4JKAA

Open and closed forms of r1865a human prp8 rnase h-like domain with bound co ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkaA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkaA01
4JKEA 3SBTA 4JKCA 4JKHA 3E66A 3E9OA 3SBGA 3E9PA 4JKBA 4JKGB 4ILHA 4JKAA 4JK9A 3ENBA 4JK7A 4JKDA 4JK8A 3E9LA 4ILGB 4JKGA 4JKFA 4ILJA
chains in the Genus database with same CATH superfamily
2QWLA 2ZD1A 3H3NO 5J2NA 3M3ZA 3KTQA 2NRHA 4CK3A 2NUBA 4BWMA 4CJFA 5C2FA 3ATUA 4CIEA 4OPJA 2CQUA 3VGLA 2PZSA 4OKJA 1BI4B 3ISNC 2BDPA 4CEAA 4GW6A 1SL2A 5K14A 4FOEA 1JLGA 2J0MA 3FZHA 4ID5A 1P90A 3CQXA 4FLVA 4CE9A 3A5MC 2Q0UA 1CLQA 3S3MA 1GC7A 3K2PA 4BC4A 2RF2A 3LP2A 2W6KA 4FJ9A 4YOUA 3AVKA 3UIQA 1TUUA 3V4IA 1F21A 1GOAA 4IFYA 1K8KB 4PKIA 4H0PA 2HBLA 2OPQA 3THYB 1EWRA 5JVLA 1ASUA 4FJMA 3ZT3A 3HSTB 4ZRKA 4YORA 3VQBA 4M7YA 4FWKA 4F7GA 4B1YB 5SWMA 2NRTA 5AZIB 2QEXN 3CJAA 4H4MA 4CF1A 3ZSZA 4OGEA 1WBBA 3OYFA 1KFSA 1QHTA 5J2MA 5I3UA 2OYQA 1C0MA 3QNNA 3SJJA 2P9IB 1ZC6A 1CZAN 1JCFA 3H1VX 4GKJK 1RT3A 2UXCK 2HW3A 1XNQK 5CY4A 2QXFA 3DLHA 4BY9C 1OH8A 4X62K 4CFAA 1DEJA 5F1XA 1IV0A 2GWJA 2Q0RA 1NGFA 4K25A 2HB5A 5JVGL 4IDKA 4JI1K 3CCQN 5JMVA 1N36K 3VQDA 4CEFA 4CI6A 3QEXA 2RKIA 2WC9A 2W40A 3K9KA 3WEEB 1WLJA 3LM9A 4FWPA 5CZ2A 1EX4A 4M7XA 3A8YA 2UUAK 4BDYA 5CHIA 4BVPA 1SKRA 2JGUA 4WCEL 3H46O 4Q0BA 3DRPA 3HI0A 5E84A 2OTLN 4EZ9A 3NGZA 3VGKA 3CCSN 2PYLA 1I39A 4W5TA 3PUFA 1MIXA 4XH5A 1VSDA 2E1YA 4FPBA 3MN5A 1HQEA 3V9UA 3C95A 3V9SA 1HNZK 2AA4A 2E5LK 3D45A 1WBDA 2KFNA 2ETJA 2ITMA 5T7BA 4BACA 1GLJO 2X6SA 4GNIA 3LDSA 2F4VK 3ZT0A 5KPZA 1QQNA 3A0IX 5FDLA 3O80A 3ZCMA 4YDUA 5KGWA 3K0SA 2HHXA 2Q1NA 3QFPA 1NLVA 1H1VA 1HB6A 4O8KA 4BRGA 1U48A 3K59A 5EVZA 3T69A 3K5NA 2I5JA 1U4BA 1HKGA 3Q7CA 2YHXA 3SLCA 2OANA 3VQCA 5BREA 1XWLA 3QESA 2Q3SA 4KHNA 2XY7A 4DS5A 1VQ9N 2G8WA 2JLEA 1HJRA 4JI4K 1GLDG 2YHWA 3F73A 4UY8O 4KPYA 3SV4A 4IEIA 4FJKA 2V51B 3C6TA 4KTWA 3NMUA 4WQ5A 3PV8A 3ZT2A 1VRUA 1U2VA 5EY4A 1V4SA 3I0SA 2KTQA 4PY5A 3M8RA 3BF1A 4BRDA 1KVAA 2EX3A 2NNWA 1A5XA 2HHSA 3VQPA 4BDPA 3GG4A 3HOSA 3ZX3A 3OYIA 2RQ1A 2Q36A 3O9UA 1KC7A 2B6AA 4JS5A 5KRTA 4CFDA 5M1KA 4CW7B 3U7DA 5CYMA 1A5WA 2FBXA 4H0XB 2I1KA 1VQ7N 4FWMA 3UB5A 2QWOA 5BRDA 4BE2A 5FPMA 3NF6A 4JRQA 3AA4A 3KD1E 3O8MA 2DY4A 4FJIA 4W5QA 5CYQA 4CGHA 1T8EA 3S9HA 3TANA 4CIGA 2FDQA 1EP4A 3P83D 2A1RA 4YY3K 4XH4A 3AVBA 4KI6A 1DIKA 2D4WA 3E9OA 1FXXA 3QB0A 4CJ5A 1MIZB 3T1YK 1NK5A 5M1QA 2QWMA 1SV5A 1KAZA 3WXLA 3SPZA 4I6MB 4FZYA 4WFBL 2O4IA 3DXMA 4EHTA 1RT4A 2QWNA 3JXUA 4WQ4C 1NKBA 4X66K 3G25A 4QS8A 2P5OA 1S1UA 3LP3A 3SNNA 1N5YA 2O8BA 1VQLN 4AQYK 3AO5A 1KQSM 3I33A 5C15A 1K8AO 2HBJA 3LPUA 3CJBA 4DR4K 3O5BA 1YT3A 4CJUA 5M1FA 5FPDA 2A3ZA 3KLEA 4IOXA 1N8RO 1NGBA 3IKMA 1YJ9N 1L3VA 5HLFA 1FJGK 3A2FA 1E4FT 4PQUA 1T05A 1N34K 2RN2A 3QIPA 4IG3A 1RBUA 2BANA 4MO4A 1TK5A 3LDOA 2O8DB 5LMUK 4OLAA 3OBWA 2QM1A 3I0RA 4FM1A 3K5OA 4KREA 1JLFA 4FOIA 4HUEA 4KHUA 3P4IA 4M45A 3NGYA 3SZ2A 4OO1J 3CHWA 3QINA 3B6PA 1YF5L 4KFBA 2FLOA 3T19A 4DSLA 3G10A 1TKDA 4DTSA 1DLOA 1J6ZA 1BISA 3NGIA 2W41A 3FZLA 3SYZA 1W2BM 4FCYA 1JL1A 1IKVA 3OYNA 4RW6A 3I55N 3CCMN 1TK8A 4DQRA 5AQFA 4JI5K 1MWMA 2A5XA 2HE7A 4HTUA 4DFJA 4LF8K 4HCBA 3EE8A 2G8VA 3CIPA 2ZWHA 1P8ZA 4B3TK 3JS6A 4JKEA 1EF1A 2FBTA 1T3VA 3GDQA 4Y1CA 5AFUH 2KQ2A 3B6OA 1SL1A 2HMPA 3A5LC 1LV5A 2E2NA 4DUYK 3RSEA 4GV9A 3U3GA 2BE2A 1VQ4N 4QAGA 3R8EA 4DTJA 1WAFA 3CYMA 4Z4FA 3S3NA 1VQNN 4DR1K 4IKFA 3HXMA 3GOIA 4KHQA 4FJLA 1IBKK 1RILA 5EX5A 2HBKA 4K41A 1ZBFA 2E8AA 3TAEA 5CZ1A 5LJWA 3EYZA 4DWIA 4DR6K 3IDHA 4ZRJA 3AVFA 3NH0A 1IH7A 4KHYA 2QKBA 3U3YA 2AP1A 3SAFA 3FLVA 1NJXA 2A6AA 4DXAB 4B9VA 2E1ZA 4DF8A 5E26A 3SQ1A 3DOLA 5BPLA 3VERA 3KLIA 3AAQA 3SBGA 4DTMA 2DFFA 1EO1A 4BRIA 3O9SA 4DQSA 4H0OA 5BN9A 4J2EA 1YTAA 4ELUA 5LMNK 3RVCA 4IOAL 1U47A 3KVGA 1VAZA 4E7KA 1QQOA 5F2RA 2O8FA 1RTIA 1CXUA 4I6MA 1BQNA 1VSEA 1S1WA 4ILJA 3DXMB 1HYZA 1NM1A 3RR8A 1TV6A 1OH6A 1MDUB 4L8RB 4O44A 3HPGA 3ZYYX 4AHSA 3PO4A 4JRPA 4LY7A 4RW7A 1EQYA 1IKXA 1VBGA 4CD1A 1KBLA 3ENBA 1ITGA 3CERA 2HNDA 4ELVA 1BA1A 4FJ8A 2O8EB 1NGGA 4BRLA 3RRGA 2Q31A 4OKEA 4KHSA 4IO8A 4FYDA 4DTRA 5HRRA 1ACAA 4CEDA 4ISFA 2HHWA 4WQ4A 4Z94A 4DQ8A 3MEDA 4JKFA 3KKSA 3VEZA 3AVHA 5TKYA 2D5RA 2IAJA 3V9ZA 3CMEN 1XQSC 1U04A 1W0HA 2E88A 2R7YA 4X65K 1LAWA 4ZTJA 1C0FA 3UKRA 4O0IA 1BIUA 2YNIA 4L3QA 2B4JA 4CHZA 1NGAA 2J0KA 1WB9A 3DLBA 4CEOA 4PA1A 2D1KA 3NCIA 3KK1A 5IWAK 2VG5A 4F2RA 1REVA 4H5TA 4FLWA 1HKCA 1K9MO 5FRMA 4BR0A 3PX6A 3KLHA 4E7HA 5IT9O 5LJVA 4CFCA 5AQRA 1VK0A 3QO9A 2G8HA 4BQZA 3MCPA 5AQVA 4Q5VA 3T7ZA 5HRNA 2KZMA 3DLEA 1IJJA 3WNEA 3NF7A 4NO7A 1S22A 1MK7B 1HX1A 3AA5X 4A57A 4J2DA 2BUPA 2KZZA 1ZXOA 1BWFO 2WFBA 5HL7L 2W6LA 3M8PA 1UA1A 3J7AP 4DCHA 1VSLA 4DLGA 2WONA 4CK1A 3O6WA 1QZ6A 2Z1GA 2O8FB 3VEYA 3AO2A 5BR8K 4B8AB 5GIOA 1MK9B 2FF6A 1W7AA 3EY1A 1RT5A 4CYEA 2O4GA 3UKUB 4JHDA 1SGHA 4FJ7A 1C1CA 4M3UA 4OLBA 3E66A 3EN9A 4FVUA 3EE9A 1WUAA 2AL6A 3THXB 3A5NC 3NVKA 1FW6A 2E2PA 4BRFA 4QS9A 4B9UA 3MX2A 2VGNA 4YL8A 4Y0WA 4LF5K 1XMQK 3HVTA 3MXMA 3HM8A 1NI2A 4LSNA 4H0YB 1RT6A 4NB4A 4LFBK 1IG8A 4Z0UA 2G8UA 3IVFA 4CZFA 4BR2A 4ISEA 4FLZA 4DFPA 3FLCO 4YNQA 3G6EN 1VQPN 1TL1A 1VQ5N 1L3TA 5AQSA 1Q81O 3O9RA 3LAKA 4GY2B 1HPZA 3M5RA 4O8UA 4H5NA 3J8AA 3KLGA 4BC3A 3M6GA 4U67L 3AO3A 5AQOA 3S3OA 2D0AA 4WYBA 2CGLA 1SL0A 3ZT1A 1OKJA 4KAZA 2D10A 1WSGA 3AA3A 4KRFA 3OYMA 1FKPA 4CCHA 3ZEUA 1KLNA 1ZYQA 3PVLA 1ST7A 3VA0A 3UKUA 4K43A 3HRGA 3OJSA 3C6HA 5B8HA 4CEBA 4FLUA 4YOYA 3CCJN 3KZBA 1SKWA 1RDWX 2BGGA 4IEEA 2QA4N 3MK6A 1BHLA 1M1KO 5AQTA 4CHYA 1C1BA 4ILGB 2GX9A 3M8SA 5AQLA 3AVIA 1NU0A 4YOTA 5HRPA 2FBYA 4O0JA 1LW0A 1OVQA 4CD3A 4AHVA 3BZCA 4BRMA 4DTPA 3ULDA 1ASVA 2ASMA 2FBVA 1RBTA 3ZX2A 2YX6A 2NZTA 4MFBA 1JLAA 4BRPA 3QFUA 3QEIA 1J53A 2KLAA 3OY9A 1DGKN 3QDKA 4CBXA 3MN6A 3L2RA 4DV7K 4RCHA 4FK2A 3VQ9A 4QCLA 4DLEA 2KFZA 2JWLA 4KB1A 4IBNA 3F9MA 3A5OC 1JL2A 3OS2A 1VQON 1BDGA 3VTHA 3PX4A 2XO7A 4U7BA 2QWPA 4P7IA 3AARA 1RT2A 4TKNA 3J81O 3ZSQA 2FF3B 2B5JA 3LANA 4KH5A 4MDAA 4CJWA 5CE3A 3SQ2A 4OVLA 1ILYA 3RMDA 3WNHA 1RGIA 1Y97A 3K57A 4V19S 3U9ZA 4CESA 4CF2A 2IVPA 1XMOK 2QTDA 3CFPA 5F0XA 3VENA 3E9PA 3I56N 3HVRA 2IVOA 1JXEA 2GEMA 3TAMA 3HPHA 4CHPA 1J5EK 4B3OA 5TKWA 4C8NA 2D0CA 4BC2A 4IDHA 4QOZB 5BPMA 3EZ5A 4OJRA 1NGIA 1X9WA 1KVCA 3FE1A 4IJNA 4E1MA 1BGXT 3HSCA 3ZETB 1NK4A 4CEEA 2H3GX 4EZ6A 4TSXA 3SK3A 2LSNA 4PWDA 1U45A 2EHGA 2GUIA 4I2PA 1SUQA 1B9FA 4H5RA 4O5FA 1XI1A 2WUSA 3W0LA 1HJOA 5FROA 3CCRN 4FVMA 4DSKA 5E41A 4CZKA 1JLEA 1HYSA 3AV9A 5SZTA 3PX0A 3SAGA 2ZM6K 1IKWA 4ICLA 3CFOA 4BE0A 4B3RK 3AVLA 3P31A 4B9LA 4A5AA 4FW1A 3ITHA 2F9TA 4CJ7A 3H6EA 1D5AA 3V1OA 3HZ6A 4CHNA 3OS1A 1EKEA 1BL3A 4FL9A 4DU3A 3G9WA 5EXWA 1SZ2A 1Y64A 1RDUA 3KIOA 4IJAA 4N5SA 4BG8A 4BR4A 2OTJN 2HBMA 4E3SA 4GKKK 2NRXA 4JK8A 2J0JA 1UAXA 3CCLN 4BRHA 3V1RA 4YFUA 4IFVA 4EIAA 3D2FA 3BEXA 1TKTA 1D9DA 1ZBUA 1N6QA 1KVBA 4OX9K 2P5GA 2HVIA 2E6LA 2VQFK 2OPSA 4Y1DA 1RT7A 2UXDK 4B1UB 2XRIA 1L5UA 3K5LA 1G15A 1KC8O 3DAWA 4WE1A 3JAMO 3D7EO 3NHGA 2O8CB 1NK7A 3VQ4A 2DTUA 3R3LA 2AEHA 1JCEA 3OJUA 1L3SA 4AHRA 1YVUA 2P9NA 4M63C 3WNGA 5I42A 4PKHA 1RBVA 1SAZA 4NXNK 3K58A 1MWKA 4DHYA 2D0OA 5BR9A 1GOBA 3RMAA 3V6DA 4AM7A 1ATNA 1WSIA 3F5TA 1NWKA 4B3MK 2DFEA 3ZDTA 5ADXA 4LC9B 4HVJA 3CMAN 1C0UA 2UU9K 1QSLA 3NH1A 1Z05A 2YNGA 2V7ZA 1NK6A 3EPYA 2D11A 3DRSA 3FGUA 3KHYA 4CGIA 2DFHA 1RTHA 3THWB 2KHOA 3W3DA 5AQYA 3DLGA 1L3UA 4DFMA 3PSFA 4XIUA 4Z4HA 2QW9A 1HNXK 4BWJA 4A2BA 2P9PB 3BINA 4NYNA 2ZPYA 1HNIA 1T6CA 3OTOK 1YUWA 4DMNA 2HVHA 3WXKA 1NOZA 1OH7A 4BG9A 4DU4A 5DM6L 4B1XB 3AAPA 3FFIA 1RTJA 3MEGA 3ZETA 3R9PA 3GE1A 1V4TA 4B9MA 3EO3A 1RDDA 1O13A 3VQEA 3O3GA 5AQHA 2IIRA 1KCFA 5GAGP 2XHBA 1ZBIA 4BGBA 5MLCQ 5HP1A 3TSUA 4LH4A 1M90O 1S9EA 1ATSA 1Q8IA 4B1ZA 3J7YP 4JK9A 1JJ2M 3TU5A 1TAUA 4DQIA 1KAXA 1LCUA 2FSJA 1Q9XA 3EZWA 2ASOA 5J1EA 3HBTA 3MECA 1G99A 1O1WA 3LZIA 4FO0A 3FP5A 5KPTA 3HP9A 4CZHA 4O4GA 4F9OA 4ID1A 5AQIA 1HQUA 1HMVA 1RBRA 2WTUA 4E0DA 3VQ6A 1RBSA 2VG7A 4HDOA 1A5VA 1VSHA 4LFCK 1NK8A 1FK9A 4YDUC 4C8MA 4CZIA 4F2SA 1S9GA 3UE5A 4CEQA 1C6VA 1ASWA 2P9NB 5JLHA 1T6DA 3DLKA 1RDBA 4H03B 3G71N 3ID6A 4OPHA 3O1WA 4JV5K 2G8KA 3I8BA 3RWUA 3VTIA 4JKBA 2GWKA 4FJHA 2IGIA 3CETA 3NH2A 4DV5K 4GMJB 2HNYA 4BE1A 3AVJA 3OYBA 2ZF5O 1S5JA 1DTQA 1LWCA 1VSMA 3WXMB 1QS4A 2XY8A 5AZIA 3VQQA 3V81A 4RW8A 3TR8A 4C8OA 1HUXA 1H4RA 5AQNA 2GV9A 4A59A 2XY5A 3OS0A 4H5WA 4KH6A 1U6ZA 2E4LA 3V1QA 2XY6A 1NMNA 4BRCA 4CJQA 1XC9A 2NLXA 4KI4A 3J80O 4JKAA 4FWQA 4CFBA 3AGKA 4R79A 4E19A 3THYA 1E4GT 1TUYA 4PHTX 2V52B 4DQPA 4KHPK 1NJIO 4BROA 1BOTO 4E7IA 4C8KA 4CJ3A 2OPRA 2FSKA 4O55A 3MX5A 3DOKA 1HNWK 2A1SA 4LFAK 2R82A 1WN7A 2YCHA 4FPAA 1J5OA 1ZBHA 2PAVA 3QMLA 4H0TB 2F96A 5DK5A 2P9LB 1MA9B 2E6MA 2VCPA 1HRHA 1Q82O 3VQ7A 1VSJA 4IXCA 4E1NA 3TSQA 3L0QA 4M3YA 1QSSA 4DG1A 3SUOA 4OPKA 1QSYA 1UA0A 2UUCK 2EMSA 2UXBK 2VGMA 4FLTA 4ZTFA 4NCBA 5ELZA 3QEVA 3DJCA 4AM6A 3HK2A 5LL6Z 4IG0A 3VQAA 4FJNA 3BF3A 4DTNA 1BCOA 4DV3K 1Z26A 2WOMA 2NRVA 4DQQA 3SMPA 4Z4IA 4E7LA 2YI1A 1WOQA 3HP6A 3R6MA 4C23A 4K42A 4DV4K 2HHQA 4FJXA 3PY8A 1BIZA 3KWGA 4ELTA 3C0BA 4DUZK 2Y1IA 1NK9A 2P51A 3T3FA 1CXQA 1C0TA 4O5BA 4KB0A 2CH5A 3H3OB 2O8DA 4AHTA 3K9JA 4Z4GA 4BGAA 1W9HA 5GAEP 3ZT4A 2HF3A 3AU4A 5BPNA 1MU2A 2GTDA 1LW2A 4FJJA 4JYAK 3P39A 4KTQA 4DFKA 1C1AA 3QBXA 4HDQA 3ALYA 5KPRA 4CGDA 1DTTA 5KI6A 2NRWA 3NF8A 4AILC 1GGOA 3QBWA 5AQQA 1TKXA 3OYHA 3MAQA 3FZKA 4I9LA 3PLAA 4XEIA 5BN8A 1T7PA 4RTFD 3EEQA 1OH5A 3H1QA 3O3FA 4DB3A 3KJVA 2BH1A 4UQGA 4LF7K 3SUPA 4BC5A 3QIOA 1SS6A 5H1SQ 3TAPA 2GUPA 4BRQA 3TI0A 1X9SA 3TAGA 4PL7A 4Z4CA 2HMIA 4DV1K 3TWHA 4OKKA 3WNFA 4G9ZA 1GOCA 3AGRA 1NOYA 4DV6K 4CBUA 4ISGA 3TPQA 4MDBA 3CC4N 1N33K 1I3AA 2QXLA 3ENOA 4YOVA 3B8AX 1I94K 3ATVA 2A42A 2A40A 1R59O 5FLXO 1RNHA 1VSIA 3ENHA 3VQ5A 2FJ9A 1XHZA 4NCGA 1LWFA 2CH6A 3OYDA 4LSLA 1OVYA 2D0BA 1QHAA 2F9WA 4KTZA 2G8IA 5AQJA 1JKHA 1X9JA 4CJKA 1YJWN 2OPPA 4GXBA 3FFKB 5KQ8A 4F8RA 2IC3A 3IG1A 1ZBLA 4K8ZA 3CM6A 1D8YA 4FW2A 4DTOA 3OYJA 1S3XA 1XHXA 4ILHA 3IUCA 4BVOA 3VGMA 3DXKB 3BDPA 3HPOA 3OHRA 2COPA 1GLLO 1ATRA 4ZRIA 4RW9A 4AHCA 4EHUA 3I8DA 4FWRA 4CZLA 4FJ5A 3MEEA 4B1WB 3O9TA 4M41A 4FWNA 3ZSYA 4KV8A 4DR5K 1KTQA 3LDNA 3CJCA 2YJEA 4CZMA 3WXIA 2PFUA 3KK3A 4BRKA 1WSJA 3IFRA 3SPYA 4CJ4A 4IZ9A 3L6QA 1RFQA 4JI2K 2V7YA 2YKNA 4JD2A 3LP1A 3CJ7A 1VSFA 1NJYA 5GIPA 4GVMA 3IS9A 1WSFA 3QEWA 4A2AA 2Q2RA 3CG7A 1BO5O 4NXMK 3RMCA 4CGJA 4BDZA 5I9EB 2YHYA 5AQPA 1KXPA 3L3VA 3HO1A 2P9UB 3SCXA 1S72N 1IBLK 3DWLA 2F8SA 1JLBA 4CJEA 4FLXA 3HJFA 5M1OA 4B9TA 4KKOA 4JNEA 4JKHA 3MN7A 4LH5A 3Q7BA 1RDAA 2IVNA 1YTUA 5AQZA 1LAVA 3LAMA 3MXJA 3O08A 1ESVA 3EL2A 2EMTA 1NTIA 3AVAA 2I7PA 5HRSA 3SV3A 3CD6N 3KWIA 5AQUA 4N76A 3P5JA 3OYGA 3BZKA 4FM2A 4CJSA 3D2EA 3ZSWA 1SQKA 4FK0A 4IOCL 4CK2A 4WF9L 2VWKA 2Y1JA 4JAXA 3N4PA 4N47A 3CPEA 3MCAB 1B9DA 1NNEA 4DSIA 1VSKA 1LWEA 3KK2A 3TABA 2P1JA 1JLCA 2RPIA 3ZSRA 3SJHA 4BR9A 3RRHA 3ULEA 4JK7A 4DSJA 4W5OA 5HOOA 2EWSA 1IO2A 4M3RA 3D0PA 3OYLA 1VQKN 3DXKA 3L4IA 2E20A 4LD0A 3ULEB 4MLEA 4BRAA 5FRNA 3WXJA 2RHKA 4I9QA 3JSMA 4CHOA 2FXUA 1EWQA 3AVMA 4KO0A 2Q97A 3KD5E 3WQTA 4FJGA 1HKBA 3VEOA 3CQYA 3N4QA 2OCEA 1X1PA 3QICA 3AO1A 5AQGA 3CPWM 3BUZB 3SMSA 4J8FA 4CHQA 1W97L 2ITGA 4IFEA 3NBPA 2VWJA 3CM5A 5C2DA 2GELA 5EU7A 5JS2A 4LF4K 1EXQA 1IG9A 1NBWA 1GLFO 3H08A 4F3TA 5AQWA 2JWKA 4J2BA 1GC6A 1GG3A 4JD2B 1D9FA 3G4SN 3J7ZO 3O3HA 2PYJA 4FWLA 5AFUA 3CI5A 1S1TA 2IOCA 3JYTA 1HYVA 1WAJA 2ZQBA 5KTQA 4I7FA 2DPNA 3OYCA 3PIPL 2CGKA 1S6PA 5FPEA 4M3ZA 1RDCA 3HTVA 2QKKA 5D3GA 1X3NA 5AZJB 4B1VA 1XUPO 4BRNA 3P1GA 2VWBA 1NGDA 2QI2A 4FSVA 1KSPA 1CZ9A 2OZMA 1HPMA 4CJTA 4JI8K 5C0YA 2IS3A 4C1NI 2O8EA 3C6UA 4CJVA 3LM2A 4CECA 3K5MA 2P9KB 1UOCA 3SQ4A 3NVMA 5M1NA 1BUPA 1GLBG 2HSTA 1HB8A 2WH5A 1CZBA 1WSHA 3MN9A 5C25A 2HRJA 3C94A 3GL1A 1NJZA 2OZSA 1ZBSA 3L2VA 1YIJN 4HWIA 3VEVA 4F4KA 4K8XA 2IDOA 1E5WA 4DV2K 4GV6A 3VA3A 3DI6A 4JKGB 3RR7A 4JI3K 3ASMA 3SQ0A 4NLCA 2ZGZA 1KRPA 3T1AA 2PBDA 2YNFA 4EP5A 3PZDA 3ZLJA 3E9LA 3TTFA 1NVLA 1Q7YO 1WSEA 2Z1IA 3E1YA 4HTLA 2RE2A 4A5BA 4JKCA 3MWPA 5AQMA 1NMDA 1YI2N 3S41A 2F8TA 4DR3K 1JCGA 3OYAA 1YITN 1Z6RA 3CCEN 3LL3A 3VETA 4NLBA 4HUGA 2LBBA 4DR7K 3WT0A 3LWMA 1SKSA 5J2PA 2CB8A 5IJMA 3RMBA 2P9IA 1NGJA 3FZFA 3TAFA 5GINA 4MO5A 4CIFA 1S1XA 4CF0A 3QLHA 4B9QA 2X78A 3MDQA 3L3UA 3IAYA 3HYFA 3U8ZA 1WNSA 1R0AA 1Z25A 4WQ5C 1BI4A 3VEWA 4J2AA 3OVNA 4E7JA 3PO5A 4B08A 3SUNA 4M42A 4MQ3A 4CJPA 2DIKA 5JS1A 3L4QA 1KLMA 3P38A 3G0ZA 4H8KA 2VQEK 3MMVA 4RG8A 5CR4A 4DKWA 4CZEA 3LALA 1VRTA 3NAEA 3T1HK 1Q86O 1HNVA 4BQLA 1TGOA 2I7NA 3RSEB 4BR5A 3LPTA 3LP0A 3ZEUB 4RWTA 5M1PA 3O4WA 1NK0A 3AVCA 1GLEG 1KD1O 4B9NA 3O4NA 2ZJPL 4NYFA 1TKZA 4CF8A 4B9SA 1QVFM 3CC2N 3C6AA 1NGCA 3AA2A 3CF5L 3L8BA 3ZSXA 3LDLA 4FWSA 4PUOA 4KBOA 5KQDA 4Z4EA 4PL8A 2KW4A 5GADP 3F9KA 2X74A 3VN5A 3THVA 5JICA 1C0GA 5AQXA 3OA9A 4AF1A 4CEZA 4HHTA 3CJ9A 4HUFA 3OW2M 3MXIA 1YJNN 1NJWA 4M3XA 3DRRA 2YVCA 4A62A 1VQMN 1K6YA 2FC0A 5BRHA 3QERA 2D0PA 1D4XA 3FZMA 1GLAG 4FM0A 4DR2K 4MLHA 3NDKA 2WBNA 1RT1A 4PKGA 4JHDB 4LF9K 4C1NK 3VOVA 1VQ8N 4EFHA 4JKGA 4DS4A 3BY5A 2HHTA 3CQ8A 2UUBK 3LZJA 1VQ6N 3BGRA 3F2KA 2HHHK 3C7NA 5AQKA 1QVGM 3LDPA 4H0VB 3QNOA 3CCUN 5DMRA 2HHVA 2YJFA 3SUQA 5ADXH 3IRXA 5AZJA 4KH4A 5C42A 5JVHL 1YAGA 4AH9A 3AVNA 5JLFA 2P9KA 4N56A 2J4RA 3HT3A 3DMJA 4IO9L 1KFDA 5EOYA 2YHBA 3AY9A 1IKYA 1NKCA 3KLFA 1BG3A 3D6RA 1YHQN 2P9PA 1QZ5A 1QTMA 4QS7A 5A2QO 4CJRA 4YOWA 3X23A 3KK7A 1X3MA 2E2OA 4XH1A 1IBMK 3O9QA 4JI6K 5AR0A 3VF2A 2GBZA 1T03A 3D2FB 3NF9A 3THXA 3V9WA 4JEPA 4EKUA 3M1FA 2ZJQL 4GVEA 1BQMA 1RTDA 4DU1A 4CBWA 3CXCM 2OA8A 2I1JA 3VF6A 5LY3A 2QK9A 1BA0A 4E89A 3U8XA 2FSNA 3CJ1A 5GAHP 2ZJRL 2HOEA 3H45C 3U9DA 3CC7N 4CZJA 4FZXC 3QIJA 4LF6K 4N41A 4FXDA 1QQCA 5AJ3K 2UYTA 4FLYA 3DYAA 3EKSA 1TYQB 3NE6A 3R1XA 4GV3A 1QQMA 3LDQA 1U49A 3DLRA 4FZZA 4ZHRA 4E1JA 3ZSVA 1YXQA 1U2VB 1FKOA 3SBTA 1RCHA 3SI6A 1HLUA 1Q18A 4B8CA 2YKMA 1S6QA 1BCMA 3CFRA 3ZSOA 4B3SK 2NRRA 3VQ8A 5J2QA 2HNZA 2YHAA 2VYPA 1NKEA 3O4QA 4DTUA 4JI7K 3U6FA 1LOTB 3EKUA 4H5VA 1J19A 3TSPA 3M8QA 4HCCA 4DTXA 4DSFA 4CF9A 2G8FA 3HOTA 3CCVN 1TK0A 4KHWA 4NY0A 2NRZA 1XC3A 4W5RA 2ASPA 1TL3A 3NFAA 4WFAL 4YOXA 3E01A 2ZE2A 3BP8A 3UKRB 3RTVA 3QETA 2VG6A 2PY5A 3L2UA 1N32K 3TARA 4CZGA 3WEEA 3HM9A 3DLLL 4DF4A 4NCAA 2CGJA 2X6NA 4CERA 4CGGA 1DKGD 2KKZA 1VBHA 1TYQA 1B92A 4R5PA 4EP4A 3WA0A 2A41A 4YHHK 1VHXA 2P9SB 4DV0K 1UWBA 3AVGA 3VPZA 3C65A 1E3MA 1QE1A 2AJQA 3DM2A 4M3TA 2P9UA 1NGEA 2E2QA 4JKDA 4FK4A 3TTCA 3VF4A 1X9MA 3QEPA 3ID8A 1NG9A 3OYKA 4K0KK 2QWRA 2ATQA 4W5NA 4RW4A 4FWOA 3WUHA 1KAYA 4JI0K 4JS4A 4OGCA 1T44A 3GBTA 3VMFB 3MWTA 3OYEA 4A61A 2Z1JA 3TAQA 1JXBA 4OPAA 1TAQA 1GLCG 2BTFA 4BR7A 5BRFA 4CGFA 4WFNL 1XNRK 4EAHD 4IWVA 3VEXA 2P9LA 3PIOL 4CJLA 1K73O 1JLQA 4F3OA 3OBYA 4JLHA 4DSEA 3THWA 4M3WA 3FR0A 1S1VA 4JN4A 4C8LA 2F7TA 1TVRA 2D2QA 1Q9YA 3SAHA 2HF4A 4X64K 5C12A 3AU5A 2O8CA 2QWQA 2Z1HA 1J54A 1Y19B 3KKRA 3PSIA 2HHUA 2YV0X 1EETA 3AO4A 2P9SA 5HBMA 3IMXA 3U4LA 4CVNE 1ISNA 4I2QA 1BU6O 2ABDA 3HL8A 3D2EB 5KGXA 4H4OA 4BREA 3VESA 3WQUA 2W42A 3L2QA 4G1QA 1K8KA 3V9XA 1JDEA 5FPNA 2ZGYA 1NGHA 5KRSA 1J9AA 5DM7L 3L2WA 5C10A 1HBKA 5C24A 5HROA 3ZX0A 1DT9A 4AHUA 1HR0K 3C7NB 3O1BA 3LWLA 3TTDA 1YVNA 2X0SA 2O8BB 2YNHA
chains in the Genus database with same CATH topology
2QWLA 5KPTA 3VEZA 4CZHA 3H3NO 4F9OA 5TKYA 5AQIA 5C0YA 3M3ZA 3CMEN 1XQSC 4C1NI 2E88A 2NRHA 3LM2A 5C2FA 1C0FA 3UKRA 2P9KB 3ATUA 4HDOA 3NVMA 2CQUA 5M1NA 1BUPA 4YDUC 1GLBG 4L3QA 3VGLA 4CZIA 2HSTA 1NGAA 2J0KA 3UE5A 1HB8A 2WH5A 2D1KA 4FOEA 2P9NB 2J0MA 3FZHA 3MN9A 5JLHA 2HRJA 1T6DA 1P90A 3GL1A 3CQXA 1ZBSA 4H5TA 1HKCA 1K9MO 1YIJN 3A5MC 4H03B 2Q0UA 4HWIA 3VEVA 3G71N 1GC7A 3ID6A 3O1WA 4OPHA 4BR0A 1E5WA 3I8BA 4BC4A 5LJVA 3VTIA 5AQRA 4JKBA 4GV6A 2GWKA 4JKGB 3CETA 4BQZA 3MCPA 4YOUA 4NLCA 5AQVA 2ZGZA 3T7ZA 2PBDA 1TUUA 1IJJA 4NO7A 2ZF5O 1K8KB 1MK7B 1S22A 1HX1A 4H0PA 3PZDA 4PKIA 3WXMB 3E9LA 2HBLA 5AZIA 3TTFA 4A57A 1NVLA 2BUPA 1Q7YO 1ZXOA 5JVLA 3E1YA 1BWFO 1HUXA 2WFBA 4HTLA 1H4RA 5AQNA 2RE2A 4A5BA 4JKCA 3MWPA 5HL7L 4ZRKA 4YORA 5AQMA 1NMDA 1YI2N 4DCHA 4A59A 4M7YA 4FWKA 3S41A 4F7GA 1JCGA 3O6WA 4H5WA 4KH6A 1YITN 1Z6RA 4B1YB 1U6ZA 1QZ6A 3CCEN 2NRTA 3LL3A 4BRCA 3VETA 4NLBA 2NLXA 5AZIB 4JKAA 4FWQA 2QEXN 3VEYA 2LBBA 3AGKA 3CJAA 4R79A 1E4GT 3WT0A 1TUYA 4PHTX 2V52B 5GIOA 1MK9B 2FF6A 1NJIO 2CB8A 4CYEA 4BROA 5IJMA 2P9IB 2P9IA 1ZC6A 1NGJA 3FZFA 1CZAN 3UKUB 1BOTO 1JCFA 4JHDA 5GINA 2FSKA 3H1VX 3MX5A 4MO5A 1SGHA 4FVUA 3E66A 3EN9A 3EE9A 2R82A 1WUAA 2YCHA 4B9QA 4FPAA 2AL6A 4BY9C 3A5NC 3NVKA 2PAVA 3MDQA 3QMLA 4H0TB 2E2PA 1MA9B 2P9LB 4QS9A 4BRFA 2VCPA 3MX2A 2VGNA 4YL8A 4Y0WA 3U8ZA 1Q82O 1DEJA 5F1XA 2GWJA 2Q0RA 1NGFA 3HM8A 1NI2A 4IXCA 4K25A 4WQ5C 3TSQA 3L0QA 3VEWA 5JVGL 4H0YB 3CCQN 2EMSA 4NB4A 2DIKA 5JMVA 1IG8A 3L4QA 5DM7L 3IVFA 3P38A 4CZFA 2VGMA 4CI6A 4BR2A 2WC9A 4ISEA 5ELZA 2W40A 3DJCA 4AM6A 3MMVA 5CR4A 3K9KA 4DKWA 4CZEA 3WEEB 3BF3A 3FLCO 3G6EN 3LM9A 4FWPA 1VQPN 1Q86O 2NRVA 4M7XA 3A8YA 3SMPA 1VQ5N 4BQLA 5AQSA 4BVPA 2YI1A 5CHIA 1Q81O 1WOQA 2I7NA 3RSEB 3R6MA 3O9RA 4BR5A 4K42A 4C23A 3ZEUB 4GY2B 4WCEL 4RWTA 3M5RA 4O8UA 4H5NA 3J8AA 4BC3A 3H46O 5M1PA 3O4WA 3M6GA 1KD1O 1GLEG 4U67L 5AQOA 3HI0A 2ZJPL 4WYBA 3KWGA 5E84A 3C0BA 2CGLA 2OTLN 1OKJA 3VGKA 3CCSN 1QVFM 3CC2N 2D10A 1NGCA 3C6AA 3CF5L 2CH5A 3H3OB 3K9JA 4BGAA 3ZEUA 3LDLA 4FWSA 1MIXA 4XH5A 3PVLA 5GAEP 2HF3A 1ST7A 2E1YA 4FPBA 4KBOA 3MN5A 3AU4A 5KQDA 3UKUA 4K43A 4PL8A 5BPNA 3HRGA 2AA4A 2GTDA 5GADP 3C6HA 2ITMA 5B8HA 3P39A 1GLJO 4GNIA 4YOYA 3CCJN 3KZBA 3QBXA 5JICA 1C0GA 1RDWX 4IEEA 1QQNA 4HDQA 3A0IX 3MK6A 5KPZA 5AQXA 5KPRA 2QA4N 3OA9A 4AF1A 3O80A 1M1KO 5AQTA 2NRWA 4YDUA 4ILGB 2GX9A 5AQLA 3CJ9A 2Q1NA 1GGOA 3QFPA 4YOTA 1NLVA 3QBWA 5AQQA 3OW2M 1H1VA 3FZKA 4CD3A 1HB6A 4O8KA 4BRGA 3PLAA 5EVZA 4XEIA 5BN8A 3T69A 4RTFD 1YJNN 4BRMA 1HKGA 3Q7CA 2YHXA 3SLCA 3H1QA 2YVCA 2OANA 4DB3A 4A62A 1VQMN 2ASMA 5BREA 2BH1A 5BRHA 2D0PA 1D4XA 4BC5A 3ZX2A 2YX6A 2NZTA 1GLAG 3FZMA 4MLHA 1SS6A 2WBNA 5H1SQ 4PKGA 1VQ9N 4JHDB 4BRPA 2GUPA 4BRQA 3QFUA 1GLDG 2YHWA 4PL7A 4UY8O 4C1NK 3VOVA 4IEIA 1VQ8N 2KLAA 2V51B 1DGKN 3QDKA 3NMUA 4WQ5A 4EFHA 4JKGA 4G9ZA 3AGRA 4CBXA 1U2VA 3MN6A 4CBUA 4ISGA 5EY4A 4MDBA 1V4SA 3TPQA 3CC4N 1VQ6N 4RCHA 2QXLA 3ENOA 3F2KA 4YOVA 3BF1A 4BRDA 3B8AX 3C7NA 2NNWA 2A42A 3ATVA 5AQKA 2A40A 1R59O 2JWLA 1QVGM 3ENHA 3GG4A 3LDPA 2FJ9A 4H0VB 3F9MA 3A5OC 3HOSA 3CCUN 1VQON 1BDGA 3VTHA 3ZX3A 2YJFA 2CH6A 5ADXH 2RQ1A 2Q36A 3O9UA 4U7BA 1KC7A 1OVYA 2F9WA 1QHAA 5AZJA 2QWPA 4P7IA 4KH4A 5AQJA 3AARA 1X9JA 4TKNA 5JVHL 1YJWN 2FF3B 1YAGA 5JLFA 4GXBA 2P9KA 4KH5A 2J4RA 4MDAA 3FFKB 5M1KA 5CE3A 5KQ8A 1ILYA 3U7DA 4IO9L 1RGIA 5EOYA 3U9ZA 4H0XB 2I1KA 2IVPA 3AY9A 2QTDA 4FWMA 1VQ7N 5F0XA 1BG3A 3D6RA 1YHQN 2P9PA 1QZ5A 3UB5A 3E9PA 4QS7A 3VENA 4YOWA 3I56N 2ZJRL 3X23A 2QWOA 5BRDA 1S3XA 2IVOA 2GEMA 3KK7A 1X3MA 5FPMA 2E2OA 4XH1A 3O8MA 4ILHA 3O9QA 5TKWA 3IUCA 5AR0A 4BC2A 4BVOA 4IDHA 3DXKB 3VGMA 3VF2A 5BPMA 3OHRA 2COPA 1NGIA 3D2FB 3FE1A 4IJNA 1GLLO 1ATRA 4ZRIA 4EHUA 3HSCA 4FWRA 4JEPA 4CZLA 3ZETB 4EKUA 4B1WB 3O9TA 3M1FA 2FDQA 2H3GX 2ZJQL 4FWNA 4GVEA 4CBWA 4XH4A 3SK3A 3CXCM 1DIKA 2D4WA 2I1JA 3E9OA 3VF6A 5LY3A 3QB0A 4H5RA 1MIZB 3LDNA 3CJCA 1BA0A 5M1QA 2YJEA 2QWMA 4O5FA 3U8XA 2FSNA 3CJ1A 5GAHP 4CZMA 2HOEA 2WUSA 3W0LA 1KAZA 3WXIA 3H45C 1HJOA 4I6MB 2PFUA 3WXLA 4WFBL 3U9DA 3CCRN 3CC7N 4CZJA 4BRKA 3QIJA 3DXMA 3IFRA 4EHTA 2QWNA 3JXUA 4WQ4C 4CZKA 2UYTA 3EKSA 1TYQB 3G25A 3L6QA 1RFQA 4IZ9A 3R1XA 4QS8A 4GV3A 2V7YA 4JD2A 3SAGA 1QQMA 3CJ7A 1VQLN 3LDQA 1KQSM 3I33A 4E1JA 5C15A 5GIPA 2HBJA 1YXQA 5C10A 3P31A 1K8AO 3CJBA 1U2VB 4A5AA 3SBTA 4A2AA 3O5BA 1HLUA 2Q2RA 1BO5O 2F9TA 1Q18A 3H6EA 4CJ7A 5M1FA 5FPDA 2A3ZA 4IOXA 3HZ6A 1N8RO 1NGBA 3IKMA 1YJ9N 1E4FT 4FL9A 5I9EB 3G9WA 5EXWA 2YHYA 1SZ2A 1Y64A 1KXPA 1RDUA 4IJAA 4MO4A 5AQPA 2NRRA 3LDOA 2P9UB 4BG8A 3OBWA 2QM1A 4BR4A 3DWLA 2VYPA 2HBMA 1S72N 2OTJN 2NRXA 4FOIA 4JK8A 2J0JA 3P4IA 1LOTB 3CCLN 3EKUA 4H5VA 1J19A 4BRHA 5M1OA 3TSPA 4OO1J 3CHWA 4JNEA 4EIAA 4JKHA 3MN7A 3D2FA 3BEXA 3HOTA 1YF5L 3Q7BA 3CCVN 2FLOA 2IVNA 4NY0A 1J6ZA 2NRZA 5AQZA 1XC3A 2W41A 2ASPA 3FZLA 1W2BM 4WFAL 4YOXA 3O08A 1ESVA 3BP8A 3UKRB 3EL2A 2EMTA 4B1UB 3I55N 3CCMN 1NTIA 2I7PA 3CD6N 5AQFA 3KWIA 4CZGA 1MWMA 2A5XA 3WEEA 2HE7A 5AQUA 3DLLL 1KC8O 2CGJA 3DAWA 3EE8A 3CIPA 2ZWHA 3D7EO 1P8ZA 2KKZA 1DKGD 3D2EA 1SQKA 3JS6A 4IOCL 4JKEA 1EF1A 1VBHA 4WF9L 1TYQA 4JAXA 3N4PA 1T3VA 3WA0A 3CPEA 3MCAB 3GDQA 3R3LA 5AFUH 2AEHA 2A41A 1JCEA 2P9SB 2HMPA 3A5LC 2E2NA 3VPZA 3C65A 2P9NA 3SJHA 4M63C 4PKHA 3RSEA 4GV9A 4BR9A 1SAZA 2P9UA 1VQ4N 1MWKA 3ULEA 4DHYA 2D0OA 4JK7A 3R8EA 1NGEA 2E2QA 4JKDA 5BR9A 3TTCA 3VF4A 4AM7A 5HOOA 1ATNA 3F5TA 1NWKA 2EWSA 3ID8A 1VQNN 1VQKN 3ZDTA 5ADXA 4LC9B 3DXKA 3L4IA 2QWRA 2E20A 3GOIA 3CMAN 4FWOA 3WUHA 1Z05A 3ULEB 2V7ZA 1KAYA 4MLEA 5EX5A 4BRAA 3EPYA 2HBKA 2D11A 2E8AA 4K41A 3WXJA 3FGUA 3KHYA 2RHKA 1T44A 3GBTA 3VMFB 5LJWA 3IDHA 4ZRJA 2KHOA 3W3DA 5AQYA 3MWTA 2FXUA 4A61A 2AP1A 3SAFA 3FLVA 2QW9A 4OPAA 2A6AA 2Q97A 1GLCG 2BTFA 4BR7A 4DXAB 3WQTA 5BRFA 4A2BA 1HKBA 2P9PB 3CQYA 3N4QA 3VEOA 4WFNL 4EAHD 4IWVA 2E1ZA 2P9LA 3QICA 3BINA 3VEXA 3PIOL 1K73O 2ZPYA 1T6CA 5E26A 5AQGA 3OBYA 3CPWM 3BUZB 1YUWA 3VERA 5BPLA 3SMSA 4J8FA 3FR0A 4JN4A 3WXKA 1W97L 3AAQA 4IFEA 4BG9A 3SBGA 2F7TA 1EO1A 5DM6L 2D2QA 4BRIA 3O9SA 4B1XB 3SAHA 3AAPA 4H0OA 2HF4A 2GELA 5C2DA 3ZETA 5C12A 5BN9A 3R9PA 3GE1A 3AU5A 1V4TA 2QWQA 3EO3A 1Y19B 1NBWA 1O13A 3RVCA 4IOAL 1GLFO 5AQWA 2JWKA 3KVGA 1VAZA 1GC6A 1GG3A 4JD2B 2IIRA 2P9SA 1QQOA 5AQHA 5F2RA 3G4SN 3J7ZO 4FWLA 5AFUA 3IMXA 3CI5A 3U4LA 1ISNA 4I6MA 1BU6O 2ABDA 5GAGP 4ILJA 3DXMB 1NM1A 3D2EB 4BREA 3VESA 4BGBA 2DPNA 3WQUA 1MDUB 5MLCQ 1K8KA 3PIPL 2CGKA 3TSUA 1JDEA 3ZYYX 5FPEA 1M90O 1ATSA 5FPNA 2ZGYA 4B1ZA 1NGHA 4JK9A 1EQYA 1JJ2M 3TU5A 3HTVA 1VBGA 4CD1A 1KAXA 1KBLA 3ENBA 2FSJA 1X3NA 1LCUA 3CERA 5AZJB 4B1VA 1HBKA 1BA1A 2ASOA 3EZWA 1XUPO 1NGGA 3ZX0A 4BRNA 1DT9A 4BRLA 2Q31A 3HBTA 3C7NB 4IO8A 2VWBA 1NGDA 3O1BA 2QI2A 1ACAA 4ISFA 3TTDA 1YVNA 1G99A 4FSVA 4WQ4A 2X0SA 4FO0A 4JKFA 4DQ8A 4Z94A 1HPMA 3FP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKE A;  3SBT A;  4JKC A;  4JKH A;  3E66 A;  3E9O A;  3SBG A;  3E9P A;  4JKB A;  4JKG B;  4ILH A;  4JKA A;  4JK9 A;  3ENB A;  4JK7 A;  4JKD A;  4JK8 A;  3E9L A;  4ILG B;  4JKG A;  4JKF A;  4ILJ A; 
#chains in the Genus database with same CATH topology
 2QWL A;  2ZD1 A;  3H3N O;  5J2N A;  3M3Z A;  3KTQ A;  2NRH A;  4CK3 A;  2NUB A;  4BWM A;  4CJF A;  5C2F A;  3ATU A;  4CIE A;  4OPJ A;  2CQU A;  3VGL A;  2PZS A;  4OKJ A;  1BI4 B;  3ISN C;  2BDP A;  4CEA A;  4GW6 A;  1SL2 A;  5K14 A;  4FOE A;  1JLG A;  2J0M A;  3FZH A;  4ID5 A;  1P90 A;  3CQX A;  4FLV A;  4CE9 A;  3A5M C;  2Q0U A;  1CLQ A;  3S3M A;  1GC7 A;  3K2P A;  4BC4 A;  2RF2 A;  3LP2 A;  2W6K A;  4FJ9 A;  4YOU A;  3AVK A;  3UIQ A;  1TUU A;  3V4I A;  1F21 A;  1GOA A;  4IFY A;  1K8K B;  4PKI A;  4H0P A;  2HBL A;  2OPQ A;  3THY B;  1EWR A;  5JVL A;  1ASU A;  4FJM A;  3ZT3 A;  3HST B;  4ZRK A;  4YOR A;  3VQB A;  4M7Y A;  4FWK A;  4F7G A;  4B1Y B;  5SWM A;  2NRT A;  5AZI B;  2QEX N;  3CJA A;  4H4M A;  4CF1 A;  3ZSZ A;  4OGE A;  1WBB A;  3OYF A;  1KFS A;  1QHT A;  5J2M A;  5I3U A;  2OYQ A;  1C0M A;  3QNN A;  3SJJ A;  2P9I B;  1ZC6 A;  1CZA N;  1JCF A;  3H1V X;  4GKJ K;  1RT3 A;  2UXC K;  2HW3 A;  1XNQ K;  5CY4 A;  2QXF A;  3DLH A;  4BY9 C;  1OH8 A;  4X62 K;  4CFA A;  1DEJ A;  5F1X A;  1IV0 A;  2GWJ A;  2Q0R A;  1NGF A;  4K25 A;  2HB5 A;  5JVG L;  4IDK A;  4JI1 K;  3CCQ N;  5JMV A;  1N36 K;  3VQD A;  4CEF A;  4CI6 A;  3QEX A;  2RKI A;  2WC9 A;  2W40 A;  3K9K A;  3WEE B;  1WLJ A;  3LM9 A;  4FWP A;  5CZ2 A;  1EX4 A;  4M7X A;  3A8Y A;  2UUA K;  4BDY A;  5CHI A;  4BVP A;  1SKR A;  2JGU A;  4WCE L;  3H46 O;  4Q0B A;  3DRP A;  3HI0 A;  5E84 A;  2OTL N;  4EZ9 A;  3NGZ A;  3VGK A;  3CCS N;  2PYL A;  1I39 A;  4W5T A;  3PUF A;  1MIX A;  4XH5 A;  1VSD A;  2E1Y A;  4FPB A;  3MN5 A;  1HQE A;  3V9U A;  3C95 A;  3V9S A;  1HNZ K;  2AA4 A;  2E5L K;  3D45 A;  1WBD A;  2KFN A;  2ETJ A;  2ITM A;  5T7B A;  4BAC A;  1GLJ O;  2X6S A;  4GNI A;  3LDS A;  2F4V K;  3ZT0 A;  5KPZ A;  1QQN A;  3A0I X;  5FDL A;  3O80 A;  3ZCM A;  4YDU A;  5KGW A;  3K0S A;  2HHX A;  2Q1N A;  3QFP A;  1NLV A;  1H1V A;  1HB6 A;  4O8K A;  4BRG A;  1U48 A;  3K59 A;  5EVZ A;  3T69 A;  3K5N A;  2I5J A;  1U4B A;  1HKG A;  3Q7C A;  2YHX A;  3SLC A;  2OAN A;  3VQC A;  5BRE A;  1XWL A;  3QES A;  2Q3S A;  4KHN A;  2XY7 A;  4DS5 A;  1VQ9 N;  2G8W A;  2JLE A;  1HJR A;  4JI4 K;  1GLD G;  2YHW A;  3F73 A;  4UY8 O;  4KPY A;  3SV4 A;  4IEI A;  4FJK A;  2V51 B;  3C6T A;  4KTW A;  3NMU A;  4WQ5 A;  3PV8 A;  3ZT2 A;  1VRU A;  1U2V A;  5EY4 A;  1V4S A;  3I0S A;  2KTQ A;  4PY5 A;  3M8R A;  3BF1 A;  4BRD A;  1KVA A;  2EX3 A;  2NNW A;  1A5X A;  2HHS A;  3VQP A;  4BDP A;  3GG4 A;  3HOS A;  3ZX3 A;  3OYI A;  2RQ1 A;  2Q36 A;  3O9U A;  1KC7 A;  2B6A A;  4JS5 A;  5KRT A;  4CFD A;  5M1K A;  4CW7 B;  3U7D A;  5CYM A;  1A5W A;  2FBX A;  4H0X B;  2I1K A;  1VQ7 N;  4FWM A;  3UB5 A;  2QWO A;  5BRD A;  4BE2 A;  5FPM A;  3NF6 A;  4JRQ A;  3AA4 A;  3KD1 E;  3O8M A;  2DY4 A;  4FJI A;  4W5Q A;  5CYQ A;  4CGH A;  1T8E A;  3S9H A;  3TAN A;  4CIG A;  2FDQ A;  1EP4 A;  3P83 D;  2A1R A;  4YY3 K;  4XH4 A;  3AVB A;  4KI6 A;  1DIK A;  2D4W A;  3E9O A;  1FXX A;  3QB0 A;  4CJ5 A;  1MIZ B;  3T1Y K;  1NK5 A;  5M1Q A;  2QWM A;  1SV5 A;  1KAZ A;  3WXL A;  3SPZ A;  4I6M B;  4FZY A;  4WFB L;  2O4I A;  3DXM A;  4EHT A;  1RT4 A;  2QWN A;  3JXU A;  4WQ4 C;  1NKB A;  4X66 K;  3G25 A;  4QS8 A;  2P5O A;  1S1U A;  3LP3 A;  3SNN A;  1N5Y A;  2O8B A;  1VQL N;  4AQY K;  3AO5 A;  1KQS M;  3I33 A;  5C15 A;  1K8A O;  2HBJ A;  3LPU A;  3CJB A;  4DR4 K;  3O5B A;  1YT3 A;  4CJU A;  5M1F A;  5FPD A;  2A3Z A;  3KLE A;  4IOX A;  1N8R O;  1NGB A;  3IKM A;  1YJ9 N;  1L3V A;  5HLF A;  1FJG K;  3A2F A;  1E4F T;  4PQU A;  1T05 A;  1N34 K;  2RN2 A;  3QIP A;  4IG3 A;  1RBU A;  2BAN A;  4MO4 A;  1TK5 A;  3LDO A;  2O8D B;  5LMU K;  4OLA A;  3OBW A;  2QM1 A;  3I0R A;  4FM1 A;  3K5O A;  4KRE A;  1JLF A;  4FOI A;  4HUE A;  4KHU A;  3P4I A;  4M45 A;  3NGY A;  3SZ2 A;  4OO1 J;  3CHW A;  3QIN A;  3B6P A;  1YF5 L;  4KFB A;  2FLO A;  3T19 A;  4DSL A;  3G10 A;  1TKD A;  4DTS A;  1DLO A;  1J6Z A;  1BIS A;  3NGI A;  2W41 A;  3FZL A;  3SYZ A;  1W2B M;  4FCY A;  1JL1 A;  1IKV A;  3OYN A;  4RW6 A;  3I55 N;  3CCM N;  1TK8 A;  4DQR A;  5AQF A;  4JI5 K;  1MWM A;  2A5X A;  2HE7 A;  4HTU A;  4DFJ A;  4LF8 K;  4HCB A;  3EE8 A;  2G8V A;  3CIP A;  2ZWH A;  1P8Z A;  4B3T K;  3JS6 A;  4JKE A;  1EF1 A;  2FBT A;  1T3V A;  3GDQ A;  4Y1C A;  5AFU H;  2KQ2 A;  3B6O A;  1SL1 A;  2HMP A;  3A5L C;  1LV5 A;  2E2N A;  4DUY K;  3RSE A;  4GV9 A;  3U3G A;  2BE2 A;  1VQ4 N;  4QAG A;  3R8E A;  4DTJ A;  1WAF A;  3CYM A;  4Z4F A;  3S3N A;  1VQN N;  4DR1 K;  4IKF A;  3HXM A;  3GOI A;  4KHQ A;  4FJL A;  1IBK K;  1RIL A;  5EX5 A;  2HBK A;  4K41 A;  1ZBF A;  2E8A A;  3TAE A;  5CZ1 A;  5LJW A;  3EYZ A;  4DWI A;  4DR6 K;  3IDH A;  4ZRJ A;  3AVF A;  3NH0 A;  1IH7 A;  4KHY A;  2QKB A;  3U3Y A;  2AP1 A;  3SAF A;  3FLV A;  1NJX A;  2A6A A;  4DXA B;  4B9V A;  2E1Z A;  4DF8 A;  5E26 A;  3SQ1 A;  3DOL A;  5BPL A;  3VER A;  3KLI A;  3AAQ A;  3SBG A;  4DTM A;  2DFF A;  1EO1 A;  4BRI A;  3O9S A;  4DQS A;  4H0O A;  5BN9 A;  4J2E A;  1YTA A;  4ELU A;  5LMN K;  3RVC A;  4IOA L;  1U47 A;  3KVG A;  1VAZ A;  4E7K A;  1QQO A;  5F2R A;  2O8F A;  1RTI A;  1CXU A;  4I6M A;  1BQN A;  1VSE A;  1S1W A;  4ILJ A;  3DXM B;  1HYZ A;  1NM1 A;  3RR8 A;  1TV6 A;  1OH6 A;  1MDU B;  4L8R B;  4O44 A;  3HPG A;  3ZYY X;  4AHS A;  3PO4 A;  4JRP A;  4LY7 A;  4RW7 A;  1EQY A;  1IKX A;  1VBG A;  4CD1 A;  1KBL A;  3ENB A;  1ITG A;  3CER A;  2HND A;  4ELV A;  1BA1 A;  4FJ8 A;  2O8E B;  1NGG A;  4BRL A;  3RRG A;  2Q31 A;  4OKE A;  4KHS A;  4IO8 A;  4FYD A;  4DTR A;  5HRR A;  1ACA A;  4CED A;  4ISF A;  2HHW A;  4WQ4 A;  4Z94 A;  4DQ8 A;  3MED A;  4JKF A;  3KKS A;  3VEZ A;  3AVH A;  5TKY A;  2D5R A;  2IAJ A;  3V9Z A;  3CME N;  1XQS C;  1U04 A;  1W0H A;  2E88 A;  2R7Y A;  4X65 K;  1LAW A;  4ZTJ A;  1C0F A;  3UKR A;  4O0I A;  1BIU A;  2YNI A;  4L3Q A;  2B4J A;  4CHZ A;  1NGA A;  2J0K A;  1WB9 A;  3DLB A;  4CEO A;  4PA1 A;  2D1K A;  3NCI A;  3KK1 A;  5IWA K;  2VG5 A;  4F2R A;  1REV A;  4H5T A;  4FLW A;  1HKC A;  1K9M O;  5FRM A;  4BR0 A;  3PX6 A;  3KLH A;  4E7H A;  5IT9 O;  5LJV A;  4CFC A;  5AQR A;  1VK0 A;  3QO9 A;  2G8H A;  4BQZ A;  3MCP A;  5AQV A;  4Q5V A;  3T7Z A;  5HRN A;  2KZM A;  3DLE A;  1IJJ A;  3WNE A;  3NF7 A;  4NO7 A;  1S22 A;  1MK7 B;  1HX1 A;  3AA5 X;  4A57 A;  4J2D A;  2BUP A;  2KZZ A;  1ZXO A;  1BWF O;  2WFB A;  5HL7 L;  2W6L A;  3M8P A;  1UA1 A;  3J7A P;  4DCH A;  1VSL A;  4DLG A;  2WON A;  4CK1 A;  3O6W A;  1QZ6 A;  2Z1G A;  2O8F B;  3VEY A;  3AO2 A;  5BR8 K;  4B8A B;  5GIO A;  1MK9 B;  2FF6 A;  1W7A A;  3EY1 A;  1RT5 A;  4CYE A;  2O4G A;  3UKU B;  4JHD A;  1SGH A;  4FJ7 A;  1C1C A;  4M3U A;  4OLB A;  3E66 A;  3EN9 A;  4FVU A;  3EE9 A;  1WUA A;  2AL6 A;  3THX B;  3A5N C;  3NVK A;  1FW6 A;  2E2P A;  4BRF A;  4QS9 A;  4B9U A;  3MX2 A;  2VGN A;  4YL8 A;  4Y0W A;  4LF5 K;  1XMQ K;  3HVT A;  3MXM A;  3HM8 A;  1NI2 A;  4LSN A;  4H0Y B;  1RT6 A;  4NB4 A;  4LFB K;  1IG8 A;  4Z0U A;  2G8U A;  3IVF A;  4CZF A;  4BR2 A;  4ISE A;  4FLZ A;  4DFP A;  3FLC O;  4YNQ A;  3G6E N;  1VQP N;  1TL1 A;  1VQ5 N;  1L3T A;  5AQS A;  1Q81 O;  3O9R A;  3LAK A;  4GY2 B;  1HPZ A;  3M5R A;  4O8U A;  4H5N A;  3J8A A;  3KLG A;  4BC3 A;  3M6G A;  4U67 L;  3AO3 A;  5AQO A;  3S3O A;  2D0A A;  4WYB A;  2CGL A;  1SL0 A;  3ZT1 A;  1OKJ A;  4KAZ A;  2D10 A;  1WSG A;  3AA3 A;  4KRF A;  3OYM A;  1FKP A;  4CCH A;  3ZEU A;  1KLN A;  1ZYQ A;  3PVL A;  1ST7 A;  3VA0 A;  3UKU A;  4K43 A;  3HRG A;  3OJS A;  3C6H A;  5B8H A;  4CEB A;  4FLU A;  4YOY A;  3CCJ N;  3KZB A;  1SKW A;  1RDW X;  2BGG A;  4IEE A;  2QA4 N;  3MK6 A;  1BHL A;  1M1K O;  5AQT A;  4CHY A;  1C1B A;  4ILG B;  2GX9 A;  3M8S A;  5AQL A;  3AVI A;  1NU0 A;  4YOT A;  5HRP A;  2FBY A;  4O0J A;  1LW0 A;  1OVQ A;  4CD3 A;  4AHV A;  3BZC A;  4BRM A;  4DTP A;  3ULD A;  1ASV A;  2ASM A;  2FBV A;  1RBT A;  3ZX2 A;  2YX6 A;  2NZT A;  4MFB A;  1JLA A;  4BRP A;  3QFU A;  3QEI A;  1J53 A;  2KLA A;  3OY9 A;  1DGK N;  3QDK A;  4CBX A;  3MN6 A;  3L2R A;  4DV7 K;  4RCH A;  4FK2 A;  3VQ9 A;  4QCL A;  4DLE A;  2KFZ A;  2JWL A;  4KB1 A;  4IBN A;  3F9M A;  3A5O C;  1JL2 A;  3OS2 A;  1VQO N;  1BDG A;  3VTH A;  3PX4 A;  2XO7 A;  4U7B A;  2QWP A;  4P7I A;  3AAR A;  1RT2 A;  4TKN A;  3J81 O;  3ZSQ A;  2FF3 B;  2B5J A;  3LAN A;  4KH5 A;  4MDA A;  4CJW A;  5CE3 A;  3SQ2 A;  4OVL A;  1ILY A;  3RMD A;  3WNH A;  1RGI A;  1Y97 A;  3K57 A;  4V19 S;  3U9Z A;  4CES A;  4CF2 A;  2IVP A;  1XMO K;  2QTD A;  3CFP A;  5F0X A;  3VEN A;  3E9P A;  3I56 N;  3HVR A;  2IVO A;  1JXE A;  2GEM A;  3TAM A;  3HPH A;  4CHP A;  1J5E K;  4B3O A;  5TKW A;  4C8N A;  2D0C A;  4BC2 A;  4IDH A;  4QOZ B;  5BPM A;  3EZ5 A;  4OJR A;  1NGI A;  1X9W A;  1KVC A;  3FE1 A;  4IJN A;  4E1M A;  1BGX T;  3HSC A;  3ZET B;  1NK4 A;  4CEE A;  2H3G X;  4EZ6 A;  4TSX A;  3SK3 A;  2LSN A;  4PWD A;  1U45 A;  2EHG A;  2GUI A;  4I2P A;  1SUQ A;  1B9F A;  4H5R A;  4O5F A;  1XI1 A;  2WUS A;  3W0L A;  1HJO A;  5FRO A;  3CCR N;  4FVM A;  4DSK A;  5E41 A;  4CZK A;  1JLE A;  1HYS A;  3AV9 A;  5SZT A;  3PX0 A;  3SAG A;  2ZM6 K;  1IKW A;  4ICL A;  3CFO A;  4BE0 A;  4B3R K;  3AVL A;  3P31 A;  4B9L A;  4A5A A;  4FW1 A;  3ITH A;  2F9T A;  4CJ7 A;  3H6E A;  1D5A A;  3V1O A;  3HZ6 A;  4CHN A;  3OS1 A;  1EKE A;  1BL3 A;  4FL9 A;  4DU3 A;  3G9W A;  5EXW A;  1SZ2 A;  1Y64 A;  1RDU A;  3KIO A;  4IJA A;  4N5S A;  4BG8 A;  4BR4 A;  2OTJ N;  2HBM A;  4E3S A;  4GKK K;  2NRX A;  4JK8 A;  2J0J A;  1UAX A;  3CCL N;  4BRH A;  3V1R A;  4YFU A;  4IFV A;  4EIA A;  3D2F A;  3BEX A;  1TKT A;  1D9D A;  1ZBU A;  1N6Q A;  1KVB A;  4OX9 K;  2P5G A;  2HVI A;  2E6L A;  2VQF K;  2OPS A;  4Y1D A;  1RT7 A;  2UXD K;  4B1U B;  2XRI A;  1L5U A;  3K5L A;  1G15 A;  1KC8 O;  3DAW A;  4WE1 A;  3JAM O;  3D7E O;  3NHG A;  2O8C B;  1NK7 A;  3VQ4 A;  2DTU A;  3R3L A;  2AEH A;  1JCE A;  3OJU A;  1L3S A;  4AHR A;  1YVU A;  2P9N A;  4M63 C;  3WNG A;  5I42 A;  4PKH A;  1RBV A;  1SAZ A;  4NXN K;  3K58 A;  1MWK A;  4DHY A;  2D0O A;  5BR9 A;  1GOB A;  3RMA A;  3V6D A;  4AM7 A;  1ATN A;  1WSI A;  3F5T A;  1NWK A;  4B3M K;  2DFE A;  3ZDT A;  5ADX A;  4LC9 B;  4HVJ A;  3CMA N;  1C0U A;  2UU9 K;  1QSL A;  3NH1 A;  1Z05 A;  2YNG A;  2V7Z A;  1NK6 A;  3EPY A;  2D11 A;  3DRS A;  3FGU A;  3KHY A;  4CGI A;  2DFH A;  1RTH A;  3THW B;  2KHO A;  3W3D A;  5AQY A;  3DLG A;  1L3U A;  4DFM A;  3PSF A;  4XIU A;  4Z4H A;  2QW9 A;  1HNX K;  4BWJ A;  4A2B A;  2P9P B;  3BIN A;  4NYN A;  2ZPY A;  1HNI A;  1T6C A;  3OTO K;  1YUW A;  4DMN A;  2HVH A;  3WXK A;  1NOZ A;  1OH7 A;  4BG9 A;  4DU4 A;  5DM6 L;  4B1X B;  3AAP A;  3FFI A;  1RTJ A;  3MEG A;  3ZET A;  3R9P A;  3GE1 A;  1V4T A;  4B9M A;  3EO3 A;  1RDD A;  1O13 A;  3VQE A;  3O3G A;  5AQH A;  2IIR A;  1KCF A;  5GAG P;  2XHB A;  1ZBI A;  4BGB A;  5MLC Q;  5HP1 A;  3TSU A;  4LH4 A;  1M90 O;  1S9E A;  1ATS A;  1Q8I A;  4B1Z A;  3J7Y P;  4JK9 A;  1JJ2 M;  3TU5 A;  1TAU A;  4DQI A;  1KAX A;  1LCU A;  2FSJ A;  1Q9X A;  3EZW A;  2ASO A;  5J1E A;  3HBT A;  3MEC A;  1G99 A;  1O1W A;  3LZI A;  4FO0 A;  3FP5 A;  5KPT A;  3HP9 A;  4CZH A;  4O4G A;  4F9O A;  4ID1 A;  5AQI A;  1HQU A;  1HMV A;  1RBR A;  2WTU A;  4E0D A;  3VQ6 A;  1RBS A;  2VG7 A;  4HDO A;  1A5V A;  1VSH A;  4LFC K;  1NK8 A;  1FK9 A;  4YDU C;  4C8M A;  4CZI A;  4F2S A;  1S9G A;  3UE5 A;  4CEQ A;  1C6V A;  1ASW A;  2P9N B;  5JLH A;  1T6D A;  3DLK A;  1RDB A;  4H03 B;  3G71 N;  3ID6 A;  4OPH A;  3O1W A;  4JV5 K;  2G8K A;  3I8B A;  3RWU A;  3VTI A;  4JKB A;  2GWK A;  4FJH A;  2IGI A;  3CET A;  3NH2 A;  4DV5 K;  4GMJ B;  2HNY A;  4BE1 A;  3AVJ A;  3OYB A;  2ZF5 O;  1S5J A;  1DTQ A;  1LWC A;  1VSM A;  3WXM B;  1QS4 A;  2XY8 A;  5AZI A;  3VQQ A;  3V81 A;  4RW8 A;  3TR8 A;  4C8O A;  1HUX A;  1H4R A;  5AQN A;  2GV9 A;  4A59 A;  2XY5 A;  3OS0 A;  4H5W A;  4KH6 A;  1U6Z A;  2E4L A;  3V1Q A;  2XY6 A;  1NMN A;  4BRC A;  4CJQ A;  1XC9 A;  2NLX A;  4KI4 A;  3J80 O;  4JKA A;  4FWQ A;  4CFB A;  3AGK A;  4R79 A;  4E19 A;  3THY A;  1E4G T;  1TUY A;  4PHT X;  2V52 B;  4DQP A;  4KHP K;  1NJI O;  4BRO A;  1BOT O;  4E7I A;  4C8K A;  4CJ3 A;  2OPR A;  2FSK A;  4O55 A;  3MX5 A;  3DOK A;  1HNW K;  2A1S A;  4LFA K;  2R82 A;  1WN7 A;  2YCH A;  4FPA A;  1J5O A;  1ZBH A;  2PAV A;  3QML A;  4H0T B;  2F96 A;  5DK5 A;  2P9L B;  1MA9 B;  2E6M A;  2VCP A;  1HRH A;  1Q82 O;  3VQ7 A;  1VSJ A;  4IXC A;  4E1N A;  3TSQ A;  3L0Q A;  4M3Y A;  1QSS A;  4DG1 A;  3SUO A;  4OPK A;  1QSY A;  1UA0 A;  2UUC K;  2EMS A;  2UXB K;  2VGM A;  4FLT A;  4ZTF A;  4NCB A;  5ELZ A;  3QEV A;  3DJC A;  4AM6 A;  3HK2 A;  5LL6 Z;  4IG0 A;  3VQA A;  4FJN A;  3BF3 A;  4DTN A;  1BCO A;  4DV3 K;  1Z26 A;  2WOM A;  2NRV A;  4DQQ A;  3SMP A;  4Z4I A;  4E7L A;  2YI1 A;  1WOQ A;  3HP6 A;  3R6M A;  4C23 A;  4K42 A;  4DV4 K;  2HHQ A;  4FJX A;  3PY8 A;  1BIZ A;  3KWG A;  4ELT A;  3C0B A;  4DUZ K;  2Y1I A;  1NK9 A;  2P51 A;  3T3F A;  1CXQ A;  1C0T A;  4O5B A;  4KB0 A;  2CH5 A;  3H3O B;  2O8D A;  4AHT A;  3K9J A;  4Z4G A;  4BGA A;  1W9H A;  5GAE P;  3ZT4 A;  2HF3 A;  3AU4 A;  5BPN A;  1MU2 A;  2GTD A;  1LW2 A;  4FJJ A;  4JYA K;  3P39 A;  4KTQ A;  4DFK A;  1C1A A;  3QBX A;  4HDQ A;  3ALY A;  5KPR A;  4CGD A;  1DTT A;  5KI6 A;  2NRW A;  3NF8 A;  4AIL C;  1GGO A;  3QBW A;  5AQQ A;  1TKX A;  3OYH A;  3MAQ A;  3FZK A;  4I9L A;  3PLA A;  4XEI A;  5BN8 A;  1T7P A;  4RTF D;  3EEQ A;  1OH5 A;  3H1Q A;  3O3F A;  4DB3 A;  3KJV A;  2BH1 A;  4UQG A;  4LF7 K;  3SUP A;  4BC5 A;  3QIO A;  1SS6 A;  5H1S Q;  3TAP A;  2GUP A;  4BRQ A;  3TI0 A;  1X9S A;  3TAG A;  4PL7 A;  4Z4C A;  2HMI A;  4DV1 K;  3TWH A;  4OKK A;  3WNF A;  4G9Z A;  1GOC A;  3AGR A;  1NOY A;  4DV6 K;  4CBU A;  4ISG A;  3TPQ A;  4MDB A;  3CC4 N;  1N33 K;  1I3A A;  2QXL A;  3ENO A;  4YOV A;  3B8A X;  1I94 K;  3ATV A;  2A42 A;  2A40 A;  1R59 O;  5FLX O;  1RNH A;  1VSI A;  3ENH A;  3VQ5 A;  2FJ9 A;  1XHZ A;  4NCG A;  1LWF A;  2CH6 A;  3OYD A;  4LSL A;  1OVY A;  2D0B A;  1QHA A;  2F9W A;  4KTZ A;  2G8I A;  5AQJ A;  1JKH A;  1X9J A;  4CJK A;  1YJW N;  2OPP A;  4GXB A;  3FFK B;  5KQ8 A;  4F8R A;  2IC3 A;  3IG1 A;  1ZBL A;  4K8Z A;  3CM6 A;  1D8Y A;  4FW2 A;  4DTO A;  3OYJ A;  1S3X A;  1XHX A;  4ILH A;  3IUC A;  4BVO A;  3VGM A;  3DXK B;  3BDP A;  3HPO A;  3OHR A;  2COP A;  1GLL O;  1ATR A;  4ZRI A;  4RW9 A;  4AHC A;  4EHU A;  3I8D A;  4FWR A;  4CZL A;  4FJ5 A;  3MEE A;  4B1W B;  3O9T A;  4M41 A;  4FWN A;  3ZSY A;  4KV8 A;  4DR5 K;  1KTQ A;  3LDN A;  3CJC A;  2YJE A;  4CZM A;  3WXI A;  2PFU A;  3KK3 A;  4BRK A;  1WSJ A;  3IFR A;  3SPY A;  4CJ4 A;  4IZ9 A;  3L6Q A;  1RFQ A;  4JI2 K;  2V7Y A;  2YKN A;  4JD2 A;  3LP1 A;  3CJ7 A;  1VSF A;  1NJY A;  5GIP A;  4GVM A;  3IS9 A;  1WSF A;  3QEW A;  4A2A A;  2Q2R A;  3CG7 A;  1BO5 O;  4NXM K;  3RMC A;  4CGJ A;  4BDZ A;  5I9E B;  2YHY A;  5AQP A;  1KXP A;  3L3V A;  3HO1 A;  2P9U B;  3SCX A;  1S72 N;  1IBL K;  3DWL A;  2F8S A;  1JLB A;  4CJE A;  4FLX A;  3HJF A;  5M1O A;  4B9T A;  4KKO A;  4JNE A;  4JKH A;  3MN7 A;  4LH5 A;  3Q7B A;  1RDA A;  2IVN A;  1YTU A;  5AQZ A;  1LAV A;  3LAM A;  3MXJ A;  3O08 A;  1ESV A;  3EL2 A;  2EMT A;  1NTI A;  3AVA A;  2I7P A;  5HRS A;  3SV3 A;  3CD6 N;  3KWI A;  5AQU A;  4N76 A;  3P5J A;  3OYG A;  3BZK A;  4FM2 A;  4CJS A;  3D2E A;  3ZSW A;  1SQK A;  4FK0 A;  4IOC L;  4CK2 A;  4WF9 L;  2VWK A;  2Y1J A;  4JAX A;  3N4P A;  4N47 A;  3CPE A;  3MCA B;  1B9D A;  1NNE A;  4DSI A;  1VSK A;  1LWE A;  3KK2 A;  3TAB A;  2P1J A;  1JLC A;  2RPI A;  3ZSR A;  3SJH A;  4BR9 A;  3RRH A;  3ULE A;  4JK7 A;  4DSJ A;  4W5O A;  5HOO A;  2EWS A;  1IO2 A;  4M3R A;  3D0P A;  3OYL A;  1VQK N;  3DXK A;  3L4I A;  2E20 A;  4LD0 A;  3ULE B;  4MLE A;  4BRA A;  5FRN A;  3WXJ A;  2RHK A;  4I9Q A;  3JSM A;  4CHO A;  2FXU A;  1EWQ A;  3AVM A;  4KO0 A;  2Q97 A;  3KD5 E;  3WQT A;  4FJG A;  1HKB A;  3VEO A;  3CQY A;  3N4Q A;  2OCE A;  1X1P A;  3QIC A;  3AO1 A;  5AQG A;  3CPW M;  3BUZ B;  3SMS A;  4J8F A;  4CHQ A;  1W97 L;  2ITG A;  4IFE A;  3NBP A;  2VWJ A;  3CM5 A;  5C2D A;  2GEL A;  5EU7 A;  5JS2 A;  4LF4 K;  1EXQ A;  1IG9 A;  1NBW A;  1GLF O;  3H08 A;  4F3T A;  5AQW A;  2JWK A;  4J2B A;  1GC6 A;  1GG3 A;  4JD2 B;  1D9F A;  3G4S N;  3J7Z O;  3O3H A;  2PYJ A;  4FWL A;  5AFU A;  3CI5 A;  1S1T A;  2IOC A;  3JYT A;  1HYV A;  1WAJ A;  2ZQB A;  5KTQ A;  4I7F A;  2DPN A;  3OYC A;  3PIP L;  2CGK A;  1S6P A;  5FPE A;  4M3Z A;  1RDC A;  3HTV A;  2QKK A;  5D3G A;  1X3N A;  5AZJ B;  4B1V A;  1XUP O;  4BRN A;  3P1G A;  2VWB A;  1NGD A;  2QI2 A;  4FSV A;  1KSP A;  1CZ9 A;  2OZM A;  1HPM A;  4CJT A;  4JI8 K;  5C0Y A;  2IS3 A;  4C1N I;  2O8E A;  3C6U A;  4CJV A;  3LM2 A;  4CEC A;  3K5M A;  2P9K B;  1UOC A;  3SQ4 A;  3NVM A;  5M1N A;  1BUP A;  1GLB G;  2HST A;  1HB8 A;  2WH5 A;  1CZB A;  1WSH A;  3MN9 A;  5C25 A;  2HRJ A;  3C94 A;  3GL1 A;  1NJZ A;  2OZS A;  1ZBS A;  3L2V A;  1YIJ N;  4HWI A;  3VEV A;  4F4K A;  4K8X A;  2IDO A;  1E5W A;  4DV2 K;  4GV6 A;  3VA3 A;  3DI6 A;  4JKG B;  3RR7 A;  4JI3 K;  3ASM A;  3SQ0 A;  4NLC A;  2ZGZ A;  1KRP A;  3T1A A;  2PBD A;  2YNF A;  4EP5 A;  3PZD A;  3ZLJ A;  3E9L A;  3TTF A;  1NVL A;  1Q7Y O;  1WSE A;  2Z1I A;  3E1Y A;  4HTL A;  2RE2 A;  4A5B A;  4JKC A;  3MWP A;  5AQM A;  1NMD A;  1YI2 N;  3S41 A;  2F8T A;  4DR3 K;  1JCG A;  3OYA A;  1YIT N;  1Z6R A;  3CCE N;  3LL3 A;  3VET A;  4NLB A;  4HUG A;  2LBB A;  4DR7 K;  3WT0 A;  3LWM A;  1SKS A;  5J2P A;  2CB8 A;  5IJM A;  3RMB A;  2P9I A;  1NGJ A;  3FZF A;  3TAF A;  5GIN A;  4MO5 A;  4CIF A;  1S1X A;  4CF0 A;  3QLH A;  4B9Q A;  2X78 A;  3MDQ A;  3L3U A;  3IAY A;  3HYF A;  3U8Z A;  1WNS A;  1R0A A;  1Z25 A;  4WQ5 C;  1BI4 A;  3VEW A;  4J2A A;  3OVN A;  4E7J A;  3PO5 A;  4B08 A;  3SUN A;  4M42 A;  4MQ3 A;  4CJP A;  2DIK A;  5JS1 A;  3L4Q A;  1KLM A;  3P38 A;  3G0Z A;  4H8K A;  2VQE K;  3MMV A;  4RG8 A;  5CR4 A;  4DKW A;  4CZE A;  3LAL A;  1VRT A;  3NAE A;  3T1H K;  1Q86 O;  1HNV A;  4BQL A;  1TGO A;  2I7N A;  3RSE B;  4BR5 A;  3LPT A;  3LP0 A;  3ZEU B;  4RWT A;  5M1P A;  3O4W A;  1NK0 A;  3AVC A;  1GLE G;  1KD1 O;  4B9N A;  3O4N A;  2ZJP L;  4NYF A;  1TKZ A;  4CF8 A;  4B9S A;  1QVF M;  3CC2 N;  3C6A A;  1NGC A;  3AA2 A;  3CF5 L;  3L8B A;  3ZSX A;  3LDL A;  4FWS A;  4PUO A;  4KBO A;  5KQD A;  4Z4E A;  4PL8 A;  2KW4 A;  5GAD P;  3F9K A;  2X74 A;  3VN5 A;  3THV A;  5JIC A;  1C0G A;  5AQX A;  3OA9 A;  4AF1 A;  4CEZ A;  4HHT A;  3CJ9 A;  4HUF A;  3OW2 M;  3MXI A;  1YJN N;  1NJW A;  4M3X A;  3DRR A;  2YVC A;  4A62 A;  1VQM N;  1K6Y A;  2FC0 A;  5BRH A;  3QER A;  2D0P A;  1D4X A;  3FZM A;  1GLA G;  4FM0 A;  4DR2 K;  4MLH A;  3NDK A;  2WBN A;  1RT1 A;  4PKG A;  4JHD B;  4LF9 K;  4C1N K;  3VOV A;  1VQ8 N;  4EFH A;  4JKG A;  4DS4 A;  3BY5 A;  2HHT A;  3CQ8 A;  2UUB K;  3LZJ A;  1VQ6 N;  3BGR A;  3F2K A;  2HHH K;  3C7N A;  5AQK A;  1QVG M;  3LDP A;  4H0V B;  3QNO A;  3CCU N;  5DMR A;  2HHV A;  2YJF A;  3SUQ A;  5ADX H;  3IRX A;  5AZJ A;  4KH4 A;  5C42 A;  5JVH L;  1YAG A;  4AH9 A;  3AVN A;  5JLF A;  2P9K A;  4N56 A;  2J4R A;  3HT3 A;  3DMJ A;  4IO9 L;  1KFD A;  5EOY A;  2YHB A;  3AY9 A;  1IKY A;  1NKC A;  3KLF A;  1BG3 A;  3D6R A;  1YHQ N;  2P9P A;  1QZ5 A;  1QTM A;  4QS7 A;  5A2Q O;  4CJR A;  4YOW A;  3X23 A;  3KK7 A;  1X3M A;  2E2O A;  4XH1 A;  1IBM K;  3O9Q A;  4JI6 K;  5AR0 A;  3VF2 A;  2GBZ A;  1T03 A;  3D2F B;  3NF9 A;  3THX A;  3V9W A;  4JEP A;  4EKU A;  3M1F A;  2ZJQ L;  4GVE A;  1BQM A;  1RTD A;  4DU1 A;  4CBW A;  3CXC M;  2OA8 A;  2I1J A;  3VF6 A;  5LY3 A;  2QK9 A;  1BA0 A;  4E89 A;  3U8X A;  2FSN A;  3CJ1 A;  5GAH P;  2ZJR L;  2HOE A;  3H45 C;  3U9D A;  3CC7 N;  4CZJ A;  4FZX C;  3QIJ A;  4LF6 K;  4N41 A;  4FXD A;  1QQC A;  5AJ3 K;  2UYT A;  4FLY A;  3DYA A;  3EKS A;  1TYQ B;  3NE6 A;  3R1X A;  4GV3 A;  1QQM A;  3LDQ A;  1U49 A;  3DLR A;  4FZZ A;  4ZHR A;  4E1J A;  3ZSV A;  1YXQ A;  1U2V B;  1FKO A;  3SBT A;  1RCH A;  3SI6 A;  1HLU A;  1Q18 A;  4B8C A;  2YKM A;  1S6Q A;  1BCM A;  3CFR A;  3ZSO A;  4B3S K;  2NRR A;  3VQ8 A;  5J2Q A;  2HNZ A;  2YHA A;  2VYP A;  1NKE A;  3O4Q A;  4DTU A;  4JI7 K;  3U6F A;  1LOT B;  3EKU A;  4H5V A;  1J19 A;  3TSP A;  3M8Q A;  4HCC A;  4DTX A;  4DSF A;  4CF9 A;  2G8F A;  3HOT A;  3CCV N;  1TK0 A;  4KHW A;  4NY0 A;  2NRZ A;  1XC3 A;  4W5R A;  2ASP A;  1TL3 A;  3NFA A;  4WFA L;  4YOX A;  3E01 A;  2ZE2 A;  3BP8 A;  3UKR B;  3RTV A;  3QET A;  2VG6 A;  2PY5 A;  3L2U A;  1N32 K;  3TAR A;  4CZG A;  3WEE A;  3HM9 A;  3DLL L;  4DF4 A;  4NCA A;  2CGJ A;  2X6N A;  4CER A;  4CGG A;  1DKG D;  2KKZ A;  1VBH A;  1TYQ A;  1B92 A;  4R5P A;  4EP4 A;  3WA0 A;  2A41 A;  4YHH K;  1VHX A;  2P9S B;  4DV0 K;  1UWB A;  3AVG A;  3VPZ A;  3C65 A;  1E3M A;  1QE1 A;  2AJQ A;  3DM2 A;  4M3T A;  2P9U A;  1NGE A;  2E2Q A;  4JKD A;  4FK4 A;  3TTC A;  3VF4 A;  1X9M A;  3QEP A;  3ID8 A;  1NG9 A;  3OYK A;  4K0K K;  2QWR A;  2ATQ A;  4W5N A;  4RW4 A;  4FWO A;  3WUH A;  1KAY A;  4JI0 K;  4JS4 A;  4OGC A;  1T44 A;  3GBT A;  3VMF B;  3MWT A;  3OYE A;  4A61 A;  2Z1J A;  3TAQ A;  1JXB A;  4OPA A;  1TAQ A;  1GLC G;  2BTF A;  4BR7 A;  5BRF A;  4CGF A;  4WFN L;  1XNR K;  4EAH D;  4IWV A;  3VEX A;  2P9L A;  3PIO L;  4CJL A;  1K73 O;  1JLQ A;  4F3O A;  3OBY A;  4JLH A;  4DSE A;  3THW A;  4M3W A;  3FR0 A;  1S1V A;  4JN4 A;  4C8L A;  2F7T A;  1TVR A;  2D2Q A;  1Q9Y A;  3SAH A;  2HF4 A;  4X64 K;  5C12 A;  3AU5 A;  2O8C A;  2QWQ A;  2Z1H A;  1J54 A;  1Y19 B;  3KKR A;  3PSI A;  2HHU A;  2YV0 X;  1EET A;  3AO4 A;  2P9S A;  5HBM A;  3IMX A;  3U4L A;  4CVN E;  1ISN A;  4I2Q A;  1BU6 O;  2ABD A;  3HL8 A;  3D2E B;  5KGX A;  4H4O A;  4BRE A;  3VES A;  3WQU A;  2W42 A;  3L2Q A;  4G1Q A;  1K8K A;  3V9X A;  1JDE A;  5FPN A;  2ZGY A;  1NGH A;  5KRS A;  1J9A A;  5DM7 L;  3L2W A;  5C10 A;  1HBK A;  5C24 A;  5HRO A;  3ZX0 A;  1DT9 A;  4AHU A;  1HR0 K;  3C7N B;  3O1B A;  3LWL A;  3TTD A;  1YVN A;  2X0S A;  2O8B B;  2YNH A; 
#chains in the Genus database with same CATH homology
 2QWL A;  5KPT A;  3VEZ A;  4CZH A;  3H3N O;  4F9O A;  5TKY A;  5AQI A;  5C0Y A;  3M3Z A;  3CME N;  1XQS C;  4C1N I;  2E88 A;  2NRH A;  3LM2 A;  5C2F A;  1C0F A;  3UKR A;  2P9K B;  3ATU A;  4HDO A;  3NVM A;  2CQU A;  5M1N A;  1BUP A;  4YDU C;  1GLB G;  4L3Q A;  3VGL A;  4CZI A;  2HST A;  1NGA A;  2J0K A;  3UE5 A;  1HB8 A;  2WH5 A;  2D1K A;  4FOE A;  2P9N B;  2J0M A;  3FZH A;  3MN9 A;  5JLH A;  2HRJ A;  1T6D A;  1P90 A;  3GL1 A;  3CQX A;  1ZBS A;  4H5T A;  1HKC A;  1K9M O;  1YIJ N;  3A5M C;  4H03 B;  2Q0U A;  4HWI A;  3VEV A;  3G71 N;  1GC7 A;  3ID6 A;  3O1W A;  4OPH A;  4BR0 A;  1E5W A;  3I8B A;  4BC4 A;  5LJV A;  3VTI A;  5AQR A;  4JKB A;  4GV6 A;  2GWK A;  4JKG B;  3CET A;  4BQZ A;  3MCP A;  4YOU A;  4NLC A;  5AQV A;  2ZGZ A;  3T7Z A;  2PBD A;  1TUU A;  1IJJ A;  4NO7 A;  2ZF5 O;  1K8K B;  1MK7 B;  1S22 A;  1HX1 A;  4H0P A;  3PZD A;  4PKI A;  3WXM B;  3E9L A;  2HBL A;  5AZI A;  3TTF A;  4A57 A;  1NVL A;  2BUP A;  1Q7Y O;  1ZXO A;  5JVL A;  3E1Y A;  1BWF O;  1HUX A;  2WFB A;  4HTL A;  1H4R A;  5AQN A;  2RE2 A;  4A5B A;  4JKC A;  3MWP A;  5HL7 L;  4ZRK A;  4YOR A;  5AQM A;  1NMD A;  1YI2 N;  4DCH A;  4A59 A;  4M7Y A;  4FWK A;  3S41 A;  4F7G A;  1JCG A;  3O6W A;  4H5W A;  4KH6 A;  1YIT N;  1Z6R A;  4B1Y B;  1U6Z A;  1QZ6 A;  3CCE N;  2NRT A;  3LL3 A;  4BRC A;  3VET A;  4NLB A;  2NLX A;  5AZI B;  4JKA A;  4FWQ A;  2QEX N;  3VEY A;  2LBB A;  3AGK A;  3CJA A;  4R79 A;  1E4G T;  3WT0 A;  1TUY A;  4PHT X;  2V52 B;  5GIO A;  1MK9 B;  2FF6 A;  1NJI O;  2CB8 A;  4CYE A;  4BRO A;  5IJM A;  2P9I B;  2P9I A;  1ZC6 A;  1NGJ A;  3FZF A;  1CZA N;  3UKU B;  1BOT O;  1JCF A;  4JHD A;  5GIN A;  2FSK A;  3H1V X;  3MX5 A;  4MO5 A;  1SGH A;  4FVU A;  3E66 A;  3EN9 A;  3EE9 A;  2R82 A;  1WUA A;  2YCH A;  4B9Q A;  4FPA A;  2AL6 A;  4BY9 C;  3A5N C;  3NVK A;  2PAV A;  3MDQ A;  3QML A;  4H0T B;  2E2P A;  1MA9 B;  2P9L B;  4QS9 A;  4BRF A;  2VCP A;  3MX2 A;  2VGN A;  4YL8 A;  4Y0W A;  3U8Z A;  1Q82 O;  1DEJ A;  5F1X A;  2GWJ A;  2Q0R A;  1NGF A;  3HM8 A;  1NI2 A;  4IXC A;  4K25 A;  4WQ5 C;  3TSQ A;  3L0Q A;  3VEW A;  5JVG L;  4H0Y B;  3CCQ N;  2EMS A;  4NB4 A;  2DIK A;  5JMV A;  1IG8 A;  3L4Q A;  5DM7 L;  3IVF A;  3P38 A;  4CZF A;  2VGM A;  4CI6 A;  4BR2 A;  2WC9 A;  4ISE A;  5ELZ A;  2W40 A;  3DJC A;  4AM6 A;  3MMV A;  5CR4 A;  3K9K A;  4DKW A;  4CZE A;  3WEE B;  3BF3 A;  3FLC O;  3G6E N;  3LM9 A;  4FWP A;  1VQP N;  1Q86 O;  2NRV A;  4M7X A;  3A8Y A;  3SMP A;  1VQ5 N;  4BQL A;  5AQS A;  4BVP A;  2YI1 A;  5CHI A;  1Q81 O;  1WOQ A;  2I7N A;  3RSE B;  3R6M A;  3O9R A;  4BR5 A;  4K42 A;  4C23 A;  3ZEU B;  4GY2 B;  4WCE L;  4RWT A;  3M5R A;  4O8U A;  4H5N A;  3J8A A;  4BC3 A;  3H46 O;  5M1P A;  3O4W A;  3M6G A;  1KD1 O;  1GLE G;  4U67 L;  5AQO A;  3HI0 A;  2ZJP L;  4WYB A;  3KWG A;  5E84 A;  3C0B A;  2CGL A;  2OTL N;  1OKJ A;  3VGK A;  3CCS N;  1QVF M;  3CC2 N;  2D10 A;  1NGC A;  3C6A A;  3CF5 L;  2CH5 A;  3H3O B;  3K9J A;  4BGA A;  3ZEU A;  3LDL A;  4FWS A;  1MIX A;  4XH5 A;  3PVL A;  5GAE P;  2HF3 A;  1ST7 A;  2E1Y A;  4FPB A;  4KBO A;  3MN5 A;  3AU4 A;  5KQD A;  3UKU A;  4K43 A;  4PL8 A;  5BPN A;  3HRG A;  2AA4 A;  2GTD A;  5GAD P;  3C6H A;  2ITM A;  5B8H A;  3P39 A;  1GLJ O;  4GNI A;  4YOY A;  3CCJ N;  3KZB A;  3QBX A;  5JIC A;  1C0G A;  1RDW X;  4IEE A;  1QQN A;  4HDQ A;  3A0I X;  3MK6 A;  5KPZ A;  5AQX A;  5KPR A;  2QA4 N;  3OA9 A;  4AF1 A;  3O80 A;  1M1K O;  5AQT A;  2NRW A;  4YDU A;  4ILG B;  2GX9 A;  5AQL A;  3CJ9 A;  2Q1N A;  1GGO A;  3QFP A;  4YOT A;  1NLV A;  3QBW A;  5AQQ A;  3OW2 M;  1H1V A;  3FZK A;  4CD3 A;  1HB6 A;  4O8K A;  4BRG A;  3PLA A;  5EVZ A;  4XEI A;  5BN8 A;  3T69 A;  4RTF D;  1YJN N;  4BRM A;  1HKG A;  3Q7C A;  2YHX A;  3SLC A;  3H1Q A;  2YVC A;  2OAN A;  4DB3 A;  4A62 A;  1VQM N;  2ASM A;  5BRE A;  2BH1 A;  5BRH A;  2D0P A;  1D4X A;  4BC5 A;  3ZX2 A;  2YX6 A;  2NZT A;  1GLA G;  3FZM A;  4MLH A;  1SS6 A;  2WBN A;  5H1S Q;  4PKG A;  1VQ9 N;  4JHD B;  4BRP A;  2GUP A;  4BRQ A;  3QFU A;  1GLD G;  2YHW A;  4PL7 A;  4UY8 O;  4C1N K;  3VOV A;  4IEI A;  1VQ8 N;  2KLA A;  2V51 B;  1DGK N;  3QDK A;  3NMU A;  4WQ5 A;  4EFH A;  4JKG A;  4G9Z A;  3AGR A;  4CBX A;  1U2V A;  3MN6 A;  4CBU A;  4ISG A;  5EY4 A;  4MDB A;  1V4S A;  3TPQ A;  3CC4 N;  1VQ6 N;  4RCH A;  2QXL A;  3ENO A;  3F2K A;  4YOV A;  3BF1 A;  4BRD A;  3B8A X;  3C7N A;  2NNW A;  2A42 A;  3ATV A;  5AQK A;  2A40 A;  1R59 O;  2JWL A;  1QVG M;  3ENH A;  3GG4 A;  3LDP A;  2FJ9 A;  4H0V B;  3F9M A;  3A5O C;  3HOS A;  3CCU N;  1VQO N;  1BDG A;  3VTH A;  3ZX3 A;  2YJF A;  2CH6 A;  5ADX H;  2RQ1 A;  2Q36 A;  3O9U A;  4U7B A;  1KC7 A;  1OVY A;  2F9W A;  1QHA A;  5AZJ A;  2QWP A;  4P7I A;  4KH4 A;  5AQJ A;  3AAR A;  1X9J A;  4TKN A;  5JVH L;  1YJW N;  2FF3 B;  1YAG A;  5JLF A;  4GXB A;  2P9K A;  4KH5 A;  2J4R A;  4MDA A;  3FFK B;  5M1K A;  5CE3 A;  5KQ8 A;  1ILY A;  3U7D A;  4IO9 L;  1RGI A;  5EOY A;  3U9Z A;  4H0X B;  2I1K A;  2IVP A;  3AY9 A;  2QTD A;  4FWM A;  1VQ7 N;  5F0X A;  1BG3 A;  3D6R A;  1YHQ N;  2P9P A;  1QZ5 A;  3UB5 A;  3E9P A;  4QS7 A;  3VEN A;  4YOW A;  3I56 N;  2ZJR L;  3X23 A;  2QWO A;  5BRD A;  1S3X A;  2IVO A;  2GEM A;  3KK7 A;  1X3M A;  5FPM A;  2E2O A;  4XH1 A;  3O8M A;  4ILH A;  3O9Q A;  5TKW A;  3IUC A;  5AR0 A;  4BC2 A;  4BVO A;  4IDH A;  3DXK B;  3VGM A;  3VF2 A;  5BPM A;  3OHR A;  2COP A;  1NGI A;  3D2F B;  3FE1 A;  4IJN A;  1GLL O;  1ATR A;  4ZRI A;  4EHU A;  3HSC A;  4FWR A;  4JEP A;  4CZL A;  3ZET B;  4EKU A;  4B1W B;  3O9T A;  3M1F A;  2FDQ A;  2H3G X;  2ZJQ L;  4FWN A;  4GVE A;  4CBW A;  4XH4 A;  3SK3 A;  3CXC M;  1DIK A;  2D4W A;  2I1J A;  3E9O A;  3VF6 A;  5LY3 A;  3QB0 A;  4H5R A;  1MIZ B;  3LDN A;  3CJC A;  1BA0 A;  5M1Q A;  2YJE A;  2QWM A;  4O5F A;  3U8X A;  2FSN A;  3CJ1 A;  5GAH P;  4CZM A;  2HOE A;  2WUS A;  3W0L A;  1KAZ A;  3WXI A;  3H45 C;  1HJO A;  4I6M B;  2PFU A;  3WXL A;  4WFB L;  3U9D A;  3CCR N;  3CC7 N;  4CZJ A;  4BRK A;  3QIJ A;  3DXM A;  3IFR A;  4EHT A;  2QWN A;  3JXU A;  4WQ4 C;  4CZK A;  2UYT A;  3EKS A;  1TYQ B;  3G25 A;  3L6Q A;  1RFQ A;  4IZ9 A;  3R1X A;  4QS8 A;  4GV3 A;  2V7Y A;  4JD2 A;  3SAG A;  1QQM A;  3CJ7 A;  1VQL N;  3LDQ A;  1KQS M;  3I33 A;  4E1J A;  5C15 A;  5GIP A;  2HBJ A;  1YXQ A;  5C10 A;  3P31 A;  1K8A O;  3CJB A;  1U2V B;  4A5A A;  3SBT A;  4A2A A;  3O5B A;  1HLU A;  2Q2R A;  1BO5 O;  2F9T A;  1Q18 A;  3H6E A;  4CJ7 A;  5M1F A;  5FPD A;  2A3Z A;  4IOX A;  3HZ6 A;  1N8R O;  1NGB A;  3IKM A;  1YJ9 N;  1E4F T;  4FL9 A;  5I9E B;  3G9W A;  5EXW A;  2YHY A;  1SZ2 A;  1Y64 A;  1KXP A;  1RDU A;  4IJA A;  4MO4 A;  5AQP A;  2NRR A;  3LDO A;  2P9U B;  4BG8 A;  3OBW A;  2QM1 A;  4BR4 A;  3DWL A;  2VYP A;  2HBM A;  1S72 N;  2OTJ N;  2NRX A;  4FOI A;  4JK8 A;  2J0J A;  3P4I A;  1LOT B;  3CCL N;  3EKU A;  4H5V A;  1J19 A;  4BRH A;  5M1O A;  3TSP A;  4OO1 J;  3CHW A;  4JNE A;  4EIA A;  4JKH A;  3MN7 A;  3D2F A;  3BEX A;  3HOT A;  1YF5 L;  3Q7B A;  3CCV N;  2FLO A;  2IVN A;  4NY0 A;  1J6Z A;  2NRZ A;  5AQZ A;  1XC3 A;  2W41 A;  2ASP A;  3FZL A;  1W2B M;  4WFA L;  4YOX A;  3O08 A;  1ESV A;  3BP8 A;  3UKR B;  3EL2 A;  2EMT A;  4B1U B;  3I55 N;  3CCM N;  1NTI A;  2I7P A;  3CD6 N;  5AQF A;  3KWI A;  4CZG A;  1MWM A;  2A5X A;  3WEE A;  2HE7 A;  5AQU A;  3DLL L;  1KC8 O;  2CGJ A;  3DAW A;  3EE8 A;  3CIP A;  2ZWH A;  3D7E O;  1P8Z A;  2KKZ A;  1DKG D;  3D2E A;  1SQK A;  3JS6 A;  4IOC L;  4JKE A;  1EF1 A;  1VBH A;  4WF9 L;  1TYQ A;  4JAX A;  3N4P A;  1T3V A;  3WA0 A;  3CPE A;  3MCA B;  3GDQ A;  3R3L A;  5AFU H;  2AEH A;  2A41 A;  1JCE A;  2P9S B;  2HMP A;  3A5L C;  2E2N A;  3VPZ A;  3C65 A;  2P9N A;  3SJH A;  4M63 C;  4PKH A;  3RSE A;  4GV9 A;  4BR9 A;  1SAZ A;  2P9U A;  1VQ4 N;  1MWK A;  3ULE A;  4DHY A;  2D0O A;  4JK7 A;  3R8E A;  1NGE A;  2E2Q A;  4JKD A;  5BR9 A;  3TTC A;  3VF4 A;  4AM7 A;  5HOO A;  1ATN A;  3F5T A;  1NWK A;  2EWS A;  3ID8 A;  1VQN N;  1VQK N;  3ZDT A;  5ADX A;  4LC9 B;  3DXK A;  3L4I A;  2QWR A;  2E20 A;  3GOI A;  3CMA N;  4FWO A;  3WUH A;  1Z05 A;  3ULE B;  2V7Z A;  1KAY A;  4MLE A;  5EX5 A;  4BRA A;  3EPY A;  2HBK A;  2D11 A;  2E8A A;  4K41 A;  3WXJ A;  3FGU A;  3KHY A;  2RHK A;  1T44 A;  3GBT A;  3VMF B;  5LJW A;  3IDH A;  4ZRJ A;  2KHO A;  3W3D A;  5AQY A;  3MWT A;  2FXU A;  4A61 A;  2AP1 A;  3SAF A;  3FLV A;  2QW9 A;  4OPA A;  2A6A A;  2Q97 A;  1GLC G;  2BTF A;  4BR7 A;  4DXA B;  3WQT A;  5BRF A;  4A2B A;  1HKB A;  2P9P B;  3CQY A;  3N4Q A;  3VEO A;  4WFN L;  4EAH D;  4IWV A;  2E1Z A;  2P9L A;  3QIC A;  3BIN A;  3VEX A;  3PIO L;  1K73 O;  2ZPY A;  1T6C A;  5E26 A;  5AQG A;  3OBY A;  3CPW M;  3BUZ B;  1YUW A;  3VER A;  5BPL A;  3SMS A;  4J8F A;  3FR0 A;  4JN4 A;  3WXK A;  1W97 L;  3AAQ A;  4IFE A;  4BG9 A;  3SBG A;  2F7T A;  1EO1 A;  5DM6 L;  2D2Q A;  4BRI A;  3O9S A;  4B1X B;  3SAH A;  3AAP A;  4H0O A;  2HF4 A;  2GEL A;  5C2D A;  3ZET A;  5C12 A;  5BN9 A;  3R9P A;  3GE1 A;  3AU5 A;  1V4T A;  2QWQ A;  3EO3 A;  1Y19 B;  1NBW A;  1O13 A;  3RVC A;  4IOA L;  1GLF O;  5AQW A;  2JWK A;  3KVG A;  1VAZ A;  1GC6 A;  1GG3 A;  4JD2 B;  2IIR A;  2P9S A;  1QQO A;  5AQH A;  5F2R A;  3G4S N;  3J7Z O;  4FWL A;  5AFU A;  3IMX A;  3CI5 A;  3U4L A;  1ISN A;  4I6M A;  1BU6 O;  2ABD A;  5GAG P;  4ILJ A;  3DXM B;  1NM1 A;  3D2E B;  4BRE A;  3VES A;  4BGB A;  2DPN A;  3WQU A;  1MDU B;  5MLC Q;  1K8K A;  3PIP L;  2CGK A;  3TSU A;  1JDE A;  3ZYY X;  5FPE A;  1M90 O;  1ATS A;  5FPN A;  2ZGY A;  4B1Z A;  1NGH A;  4JK9 A;  1EQY A;  1JJ2 M;  3TU5 A;  3HTV A;  1VBG A;  4CD1 A;  1KAX A;  1KBL A;  3ENB A;  2FSJ A;  1X3N A;  1LCU A;  3CER A;  5AZJ B;  4B1V A;  1HBK A;  1BA1 A;  2ASO A;  3EZW A;  1XUP O;  1NGG A;  3ZX0 A;  4BRN A;  1DT9 A;  4BRL A;  2Q31 A;  3HBT A;  3C7N B;  4IO8 A;  2VWB A;  1NGD A;  3O1B A;  2QI2 A;  1ACA A;  4ISF A;  3TTD A;  1YVN A;  1G99 A;  4FSV A;  4WQ4 A;  2X0S A;  4FO0 A;  4JKF A;  4DQ8 A;  4Z94 A;  1HPM A;  3FP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...