZ A;  2QKB A;  2ZQB A;  4FK0 A;  3OYI A;  3NGY A;  4AHC A;  3M8Q A;  3RTV A;  1V4T A;  2IIR A;  3L8B A;  1C0T A;  4CZF A;  1NGC A;  1SAZ A;  5C2F A;  3N4P A;  4MLH A;  4CBX A;  1VK0 A;  3CFO A;  2G8F A;  1IO2 A;  3G4S N;  5H1S Q;  1XHX A;  1NGE A;  1WSJ A;  1HNZ K;  1IKV A;  3OYJ A;  4CGD A;  1JLC A;  4DR3 K;  3DXK A;  5AQJ A;  1QVF M;  3FZH A;  3L3V A;  1HQU A;  1RT2 A;  5LJW A;  5MLC Q;  3CC4 N;  3EEQ A;  1DKG D;  3WEE B;  4Z0U A;  2OTL N;  2GBZ A;  2ZWH A;  3ENB A;  3VQE A;  3DOL A;  3J8A A;  1NGG A;  1O1W A;  3SBG A;  4BE1 A;  1K8K A;  3ZEU B;  2Q3S A;  4NCA A;  4CER A;  4CJU A;  1TKD A;  4RW9 A;  3OYG A;  4DG1 A;  4J2A A;  4CHN A;  3B6O A;  2KLA A;  1W2B M;  1U47 A;  5AQQ A;  3OBW A;  4YOU A;  1RT5 A;  3VEN A;  3V9S A;  4B9U A;  3AVF A;  4F9O A;  3MEE A;  1NK7 A;  4CZH A;  2YNH A;  2W6L A;  2KZZ A;  1T44 A;  5AQL A;  2FBY A;  4DUZ K;  1DT9 A;  1O13 A;  2HF4 A;  3MN7 A;  3O4N A;  1NMN A;  4W5Q A;  3ZSR A;  1TKT A;  1RT1 A;  3HL8 A;  1QVG M;  4MO4 A;  2G8I A;  3SQ4 A;  2RPI A;  5JVH L;  3U9Z A;  4DTJ A;  4EZ9 A;  2B5J A;  1BHL A;  2BTF A;  3MK6 A;  5JS2 A;  1BQN A;  3SUP A;  2IC3 A;  4LSL A;  3CJ9 A;  4OJR A;  2PYL A;  4FWS A;  4BQZ A;  3WA0 A;  2FSK A;  4BVP A;  4KH6 A;  4NLB A;  4H5W A;  4PL7 A;  4IFE A;  4LFA K;  3SJH A;  3H1V X;  3VTI A;  1R0A A;  4JKF A;  1XUP O;  3C6A A;  3O9U A;  3FZF A;  4OO1 J;  4RW6 A;  4J8F A;  4E19 A;  5JVL A;  3WT0 A;  4GW6 A;  4TKN A;  3HPO A;  2DTU A;  5HL7 L;  4BRD A;  3DYA A;  3KLG A;  5GAG P;  4FM1 A;  3QER A;  3KK7 A;  4BR9 A;  3VQP A;  1VSF A;  4DF4 A;  4XIU A;  1UOC A;  1KAZ A;  1T7P A;  4NLC A;  4CVN E;  4EP5 A;  3KK1 A;  4IFV A;  1BL3 A;  2QWN A;  1A5W A;  1VRT A;  3AGR A;  4O0J A;  1VSD A;  4DSF A;  1OVQ A;  2G8W A;  3CJB A;  4FW1 A;  4BDP A;  5AQF A;  3IMX A;  2HHU A;  4K43 A;  3EN9 A;  3KD5 E;  1YF5 L;  5AQT A;  5FPM A;  1MA9 B;  2KTQ A;  1LW2 A;  2NLX A;  4CF1 A;  2IOC A;  3O8M A;  5EU7 A;  2J0M A;  4CEE A;  1NJX A;  3EKU A;  3C6T A;  3CJC A;  3AVH A;  1A5V A;  3LDP A;  4ZHR A;  5AJ3 K;  1H1V A;  1VQN N;  3NF9 A;  4DTS A;  3TSU A;  1N33 K;  3FFI A;  1RT3 A;  2D2Q A;  3J81 O;  1X9W A;  2HHH K;  4FJK A;  4FM2 A;  5CYQ A;  3V1O A;  1BQM A;  1JXE A;  1T3V A;  5KRS A;  4DUY K;  3NAE A;  4ELV A;  3DM2 A;  1ITG A;  3KTQ A;  1NOZ A;  4MFB A;  3S3M A;  4DTN A;  3EKS A;  4DFJ A;  4ZTJ A;  3DLH A;  4PA1 A;  4BR0 A;  5AFU H;  4O8K A;  3VQC A;  4FPB A;  4DF8 A;  5LY3 A;  2HBM A;  4YY3 K;  4GV6 A;  4F3T A;  3QIN A;  3SUO A;  1DLO A;  5E26 A;  1JKH A;  1RDB A;  1IJJ A;  3TWH A;  3VGL A;  4DQ8 A;  3MEG A;  4MDB A;  3QNN A;  2GWK A;  5IWA K;  3NF7 A;  1CZA N;  4BRE A;  3AAR A;  2NZT A;  2P9S B;  1EWQ A;  2IGI A;  4B9M A;  1RNH A;  1HNX K;  4I6M B;  4KHQ A;  3PY8 A;  4BR4 A;  3SUN A;  5JIC A;  4WFB L;  5CZ1 A;  5IJM A;  4DSI A;  5M1Q A;  4KO0 A;  1I94 K;  3CPE A;  3DI6 A;  3NH2 A;  3CCS N;  1T6C A;  1QSL A;  1LAV A;  5BR9 A;  2PAV A;  2YHB A;  4JS4 A;  3ZT1 A;  4KHY A;  2NRV A;  2RKI A;  3IS9 A;  4B08 A;  4CFD A;  4N41 A;  4IXC A;  5LMN K;  5C42 A;  1V4S A;  1NK8 A;  1ISN A;  3HOT A;  4WQ4 A;  4IKF A;  1NKE A;  3HZ6 A;  3SYZ A;  3RMD A;  2R82 A;  1KVA A;  3EO3 A;  4BDZ A;  5BR8 K;  4XH1 A;  1OH7 A;  1C0G A;  4OGC A;  3G6E N;  2P51 A;  4JKE A;  3A5L C;  1X9S A;  2IVP A;  1G99 A;  4FLV A;  2HBJ A;  1CZ9 A;  2WON A;  2DFF A;  3VTH A;  2QTD A;  2O8E A;  2HHT A;  3VPZ A;  1LWE A;  3NH1 A;  4K41 A;  1VBG A;  3UKU B;  4PKI A;  4HCC A;  4NCB A;  3ZET A;  4CZK A;  3K9J A;  3J7A P;  4LF4 K;  1U6Z A;  1QHA A;  3V9W A;  3GG4 A;  1TUY A;  2ZJQ L;  3THW B;  4DR1 K;  2UU9 K;  2DFH A;  3SMS A;  2FLO A;  3LDN A;  5AQK A;  3HT3 A;  1RTI A;  4FSV A;  4LFC K;  1YJW N;  4GNI A;  2D0B A;  4CJ5 A;  4CEZ A;  3U8Z A;  1WNS A;  2YNI A;  2GWJ A;  5KRT A;  1IG8 A;  3ZX2 A;  4E7J A;  4JI1 K;  2HVI A;  2HBK A;  4LD0 A;  3TTC A;  3G0Z A;  4ICL A;  4Q5V A;  2HB5 A;  4BR5 A;  3OS2 A;  4IG0 A;  1XI1 A;  4W5R A;  4CHP A;  3ZEU A;  1NGD A;  2A6A A;  3QDK A;  3DWL A;  3TSP A;  1TV6 A;  3KHY A;  3ATU A;  3TSQ A;  4CFC A;  4JYA K;  3ENH A;  4F7G A;  4FVM A;  1BIZ A;  4FJL A;  1CXQ A;  3JXU A;  1WOQ A;  4JI7 K;  1N34 K;  3OW2 M;  5AQP A;  1VQ9 N;  3VQ7 A;  4BRC A;  3X23 A;  4X65 K;  3F73 A;  2G8K A;  2VGM A;  3LDQ A;  4DV3 K;  3PSF A;  4IOA L;  4JKD A;  3RSE B;  3THX A;  5CHI A;  5AQV A;  4OKJ A;  4G1Q A;  4HWI A;  4BR7 A;  2F4V K;  3E9O A;  3QEI A;  1Q9X A;  4KH5 A;  3TAF A;  3VF4 A;  1BO5 O;  4JNE A;  3H45 C;  3PUF A;  3THW A;  3K5M A;  1I3A A;  4A2A A;  4DU3 A;  4B1Z A;  1WB9 A;  3MN9 A;  3C0B A;  4IFY A;  1QTM A;  3NVK A;  4H0O A;  1X3M A;  3O5B A;  3UKU A;  4N56 A;  3CCR N;  2VGN A;  2Z1I A;  3GOI A;  5M1N A;  4NXN K;  2I1J A;  4JKG B;  2XY7 A;  4B3R K;  3D0P A;  3AVG A;  4JK9 A;  1TGO A;  4FZX C;  2OCE A;  2KKZ A;  1RTH A;  4EP4 A;  2NNW A;  4IOC L;  1KQS M;  4IWV A;  4O8U A;  4DTO A;  1UA1 A;  2BDP A;  1JL2 A;  3RVC A;  3O1B A;  1NKB A;  2HND A;  3B6P A;  3HYF A;  4AH9 A;  1S1U A;  4CI6 A;  2H3G X;  3O80 A;  1C1B A;  3D7E O;  5AZJ B;  4CD1 A;  5F2R A;  4FJN A;  1NU0 A;  3BF3 A;  3MXM A;  4UQG A;  4CJE A;  3ZX3 A;  1W0H A;  2P5G A;  5TKY A;  4JS5 A;  3QES A;  1S1W A;  3SI6 A;  3O9Q A;  2YVC A;  4C8N A;  2UXB K;  4X66 K;  1J19 A;  3VEZ A;  4GXB A;  4ID5 A;  3QIJ A;  4DR6 K;  3HI0 A;  4KBO A;  2F9T A;  4CEB A;  3GL1 A;  1S3X A;  5HLF A;  4H5R A;  4FL9 A;  4YOR A;  2I1K A;  4QCL A;  1EX4 A;  5C2D A;  5JS1 A;  4PL8 A;  1DGK N;  1ASV A;  2YX6 A;  4CZG A;  3QBW A;  1JDE A;  2I5J A;  3F2K A;  4CZM A;  3EY1 A;  1W7A A;  1M1K O;  4IJA A;  3VQ8 A;  3IDH A;  4DKW A;  2QWQ A;  4CED A;  5AFU A;  4J2D A;  2KHO A;  2CGJ A;  4W5N A;  3BDP A;  4OKE A;  3KLI A;  4A2B A;  2CQU A;  3E66 A;  1X9M A;  2X6N A;  4OPH A;  4JK8 A;  5HRN A;  3CJ7 A;  2BUP A;  4KTZ A;  2GUP A;  2W42 A;  1KC7 A;  2D0O A;  3LZJ A;  4FJ9 A;  4HTU A;  3B8A X;  2NRH A;  1FKO A;  4FK2 A;  3MCP A;  3SJJ A;  1C1A A;  3CER A;  1NLV A;  2DY4 A;  3TI0 A;  3LM2 A;  4AM7 A;  3K9K A;  3H6E A;  2QXL A;  2ZE2 A;  2FJ9 A;  2FBT A;  4ID1 A;  4EHU A;  4ELT A;  3VOV A;  1HYZ A;  4CD3 A;  4JHD B;  5JMV A;  3CHW A;  5BPL A;  3N4Q A;  3ID8 A;  3CM5 A;  4HUG A;  2QK9 A;  3RRG A;  4LF7 K;  3RR7 A;  1XMQ K;  3ULE A;  3AA4 A;  3ITH A;  3VQ5 A;  3SNN A;  2J0J A;  5FPE A;  1KC8 O;  1RBS A;  4BRM A;  4DSJ A;  4MO5 A;  4RW4 A;  1MWM A;  3K58 A;  4B9T A;  1S1T A;  3PX4 A;  1JCG A;  3PX6 A;  2HMI A;  4G9Z A;  1S9G A;  3H08 A;  1DIK A;  1NK6 A;  4H0X B;  1TKX A;  3VEW A;  4CJK A;  1NGF A;  5ADX A;  4FM0 A;  4B1X B;  3SUQ A;  1HNI A;  3R9P A;  3CQY A;  3CC2 N;  2BGG A;  4B3S K;  4CHQ A;  4M3W A;  4NY0 A;  1E3M A;  4J2E A;  4RCH A;  5M1O A;  1Z05 A;  1ATR A;  1I39 A;  3CET A;  4JEP A;  3ZSW A;  4AF1 A;  4BRQ A;  1N36 K;  1ACA A;  2HHQ A;  3AA3 A;  4CE9 A;  3HPH A;  1U48 A;  1C1C A;  1GC7 A;  4PHT X;  4KRF A;  1REV A;  5TKW A;  4IO8 A;  1SUQ A;  4B3O A;  3AGK A;  4BRO A;  4Y1D A;  2ZJR L;  1VSE A;  4FWP A;  4H4M A;  1VSJ A;  4ZRI A;  1NGI A;  3E9L A;  4FXD A;  1YAG A;  1S6Q A;  4CK2 A;  1NVL A;  3LDO A;  2XHB A;  3WNE A;  4OKK A;  1J53 A;  5GIN A;  4E3S A;  5HRO A;  2J4R A;  4DTP A;  4K42 A;  5KGW A;  3OYL A;  1Q86 O;  2ITM A;  1VQ4 N;  1MIZ B;  4OX9 K;  3ZX0 A;  5DM6 L;  4JI6 K;  3FZM A;  1TK8 A;  1T05 A;  5E84 A;  4NYN A;  4NO7 A;  3AU4 A;  5CE3 A;  2NRZ A;  2E4L A;  3OS0 A;  3T1Y K;  4CCH A;  1SKS A;  1Q8I A;  1BIS A;  3Q7C A;  3A0I X;  1DEJ A;  4WQ5 A;  4E7K A;  3I33 A;  4U67 L;  4B9V A;  1NGH A;  1HBK A;  5DK5 A;  1X9J A;  4ELU A;  2O4G A;  4JHD A;  4M3Z A;  4FJ8 A;  4ISF A;  2GUI A;  3QEP A;  3HP6 A;  4X64 K;  1ATN A;  4I9Q A;  3TAE A;  3DRP A;  1Q81 O;  4FJH A;  4PQU A;  3F9M A;  4H5N A;  3MCA B;  2Q1N A;  2XY5 A;  4KPY A;  2QI2 A;  4BGB A;  2Z1H A;  4BG8 A;  1VQO N;  2A1S A;  4CK1 A;  3O9S A;  2F8S A;  3AVM A;  2HRJ A;  1QSY A;  4GVE A;  1RDC A;  3CCM N;  1NJZ A;  4O44 A;  1GGO A;  4BRH A;  1K8A O;  2HMP A;  2O8C A;  1ASW A;  2OA8 A;  1IH7 A;  5LMU K;  1VQ5 N;  3UE5 A;  2AJQ A;  3LAL A;  4WQ5 C;  3HVR A;  3K2P A;  3CCU N;  1BU6 O;  3MN6 A;  1J54 A;  3L3U A;  2YHY A;  5HOO A;  4DSK A;  1BI4 A;  4F2R A;  2W6K A;  4FJ5 A;  3OJU A;  5KPZ A;  1NBW A;  4BE0 A;  4PKH A;  1KLM A;  1VSM A;  3NGI A;  1VQ8 N;  1EWR A;  4B9L A;  1VRU A;  4JKG A;  5FRN A;  4FZZ A;  1HLU A;  2D10 A;  2HNY A;  2J0K A;  3VQB A;  3G10 A;  3EPY A;  3MMV A;  3VQA A;  5GIO A;  1WAJ A;  1KFD A;  1NI2 A;  4DQR A;  4E7H A;  4GY2 B;  2WC9 A;  1BA0 A;  2YV0 X;  4M3X A;  2QEX N;  2VWJ A;  3HM9 A;  1WLJ A;  1U45 A;  2OTJ N;  1VBH A;  4LH4 A;  3SQ2 A;  3VEY A;  4KHN A;  3DAW A;  4C23 A;  4ISE A;  4WYB A;  4I7F A;  2ZJP L;  3OY9 A;  4HDO A;  3L4Q A;  5GAE P;  2EMS A;  4CZL A;  3LDS A;  3QIC A;  1BI4 B;  4BR2 A;  4M7Y A;  1Q18 A;  3OYK A;  3NF6 A;  4KHU A;  3OYC A;  4FLZ A;  4FWR A;  3KWI A;  2GV9 A;  3E1Y A;  2WFB A;  1GLD G;  1EXQ A;  1EET A;  4Y1C A;  1Q9Y A;  3A5N C;  4LC9 B;  3WNH A;  4CIF A;  1HNV A;  1J6Z A;  3JAM O;  4M3Y A;  3OYB A;  1WBD A;  4A62 A;  3VN5 A;  4E89 A;  2ETJ A;  3ZT2 A;  4EZ6 A;  3P4I A;  4B1U B;  4DR2 K;  2X78 A;  1OH6 A;  2YHW A;  2YKM A;  5FLX O;  4LSN A;  3O3G A;  2VG6 A;  4CJW A;  3IG1 A;  4RW8 A;  3MDQ A;  1HB6 A;  3U4L A;  4AHT A;  5AQH A;  4DQS A;  4AM6 A;  3CQ8 A;  3MAQ A;  4M7X A;  4CEA A;  2VG5 A;  1N8R O;  3S41 A;  2JWL A;  3ZSX A;  1N5Y A;  2IAJ A;  1E5W A;  4O0I A;  2IDO A;  1HKB A;  1HUX A;  4CF0 A;  3QEX A;  4PWD A;  3HJF A;  4GKK K;  2P9N A;  2AEH A;  4FLT A;  3JSM A;  1L3U A;  3BEX A;  2HVH A;  3NH0 A;  3CFP A;  1K6Y A;  1HJR A;  4DB3 A;  2F96 A;  3H1Q A;  5JLH A;  3C65 A;  4W5T A;  3IFR A;  5HRP A;  1UWB A;  1VQP N;  1TVR A;  2COP A;  1J5O A;  4BRA A;  4HUE A;  5EOY A;  4C8K A;  4F8R A;  4C8O A;  5AZI B;  2OAN A;  2QWO A;  2O8D A;  2QWP A;  4OVL A;  3OYF A;  5FPD A;  2IVN A;  4YDU A;  5BN8 A;  4LF8 K;  3V6D A;  1U2V A;  5EVZ A;  1MK7 B;  1S5J A;  1HX1 A;  3G9W A;  4L8R B;  5F0X A;  1MWK A;  2WTU A;  4Z4F A;  1H4R A;  3FR0 A;  1JLQ A;  4UY8 O;  4DV2 K;  4BDY A;  4C1N I;  4CF8 A;  2YKN A;  1IKY A;  2YNF A;  1ZBH A;  2UXC K;  1BA1 A;  2LBB A;  3LP2 A;  3NBP A;  2V52 B;  1L5U A;  3I0R A;  1GLF O;  2ZM6 K;  1BDG A;  4ZRJ A;  3H3O B;  3HP9 A;  3KZB A;  4B3M K;  1RTD A;  3WUH A;  3AO5 A;  3LAK A;  4O55 A;  2RHK A;  3VET A;  4Y0W A;  2DIK A;  4JRQ A;  3SQ0 A;  4LFB K;  4M3T A;  4HUF A;  4U7B A;  3U8X A;  1M90 O;  4WQ4 C;  1FK9 A;  2A1R A;  1TKZ A;  1YJN N;  5BPN A;  3THY A;  4E7L A;  5J2M A;  3W3D A;  3WNF A;  1E4F T;  2P9S A;  2XY6 A;  3ZSV A;  3HXM A;  4GV9 A;  1NK9 A;  4BRL A;  4E1M A;  5JLF A;  4DV0 K;  4R5P A;  4FCY A;  3AO3 A;  4OPK A;  3DXK B;  1L3S A;  1QQC A;  4FWN A;  2E6M A;  2VWK A;  3AVN A;  3R1X A;  4LF6 K;  1HJO A;  2P9N B;  3RMB A;  4FWK A;  4XH5 A;  3RMA A;  1S6P A;  3FZL A;  1K73 O;  5AQU A;  1GLB G;  1S22 A;  3OA9 A;  1RDD A;  1TUU A;  3WXI A;  4DV7 K;  5KPR A;  2UUC K;  1WSI A;  3U7D A;  1Z26 A;  1WSH A;  2QXF A;  5M1K A;  4K0K K;  5AQM A;  2LSN A;  3HRG A;  3T1A A;  3L2U A;  3FP5 A;  1N6Q A;  4A5B A;  4QS9 A;  1IG9 A;  3O6W A;  3EZW A;  5DM7 L;  1YTU A;  3T19 A;  3QLH A;  5I3U A;  1XNR K;  3CF5 L;  4CJQ A;  3K5O A;  4CZE A;  4O5B A;  3V9U A;  2B4J A;  2OPP A;  3PSI A;  3DOK A;  3M3Z A;  2PBD A;  2QA4 N;  4LY7 A;  4BC5 A;  3LL3 A;  4H5T A;  1HRH A;  3GE1 A;  1JCF A;  4YNQ A;  4JV5 K;  4BVO A;  4P7I A;  1TL1 A;  3OS1 A;  2Q0R A;  3E9P A;  1HMV A;  2AA4 A;  3LM9 A;  3VGK A;  3LDL A;  5FRM A;  1EKE A;  5CR4 A;  2OZM A;  4JK7 A;  4JKA A;  1WN7 A;  2ATQ A;  4BRG A;  3THV A;  4FWO A;  1BCO A;  3WQU A;  2NRW A;  2GTD A;  1IBK K;  1S72 N;  4FWM A;  3LWM A;  4E7I A;  3A5M C;  5KTQ A;  4BY9 C;  2O8C B;  3E01 A;  3CM6 A;  4H8K A;  5F1X A;  1TK5 A;  3D2E A;  1W9H A;  2Q97 A;  5LJV A;  4C8M A;  1RT6 A;  5T7B A;  3MED A;  5IT9 O;  3M1F A;  3ZT3 A;  3DLL L;  3AA2 A;  3MN5 A;  4N5S A;  4GKJ K;  5FRO A;  1NMD A;  1KLN A;  2ZF5 O;  1VSI A;  3Q7B A;  5AQR A;  3WXJ A;  1VSK A;  3P83 D;  3L2W A;  4K8X A;  1NWK A;  3IRX A;  4JD2 B;  2G8U A;  3L0Q A;  3OYA A;  2FBV A;  1DTT A;  4FLU A;  5BPM A;  3I56 N;  2AL6 A;  4CJT A;  1IKW A;  1VSL A;  2RN2 A;  4YDU C;  4BWJ A;  1T6D A;  5BRH A;  3ASM A;  4K25 A;  3V81 A;  4DLE A;  4DV5 K;  1U2V B;  2D0P A;  4B9S A;  3K5N A;  2X6S A;  3C95 A;  4BG9 A;  4CF9 A;  1RGI A;  4CJ7 A;  3FZK A;  2P9U B;  1MIX A;  5HRR A;  4A57 A;  4Z4E A;  2HHV A;  5KPT A;  4Z94 A;  2E2P A;  2HHS A;  1FJG K;  4Z4H A;  4OLB A;  1YIT N;  3M8S A;  3BZC A;  2CB8 A;  1QQN A;  4GMJ B;  3MX2 A;  1KCF A;  4CEQ A;  1WBB A;  1HYV A;  1GC6 A;  3HPG A;  3M8P A;  3S9H A;  2E6L A;  5K14 A;  1NNE A;  5M1P A;  3VA3 A;  2O8B B;  3QFP A;  3AAQ A;  3ISN C;  3AVJ A;  5DMR A;  2P5O A;  3L2V A;  1BUP A;  2E1Z A;  3OHR A;  3T7Z A;  3O3H A;  1HNW K;  5GAH P;  3M5R A;  4H5V A;  3SCX A;  5CY4 A;  3QO9 A;  3BGR A;  1IV0 A;  3UB5 A;  3VF2 A;  3TAB A;  2UUA K;  3OYM A;  4CEC A;  5C0Y A;  2KFN A;  4DQP A;  2A41 A;  3DLR A;  1YVU A;  2GEM A;  3AY9 A;  4EFH A;  1EF1 A;  3ID6 A;  3P31 A;  4W5O A;  4B9N A;  5E41 A;  4LF9 K;  3QB0 A;  1JLA A;  1XC3 A;  4CFA A;  5AZI A;  1RIL A;  2Z1G A;  1GLJ O;  4DR5 K;  1JLB A;  4KFB A;  3R3L A;  3QNO A;  3O9T A;  3HSC A;  3DLK A;  2BAN A;  2Q2R A;  3CJA A;  3UIQ A;  3L4I A;  2ABD A;  4OPA A;  4FJI A;  2JLE A;  3ULE B;  3AO4 A;  1EO1 A;  1HR0 K;  2I7N A;  1SL2 A;  1SKW A;  1XQS C;  3J7Z O;  3EL2 A;  4HCB A;  1YJ9 N;  3SPY A;  2D4W A;  1EP4 A;  1T8E A;  4DR7 K;  2OZS A;  4CES A;  3AO1 A;  4YHH K;  3D45 A;  3MXI A;  2G8V A;  2QWL A;  4M3R A;  3C94 A;  5J2N A;  4IO9 L;  4CHO A;  2FF6 A;  3HTV A;  3G25 A;  1U49 A;  2ASM A;  3JYT A;  1NG9 A;  3LWL A;  4DU1 A;  3SMP A;  4XEI A;  4FLX A;  3LPU A;  3BF1 A;  4CEF A;  4BAC A;  1S1X A;  2F7T A;  1BIU A;  3P5J A;  2Z1J A;  1NKC A;  3WXK A;  5B8H A;  3CCJ N;  3WEE A;  3L2Q A;  1KTQ A;  1C0U A;  3NHG A;  1NK5 A;  3UKR B;  4HHT A;  4B1Y B;  1RCH A;  4CFB A;  4Z4I A;  1MK9 B;  1WAF A;  3LAM A;  1YXQ A;  2CH6 A;  4DTM A;  4F3O A;  3CCL N;  1SV5 A;  1N32 K;  3MEC A;  1NGJ A;  1RDU A;  2IVO A;  3V4I A;  2QKK A;  2PFU A;  1MU2 A;  3U3G A;  4CZI A;  2WOM A;  1ASU A;  4JD2 A;  3CQX A;  3T3F A;  1OKJ A;  5BN9 A;  4JI4 K;  3TAN A;  3SAF A;  1C0M A;  1GOA A;  3GDQ A;  4HVJ A;  3TTD A;  5C25 A;  3ZYY X;  1NTI A;  4JAX A;  1TYQ B;  3SBT A;  4FLW A;  3V9X A;  5EY4 A;  1WSE A;  3SAH A;  4KV8 A;  5GAD P;  2YCH A;  1HPM A;  3C7N A;  1YVN A;  2CGL A;  2PY5 A;  1TAQ A;  3V9Z A;  4AQY K;  1ZBL A;  4JKH A;  4JI2 K;  4Z4G A;  3HO1 A;  1X3N A;  4KHS A;  3KLH A;  3QEV A;  3QEW A;  4CW7 B;  1TYQ A;  4M63 C;  4I6M A;  2RF2 A;  4CBW A;  4BE2 A;  3ZT0 A;  3EZ5 A;  3I0S A;  1Z25 A;  1G15 A;  4BC4 A;  3H3N O;  3I55 N;  2P9L B;  4MLE A;  3W0L A;  4OGE A;  4FPA A;  2G8H A;  1HYS A;  4DXA B;  1RDW X;  4KHW A;  1Z6R A;  1ST7 A;  4BRI A;  3DLB A;  4CJS A;  3PO5 A;  3CPW M;  4BRK A;  1Q7Y O;  4KI4 A;  2Y1I A;  3HST B;  4CJR A;  2BH1 A;  4CYE A;  4DU4 A;  3T1H K;  1RBR A;  2P9L A;  1F21 A;  3OJS A;  4GVM A;  2Q31 A;  2X74 A;  1JXB A;  1XWL A;  2RE2 A;  4AIL C;  1VQM N;  3NVM A;  4DTR A;  3TTF A;  4FJJ A;  1BOT O;  3L6Q A;  4PY5 A;  4FJG A;  1QZ5 A;  4M3U A;  1RT4 A;  2NRX A;  1A5X A;  2ZGZ A;  4O4G A;  1OH8 A;  3HVT A;  2KW4 A;  1CZB A;  3K5L A;  4FK4 A;  1S1V A;  1SKR A;  3RMC A;  1SL1 A;  4L3Q A;  3KD1 E;  2QWM A;  1IBM K;  1TL3 A;  1SS6 A;  1BGX T;  2EWS A;  1ZBS A;  3VEO A;  2VWB A;  1WSG A;  3KLE A;  3NE6 A;  3MX5 A;  3QET A;  3RSE A;  3THX B;  4KI6 A;  1NK0 A;  3KIO A;  3ZSQ A;  3PX0 A;  1C6V A;  3DRR A;  2B6A A;  4FJ7 A;  3OYN A;  1YT3 A;  1LCU A;  3QIO A;  4TSX A;  2P9P B;  4BGA A;  2FSN A;  3WNG A;  3DXM B;  5I9E B;  2QM1 A;  2EHG A;  4DS5 A;  1ZBF A;  4EAH D;  4I2P A;  3PV8 A;  2E2O A;  4CJV A;  4MQ3 A;  3PIO L;  5AQO A;  3H46 O;  3THY B;  5AR0 A;  5AQN A;  2FDQ A;  3FLV A;  2FC0 A;  2HE7 A;  4AHS A;  2E20 A;  3O4W A;  1LWC A;  1U04 A;  2HNZ A;  3SZ2 A;  4WFA L;  1QHT A;  4C1N K;  3ZLJ A;  4QS8 A;  2CH5 A;  3LP3 A;  4YOW A;  2F9W A;  4YL8 A;  3R8E A;  3FGU A;  2A3Z A;  4DMN A;  5C10 A;  5AQY A;  2YHX A;  3ALY A;  3SPZ A;  4RTF D;  4EKU A;  1QE1 A;  4DHY A;  1KFS A;  4QAG A;  4CIG A;  1HB8 A;  3VER A;  3CJ1 A;  3DXM A;  5KQD A;  4N47 A;  3EE8 A;  3TU5 A;  4RW7 A;  2P9K B;  4DSL A;  1VHX A;  2KFZ A;  1B9D A;  4AHU A;  3O4Q A;  5KGX A;  3ZSZ A;  4B3T K;  1JLF A;  3DMJ A;  1X1P A;  4DTU A;  2EMT A;  1RT7 A;  3TAM A;  4FJM A;  1C0F A;  2VYP A;  3A5O C;  3GBT A;  3U3Y A;  2Q0U A;  2ZGY A;  3U6F A;  1XC9 A;  3OYE A;  1NGA A;  2QWR A;  1ESV A;  3FFK B;  4H0Y B;  4KB0 A;  2O8E B;  2I7P A;  3ZET B;  3SV4 A;  4NCG A;  1VAZ A;  4CGH A;  3TAP A;  2YI1 A;  3HOS A;  3EYZ A;  1XNQ K;  4Z4C A;  4A61 A;  1ZBU A;  3AO2 A;  4DLG A;  4MDA A;  1J9A A;  3P1G A; 
#chains in the Genus database with same CATH homology
 1T44 A;  3OBY A;  2CGJ A;  4QS9 A;  2NRT A;  5AQL A;  3O6W A;  5AQW A;  3EZW A;  3CME N;  2P9I B;  5DM7 L;  1DT9 A;  1ZC6 A;  1O13 A;  2CQU A;  3E66 A;  2HF4 A;  3JS6 A;  3MN7 A;  4A2B A;  3CF5 L;  3CCV N;  4CZE A;  4OPH A;  4JK8 A;  3CJ7 A;  4DCH A;  2BUP A;  5C15 A;  2AP1 A;  1D4X A;  2GUP A;  1KC7 A;  1QVG M;  4MO4 A;  2D0O A;  4ILJ A;  3M3Z A;  2PBD A;  2WBN A;  2QA4 N;  3G71 N;  3B8A X;  4BC5 A;  3LL3 A;  2NRH A;  4H5T A;  3PZD A;  3GE1 A;  1JCF A;  3U9Z A;  5JVH L;  4ILH A;  3O08 A;  2A5X A;  3MCP A;  2BTF A;  4BVO A;  3C6H A;  4P7I A;  2JWK A;  4ILG B;  1KXP A;  2Q0R A;  3MK6 A;  5KQ8 A;  5AQS A;  2E1Y A;  1NLV A;  3E9P A;  3CER A;  2AA4 A;  3LM9 A;  3VGK A;  3LM2 A;  2V7Y A;  4AM7 A;  2UYT A;  3K9K A;  3KVG A;  3LDL A;  4B9Q A;  5CR4 A;  3H6E A;  4YOT A;  2QXL A;  4JK7 A;  4JKA A;  2FJ9 A;  4EHU A;  3VOV A;  2V7Z A;  4BRG A;  4FWO A;  3CJ9 A;  4CD3 A;  1EQY A;  4JHD B;  1NM1 A;  2NRW A;  3CHW A;  2GTD A;  3WQU A;  3N4Q A;  5BPL A;  5JMV A;  4FWS A;  3ID8 A;  1P90 A;  4BQZ A;  3WA0 A;  2FSK A;  1S72 N;  4BVP A;  4KH6 A;  4FWM A;  4NLB A;  4IJN A;  3ENO A;  4H5W A;  3A5M C;  3WXL A;  4PL7 A;  4GV3 A;  4IFE A;  2HST A;  3SJH A;  3H1V X;  3VTI A;  3BUZ B;  3D2E B;  2E8A A;  4JKF A;  1WUA A;  1XUP O;  3ULE A;  3C6A A;  4BY9 C;  4R79 A;  3O9U A;  3FZF A;  5F1X A;  4OO1 J;  3D2E A;  1KD1 O;  2J0J A;  4J8F A;  1SQK A;  2Q97 A;  5LJV A;  5JVL A;  5FPE A;  1KC8 O;  4H0P A;  3WT0 A;  4BRM A;  4MO5 A;  2D11 A;  3M1F A;  5ADX H;  4TKN A;  1P8Z A;  4FO0 A;  3DLL L;  3MN5 A;  1MWM A;  4BRP A;  5HL7 L;  4BRD A;  3FE1 A;  1JCG A;  2E2Q A;  4JKB A;  3CCE N;  4G9Z A;  5GAG P;  1NMD A;  1QQO A;  1DIK A;  2ZF5 O;  3KK7 A;  4H0X B;  3Q7B A;  4BR9 A;  3VEW A;  5AQR A;  3WXJ A;  1NGF A;  3EE9 A;  3HM8 A;  5ADX A;  4B1X B;  3R9P A;  3CQY A;  1NWK A;  2A42 A;  3CC2 N;  4JD2 B;  1KAZ A;  1MDU B;  4NY0 A;  3L0Q A;  4PKG A;  4RCH A;  5M1O A;  1Z05 A;  4IDH A;  1ATR A;  3CET A;  4JEP A;  4NLC A;  4AF1 A;  4BRQ A;  1ACA A;  5BPM A;  3I56 N;  2AL6 A;  2W41 A;  1VQK N;  1NJI O;  2ASP A;  4YDU C;  2DPN A;  1T6D A;  5BRH A;  1GC7 A;  4PHT X;  3PIP L;  5TKW A;  1E4G T;  5M1F A;  3SAG A;  4IO8 A;  1BWF O;  4K25 A;  3AGK A;  1U2V B;  2D0P A;  2QWN A;  4BRO A;  2CGK A;  3CXC M;  3AGR A;  3CCQ N;  3SK3 A;  4BG9 A;  3WQT A;  2ZJR L;  2ZPY A;  3CJB A;  1RGI A;  4FWP A;  4CJ7 A;  3FZK A;  3IMX A;  5AQF A;  2P9U B;  1MIX A;  2HF3 A;  5AZJ A;  4A57 A;  4ZRI A;  4K43 A;  4E1J A;  3EN9 A;  4WCE L;  1NGI A;  3E9L A;  3TPQ A;  4Z94 A;  1YF5 L;  5KPT A;  3ZDT A;  1YAG A;  5AQT A;  2E2P A;  1NVL A;  3LDO A;  5GIN A;  5FPM A;  2J4R A;  1MA9 B;  1K8A O;  4XH4 A;  4K42 A;  2NLX A;  3CI5 A;  1YIT N;  2VCP A;  1Q86 O;  2CB8 A;  1QQN A;  3O8M A;  3MX2 A;  2J0M A;  1ATS A;  2ITM A;  5JVG L;  3EKU A;  1MIZ B;  1W97 L;  3CJC A;  3LDP A;  1GC6 A;  5AQG A;  4HDQ A;  1KAY A;  3ZX0 A;  5DM6 L;  1H1V A;  5M1P A;  1VQN N;  3FZM A;  1R59 O;  3QFP A;  5FPN A;  3TSU A;  3AAQ A;  4A59 A;  5E84 A;  4NO7 A;  3AU4 A;  4ZRK A;  2P9I A;  2D2Q A;  5CE3 A;  2NRZ A;  1BUP A;  1VQL N;  5AQI A;  2E1Z A;  3OHR A;  3T7Z A;  1T3V A;  3Q7C A;  3D2F B;  2X0S A;  3A0I X;  3M5R A;  5GAH P;  4H5V A;  5EX5 A;  1DEJ A;  4WQ5 A;  1JJ2 M;  3UB5 A;  3VF2 A;  1Y64 A;  4JN4 A;  3SLC A;  1VQ4 N;  1VQ6 N;  3UKR A;  3I33 A;  4U67 L;  3EKS A;  1NGH A;  5C0Y A;  1HBK A;  4KH4 A;  1X9J A;  2A41 A;  4YOY A;  4BR0 A;  5AFU H;  4JHD A;  4O8K A;  2GEM A;  3AY9 A;  4FPB A;  4EFH A;  1EF1 A;  3ID6 A;  3P31 A;  5LY3 A;  5AQZ A;  2HBM A;  4GV6 A;  4ISF A;  5E26 A;  4CBU A;  1ATN A;  3QB0 A;  1IJJ A;  1XC3 A;  3MWT A;  3VGL A;  2QW9 A;  4DQ8 A;  5AZI A;  1Q81 O;  1GLJ O;  4MDB A;  2GWK A;  3F9M A;  3MCA B;  3R3L A;  4H5N A;  1HKC A;  2Q1N A;  1CZA N;  4BRE A;  2QI2 A;  3AAR A;  2NZT A;  3O9T A;  4BGB A;  3HSC A;  2P9S B;  4QS7 A;  4BG8 A;  2Q2R A;  3CJA A;  1VQO N;  2HOE A;  2ABD A;  3L4I A;  4OPA A;  3I8B A;  3O9S A;  4HTL A;  3ULE B;  4FOE A;  4BQL A;  2HRJ A;  2GX9 A;  4I6M B;  3VGM A;  1EO1 A;  2I7N A;  4GVE A;  1XQS C;  3J7Z O;  3CCM N;  4BR4 A;  1GGO A;  5JIC A;  1YIJ N;  4WFB L;  4BC3 A;  3EL2 A;  4BRH A;  5IJM A;  3O9R A;  3QFU A;  2HMP A;  1YJ9 N;  4H0V B;  1BG3 A;  4B1W B;  5M1Q A;  4EHT A;  3R6M A;  3VEV A;  2YJF A;  4IEI A;  4CZJ A;  2D4W A;  1VQ5 N;  2A40 A;  3CPE A;  3UE5 A;  3CMA N;  3PVL A;  3CCS N;  4B1V A;  4WQ5 C;  1T6C A;  2QWL A;  5BR9 A;  3CCU N;  4IO9 L;  1BU6 O;  2PAV A;  3MN6 A;  3QML A;  3CIP A;  1ILY A;  3CC7 N;  2FF6 A;  2P9U A;  3HTV A;  3G25 A;  2YHY A;  3IUC A;  2ASM A;  2NRV A;  5HOO A;  3SMP A;  3HBT A;  4IXC A;  1KBL A;  1V4S A;  1ISN A;  4XEI A;  5KPZ A;  2FXU A;  3HOT A;  4WQ4 A;  1NBW A;  4PKH A;  4FWL A;  3HZ6 A;  3M6G A;  3BF1 A;  2R82 A;  2F7T A;  3EO3 A;  1VQ8 N;  1RFQ A;  3WXK A;  5B8H A;  3CCJ N;  4JKG A;  4XH1 A;  3PLA A;  3WEE A;  3O1W A;  1HLU A;  2WH5 A;  1C0G A;  2D10 A;  3G6E N;  1NGB A;  2J0K A;  2P9P A;  4JKE A;  3UKR B;  3EPY A;  3MMV A;  5GIO A;  3A5L C;  3IKM A;  4B1Y B;  4BRN A;  2Q36 A;  1GLC G;  2IVP A;  1G99 A;  2P9K A;  1MK9 B;  1NI2 A;  2FSJ A;  2HBJ A;  1YXQ A;  2CH6 A;  1QZ6 A;  3VTH A;  3CCL N;  2E2N A;  2QTD A;  4GY2 B;  2WC9 A;  3VPZ A;  1BA0 A;  3P39 A;  1NGJ A;  1RDU A;  2IVO A;  2NRR A;  2QEX N;  3DJC A;  4K41 A;  1VBG A;  2OTJ N;  1VBH A;  2PFU A;  3UKU B;  3VEY A;  4CZI A;  3DAW A;  4PKI A;  4ISE A;  4C23 A;  4WYB A;  4JD2 A;  3ZET A;  2V51 B;  3CQX A;  4CZK A;  3K9J A;  2ZJP L;  4HDO A;  1OKJ A;  3L4Q A;  5GAE P;  2EMS A;  5BN9 A;  4FWQ A;  5ELZ A;  4CZL A;  1U6Z A;  3QIC A;  1QHA A;  5EXW A;  3SAF A;  3GG4 A;  1TUY A;  3GDQ A;  4O5F A;  2ZJQ L;  4FVU A;  3TTD A;  4YOV A;  4BR2 A;  3SMS A;  2FLO A;  3LDN A;  1SGH A;  1Q18 A;  2HBL A;  4M7Y A;  1K8K B;  3ZYY X;  3IVF A;  4FWR A;  5AQK A;  1NTI A;  3KWI A;  3E1Y A;  1TYQ B;  2WFB A;  4JAX A;  5AQX A;  1GLD G;  3SBT A;  3FLC O;  3ATV A;  4FSV A;  5EY4 A;  3SAH A;  1YJW N;  3A5N C;  4GNI A;  2YCH A;  4LC9 B;  1HPM A;  3C7N A;  5GAD P;  1YVN A;  2CGL A;  1J6Z A;  4JKH A;  3MWP A;  3U8Z A;  1X3N A;  2GWJ A;  3F5T A;  1VQ7 N;  3BIN A;  1IG8 A;  1JCE A;  3ZX2 A;  4A62 A;  5GIP A;  3P4I A;  4JKC A;  4B1U B;  3AU5 A;  1TYQ A;  2FF3 B;  2HBK A;  4M63 C;  4I6M A;  4NB4 A;  3TTC A;  4BC2 A;  4CBW A;  1GLA G;  1GLL O;  1Q82 O;  4IOX A;  2YHW A;  3P38 A;  4BR5 A;  4BC4 A;  3H3N O;  3I55 N;  2P9L B;  4MLE A;  3MDQ A;  3W0L A;  1ZXO A;  4FPA A;  1HB6 A;  3U4L A;  3ZEU A;  5AQH A;  1Y19 B;  4DXA B;  1NGD A;  1RDW X;  4AM6 A;  1Z6R A;  4M7X A;  1ST7 A;  4BRI A;  2A6A A;  3QDK A;  1N8R O;  3QBX A;  3S41 A;  2JWL A;  3CPW M;  1GG3 A;  3DWL A;  3TSP A;  4BRK A;  1Q7Y O;  1KAX A;  3KHY A;  3NMU A;  4FOI A;  1OVY A;  3ATU A;  3TSQ A;  1E5W A;  1YUW A;  4A5A A;  4BRF A;  1HKG A;  2BH1 A;  4H0T B;  4CYE A;  1HKB A;  2ASO A;  4F7G A;  3AAP A;  1HUX A;  2P9L A;  3ENH A;  4WF9 L;  2P9N A;  2Q31 A;  2AEH A;  5C12 A;  1QQM A;  2W40 A;  2RE2 A;  3JXU A;  1WOQ A;  1VQM N;  3NVM A;  3VMF B;  3BEX A;  3TTF A;  3VES A;  1BOT O;  4IZ9 A;  3L6Q A;  3OW2 M;  1SZ2 A;  2RQ1 A;  5AQP A;  1VQ9 N;  4BRC A;  3X23 A;  1QZ5 A;  4DB3 A;  4IEE A;  2NRX A;  2ZGZ A;  3H1Q A;  4EIA A;  2YJE A;  3C65 A;  3D2F A;  5JLH A;  3IFR A;  2VGM A;  3LDQ A;  1VQP N;  4IOA L;  4JKD A;  3RSE B;  2COP A;  5CHI A;  5AQV A;  1GLE G;  1YI2 N;  4BRA A;  4L3Q A;  3D6R A;  2QWM A;  4HWI A;  5EOY A;  4ISG A;  5BRE A;  1SS6 A;  5AZI B;  3E9O A;  2OAN A;  4BR7 A;  2QWO A;  1K9M O;  2EWS A;  4KH5 A;  1ZBS A;  3VF4 A;  1BO5 O;  3VEO A;  4WFN L;  2VWB A;  3KWG A;  2QWP A;  3CD6 N;  4JNE A;  3H45 C;  5FPD A;  3MX5 A;  2IVN A;  2GEL A;  3RSE A;  4YDU A;  5BN8 A;  4A2A A;  4B1Z A;  3MN9 A;  1U2V A;  3C0B A;  5EVZ A;  1MK7 B;  2E88 A;  4H03 B;  1YHQ N;  1HX1 A;  3NVK A;  3A8Y A;  4H0O A;  1X3M A;  3O5B A;  2D1K A;  1LCU A;  3G9W A;  2WUS A;  3UKU A;  5F0X A;  3T69 A;  1MWK A;  3CCR N;  2P9P B;  4BGA A;  2FSN A;  2VGN A;  3DXM B;  3GOI A;  3VF6 A;  5I9E B;  1H4R A;  1LOT B;  3FR0 A;  5BRF A;  2QM1 A;  5M1N A;  4UY8 O;  2I1J A;  4JKG B;  4EAH D;  3BP8 A;  5BRD A;  3U9D A;  4RWT A;  4YOX A;  4C1N I;  2E2O A;  3C7N B;  4JK9 A;  3VEX A;  3PIO L;  5AQO A;  3H46 O;  3WXM B;  2KKZ A;  5AR0 A;  5AQN A;  2FDQ A;  3FLV A;  2HE7 A;  2NNW A;  2E20 A;  3O4W A;  1BA1 A;  4IOC L;  1KQS M;  4IWV A;  4O8U A;  4C1N K;  4WFA L;  2LBB A;  4QS8 A;  2CH5 A;  4YOW A;  3RVC A;  2F9W A;  4YL8 A;  2V52 B;  1V4T A;  3O1B A;  1GLF O;  3R8E A;  3FGU A;  2A3Z A;  2IIR A;  5C10 A;  1BDG A;  4ZRJ A;  4CZF A;  3H3O B;  5AQY A;  2YHX A;  1NGC A;  4CI6 A;  3KZB A;  1SAZ A;  2H3G X;  5C2F A;  3WUH A;  3O80 A;  4EKU A;  3D7E O;  3N4P A;  4MLH A;  4RTF D;  4CBX A;  5AZJ B;  2RHK A;  4CD1 A;  3VET A;  4DHY A;  4Y0W A;  2DIK A;  5F2R A;  1HB8 A;  3VER A;  3CJ1 A;  3G4S N;  3BF3 A;  5H1S Q;  3DXM A;  5KQD A;  1NGE A;  4U7B A;  3U8X A;  1M90 O;  3EE8 A;  4WQ4 C;  3ZX3 A;  3TU5 A;  3DXK A;  5TKY A;  5AQJ A;  2P9K B;  1YJN N;  5BPN A;  1QVF M;  3O9Q A;  3W3D A;  2YVC A;  3FZH A;  1E4F T;  5LJW A;  5MLC Q;  2P9S A;  3CC4 N;  1J19 A;  3VEZ A;  4GXB A;  4GV9 A;  3QIJ A;  1DKG D;  3HI0 A;  4KBO A;  3WEE B;  2F9T A;  4BRL A;  2OTL N;  2EMT A;  3GL1 A;  1S3X A;  5JLF A;  3DXK B;  1C0F A;  2ZWH A;  3ENB A;  2VYP A;  4FWN A;  3A5O C;  3GBT A;  3J8A A;  4FL9 A;  1NGG A;  4H5R A;  3SBG A;  3R1X A;  1K8K A;  3ZEU B;  4YOR A;  1HJO A;  2Q0U A;  2ZGY A;  2P9N B;  2I1K A;  4FWK A;  1NGA A;  2QWR A;  3FZL A;  4XH5 A;  1K73 O;  5AQU A;  1ESV A;  5C2D A;  1GLB G;  1S22 A;  3FFK B;  3OA9 A;  1DGK N;  4H0Y B;  4PL8 A;  3WXI A;  1TUU A;  2I7P A;  2YX6 A;  5KPR A;  3ZET B;  3U7D A;  3QBW A;  4CZG A;  1JDE A;  3F2K A;  2KLA A;  5M1K A;  1W2B M;  5AQM A;  4CZM A;  1VAZ A;  5AQQ A;  3OBW A;  2YI1 A;  4YOU A;  3VEN A;  3HOS A;  1M1K O;  4IJA A;  3HRG A;  4F9O A;  4A61 A;  3IDH A;  4DKW A;  2QWQ A;  5AFU A;  3FP5 A;  4MDA A;  4CZH A;  4A5B A;  2KHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...