4JKEA

Open and closed forms of t1789p human prp8 rnase h-like domain with bound mg ion
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
219
Chain Sequence
b'LFSQIIWFVDDTNVYRVPIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 68
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkeA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkeA01
4ILGB 3ENBA 4JK7A 4JK9A 4ILJA 4JKGA 4JKBA 4JKHA 4JKDA 3E66A 4JKEA 3E9LA 4JKFA 3SBTA 4JKGB 4ILHA 4JK8A 3E9OA 4JKAA 3E9PA 3SBGA 4JKCA
chains in the Genus database with same CATH superfamily
3BINA 4DR2K 1GG3A 3AVHA 3E1YA 3LP3A 3OYNA 1SL0A 4JK9A 4CCHA 4ZRIA 1VBHA 1HBKA 3HPHA 5ADXA 4DR6K 1OVQA 2YHWA 1RT7A 4Z4CA 4OPAA 4I2QA 4I9QA 3SAFA 1J53A 2Q0UA 4B8AB 1BIUA 1QQOA 1REVA 2ASMA 4FLVA 3F9KA 4XH1A 4BWJA 3HOTA 2O8BA 3OYDA 3VQEA 3KHYA 4FJKA 3DRSA 3QB0A 3ZDTA 3VGLA 4C8NA 3ENBA 1A5XA 4TKNA 2BDPA 2QXFA 4DTOA 4H5WA 2E6MA 2YHXA 1JJ2M 2KW4A 4AQYK 3DOLA 1HKCA 1MIXA 4BROA 4DSEA 4B3OA 5GIPA 3NDKA 1T8EA 3F2KA 4FJLA 3TAMA 1RT6A 4E7IA 1VBGA 1EQYA 1TV6A 3VQ5A 1JLGA 3CCQN 2P9UB 2F9TA 4BR2A 1T7PA 5FRMA 4BRHA 3S41A 3O9UA 2P9IA 4BRAA 3QFUA 2NRVA 5AFUH 1VQPN 4CBXA 3VQ6A 4KAZA 3PVLA 3OYIA 1BI4A 4BR0A 3A2FA 3VF4A 1XI1A 4O8KA 3TARA 2ZPYA 3HPGA 4RW6A 1WNSA 2J0JA 3NVKA 4WFNL 3T1YK 4FJ8A 2A41A 1VQ4N 1RTIA 3SYZA 4CZFA 4FWOA 1BQMA 4QOZB 1I39A 4H8KA 4B9SA 1NK6A 3VN5A 3CCJN 4E3SA 1KTQA 1VQNN 2BH1A 5EOYA 1FK9A 1VSKA 4IFEA 4CZMA 3VQPA 2VCPA 1GLDG 3T69A 3NCIA 3O4WA 3M8PA 5KI6A 2LSNA 2F96A 3ZSQA 1VQ8N 3K5MA 4JKGB 3D6RA 3UIQA 1GC6A 5GINA 3VENA 4WFAL 3K9JA 4H0TB 4F7GA 4FO0A 4K8XA 3SAHA 4YOTA 3OBYA 4YOXA 2ZGYA 1WLJA 4C8KA 3DYAA 4OPHA 1D9FA 4Z0UA 2QKBA 3VEZA 2A42A 2O8CA 3MEGA 1B9DA 3CI5A 4B1YB 2PAVA 4KI4A 2ABDA 3IUCA 1NJXA 1EWRA 5AFUA 4K43A 1V4SA 4IFYA 3ZX0A 4HUEA 3ZX3A 4U67L 2RQ1A 2NZTA 4CHNA 4DQQA 3PO4A 2A5XA 2EMTA 3L2RA 3FZKA 1ZBIA 1IO2A 1TKDA 4DQSA 3D2FA 1UAXA 4OVLA 3V6DA 2P51A 4DKWA 4M3UA 4EIAA 4H03B 3RRHA 3QESA 4K25A 4KPYA 3H1VX 2D4WA 3NAEA 3PUFA 2P9NB 3CFPA 1LW2A 2AA4A 3KZBA 3CPEA 3DMJA 5JLHA 2W6KA 3IG1A 2GV9A 1HQEA 2NLXA 1QVFM 4JK7A 1GLBG 1EXQA 5AQMA 1NK5A 1WUAA 3OW2M 2RHKA 3LDPA 1VQ5N 2A1SA 2W40A 3SNNA 3HXMA 2KFZA 5F1XA 5HRSA 1NOYA 4DSFA 4DF8A 4IDHA 4B9LA 2YKNA 4WFBL 2DFHA 1VSHA 1VQKN 4DG1A 4KHPK 3R3LA 1UOCA 4NB4A 2G8HA 3ULDA 4CEZA 4B9TA 4NXNK 2ATQA 1MK9B 3QEIA 4A61A 4C1NI 5M1FA 3BY5A 3EPYA 1RTHA 1LCUA 2NRZA 5T7BA 4EAHD 5C2DA 2P9UA 1GLCG 3SBTA 5AQXA 4CD1A 1XWLA 3OBWA 1BL3A 2UXCK 3OYBA 2JWLA 3OY9A 3J7YP 5I3UA 4E0DA 2ITMA 4M3XA 4GNIA 3NGYA 3THXB 1X9MA 1LWEA 2FBXA 4NCBA 4CZKA 2HHQA 1RTDA 1RBUA 3DLEA 2OPPA 4ISGA 3SAGA 1IBLK 2IGIA 3U9DA 1XQSC 1KVBA 4CEAA 1D9DA 4DV1K 1SL1A 1EETA 1NK4A 1KFSA 1XUPO 1CXUA 1JLQA 3VQAA 5GIOA 3MXJA 4H0VB 3IDHA 3RR8A 3HSCA 3TTCA 1MDUB 4JKAA 5C25A 3NH2A 4DTJA 3N4PA 4FW1A 1TAQA 2IVPA 3QNOA 1EWQA 4DTSA 1QSLA 3HZ6A 3VGKA 2D0CA 4KFBA 2X6SA 3K5OA 5F0XA 2Q36A 4E1MA 1S22A 3P39A 4E7HA 4JKGA 1JLBA 4MQ3A 3NF8A 4FJ7A 4CBWA 4Z4GA 3LP1A 5BPNA 3SI6A 3LALA 2IS3A 2YNHA 4DV5K 1QSSA 4ELUA 2ZQBA 3E9OA 5AQFA 1DTQA 4H0OA 4WQ5C 2NRRA 1RBTA 3Q7CA 1X9SA 2HW3A 3OYMA 1EX4A 3E01A 2Q31A 2G8VA 3FLCO 5FDLA 3ZSZA 3QEWA 2GEMA 2QK9A 3LZIA 1SS6A 3AVBA 1U48A 1YIJN 4CZIA 1D4XA 1LWFA 2YNFA 3GBTA 3QIOA 5BRFA 1QHAA 4BRQA 4W5TA 4DV2K 1HKGA 3UKRB 2O8DB 2FJ9A 3QERA 5AQTA 3EL2A 5KQDA 3G10A 3OTOK 2EWSA 4ZRKA 5BREA 4K0KK 1JLEA 3RRGA 2YNGA 3R1XA 1RTJA 1SKRA 4DFMA 4IJAA 1NKEA 4CJ4A 4HCCA 1BCOA 3F73A 1A5VA 2XHBA 1KRPA 2P9NA 3HT3A 1GC7A 3O80A 4ID5A 4I2PA 5FPMA 2QWLA 4FM0A 4JYAK 2I5JA 2QXLA 2YI1A 4FK2A 3NHGA 4JKCA 3SUNA 3ATVA 2RKIA 3ASMA 3KIOA 2AEHA 3FLVA 5C2FA 1VQLN 1KVAA 1LAVA 5M1NA 4LF6K 3I0RA 2WBNA 4BGAA 4IO9L 3S3MA 3KLGA 3MWTA 4N76A 3MEDA 4C8MA 1D8YA 4FYDA 5JVGL 1ZYQA 3VQ4A 3O08A 5HRPA 4BR4A 5CZ2A 3KLHA 1RT1A 4AILC 4A5AA 4ID1A 1NNEA 4A62A 2QW9A 1KAXA 1WB9A 4DR4K 3WT0A 4N56A 2NRXA 3T1HK 3O9QA 3FP5A 4B1UB 4GKJK 4IOXA 4IG3A 3VERA 1IV0A 2CB8A 4JKEA 3R8EA 1YTAA 2BE2A 3CCVN 4PHTX 2XY5A 3THXA 3SV4A 3NH0A 3JS6A 3QIPA 4EZ9A 4JNEA 1F21A 4OGEA 3ZT3A 4CIGA 2PYLA 3OYLA 1NOZA 1BWFO 4DR7K 1YT3A 4FWRA 3RMAA 2BANA 1RDWX 5AQRA 3O4QA 3BZCA 4CJKA 1E3MA 1Q18A 3L4IA 4IWVA 4CJ5A 1S72N 1HNZK 5KTQA 3CCLN 4MDBA 1ASWA 3C0BA 3LM9A 3KK1A 2Q97A 4RTFD 3A8YA 1R0AA 4CI6A 3E9PA 3T7ZA 4BE1A 3SQ0A 2DTUA 4B3RK 3P83D 3VOVA 3SUPA 5DMRA 4BC4A 1IJJA 3CM5A 4BVPA 1EF1A 4OKEA 4CHOA 4FW2A 2G8IA 3T3FA 2FSKA 4BQLA 2E8AA 5TKWA 1NM1A 2W42A 4CJFA 1E4GT 4RCHA 3S9HA 4JS4A 4MO4A 3ZX2A 3AO2A 2DY4A 1XNQK 4Q0BA 4NLBA 1C0UA 4F2SA 1L3SA 2OPSA 4GV3A 2P9KB 1QS4A 3UKRA 3W3DA 2HF4A 3BEXA 4CEDA 4EHTA 4N5SA 4FLUA 1GOCA 1TAUA 3ZCMA 3RMBA 3A5LC 4FK0A 4J2BA 4YDUA 1S1WA 3C7NB 1BCMA 4WQ4A 2DPNA 2ZJRL 4X65K 4DSLA 1X9WA 1RBSA 3K57A 4JI3K 3LAMA 3CC4N 1NGGA 3HP9A 5AQNA 4BR5A 5AQKA 3AVGA 1ST7A 4GVEA 3MMVA 2YJFA 3A5MC 5MLCQ 1NTIA 4P7IA 4B1VA 3C6UA 5AZJB 4O0IA 1X3MA 2IAJA 4KBOA 3MX5A 5J2QA 1HQUA 3A5NC 3AA3A 5DK5A 2YJEA 4MLEA 1GLAG 1ZBSA 3LWLA 1NK0A 1JDEA 3P5JA 1WSEA 1Q7YO 1N8RO 2XO7A 2F9WA 4B1ZA 3WXMB 1DLOA 2Y1IA 2D0OA 2NRWA 2VWKA 3H46O 1T6DA 3OS1A 5AQSA 3G0ZA 2DIKA 2WTUA 3EN9A 5J2PA 3K58A 3CQXA 1NJWA 1SUQA 3I55N 1MWMA 4Y0WA 2ASOA 3L6QA 1SZ2A 5KPZA 2R7YA 4FWQA 4CJWA 1YHQN 4Z4EA 2G8UA 4BR7A 4CHPA 4AH9A 2P5GA 2XRIA 4DR5K 1RDDA 3VESA 4ILGB 4DQPA 1RT3A 3MN9A 2RN2A 3OS0A 4DTNA 4DFJA 4DR3K 1YF5L 2WONA 4YNQA 4JEPA 1JL1A 4HWIA 4KHSA 3JYTA 2CQUA 2HRJA 1RDAA 3VA3A 4J2EA 2GWKA 3AAPA 5BRHA 3PIOL 4HTLA 4FJIA 5C12A 1RFQA 3TABA 1BGXT 2VYPA 3TSUA 3B6PA 3MK6A 4CF0A 1W97L 3SQ1A 4BRIA 4GVMA 1VSFA 3PY8A 1YXQA 4N41A 2BUPA 4EKUA 4CJTA 2PBDA 3G25A 4F3TA 2COPA 4O0JA 1KAYA 1NWKA 4KHQA 1HB6A 1RILA 5HBMA 3EY1A 1TL1A 3CD6N 2IOCA 4DU3A 1M90O 3LANA 4FJHA 3AARA 4E1NA 4FJXA 4NYFA 4YFUA 2B5JA 5AQLA 1BISA 4BREA 4DHYA 2QWNA 4KO0A 4HDOA 2P9KA 3CFRA 2YVCA 4BQZA 5M1OA 2VGNA 4JN4A 1V4TA 5CYQA 3V81A 2E2PA 3C7NA 2HOEA 4H5TA 2OPRA 2P9LB 1BO5O 3DAWA 3V4IA 4FM1A 2AP1A 1U47A 3LAKA 3ITHA 3AO5A 3D2EB 2JWKA 1VSEA 4ELTA 1J5OA 2QWQA 3PSIA 1LV5A 3KWGA 3TPQA 3CC7N 1KC7A 3C6HA 4EZ6A 5IJMA 3QNNA 2J4RA 2QI2A 4CF9A 4E1JA 1TK0A 4IEIA 1R59O 3NF6A 5AQJA 3U3YA 3DLRA 4JLHA 3AVLA 4IG0A 4B8CA 3LL3A 1TVRA 2PYJA 1RNHA 2CH6A 3HRGA 4CHQA 4DLEA 3OYGA 1H4RA 4IEEA 3ID8A 4L3QA 4FZYA 4PKHA 3QETA 3CM6A 2YHAA 1HUXA 4JI7K 2VGMA 4BC2A 5B8HA 1TUUA 3BF1A 3DLGA 3U7DA 1HYVA 4M7XA 1GLFO 3EO3A 3L3UA 2YX6A 2I7NA 1RCHA 1RDCA 3U3GA 3GOIA 1SAZA 4CEOA 3HPOA 3LDLA 1BG3A 3ZLJA 1I3AA 3LZJA 3BF3A 1DIKA 1RT5A 5EXWA 3OYKA 4DFKA 4DTMA 4JK8A 3R9PA 1CZ9A 2Y1JA 3OA9A 4E89A 4OLAA 1Z6RA 4BWMA 4F9OA 3GE1A 3M1FA 4O44A 4G1QA 4JI2K 3FE1A 3A0IX 5JMVA 5TKYA 1QHTA 3M5RA 5CE3A 5FRNA 1KAZA 5AQIA 3QO9A 4R5PA 4FWPA 5KPRA 3U8ZA 1Q9YA 1W0HA 1QQNA 1EKEA 4DSIA 4DU1A 1OKJA 3FZMA 3M6GA 3C95A 1U04A 3HSTB 3HOSA 1G99A 3BP8A 2FBYA 4I9LA 4NYNA 4U7BA 5CZ1A 2A1RA 1NK8A 2QKKA 1M1KO 2GUPA 3DXKB 3AV9A 4CJEA 5JS2A 4YL8A 1NGAA 4MFBA 5GAHP 2P9SB 3KLEA 1Y97A 2E88A 4WYBA 4GV6A 1BOTO 3WNGA 4DV4K 1HPZA 2EHGA 3MECA 2VQEK 4KTZA 1NKCA 3T19A 4JHDB 1VQ6N 4XIUA 3J81O 4BRPA 1ATNA 1KBLA 1MU2A 2G8KA 2HHSA 3KK3A 2RPIA 1WSFA 3LPTA 4H5NA 3AGRA 3JSMA 4AHUA 3O9SA 3RMDA 2FF3B 1TGOA 1BIZA 4IBNA 3QEPA 4J2AA 3OYJA 2XY8A 2UXDK 4DF4A 2P9LA 4DWIA 4F3OA 3O4NA 4DUZK 4EFHA 1T6CA 4JI6K 4BG9A 4IDKA 2GX9A 3V9ZA 4RWTA 3TU5A 1E5WA 3RTVA 3D2EA 1J6ZA 1HPMA 3FZFA 4KI6A 1RBRA 3J80O 1WN7A 1S1TA 3NFAA 1NU0A 5K14A 1K6YA 3X23A 2FSNA 5AQGA 4M3TA 2QEXN 2KHOA 4CJLA 1JXBA 1UA0A 3TAGA 2RF2A 3FZLA 4BRFA 5FPDA 5JICA 4K42A 3HM8A 1JCGA 3SV3A 4CD3A 3OYHA 4LH5A 4KKOA 3QEVA 3AVMA 4MLHA 4ICLA 1FKPA 2B6AA 1TKZA 2V7ZA 4EP4A 5AQUA 3VF6A 4QS8A 2ZJQL 4H4OA 4B9UA 2FC0A 3HYFA 5D3GA 1U49A 5DM6L 2D2QA 2V7YA 3P1GA 4H0PA 1YUWA 3DLKA 4Z94A 1XMOK 3PLAA 1NGFA 3VTIA 1NK7A 4H4MA 1GOAA 3ISNC 4OPKA 3GL1A 3JXUA 2GTDA 2HHHK 4OX9K 4O8UA 4FPBA 3UE5A 5KRTA 1KXPA 4PKGA 1XMQK 4LC9B 5E26A 2A6AA 1NI2A 4W5NA 3WXKA 4DQ8A 1TK8A 4HDQA 5EX5A 1DEJA 1X1PA 4J8FA 4LF8K 3WQTA 4FPAA 4FXDA 4DV0K 1VSDA 4FVUA 3QBWA 4Y1DA 3PX0A 2JGUA 1VHXA 2HHWA 3KKSA 3CCEN 4XH4A 5CYMA 3W0LA 2ZF5O 4TSXA 3SQ2A 1T44A 3M8SA 3VEVA 3H3NO 1WSIA 2ZE2A 4CIFA 3CJ9A 4AHTA 2X74A 1UA1A 1NGDA 2ITGA 4CK1A 4KB0A 1BA1A 4JD2B 2UUCK 3V1RA 3DWLA 2VG7A 2HNZA 5CHIA 5HOOA 1N32K 3MN7A 4DS4A 2D5RA 3DXKA 1RT2A 3AVNA 5DM7L 3CJCA 2O4IA 3H6EA 3HJFA 4FLTA 2D11A 2P9SA 2E5LK 4KH4A 1HJRA 1ACAA 1CLQA 4CGHA 5KRSA 1Y64A 4CF8A 4IXCA 3CQYA 4DSJA 3LP2A 3WXLA 3PO5A 4JHDA 4CJUA 4C23A 3AU5A 4LY7A 4F4KA 2IIRA 3KK7A 1NJZA 4B1XB 1QSYA 1OH8A 1S5JA 1FJGK 3HP6A 1YTUA 1N34K 2X0SA 4AM6A 1YAGA 1FKOA 3GDQA 2NRHA 2X78A 3ZT2A 3OVNA 1L3UA 1WAJA 2WC9A 4HUGA 5F2RA 5AQQA 4X64K 3O8MA 3CG7A 3KJVA 1OH6A 1IH7A 5I42A 1HR0K 4Y1CA 4IKFA 1X3NA 1EO1A 5LJVA 1KD1O 1J5EK 4CGDA 4LF4K 4A59A 1KSPA 1P8ZA 3CERA 4AHSA 3TI0A 1O13A 2HBMA 1U2VB 3M8RA 4BDZA 1HNIA 3CF5L 1BA0A 4UY8O 4CGIA 4CIEA 3P38A 3CXCM 4DTUA 4CK2A 4E7LA 1XHXA 3LP0A 2AL6A 4HTUA 1XC9A 4PKIA 3LPUA 4BDYA 3O9RA 3KK2A 3QLHA 3SUQA 4C8OA 3PV8A 4WF9L 5AZIB 4FL9A 4L8RB 1C6VA 2QA4N 1VRUA 3L8BA 3V9XA 2AJQA 1ZXOA 2E1YA 5LJWA 4E19A 3M8QA 4RW8A 2GBZA 3QMLA 1WOQA 3D45A 3LDQA 2P5OA 3OYEA 4M3RA 4MO5A 4LD0A 2KKZA 1YVNA 1WBDA 2NRTA 3KD5E 4B1WB 1IG9A 5AQPA 3NGZA 5I9EB 4JI4K 2FF6A 3OJSA 4CFAA 1VQ7N 3VMFB 1C1CA 4FOIA 5GAGP 3FFKB 5AQZA 5IT9O 4OPJA 4ILJA 2CGLA 2XY7A 3F5TA 5BN9A 1S6QA 2ZJPL 3BGRA 4LFCK 1VSLA 4LF7K 1QQCA 1HMVA 3MDQA 1VQON 4CZHA 2WH5A 4BC3A 2YHBA 5JS1A 3VF2A 1SGHA 1RT4A 4FWSA 3WNFA 1QE1A 5M1QA 5FROA 5E84A 2JLEA 3WNHA 4Z4IA 1IKVA 1GOBA 3MWPA 3CMEN 4QCLA 2O8DA 4JD2A 1S1XA 1WSGA 4IFVA 2E2QA 4M45A 3T1AA 3C6TA 4PL8A 4DUYK 4KREA 3OS2A 2I1JA 2I7PA 3EE9A 4CEEA 4HVJA 1SKWA 3DLBA 4JV5K 2LBBA 4IJNA 2DFEA 3HO1A 2HMIA 1EP4A 1KLMA 4LFAK 2I1KA 1MK7B 3U6FA 2WOMA 4RG8A 2G8WA 1ZBLA 3EKUA 1ATSA 3AVFA 2PFUA 4Q5VA 2HBLA 2HVHA 3J7AP 4DU4A 4M63C 4CF1A 3NMUA 4FLWA 3LDSA 4E7KA 4B3TK 4ZTFA 3O5BA 1QVGM 4B9NA 3NH1A 4NLCA 3ZSVA 3E9LA 4OO1J 4DQIA 1GLJO 4KHUA 4RW9A 4KH5A 2HHTA 4YHHK 3HVTA 4CJRA 1NGCA 3HK2A 4YOVA 1KFDA 1NG9A 3UB5A 5IWAK 4FJGA 2HHVA 1VAZA 4JKBA 3BUZB 4FJMA 4XH5A 2E1ZA 3G6EN 5AQVA 1S9GA 3C94A 3Q7BA 4PY5A 1U6ZA 1S1UA 4F2RA 5AQYA 4FVMA 1U2VA 3HI0A 4N47A 1TKTA 3I0SA 1HNWK 4R79A 4CYEA 1B9FA 1YJWN 2Q1NA 3CHWA 2VG6A 3TWHA 4DTXA 5JVHL 2FBTA 3AO3A 2OANA 3N4QA 4NCGA 3S3NA 2OZSA 4WQ5A 2E6LA 5AZIA 3SJHA 1K8KB 3DOKA 2EX3A 2ZD1A 5KQ8A 1G15A 3M3ZA 1JCFA 4LH4A 2F8TA 4KTWA 3HM9A 3EYZA 1VRTA 4AHCA 4PA1A 1S6PA 4C8LA 3TANA 4LF5K 1LOTB 3CCRN 2H3GX 4DTRA 3C6AA 3O3GA 3WEEB 3TTDA 4W5RA 1OH7A 2DFFA 5E41A 1ILYA 3ZT0A 4DS5A 4ILHA 3THWB 4CFBA 3MAQA 1BHLA 1P90A 1NMNA 1O1WA 3J7ZO 3MXMA 2ZM6K 1GLLO 1NGBA 4Z4HA 1NK9A 3VQQA 3H45C 4AF1A 3VQ7A 3DRPA 4DQRA 1Q8IA 5M1PA 4B08A 4BVOA 4CVNE 3K0SA 4FOEA 2F7TA 4FWNA 1DT9A 4WCEL 1KQSM 2ASPA 4B9VA 5C0YA 2QM1A 1ASVA 5AJ3K 4X62K 5C24A 1T03A 1UWBA 2D0AA 3KLIA 1HRHA 4BE2A 4H0YB 3L3VA 1RGIA 2VWJA 1K73O 4A2BA 1N6QA 5AZJA 4K41A 5BR9A 3WUHA 2O8FB 1U4BA 3VQ9A 3VETA 3K2PA 4BE0A 2KLAA 4DMNA 4FM2A 3KTQA 2D0PA 2YHYA 3ATUA 4W5QA 3CQ8A 3RMCA 1SL2A 1VQ9N 4MDAA 2O4GA 1VSJA 1JCEA 3NVMA 4NO7A 3NE6A 5HLFA 3CYMA 2KFNA 3WA0A 1K8AO 3FZHA 4OGCA 4CGJA 4CW7B 2GWJA 3AO1A 4BRMA 3NF9A 4GMJB 3TSPA 2HF3A 3HVRA 4H5VA 3VA0A 3CJ7A 1W2BM 3J8AA 1JL2A 4DLGA 3E66A 1HYSA 1BUPA 2Z1IA 2HHXA 4DV3K 4GKKK 3ENHA 1GLEG 3AVAA 3PSFA 4ISFA 3U9ZA 4CZJA 1QZ6A 4KHYA 4K8ZA 3ZEUB 2FLOA 1BQNA 1TKXA 2ZGZA 4CGGA 4YORA 4CHZA 4IOCL 3ZSRA 4CJSA 1K8KA 3QBXA 2UUBK 2QWOA 2A3ZA 1HYZA 2CGKA 1ASUA 4JAXA 3ID6A 3MCPA 1CXQA 1TYQB 3P31A 3FFIA 3CJAA 4FLYA 4GXBA 3L2UA 3O1BA 4LF9K 4WE1A 2OTLN 1W7AA 4CECA 5KGWA 2KZMA 2BTFA 4CHYA 1XNRK 4FZZA 4EP5A 1Y19B 1S9EA 2E2OA 3U8XA 3WEEA 4BR9A 3G9WA 3K59A 3PX4A 4FLZA 4GY2B 5J2MA 3THWA 1HNXK 3K5NA 1C1BA 2Z1JA 3AVIA 3THYB 3DM2A 1TL3A 3PIPL 4FZXC 4AHRA 2OZMA 3KVGA 1C1AA 4JI5K 2IC3A 3AA4A 1Q82O 3AU4A 3UKUB 1A5WA 2P1JA 3AA2A 2KZZA 5BR8K 4BACA 2OCEA 3ENOA 2GUIA 1J9AA 3OYFA 3VPZA 1VK0A 2HBJA 1VSMA 1HLUA 4JKDA 4KV8A 3IKMA 4DR1K 1NGEA 5FLXO 3H08A 3A5OC 4CZGA 3CETA 1C0GA 4E7JA 3L4QA 3TTFA 1HKBA 2NUBA 2HE7A 4CF2A 5HP1A 1ITGA 3HTVA 1Z05A 2HHUA 3QEXA 2D0BA 2O8FA 3V9WA 5LY3A 2XY6A 3SMPA 1MWKA 3ZYYX 4YDUC 1QZ5A 3OYCA 4DB3A 4PWDA 4WQ4C 2GELA 3SBGA 4J2DA 3GG4A 1NLVA 3ZT4A 2ZWHA 4BC5A 3ZETB 4V19S 1NJIO 3WQUA 4PUOA 3QINA 2R82A 1X9JA 3EEQA 1SQKA 3CCUN 1KLNA 1CZAN 4BRLA 4FJNA 2QTDA 5HROA 3IVFA 5J2NA 4G9ZA 4HCBA 5C15A 3NF7A 3OHRA 4DCHA 4YOUA 2YNIA 4QAGA 5SWMA 1ESVA 4OKJA 1LAWA 1OVYA 3DXMB 4GW6A 5HRRA 4CZEA 5SZTA 1Q86O 3DRRA 3IS9A 4BGBA 5BPLA 3ZT1A 4I6MB 5HRNA 4X66K 4CEQA 2HBKA 5KPTA 1L3TA 3RWUA 4BDPA 2J0MA 1RDUA 4OJRA 2IVOA 3ZEUA 2O8EB 3C65A 1HB8A 5KGXA 3OJUA 3LWMA 5BPMA 4KB1A 1IKYA 1J19A 2HMPA 2J0KA 3THVA 1WAFA 3K5LA 2Q2RA 3VQCA 4Z4FA 2Z1GA 3DJCA 3RR7A 1TYQA 3BZKA 1IBKK 3TAPA 3IAYA 4DSKA 1OH5A 4BRKA 4H5RA 1ZBUA 5EU7A 5LMUK 3PX6A 1FXXA 3DI6A 2CH5A 3VGMA 4FJ5A 3MX2A 4CE9A 4CJPA 4JI1K 3LDOA 4DTPA 3VEXA 3FR0A 4ZRJA 4BG8A 1LWCA 2D1KA 3MCAB 4JKFA 5FPEA 3WXIA 4QS9A 3TAFA 1B92A 4CERA 1J54A 1T05A 2EMSA 2OYQA 2HVIA 3QICA 3NGIA 3S3OA 2HSTA 4EHUA 4W5OA 3THYA 1NJYA 4OLBA 1RDBA 2OPQA 3B6OA 3MN6A 5JVLA 4A5BA 1E4FT 2WUSA 2D10A 2KQ2A 4JI8K 4CGFA 3V1OA 5EVZA 1K9MO 3AGKA 4HHTA 3AA5X 3SCXA 4M3YA 3AVJA 3UKUA 3F9MA 1SV5A 3O1WA 4CJQA 4YOYA 1DGKN 3KWIA 2OTJN 3ULEB 4CESA 1IKWA 2UUAK 2VG5A 3PZDA 1DKGD 2P9PB 4A57A 1JKHA 4F8RA 3MEEA 3V9UA 1Q9XA 4M41A 1DTTA 4JRQA 3VEWA 4O5FA 4BRDA 4H0XB 2QWMA 3SJJA 4CJ7A 3NBPA 4BRGA 2IDOA 4FLXA 3CJBA 3ZSYA 3QDKA 4OKKA 3QFPA 3TAEA 1C0TA 2B4JA 2PZSA 3SLCA 2Q0RA 1WSHA 5AQOA 4LFBK 3I56N 3QIJA 3WXJA 2E4LA 3ZETA 3VQ8A 3ALYA 4YY3K 1MA9B 4BRNA 3EZ5A 1NKBA 1N33K 4KRFA 5ELZA 1TK5A 1Z26A 5AQWA 3CIPA 1NGIA 2HNDA 3SUOA 4LSLA 3CMAN 4FCYA 1KCFA 3HL8A 1D5AA 3DXMA 4CEBA 2W41A 3G4SN 3SPYA 2E2NA 4I6MA 3O9TA 5GAEP 3RSEB 2UU9K 3V1QA 3VQBA 4CFCA 4FJ9A 4KTQA 5CY4A 4A2AA 1U45A 1N36K 2O8EA 2YKMA 2HB5A 1QTMA 1IKXA 4NY0A 3DLHA 4FSVA 4LSNA 3EKSA 5CR4A 1QQMA 5LL6Z 4XEIA 3SK3A 4BY9C 4O55A 4GV9A 2HNYA 2OA8A 4ISEA 2G8FA 1HX1A 1NMDA 4CBUA 3L2VA 2FSJA 1SKSA 3B8AX 2X6NA 1NBWA 2NNWA 1YI2N 1HJOA 3CFOA 3VQDA 4DFPA 1RBVA 4JKHA 3K9KA 4M7YA 5EY4A 1NVLA 2FXUA 1FW6A 1LW0A 4DV7K 3SQ4A 4IOAL 5M1KA 1ZBFA 1JLAA 2QWPA 4C1NK 1WBBA 4B3SK 4B9MA 3EZWA 3D0PA 1ZBHA 3BDPA 4ELVA 1NGHA 3V9SA 2O8BB 1C0MA 4AM7A 2ETJA 1IBMK 3IMXA 1BDGA 3KKRA 1BU6O 5JLFA 3D7EO 4CJVA 3G71N 1KVCA 3ULEA 3CPWM 4DXAB 4M42A 1ISNA 5A2QO 5GADP 4NCAA 2Q3SA 2Z1HA 2P9PA 3KLFA 1HNVA 1W9HA 3JAMO 4B3MK 3H3OB 4CK3A 4CEFA 4IZ9A 3TSQA 3O3HA 2RE2A 3KD1E 4FWKA 1KC8O 2VWBA 4AHVA 2YCHA 2WFBA 2PY5A 2P9IB 5AR0A 3I8BA 3IRXA 4JRPA 3I33A 2UYTA 4I7FA 2CGJA 3AO4A 4HUFA 1BI4B 1ATRA 2UXBK 4CZLA 4KH6A 4QS7A 4DV6K 4NXMK 4JS5A 3SZ2A 1L5UA 4M3WA 3TR8A 3L0QA 3P4IA 2KTQA 1IG8A 1JXEA 3ZSOA 3H1QA 5HL7L 4RW4A 3LM2A 1XC3A 2F8SA 1YJNN 2E20A 3SPZA 2YV0X 4ZHRA 2VQFK 3IFRA 1L3VA 4FJJA 5J1EA 1NGJA 4FK4A 3VTHA 1VSIA 4IO8A 4BRCA 5ADXH 2BGGA 4CJ3A 1S1VA 3AVCA 4KHWA 3WNEA 1JLFA 3FGUA 3VEYA 3EE8A 4M3ZA 4ZTJA 2V51B 4FWMA 2FDQA 3O3FA 1CZBA 3R6MA 3RSEA 3HBTA 3I8DA 1GGOA 3L2QA 3MXIA 2FBVA 1S3XA 3TAQA 5BRDA 5LMNK 3RVCA 1Z25A 1H1VA 4FWLA 1YITN 1ZC6A 2V52B 4KHNA 3AVKA 4PQUA 2A40A 3CCSN 1VQMN 1TUYA 5AQHA 3ZSWA 2W6LA 3AAQA 1N5YA 3LDNA 1XHZA 2O8CB 1JLCA 2IVNA 2F4VK 1I94K 1YVUA 4B9QA 3AY9A 3U4LA 1WSJA 1YJ9N 3O6WA 4RW7A 5H1SQ 5FPNA 4UQGA 1MIZB 3ZSXA 1C0FA 4O5BA 3CC2N 4JI0K 3CCMN 4PL7A 4YOWA 4CFDA 3VEOA 3CJ1A 5C42A 3OYAA 3DLLL 3MN5A 1T3VA 5C10A 3D2FB 3L2WA 1Q81O 2QWRA 3SMSA 4O4GA 5BN8A
chains in the Genus database with same CATH topology
4GV3A 3BINA 2P9KB 1GG3A 3H6EA 3AU4A 3UKUB 2D11A 3UKRA 3W3DA 2P9SA 2HF4A 3BEXA 4EHTA 3E1YA 4JK9A 4KH4A 3ENOA 4ZRIA 1ACAA 1VBHA 1Y64A 3VPZA 3A5LC 1HBKA 4YDUA 2HBJA 4IXCA 5ADXA 1HLUA 3C7NB 2YHWA 4JKDA 3CQYA 4WQ4A 2DPNA 2ZJRL 4OPAA 3WXLA 3IKMA 1NGEA 3SAFA 2Q0UA 4JHDA 3A5OC 1QQOA 2ASMA 4C23A 3CETA 3AU5A 1C0GA 4XH1A 4CZGA 3HOTA 3CC4N 1NGGA 2IIRA 3L4QA 3KK7A 5AQNA 3KHYA 1HKBA 3TTFA 2HE7A 4B1XB 4BR5A 5AQKA 1ST7A 4GVEA 3MMVA 2YJFA 3A5MC 5MLCQ 1NTIA 4P7IA 3QB0A 3ZDTA 4B1VA 3VGLA 2X0SA 5AZJB 3ENBA 4AM6A 1YAGA 3HTVA 3GDQA 4TKNA 1X3MA 2NRHA 1Z05A 4KBOA 3MX5A 4H5WA 2WC9A 2YHXA 1JJ2M 5F2RA 5AQQA 3A5NC 5LY3A 1HKCA 3O8MA 1MIXA 2YJEA 4MLEA 1GLAG 3SMPA 4BROA 1MWKA 1ZBSA 3ZYYX 5GIPA 1JDEA 1QZ5A 4YDUC 1X3NA 1EO1A 4DB3A 5LJVA 3F2KA 4WQ4C 1KD1O 2GELA 3SBGA 1Q7YO 1N8RO 3GG4A 1NLVA 4A59A 1VBGA 1P8ZA 2F9WA 1EQYA 2ZWHA 4B1ZA 3WXMB 4BC5A 3CCQN 2P9UB 3ZETB 2F9TA 2D0OA 2NRWA 3CERA 3WQUA 3S41A 3O9UA 4BRHA 2P9IA 4BR2A 4BRAA 3H46O 3QFUA 1O13A 2R82A 1T6DA 2HBMA 2NRVA 1U2VB 1X9JA 5AFUH 5AQSA 1VQPN 2DIKA 1SQKA 3CCUN 4CBXA 1CZAN 3EN9A 4BRLA 3PVLA 2QTDA 4BR0A 3IVFA 3CQXA 3CF5L 1BA0A 4G9ZA 3I55N 1MWMA 4Y0WA 2ASOA 3L6QA 1SZ2A 3OHRA 4O8KA 3VF4A 5C15A 4DCHA 2ZPYA 3P38A 4YOUA 3CXCM 2J0JA 3NVKA 4FWQA 4WFNL 1ESVA 2A41A 1VQ4N 1YHQN 2AL6A 1OVYA 4CZFA 3DXMB 4PKIA 4CZEA 1Q86O 3O9RA 4BR7A 4FWOA 4BGBA 5BPLA 4WF9L 5AZIB 4I6MB 4FL9A 3VESA 4ILGB 2HBKA 3CCJN 5KPTA 2QA4N 1VQNN 3MN9A 2BH1A 5EOYA 4IFEA 1ZXOA 2E1YA 4CZMA 5LJWA 2J0MA 1RDUA 2VCPA 2IVOA 1GLDG 3T69A 3ZEUA 3C65A 1YF5L 1HB8A 4JEPA 3QMLA 1WOQA 4HWIA 2CQUA 2HRJA 5BPMA 3O4WA 3LDQA 1J19A 2HMPA 2J0KA 2GWKA 3AAPA 4MO5A 2KKZA 1VQ8N 4JKGB 1YVNA 2Q2RA 2NRTA 5BRHA 3D6RA 3PIOL 4HTLA 1GC6A 4B1WB 5AQPA 5GINA 3VENA 3DJCA 5I9EB 1TYQA 5C12A 1RFQA 3K9JA 4H0TB 4WFAL 2FF6A 4F7GA 4FO0A 4BRKA 1VQ7N 4H5RA 2VYPA 3SAHA 3TSUA 4YOTA 3VMFB 4FOIA 5GAGP 3OBYA 4YOXA 2CH5A 3FFKB 5AQZA 2ZGYA 3MK6A 1W97L 3VGMA 4ILJA 2CGLA 3F5TA 5BN9A 3MX2A 4OPHA 4BRIA 2ZJPL 3LDOA 1YXQA 3VEXA 3VEZA 3FR0A 3MDQA 4ZRJA 2BUPA 2A42A 4BG8A 4EKUA 2D1KA 1VQON 4CZHA 2WH5A 2PBDA 3G25A 3CI5A 2COPA 4JKFA 2PAVA 3MCAB 4B1YB 4BC3A 2ABDA 3WXIA 5FPEA 3IUCA 4QS9A 3VF2A 1KAYA 1NWKA 1HB6A 5AFUA 1SGHA 4K43A 2EMSA 4FWSA 3CD6N 3QICA 5M1QA 1V4SA 3ZX0A 2HSTA 3ZX3A 4EHUA 4U67L 2RQ1A 2NZTA 1M90O 5E84A 3AARA 3MN6A 5JVLA 2EMTA 2A5XA 4A5BA 1E4FT 2WUSA 2D10A 3FZKA 3MWPA 3CMEN 4JD2A 5AQLA 2E2QA 4PL8A 3D2FA 5EVZA 2I1JA 2I7PA 3AGKA 3EE9A 1K9MO 4BREA 2LBBA 4DHYA 4IJNA 2QWNA 4DKWA 4HDOA 4EIAA 2P9KA 4H03B 3UKUA 2I1KA 1MK7B 2YVCA 3F9MA 4K25A 3O1WA 3H1VX 2D4WA 4BQZA 2VGNA 5M1OA 2P9NB 3EKUA 1V4TA 2AA4A 4JN4A 3KZBA 1ATSA 3CPEA 4YOYA 5JLHA 1DGKN 2E2PA 3KWIA 3C7NA 2HOEA 2PFUA 4H5TA 2OTJN 3ULEB 2HBLA 2P9LB 1BO5O 3DAWA 2NLXA 1QVFM 4JK7A 2AP1A 1GLBG 4M63C 5AQMA 3NMUA 1WUAA 3PZDA 1DKGD 2P9PB 3D2EB 3O5BA 3OW2M 1QVGM 2RHKA 2JWKA 3LDPA 2QWQA 4A57A 1VQ5N 4NLCA 2W40A 3KWGA 3E9LA 3TPQA 4OO1J 5F1XA 1KC7A 1GLJO 3CC7N 3C6HA 5IJMA 4KH5A 2J4RA 2QI2A 3VEWA 4O5FA 4BRDA 4H0XB 2QWMA 4IDHA 1NGCA 4WFBL 4CJ7A 4YOVA 4BRGA 1VQKN 4E1JA 3CJBA 3R3LA 4NB4A 4IEIA 3UB5A 5KPZA 1R59O 5AQJA 5JICA 3QDKA 1VAZA 4JKBA 3QFPA 3LL3A 3BUZB 1MK9B 4XH5A 3SLCA 2E1ZA 4A61A 3G6EN 2CH6A 3HRGA 4C1NI 2Q0RA 5AQVA 3EPYA 5M1FA 1LCUA 5AQOA 1H4RA 2NRZA 3I56N 4IEEA 3QIJA 3Q7BA 3ID8A 4L3QA 3WXJA 4EAHD 5C2DA 4PKHA 2P9UA 3ZETA 1GLCG 1U6ZA 3SBTA 5AQXA 4CD1A 1HUXA 2VGMA 5AQYA 1MA9B 1U2VA 3HI0A 3OBWA 1TUUA 4BC2A 4BRNA 5B8HA 3BF1A 3U7DA 2JWLA 4M7XA 1GLFO 3EO3A 5ELZA 4R79A 4CYEA 2YX6A 1YJWN 2ITMA 2Q1NA 3CHWA 4GNIA 1KC8O 5AQWA 3CIPA 1NGIA 2I7NA 4CZKA 3CMAN 5JVHL 3GOIA 2OANA 4ISGA 1SAZA 3SAGA 3U9DA 1XQSC 3LDLA 1BG3A 3DXMA 3N4QA 2W41A 3G4SN 2E2NA 4WQ5A 5AZIA 1XUPO 3O9TA 4I6MA 3BF3A 3SJHA 1DIKA 1K8KB 5EXWA 3RSEB 5GAEP 5KQ8A 5GIOA 4H0VB 3M3ZA 3IDHA 1JCFA 4JK8A 3R9PA 3HSCA 3TTCA 4A2AA 1MDUB 3OA9A 4JKAA 3N4PA 2IVPA 1Z6RA 4F9OA 3GE1A 3M1FA 3HZ6A 3VGKA 3FE1A 4NY0A 3A0IX 1LOTB 2Q36A 5F0XA 5JMVA 3CCRN 2H3GX 5TKYA 3M5RA 3C6AA 1S22A 3P39A 4FSVA 5CE3A 4JKGA 3EKSA 5CR4A 1QQMA 1KAZA 5AQIA 4CBWA 3WEEB 3TTDA 4XEIA 3SK3A 4BY9C 4FWPA 5BPNA 1ILYA 5KPRA 3U8ZA 4GV9A 1QQNA 4ILHA 4ISEA 1HX1A 3E9OA 1NMDA 4CBUA 5AQFA 2FSJA 1P90A 4H0OA 4WQ5C 2NRRA 1OKJA 3FZMA 3M6GA 3B8AX 3Q7CA 3HOSA 1G99A 1NBWA 2Q31A 3BP8A 3J7ZO 2NNWA 1YI2N 3FLCO 4U7BA 1GLLO 1HJOA 1NGBA 1M1KO 2GUPA 3DXKB 2GEMA 3H45C 4AF1A 4JKHA 3K9KA 4M7YA 5EY4A 1SS6A 1NVLA 2FXUA 1YIJN 4YL8A 4CZIA 1D4XA 3GBTA 5BRFA 1NGAA 1QHAA 4BRQA 5GAHP 1HKGA 3UKRB 2P9SB 2FJ9A 2E88A 4WYBA 5AQTA 4GV6A 1BOTO 5M1PA 3EL2A 4IOAL 5KQDA 4BVOA 5M1KA 2QWPA 4C1NK 2EWSA 4FOEA 4ZRKA 5BREA 2F7TA 4FWNA 1DT9A 3EZWA 4JHDB 1VQ6N 3R1XA 4WCEL 4BRPA 2ASPA 1KQSM 1ATNA 5C0YA 1KBLA 2QM1A 1NGHA 4H5NA 4AM7A 4IJAA 3AGRA 3O9SA 3IMXA 1BDGA 1BU6O 2P9NA 5JLFA 1GC7A 3O80A 2FF3B 3D7EO 5FPMA 4H0YB 3G71N 1RGIA 2QWLA 3ULEA 2P9LA 1K73O 4EFHA 3CPWM 4DXAB 1T6CA 4BG9A 2QXLA 4A2BA 1ISNA 5AZJA 2YI1A 4K41A 5GADP 5BR9A 2GX9A 4RWTA 3TU5A 1E5WA 4JKCA 3WUHA 3ATVA 2P9PA 3D2EA 3VETA 1J6ZA 1HPMA 3FZFA 2AEHA 2KLAA 3FLVA 5C2FA 3H3OB 1VQLN 4IZ9A 5M1NA 2D0PA 2WBNA 2YHYA 3ATUA 4BGAA 3X23A 2FSNA 4IO9L 3MWTA 5AQGA 3TSQA 4MDAA 1VQ9N 2QEXN 2RE2A 2KHOA 5JVGL 1JCEA 4FWKA 2VWBA 3FZLA 3NVMA 4BRFA 4NO7A 2YCHA 2WFBA 3O08A 4K42A 5FPDA 2P9IB 3HM8A 5AR0A 3I8BA 4BR4A 1JCGA 3I33A 2UYTA 3WA0A 4CD3A 1K8AO 3FZHA 2CGJA 4A5AA 4MLHA 1ATRA 2V7ZA 4CZLA 2GWJA 4KH6A 5AQUA 4QS7A 3VF6A 4BRMA 4A62A 4QS8A 2ZJQL 2QW9A 3L0QA 1KAXA 3TSPA 3P4IA 2HF3A 4H5VA 1IG8A 3WT0A 3CJ7A 2NRXA 1W2BM 3H1QA 3O9QA 3FP5A 5HL7L 4B1UB 3J8AA 4IOXA 3LM2A 3VERA 1XC3A 2D2QA 2V7YA 5DM6L 2CB8A 3E66A 4JKEA 3R8EA 1BUPA 1YJNN 2E20A 4H0PA 1YUWA 1GLEG 3ENHA 4ISFA 3IFRA 3U9ZA 4CZJA 1QZ6A 4Z94A 3CCVN 3PLAA 1NGJA 1NGFA 3VTIA 3VTHA 4PHTX 3ZEUB 2FLOA 4IO8A 3JS6A 4BRCA 3GL1A 2ZGZA 2GTDA 3JXUA 4JNEA 4YORA 5ADXH 4IOCL 4O8UA 4FPBA 3UE5A 1KXPA 4PKGA 4LC9B 3FGUA 5E26A 3VEYA 3EE8A 1BWFO 4FWRA 2V51B 4FWMA 2FDQA 1RDWX 5AQRA 1K8KA 3QBXA 3HBTA 3R6MA 2A6AA 1GGOA 2QWOA 3RSEA 1NI2A 2A3ZA 2CGKA 1Q18A 4JAXA 1S3XA 3ID6A 3L4IA 1TYQB 3MCPA 4IWVA 3WXKA 4DQ8A 3P31A 5BRDA 1S72N 3CJAA 4HDQA 4GXBA 5EX5A 3RVCA 1DEJA 4J8FA 1H1VA 4FWLA 3O1BA 3WQTA 4FPAA 1YITN 1ZC6A 2V52B 3CCLN 4MDBA 2A40A 3CCSN 3C0BA 3LM9A 2OTLN 1VQMN 4FVUA 2Q97A 3QBWA 4RTFD 1TUYA 3A8YA 2BTFA 5AQHA 4CI6A 3AAQA 3E9PA 3T7ZA 3LDNA 3VOVA 3CCEN 2IVNA 4XH4A 1Y19B 3WEEA 2E2OA 3U8XA 4B9QA 4BR9A 3G9WA 4BC4A 1IJJA 2ZF5O 3W0LA 3AY9A 3U4LA 4BVPA 1EF1A 1T44A 4GY2B 3O6WA 1YJ9N 3VEVA 5FPNA 5H1SQ 3H3NO 2FSKA 4BQLA 2E8AA 3CJ9A 5TKWA 1MIZB 1NM1A 1C0FA 3CC2N 4UY8O 1E4GT 1NGDA 4RCHA 3CCMN 4PL7A 4YOWA 3VEOA 3CJ1A 1BA1A 4JD2B 4MO4A 3DWLA 3PIPL 3DLLL 3ZX2A 3MN5A 1T3VA 5C10A 5CHIA 3MN7A 5HOOA 3D2FB 1NJIO 1Q81O 3DXKA 2QWRA 3KVGA 5DM7L 3SMSA 5BN8A 3CJCA 4NLBA 1Q82O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILG B;  3ENB A;  4JK7 A;  4JK9 A;  4ILJ A;  4JKG A;  4JKB A;  4JKH A;  4JKD A;  3E66 A;  4JKE A;  3E9L A;  4JKF A;  3SBT A;  4JKG B;  4ILH A;  4JK8 A;  3E9O A;  4JKA A;  3E9P A;  3SBG A;  4JKC A; 
#chains in the Genus database with same CATH topology
 3BIN A;  4DR2 K;  1GG3 A;  3AVH A;  3E1Y A;  3LP3 A;  3OYN A;  1SL0 A;  4JK9 A;  4CCH A;  4ZRI A;  1VBH A;  1HBK A;  3HPH A;  5ADX A;  4DR6 K;  1OVQ A;  2YHW A;  1RT7 A;  4Z4C A;  4OPA A;  4I2Q A;  4I9Q A;  3SAF A;  1J53 A;  2Q0U A;  4B8A B;  1BIU A;  1QQO A;  1REV A;  2ASM A;  4FLV A;  3F9K A;  4XH1 A;  4BWJ A;  3HOT A;  2O8B A;  3OYD A;  3VQE A;  3KHY A;  4FJK A;  3DRS A;  3QB0 A;  3ZDT A;  3VGL A;  4C8N A;  3ENB A;  1A5X A;  4TKN A;  2BDP A;  2QXF A;  4DTO A;  4H5W A;  2E6M A;  2YHX A;  1JJ2 M;  2KW4 A;  4AQY K;  3DOL A;  1HKC A;  1MIX A;  4BRO A;  4DSE A;  4B3O A;  5GIP A;  3NDK A;  1T8E A;  3F2K A;  4FJL A;  3TAM A;  1RT6 A;  4E7I A;  1VBG A;  1EQY A;  1TV6 A;  3VQ5 A;  1JLG A;  3CCQ N;  2P9U B;  2F9T A;  4BR2 A;  1T7P A;  5FRM A;  4BRH A;  3S41 A;  3O9U A;  2P9I A;  4BRA A;  3QFU A;  2NRV A;  5AFU H;  1VQP N;  4CBX A;  3VQ6 A;  4KAZ A;  3PVL A;  3OYI A;  1BI4 A;  4BR0 A;  3A2F A;  3VF4 A;  1XI1 A;  4O8K A;  3TAR A;  2ZPY A;  3HPG A;  4RW6 A;  1WNS A;  2J0J A;  3NVK A;  4WFN L;  3T1Y K;  4FJ8 A;  2A41 A;  1VQ4 N;  1RTI A;  3SYZ A;  4CZF A;  4FWO A;  1BQM A;  4QOZ B;  1I39 A;  4H8K A;  4B9S A;  1NK6 A;  3VN5 A;  3CCJ N;  4E3S A;  1KTQ A;  1VQN N;  2BH1 A;  5EOY A;  1FK9 A;  1VSK A;  4IFE A;  4CZM A;  3VQP A;  2VCP A;  1GLD G;  3T69 A;  3NCI A;  3O4W A;  3M8P A;  5KI6 A;  2LSN A;  2F96 A;  3ZSQ A;  1VQ8 N;  3K5M A;  4JKG B;  3D6R A;  3UIQ A;  1GC6 A;  5GIN A;  3VEN A;  4WFA L;  3K9J A;  4H0T B;  4F7G A;  4FO0 A;  4K8X A;  3SAH A;  4YOT A;  3OBY A;  4YOX A;  2ZGY A;  1WLJ A;  4C8K A;  3DYA A;  4OPH A;  1D9F A;  4Z0U A;  2QKB A;  3VEZ A;  2A42 A;  2O8C A;  3MEG A;  1B9D A;  3CI5 A;  4B1Y B;  2PAV A;  4KI4 A;  2ABD A;  3IUC A;  1NJX A;  1EWR A;  5AFU A;  4K43 A;  1V4S A;  4IFY A;  3ZX0 A;  4HUE A;  3ZX3 A;  4U67 L;  2RQ1 A;  2NZT A;  4CHN A;  4DQQ A;  3PO4 A;  2A5X A;  2EMT A;  3L2R A;  3FZK A;  1ZBI A;  1IO2 A;  1TKD A;  4DQS A;  3D2F A;  1UAX A;  4OVL A;  3V6D A;  2P51 A;  4DKW A;  4M3U A;  4EIA A;  4H03 B;  3RRH A;  3QES A;  4K25 A;  4KPY A;  3H1V X;  2D4W A;  3NAE A;  3PUF A;  2P9N B;  3CFP A;  1LW2 A;  2AA4 A;  3KZB A;  3CPE A;  3DMJ A;  5JLH A;  2W6K A;  3IG1 A;  2GV9 A;  1HQE A;  2NLX A;  1QVF M;  4JK7 A;  1GLB G;  1EXQ A;  5AQM A;  1NK5 A;  1WUA A;  3OW2 M;  2RHK A;  3LDP A;  1VQ5 N;  2A1S A;  2W40 A;  3SNN A;  3HXM A;  2KFZ A;  5F1X A;  5HRS A;  1NOY A;  4DSF A;  4DF8 A;  4IDH A;  4B9L A;  2YKN A;  4WFB L;  2DFH A;  1VSH A;  1VQK N;  4DG1 A;  4KHP K;  3R3L A;  1UOC A;  4NB4 A;  2G8H A;  3ULD A;  4CEZ A;  4B9T A;  4NXN K;  2ATQ A;  1MK9 B;  3QEI A;  4A61 A;  4C1N I;  5M1F A;  3BY5 A;  3EPY A;  1RTH A;  1LCU A;  2NRZ A;  5T7B A;  4EAH D;  5C2D A;  2P9U A;  1GLC G;  3SBT A;  5AQX A;  4CD1 A;  1XWL A;  3OBW A;  1BL3 A;  2UXC K;  3OYB A;  2JWL A;  3OY9 A;  3J7Y P;  5I3U A;  4E0D A;  2ITM A;  4M3X A;  4GNI A;  3NGY A;  3THX B;  1X9M A;  1LWE A;  2FBX A;  4NCB A;  4CZK A;  2HHQ A;  1RTD A;  1RBU A;  3DLE A;  2OPP A;  4ISG A;  3SAG A;  1IBL K;  2IGI A;  3U9D A;  1XQS C;  1KVB A;  4CEA A;  1D9D A;  4DV1 K;  1SL1 A;  1EET A;  1NK4 A;  1KFS A;  1XUP O;  1CXU A;  1JLQ A;  3VQA A;  5GIO A;  3MXJ A;  4H0V B;  3IDH A;  3RR8 A;  3HSC A;  3TTC A;  1MDU B;  4JKA A;  5C25 A;  3NH2 A;  4DTJ A;  3N4P A;  4FW1 A;  1TAQ A;  2IVP A;  3QNO A;  1EWQ A;  4DTS A;  1QSL A;  3HZ6 A;  3VGK A;  2D0C A;  4KFB A;  2X6S A;  3K5O A;  5F0X A;  2Q36 A;  4E1M A;  1S22 A;  3P39 A;  4E7H A;  4JKG A;  1JLB A;  4MQ3 A;  3NF8 A;  4FJ7 A;  4CBW A;  4Z4G A;  3LP1 A;  5BPN A;  3SI6 A;  3LAL A;  2IS3 A;  2YNH A;  4DV5 K;  1QSS A;  4ELU A;  2ZQB A;  3E9O A;  5AQF A;  1DTQ A;  4H0O A;  4WQ5 C;  2NRR A;  1RBT A;  3Q7C A;  1X9S A;  2HW3 A;  3OYM A;  1EX4 A;  3E01 A;  2Q31 A;  2G8V A;  3FLC O;  5FDL A;  3ZSZ A;  3QEW A;  2GEM A;  2QK9 A;  3LZI A;  1SS6 A;  3AVB A;  1U48 A;  1YIJ N;  4CZI A;  1D4X A;  1LWF A;  2YNF A;  3GBT A;  3QIO A;  5BRF A;  1QHA A;  4BRQ A;  4W5T A;  4DV2 K;  1HKG A;  3UKR B;  2O8D B;  2FJ9 A;  3QER A;  5AQT A;  3EL2 A;  5KQD A;  3G10 A;  3OTO K;  2EWS A;  4ZRK A;  5BRE A;  4K0K K;  1JLE A;  3RRG A;  2YNG A;  3R1X A;  1RTJ A;  1SKR A;  4DFM A;  4IJA A;  1NKE A;  4CJ4 A;  4HCC A;  1BCO A;  3F73 A;  1A5V A;  2XHB A;  1KRP A;  2P9N A;  3HT3 A;  1GC7 A;  3O80 A;  4ID5 A;  4I2P A;  5FPM A;  2QWL A;  4FM0 A;  4JYA K;  2I5J A;  2QXL A;  2YI1 A;  4FK2 A;  3NHG A;  4JKC A;  3SUN A;  3ATV A;  2RKI A;  3ASM A;  3KIO A;  2AEH A;  3FLV A;  5C2F A;  1VQL N;  1KVA A;  1LAV A;  5M1N A;  4LF6 K;  3I0R A;  2WBN A;  4BGA A;  4IO9 L;  3S3M A;  3KLG A;  3MWT A;  4N76 A;  3MED A;  4C8M A;  1D8Y A;  4FYD A;  5JVG L;  1ZYQ A;  3VQ4 A;  3O08 A;  5HRP A;  4BR4 A;  5CZ2 A;  3KLH A;  1RT1 A;  4AIL C;  4A5A A;  4ID1 A;  1NNE A;  4A62 A;  2QW9 A;  1KAX A;  1WB9 A;  4DR4 K;  3WT0 A;  4N56 A;  2NRX A;  3T1H K;  3O9Q A;  3FP5 A;  4B1U B;  4GKJ K;  4IOX A;  4IG3 A;  3VER A;  1IV0 A;  2CB8 A;  4JKE A;  3R8E A;  1YTA A;  2BE2 A;  3CCV N;  4PHT X;  2XY5 A;  3THX A;  3SV4 A;  3NH0 A;  3JS6 A;  3QIP A;  4EZ9 A;  4JNE A;  1F21 A;  4OGE A;  3ZT3 A;  4CIG A;  2PYL A;  3OYL A;  1NOZ A;  1BWF O;  4DR7 K;  1YT3 A;  4FWR A;  3RMA A;  2BAN A;  1RDW X;  5AQR A;  3O4Q A;  3BZC A;  4CJK A;  1E3M A;  1Q18 A;  3L4I A;  4IWV A;  4CJ5 A;  1S72 N;  1HNZ K;  5KTQ A;  3CCL N;  4MDB A;  1ASW A;  3C0B A;  3LM9 A;  3KK1 A;  2Q97 A;  4RTF D;  3A8Y A;  1R0A A;  4CI6 A;  3E9P A;  3T7Z A;  4BE1 A;  3SQ0 A;  2DTU A;  4B3R K;  3P83 D;  3VOV A;  3SUP A;  5DMR A;  4BC4 A;  1IJJ A;  3CM5 A;  4BVP A;  1EF1 A;  4OKE A;  4CHO A;  4FW2 A;  2G8I A;  3T3F A;  2FSK A;  4BQL A;  2E8A A;  5TKW A;  1NM1 A;  2W42 A;  4CJF A;  1E4G T;  4RCH A;  3S9H A;  4JS4 A;  4MO4 A;  3ZX2 A;  3AO2 A;  2DY4 A;  1XNQ K;  4Q0B A;  4NLB A;  1C0U A;  4F2S A;  1L3S A;  2OPS A;  4GV3 A;  2P9K B;  1QS4 A;  3UKR A;  3W3D A;  2HF4 A;  3BEX A;  4CED A;  4EHT A;  4N5S A;  4FLU A;  1GOC A;  1TAU A;  3ZCM A;  3RMB A;  3A5L C;  4FK0 A;  4J2B A;  4YDU A;  1S1W A;  3C7N B;  1BCM A;  4WQ4 A;  2DPN A;  2ZJR L;  4X65 K;  4DSL A;  1X9W A;  1RBS A;  3K57 A;  4JI3 K;  3LAM A;  3CC4 N;  1NGG A;  3HP9 A;  5AQN A;  4BR5 A;  5AQK A;  3AVG A;  1ST7 A;  4GVE A;  3MMV A;  2YJF A;  3A5M C;  5MLC Q;  1NTI A;  4P7I A;  4B1V A;  3C6U A;  5AZJ B;  4O0I A;  1X3M A;  2IAJ A;  4KBO A;  3MX5 A;  5J2Q A;  1HQU A;  3A5N C;  3AA3 A;  5DK5 A;  2YJE A;  4MLE A;  1GLA G;  1ZBS A;  3LWL A;  1NK0 A;  1JDE A;  3P5J A;  1WSE A;  1Q7Y O;  1N8R O;  2XO7 A;  2F9W A;  4B1Z A;  3WXM B;  1DLO A;  2Y1I A;  2D0O A;  2NRW A;  2VWK A;  3H46 O;  1T6D A;  3OS1 A;  5AQS A;  3G0Z A;  2DIK A;  2WTU A;  3EN9 A;  5J2P A;  3K58 A;  3CQX A;  1NJW A;  1SUQ A;  3I55 N;  1MWM A;  4Y0W A;  2ASO A;  3L6Q A;  1SZ2 A;  5KPZ A;  2R7Y A;  4FWQ A;  4CJW A;  1YHQ N;  4Z4E A;  2G8U A;  4BR7 A;  4CHP A;  4AH9 A;  2P5G A;  2XRI A;  4DR5 K;  1RDD A;  3VES A;  4ILG B;  4DQP A;  1RT3 A;  3MN9 A;  2RN2 A;  3OS0 A;  4DTN A;  4DFJ A;  4DR3 K;  1YF5 L;  2WON A;  4YNQ A;  4JEP A;  1JL1 A;  4HWI A;  4KHS A;  3JYT A;  2CQU A;  2HRJ A;  1RDA A;  3VA3 A;  4J2E A;  2GWK A;  3AAP A;  5BRH A;  3PIO L;  4HTL A;  4FJI A;  5C12 A;  1RFQ A;  3TAB A;  1BGX T;  2VYP A;  3TSU A;  3B6P A;  3MK6 A;  4CF0 A;  1W97 L;  3SQ1 A;  4BRI A;  4GVM A;  1VSF A;  3PY8 A;  1YXQ A;  4N41 A;  2BUP A;  4EKU A;  4CJT A;  2PBD A;  3G25 A;  4F3T A;  2COP A;  4O0J A;  1KAY A;  1NWK A;  4KHQ A;  1HB6 A;  1RIL A;  5HBM A;  3EY1 A;  1TL1 A;  3CD6 N;  2IOC A;  4DU3 A;  1M90 O;  3LAN A;  4FJH A;  3AAR A;  4E1N A;  4FJX A;  4NYF A;  4YFU A;  2B5J A;  5AQL A;  1BIS A;  4BRE A;  4DHY A;  2QWN A;  4KO0 A;  4HDO A;  2P9K A;  3CFR A;  2YVC A;  4BQZ A;  5M1O A;  2VGN A;  4JN4 A;  1V4T A;  5CYQ A;  3V81 A;  2E2P A;  3C7N A;  2HOE A;  4H5T A;  2OPR A;  2P9L B;  1BO5 O;  3DAW A;  3V4I A;  4FM1 A;  2AP1 A;  1U47 A;  3LAK A;  3ITH A;  3AO5 A;  3D2E B;  2JWK A;  1VSE A;  4ELT A;  1J5O A;  2QWQ A;  3PSI A;  1LV5 A;  3KWG A;  3TPQ A;  3CC7 N;  1KC7 A;  3C6H A;  4EZ6 A;  5IJM A;  3QNN A;  2J4R A;  2QI2 A;  4CF9 A;  4E1J A;  1TK0 A;  4IEI A;  1R59 O;  3NF6 A;  5AQJ A;  3U3Y A;  3DLR A;  4JLH A;  3AVL A;  4IG0 A;  4B8C A;  3LL3 A;  1TVR A;  2PYJ A;  1RNH A;  2CH6 A;  3HRG A;  4CHQ A;  4DLE A;  3OYG A;  1H4R A;  4IEE A;  3ID8 A;  4L3Q A;  4FZY A;  4PKH A;  3QET A;  3CM6 A;  2YHA A;  1HUX A;  4JI7 K;  2VGM A;  4BC2 A;  5B8H A;  1TUU A;  3BF1 A;  3DLG A;  3U7D A;  1HYV A;  4M7X A;  1GLF O;  3EO3 A;  3L3U A;  2YX6 A;  2I7N A;  1RCH A;  1RDC A;  3U3G A;  3GOI A;  1SAZ A;  4CEO A;  3HPO A;  3LDL A;  1BG3 A;  3ZLJ A;  1I3A A;  3LZJ A;  3BF3 A;  1DIK A;  1RT5 A;  5EXW A;  3OYK A;  4DFK A;  4DTM A;  4JK8 A;  3R9P A;  1CZ9 A;  2Y1J A;  3OA9 A;  4E89 A;  4OLA A;  1Z6R A;  4BWM A;  4F9O A;  3GE1 A;  3M1F A;  4O44 A;  4G1Q A;  4JI2 K;  3FE1 A;  3A0I X;  5JMV A;  5TKY A;  1QHT A;  3M5R A;  5CE3 A;  5FRN A;  1KAZ A;  5AQI A;  3QO9 A;  4R5P A;  4FWP A;  5KPR A;  3U8Z A;  1Q9Y A;  1W0H A;  1QQN A;  1EKE A;  4DSI A;  4DU1 A;  1OKJ A;  3FZM A;  3M6G A;  3C95 A;  1U04 A;  3HST B;  3HOS A;  1G99 A;  3BP8 A;  2FBY A;  4I9L A;  4NYN A;  4U7B A;  5CZ1 A;  2A1R A;  1NK8 A;  2QKK A;  1M1K O;  2GUP A;  3DXK B;  3AV9 A;  4CJE A;  5JS2 A;  4YL8 A;  1NGA A;  4MFB A;  5GAH P;  2P9S B;  3KLE A;  1Y97 A;  2E88 A;  4WYB A;  4GV6 A;  1BOT O;  3WNG A;  4DV4 K;  1HPZ A;  2EHG A;  3MEC A;  2VQE K;  4KTZ A;  1NKC A;  3T19 A;  4JHD B;  1VQ6 N;  4XIU A;  3J81 O;  4BRP A;  1ATN A;  1KBL A;  1MU2 A;  2G8K A;  2HHS A;  3KK3 A;  2RPI A;  1WSF A;  3LPT A;  4H5N A;  3AGR A;  3JSM A;  4AHU A;  3O9S A;  3RMD A;  2FF3 B;  1TGO A;  1BIZ A;  4IBN A;  3QEP A;  4J2A A;  3OYJ A;  2XY8 A;  2UXD K;  4DF4 A;  2P9L A;  4DWI A;  4F3O A;  3O4N A;  4DUZ K;  4EFH A;  1T6C A;  4JI6 K;  4BG9 A;  4IDK A;  2GX9 A;  3V9Z A;  4RWT A;  3TU5 A;  1E5W A;  3RTV A;  3D2E A;  1J6Z A;  1HPM A;  3FZF A;  4KI6 A;  1RBR A;  3J80 O;  1WN7 A;  1S1T A;  3NFA A;  1NU0 A;  5K14 A;  1K6Y A;  3X23 A;  2FSN A;  5AQG A;  4M3T A;  2QEX N;  2KHO A;  4CJL A;  1JXB A;  1UA0 A;  3TAG A;  2RF2 A;  3FZL A;  4BRF A;  5FPD A;  5JIC A;  4K42 A;  3HM8 A;  1JCG A;  3SV3 A;  4CD3 A;  3OYH A;  4LH5 A;  4KKO A;  3QEV A;  3AVM A;  4MLH A;  4ICL A;  1FKP A;  2B6A A;  1TKZ A;  2V7Z A;  4EP4 A;  5AQU A;  3VF6 A;  4QS8 A;  2ZJQ L;  4H4O A;  4B9U A;  2FC0 A;  3HYF A;  5D3G A;  1U49 A;  5DM6 L;  2D2Q A;  2V7Y A;  3P1G A;  4H0P A;  1YUW A;  3DLK A;  4Z94 A;  1XMO K;  3PLA A;  1NGF A;  3VTI A;  1NK7 A;  4H4M A;  1GOA A;  3ISN C;  4OPK A;  3GL1 A;  3JXU A;  2GTD A;  2HHH K;  4OX9 K;  4O8U A;  4FPB A;  3UE5 A;  5KRT A;  1KXP A;  4PKG A;  1XMQ K;  4LC9 B;  5E26 A;  2A6A A;  1NI2 A;  4W5N A;  3WXK A;  4DQ8 A;  1TK8 A;  4HDQ A;  5EX5 A;  1DEJ A;  1X1P A;  4J8F A;  4LF8 K;  3WQT A;  4FPA A;  4FXD A;  4DV0 K;  1VSD A;  4FVU A;  3QBW A;  4Y1D A;  3PX0 A;  2JGU A;  1VHX A;  2HHW A;  3KKS A;  3CCE N;  4XH4 A;  5CYM A;  3W0L A;  2ZF5 O;  4TSX A;  3SQ2 A;  1T44 A;  3M8S A;  3VEV A;  3H3N O;  1WSI A;  2ZE2 A;  4CIF A;  3CJ9 A;  4AHT A;  2X74 A;  1UA1 A;  1NGD A;  2ITG A;  4CK1 A;  4KB0 A;  1BA1 A;  4JD2 B;  2UUC K;  3V1R A;  3DWL A;  2VG7 A;  2HNZ A;  5CHI A;  5HOO A;  1N32 K;  3MN7 A;  4DS4 A;  2D5R A;  3DXK A;  1RT2 A;  3AVN A;  5DM7 L;  3CJC A;  2O4I A;  3H6E A;  3HJF A;  4FLT A;  2D11 A;  2P9S A;  2E5L K;  4KH4 A;  1HJR A;  1ACA A;  1CLQ A;  4CGH A;  5KRS A;  1Y64 A;  4CF8 A;  4IXC A;  3CQY A;  4DSJ A;  3LP2 A;  3WXL A;  3PO5 A;  4JHD A;  4CJU A;  4C23 A;  3AU5 A;  4LY7 A;  4F4K A;  2IIR A;  3KK7 A;  1NJZ A;  4B1X B;  1QSY A;  1OH8 A;  1S5J A;  1FJG K;  3HP6 A;  1YTU A;  1N34 K;  2X0S A;  4AM6 A;  1YAG A;  1FKO A;  3GDQ A;  2NRH A;  2X78 A;  3ZT2 A;  3OVN A;  1L3U A;  1WAJ A;  2WC9 A;  4HUG A;  5F2R A;  5AQQ A;  4X64 K;  3O8M A;  3CG7 A;  3KJV A;  1OH6 A;  1IH7 A;  5I42 A;  1HR0 K;  4Y1C A;  4IKF A;  1X3N A;  1EO1 A;  5LJV A;  1KD1 O;  1J5E K;  4CGD A;  4LF4 K;  4A59 A;  1KSP A;  1P8Z A;  3CER A;  4AHS A;  3TI0 A;  1O13 A;  2HBM A;  1U2V B;  3M8R A;  4BDZ A;  1HNI A;  3CF5 L;  1BA0 A;  4UY8 O;  4CGI A;  4CIE A;  3P38 A;  3CXC M;  4DTU A;  4CK2 A;  4E7L A;  1XHX A;  3LP0 A;  2AL6 A;  4HTU A;  1XC9 A;  4PKI A;  3LPU A;  4BDY A;  3O9R A;  3KK2 A;  3QLH A;  3SUQ A;  4C8O A;  3PV8 A;  4WF9 L;  5AZI B;  4FL9 A;  4L8R B;  1C6V A;  2QA4 N;  1VRU A;  3L8B A;  3V9X A;  2AJQ A;  1ZXO A;  2E1Y A;  5LJW A;  4E19 A;  3M8Q A;  4RW8 A;  2GBZ A;  3QML A;  1WOQ A;  3D45 A;  3LDQ A;  2P5O A;  3OYE A;  4M3R A;  4MO5 A;  4LD0 A;  2KKZ A;  1YVN A;  1WBD A;  2NRT A;  3KD5 E;  4B1W B;  1IG9 A;  5AQP A;  3NGZ A;  5I9E B;  4JI4 K;  2FF6 A;  3OJS A;  4CFA A;  1VQ7 N;  3VMF B;  1C1C A;  4FOI A;  5GAG P;  3FFK B;  5AQZ A;  5IT9 O;  4OPJ A;  4ILJ A;  2CGL A;  2XY7 A;  3F5T A;  5BN9 A;  1S6Q A;  2ZJP L;  3BGR A;  4LFC K;  1VSL A;  4LF7 K;  1QQC A;  1HMV A;  3MDQ A;  1VQO N;  4CZH A;  2WH5 A;  4BC3 A;  2YHB A;  5JS1 A;  3VF2 A;  1SGH A;  1RT4 A;  4FWS A;  3WNF A;  1QE1 A;  5M1Q A;  5FRO A;  5E84 A;  2JLE A;  3WNH A;  4Z4I A;  1IKV A;  1GOB A;  3MWP A;  3CME N;  4QCL A;  2O8D A;  4JD2 A;  1S1X A;  1WSG A;  4IFV A;  2E2Q A;  4M45 A;  3T1A A;  3C6T A;  4PL8 A;  4DUY K;  4KRE A;  3OS2 A;  2I1J A;  2I7P A;  3EE9 A;  4CEE A;  4HVJ A;  1SKW A;  3DLB A;  4JV5 K;  2LBB A;  4IJN A;  2DFE A;  3HO1 A;  2HMI A;  1EP4 A;  1KLM A;  4LFA K;  2I1K A;  1MK7 B;  3U6F A;  2WOM A;  4RG8 A;  2G8W A;  1ZBL A;  3EKU A;  1ATS A;  3AVF A;  2PFU A;  4Q5V A;  2HBL A;  2HVH A;  3J7A P;  4DU4 A;  4M63 C;  4CF1 A;  3NMU A;  4FLW A;  3LDS A;  4E7K A;  4B3T K;  4ZTF A;  3O5B A;  1QVG M;  4B9N A;  3NH1 A;  4NLC A;  3ZSV A;  3E9L A;  4OO1 J;  4DQI A;  1GLJ O;  4KHU A;  4RW9 A;  4KH5 A;  2HHT A;  4YHH K;  3HVT A;  4CJR A;  1NGC A;  3HK2 A;  4YOV A;  1KFD A;  1NG9 A;  3UB5 A;  5IWA K;  4FJG A;  2HHV A;  1VAZ A;  4JKB A;  3BUZ B;  4FJM A;  4XH5 A;  2E1Z A;  3G6E N;  5AQV A;  1S9G A;  3C94 A;  3Q7B A;  4PY5 A;  1U6Z A;  1S1U A;  4F2R A;  5AQY A;  4FVM A;  1U2V A;  3HI0 A;  4N47 A;  1TKT A;  3I0S A;  1HNW K;  4R79 A;  4CYE A;  1B9F A;  1YJW N;  2Q1N A;  3CHW A;  2VG6 A;  3TWH A;  4DTX A;  5JVH L;  2FBT A;  3AO3 A;  2OAN A;  3N4Q A;  4NCG A;  3S3N A;  2OZS A;  4WQ5 A;  2E6L A;  5AZI A;  3SJH A;  1K8K B;  3DOK A;  2EX3 A;  2ZD1 A;  5KQ8 A;  1G15 A;  3M3Z A;  1JCF A;  4LH4 A;  2F8T A;  4KTW A;  3HM9 A;  3EYZ A;  1VRT A;  4AHC A;  4PA1 A;  1S6P A;  4C8L A;  3TAN A;  4LF5 K;  1LOT B;  3CCR N;  2H3G X;  4DTR A;  3C6A A;  3O3G A;  3WEE B;  3TTD A;  4W5R A;  1OH7 A;  2DFF A;  5E41 A;  1ILY A;  3ZT0 A;  4DS5 A;  4ILH A;  3THW B;  4CFB A;  3MAQ A;  1BHL A;  1P90 A;  1NMN A;  1O1W A;  3J7Z O;  3MXM A;  2ZM6 K;  1GLL O;  1NGB A;  4Z4H A;  1NK9 A;  3VQQ A;  3H45 C;  4AF1 A;  3VQ7 A;  3DRP A;  4DQR A;  1Q8I A;  5M1P A;  4B08 A;  4BVO A;  4CVN E;  3K0S A;  4FOE A;  2F7T A;  4FWN A;  1DT9 A;  4WCE L;  1KQS M;  2ASP A;  4B9V A;  5C0Y A;  2QM1 A;  1ASV A;  5AJ3 K;  4X62 K;  5C24 A;  1T03 A;  1UWB A;  2D0A A;  3KLI A;  1HRH A;  4BE2 A;  4H0Y B;  3L3V A;  1RGI A;  2VWJ A;  1K73 O;  4A2B A;  1N6Q A;  5AZJ A;  4K41 A;  5BR9 A;  3WUH A;  2O8F B;  1U4B A;  3VQ9 A;  3VET A;  3K2P A;  4BE0 A;  2KLA A;  4DMN A;  4FM2 A;  3KTQ A;  2D0P A;  2YHY A;  3ATU A;  4W5Q A;  3CQ8 A;  3RMC A;  1SL2 A;  1VQ9 N;  4MDA A;  2O4G A;  1VSJ A;  1JCE A;  3NVM A;  4NO7 A;  3NE6 A;  5HLF A;  3CYM A;  2KFN A;  3WA0 A;  1K8A O;  3FZH A;  4OGC A;  4CGJ A;  4CW7 B;  2GWJ A;  3AO1 A;  4BRM A;  3NF9 A;  4GMJ B;  3TSP A;  2HF3 A;  3HVR A;  4H5V A;  3VA0 A;  3CJ7 A;  1W2B M;  3J8A A;  1JL2 A;  4DLG A;  3E66 A;  1HYS A;  1BUP A;  2Z1I A;  2HHX A;  4DV3 K;  4GKK K;  3ENH A;  1GLE G;  3AVA A;  3PSF A;  4ISF A;  3U9Z A;  4CZJ A;  1QZ6 A;  4KHY A;  4K8Z A;  3ZEU B;  2FLO A;  1BQN A;  1TKX A;  2ZGZ A;  4CGG A;  4YOR A;  4CHZ A;  4IOC L;  3ZSR A;  4CJS A;  1K8K A;  3QBX A;  2UUB K;  2QWO A;  2A3Z A;  1HYZ A;  2CGK A;  1ASU A;  4JAX A;  3ID6 A;  3MCP A;  1CXQ A;  1TYQ B;  3P31 A;  3FFI A;  3CJA A;  4FLY A;  4GXB A;  3L2U A;  3O1B A;  4LF9 K;  4WE1 A;  2OTL N;  1W7A A;  4CEC A;  5KGW A;  2KZM A;  2BTF A;  4CHY A;  1XNR K;  4FZZ A;  4EP5 A;  1Y19 B;  1S9E A;  2E2O A;  3U8X A;  3WEE A;  4BR9 A;  3G9W A;  3K59 A;  3PX4 A;  4FLZ A;  4GY2 B;  5J2M A;  3THW A;  1HNX K;  3K5N A;  1C1B A;  2Z1J A;  3AVI A;  3THY B;  3DM2 A;  1TL3 A;  3PIP L;  4FZX C;  4AHR A;  2OZM A;  3KVG A;  1C1A A;  4JI5 K;  2IC3 A;  3AA4 A;  1Q82 O;  3AU4 A;  3UKU B;  1A5W A;  2P1J A;  3AA2 A;  2KZZ A;  5BR8 K;  4BAC A;  2OCE A;  3ENO A;  2GUI A;  1J9A A;  3OYF A;  3VPZ A;  1VK0 A;  2HBJ A;  1VSM A;  1HLU A;  4JKD A;  4KV8 A;  3IKM A;  4DR1 K;  1NGE A;  5FLX O;  3H08 A;  3A5O C;  4CZG A;  3CET A;  1C0G A;  4E7J A;  3L4Q A;  3TTF A;  1HKB A;  2NUB A;  2HE7 A;  4CF2 A;  5HP1 A;  1ITG A;  3HTV A;  1Z05 A;  2HHU A;  3QEX A;  2D0B A;  2O8F A;  3V9W A;  5LY3 A;  2XY6 A;  3SMP A;  1MWK A;  3ZYY X;  4YDU C;  1QZ5 A;  3OYC A;  4DB3 A;  4PWD A;  4WQ4 C;  2GEL A;  3SBG A;  4J2D A;  3GG4 A;  1NLV A;  3ZT4 A;  2ZWH A;  4BC5 A;  3ZET B;  4V19 S;  1NJI O;  3WQU A;  4PUO A;  3QIN A;  2R82 A;  1X9J A;  3EEQ A;  1SQK A;  3CCU N;  1KLN A;  1CZA N;  4BRL A;  4FJN A;  2QTD A;  5HRO A;  3IVF A;  5J2N A;  4G9Z A;  4HCB A;  5C15 A;  3NF7 A;  3OHR A;  4DCH A;  4YOU A;  2YNI A;  4QAG A;  5SWM A;  1ESV A;  4OKJ A;  1LAW A;  1OVY A;  3DXM B;  4GW6 A;  5HRR A;  4CZE A;  5SZT A;  1Q86 O;  3DRR A;  3IS9 A;  4BGB A;  5BPL A;  3ZT1 A;  4I6M B;  5HRN A;  4X66 K;  4CEQ A;  2HBK A;  5KPT A;  1L3T A;  3RWU A;  4BDP A;  2J0M A;  1RDU A;  4OJR A;  2IVO A;  3ZEU A;  2O8E B;  3C65 A;  1HB8 A;  5KGX A;  3OJU A;  3LWM A;  5BPM A;  4KB1 A;  1IKY A;  1J19 A;  2HMP A;  2J0K A;  3THV A;  1WAF A;  3K5L A;  2Q2R A;  3VQC A;  4Z4F A;  2Z1G A;  3DJC A;  3RR7 A;  1TYQ A;  3BZK A;  1IBK K;  3TAP A;  3IAY A;  4DSK A;  1OH5 A;  4BRK A;  4H5R A;  1ZBU A;  5EU7 A;  5LMU K;  3PX6 A;  1FXX A;  3DI6 A;  2CH5 A;  3VGM A;  4FJ5 A;  3MX2 A;  4CE9 A;  4CJP A;  4JI1 K;  3LDO A;  4DTP A;  3VEX A;  3FR0 A;  4ZRJ A;  4BG8 A;  1LWC A;  2D1K A;  3MCA B;  4JKF A;  5FPE A;  3WXI A;  4QS9 A;  3TAF A;  1B92 A;  4CER A;  1J54 A;  1T05 A;  2EMS A;  2OYQ A;  2HVI A;  3QIC A;  3NGI A;  3S3O A;  2HST A;  4EHU A;  4W5O A;  3THY A;  1NJY A;  4OLB A;  1RDB A;  2OPQ A;  3B6O A;  3MN6 A;  5JVL A;  4A5B A;  1E4F T;  2WUS A;  2D10 A;  2KQ2 A;  4JI8 K;  4CGF A;  3V1O A;  5EVZ A;  1K9M O;  3AGK A;  4HHT A;  3AA5 X;  3SCX A;  4M3Y A;  3AVJ A;  3UKU A;  3F9M A;  1SV5 A;  3O1W A;  4CJQ A;  4YOY A;  1DGK N;  3KWI A;  2OTJ N;  3ULE B;  4CES A;  1IKW A;  2UUA K;  2VG5 A;  3PZD A;  1DKG D;  2P9P B;  4A57 A;  1JKH A;  4F8R A;  3MEE A;  3V9U A;  1Q9X A;  4M41 A;  1DTT A;  4JRQ A;  3VEW A;  4O5F A;  4BRD A;  4H0X B;  2QWM A;  3SJJ A;  4CJ7 A;  3NBP A;  4BRG A;  2IDO A;  4FLX A;  3CJB A;  3ZSY A;  3QDK A;  4OKK A;  3QFP A;  3TAE A;  1C0T A;  2B4J A;  2PZS A;  3SLC A;  2Q0R A;  1WSH A;  5AQO A;  4LFB K;  3I56 N;  3QIJ A;  3WXJ A;  2E4L A;  3ZET A;  3VQ8 A;  3ALY A;  4YY3 K;  1MA9 B;  4BRN A;  3EZ5 A;  1NKB A;  1N33 K;  4KRF A;  5ELZ A;  1TK5 A;  1Z26 A;  5AQW A;  3CIP A;  1NGI A;  2HND A;  3SUO A;  4LSL A;  3CMA N;  4FCY A;  1KCF A;  3HL8 A;  1D5A A;  3DXM A;  4CEB A;  2W41 A;  3G4S N;  3SPY A;  2E2N A;  4I6M A;  3O9T A;  5GAE P;  3RSE B;  2UU9 K;  3V1Q A;  3VQB A;  4CFC A;  4FJ9 A;  4KTQ A;  5CY4 A;  4A2A A;  1U45 A;  1N36 K;  2O8E A;  2YKM A;  2HB5 A;  1QTM A;  1IKX A;  4NY0 A;  3DLH A;  4FSV A;  4LSN A;  3EKS A;  5CR4 A;  1QQM A;  5LL6 Z;  4XEI A;  3SK3 A;  4BY9 C;  4O55 A;  4GV9 A;  2HNY A;  2OA8 A;  4ISE A;  2G8F A;  1HX1 A;  1NMD A;  4CBU A;  3L2V A;  2FSJ A;  1SKS A;  3B8A X;  2X6N A;  1NBW A;  2NNW A;  1YI2 N;  1HJO A;  3CFO A;  3VQD A;  4DFP A;  1RBV A;  4JKH A;  3K9K A;  4M7Y A;  5EY4 A;  1NVL A;  2FXU A;  1FW6 A;  1LW0 A;  4DV7 K;  3SQ4 A;  4IOA L;  5M1K A;  1ZBF A;  1JLA A;  2QWP A;  4C1N K;  1WBB A;  4B3S K;  4B9M A;  3EZW A;  3D0P A;  1ZBH A;  3BDP A;  4ELV A;  1NGH A;  3V9S A;  2O8B B;  1C0M A;  4AM7 A;  2ETJ A;  1IBM K;  3IMX A;  1BDG A;  3KKR A;  1BU6 O;  5JLF A;  3D7E O;  4CJV A;  3G71 N;  1KVC A;  3ULE A;  3CPW M;  4DXA B;  4M42 A;  1ISN A;  5A2Q O;  5GAD P;  4NCA A;  2Q3S A;  2Z1H A;  2P9P A;  3KLF A;  1HNV A;  1W9H A;  3JAM O;  4B3M K;  3H3O B;  4CK3 A;  4CEF A;  4IZ9 A;  3TSQ A;  3O3H A;  2RE2 A;  3KD1 E;  4FWK A;  1KC8 O;  2VWB A;  4AHV A;  2YCH A;  2WFB A;  2PY5 A;  2P9I B;  5AR0 A;  3I8B A;  3IRX A;  4JRP A;  3I33 A;  2UYT A;  4I7F A;  2CGJ A;  3AO4 A;  4HUF A;  1BI4 B;  1ATR A;  2UXB K;  4CZL A;  4KH6 A;  4QS7 A;  4DV6 K;  4NXM K;  4JS5 A;  3SZ2 A;  1L5U A;  4M3W A;  3TR8 A;  3L0Q A;  3P4I A;  2KTQ A;  1IG8 A;  1JXE A;  3ZSO A;  3H1Q A;  5HL7 L;  4RW4 A;  3LM2 A;  1XC3 A;  2F8S A;  1YJN N;  2E20 A;  3SPZ A;  2YV0 X;  4ZHR A;  2VQF K;  3IFR A;  1L3V A;  4FJJ A;  5J1E A;  1NGJ A;  4FK4 A;  3VTH A;  1VSI A;  4IO8 A;  4BRC A;  5ADX H;  2BGG A;  4CJ3 A;  1S1V A;  3AVC A;  4KHW A;  3WNE A;  1JLF A;  3FGU A;  3VEY A;  3EE8 A;  4M3Z A;  4ZTJ A;  2V51 B;  4FWM A;  2FDQ A;  3O3F A;  1CZB A;  3R6M A;  3RSE A;  3HBT A;  3I8D A;  1GGO A;  3L2Q A;  3MXI A;  2FBV A;  1S3X A;  3TAQ A;  5BRD A;  5LMN K;  3RVC A;  1Z25 A;  1H1V A;  4FWL A;  1YIT N;  1ZC6 A;  2V52 B;  4KHN A;  3AVK A;  4PQU A;  2A40 A;  3CCS N;  1VQM N;  1TUY A;  5AQH A;  3ZSW A;  2W6L A;  3AAQ A;  1N5Y A;  3LDN A;  1XHZ A;  2O8C B;  1JLC A;  2IVN A;  2F4V K;  1I94 K;  1YVU A;  4B9Q A;  3AY9 A;  3U4L A;  1WSJ A;  1YJ9 N;  3O6W A;  4RW7 A;  5H1S Q;  5FPN A;  4UQG A;  1MIZ B;  3ZSX A;  1C0F A;  4O5B A;  3CC2 N;  4JI0 K;  3CCM N;  4PL7 A;  4YOW A;  4CFD A;  3VEO A;  3CJ1 A;  5C42 A;  3OYA A;  3DLL L;  3MN5 A;  1T3V A;  5C10 A;  3D2F B;  3L2W A;  1Q81 O;  2QWR A;  3SMS A;  4O4G A;  5BN8 A; 
#chains in the Genus database with same CATH homology
 4GV3 A;  3BIN A;  2P9K B;  1GG3 A;  3H6E A;  3AU4 A;  3UKU B;  2D11 A;  3UKR A;  3W3D A;  2P9S A;  2HF4 A;  3BEX A;  4EHT A;  3E1Y A;  4JK9 A;  4KH4 A;  3ENO A;  4ZRI A;  1ACA A;  1VBH A;  1Y64 A;  3VPZ A;  3A5L C;  1HBK A;  4YDU A;  2HBJ A;  4IXC A;  5ADX A;  1HLU A;  3C7N B;  2YHW A;  4JKD A;  3CQY A;  4WQ4 A;  2DPN A;  2ZJR L;  4OPA A;  3WXL A;  3IKM A;  1NGE A;  3SAF A;  2Q0U A;  4JHD A;  3A5O C;  1QQO A;  2ASM A;  4C23 A;  3CET A;  3AU5 A;  1C0G A;  4XH1 A;  4CZG A;  3HOT A;  3CC4 N;  1NGG A;  2IIR A;  3L4Q A;  3KK7 A;  5AQN A;  3KHY A;  1HKB A;  3TTF A;  2HE7 A;  4B1X B;  4BR5 A;  5AQK A;  1ST7 A;  4GVE A;  3MMV A;  2YJF A;  3A5M C;  5MLC Q;  1NTI A;  4P7I A;  3QB0 A;  3ZDT A;  4B1V A;  3VGL A;  2X0S A;  5AZJ B;  3ENB A;  4AM6 A;  1YAG A;  3HTV A;  3GDQ A;  4TKN A;  1X3M A;  2NRH A;  1Z05 A;  4KBO A;  3MX5 A;  4H5W A;  2WC9 A;  2YHX A;  1JJ2 M;  5F2R A;  5AQQ A;  3A5N C;  5LY3 A;  1HKC A;  3O8M A;  1MIX A;  2YJE A;  4MLE A;  1GLA G;  3SMP A;  4BRO A;  1MWK A;  1ZBS A;  3ZYY X;  5GIP A;  1JDE A;  1QZ5 A;  4YDU C;  1X3N A;  1EO1 A;  4DB3 A;  5LJV A;  3F2K A;  4WQ4 C;  1KD1 O;  2GEL A;  3SBG A;  1Q7Y O;  1N8R O;  3GG4 A;  1NLV A;  4A59 A;  1VBG A;  1P8Z A;  2F9W A;  1EQY A;  2ZWH A;  4B1Z A;  3WXM B;  4BC5 A;  3CCQ N;  2P9U B;  3ZET B;  2F9T A;  2D0O A;  2NRW A;  3CER A;  3WQU A;  3S41 A;  3O9U A;  4BRH A;  2P9I A;  4BR2 A;  4BRA A;  3H46 O;  3QFU A;  1O13 A;  2R82 A;  1T6D A;  2HBM A;  2NRV A;  1U2V B;  1X9J A;  5AFU H;  5AQS A;  1VQP N;  2DIK A;  1SQK A;  3CCU N;  4CBX A;  1CZA N;  3EN9 A;  4BRL A;  3PVL A;  2QTD A;  4BR0 A;  3IVF A;  3CQX A;  3CF5 L;  1BA0 A;  4G9Z A;  3I55 N;  1MWM A;  4Y0W A;  2ASO A;  3L6Q A;  1SZ2 A;  3OHR A;  4O8K A;  3VF4 A;  5C15 A;  4DCH A;  2ZPY A;  3P38 A;  4YOU A;  3CXC M;  2J0J A;  3NVK A;  4FWQ A;  4WFN L;  1ESV A;  2A41 A;  1VQ4 N;  1YHQ N;  2AL6 A;  1OVY A;  4CZF A;  3DXM B;  4PKI A;  4CZE A;  1Q86 O;  3O9R A;  4BR7 A;  4FWO A;  4BGB A;  5BPL A;  4WF9 L;  5AZI B;  4I6M B;  4FL9 A;  3VES A;  4ILG B;  2HBK A;  3CCJ N;  5KPT A;  2QA4 N;  1VQN N;  3MN9 A;  2BH1 A;  5EOY A;  4IFE A;  1ZXO A;  2E1Y A;  4CZM A;  5LJW A;  2J0M A;  1RDU A;  2VCP A;  2IVO A;  1GLD G;  3T69 A;  3ZEU A;  3C65 A;  1YF5 L;  1HB8 A;  4JEP A;  3QML A;  1WOQ A;  4HWI A;  2CQU A;  2HRJ A;  5BPM A;  3O4W A;  3LDQ A;  1J19 A;  2HMP A;  2J0K A;  2GWK A;  3AAP A;  4MO5 A;  2KKZ A;  1VQ8 N;  4JKG B;  1YVN A;  2Q2R A;  2NRT A;  5BRH A;  3D6R A;  3PIO L;  4HTL A;  1GC6 A;  4B1W B;  5AQP A;  5GIN A;  3VEN A;  3DJC A;  5I9E B;  1TYQ A;  5C12 A;  1RFQ A;  3K9J A;  4H0T B;  4WFA L;  2FF6 A;  4F7G A;  4FO0 A;  4BRK A;  1VQ7 N;  4H5R A;  2VYP A;  3SAH A;  3TSU A;  4YOT A;  3VMF B;  4FOI A;  5GAG P;  3OBY A;  4YOX A;  2CH5 A;  3FFK B;  5AQZ A;  2ZGY A;  3MK6 A;  1W97 L;  3VGM A;  4ILJ A;  2CGL A;  3F5T A;  5BN9 A;  3MX2 A;  4OPH A;  4BRI A;  2ZJP L;  3LDO A;  1YXQ A;  3VEX A;  3VEZ A;  3FR0 A;  3MDQ A;  4ZRJ A;  2BUP A;  2A42 A;  4BG8 A;  4EKU A;  2D1K A;  1VQO N;  4CZH A;  2WH5 A;  2PBD A;  3G25 A;  3CI5 A;  2COP A;  4JKF A;  2PAV A;  3MCA B;  4B1Y B;  4BC3 A;  2ABD A;  3WXI A;  5FPE A;  3IUC A;  4QS9 A;  3VF2 A;  1KAY A;  1NWK A;  1HB6 A;  5AFU A;  1SGH A;  4K43 A;  2EMS A;  4FWS A;  3CD6 N;  3QIC A;  5M1Q A;  1V4S A;  3ZX0 A;  2HST A;  3ZX3 A;  4EHU A;  4U67 L;  2RQ1 A;  2NZT A;  1M90 O;  5E84 A;  3AAR A;  3MN6 A;  5JVL A;  2EMT A;  2A5X A;  4A5B A;  1E4F T;  2WUS A;  2D10 A;  3FZK A;  3MWP A;  3CME N;  4JD2 A;  5AQL A;  2E2Q A;  4PL8 A;  3D2F A;  5EVZ A;  2I1J A;  2I7P A;  3AGK A;  3EE9 A;  1K9M O;  4BRE A;  2LBB A;  4DHY A;  4IJN A;  2QWN A;  4DKW A;  4HDO A;  4EIA A;  2P9K A;  4H03 B;  3UKU A;  2I1K A;  1MK7 B;  2YVC A;  3F9M A;  4K25 A;  3O1W A;  3H1V X;  2D4W A;  4BQZ A;  2VGN A;  5M1O A;  2P9N B;  3EKU A;  1V4T A;  2AA4 A;  4JN4 A;  3KZB A;  1ATS A;  3CPE A;  4YOY A;  5JLH A;  1DGK N;  2E2P A;  3KWI A;  3C7N A;  2HOE A;  2PFU A;  4H5T A;  2OTJ N;  3ULE B;  2HBL A;  2P9L B;  1BO5 O;  3DAW A;  2NLX A;  1QVF M;  4JK7 A;  2AP1 A;  1GLB G;  4M63 C;  5AQM A;  3NMU A;  1WUA A;  3PZD A;  1DKG D;  2P9P B;  3D2E B;  3O5B A;  3OW2 M;  1QVG M;  2RHK A;  2JWK A;  3LDP A;  2QWQ A;  4A57 A;  1VQ5 N;  4NLC A;  2W40 A;  3KWG A;  3E9L A;  3TPQ A;  4OO1 J;  5F1X A;  1KC7 A;  1GLJ O;  3CC7 N;  3C6H A;  5IJM A;  4KH5 A;  2J4R A;  2QI2 A;  3VEW A;  4O5F A;  4BRD A;  4H0X B;  2QWM A;  4IDH A;  1NGC A;  4WFB L;  4CJ7 A;  4YOV A;  4BRG A;  1VQK N;  4E1J A;  3CJB A;  3R3L A;  4NB4 A;  4IEI A;  3UB5 A;  5KPZ A;  1R59 O;  5AQJ A;  5JIC A;  3QDK A;  1VAZ A;  4JKB A;  3QFP A;  3LL3 A;  3BUZ B;  1MK9 B;  4XH5 A;  3SLC A;  2E1Z A;  4A61 A;  3G6E N;  2CH6 A;  3HRG A;  4C1N I;  2Q0R A;  5AQV A;  3EPY A;  5M1F A;  1LCU A;  5AQO A;  1H4R A;  2NRZ A;  3I56 N;  4IEE A;  3QIJ A;  3Q7B A;  3ID8 A;  4L3Q A;  3WXJ A;  4EAH D;  5C2D A;  4PKH A;  2P9U A;  3ZET A;  1GLC G;  1U6Z A;  3SBT A;  5AQX A;  4CD1 A;  1HUX A;  2VGM A;  5AQY A;  1MA9 B;  1U2V A;  3HI0 A;  3OBW A;  1TUU A;  4BC2 A;  4BRN A;  5B8H A;  3BF1 A;  3U7D A;  2JWL A;  4M7X A;  1GLF O;  3EO3 A;  5ELZ A;  4R79 A;  4CYE A;  2YX6 A;  1YJW N;  2ITM A;  2Q1N A;  3CHW A;  4GNI A;  1KC8 O;  5AQW A;  3CIP A;  1NGI A;  2I7N A;  4CZK A;  3CMA N;  5JVH L;  3GOI A;  2OAN A;  4ISG A;  1SAZ A;  3SAG A;  3U9D A;  1XQS C;  3LDL A;  1BG3 A;  3DXM A;  3N4Q A;  2W41 A;  3G4S N;  2E2N A;  4WQ5 A;  5AZI A;  1XUP O;  3O9T A;  4I6M A;  3BF3 A;  3SJH A;  1DIK A;  1K8K B;  5EXW A;  3RSE B;  5GAE P;  5KQ8 A;  5GIO A;  4H0V B;  3M3Z A;  3IDH A;  1JCF A;  4JK8 A;  3R9P A;  3HSC A;  3TTC A;  4A2A A;  1MDU B;  3OA9 A;  4JKA A;  3N4P A;  2IVP A;  1Z6R A;  4F9O A;  3GE1 A;  3M1F A;  3HZ6 A;  3VGK A;  3FE1 A;  4NY0 A;  3A0I X;  1LOT B;  2Q36 A;  5F0X A;  5JMV A;  3CCR N;  2H3G X;  5TKY A;  3M5R A;  3C6A A;  1S22 A;  3P39 A;  4FSV A;  5CE3 A;  4JKG A;  3EKS A;  5CR4 A;  1QQM A;  1KAZ A;  5AQI A;  4CBW A;  3WEE B;  3TTD A;  4XEI A;  3SK3 A;  4BY9 C;  4FWP A;  5BPN A;  1ILY A;  5KPR A;  3U8Z A;  4GV9 A;  1QQN A;  4ILH A;  4ISE A;  1HX1 A;  3E9O A;  1NMD A;  4CBU A;  5AQF A;  2FSJ A;  1P90 A;  4H0O A;  4WQ5 C;  2NRR A;  1OKJ A;  3FZM A;  3M6G A;  3B8A X;  3Q7C A;  3HOS A;  1G99 A;  1NBW A;  2Q31 A;  3BP8 A;  3J7Z O;  2NNW A;  1YI2 N;  3FLC O;  4U7B A;  1GLL O;  1HJO A;  1NGB A;  1M1K O;  2GUP A;  3DXK B;  2GEM A;  3H45 C;  4AF1 A;  4JKH A;  3K9K A;  4M7Y A;  5EY4 A;  1SS6 A;  1NVL A;  2FXU A;  1YIJ N;  4YL8 A;  4CZI A;  1D4X A;  3GBT A;  5BRF A;  1NGA A;  1QHA A;  4BRQ A;  5GAH P;  1HKG A;  3UKR B;  2P9S B;  2FJ9 A;  2E88 A;  4WYB A;  5AQT A;  4GV6 A;  1BOT O;  5M1P A;  3EL2 A;  4IOA L;  5KQD A;  4BVO A;  5M1K A;  2QWP A;  4C1N K;  2EWS A;  4FOE A;  4ZRK A;  5BRE A;  2F7T A;  4FWN A;  1DT9 A;  3EZW A;  4JHD B;  1VQ6 N;  3R1X A;  4WCE L;  4BRP A;  2ASP A;  1KQS M;  1ATN A;  5C0Y A;  1KBL A;  2QM1 A;  1NGH A;  4H5N A;  4AM7 A;  4IJA A;  3AGR A;  3O9S A;  3IMX A;  1BDG A;  1BU6 O;  2P9N A;  5JLF A;  1GC7 A;  3O80 A;  2FF3 B;  3D7E O;  5FPM A;  4H0Y B;  3G71 N;  1RGI A;  2QWL A;  3ULE A;  2P9L A;  1K73 O;  4EFH A;  3CPW M;  4DXA B;  1T6C A;  4BG9 A;  2QXL A;  4A2B A;  1ISN A;  5AZJ A;  2YI1 A;  4K41 A;  5GAD P;  5BR9 A;  2GX9 A;  4RWT A;  3TU5 A;  1E5W A;  4JKC A;  3WUH A;  3ATV A;  2P9P A;  3D2E A;  3VET A;  1J6Z A;  1HPM A;  3FZF A;  2AEH A;  2KLA A;  3FLV A;  5C2F A;  3H3O B;  1VQL N;  4IZ9 A;  5M1N A;  2D0P A;  2WBN A;  2YHY A;  3ATU A;  4BGA A;  3X23 A;  2FSN A;  4IO9 L;  3MWT A;  5AQG A;  3TSQ A;  4MDA A;  1VQ9 N;  2QEX N;  2RE2 A;  2KHO A;  5JVG L;  1JCE A;  4FWK A;  2VWB A;  3FZL A;  3NVM A;  4BRF A;  4NO7 A;  2YCH A;  2WFB A;  3O08 A;  4K42 A;  5FPD A;  2P9I B;  3HM8 A;  5AR0 A;  3I8B A;  4BR4 A;  1JCG A;  3I33 A;  2UYT A;  3WA0 A;  4CD3 A;  1K8A O;  3FZH A;  2CGJ A;  4A5A A;  4MLH A;  1ATR A;  2V7Z A;  4CZL A;  2GWJ A;  4KH6 A;  5AQU A;  4QS7 A;  3VF6 A;  4BRM A;  4A62 A;  4QS8 A;  2ZJQ L;  2QW9 A;  3L0Q A;  1KAX A;  3TSP A;  3P4I A;  2HF3 A;  4H5V A;  1IG8 A;  3WT0 A;  3CJ7 A;  2NRX A;  1W2B M;  3H1Q A;  3O9Q A;  3FP5 A;  5HL7 L;  4B1U B;  3J8A A;  4IOX A;  3LM2 A;  3VER A;  1XC3 A;  2D2Q A;  2V7Y A;  5DM6 L;  2CB8 A;  3E66 A;  4JKE A;  3R8E A;  1BUP A;  1YJN N;  2E20 A;  4H0P A;  1YUW A;  1GLE G;  3ENH A;  4ISF A;  3IFR A;  3U9Z A;  4CZJ A;  1QZ6 A;  4Z94 A;  3CCV N;  3PLA A;  1NGJ A;  1NGF A;  3VTI A;  3VTH A;  4PHT X;  3ZEU B;  2FLO A;  4IO8 A;  3JS6 A;  4BRC A;  3GL1 A;  2ZGZ A;  2GTD A;  3JXU A;  4JNE A;  4YOR A;  5ADX H;  4IOC L;  4O8U A;  4FPB A;  3UE5 A;  1KXP A;  4PKG A;  4LC9 B;  3FGU A;  5E26 A;  3VEY A;  3EE8 A;  1BWF O;  4FWR A;  2V51 B;  4FWM A;  2FDQ A;  1RDW X;  5AQR A;  1K8K A;  3QBX A;  3HBT A;  3R6M A;  2A6A A;  1GGO A;  2QWO A;  3RSE A;  1NI2 A;  2A3Z A;  2CGK A;  1Q18 A;  4JAX A;  1S3X A;  3ID6 A;  3L4I A;  1TYQ B;  3MCP A;  4IWV A;  3WXK A;  4DQ8 A;  3P31 A;  5BRD A;  1S72 N;  3CJA A;  4HDQ A;  4GXB A;  5EX5 A;  3RVC A;  1DEJ A;  4J8F A;  1H1V A;  4FWL A;  3O1B A;  3WQT A;  4FPA A;  1YIT N;  1ZC6 A;  2V52 B;  3CCL N;  4MDB A;  2A40 A;  3CCS N;  3C0B A;  3LM9 A;  2OTL N;  1VQM N;  4FVU A;  2Q97 A;  3QBW A;  4RTF D;  1TUY A;  3A8Y A;  2BTF A;  5AQH A;  4CI6 A;  3AAQ A;  3E9P A;  3T7Z A;  3LDN A;  3VOV A;  3CCE N;  2IVN A;  4XH4 A;  1Y19 B;  3WEE A;  2E2O A;  3U8X A;  4B9Q A;  4BR9 A;  3G9W A;  4BC4 A;  1IJJ A;  2ZF5 O;  3W0L A;  3AY9 A;  3U4L A;  4BVP A;  1EF1 A;  1T44 A;  4GY2 B;  3O6W A;  1YJ9 N;  3VEV A;  5FPN A;  5H1S Q;  3H3N O;  2FSK A;  4BQL A;  2E8A A;  3CJ9 A;  5TKW A;  1MIZ B;  1NM1 A;  1C0F A;  3CC2 N;  4UY8 O;  1E4G T;  1NGD A;  4RCH A;  3CCM N;  4PL7 A;  4YOW A;  3VEO A;  3CJ1 A;  1BA1 A;  4JD2 B;  4MO4 A;  3DWL A;  3PIP L;  3DLL L;  3ZX2 A;  3MN5 A;  1T3V A;  5C10 A;  5CHI A;  3MN7 A;  5HOO A;  3D2F B;  1NJI O;  1Q81 O;  3DXK A;  2QWR A;  3KVG A;  5DM7 L;  3SMS A;  5BN8 A;  3CJC A;  4NLB A;  1Q82 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...