4JKAA

Open and closed forms of r1865a human prp8 rnase h-like domain with bound co ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkaA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkaA01
3E9LA 4JKDA 3SBGA 4JKAA 4JKFA 3E9OA 4JKGB 4JKEA 4ILJA 4JK8A 4ILHA 3E9PA 4JKBA 4JKGA 3SBTA 3ENBA 4ILGB 3E66A 4JK9A 4JKHA 4JK7A 4JKCA
chains in the Genus database with same CATH superfamily
3E9LA 5HOOA 3LANA 4CJSA 4YL8A 1BO5O 4JD2B 3CJBA 3VN5A 5GAGP 3C6HA 1RTJA 3FZFA 4KTQA 2P9SB 3AVFA 1RT3A 2ITMA 3NH0A 5GAEP 3VQQA 3ZYYX 1LCUA 3AA5X 3OYGA 4N5SA 4ELUA 3NMUA 4NXMK 4DSKA 4C8LA 3F73A 1JKHA 3WEEB 3A0IX 2V51B 3OYFA 4CEQA 2I7PA 2PBDA 1EP4A 4GV9A 2O8EA 4BE0A 4F3TA 4DU1A 1NJIO 4O55A 5JLHA 2IGIA 3T69A 4H4OA 3O3HA 1HLUA 4O44A 4W5RA 2NUBA 4JK9A 2KW4A 1HKCA 4RG8A 4DTNA 1IV0A 2YCHA 3ZCMA 5E41A 2P9IA 1NGEA 1HNXK 1JCGA 4F2RA 1ITGA 2E2OA 3Q7BA 2P9UA 3D2EA 3P31A 2WOMA 2FSJA 5CE3A 3P4IA 3PSIA 4WQ4C 4KH5A 1J5OA 3ZSXA 2E5LK 4M7YA 4QS9A 1RCHA 4BGBA 2D0CA 2ZD1A 2ZJRL 4CHPA 4PKIA 2H3GX 1DKGD 1NK0A 1B92A 1VQKN 2QWPA 3DRPA 1MWMA 4FZYA 4B9SA 4IOAL 4BRNA 1ZXOA 1SAZA 1C1AA 4WCEL 3MX5A 3SUQA 4CZLA 3KLIA 2G8IA 1HNVA 1MA9B 4BDZA 5BN8A 2YHXA 5BR9A 1QSLA 4BRDA 1FW6A 1MWKA 3AAPA 2DFEA 1YT3A 3P5JA 3K57A 4E7HA 2HW3A 1D4XA 5T7BA 3CCRN 2R7YA 3WXJA 4JI5K 2CH6A 4M42A 3KK1A 3DRSA 4JHDA 1ZYQA 3TTCA 1NGAA 2YHYA 1Y97A 3VQ8A 3ATVA 3HVRA 3SNNA 1XHZA 3O9QA 5EXWA 2HF3A 4JI3K 3ALYA 4LFAK 2GBZA 4DTOA 1LWFA 1VSEA 4CZHA 3AO4A 3KLGA 1NJXA 4GKJK 1VSDA 4NYFA 3CJ7A 4KTZA 2A1SA 3CFRA 3V9SA 2GWJA 2P9KB 2VQFK 3RSEA 3NF7A 5K14A 3KWIA 3T1YK 1A5VA 1VSMA 3THVA 4DLGA 2P9LB 4YOWA 4IBNA 1N6QA 1NK9A 1HYVA 1QQNA 3OYHA 2HHHK 3T7ZA 1L3UA 1RBSA 5AQKA 4CFBA 3O3GA 3AGRA 3AVBA 4N47A 4BRCA 4JKGB 1DT9A 5FPDA 4BQZA 1MIZB 3V9ZA 1N32K 1KAYA 4NXNK 2VGNA 1BL3A 2HMIA 3WXLA 4XIUA 1VQ7N 2ATQA 4H0PA 2X78A 4HWIA 4JKDA 1BQNA 4FK4A 3ZT1A 1DTTA 3CJAA 3H1QA 5C24A 3O1WA 4LF7K 4G9ZA 1Z26A 2E6LA 4AQYK 3THYA 2CH5A 4K25A 1IJJA 1NGGA 1YF5L 2QEXN 2G8WA 4U67L 2QXFA 3QB0A 3W0LA 3PVLA 1ISNA 3MX2A 2B4JA 3LPTA 4BRHA 5GINA 3ZT0A 1VRTA 4AHTA 4FLYA 3IKMA 5LL6Z 1HNWK 4EHUA 2AEHA 1KAZA 2QW9A 5CY4A 4KTWA 3U8XA 3FP5A 1KCFA 2OANA 1A5WA 1YVUA 3O4NA 1P90A 2W40A 2O4GA 2RHKA 1QQOA 2HOEA 3KIOA 1ESVA 4WFAL 1NMDA 1Q82O 4KI4A 4B9MA 4FL9A 3IG1A 5CHIA 3MAQA 4DTXA 4E1NA 2HBKA 3ENOA 3RRHA 4CFAA 3EYZA 1BI4A 1S6PA 3IS9A 4BC2A 4DQ8A 5IT9O 2W6LA 4DTPA 1DEJA 5EU7A 1NBWA 3L3VA 3WNGA 4BWMA 3SYZA 4CESA 2V52B 3T1AA 1NM1A 4FO0A 2CGLA 4R79A 3HOSA 3LDNA 4FYDA 4QCLA 1VSHA 1R0AA 1ATNA 3AY9A 3ZLJA 1N8RO 1TYQB 3GBTA 3JAMO 3O1BA 2WFBA 2G8FA 3B6PA 3PLAA 4YOYA 3HSTB 2IVNA 1HQUA 4GXBA 3AVNA 1RDUA 4EFHA 1HBKA 4FZZA 4JKGA 1DGKN 2YHWA 4DSIA 1IH7A 4AHUA 4CK2A 3K5MA 2EMTA 3VQ9A 4CD1A 1KBLA 2NRTA 4KHYA 1KQSM 3X23A 4B1ZA 3O5BA 1J5EK 4LF6K 3HJFA 4JK8A 4CIFA 3LDLA 3U3GA 3CHWA 4CHQA 3SQ2A 3CM6A 3O6WA 3QEIA 3AVAA 1GLFO 3C65A 3L2WA 3AV9A 3PV8A 2X0SA 2LSNA 3NE6A 4IOXA 4B08A 2CB8A 4IJNA 3V81A 1U2VA 1UA0A 4I2PA 3SLCA 4J2AA 4B9VA 4N56A 3KD5E 4CJLA 3RRGA 1Y19B 3CI5A 3CPWM 3NAEA 4NCAA 3QDKA 1RFQA 1S9EA 4FWNA 3VGLA 1FK9A 4JKBA 4KB0A 3O4WA 1W97L 3JXUA 3W3DA 4CW7B 5CZ1A 3T3FA 2BH1A 3P83D 2HHXA 1XNRK 3D6RA 3CXCM 5LJWA 1V4SA 4B9UA 1NWKA 3R3LA 1TV6A 2QI2A 4CJFA 4DTSA 1U45A 4JV5K 4H0YB 3BF1A 1XUPO 3LP2A 1T6DA 3VF4A 4GVMA 5LY3A 1T3VA 5AZIB 3ITHA 2G8VA 1QHTA 3D2FA 1S3XA 1N36K 3D0PA 4DR7K 2O8CA 4FJ7A 4U7BA 1IBMK 2DFHA 4CHZA 1T7PA 4DG1A 5BRHA 3LDPA 1OKJA 5AJ3K 2VCPA 2YKMA 3WA0A 3QEXA 4JYAK 2O8BA 4DR5K 1TK8A 1N5YA 2PYLA 3KKRA 1RBUA 4IDHA 3VQ7A 1SGHA 3THXB 2YNIA 4DQIA 2G8KA 4JKCA 2Q36A 4GW6A 3WXMB 2OZMA 2DPNA 5ELZA 2IVPA 1EX4A 4JI6K 3LM2A 1VQ4N 5TKWA 2A1RA 2KLAA 1NG9A 4LF9K 3BINA 1U49A 1CXUA 4FVMA 1WNSA 1BQMA 2PY5A 3M6GA 1S9GA 4DTJA 3TAQA 3CC7N 2WUSA 4LH5A 3QERA 5C42A 4PQUA 4CJVA 4ISGA 4IOCL 4H4MA 1VQLN 2HNDA 1K8AO 5M1NA 3S41A 5BREA 2IVOA 1NJZA 2UYTA 1J9AA 4FOIA 3R1XA 4I9QA 4N76A 3FR0A 2ZE2A 3DI6A 3I8BA 3VESA 3C94A 2VWKA 4DV6K 1NLVA 3U9ZA 3M8QA 4FLZA 2Z1IA 2YNHA 2E2PA 1KC7A 1EWQA 3EL2A 1IO2A 3ZT3A 4CF8A 4EZ9A 2CGKA 4EKUA 3BP8A 4FPBA 3RMDA 1JJ2M 1L5UA 4YY3K 2A41A 4C8MA 3CFOA 4E0DA 4CI6A 1WSJA 5I42A 1IG8A 3DRRA 4NB4A 4KREA 1ILYA 3FZKA 1J6ZA 4MDBA 2VWJA 5AZJA 2FBYA 3DXMB 5HRPA 2D0AA 3AAQA 4ZRKA 3VEXA 2WBNA 1YITN 4OLBA 2BE2A 1QVFM 2X6NA 4DSFA 4H03B 4LF5K 4WE1A 5E26A 3K5LA 4B9LA 1ATRA 4CEFA 5FLXO 5M1QA 4CGGA 3O9TA 2ABDA 5KQ8A 3AA2A 2BTFA 5HROA 3WXKA 2P9PB 4CJWA 4F7GA 3L2QA 4FWQA 2J4RA 1YXQA 1T6CA 4YNQA 3AVGA 4M3XA 1BU6O 3CCSN 2YI1A 3VEVA 4FWMA 3AO3A 1OH8A 2NNWA 4FZXC 1ZBHA 2D5RA 3UKRA 3DLEA 1EF1A 3AGKA 3GL1A 3O9SA 4DQPA 5F2RA 1S1VA 1MU2A 5J1EA 1WLJA 5C25A 3PX4A 4H5RA 4CZGA 3K0SA 1BDGA 2E8AA 4FJ9A 1RTHA 4DFPA 2RF2A 5AQZA 4CD3A 4CJRA 1VSLA 4DHYA 3U4LA 3SQ1A 4DU3A 1X3NA 3QIPA 3BUZB 3OVNA 4B1VA 4HTLA 1S22A 3E1YA 3BY5A 1BIUA 3VQEA 3R6MA 2HVIA 1GLJO 4YOVA 2KZZA 3NDKA 4DV1K 3QETA 2G8HA 2O8DB 3SCXA 4KHPK 3SPZA 1WSGA 3O9UA 3AVKA 4OKEA 4CE9A 2AA4A 3HZ6A 5MLCQ 3S3NA 4E89A 4JI7K 5JICA 1LAWA 4KKOA 2E2NA 3ZETB 1NK8A 3I56N 2P9NB 4FW2A 1IBKK 3V9UA 1XMOK 3KKSA 3E9OA 4CJKA 3KLHA 3NCIA 2KFNA 4CF1A 1Z05A 4F3OA 5D3GA 3TAFA 3EKUA 5KPTA 4ZTFA 3CQXA 2ZJPL 1JLEA 3HRGA 4KH6A 4CGFA 3KK3A 3ULDA 4NCBA 4BDYA 1JLBA 4OLAA 2ITGA 1KLNA 3J7YP 1X9JA 3LP1A 1GLLO 3CQ8A 4IFEA 3WNHA 3BF3A 4X66K 4F9OA 4JRPA 3PUFA 3NH2A 4CBWA 4OPAA 4RW4A 2Z1JA 2V7YA 3MWTA 2XY6A 4J8FA 4DLEA 3S3MA 3ULEA 1S1UA 5M1OA 4JI8K 4FVUA 2HHTA 3U7DA 3MK6A 4ZTJA 4BACA 3WUHA 1VSFA 3I8DA 1KTQA 3V1RA 4BGAA 3SV4A 3DOKA 1WOQA 4DF8A 3L2UA 2FDQA 4BVPA 4KHSA 3LAKA 3PY8A 4UQGA 1WSIA 3ASMA 1QZ6A 4H5NA 5KRTA 3AA3A 3F9KA 4PKGA 1YUWA 4LH4A 5DM6L 5ADXH 2YNGA 4CJ5A 2XO7A 1NJWA 3C6UA 2YHBA 2XY5A 2R82A 2NRXA 3KVGA 5C15A 3CCQN 5DM7L 4FJMA 4WQ4A 3OHRA 3KD1E 1TGOA 3VA3A 3MEDA 3AO1A 3TTDA 3K59A 1C6VA 2WONA 4FLTA 1RT7A 4IJAA 3LDSA 3PIPL 1NTIA 4ID1A 4PHTX 1JCEA 3IRXA 3OY9A 3QEWA 4GMJB 2KZMA 4HDQA 2CGJA 1R59O 4KV8A 4AH9A 4CZKA 5AQLA 3VQPA 1RTDA 2UUBK 1KFSA 3VGKA 3HT3A 2A42A 1REVA 4CIGA 2P51A 4JD2A 1RDWX 2VG7A 4LF8K 2P9SA 1ASWA 1U47A 4AM7A 4OPHA 1YVNA 4FWPA 3AVIA 3QLHA 3SJHA 1HNIA 3VOVA 1YI2N 4FM2A 1C0FA 4FWKA 4CHOA 3H3NO 3O08A 2AL6A 5KGXA 1IKXA 2FF3B 5HP1A 2A40A 3A5MC 1FXXA 3WEEA 3M3ZA 4WFNL 4DFMA 1T03A 5BPMA 1NKCA 5IWAK 3VMFB 4DSEA 5KRSA 3HO1A 3GE1A 4KB1A 4DF4A 1EXQA 1TL3A 1S1WA 1EETA 2B6AA 3CJ1A 1GC6A 5AQMA 4EIAA 2F4VK 1NOZA 2NLXA 3DWLA 4QS7A 4QOZB 5EVZA 1M90O 4CCHA 4FM0A 2XY8A 4KH4A 2VG6A 4V19S 2QWMA 2HHUA 2WC9A 1JXEA 3NF9A 1ZC6A 4J2DA 5AR0A 2QKKA 4ISEA 4DMNA 4C8KA 4M3WA 4EZ6A 4CJEA 3HP9A 1VQON 3MCPA 4AF1A 3T19A 2W42A 1BUPA 3LPUA 2D4WA 2YKNA 2LBBA 1TAUA 2E20A 1EQYA 5M1PA 3VPZA 3QIJA 3CFPA 4BR5A 2GWKA 4XEIA 2W41A 2HBLA 4FJNA 4E1JA 5J2MA 4K8ZA 1RNHA 4I2QA 3KK7A 5JLFA 4GVEA 3OYEA 1C0TA 1VQPN 3C7NB 3NVMA 4H0XB 5HRNA 3ZX3A 3O3FA 1K9MO 1HUXA 4DTMA 4CHNA 3M8RA 3K2PA 4CJ4A 3VQ5A 5BR8K 1W0HA 1W2BM 4FPAA 3JYTA 1GOAA 5IJMA 4DS4A 3FLVA 1VSJA 4QAGA 4BRFA 1VBGA 3QO9A 1N34K 2YV0X 5DMRA 1B9DA 4JRQA 2I5JA 1OVQA 2HRJA 5H1SQ 4TKNA 3QNNA 2HNYA 3HPHA 4GY2B 4JEPA 1SL0A 2J0KA 3IAYA 1VSIA 3TSQA 3SUOA 4BRQA 3OYKA 1YJWN 2EWSA 4WQ5C 4W5NA 1XC3A 3J80O 4F4KA 2ETJA 1J53A 2GUIA 2IC3A 2E1ZA 3MEGA 2HHVA 3SMPA 2NRHA 3BGRA 3C6AA 1Z6RA 1YHQN 1LW2A 1VQ9N 5AQRA 4W5TA 2D0PA 2P9KA 4IO9L 4RW6A 4DB3A 3D45A 4AHVA 2P9LA 5C12A 1P8ZA 3RR7A 1KVAA 5B8HA 4DR2K 2Q31A 3AARA 3Q7CA 2G8UA 1QVGM 3J7AP 1HB8A 1U04A 1MK9B 3H08A 1MDUB 3CG7A 1ZBSA 4R5PA 4BVOA 3IVFA 3P39A 3MWPA 4CF2A 2BDPA 1OH6A 4FK0A 4IXCA 4LFBK 3SZ2A 1E4GT 1LWEA 1RBTA 1S1TA 4CZIA 4BC4A 3L4QA 4C1NI 1VK0A 4JLHA 3QIOA 3U8ZA 4DTRA 4WYBA 1KC8O 2QM1A 4JKEA 1L3SA 3LAMA 3MN6A 1NNEA 2RE2A 4BRKA 1JLFA 1B9FA 1RDDA 3CIPA 3A5NC 4B1UB 4FJKA 3GDQA 5F1XA 4H0VB 3CCEN 1EKEA 3HTVA 3IMXA 4KO0A 2QTDA 1S72N 3UKUB 3F2KA 1J54A 1X9SA 1WBDA 3L4IA 1ST7A 2NRRA 4MQ3A 1RILA 3C95A 1CZ9A 2FSKA 4AM6A 4ELTA 3LL3A 3FLCO 1GC7A 3G10A 3FZHA 5AFUA 2KQ2A 1SUQA 1S1XA 4B1WB 4W5QA 4MLHA 3CF5L 3SUNA 1WAFA 2D0OA 4E19A 4I7FA 4YDUA 1QSSA 3OYCA 2F7TA 2OPRA 4FM1A 4ICLA 3CM5A 3ISNC 3PZDA 1WSHA 1K6YA 3HVTA 4K43A 2QA4N 3WNEA 4JI4K 3B6OA 3LDQA 4GKKK 2I1KA 4CEZA 2YJFA 3DXKB 5LMUK 4B1XB 3RMBA 1YTUA 4FJGA 1SQKA 3NBPA 1YJ9N 2ZM6K 5J2NA 3OJSA 3EZWA 4H0TB 3MCAB 3ZT2A 2QWLA 3LWLA 4AHCA 3H46O 5CYMA 4DQRA 4Q0BA 1ZBUA 3ZEUB 3CC2N 4M3RA 1QTMA 2EX3A 4K42A 1DIKA 1NGJA 1TYQA 1BA0A 1YTAA 2QWQA 4CF0A 4BG8A 2EHGA 3E9PA 4RW8A 4E7JA 1D8YA 3I0SA 2RPIA 5FPEA 1XI1A 4F2SA 3AVHA 3CC4N 2YJEA 4DR1K 3OYJA 4K41A 3KZBA 3DM2A 1XQSC 1HNZK 4DFJA 5KPZA 4Z4GA 4AHRA 3CQYA 4NCGA 3V1OA 3LZJA 4MO4A 4FJHA 1YIJN 3WQTA 3V4IA 2XRIA 1IKWA 1D9FA 3O4QA 4M3ZA 1BGXT 2F9TA 4FLUA 1KVBA 3AU5A 1T05A 1WAJA 1K8KB 1BISA 2Y1IA 3OJUA 3LZIA 4H5WA 3FZMA 3ZSZA 1OVYA 1ZBFA 5C2DA 2DFFA 3L3UA 1RDBA 3O80A 4CZMA 4BR0A 4PL7A 2HSTA 1Q86O 4M3UA 4I6MB 5AQVA 1N33K 1YJNN 2O8FB 5SZTA 2Q1NA 4CFCA 2ASOA 4CYEA 3MECA 3AVLA 3OA9A 2VWBA 4HUGA 4CECA 3V9XA 1K73O 1Q81O 4HCCA 1HPMA 4DUZK 2IIRA 4DR4K 1C0MA 3ID6A 4CEDA 4NY0A 4CEAA 1GG3A 4RTFD 5EX5A 2NRWA 5C10A 4CJTA 2WH5A 1OH7A 2Q97A 1SZ2A 4FK2A 2OYQA 5AFUH 4OPJA 1ZBLA 1JCFA 2HF4A 1BWFO 2Z1GA 3VQBA 4DV7K 1WSFA 2F8SA 3TANA 3J7ZO 2GEMA 4FOEA 4B3RK 1S5JA 3CPEA 3MMVA 3JSMA 3KTQA 2D10A 4X64K 4JN4A 3PX0A 3PIOL 1SKRA 2NRZA 4GNIA 3GOIA 5LMNK 1WBBA 2I1JA 4CZEA 3LP0A 4BRPA 4OJRA 5AZIA 3VTIA 3G71N 5I9EB 3VEZA 1XHXA 3L6QA 4LSNA 2AP1A 3CMAN 4HTUA 3V1QA 3DLKA 1UAXA 2FF6A 1SKWA 4XH5A 3T1HK 2HVHA 5A2QO 4BE1A 4M3TA 1UWBA 4CGDA 3EZ5A 1U4BA 1X9WA 1LW0A 3SK3A 2OTJN 3F5TA 4FLXA 3RTVA 4PA1A 4K0KK 4OGEA 4A5AA 1NGHA 2BGGA 3TTFA 2O8EB 2FJ9A 4CGJA 3OS0A 3CMEN 3THXA 4B3SK 1GOBA 3TWHA 1HPZA 3OW2M 3CCVN 2HE7A 1C0GA 2PYJA 3CCLN 2FLOA 4ELVA 3VF2A 3FE1A 1Y64A 2OPPA 3PSFA 4BR9A 4Y0WA 1EWRA 3CCJN 3OS1A 2JLEA 3VEYA 3MN9A 3NVKA 2P9IB 4YFUA 4PKHA 4BY9C 1UOCA 3VF6A 5AQNA 4YORA 4IFYA 3QEPA 1NVLA 5CYQA 3I55N 2P9UB 2PFUA 4HCBA 1D5AA 1RDAA 3D2EB 5CR4A 1RT1A 5JS1A 3AVCA 1ZBIA 4DS5A 1CZBA 1TKDA 1NOYA 3C6TA 3WXIA 3KHYA 2A3ZA 1TK5A 1QS4A 4DV2K 1Q18A 1QZ5A 2OCEA 4BR7A 2J0JA 4YOUA 1QSYA 4PY5A 1IBLK 5AQGA 5AQSA 3OS2A 3OYAA 1UA1A 1U48A 1W9HA 1GLCG 1KXPA 3AO5A 4IG0A 4FWRA 2JWKA 4CJPA 1QE1A 2J0MA 1G15A 1A5XA 3G25A 3ATUA 3SAHA 2YNFA 3OBYA 3OYMA 4IWVA 1NGFA 4JI1K 4CGHA 4DXAB 4CERA 1SKSA 4JNEA 3DXMA 1TKZA 4E7LA 3KLEA 5DK5A 4H0OA 4JHDB 4FJLA 4XH1A 3HSCA 4Q5VA 2VGMA 1RBVA 3U9DA 4KFBA 4JS5A 2FBXA 3ZSOA 1LV5A 4L8RB 3NHGA 1SV5A 1RDCA 3DJCA 3ID8A 3TPQA 3L8BA 1GLDG 3SJJA 3NFAA 3EEQA 1HJOA 1KLMA 2E1YA 1BIZA 4EP4A 4B3MK 2P9PA 1TKTA 3LDOA 1JLGA 3CD6N 3HBTA 4KHUA 1TAQA 1X1PA 4DSLA 1IKVA 2QWNA 3RSEB 4B8CA 4B9QA 1ATSA 3SAGA 4XH4A 1J19A 4LC9B 4F8RA 3P38A 3QESA 1FKOA 2QWOA 2DTUA 3TI0A 1XWLA 1HKGA 4Y1CA 4EAHD 2PZSA 3IFRA 5HRRA 3EKSA 2VQEK 4E3SA 3BDPA 3VQAA 3FZLA 1FKPA 3TSPA 4O5FA 1LOTB 1HQEA 1HR0K 2Q0RA 2FXUA 3SUPA 3TARA 2HHWA 3I0RA 4B9NA 3M1FA 2FC0A 5F0XA 4JI0K 5EY4A 1JXBA 4CK1A 2IDOA 2D2QA 3EN9A 3H6EA 4ID5A 3LWMA 5AQXA 3VQ6A 4BE2A 4FWOA 3VEOA 4DV0K 5GIPA 3H1VX 3THYB 5FRNA 4BC5A 1KAXA 3SI6A 2O8DA 3OTOK 4A5BA 3ZDTA 3AU4A 4LY7A 5BPNA 5GADP 4BR4A 4B1YB 2BUPA 5AQHA 4YOTA 5LJVA 3SPYA 4KPYA 5CZ2A 2YX6A 5AQTA 3ZETA 2P9NA 2DIKA 3BZCA 1JLCA 1C1BA 2KTQA 4OX9K 1O1WA 1EO1A 2X6SA 4O8KA 3S3OA 2DY4A 1VQNN 3HYFA 1W7AA 3CYMA 3J81O 4FWLA 1NU0A 2F8TA 1VHXA 4FCYA 1HYZA 3NGIA 4IFVA 3L2RA 4FLVA 1VQMN 1GLBG 5AQFA 4ZHRA 3BEXA 1OH5A 1WN7A 2E88A 3TAGA 4DTUA 4IEIA 1BI4B 5E84A 2ASMA 1VQ5N 4DV5K 3OYNA 1VQ6N 2ZPYA 3TSUA 4C8OA 1WSEA 5HBMA 1NKEA 3KJVA 3NGYA 2Q2RA 4Z0UA 5BRFA 2HNZA 1HX1A 4BROA 3AA4A 4X65K 2HBJA 4I9LA 1RT2A 3VENA 1DTQA 5EOYA 4A62A 1C0UA 2ZF5O 1NK5A 1KFDA 3R8EA 4MO5A 2VYPA 3I33A 3F9MA 3JS6A 3AVJA 3CERA 5FPMA 5FPNA 3B8AX 2F9WA 4O0JA 4C8NA 1VRUA 1X9MA 4NLCA 4JKAA 4DQQA 5FROA 5JVLA 3TR8A 4CJ7A 4M63C 1CXQA 1F21A 4OVLA 3LP3A 1YAGA 5KTQA 3TAPA 2FBVA 3HP6A 3QFPA 3K5NA 3WNFA 3OYDA 3VEWA 1NGCA 1M1KO 2XHBA 3ZSYA 1TVRA 4H5VA 3HXMA 3MXIA 2HHQA 5M1KA 3THWB 2COPA 3G4SN 1ACAA 3EO3A 5TKYA 1JLQA 3S9HA 3EE8A 3D7EO 4RW7A 4KHNA 3MEEA 3VA0A 4FJIA 3ZX2A 5JS2A 2OZSA 4Z4IA 2P5GA 1T44A 4LD0A 3ENBA 4G1QA 4A2AA 2UXCK 1U2VB 5GIOA 3MDQA 1BCOA 4A2BA 3A8YA 3K9JA 4CEOA 4J2EA 4CGIA 4CVNE 3CETA 1Q9YA 3EE9A 3K5OA 1XC9A 1KD1O 1GGOA 3A2FA 4MDAA 3P1GA 3VQ4A 5KI6A 1DLOA 1U6ZA 4A57A 3QBWA 2YHAA 2UU9K 5FRMA 1FJGK 4CIEA 2ZQBA 2OPSA 4DQSA 1SL1A 2Q3SA 3L0QA 2RN2A 4Z4CA 2FBTA 3OYBA 3HPOA 3UE5A 3VGMA 4WQ5A 4GV3A 3K9KA 1O13A 4O5BA 1RT6A 4TSXA 4HVJA 4JKFA 4DKWA 1TL1A 2JGUA 1Q8IA 1MK7B 1LAVA 4N41A 4HDOA 4BR2A 1RBRA 3CJCA 3D2FB 3M5RA 3DAWA 2E2QA 2KFZA 2O8CB 1TUUA 2WTUA 1RGIA 5JVHL 3E66A 2HMPA 4JK7A 3TAMA 1RTIA 1I94K 1LWCA 1QQCA 2O8BB 4KAZA 1NGDA 1Z25A 4K8XA 3OBWA 5I3UA 3PO5A 4NO7A 4UY8O 1H4RA 4DR3K 5KGWA 4WFBL 2ZGZA 5BPLA 4IKFA 2JWLA 3DLLL 4PWDA 5AQJA 1I39A 3SV3A 3KK2A 3ENHA 1SS6A 1BA1A 3RMAA 2HB5A 1CZAN 4DWIA 3QINA 3MXJA 5AQWA 1S6QA 3BZKA 3OYIA 1E3MA 4CJ3A 4IEEA 3R9PA 4BRIA 4FJXA 3C7NA 3G6EN 3CCMN 4KHWA 3FFKB 3THWA 1BG3A 2D0BA 3DLGA 4H5TA 3HK2A 3EY1A 2QKBA 3GG4A 3M8PA 4O0IA 3RVCA 4Z4EA 4RW9A 2OA8A 4IZ9A 4YDUC 4JI2K 2ASPA 2W6KA 2RKIA 4CZJA 2E6MA 1KSPA 3ZX0A 1HJRA 3A5LC 2IS3A 4M41A 3DMJA 2HHSA 2QK9A 3G9WA 4IDKA 3L2VA 4FWSA 5HL7L 4DUYK 2UXBK 1TUYA 3DLRA 1L3TA 4OO1J 1VSKA 2KKZA 4M3YA 4CJQA 4FSVA 2CQUA 3VTHA 3C0BA 3DLHA 1JLAA 5AQYA 4EHTA 4CHYA 4PUOA 1NMNA 5SWMA 2VG5A 4O4GA 5J2PA 5AZJB 1VQ8N 1CLQA 4B3TK 3MN7A 1HB6A 4Z4FA 3FGUA 4FW1A 5HRSA 4DCHA 2D11A 3HM8A 2ZGYA 4RWTA 1E4FT 3NF6A 4AILC 4O8UA 2NRVA 3M8SA 4B3OA 3AVMA 4ILGB 5C2FA 1NGBA 5JVGL 5GAHP 4J2BA 4FLWA 2QWRA 1IG9A 3N4PA 3G0ZA 4IG3A 4DU4A 4NLBA 3TABA 1D9DA 4KRFA 2HBMA 4QS8A 2NZTA 5AQIA 2OPQA 3ZSQA 4YHHK 2IOCA 3SQ0A 4CFDA 4OPKA 5BN9A 4C23A 2UXDK 3MXMA 1TKXA 1X3MA 4LFCK 4FJ5A 3U6FA 4OGCA 4L3QA 4CZFA 3UKRB 2RQ1A 4ZRJA 1HKBA 1QQMA 1HRHA 4KI6A 4DSJA 4E1MA 3IUCA 4ZRIA 2O4IA 1NI2A 4BDPA 3UKUA 3KWGA 4FJJA 3SAFA 2A5XA 1XMQK 4CEBA 4HUEA 2EMSA 1L3VA 3H3OB 3RMCA 3CJ9A 2E4LA 3H45C 4A61A 4B8AB 4CBUA 1BCMA 3QNOA 3UB5A 4E7IA 2GV9A 1KVCA 4M7XA 1E5WA 2QXLA 3ZSRA 3RWUA 2KHOA 1KRPA 1VBHA 3SMSA 4BREA 1RT4A 4BRGA 4H8KA 3V9WA 4JAXA 1NK7A 5KQDA 1JL2A 5C0YA 4DV3K 1GLEG 1ASUA 4Z4HA 3HOTA 3MN5A 1IKYA 3HL8A 4ILHA 4B9TA 4ISFA 3ZSWA 1NK4A 3WT0A 4Z94A 3RR8A 3LALA 2PAVA 3J8AA 3TU5A 1ASVA 3DXKA 2Z1HA 2D1KA 1T8EA 4FJ8A 3U3YA 2GX9A 4OKKA 1Q7YO 2IAJA 4OKJA 4YOXA 3N4QA 4HHTA 4Y1DA 1SL2A 2GELA 3QICA 3ZSVA 3VERA 4KHQA 4AHSA 4BRAA 3VQDA 4MFBA 3ZEUA 4A59A 1Q9XA 2P1JA 1NKBA 4KBOA 3NH1A 4MLEA 3UIQA 3DYAA 5AQOA 3VQCA 1HMVA 4W5OA 3PX6A 3HM9A 1XNQK 3SBGA 3NGZA 1BOTO 4BQLA 4LF4K 2OTLN 4NYNA 5M1FA 1NJYA 2V7ZA 2P5OA 1BHLA 1VAZA 2GUPA 2ZWHA 5AQQA 3K58A 2XY7A 3ULEB 4HUFA 1QHAA 4BRMA 1JL1A 1V4TA 4M45A 4C1NK 4CF9A 1GLAG 3HPGA 4FXDA 1I3AA 3FFIA 2F96A 5KPRA 4CBXA 2X74A 4CJUA 4DR6K 4BWJA 3IDHA 3TAEA 4JS4A 4WF9L 3NF8A 2GTDA 3PO4A 1K8KA 3EPYA 4P7IA 4DFKA 2Q0UA 3HI0A 4E7KA 5BRDA 5ADXA 4ILJA 5FDLA 2O8FA 4EP5A 4I6MA 1RT5A 3E01A 3O8MA 3CCUN 1G99A 4X62K 3VETA 1HYSA 4RCHA 1GOCA 1WUAA 3QBXA 2I7NA 3OYLA 2UUAK 1NGIA 4BG9A 4JKHA 5HLFA 3QFUA 3A5OC 5JMVA 2YVCA 4CEEA 1TK0A 4CK3A 3SQ4A 1WB9A 4PL8A 4BC3A 2A6AA 4LSLA 1H1VA 1JDEA 5J2QA 3QEVA 3DLBA 3KLFA 1MIXA 3V6DA 2BANA 2UUCK 2AJQA 2ZJQL 2Y1JA 1NK6A 4GV6A 3SBTA 3LM9A 3AO2A 4DV4K 5AQPA 3O9RA 4IO8A 5AQUA 1C1CA 3DOLA 3ZT4A 2FSNA 2B5JA 3QMLA 4BRLA 3WQUA
chains in the Genus database with same CATH topology
3E9LA 5HOOA 4CZIA 1VQLN 4BC4A 1K8AO 4YL8A 2Q2RA 3L4QA 1BO5O 4JD2B 5M1NA 3S41A 4C1NI 5BREA 2IVOA 5BRFA 2UYTA 3CJBA 5GAGP 4FOIA 3C6HA 1HX1A 3R1XA 4BROA 3U8ZA 2HBJA 3FZFA 3FR0A 2P9SB 4JKEA 2QM1A 4WYBA 3I8BA 3VENA 3VESA 3MN6A 5EOYA 4A62A 2ZF5O 2RE2A 1NLVA 2ITMA 3R8EA 3U9ZA 4BRKA 5GAEP 4MO5A 3ZYYX 3CIPA 3A5NC 4B1UB 2E2PA 1LCUA 2VYPA 3I33A 1KC7A 3GDQA 3EL2A 3F9MA 3JS6A 5F1XA 3NMUA 4H0VB 4CZLA 3CCEN 2CGKA 3HTVA 3IMXA 4EKUA 2QTDA 3BP8A 3CERA 4FPBA 5FPMA 1S72N 1JJ2M 3UKUB 3F2KA 3WEEB 5FPNA 3A0IX 2A41A 2F9WA 3B8AX 2V51B 4NLCA 4JKAA 3L4IA 1ST7A 2NRRA 5JVLA 4CI6A 1IG8A 2I7PA 2PBDA 4GV9A 4NB4A 4CJ7A 4M63C 2FSKA 1ILYA 3FZKA 1YAGA 4AM6A 1J6ZA 4MDBA 3LL3A 5AZJA 1NJIO 3QFPA 3FLCO 5JLHA 3DXMB 1GC7A 3T69A 3FZHA 5AFUA 4B1WB 3VEWA 3AAQA 4MLHA 4ZRKA 1NGCA 3VEXA 2WBNA 1M1KO 1HLUA 1YITN 3CF5L 4JK9A 2D0OA 1HKCA 4YDUA 1QVFM 4H03B 2F7TA 4H5VA 2YCHA 5M1KA 2COPA 3G4SN 2P9IA 5E26A 1NGEA 3PZDA 1ACAA 1ATRA 3EO3A 5TKYA 1JCGA 3EE8A 3D7EO 5M1QA 3O9TA 4K43A 2ABDA 2QA4N 2E2OA 3Q7BA 5KQ8A 3LDQA 2BTFA 2I1KA 2P9UA 3ZX2A 3WXKA 2YJFA 3D2EA 3DXKB 2P9PB 3P31A 4B1XB 1T44A 2FSJA 4F7GA 5CE3A 3P4IA 3ENBA 1SQKA 4WQ4C 4KH5A 4A2AA 1YJ9N 4M7YA 1U2VB 5GIOA 3MDQA 4QS9A 4FWQA 4A2BA 4BGBA 2J4RA 3A8YA 3EZWA 3K9JA 4H0TB 2ZJRL 1YXQA 3MCAB 1T6CA 2QWLA 1BU6O 4PKIA 3CCSN 2H3GX 1DKGD 2YI1A 3CETA 3H46O 3VEVA 4FWMA 1VQKN 3EE9A 2NNWA 3ZEUB 3CC2N 2QWPA 1MWMA 1KD1O 4IOAL 4BRNA 1ZXOA 1GGOA 1SAZA 4K42A 4WCEL 4MDAA 3UKRA 1EF1A 3MX5A 1DIKA 4A57A 1U6ZA 1NGJA 3AGKA 1TYQA 3GL1A 1BA0A 2QWQA 1MA9B 3O9SA 3QBWA 5F2RA 4BY9C 4BG8A 5BN8A 2YHXA 5BR9A 3E9PA 4BRDA 1MWKA 3AAPA 5FPEA 3L0QA 4H5RA 4CZGA 1D4XA 3UE5A 2YJEA 3CC4N 3VGMA 4WQ5A 4GV3A 2E8AA 1BDGA 3K9KA 4K41A 3CCRN 3KZBA 1O13A 5AQZA 4CD3A 3WXJA 1XQSC 4DHYA 4JKFA 3U4LA 4DKWA 5KPZA 1X3NA 2CH6A 1MK7B 3CQYA 4HDOA 4ISGA 4MO4A 4BR2A 3BUZB 1YIJN 3WQTA 4B1VA 4JHDA 1Q82O 4HTLA 1S22A 3CJCA 3D2FB 3TTCA 1KC8O 3E1YA 1NGAA 3M5RA 3DAWA 2YHYA 3R6MA 2F9TA 2E2QA 3ATVA 1TUUA 3AU5A 1GLJO 4YOVA 1K8KB 1RGIA 3O9QA 5JVHL 5EXWA 3E66A 4H5WA 3FZMA 2HF3A 2HMPA 3O9UA 2AA4A 4JK7A 1OVYA 3HZ6A 5C2DA 5MLCQ 3O80A 4CZMA 4PL7A 4BR0A 1Q86O 2HSTA 4I6MB 5AQVA 1NGDA 5JICA 1YJNN 2E2NA 2Q1NA 3ZETB 4CZHA 3I56N 2P9NB 3OBWA 2ASOA 4CYEA 4NO7A 4UY8O 3E9OA 1H4RA 3CJ7A 4WFBL 2ZGZA 3OA9A 1Z05A 2VWBA 5BPLA 2JWLA 3DLLL 1K73O 1Q81O 2GWJA 1HPMA 2IIRA 3EKUA 5KPTA 5AQJA 2P9KB 3CQXA 3RSEA 3KWIA 3ID6A 2ZJPL 4NY0A 3ENHA 2P9LB 1GG3A 4RTFD 4YOWA 5EX5A 1SS6A 2NRWA 3HRGA 1BA1A 4KH6A 5C10A 1CZAN 2WH5A 2Q97A 5AQWA 1SZ2A 1QQNA 4IEEA 3T7ZA 5AQKA 3R9PA 3AGRA 5AFUH 4BRIA 1X9JA 3C7NA 1JCFA 2HF4A 1BWFO 1GLLO 3G6EN 3CCMN 4BRCA 4JKGB 3FFKB 1DT9A 1BG3A 4IFEA 5FPDA 3BF3A 3J7ZO 4H5TA 4BQZA 2GEMA 1MIZB 4F9OA 4FOEA 3CPEA 3MMVA 3GG4A 2D10A 4CBWA 4OPAA 3MWTA 1KAYA 2V7YA 4JN4A 3PIOL 2NRZA 4GNIA 4J8FA 2VGNA 3GOIA 3ULEA 3RVCA 2I1JA 3WXLA 1VQ7N 4CZEA 4H0PA 5M1OA 4BRPA 5AZIA 4HWIA 3VTIA 4JKDA 4IZ9A 4FVUA 3U7DA 4YDUC 3MK6A 2ASPA 5I9EB 3CJAA 3G71N 3VEZA 4CZJA 3L6QA 3H1QA 4G9ZA 3O1WA 3WUHA 3ZX0A 2AP1A 3CMAN 3A5LC 2CH5A 2FF6A 4BGAA 1WOQA 3G9WA 1IJJA 1NGGA 1YF5L 4FWSA 4K25A 2FDQA 4XH5A 1TUYA 4BVPA 5HL7L 2QEXN 4U67L 3QB0A 2OTJN 3SK3A 3W0LA 4OO1J 3PVLA 1ISNA 1QZ6A 2KKZA 3F5TA 4H5NA 3MX2A 4FSVA 4BRHA 2CQUA 4A5AA 3VTHA 5GINA 1NGHA 3C0BA 4PKGA 1YUWA 5AQYA 3TTFA 5DM6L 3IKMA 5ADXH 4EHTA 2FJ9A 4EHUA 3CMEN 2R82A 2AEHA 1KAZA 2QW9A 5AZJB 3OW2M 3CCVN 1VQ8N 3MN7A 2NRXA 2HE7A 1C0GA 1HB6A 3KVGA 5C15A 3CCLN 3FGUA 3CCQN 2FLOA 3U8XA 3VF2A 5DM7L 4DCHA 2D11A 3HM8A 3FE1A 3OHRA 2ZGYA 3FP5A 1E4FT 4WQ4A 2OANA 4RWTA 1Y64A 1P90A 4O8UA 2NRVA 3TTDA 4Y0WA 4BR9A 3CCJN 2W40A 3VEYA 3MN9A 4IJAA 4ILGB 2RHKA 3PIPL 5C2FA 3NVKA 1NTIA 2P9IB 4PHTX 1JCEA 1NGBA 1QQOA 1ESVA 2HOEA 1NMDA 4PKHA 5GAHP 4HDQA 3VF6A 4WFAL 4FL9A 2CGJA 1R59O 5CHIA 2QWRA 5AQNA 3N4PA 4YORA 2HBKA 3ENOA 1NVLA 4CZKA 3I55N 5AQLA 2P9UB 2PFUA 4NLBA 3D2EB 5CR4A 4BC2A 3VGKA 4DQ8A 2A42A 2HBMA 1DEJA 4QS8A 2NZTA 1NBWA 5AQIA 4JD2A 3WXIA 2V52B 3KHYA 1NM1A 1RDWX 4FO0A 2A3ZA 2CGLA 5BN9A 4R79A 3HOSA 4C23A 1Q18A 2P9SA 3LDNA 1YJWN 1X3MA 4AM7A 4OPHA 1QZ5A 1YVNA 4FWPA 4L3QA 3SJHA 4CZFA 3UKRB 4BR7A 1ATNA 2J0JA 2RQ1A 4ZRJA 1HKBA 1QQMA 3AY9A 3VOVA 1YI2N 1N8RO 1TYQB 4YOUA 3GBTA 1C0FA 3IUCA 4FWKA 3O1BA 3H3NO 2WFBA 2AL6A 3O08A 4ZRIA 5AQGA 2FF3B 3PLAA 2A40A 3A5MC 5AQSA 4YOYA 1NI2A 3UKUA 3KWGA 1GLCG 3WEEA 1KXPA 2A5XA 3M3ZA 2IVNA 3SAFA 4FWRA 4WFNL 2JWKA 4GXBA 2EMSA 1RDUA 5BPMA 4EFHA 3H3OB 2J0MA 1HBKA 3CJ9A 3VMFB 3G25A 3ATUA 3H45C 4JKGA 3SAHA 3OBYA 1DGKN 4A61A 4IWVA 1NGFA 3GE1A 2YHWA 4CBUA 4DXAB 3UB5A 3DXMA 3CJ1A 1E5WA 2QXLA 2EMTA 1GC6A 4JNEA 2KHOA 4M7XA 5AQMA 4EIAA 4CD1A 1VBHA 4H0OA 2NLXA 1KBLA 4JHDB 3SMSA 4BREA 2NRTA 4XH1A 3HSCA 3DWLA 4QS7A 3X23A 4BRGA 1KQSM 4JAXA 5EVZA 2VGMA 4B1ZA 3O5BA 3U9DA 5KQDA 1M90O 5C0YA 1GLEG 4KH4A 3HOTA 4JK8A 3MN5A 4ILHA 2QWMA 4ISFA 3LDLA 3DJCA 3CHWA 2WC9A 3ID8A 3TPQA 1GLDG 1ZC6A 3O6WA 3WT0A 5AR0A 4Z94A 1HJOA 2PAVA 3J8AA 4ISEA 2E1YA 3TU5A 1GLFO 3C65A 3DXKA 2P9PA 2D1KA 2X0SA 3LDOA 4IOXA 2GX9A 1VQON 3MCPA 1Q7YO 3CD6N 3HBTA 2CB8A 4IJNA 4AF1A 1U2VA 3SLCA 1BUPA 4YOXA 3N4QA 2QWNA 2D4WA 1Y19B 3CI5A 2GELA 3RSEB 3QICA 4B9QA 3VERA 2LBBA 2E20A 1EQYA 1ATSA 3SAGA 5M1PA 3CPWM 4BRAA 3VPZA 3QDKA 3ZEUA 3QIJA 1J19A 1RFQA 4XH4A 4FWNA 3VGLA 4A59A 4JKBA 4BR5A 2GWKA 4XEIA 2W41A 4LC9B 3O4WA 1W97L 2HBLA 3JXUA 4KBOA 3W3DA 4E1JA 3P38A 2QWOA 4MLEA 2BH1A 3KK7A 5JLFA 5AQOA 1HKGA 4GVEA 3D6RA 3CXCM 5LJWA 1VQPN 3C7NB 1V4SA 4EAHD 3NVMA 1NWKA 3IFRA 3EKSA 3R3LA 4H0XB 3ZX3A 1K9MO 1HUXA 2QI2A 3SBGA 1BOTO 4BQLA 3FZLA 3TSPA 4O5FA 1LOTB 2OTLN 5M1FA 2V7ZA 1VAZA 1W2BM 2Q0RA 2GUPA 2ZWHA 2FXUA 4H0YB 5AQQA 4FPAA 3BF1A 1XUPO 3ULEB 3M1FA 5IJMA 3FLVA 1T6DA 1QHAA 3VF4A 1V4TA 1T3VA 4BRMA 5F0XA 5EY4A 5LY3A 4BRFA 1VBGA 5AZIB 4C1NK 1GLAG 2D2QA 3EN9A 3H6EA 5KPRA 4CBXA 3D2FA 5H1SQ 2HRJA 1S3XA 4TKNA 5AQXA 5JVGL 3IDHA 4JEPA 4GY2B 2J0KA 4FWOA 3VEOA 4WF9L 2GTDA 3H1VX 5GIPA 3TSQA 4BC5A 1K8KA 1KAXA 4BRQA 4U7BA 4A5BA 3EPYA 3ZDTA 3AU4A 2EWSA 4WQ5C 5BPNA 4BR4A 5GADP 1XC3A 4P7IA 2Q0UA 3LDPA 5BRHA 1OKJA 3HI0A 4B1YB 5BRDA 2VCPA 2BUPA 5ADXA 4ILJA 3WA0A 2E1ZA 5AQHA 4YOTA 5LJVA 3SMPA 4I6MA 2NRHA 2YX6A 5AQTA 3ZETA 2P9NA 2DIKA 3O8MA 3C6AA 3CCUN 1Z6RA 1G99A 1YHQN 3VETA 4IDHA 4RCHA 1EO1A 1SGHA 1VQ9N 1WUAA 3QBXA 2I7NA 5AQRA 4O8KA 1NGIA 4BG9A 1VQNN 4JKHA 2D0PA 3QFUA 2P9KA 4IO9L 3A5OC 4JKCA 4DB3A 5JMVA 2YVCA 2Q36A 4PL8A 3WXMB 4BC3A 2DPNA 2A6AA 2IVPA 2P9LA 5ELZA 1P8ZA 4FWLA 1H1VA 3LM2A 5B8HA 1JDEA 5C12A 1VQ4N 5TKWA 2Q31A 3AARA 2KLAA 3Q7CA 3BINA 1VQMN 1QVGM 1GLBG 1MIXA 1HB8A 5AQFA 1MK9B 3M6GA 1MDUB 3BEXA 2ZJQL 4GV6A 3SBTA 3LM9A 2E88A 3CC7N 2WUSA 5AQPA 3O9RA 1ZBSA 4IO8A 5AQUA 4BVOA 4IEIA 3IVFA 3P39A 5E84A 2ASMA 3MWPA 4IXCA 2FSNA 1VQ5N 1VQ6N 1E4GT 3QMLA 4BRLA 4IOCL 2ZPYA 3WQUA 3TSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9L A;  4JKD A;  3SBG A;  4JKA A;  4JKF A;  3E9O A;  4JKG B;  4JKE A;  4ILJ A;  4JK8 A;  4ILH A;  3E9P A;  4JKB A;  4JKG A;  3SBT A;  3ENB A;  4ILG B;  3E66 A;  4JK9 A;  4JKH A;  4JK7 A;  4JKC A; 
#chains in the Genus database with same CATH topology
 3E9L A;  5HOO A;  3LAN A;  4CJS A;  4YL8 A;  1BO5 O;  4JD2 B;  3CJB A;  3VN5 A;  5GAG P;  3C6H A;  1RTJ A;  3FZF A;  4KTQ A;  2P9S B;  3AVF A;  1RT3 A;  2ITM A;  3NH0 A;  5GAE P;  3VQQ A;  3ZYY X;  1LCU A;  3AA5 X;  3OYG A;  4N5S A;  4ELU A;  3NMU A;  4NXM K;  4DSK A;  4C8L A;  3F73 A;  1JKH A;  3WEE B;  3A0I X;  2V51 B;  3OYF A;  4CEQ A;  2I7P A;  2PBD A;  1EP4 A;  4GV9 A;  2O8E A;  4BE0 A;  4F3T A;  4DU1 A;  1NJI O;  4O55 A;  5JLH A;  2IGI A;  3T69 A;  4H4O A;  3O3H A;  1HLU A;  4O44 A;  4W5R A;  2NUB A;  4JK9 A;  2KW4 A;  1HKC A;  4RG8 A;  4DTN A;  1IV0 A;  2YCH A;  3ZCM A;  5E41 A;  2P9I A;  1NGE A;  1HNX K;  1JCG A;  4F2R A;  1ITG A;  2E2O A;  3Q7B A;  2P9U A;  3D2E A;  3P31 A;  2WOM A;  2FSJ A;  5CE3 A;  3P4I A;  3PSI A;  4WQ4 C;  4KH5 A;  1J5O A;  3ZSX A;  2E5L K;  4M7Y A;  4QS9 A;  1RCH A;  4BGB A;  2D0C A;  2ZD1 A;  2ZJR L;  4CHP A;  4PKI A;  2H3G X;  1DKG D;  1NK0 A;  1B92 A;  1VQK N;  2QWP A;  3DRP A;  1MWM A;  4FZY A;  4B9S A;  4IOA L;  4BRN A;  1ZXO A;  1SAZ A;  1C1A A;  4WCE L;  3MX5 A;  3SUQ A;  4CZL A;  3KLI A;  2G8I A;  1HNV A;  1MA9 B;  4BDZ A;  5BN8 A;  2YHX A;  5BR9 A;  1QSL A;  4BRD A;  1FW6 A;  1MWK A;  3AAP A;  2DFE A;  1YT3 A;  3P5J A;  3K57 A;  4E7H A;  2HW3 A;  1D4X A;  5T7B A;  3CCR N;  2R7Y A;  3WXJ A;  4JI5 K;  2CH6 A;  4M42 A;  3KK1 A;  3DRS A;  4JHD A;  1ZYQ A;  3TTC A;  1NGA A;  2YHY A;  1Y97 A;  3VQ8 A;  3ATV A;  3HVR A;  3SNN A;  1XHZ A;  3O9Q A;  5EXW A;  2HF3 A;  4JI3 K;  3ALY A;  4LFA K;  2GBZ A;  4DTO A;  1LWF A;  1VSE A;  4CZH A;  3AO4 A;  3KLG A;  1NJX A;  4GKJ K;  1VSD A;  4NYF A;  3CJ7 A;  4KTZ A;  2A1S A;  3CFR A;  3V9S A;  2GWJ A;  2P9K B;  2VQF K;  3RSE A;  3NF7 A;  5K14 A;  3KWI A;  3T1Y K;  1A5V A;  1VSM A;  3THV A;  4DLG A;  2P9L B;  4YOW A;  4IBN A;  1N6Q A;  1NK9 A;  1HYV A;  1QQN A;  3OYH A;  2HHH K;  3T7Z A;  1L3U A;  1RBS A;  5AQK A;  4CFB A;  3O3G A;  3AGR A;  3AVB A;  4N47 A;  4BRC A;  4JKG B;  1DT9 A;  5FPD A;  4BQZ A;  1MIZ B;  3V9Z A;  1N32 K;  1KAY A;  4NXN K;  2VGN A;  1BL3 A;  2HMI A;  3WXL A;  4XIU A;  1VQ7 N;  2ATQ A;  4H0P A;  2X78 A;  4HWI A;  4JKD A;  1BQN A;  4FK4 A;  3ZT1 A;  1DTT A;  3CJA A;  3H1Q A;  5C24 A;  3O1W A;  4LF7 K;  4G9Z A;  1Z26 A;  2E6L A;  4AQY K;  3THY A;  2CH5 A;  4K25 A;  1IJJ A;  1NGG A;  1YF5 L;  2QEX N;  2G8W A;  4U67 L;  2QXF A;  3QB0 A;  3W0L A;  3PVL A;  1ISN A;  3MX2 A;  2B4J A;  3LPT A;  4BRH A;  5GIN A;  3ZT0 A;  1VRT A;  4AHT A;  4FLY A;  3IKM A;  5LL6 Z;  1HNW K;  4EHU A;  2AEH A;  1KAZ A;  2QW9 A;  5CY4 A;  4KTW A;  3U8X A;  3FP5 A;  1KCF A;  2OAN A;  1A5W A;  1YVU A;  3O4N A;  1P90 A;  2W40 A;  2O4G A;  2RHK A;  1QQO A;  2HOE A;  3KIO A;  1ESV A;  4WFA L;  1NMD A;  1Q82 O;  4KI4 A;  4B9M A;  4FL9 A;  3IG1 A;  5CHI A;  3MAQ A;  4DTX A;  4E1N A;  2HBK A;  3ENO A;  3RRH A;  4CFA A;  3EYZ A;  1BI4 A;  1S6P A;  3IS9 A;  4BC2 A;  4DQ8 A;  5IT9 O;  2W6L A;  4DTP A;  1DEJ A;  5EU7 A;  1NBW A;  3L3V A;  3WNG A;  4BWM A;  3SYZ A;  4CES A;  2V52 B;  3T1A A;  1NM1 A;  4FO0 A;  2CGL A;  4R79 A;  3HOS A;  3LDN A;  4FYD A;  4QCL A;  1VSH A;  1R0A A;  1ATN A;  3AY9 A;  3ZLJ A;  1N8R O;  1TYQ B;  3GBT A;  3JAM O;  3O1B A;  2WFB A;  2G8F A;  3B6P A;  3PLA A;  4YOY A;  3HST B;  2IVN A;  1HQU A;  4GXB A;  3AVN A;  1RDU A;  4EFH A;  1HBK A;  4FZZ A;  4JKG A;  1DGK N;  2YHW A;  4DSI A;  1IH7 A;  4AHU A;  4CK2 A;  3K5M A;  2EMT A;  3VQ9 A;  4CD1 A;  1KBL A;  2NRT A;  4KHY A;  1KQS M;  3X23 A;  4B1Z A;  3O5B A;  1J5E K;  4LF6 K;  3HJF A;  4JK8 A;  4CIF A;  3LDL A;  3U3G A;  3CHW A;  4CHQ A;  3SQ2 A;  3CM6 A;  3O6W A;  3QEI A;  3AVA A;  1GLF O;  3C65 A;  3L2W A;  3AV9 A;  3PV8 A;  2X0S A;  2LSN A;  3NE6 A;  4IOX A;  4B08 A;  2CB8 A;  4IJN A;  3V81 A;  1U2V A;  1UA0 A;  4I2P A;  3SLC A;  4J2A A;  4B9V A;  4N56 A;  3KD5 E;  4CJL A;  3RRG A;  1Y19 B;  3CI5 A;  3CPW M;  3NAE A;  4NCA A;  3QDK A;  1RFQ A;  1S9E A;  4FWN A;  3VGL A;  1FK9 A;  4JKB A;  4KB0 A;  3O4W A;  1W97 L;  3JXU A;  3W3D A;  4CW7 B;  5CZ1 A;  3T3F A;  2BH1 A;  3P83 D;  2HHX A;  1XNR K;  3D6R A;  3CXC M;  5LJW A;  1V4S A;  4B9U A;  1NWK A;  3R3L A;  1TV6 A;  2QI2 A;  4CJF A;  4DTS A;  1U45 A;  4JV5 K;  4H0Y B;  3BF1 A;  1XUP O;  3LP2 A;  1T6D A;  3VF4 A;  4GVM A;  5LY3 A;  1T3V A;  5AZI B;  3ITH A;  2G8V A;  1QHT A;  3D2F A;  1S3X A;  1N36 K;  3D0P A;  4DR7 K;  2O8C A;  4FJ7 A;  4U7B A;  1IBM K;  2DFH A;  4CHZ A;  1T7P A;  4DG1 A;  5BRH A;  3LDP A;  1OKJ A;  5AJ3 K;  2VCP A;  2YKM A;  3WA0 A;  3QEX A;  4JYA K;  2O8B A;  4DR5 K;  1TK8 A;  1N5Y A;  2PYL A;  3KKR A;  1RBU A;  4IDH A;  3VQ7 A;  1SGH A;  3THX B;  2YNI A;  4DQI A;  2G8K A;  4JKC A;  2Q36 A;  4GW6 A;  3WXM B;  2OZM A;  2DPN A;  5ELZ A;  2IVP A;  1EX4 A;  4JI6 K;  3LM2 A;  1VQ4 N;  5TKW A;  2A1R A;  2KLA A;  1NG9 A;  4LF9 K;  3BIN A;  1U49 A;  1CXU A;  4FVM A;  1WNS A;  1BQM A;  2PY5 A;  3M6G A;  1S9G A;  4DTJ A;  3TAQ A;  3CC7 N;  2WUS A;  4LH5 A;  3QER A;  5C42 A;  4PQU A;  4CJV A;  4ISG A;  4IOC L;  4H4M A;  1VQL N;  2HND A;  1K8A O;  5M1N A;  3S41 A;  5BRE A;  2IVO A;  1NJZ A;  2UYT A;  1J9A A;  4FOI A;  3R1X A;  4I9Q A;  4N76 A;  3FR0 A;  2ZE2 A;  3DI6 A;  3I8B A;  3VES A;  3C94 A;  2VWK A;  4DV6 K;  1NLV A;  3U9Z A;  3M8Q A;  4FLZ A;  2Z1I A;  2YNH A;  2E2P A;  1KC7 A;  1EWQ A;  3EL2 A;  1IO2 A;  3ZT3 A;  4CF8 A;  4EZ9 A;  2CGK A;  4EKU A;  3BP8 A;  4FPB A;  3RMD A;  1JJ2 M;  1L5U A;  4YY3 K;  2A41 A;  4C8M A;  3CFO A;  4E0D A;  4CI6 A;  1WSJ A;  5I42 A;  1IG8 A;  3DRR A;  4NB4 A;  4KRE A;  1ILY A;  3FZK A;  1J6Z A;  4MDB A;  2VWJ A;  5AZJ A;  2FBY A;  3DXM B;  5HRP A;  2D0A A;  3AAQ A;  4ZRK A;  3VEX A;  2WBN A;  1YIT N;  4OLB A;  2BE2 A;  1QVF M;  2X6N A;  4DSF A;  4H03 B;  4LF5 K;  4WE1 A;  5E26 A;  3K5L A;  4B9L A;  1ATR A;  4CEF A;  5FLX O;  5M1Q A;  4CGG A;  3O9T A;  2ABD A;  5KQ8 A;  3AA2 A;  2BTF A;  5HRO A;  3WXK A;  2P9P B;  4CJW A;  4F7G A;  3L2Q A;  4FWQ A;  2J4R A;  1YXQ A;  1T6C A;  4YNQ A;  3AVG A;  4M3X A;  1BU6 O;  3CCS N;  2YI1 A;  3VEV A;  4FWM A;  3AO3 A;  1OH8 A;  2NNW A;  4FZX C;  1ZBH A;  2D5R A;  3UKR A;  3DLE A;  1EF1 A;  3AGK A;  3GL1 A;  3O9S A;  4DQP A;  5F2R A;  1S1V A;  1MU2 A;  5J1E A;  1WLJ A;  5C25 A;  3PX4 A;  4H5R A;  4CZG A;  3K0S A;  1BDG A;  2E8A A;  4FJ9 A;  1RTH A;  4DFP A;  2RF2 A;  5AQZ A;  4CD3 A;  4CJR A;  1VSL A;  4DHY A;  3U4L A;  3SQ1 A;  4DU3 A;  1X3N A;  3QIP A;  3BUZ B;  3OVN A;  4B1V A;  4HTL A;  1S22 A;  3E1Y A;  3BY5 A;  1BIU A;  3VQE A;  3R6M A;  2HVI A;  1GLJ O;  4YOV A;  2KZZ A;  3NDK A;  4DV1 K;  3QET A;  2G8H A;  2O8D B;  3SCX A;  4KHP K;  3SPZ A;  1WSG A;  3O9U A;  3AVK A;  4OKE A;  4CE9 A;  2AA4 A;  3HZ6 A;  5MLC Q;  3S3N A;  4E89 A;  4JI7 K;  5JIC A;  1LAW A;  4KKO A;  2E2N A;  3ZET B;  1NK8 A;  3I56 N;  2P9N B;  4FW2 A;  1IBK K;  3V9U A;  1XMO K;  3KKS A;  3E9O A;  4CJK A;  3KLH A;  3NCI A;  2KFN A;  4CF1 A;  1Z05 A;  4F3O A;  5D3G A;  3TAF A;  3EKU A;  5KPT A;  4ZTF A;  3CQX A;  2ZJP L;  1JLE A;  3HRG A;  4KH6 A;  4CGF A;  3KK3 A;  3ULD A;  4NCB A;  4BDY A;  1JLB A;  4OLA A;  2ITG A;  1KLN A;  3J7Y P;  1X9J A;  3LP1 A;  1GLL O;  3CQ8 A;  4IFE A;  3WNH A;  3BF3 A;  4X66 K;  4F9O A;  4JRP A;  3PUF A;  3NH2 A;  4CBW A;  4OPA A;  4RW4 A;  2Z1J A;  2V7Y A;  3MWT A;  2XY6 A;  4J8F A;  4DLE A;  3S3M A;  3ULE A;  1S1U A;  5M1O A;  4JI8 K;  4FVU A;  2HHT A;  3U7D A;  3MK6 A;  4ZTJ A;  4BAC A;  3WUH A;  1VSF A;  3I8D A;  1KTQ A;  3V1R A;  4BGA A;  3SV4 A;  3DOK A;  1WOQ A;  4DF8 A;  3L2U A;  2FDQ A;  4BVP A;  4KHS A;  3LAK A;  3PY8 A;  4UQG A;  1WSI A;  3ASM A;  1QZ6 A;  4H5N A;  5KRT A;  3AA3 A;  3F9K A;  4PKG A;  1YUW A;  4LH4 A;  5DM6 L;  5ADX H;  2YNG A;  4CJ5 A;  2XO7 A;  1NJW A;  3C6U A;  2YHB A;  2XY5 A;  2R82 A;  2NRX A;  3KVG A;  5C15 A;  3CCQ N;  5DM7 L;  4FJM A;  4WQ4 A;  3OHR A;  3KD1 E;  1TGO A;  3VA3 A;  3MED A;  3AO1 A;  3TTD A;  3K59 A;  1C6V A;  2WON A;  4FLT A;  1RT7 A;  4IJA A;  3LDS A;  3PIP L;  1NTI A;  4ID1 A;  4PHT X;  1JCE A;  3IRX A;  3OY9 A;  3QEW A;  4GMJ B;  2KZM A;  4HDQ A;  2CGJ A;  1R59 O;  4KV8 A;  4AH9 A;  4CZK A;  5AQL A;  3VQP A;  1RTD A;  2UUB K;  1KFS A;  3VGK A;  3HT3 A;  2A42 A;  1REV A;  4CIG A;  2P51 A;  4JD2 A;  1RDW X;  2VG7 A;  4LF8 K;  2P9S A;  1ASW A;  1U47 A;  4AM7 A;  4OPH A;  1YVN A;  4FWP A;  3AVI A;  3QLH A;  3SJH A;  1HNI A;  3VOV A;  1YI2 N;  4FM2 A;  1C0F A;  4FWK A;  4CHO A;  3H3N O;  3O08 A;  2AL6 A;  5KGX A;  1IKX A;  2FF3 B;  5HP1 A;  2A40 A;  3A5M C;  1FXX A;  3WEE A;  3M3Z A;  4WFN L;  4DFM A;  1T03 A;  5BPM A;  1NKC A;  5IWA K;  3VMF B;  4DSE A;  5KRS A;  3HO1 A;  3GE1 A;  4KB1 A;  4DF4 A;  1EXQ A;  1TL3 A;  1S1W A;  1EET A;  2B6A A;  3CJ1 A;  1GC6 A;  5AQM A;  4EIA A;  2F4V K;  1NOZ A;  2NLX A;  3DWL A;  4QS7 A;  4QOZ B;  5EVZ A;  1M90 O;  4CCH A;  4FM0 A;  2XY8 A;  4KH4 A;  2VG6 A;  4V19 S;  2QWM A;  2HHU A;  2WC9 A;  1JXE A;  3NF9 A;  1ZC6 A;  4J2D A;  5AR0 A;  2QKK A;  4ISE A;  4DMN A;  4C8K A;  4M3W A;  4EZ6 A;  4CJE A;  3HP9 A;  1VQO N;  3MCP A;  4AF1 A;  3T19 A;  2W42 A;  1BUP A;  3LPU A;  2D4W A;  2YKN A;  2LBB A;  1TAU A;  2E20 A;  1EQY A;  5M1P A;  3VPZ A;  3QIJ A;  3CFP A;  4BR5 A;  2GWK A;  4XEI A;  2W41 A;  2HBL A;  4FJN A;  4E1J A;  5J2M A;  4K8Z A;  1RNH A;  4I2Q A;  3KK7 A;  5JLF A;  4GVE A;  3OYE A;  1C0T A;  1VQP N;  3C7N B;  3NVM A;  4H0X B;  5HRN A;  3ZX3 A;  3O3F A;  1K9M O;  1HUX A;  4DTM A;  4CHN A;  3M8R A;  3K2P A;  4CJ4 A;  3VQ5 A;  5BR8 K;  1W0H A;  1W2B M;  4FPA A;  3JYT A;  1GOA A;  5IJM A;  4DS4 A;  3FLV A;  1VSJ A;  4QAG A;  4BRF A;  1VBG A;  3QO9 A;  1N34 K;  2YV0 X;  5DMR A;  1B9D A;  4JRQ A;  2I5J A;  1OVQ A;  2HRJ A;  5H1S Q;  4TKN A;  3QNN A;  2HNY A;  3HPH A;  4GY2 B;  4JEP A;  1SL0 A;  2J0K A;  3IAY A;  1VSI A;  3TSQ A;  3SUO A;  4BRQ A;  3OYK A;  1YJW N;  2EWS A;  4WQ5 C;  4W5N A;  1XC3 A;  3J80 O;  4F4K A;  2ETJ A;  1J53 A;  2GUI A;  2IC3 A;  2E1Z A;  3MEG A;  2HHV A;  3SMP A;  2NRH A;  3BGR A;  3C6A A;  1Z6R A;  1YHQ N;  1LW2 A;  1VQ9 N;  5AQR A;  4W5T A;  2D0P A;  2P9K A;  4IO9 L;  4RW6 A;  4DB3 A;  3D45 A;  4AHV A;  2P9L A;  5C12 A;  1P8Z A;  3RR7 A;  1KVA A;  5B8H A;  4DR2 K;  2Q31 A;  3AAR A;  3Q7C A;  2G8U A;  1QVG M;  3J7A P;  1HB8 A;  1U04 A;  1MK9 B;  3H08 A;  1MDU B;  3CG7 A;  1ZBS A;  4R5P A;  4BVO A;  3IVF A;  3P39 A;  3MWP A;  4CF2 A;  2BDP A;  1OH6 A;  4FK0 A;  4IXC A;  4LFB K;  3SZ2 A;  1E4G T;  1LWE A;  1RBT A;  1S1T A;  4CZI A;  4BC4 A;  3L4Q A;  4C1N I;  1VK0 A;  4JLH A;  3QIO A;  3U8Z A;  4DTR A;  4WYB A;  1KC8 O;  2QM1 A;  4JKE A;  1L3S A;  3LAM A;  3MN6 A;  1NNE A;  2RE2 A;  4BRK A;  1JLF A;  1B9F A;  1RDD A;  3CIP A;  3A5N C;  4B1U B;  4FJK A;  3GDQ A;  5F1X A;  4H0V B;  3CCE N;  1EKE A;  3HTV A;  3IMX A;  4KO0 A;  2QTD A;  1S72 N;  3UKU B;  3F2K A;  1J54 A;  1X9S A;  1WBD A;  3L4I A;  1ST7 A;  2NRR A;  4MQ3 A;  1RIL A;  3C95 A;  1CZ9 A;  2FSK A;  4AM6 A;  4ELT A;  3LL3 A;  3FLC O;  1GC7 A;  3G10 A;  3FZH A;  5AFU A;  2KQ2 A;  1SUQ A;  1S1X A;  4B1W B;  4W5Q A;  4MLH A;  3CF5 L;  3SUN A;  1WAF A;  2D0O A;  4E19 A;  4I7F A;  4YDU A;  1QSS A;  3OYC A;  2F7T A;  2OPR A;  4FM1 A;  4ICL A;  3CM5 A;  3ISN C;  3PZD A;  1WSH A;  1K6Y A;  3HVT A;  4K43 A;  2QA4 N;  3WNE A;  4JI4 K;  3B6O A;  3LDQ A;  4GKK K;  2I1K A;  4CEZ A;  2YJF A;  3DXK B;  5LMU K;  4B1X B;  3RMB A;  1YTU A;  4FJG A;  1SQK A;  3NBP A;  1YJ9 N;  2ZM6 K;  5J2N A;  3OJS A;  3EZW A;  4H0T B;  3MCA B;  3ZT2 A;  2QWL A;  3LWL A;  4AHC A;  3H46 O;  5CYM A;  4DQR A;  4Q0B A;  1ZBU A;  3ZEU B;  3CC2 N;  4M3R A;  1QTM A;  2EX3 A;  4K42 A;  1DIK A;  1NGJ A;  1TYQ A;  1BA0 A;  1YTA A;  2QWQ A;  4CF0 A;  4BG8 A;  2EHG A;  3E9P A;  4RW8 A;  4E7J A;  1D8Y A;  3I0S A;  2RPI A;  5FPE A;  1XI1 A;  4F2S A;  3AVH A;  3CC4 N;  2YJE A;  4DR1 K;  3OYJ A;  4K41 A;  3KZB A;  3DM2 A;  1XQS C;  1HNZ K;  4DFJ A;  5KPZ A;  4Z4G A;  4AHR A;  3CQY A;  4NCG A;  3V1O A;  3LZJ A;  4MO4 A;  4FJH A;  1YIJ N;  3WQT A;  3V4I A;  2XRI A;  1IKW A;  1D9F A;  3O4Q A;  4M3Z A;  1BGX T;  2F9T A;  4FLU A;  1KVB A;  3AU5 A;  1T05 A;  1WAJ A;  1K8K B;  1BIS A;  2Y1I A;  3OJU A;  3LZI A;  4H5W A;  3FZM A;  3ZSZ A;  1OVY A;  1ZBF A;  5C2D A;  2DFF A;  3L3U A;  1RDB A;  3O80 A;  4CZM A;  4BR0 A;  4PL7 A;  2HST A;  1Q86 O;  4M3U A;  4I6M B;  5AQV A;  1N33 K;  1YJN N;  2O8F B;  5SZT A;  2Q1N A;  4CFC A;  2ASO A;  4CYE A;  3MEC A;  3AVL A;  3OA9 A;  2VWB A;  4HUG A;  4CEC A;  3V9X A;  1K73 O;  1Q81 O;  4HCC A;  1HPM A;  4DUZ K;  2IIR A;  4DR4 K;  1C0M A;  3ID6 A;  4CED A;  4NY0 A;  4CEA A;  1GG3 A;  4RTF D;  5EX5 A;  2NRW A;  5C10 A;  4CJT A;  2WH5 A;  1OH7 A;  2Q97 A;  1SZ2 A;  4FK2 A;  2OYQ A;  5AFU H;  4OPJ A;  1ZBL A;  1JCF A;  2HF4 A;  1BWF O;  2Z1G A;  3VQB A;  4DV7 K;  1WSF A;  2F8S A;  3TAN A;  3J7Z O;  2GEM A;  4FOE A;  4B3R K;  1S5J A;  3CPE A;  3MMV A;  3JSM A;  3KTQ A;  2D10 A;  4X64 K;  4JN4 A;  3PX0 A;  3PIO L;  1SKR A;  2NRZ A;  4GNI A;  3GOI A;  5LMN K;  1WBB A;  2I1J A;  4CZE A;  3LP0 A;  4BRP A;  4OJR A;  5AZI A;  3VTI A;  3G71 N;  5I9E B;  3VEZ A;  1XHX A;  3L6Q A;  4LSN A;  2AP1 A;  3CMA N;  4HTU A;  3V1Q A;  3DLK A;  1UAX A;  2FF6 A;  1SKW A;  4XH5 A;  3T1H K;  2HVH A;  5A2Q O;  4BE1 A;  4M3T A;  1UWB A;  4CGD A;  3EZ5 A;  1U4B A;  1X9W A;  1LW0 A;  3SK3 A;  2OTJ N;  3F5T A;  4FLX A;  3RTV A;  4PA1 A;  4K0K K;  4OGE A;  4A5A A;  1NGH A;  2BGG A;  3TTF A;  2O8E B;  2FJ9 A;  4CGJ A;  3OS0 A;  3CME N;  3THX A;  4B3S K;  1GOB A;  3TWH A;  1HPZ A;  3OW2 M;  3CCV N;  2HE7 A;  1C0G A;  2PYJ A;  3CCL N;  2FLO A;  4ELV A;  3VF2 A;  3FE1 A;  1Y64 A;  2OPP A;  3PSF A;  4BR9 A;  4Y0W A;  1EWR A;  3CCJ N;  3OS1 A;  2JLE A;  3VEY A;  3MN9 A;  3NVK A;  2P9I B;  4YFU A;  4PKH A;  4BY9 C;  1UOC A;  3VF6 A;  5AQN A;  4YOR A;  4IFY A;  3QEP A;  1NVL A;  5CYQ A;  3I55 N;  2P9U B;  2PFU A;  4HCB A;  1D5A A;  1RDA A;  3D2E B;  5CR4 A;  1RT1 A;  5JS1 A;  3AVC A;  1ZBI A;  4DS5 A;  1CZB A;  1TKD A;  1NOY A;  3C6T A;  3WXI A;  3KHY A;  2A3Z A;  1TK5 A;  1QS4 A;  4DV2 K;  1Q18 A;  1QZ5 A;  2OCE A;  4BR7 A;  2J0J A;  4YOU A;  1QSY A;  4PY5 A;  1IBL K;  5AQG A;  5AQS A;  3OS2 A;  3OYA A;  1UA1 A;  1U48 A;  1W9H A;  1GLC G;  1KXP A;  3AO5 A;  4IG0 A;  4FWR A;  2JWK A;  4CJP A;  1QE1 A;  2J0M A;  1G15 A;  1A5X A;  3G25 A;  3ATU A;  3SAH A;  2YNF A;  3OBY A;  3OYM A;  4IWV A;  1NGF A;  4JI1 K;  4CGH A;  4DXA B;  4CER A;  1SKS A;  4JNE A;  3DXM A;  1TKZ A;  4E7L A;  3KLE A;  5DK5 A;  4H0O A;  4JHD B;  4FJL A;  4XH1 A;  3HSC A;  4Q5V A;  2VGM A;  1RBV A;  3U9D A;  4KFB A;  4JS5 A;  2FBX A;  3ZSO A;  1LV5 A;  4L8R B;  3NHG A;  1SV5 A;  1RDC A;  3DJC A;  3ID8 A;  3TPQ A;  3L8B A;  1GLD G;  3SJJ A;  3NFA A;  3EEQ A;  1HJO A;  1KLM A;  2E1Y A;  1BIZ A;  4EP4 A;  4B3M K;  2P9P A;  1TKT A;  3LDO A;  1JLG A;  3CD6 N;  3HBT A;  4KHU A;  1TAQ A;  1X1P A;  4DSL A;  1IKV A;  2QWN A;  3RSE B;  4B8C A;  4B9Q A;  1ATS A;  3SAG A;  4XH4 A;  1J19 A;  4LC9 B;  4F8R A;  3P38 A;  3QES A;  1FKO A;  2QWO A;  2DTU A;  3TI0 A;  1XWL A;  1HKG A;  4Y1C A;  4EAH D;  2PZS A;  3IFR A;  5HRR A;  3EKS A;  2VQE K;  4E3S A;  3BDP A;  3VQA A;  3FZL A;  1FKP A;  3TSP A;  4O5F A;  1LOT B;  1HQE A;  1HR0 K;  2Q0R A;  2FXU A;  3SUP A;  3TAR A;  2HHW A;  3I0R A;  4B9N A;  3M1F A;  2FC0 A;  5F0X A;  4JI0 K;  5EY4 A;  1JXB A;  4CK1 A;  2IDO A;  2D2Q A;  3EN9 A;  3H6E A;  4ID5 A;  3LWM A;  5AQX A;  3VQ6 A;  4BE2 A;  4FWO A;  3VEO A;  4DV0 K;  5GIP A;  3H1V X;  3THY B;  5FRN A;  4BC5 A;  1KAX A;  3SI6 A;  2O8D A;  3OTO K;  4A5B A;  3ZDT A;  3AU4 A;  4LY7 A;  5BPN A;  5GAD P;  4BR4 A;  4B1Y B;  2BUP A;  5AQH A;  4YOT A;  5LJV A;  3SPY A;  4KPY A;  5CZ2 A;  2YX6 A;  5AQT A;  3ZET A;  2P9N A;  2DIK A;  3BZC A;  1JLC A;  1C1B A;  2KTQ A;  4OX9 K;  1O1W A;  1EO1 A;  2X6S A;  4O8K A;  3S3O A;  2DY4 A;  1VQN N;  3HYF A;  1W7A A;  3CYM A;  3J81 O;  4FWL A;  1NU0 A;  2F8T A;  1VHX A;  4FCY A;  1HYZ A;  3NGI A;  4IFV A;  3L2R A;  4FLV A;  1VQM N;  1GLB G;  5AQF A;  4ZHR A;  3BEX A;  1OH5 A;  1WN7 A;  2E88 A;  3TAG A;  4DTU A;  4IEI A;  1BI4 B;  5E84 A;  2ASM A;  1VQ5 N;  4DV5 K;  3OYN A;  1VQ6 N;  2ZPY A;  3TSU A;  4C8O A;  1WSE A;  5HBM A;  1NKE A;  3KJV A;  3NGY A;  2Q2R A;  4Z0U A;  5BRF A;  2HNZ A;  1HX1 A;  4BRO A;  3AA4 A;  4X65 K;  2HBJ A;  4I9L A;  1RT2 A;  3VEN A;  1DTQ A;  5EOY A;  4A62 A;  1C0U A;  2ZF5 O;  1NK5 A;  1KFD A;  3R8E A;  4MO5 A;  2VYP A;  3I33 A;  3F9M A;  3JS6 A;  3AVJ A;  3CER A;  5FPM A;  5FPN A;  3B8A X;  2F9W A;  4O0J A;  4C8N A;  1VRU A;  1X9M A;  4NLC A;  4JKA A;  4DQQ A;  5FRO A;  5JVL A;  3TR8 A;  4CJ7 A;  4M63 C;  1CXQ A;  1F21 A;  4OVL A;  3LP3 A;  1YAG A;  5KTQ A;  3TAP A;  2FBV A;  3HP6 A;  3QFP A;  3K5N A;  3WNF A;  3OYD A;  3VEW A;  1NGC A;  1M1K O;  2XHB A;  3ZSY A;  1TVR A;  4H5V A;  3HXM A;  3MXI A;  2HHQ A;  5M1K A;  3THW B;  2COP A;  3G4S N;  1ACA A;  3EO3 A;  5TKY A;  1JLQ A;  3S9H A;  3EE8 A;  3D7E O;  4RW7 A;  4KHN A;  3MEE A;  3VA0 A;  4FJI A;  3ZX2 A;  5JS2 A;  2OZS A;  4Z4I A;  2P5G A;  1T44 A;  4LD0 A;  3ENB A;  4G1Q A;  4A2A A;  2UXC K;  1U2V B;  5GIO A;  3MDQ A;  1BCO A;  4A2B A;  3A8Y A;  3K9J A;  4CEO A;  4J2E A;  4CGI A;  4CVN E;  3CET A;  1Q9Y A;  3EE9 A;  3K5O A;  1XC9 A;  1KD1 O;  1GGO A;  3A2F A;  4MDA A;  3P1G A;  3VQ4 A;  5KI6 A;  1DLO A;  1U6Z A;  4A57 A;  3QBW A;  2YHA A;  2UU9 K;  5FRM A;  1FJG K;  4CIE A;  2ZQB A;  2OPS A;  4DQS A;  1SL1 A;  2Q3S A;  3L0Q A;  2RN2 A;  4Z4C A;  2FBT A;  3OYB A;  3HPO A;  3UE5 A;  3VGM A;  4WQ5 A;  4GV3 A;  3K9K A;  1O13 A;  4O5B A;  1RT6 A;  4TSX A;  4HVJ A;  4JKF A;  4DKW A;  1TL1 A;  2JGU A;  1Q8I A;  1MK7 B;  1LAV A;  4N41 A;  4HDO A;  4BR2 A;  1RBR A;  3CJC A;  3D2F B;  3M5R A;  3DAW A;  2E2Q A;  2KFZ A;  2O8C B;  1TUU A;  2WTU A;  1RGI A;  5JVH L;  3E66 A;  2HMP A;  4JK7 A;  3TAM A;  1RTI A;  1I94 K;  1LWC A;  1QQC A;  2O8B B;  4KAZ A;  1NGD A;  1Z25 A;  4K8X A;  3OBW A;  5I3U A;  3PO5 A;  4NO7 A;  4UY8 O;  1H4R A;  4DR3 K;  5KGW A;  4WFB L;  2ZGZ A;  5BPL A;  4IKF A;  2JWL A;  3DLL L;  4PWD A;  5AQJ A;  1I39 A;  3SV3 A;  3KK2 A;  3ENH A;  1SS6 A;  1BA1 A;  3RMA A;  2HB5 A;  1CZA N;  4DWI A;  3QIN A;  3MXJ A;  5AQW A;  1S6Q A;  3BZK A;  3OYI A;  1E3M A;  4CJ3 A;  4IEE A;  3R9P A;  4BRI A;  4FJX A;  3C7N A;  3G6E N;  3CCM N;  4KHW A;  3FFK B;  3THW A;  1BG3 A;  2D0B A;  3DLG A;  4H5T A;  3HK2 A;  3EY1 A;  2QKB A;  3GG4 A;  3M8P A;  4O0I A;  3RVC A;  4Z4E A;  4RW9 A;  2OA8 A;  4IZ9 A;  4YDU C;  4JI2 K;  2ASP A;  2W6K A;  2RKI A;  4CZJ A;  2E6M A;  1KSP A;  3ZX0 A;  1HJR A;  3A5L C;  2IS3 A;  4M41 A;  3DMJ A;  2HHS A;  2QK9 A;  3G9W A;  4IDK A;  3L2V A;  4FWS A;  5HL7 L;  4DUY K;  2UXB K;  1TUY A;  3DLR A;  1L3T A;  4OO1 J;  1VSK A;  2KKZ A;  4M3Y A;  4CJQ A;  4FSV A;  2CQU A;  3VTH A;  3C0B A;  3DLH A;  1JLA A;  5AQY A;  4EHT A;  4CHY A;  4PUO A;  1NMN A;  5SWM A;  2VG5 A;  4O4G A;  5J2P A;  5AZJ B;  1VQ8 N;  1CLQ A;  4B3T K;  3MN7 A;  1HB6 A;  4Z4F A;  3FGU A;  4FW1 A;  5HRS A;  4DCH A;  2D11 A;  3HM8 A;  2ZGY A;  4RWT A;  1E4F T;  3NF6 A;  4AIL C;  4O8U A;  2NRV A;  3M8S A;  4B3O A;  3AVM A;  4ILG B;  5C2F A;  1NGB A;  5JVG L;  5GAH P;  4J2B A;  4FLW A;  2QWR A;  1IG9 A;  3N4P A;  3G0Z A;  4IG3 A;  4DU4 A;  4NLB A;  3TAB A;  1D9D A;  4KRF A;  2HBM A;  4QS8 A;  2NZT A;  5AQI A;  2OPQ A;  3ZSQ A;  4YHH K;  2IOC A;  3SQ0 A;  4CFD A;  4OPK A;  5BN9 A;  4C23 A;  2UXD K;  3MXM A;  1TKX A;  1X3M A;  4LFC K;  4FJ5 A;  3U6F A;  4OGC A;  4L3Q A;  4CZF A;  3UKR B;  2RQ1 A;  4ZRJ A;  1HKB A;  1QQM A;  1HRH A;  4KI6 A;  4DSJ A;  4E1M A;  3IUC A;  4ZRI A;  2O4I A;  1NI2 A;  4BDP A;  3UKU A;  3KWG A;  4FJJ A;  3SAF A;  2A5X A;  1XMQ K;  4CEB A;  4HUE A;  2EMS A;  1L3V A;  3H3O B;  3RMC A;  3CJ9 A;  2E4L A;  3H45 C;  4A61 A;  4B8A B;  4CBU A;  1BCM A;  3QNO A;  3UB5 A;  4E7I A;  2GV9 A;  1KVC A;  4M7X A;  1E5W A;  2QXL A;  3ZSR A;  3RWU A;  2KHO A;  1KRP A;  1VBH A;  3SMS A;  4BRE A;  1RT4 A;  4BRG A;  4H8K A;  3V9W A;  4JAX A;  1NK7 A;  5KQD A;  1JL2 A;  5C0Y A;  4DV3 K;  1GLE G;  1ASU A;  4Z4H A;  3HOT A;  3MN5 A;  1IKY A;  3HL8 A;  4ILH A;  4B9T A;  4ISF A;  3ZSW A;  1NK4 A;  3WT0 A;  4Z94 A;  3RR8 A;  3LAL A;  2PAV A;  3J8A A;  3TU5 A;  1ASV A;  3DXK A;  2Z1H A;  2D1K A;  1T8E A;  4FJ8 A;  3U3Y A;  2GX9 A;  4OKK A;  1Q7Y O;  2IAJ A;  4OKJ A;  4YOX A;  3N4Q A;  4HHT A;  4Y1D A;  1SL2 A;  2GEL A;  3QIC A;  3ZSV A;  3VER A;  4KHQ A;  4AHS A;  4BRA A;  3VQD A;  4MFB A;  3ZEU A;  4A59 A;  1Q9X A;  2P1J A;  1NKB A;  4KBO A;  3NH1 A;  4MLE A;  3UIQ A;  3DYA A;  5AQO A;  3VQC A;  1HMV A;  4W5O A;  3PX6 A;  3HM9 A;  1XNQ K;  3SBG A;  3NGZ A;  1BOT O;  4BQL A;  4LF4 K;  2OTL N;  4NYN A;  5M1F A;  1NJY A;  2V7Z A;  2P5O A;  1BHL A;  1VAZ A;  2GUP A;  2ZWH A;  5AQQ A;  3K58 A;  2XY7 A;  3ULE B;  4HUF A;  1QHA A;  4BRM A;  1JL1 A;  1V4T A;  4M45 A;  4C1N K;  4CF9 A;  1GLA G;  3HPG A;  4FXD A;  1I3A A;  3FFI A;  2F96 A;  5KPR A;  4CBX A;  2X74 A;  4CJU A;  4DR6 K;  4BWJ A;  3IDH A;  3TAE A;  4JS4 A;  4WF9 L;  3NF8 A;  2GTD A;  3PO4 A;  1K8K A;  3EPY A;  4P7I A;  4DFK A;  2Q0U A;  3HI0 A;  4E7K A;  5BRD A;  5ADX A;  4ILJ A;  5FDL A;  2O8F A;  4EP5 A;  4I6M A;  1RT5 A;  3E01 A;  3O8M A;  3CCU N;  1G99 A;  4X62 K;  3VET A;  1HYS A;  4RCH A;  1GOC A;  1WUA A;  3QBX A;  2I7N A;  3OYL A;  2UUA K;  1NGI A;  4BG9 A;  4JKH A;  5HLF A;  3QFU A;  3A5O C;  5JMV A;  2YVC A;  4CEE A;  1TK0 A;  4CK3 A;  3SQ4 A;  1WB9 A;  4PL8 A;  4BC3 A;  2A6A A;  4LSL A;  1H1V A;  1JDE A;  5J2Q A;  3QEV A;  3DLB A;  3KLF A;  1MIX A;  3V6D A;  2BAN A;  2UUC K;  2AJQ A;  2ZJQ L;  2Y1J A;  1NK6 A;  4GV6 A;  3SBT A;  3LM9 A;  3AO2 A;  4DV4 K;  5AQP A;  3O9R A;  4IO8 A;  5AQU A;  1C1C A;  3DOL A;  3ZT4 A;  2FSN A;  2B5J A;  3QML A;  4BRL A;  3WQU A; 
#chains in the Genus database with same CATH homology
 3E9L A;  5HOO A;  4CZI A;  1VQL N;  4BC4 A;  1K8A O;  4YL8 A;  2Q2R A;  3L4Q A;  1BO5 O;  4JD2 B;  5M1N A;  3S41 A;  4C1N I;  5BRE A;  2IVO A;  5BRF A;  2UYT A;  3CJB A;  5GAG P;  4FOI A;  3C6H A;  1HX1 A;  3R1X A;  4BRO A;  3U8Z A;  2HBJ A;  3FZF A;  3FR0 A;  2P9S B;  4JKE A;  2QM1 A;  4WYB A;  3I8B A;  3VEN A;  3VES A;  3MN6 A;  5EOY A;  4A62 A;  2ZF5 O;  2RE2 A;  1NLV A;  2ITM A;  3R8E A;  3U9Z A;  4BRK A;  5GAE P;  4MO5 A;  3ZYY X;  3CIP A;  3A5N C;  4B1U B;  2E2P A;  1LCU A;  2VYP A;  3I33 A;  1KC7 A;  3GDQ A;  3EL2 A;  3F9M A;  3JS6 A;  5F1X A;  3NMU A;  4H0V B;  4CZL A;  3CCE N;  2CGK A;  3HTV A;  3IMX A;  4EKU A;  2QTD A;  3BP8 A;  3CER A;  4FPB A;  5FPM A;  1S72 N;  1JJ2 M;  3UKU B;  3F2K A;  3WEE B;  5FPN A;  3A0I X;  2A41 A;  2F9W A;  3B8A X;  2V51 B;  4NLC A;  4JKA A;  3L4I A;  1ST7 A;  2NRR A;  5JVL A;  4CI6 A;  1IG8 A;  2I7P A;  2PBD A;  4GV9 A;  4NB4 A;  4CJ7 A;  4M63 C;  2FSK A;  1ILY A;  3FZK A;  1YAG A;  4AM6 A;  1J6Z A;  4MDB A;  3LL3 A;  5AZJ A;  1NJI O;  3QFP A;  3FLC O;  5JLH A;  3DXM B;  1GC7 A;  3T69 A;  3FZH A;  5AFU A;  4B1W B;  3VEW A;  3AAQ A;  4MLH A;  4ZRK A;  1NGC A;  3VEX A;  2WBN A;  1M1K O;  1HLU A;  1YIT N;  3CF5 L;  4JK9 A;  2D0O A;  1HKC A;  4YDU A;  1QVF M;  4H03 B;  2F7T A;  4H5V A;  2YCH A;  5M1K A;  2COP A;  3G4S N;  2P9I A;  5E26 A;  1NGE A;  3PZD A;  1ACA A;  1ATR A;  3EO3 A;  5TKY A;  1JCG A;  3EE8 A;  3D7E O;  5M1Q A;  3O9T A;  4K43 A;  2ABD A;  2QA4 N;  2E2O A;  3Q7B A;  5KQ8 A;  3LDQ A;  2BTF A;  2I1K A;  2P9U A;  3ZX2 A;  3WXK A;  2YJF A;  3D2E A;  3DXK B;  2P9P B;  3P31 A;  4B1X B;  1T44 A;  2FSJ A;  4F7G A;  5CE3 A;  3P4I A;  3ENB A;  1SQK A;  4WQ4 C;  4KH5 A;  4A2A A;  1YJ9 N;  4M7Y A;  1U2V B;  5GIO A;  3MDQ A;  4QS9 A;  4FWQ A;  4A2B A;  4BGB A;  2J4R A;  3A8Y A;  3EZW A;  3K9J A;  4H0T B;  2ZJR L;  1YXQ A;  3MCA B;  1T6C A;  2QWL A;  1BU6 O;  4PKI A;  3CCS N;  2H3G X;  1DKG D;  2YI1 A;  3CET A;  3H46 O;  3VEV A;  4FWM A;  1VQK N;  3EE9 A;  2NNW A;  3ZEU B;  3CC2 N;  2QWP A;  1MWM A;  1KD1 O;  4IOA L;  4BRN A;  1ZXO A;  1GGO A;  1SAZ A;  4K42 A;  4WCE L;  4MDA A;  3UKR A;  1EF1 A;  3MX5 A;  1DIK A;  4A57 A;  1U6Z A;  1NGJ A;  3AGK A;  1TYQ A;  3GL1 A;  1BA0 A;  2QWQ A;  1MA9 B;  3O9S A;  3QBW A;  5F2R A;  4BY9 C;  4BG8 A;  5BN8 A;  2YHX A;  5BR9 A;  3E9P A;  4BRD A;  1MWK A;  3AAP A;  5FPE A;  3L0Q A;  4H5R A;  4CZG A;  1D4X A;  3UE5 A;  2YJE A;  3CC4 N;  3VGM A;  4WQ5 A;  4GV3 A;  2E8A A;  1BDG A;  3K9K A;  4K41 A;  3CCR N;  3KZB A;  1O13 A;  5AQZ A;  4CD3 A;  3WXJ A;  1XQS C;  4DHY A;  4JKF A;  3U4L A;  4DKW A;  5KPZ A;  1X3N A;  2CH6 A;  1MK7 B;  3CQY A;  4HDO A;  4ISG A;  4MO4 A;  4BR2 A;  3BUZ B;  1YIJ N;  3WQT A;  4B1V A;  4JHD A;  1Q82 O;  4HTL A;  1S22 A;  3CJC A;  3D2F B;  3TTC A;  1KC8 O;  3E1Y A;  1NGA A;  3M5R A;  3DAW A;  2YHY A;  3R6M A;  2F9T A;  2E2Q A;  3ATV A;  1TUU A;  3AU5 A;  1GLJ O;  4YOV A;  1K8K B;  1RGI A;  3O9Q A;  5JVH L;  5EXW A;  3E66 A;  4H5W A;  3FZM A;  2HF3 A;  2HMP A;  3O9U A;  2AA4 A;  4JK7 A;  1OVY A;  3HZ6 A;  5C2D A;  5MLC Q;  3O80 A;  4CZM A;  4PL7 A;  4BR0 A;  1Q86 O;  2HST A;  4I6M B;  5AQV A;  1NGD A;  5JIC A;  1YJN N;  2E2N A;  2Q1N A;  3ZET B;  4CZH A;  3I56 N;  2P9N B;  3OBW A;  2ASO A;  4CYE A;  4NO7 A;  4UY8 O;  3E9O A;  1H4R A;  3CJ7 A;  4WFB L;  2ZGZ A;  3OA9 A;  1Z05 A;  2VWB A;  5BPL A;  2JWL A;  3DLL L;  1K73 O;  1Q81 O;  2GWJ A;  1HPM A;  2IIR A;  3EKU A;  5KPT A;  5AQJ A;  2P9K B;  3CQX A;  3RSE A;  3KWI A;  3ID6 A;  2ZJP L;  4NY0 A;  3ENH A;  2P9L B;  1GG3 A;  4RTF D;  4YOW A;  5EX5 A;  1SS6 A;  2NRW A;  3HRG A;  1BA1 A;  4KH6 A;  5C10 A;  1CZA N;  2WH5 A;  2Q97 A;  5AQW A;  1SZ2 A;  1QQN A;  4IEE A;  3T7Z A;  5AQK A;  3R9P A;  3AGR A;  5AFU H;  4BRI A;  1X9J A;  3C7N A;  1JCF A;  2HF4 A;  1BWF O;  1GLL O;  3G6E N;  3CCM N;  4BRC A;  4JKG B;  3FFK B;  1DT9 A;  1BG3 A;  4IFE A;  5FPD A;  3BF3 A;  3J7Z O;  4H5T A;  4BQZ A;  2GEM A;  1MIZ B;  4F9O A;  4FOE A;  3CPE A;  3MMV A;  3GG4 A;  2D10 A;  4CBW A;  4OPA A;  3MWT A;  1KAY A;  2V7Y A;  4JN4 A;  3PIO L;  2NRZ A;  4GNI A;  4J8F A;  2VGN A;  3GOI A;  3ULE A;  3RVC A;  2I1J A;  3WXL A;  1VQ7 N;  4CZE A;  4H0P A;  5M1O A;  4BRP A;  5AZI A;  4HWI A;  3VTI A;  4JKD A;  4IZ9 A;  4FVU A;  3U7D A;  4YDU C;  3MK6 A;  2ASP A;  5I9E B;  3CJA A;  3G71 N;  3VEZ A;  4CZJ A;  3L6Q A;  3H1Q A;  4G9Z A;  3O1W A;  3WUH A;  3ZX0 A;  2AP1 A;  3CMA N;  3A5L C;  2CH5 A;  2FF6 A;  4BGA A;  1WOQ A;  3G9W A;  1IJJ A;  1NGG A;  1YF5 L;  4FWS A;  4K25 A;  2FDQ A;  4XH5 A;  1TUY A;  4BVP A;  5HL7 L;  2QEX N;  4U67 L;  3QB0 A;  2OTJ N;  3SK3 A;  3W0L A;  4OO1 J;  3PVL A;  1ISN A;  1QZ6 A;  2KKZ A;  3F5T A;  4H5N A;  3MX2 A;  4FSV A;  4BRH A;  2CQU A;  4A5A A;  3VTH A;  5GIN A;  1NGH A;  3C0B A;  4PKG A;  1YUW A;  5AQY A;  3TTF A;  5DM6 L;  3IKM A;  5ADX H;  4EHT A;  2FJ9 A;  4EHU A;  3CME N;  2R82 A;  2AEH A;  1KAZ A;  2QW9 A;  5AZJ B;  3OW2 M;  3CCV N;  1VQ8 N;  3MN7 A;  2NRX A;  2HE7 A;  1C0G A;  1HB6 A;  3KVG A;  5C15 A;  3CCL N;  3FGU A;  3CCQ N;  2FLO A;  3U8X A;  3VF2 A;  5DM7 L;  4DCH A;  2D11 A;  3HM8 A;  3FE1 A;  3OHR A;  2ZGY A;  3FP5 A;  1E4F T;  4WQ4 A;  2OAN A;  4RWT A;  1Y64 A;  1P90 A;  4O8U A;  2NRV A;  3TTD A;  4Y0W A;  4BR9 A;  3CCJ N;  2W40 A;  3VEY A;  3MN9 A;  4IJA A;  4ILG B;  2RHK A;  3PIP L;  5C2F A;  3NVK A;  1NTI A;  2P9I B;  4PHT X;  1JCE A;  1NGB A;  1QQO A;  1ESV A;  2HOE A;  1NMD A;  4PKH A;  5GAH P;  4HDQ A;  3VF6 A;  4WFA L;  4FL9 A;  2CGJ A;  1R59 O;  5CHI A;  2QWR A;  5AQN A;  3N4P A;  4YOR A;  2HBK A;  3ENO A;  1NVL A;  4CZK A;  3I55 N;  5AQL A;  2P9U B;  2PFU A;  4NLB A;  3D2E B;  5CR4 A;  4BC2 A;  3VGK A;  4DQ8 A;  2A42 A;  2HBM A;  1DEJ A;  4QS8 A;  2NZT A;  1NBW A;  5AQI A;  4JD2 A;  3WXI A;  2V52 B;  3KHY A;  1NM1 A;  1RDW X;  4FO0 A;  2A3Z A;  2CGL A;  5BN9 A;  4R79 A;  3HOS A;  4C23 A;  1Q18 A;  2P9S A;  3LDN A;  1YJW N;  1X3M A;  4AM7 A;  4OPH A;  1QZ5 A;  1YVN A;  4FWP A;  4L3Q A;  3SJH A;  4CZF A;  3UKR B;  4BR7 A;  1ATN A;  2J0J A;  2RQ1 A;  4ZRJ A;  1HKB A;  1QQM A;  3AY9 A;  3VOV A;  1YI2 N;  1N8R O;  1TYQ B;  4YOU A;  3GBT A;  1C0F A;  3IUC A;  4FWK A;  3O1B A;  3H3N O;  2WFB A;  2AL6 A;  3O08 A;  4ZRI A;  5AQG A;  2FF3 B;  3PLA A;  2A40 A;  3A5M C;  5AQS A;  4YOY A;  1NI2 A;  3UKU A;  3KWG A;  1GLC G;  3WEE A;  1KXP A;  2A5X A;  3M3Z A;  2IVN A;  3SAF A;  4FWR A;  4WFN L;  2JWK A;  4GXB A;  2EMS A;  1RDU A;  5BPM A;  4EFH A;  3H3O B;  2J0M A;  1HBK A;  3CJ9 A;  3VMF B;  3G25 A;  3ATU A;  3H45 C;  4JKG A;  3SAH A;  3OBY A;  1DGK N;  4A61 A;  4IWV A;  1NGF A;  3GE1 A;  2YHW A;  4CBU A;  4DXA B;  3UB5 A;  3DXM A;  3CJ1 A;  1E5W A;  2QXL A;  2EMT A;  1GC6 A;  4JNE A;  2KHO A;  4M7X A;  5AQM A;  4EIA A;  4CD1 A;  1VBH A;  4H0O A;  2NLX A;  1KBL A;  4JHD B;  3SMS A;  4BRE A;  2NRT A;  4XH1 A;  3HSC A;  3DWL A;  4QS7 A;  3X23 A;  4BRG A;  1KQS M;  4JAX A;  5EVZ A;  2VGM A;  4B1Z A;  3O5B A;  3U9D A;  5KQD A;  1M90 O;  5C0Y A;  1GLE G;  4KH4 A;  3HOT A;  4JK8 A;  3MN5 A;  4ILH A;  2QWM A;  4ISF A;  3LDL A;  3DJC A;  3CHW A;  2WC9 A;  3ID8 A;  3TPQ A;  1GLD G;  1ZC6 A;  3O6W A;  3WT0 A;  5AR0 A;  4Z94 A;  1HJO A;  2PAV A;  3J8A A;  4ISE A;  2E1Y A;  3TU5 A;  1GLF O;  3C65 A;  3DXK A;  2P9P A;  2D1K A;  2X0S A;  3LDO A;  4IOX A;  2GX9 A;  1VQO N;  3MCP A;  1Q7Y O;  3CD6 N;  3HBT A;  2CB8 A;  4IJN A;  4AF1 A;  1U2V A;  3SLC A;  1BUP A;  4YOX A;  3N4Q A;  2QWN A;  2D4W A;  1Y19 B;  3CI5 A;  2GEL A;  3RSE B;  3QIC A;  4B9Q A;  3VER A;  2LBB A;  2E20 A;  1EQY A;  1ATS A;  3SAG A;  5M1P A;  3CPW M;  4BRA A;  3VPZ A;  3QDK A;  3ZEU A;  3QIJ A;  1J19 A;  1RFQ A;  4XH4 A;  4FWN A;  3VGL A;  4A59 A;  4JKB A;  4BR5 A;  2GWK A;  4XEI A;  2W41 A;  4LC9 B;  3O4W A;  1W97 L;  2HBL A;  3JXU A;  4KBO A;  3W3D A;  4E1J A;  3P38 A;  2QWO A;  4MLE A;  2BH1 A;  3KK7 A;  5JLF A;  5AQO A;  1HKG A;  4GVE A;  3D6R A;  3CXC M;  5LJW A;  1VQP N;  3C7N B;  1V4S A;  4EAH D;  3NVM A;  1NWK A;  3IFR A;  3EKS A;  3R3L A;  4H0X B;  3ZX3 A;  1K9M O;  1HUX A;  2QI2 A;  3SBG A;  1BOT O;  4BQL A;  3FZL A;  3TSP A;  4O5F A;  1LOT B;  2OTL N;  5M1F A;  2V7Z A;  1VAZ A;  1W2B M;  2Q0R A;  2GUP A;  2ZWH A;  2FXU A;  4H0Y B;  5AQQ A;  4FPA A;  3BF1 A;  1XUP O;  3ULE B;  3M1F A;  5IJM A;  3FLV A;  1T6D A;  1QHA A;  3VF4 A;  1V4T A;  1T3V A;  4BRM A;  5F0X A;  5EY4 A;  5LY3 A;  4BRF A;  1VBG A;  5AZI B;  4C1N K;  1GLA G;  2D2Q A;  3EN9 A;  3H6E A;  5KPR A;  4CBX A;  3D2F A;  5H1S Q;  2HRJ A;  1S3X A;  4TKN A;  5AQX A;  5JVG L;  3IDH A;  4JEP A;  4GY2 B;  2J0K A;  4FWO A;  3VEO A;  4WF9 L;  2GTD A;  3H1V X;  5GIP A;  3TSQ A;  4BC5 A;  1K8K A;  1KAX A;  4BRQ A;  4U7B A;  4A5B A;  3EPY A;  3ZDT A;  3AU4 A;  2EWS A;  4WQ5 C;  5BPN A;  4BR4 A;  5GAD P;  1XC3 A;  4P7I A;  2Q0U A;  3LDP A;  5BRH A;  1OKJ A;  3HI0 A;  4B1Y B;  5BRD A;  2VCP A;  2BUP A;  5ADX A;  4ILJ A;  3WA0 A;  2E1Z A;  5AQH A;  4YOT A;  5LJV A;  3SMP A;  4I6M A;  2NRH A;  2YX6 A;  5AQT A;  3ZET A;  2P9N A;  2DIK A;  3O8M A;  3C6A A;  3CCU N;  1Z6R A;  1G99 A;  1YHQ N;  3VET A;  4IDH A;  4RCH A;  1EO1 A;  1SGH A;  1VQ9 N;  1WUA A;  3QBX A;  2I7N A;  5AQR A;  4O8K A;  1NGI A;  4BG9 A;  1VQN N;  4JKH A;  2D0P A;  3QFU A;  2P9K A;  4IO9 L;  3A5O C;  4JKC A;  4DB3 A;  5JMV A;  2YVC A;  2Q36 A;  4PL8 A;  3WXM B;  4BC3 A;  2DPN A;  2A6A A;  2IVP A;  2P9L A;  5ELZ A;  1P8Z A;  4FWL A;  1H1V A;  3LM2 A;  5B8H A;  1JDE A;  5C12 A;  1VQ4 N;  5TKW A;  2Q31 A;  3AAR A;  2KLA A;  3Q7C A;  3BIN A;  1VQM N;  1QVG M;  1GLB G;  1MIX A;  1HB8 A;  5AQF A;  1MK9 B;  3M6G A;  1MDU B;  3BEX A;  2ZJQ L;  4GV6 A;  3SBT A;  3LM9 A;  2E88 A;  3CC7 N;  2WUS A;  5AQP A;  3O9R A;  1ZBS A;  4IO8 A;  5AQU A;  4BVO A;  4IEI A;  3IVF A;  3P39 A;  5E84 A;  2ASM A;  3MWP A;  4IXC A;  2FSN A;  1VQ5 N;  1VQ6 N;  1E4G T;  3QML A;  4BRL A;  4IOC L;  2ZPY A;  3WQU A;  3TSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...