4JKEA

Open and closed forms of t1789p human prp8 rnase h-like domain with bound mg ion
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
219
Chain Sequence
LFSQIIWFVDDTNVYRVPIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 68
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkeA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkeA01
3ENBA 3E9OA 4JK8A 3E66A 4JKHA 4ILJA 3E9LA 3SBTA 4JK7A 4JKEA 4JKFA 4JK9A 4JKBA 4JKAA 4JKGA 4ILGB 3SBGA 4JKCA 4JKGB 3E9PA 4JKDA 4ILHA
chains in the Genus database with same CATH superfamily
2JGUA 4B8CA 2Q0UA 4IFVA 1KLNA 3IDHA 4H0XB 3E01A 1KAXA 4JN4A 1WSHA 2V52B 4BVOA 3ASMA 2BUPA 1DKGD 2Z1JA 2J0JA 2XRIA 1IBKK 4FYDA 4IEIA 2OPSA 1K8KB 1SV5A 2ZD1A 4FZZA 1BG3A 2JWKA 4E7IA 4K0KK 4HVJA 1JL1A 3K59A 1TGOA 3V9XA 2OTJN 4B1YB 3ZSOA 3VF4A 4CJFA 1WB9A 3AVFA 4DXAB 2DFEA 1NGHA 4FW2A 4PWDA 1GLAG 1QHTA 4YY3K 3HK2A 1WUAA 4CYEA 1VSKA 1NGGA 4IEEA 4NCGA 5FROA 3HXMA 3WNHA 3I33A 2HHXA 2GTDA 4ISEA 4JHDA 4M42A 3RRGA 4H0VB 1VQ7N 5F0XA 4GW6A 2COPA 1S1WA 3N4QA 4CGJA 3VQ6A 3SMPA 1P90A 3EO3A 3ZETB 2ZJRL 1VSLA 4G1QA 3LP0A 5DM7L 3K5MA 5E41A 5F2RA 3TAGA 3K9KA 4LSLA 3P39A 2VQEK 4DQ8A 2AEHA 3DWLA 3IG1A 4M63C 3MEDA 4KHPK 2WFBA 4DU3A 4RW4A 3V9WA 4CJRA 2CH5A 2J4RA 1SAZA 1Y97A 1XHZA 1C1CA 5HRNA 3I8DA 3H46O 4OO1J 1XMOK 2BGGA 5AZJA 1N33K 2YHYA 4O0IA 2P9IB 3AO1A 3CJCA 1MK9B 1QS4A 5E26A 3ZSZA 2G8UA 3HO1A 1C0FA 3ATVA 3A5NC 4Y0WA 4ZTJA 1N5YA 3AVNA 4B1VA 3UKRB 3BUZB 1W7AA 4E1MA 4PY5A 5AZIA 4NXMK 2QM1A 3NFAA 5AQQA 3BP8A 1RBRA 3V9ZA 3TSUA 2X6NA 2YJFA 3TTCA 1NJXA 3A0IX 4C8OA 3OYCA 1MDUB 3VQ8A 1OH7A 3O3HA 1JLBA 4NLBA 2D0BA 3LM2A 4JI4K 2X74A 4HHTA 4DU1A 4H5RA 2E6LA 3E1YA 3O1WA 4F9OA 3NF7A 3GE1A 3JYTA 1OKJA 3VETA 3TPQA 2Q3SA 3CCMN 2VG7A 3DXKA 4WQ5C 1TAUA 4FK2A 1QVFM 1S1VA 1P8ZA 2UUAK 3F2KA 3SQ0A 3KLGA 1RT5A 4CCHA 4FPAA 5JLHA 1U2VA 5JICA 1VRTA 5FLXO 4KB0A 3P38A 5GADP 1VQKN 3U9DA 4H5VA 1IV0A 3VEWA 4CECA 3JSMA 4CHQA 3AVKA 1DTTA 3RTVA 4W5RA 4IKFA 3QEVA 3T69A 3S41A 1WN7A 3U8ZA 4CJ4A 4GVMA 1T6CA 4GV6A 3V6DA 3KLFA 4ICLA 3TSPA 4JLHA 4DV5K 3LZIA 3E66A 4DTSA 4OKJA 3L2RA 5M1KA 2YJEA 4BGAA 2OCEA 3NMUA 5TKWA 5AJ3K 2P9PB 3TAPA 3PX6A 3RSEA 3AV9A 1BA0A 3G25A 1SL2A 1ZBUA 1DIKA 4CHZA 2KFZA 5I3UA 3BINA 1BISA 2VCPA 2A42A 4YNQA 5C0YA 3HL8A 3THWA 3PX4A 4U7BA 2E88A 3DLRA 4KV8A 4CBXA 1TKDA 2O4IA 1HKBA 4OVLA 4QAGA 4E7KA 1JLEA 5I42A 4HDOA 1N36K 3IMXA 1XUPO 1T44A 4PKHA 5T7BA 1HPZA 4YORA 1E5WA 4F8RA 3SQ4A 4BDPA 1NMNA 2HVIA 1XC3A 1IO2A 2QKKA 1KQSM 3S3MA 4TSXA 4QS8A 2G8KA 2HNYA 3MMVA 5AQJA 1BQMA 4WFNL 1NJWA 2ZQBA 1J54A 3LL3A 4ILJA 4FWLA 2I1KA 4EFHA 4DLGA 1Q18A 3OS1A 1HYZA 4ILGB 1VQLN 3O5BA 3QICA 5AQGA 4BREA 5HRRA 4JKDA 3BGRA 2IGIA 4DSKA 2FSKA 4ILHA 1NK0A 4P7IA 1NJIO 2GWJA 2ASMA 2NRRA 5DM6L 4DV7K 4CE9A 1GOCA 4CHPA 2ITGA 4CEQA 3FZFA 3RVCA 1NTIA 1KBLA 1OVYA 5AQUA 2PYLA 5BPNA 1FK9A 4YOUA 4YFUA 4ZRIA 2GUIA 2UXDK 3ID6A 4DHYA 2E5LK 2QEXN 2VYPA 3U3GA 1HYSA 3MX2A 3MEEA 4X66K 4PQUA 1IKYA 2P9KB 3J80O 4DV3K 1NBWA 2Y1IA 4JNEA 3U6FA 3CJ9A 3VQAA 5AR0A 2I5JA 1DTQA 2FC0A 3ZSWA 2DFHA 3HVTA 1KD1O 4BE1A 4A5AA 3O9QA 2W40A 5GAEP 1HNIA 5A2QO 3NH2A 4XH1A 2G8HA 4CHNA 2P9SA 1HQUA 4FJ5A 4QOZB 1X3NA 3QETA 1BCOA 5AQSA 4CJQA 4R5PA 4M3ZA 1W9HA 3SAGA 3NF9A 2D0OA 3LP1A 4OJRA 5IWAK 1SGHA 3CC7N 1FXXA 1WOQA 4FJLA 3R6MA 1OH8A 2Y1JA 4LF7K 3AA3A 2B5JA 4KI4A 1NM1A 1HYVA 1LW2A 1EWRA 4LF8K 3X23A 3AA4A 4BC3A 4Z0UA 2D0CA 2IS3A 4CZGA 2KW4A 4ELTA 3LAKA 4CBUA 4GXBA 1ILYA 4IOXA 3FFIA 2LSNA 3CMEN 3ZT0A 4FJXA 4CGHA 1KVAA 5C25A 1Z05A 5K14A 1S6PA 2GX9A 4DF4A 1XQSC 1BI4A 3ENHA 3I56N 4F7GA 1RCHA 1ASWA 3K9JA 3KWGA 3CCVN 4DV1K 4CFDA 1RGIA 1XC9A 4NXNK 1MA9B 1G99A 2QXLA 2E8AA 4AM7A 4LY7A 4Y1CA 1NGDA 2KLAA 1YIJN 1NGCA 5M1OA 1KC8O 4KBOA 4CD3A 1YI2N 2D4WA 2GBZA 3SJJA 1J6ZA 3CFRA 4CEDA 3LDNA 4DLEA 2HMPA 1W2BM 4Z94A 2PY5A 3WEEA 3QEWA 5MLCQ 2P9UB 3H6EA 3QEXA 1C1AA 3VA0A 4BRHA 2Q0RA 4IWVA 1V4SA 1QHAA 4FWNA 4I9QA 3V4IA 1JXEA 3SCXA 1YJWN 3CMAN 1TYQA 3ZT1A 1DT9A 2EMTA 2PFUA 4B9VA 3T1AA 1TL3A 1SQKA 1I39A 3SUOA 3ZSVA 3WA0A 3QIJA 1JDEA 3VTHA 1R0AA 1VQON 4FWRA 4EKUA 4YOYA 5LY3A 4B8AB 3OYGA 1RTDA 4K8XA 3C94A 3PIOL 2BDPA 3WXLA 4BRQA 3HT3A 1BU6O 3V9UA 3RWUA 4E3SA 3MN5A 4DV6K 4JKHA 2F9TA 4BE0A 1YJ9N 3AAPA 3AO3A 1Q9XA 3M8RA 3CXCM 4OGEA 1L5UA 4A61A 2A41A 5GAGP 1K8AO 4R79A 5BR9A 3IRXA 4L8RB 3O1BA 1QSLA 2EX3A 1ISNA 1GLCG 2B4JA 4A57A 1UA1A 3ID8A 2O8CB 1NVLA 2F8SA 4JKGA 2YI1A 4ZRKA 4FLTA 1EP4A 2RF2A 5BR8K 3WXMB 4UY8O 3HTVA 3OYBA 2GELA 1C0MA 3FFKB 3WXKA 2XHBA 1EQYA 4FJGA 2OPPA 1HB6A 3CQYA 4AF1A 3VEYA 4B9QA 4HCBA 2FJ9A 2ZGYA 2ZM6K 3CIPA 4JKEA 4KTWA 4K42A 2Q2RA 1XWLA 1U04A 4JKAA 1NI2A 5HL7L 4YOXA 3LDPA 1MK7B 3QMLA 3SPYA 5KPZA 2YKMA 3CETA 4DFMA 3NF8A 3CCLN 1X9JA 2CGKA 2P9NB 1UWBA 2Q1NA 4HCCA 3FLCO 3EKSA 5TKYA 4EZ9A 2RPIA 5JS2A 3AAQA 4J2BA 1RBUA 2NNWA 2QTDA 3WQTA 4IOAL 4B3OA 1IG8A 4GVEA 4FLWA 3DLBA 2IOCA 3MN7A 2HVHA 1ZBLA 1OVQA 3TAFA 4CJPA 2QWPA 3L2UA 2ZF5O 3SPZA 3H1VX 1RDAA 4Z4CA 3VQ4A 2G8VA 2KZZA 3DMJA 4M7YA 2BH1A 3ENBA 3CYMA 3K2PA 5LJWA 3MAQA 5ADXA 4BG9A 2IIRA 2YV0X 3EZ5A 4KO0A 4CZHA 2XO7A 5HROA 4DQRA 2FBTA 4B1UB 2KKZA 3NGZA 2VGNA 4FW1A 4WQ4A 4KI6A 5H1SQ 4FZXC 1NOYA 4DB3A 3ZEUA 4DMNA 4FWKA 3P1GA 1ASUA 1GLJO 2BANA 5J2MA 4O0JA 1RT7A 1GLBG 4NCBA 3TWHA 1X3MA 1RDUA 4NYFA 5FRNA 1BCMA 3TTFA 1BIZA 1J53A 3ALYA 2FBYA 3R1XA 1ACAA 3UKRA 1RFQA 4YOWA 4B9TA 4M3YA 1NLVA 4FM1A 2HHSA 3NH0A 1S72N 5AQZA 1ATNA 1YT3A 2WC9A 4DR6K 2YVCA 3O4WA 1QE1A 4WE1A 4MDBA 1QQOA 5CYQA 3C7NB 4CIFA 1MIZB 3MCPA 4BRGA 3AGRA 4CK1A 1VQ4N 1BGXT 2NRXA 5EVZA 3D6RA 3V81A 4M3WA 3CCUN 4H5TA 1E3MA 1XNQK 3F9KA 4J2DA 3ULDA 4G9ZA 3HPOA 1JCGA 2NLXA 3J8AA 4MO5A 4TKNA 2HE7A 2QWOA 1B9FA 4RG8A 4I7FA 3UIQA 3VQBA 4DSLA 4DTOA 1VQ9N 2YHBA 1RT2A 3MXMA 3OYDA 4C23A 1GLFO 1KVBA 3EE9A 2QK9A 4HWIA 4KHQA 4YOVA 3CCQN 4CJWA 3TARA 2WH5A 4BQLA 4CF1A 3SAHA 2GEMA 4L3QA 4C8NA 1J5EK 1QZ5A 4C8MA 4CGIA 4FWQA 4JKCA 3HP6A 5CR4A 2A5XA 2Z1HA 4DV2K 2ITMA 3NBPA 1N6QA 1JL2A 4DFJA 2NRHA 4RW9A 4ZRJA 5CHIA 4CI6A 4KAZA 2F8TA 4DR2K 4NB4A 3QEPA 1JKHA 1CZAN 3L2WA 4RW6A 2RQ1A 4FZYA 4CK2A 1ZBIA 2ASOA 4I9LA 2EWSA 3RMBA 3PO5A 2E4LA 3QEIA 4Z4GA 3OYIA 2HBKA 3HM8A 2ZJQL 3FLVA 3ZLJA 3KLIA 2O8EB 4XEIA 5C15A 4KHNA 1DLOA 2PBDA 4CJSA 3FZMA 4FL9A 4KTQA 2FSNA 3VQDA 2E2NA 3KJVA 3BY5A 3DM2A 4DTNA 4DF8A 1QQCA 5FPNA 3DAWA 3KD5E 1S22A 2Q31A 3GG4A 1YTUA 4EHUA 3S3NA 1I94K 3O4NA 4C1NI 1B9DA 3THYA 2D0AA 2CH6A 1X1PA 3PSFA 4J8FA 3AY9A 1HJRA 3TTDA 3ATUA 4H0PA 1KLMA 2W42A 1W0HA 3OYKA 5HRPA 1KFSA 4LD0A 3ZYYX 3WUHA 2KHOA 3DXMB 4FOIA 5C42A 1NGJA 4BWJA 2AL6A 3D2FA 2Z1GA 2E2OA 3VQQA 2O8BB 4KPYA 1UAXA 4N5SA 4F3OA 5SZTA 1R59O 3QBWA 2XY6A 3PO4A 3D0PA 3VTIA 4CJ7A 1FJGK 5JVLA 2Q36A 5DMRA 5AQTA 1VSJA 1LWEA 2UUCK 3ZX0A 1WSJA 3QB0A 4B9SA 2AJQA 4GV3A 3AVJA 2P5GA 4ZTFA 4JAXA 1X9SA 1C0GA 1CZ9A 1U48A 3M3ZA 1HJOA 4RTFD 2VGMA 4AHUA 3CCSN 2ZGZA 2Z1IA 1EKEA 1ZXOA 1Q9YA 3HRGA 1IKWA 4KFBA 1VQ8N 3C6TA 2RN2A 1TV6A 2HRJA 5DK5A 2FDQA 1L3TA 3DRSA 3HOTA 1H1VA 3O3GA 4NLCA 3PVLA 2D0PA 4BC5A 1QQMA 2KFNA 1OH6A 3P83D 1VSEA 2HHHK 3KZBA 1MIXA 4B9LA 4CJ3A 4PKGA 2FF6A 4CZMA 4X65K 4DUZK 2I7NA 4BC2A 2DY4A 3QERA 3O4QA 2E1ZA 2WTUA 1HNWK 4EP4A 5KGXA 3TSQA 3SV3A 3NGIA 3O3FA 4LF6K 3MN9A 4H4OA 4OKEA 1Q8IA 3CG7A 4K41A 3MCAB 5SWMA 2FF3B 3AGKA 4HUFA 1K9MO 3THVA 4FJ8A 3G9WA 1Q82O 4B9MA 1SL0A 3J7ZO 2HHVA 1KAYA 4CF2A 3VERA 4DCHA 3CM6A 3MWTA 1VBGA 4DG1A 4LF9K 4DSFA 4JI8K 4FJHA 3AVMA 5FRMA 4BR0A 2P9UA 4N41A 3S9HA 2G8IA 2HF3A 4FJKA 4FWOA 2OZSA 5AQNA 4I2QA 5KPRA 3OYMA 3L2QA 4F4KA 4JI1K 5HLFA 4BRPA 4H03B 3PLAA 1VSDA 1BWFO 3I0RA 4AHCA 3CPWM 4CBWA 1UA0A 4H8KA 3OYJA 4FLXA 1RT6A 1VAZA 3LWLA 2PAVA 4FK4A 4FWPA 3WXIA 5EXWA 2CQUA 3KK3A 3VEXA 3K58A 3JXUA 3L4IA 5HBMA 1QSSA 3IUCA 3NGYA 4WF9L 4OPKA 5JLFA 1BA1A 2DFFA 2E20A 1YF5L 1YVUA 3EE8A 1JCFA 3IFRA 4AHVA 4CHYA 3HP9A 4CZFA 3WNGA 4F2RA 3DOLA 3SUQA 2QWLA 5LMUK 3M8PA 4IDKA 4LFBK 3G71N 3F9MA 3OBWA 3CCRN 3HI0A 2HHUA 4EIAA 4CEBA 4YHHK 2VG6A 1RT4A 1ITGA 1LOTB 3VOVA 4HUGA 2O8CA 1GG3A 4DTUA 5FPEA 2Q97A 2HOEA 1BL3A 4I2PA 1QSYA 1NOZA 1MWKA 3C95A 4BR9A 4JD2A 2VQFK 2FSJA 3L0QA 3THXA 5AQKA 4PA1A 2O8FA 3LDLA 3A5OC 3VQPA 3VQ7A 1VSIA 1WAJA 3DJCA 3UE5A 2ZE2A 3NAEA 3DXKB 1WAFA 3QINA 2QWRA 1LAWA 3T19A 4IO8A 3CF5L 3KLEA 2OYQA 1G15A 3GDQA 4H0YB 4KH5A 2IDOA 2AP1A 1FW6A 1U2VB 3O8MA 4CZKA 1NGBA 3QNOA 1E4FT 4DQSA 4BRLA 3U8XA 3KK2A 5AFUH 3BZCA 5EOYA 4B9UA 4AHTA 4CFBA 1K73O 4C8LA 3SQ2A 3JAMO 5FDLA 3TAEA 3CJ7A 3SZ2A 3SQ1A 3GOIA 3CPEA 1KAZA 1RBTA 3EL2A 4WCEL 1NGIA 1B92A 3QNNA 5KPTA 3LM9A 2I1JA 3V1OA 1GLDG 1HKCA 4CD1A 4AQYK 3G0ZA 4LH5A 1JLCA 5GIOA 1T7PA 4BRKA 3BEXA 4ID5A 3LAMA 4K25A 3O80A 2JLEA 3CJBA 2I7PA 2PYJA 5CZ2A 4J2EA 4M3RA 3Q7CA 5C24A 5CE3A 1RTHA 2F96A 3B6OA 4EHTA 1NJYA 5AQOA 4DWIA 4DSIA 1O1WA 4JKFA 4YDUA 1ZBFA 2QWMA 4IJAA 2UXCK 2OZMA 4A62A 2ZJPL 3LWMA 4IFYA 5GAHP 2DIKA 4O55A 3VEVA 3M1FA 2GV9A 1L3SA 3HPGA 2JWLA 3HVRA 3HYFA 2YHXA 1NKEA 4CEFA 4CESA 4CJTA 1VRUA 4KREA 3G6EN 4AILC 4BR5A 4E7LA 3MWPA 4KHSA 4B1WB 3C6UA 1VQPN 1DEJA 1GC6A 2HNZA 4JI6K 3T3FA 1EXQA 1HQEA 3EEQA 3RR8A 3TI0A 4O44A 3ZT2A 3SBGA 5AQLA 4I6MB 2HW3A 4FM0A 4CGDA 3U3YA 4DTMA 2G8WA 4BQZA 5M1PA 3QFPA 5BRFA 3OTOK 4DSEA 3PIPL 1YXQA 1S1UA 2QWQA 2HF4A 4OPJA 1C0UA 4BGBA 3O9UA 3OS2A 1U47A 2LBBA 1TK0A 2OPRA 3WXJA 1HLUA 1MWMA 4FSVA 4ZHRA 3L3VA 4BY9C 4OLAA 2P9LB 2IAJA 1KVCA 3D45A 3SUNA 3MECA 4B08A 3CJAA 3OYHA 2X78A 3AA2A 3H45C 2IVPA 4ELUA 3FR0A 4FLVA 3LDOA 1RDWX 2RE2A 2YHWA 5AQVA 1K8KA 1C6VA 3OA9A 5KI6A 1A5XA 3M8QA 2P9SB 3K5LA 3HSCA 3FP5A 3A5LC 1ATRA 1CXUA 1VQ6N 2D5RA 2FLOA 2ATQA 2QKBA 1M1KO 4FCYA 2E6MA 2X0SA 3WNFA 5I9EB 1S6QA 4NO7A 2FXUA 4MDAA 4CEEA 1ZC6A 3NE6A 3NVMA 4B3RK 3VEZA 4O8UA 5EU7A 4LSNA 3TU5A 1EF1A 1EO1A 4RW8A 5HRSA 2YCHA 1BDGA 3ZETA 2UXBK 1HR0K 3DLEA 4CJUA 2W6KA 4FXDA 4BC4A 4CJKA 1RT3A 3UKUB 3ULEB 3MN6A 1SUQA 4DKWA 4CEOA 4LFAK 1BI4B 3L4QA 1S1TA 3CJ1A 4NYNA 3EKUA 1HRHA 1JXBA 3GL1A 3P31A 2O8DB 3KKSA 4DQQA 5M1QA 4CJLA 5M1NA 4B3TK 4M7XA 4DUYK 2VWJA 2H3GX 1NK8A 1WSGA 2V7YA 4FWMA 4CJVA 1N8RO 4MLEA 2P9IA 3MX5A 1T3VA 3MK6A 4CJEA 3HSTB 2KZMA 3B8AX 1J19A 3OJSA 4Z4HA 3AVLA 3SAFA 4A2BA 3AVAA 4HTLA 4H5WA 4CIGA 4DR7K 1REVA 1C1BA 4BDZA 1NK9A 3N4PA 4DV0K 1EETA 3VGKA 3HJFA 1L3UA 2IVOA 2WOMA 1HB8A 3LP3A 4PUOA 4QS9A 4BDYA 1J5OA 4IJNA 3BDPA 4PHTX 4UQGA 4M3XA 2YNFA 1HNZK 4W5NA 1OH5A 1IBLK 2BTFA 3CC4N 4KHYA 4A2AA 3CQ8A 4IG3A 3PSIA 1SZ2A 3OYAA 4WQ5A 4CW7B 2CB8A 5CZ1A 4ELVA 2W41A 4B9NA 1ZYQA 4DU4A 4QS7A 3QIPA 4DTRA 4FJ7A 1A5WA 2VG5A 3VESA 4DS5A 4KRFA 3VA3A 4CIEA 1TVRA 3OBYA 4DFKA 3G10A 1JLGA 1TKTA 4O4GA 4CFCA 5GINA 1NK6A 4JI0K 1ST7A 4JKGB 3L3UA 3M5RA 3R3LA 3ISNC 1NMDA 5D3GA 4XH5A 5ADXH 4C8KA 1WLJA 3LALA 5JVHL 3R9PA 4DR5K 1MU2A 5C12A 2E2PA 1RDBA 1F21A 3K5NA 5BN9A 3EY1A 1GOBA 4MLHA 2HBMA 3SNNA 2YHAA 4M3TA 3TAMA 3CC2N 2P9PA 2ASPA 4NCAA 4Z4IA 2X6SA 3QLHA 4YL8A 1LW0A 4EP5A 3VPZA 1D4XA 3A5MC 3LANA 4BRCA 3NCIA 4F2SA 1RBSA 2HHWA 3CQXA 3K5OA 3AVBA 4OPHA 4GKJK 4CZJA 2KTQA 1WSFA 1I3AA 1IH7A 1N34K 1WSEA 2J0KA 3SBTA 3K0SA 2A3ZA 2A1RA 4E1NA 4M45A 1YTAA 3SLCA 4W5OA 4OX9K 3DYAA 5LJVA 3VQ5A 2NRTA 1HUXA 4J2AA 3H1QA 4M3UA 4IBNA 4W5TA 4ISFA 5HOOA 2G8FA 1GC7A 3VEOA 3VGLA 1H4RA 3QIOA 3KHYA 4XH4A 3KKRA 3AARA 4B1ZA 4DR3K 1YITN 4WQ4C 1IKXA 1C0TA 4KB1A 2UYTA 3ZEUB 4IFEA 4OKKA 4DTJA 5BPLA 1CXQA 4ID1A 4N47A 4V19S 4AH9A 4FK0A 1T05A 2F4VK 4CEZA 3D2EB 1KFDA 3SYZA 2HHTA 4MO4A 3NF6A 4H0TB 1VQNN 3AO5A 1HBKA 4JK8A 2ZPYA 3UB5A 4LF5K 1T03A 3ZT3A 1HKGA 3LDQA 1T8EA 1YHQN 1UOCA 4CK3A 2P9KA 1S9EA 1E4GT 3CFOA 3IKMA 2OPQA 3W3DA 3AVGA 2HNDA 4AHRA 4O8KA 5AQYA 1FKOA 5IJMA 2YX6A 1NGFA 1X9MA 4A59A 4MFBA 3HM9A 3M6GA 2UU9K 3PUFA 3OYFA 1BHLA 3U4LA 3TR8A 1JCEA 5AQXA 4FJJA 4FVMA 1NWKA 1RTIA 2HSTA 1JJ2M 3A2FA 3DLKA 4BWMA 2NZTA 5C2DA 4JI5K 3CD6N 5AQPA 1QTMA 2FBXA 3LPTA 1XI1A 5C10A 1NGEA 4JK7A 2KQ2A 1BUPA 4FVUA 3EYZA 4JEPA 4QCLA 1LWFA 1HPMA 3U7DA 4CGFA 1O13A 3SV4A 3CFPA 1Z25A 3O6WA 1KCFA 4K43A 3EZWA 3KWIA 3CERA 1J9AA 1JLFA 2E2QA 2OANA 4IZ9A 3IAYA 1LCUA 3ITHA 3VF2A 3AU5A 1BQNA 4B3MK 4BRAA 4DTPA 4IG0A 1CLQA 4JI3K 1Y64A 4JK9A 4CF0A 4JKBA 4RWTA 5AQRA 4JHDB 2HB5A 3I8BA 2OTLN 1KSPA 4CGGA 2YKNA 1ATSA 4BG8A 3L2VA 5FPMA 4DQIA 1N32K 4EAHD 3M8SA 3AO2A 1D9FA 1Q86O 2E1YA 4GNIA 4FJIA 2IC3A 2A6AA 3FZLA 4KTZA 3CHWA 4FO0A 4BR7A 3QESA 2D1KA 3HZ6A 3FZKA 3S3OA 3K57A 4CFAA 1QQNA 2XY7A 3Q7BA 3THYB 1SKSA 1KRPA 5AFUA 2QW9A 3ZSQA 4BRNA 4LF4K 3CI5A 1RTJA 5AZJB 5M1FA 3VENA 1GGOA 4KH4A 1JLQA 1SS6A 4CZLA 4BR4A 1U6ZA 3P5JA 3WNEA 1M90O 1TKXA 1Z6RA 4CEAA 3QFUA 4IOCL 3OS0A 2GWKA 1VSHA 1EX4A 3D2FB 4I6MA 5EX5A 3O9SA 4BROA 4Y1DA 1HNXK 5KRSA 5KQDA 3PY8A 1BO5O 3ZX2A 3PZDA 3BF1A 2ABDA 5AZIB 1YVNA 4E19A 3HBTA 4MQ3A 4JI2K 3HOSA 2P51A 1U49A 1D5AA 5AQWA 4DS4A 1S9GA 5ELZA 2R82A 1JLAA 3IVFA 3H08A 3J81O 2RKIA 1GOAA 5BREA 2QA4N 1WBBA 4WYBA 4E89A 2QI2A 1HNVA 3QDKA 4Q5VA 2P9LA 4JS5A 4LC9B 3LPUA 4CF8A 4HTUA 4DTXA 3VN5A 3DLHA 3G4SN 5BPMA 2CGLA 4FJNA 5GIPA 3V1QA 3FZHA 1TL1A 1Q81O 4FJ9A 5KTQA 3B6PA 1Z26A 3CCEN 1GLLO 3L6QA 4BRDA 2NRVA 3DLLL 4N76A 1NU0A 3NH1A 1D9DA 3DRRA 4LFCK 3TABA 5J1EA 2PZSA 2P9NA 5EY4A 1ZBSA 5CY4A 3I55N 3V9SA 2V7ZA 3KTQA 2D2QA 1KXPA 2NUBA 4KKOA 4F3TA 3AVHA 2ETJA 2XY8A 1BOTO 1LAVA 5AQHA 1Y19B 2B6AA 5FPDA 4W5QA 2EMSA 3C6AA 3EN9A 3D7EO 1VSMA 2VWBA 3CCJN 2IVNA 2HBJA 2D11A 3UKUA 3ULEA 3RMCA 3C65A 4FWSA 1WSIA 4BVPA 1TK5A 4KHUA 2XY5A 3MXJA 1DGKN 3OYLA 5KGWA 3PX0A 3DOKA 1NK5A 3MDQA 4H4MA 2P5OA 3RSEB 5B8HA 3BZKA 2WUSA 2O8DA 5LL6Z 2FBVA 3QO9A 4GY2B 2RHKA 1V4TA 2NRZA 3MEGA 4OLBA 4JYAK 4FJMA 5IT9O 1VQ5N 1WNSA 4EZ6A 3THWB 2O4GA 4IO9L 5JVGL 1W97L 3V1RA 3O9RA 3KIOA 3F5TA 2HHQA 3CM5A 4IDHA 3SI6A 4CZEA 5J2NA 3IS9A 1IBMK 5F1XA 4FOEA 1GLEG 1Q7YO 4Z4FA 4DV4K 5KQ8A 4CVNE 4JI7K 4RW7A 3L8BA 4JV5K 1IKVA 3R8EA 3KK1A 4H5NA 4U67L 3OYEA 4IXCA 2UUBK 4CHOA 3KK7A 4AM6A 5LMNK 3ZDTA 3OYNA 2D10A 1ASVA 3LP2A 1NNEA 4B1XB 1QZ6A 1NG9A 4N56A 4B3SK 4CF9A 1IJJA 1VHXA 1YAGA 3AVCA 3NDKA 2OA8A 2V51B 1TUYA 4KH6A 4Z4EA 3J7YP 3VGMA 3A8YA 1LV5A 5KRTA 1K6YA 2W6LA 3MXIA 3C7NA 3LDSA 3OHRA 4YOTA 4HDQA 3RR7A 2J0MA 2DPNA 3VQEA 1D8YA 3OW2M 4WFBL 2AA4A 1VQMN 4OGCA 3F73A 3E9LA 4DFPA 1NKBA 5BN8A 3ZX3A 2GUPA 2HMIA 4E0DA 4E7JA 5CYMA 3OVNA 3FGUA 4PKIA 5BRHA 1RDDA 5AQMA 5BRDA 3VF6A 3H3NO 3FE1A 2R7YA 2HBLA 4DR4K 3RMDA 4DSJA 3PV8A 1YUWA 4JD2B 2EHGA 3JS6A 3NVKA 3THXB 4BRFA 2O8FB 3O08A 4FPBA 1RT1A 3P4IA 3RMAA 4WFAL 3BF3A 2QWNA 3KD1E 2A40A 4FLZA 3DRPA 3T7ZA 2YNGA 1S1XA 5AQFA 1CZBA 3ENOA 3O9TA 4E1JA 1IG9A 3VQ9A 3E9PA 4XIUA 3HPHA 3ZSXA 2F9WA 4JRPA 2VWKA 2O8EA 4FLUA 4FM2A 1VBHA 1XNRK 3TANA 3ZSRA 3U9ZA 2F7TA 2WBNA 3KLHA 4X64K 4PL7A 1TUUA 3T1HK 3SMSA 3VMFB 4AHSA 1S3XA 4CERA 4X62K 3W0LA 3SK3A 3RRHA 4BACA 1NJZA 1LWCA 3ZCMA 4GMJB 2WONA 3TAQA 4M41A 1FKPA 1YJNN 2ZWHA 4PL8A 1RDCA 3AO4A 4RCHA 5E84A 5HP1A 1VSFA 3SJHA 4Q0BA 2YNHA 5JMVA 4DR1K 4GV9A 1SKWA 1EWQA 3WEEB 2BE2A 4JS4A 3H3OB 4A5BA 1NGAA 3E9OA 4NY0A 1U45A 3DXMA 1VK0A 1HMVA 3KVGA 2QXFA 2O8BA 4E7HA 4K8ZA 3J7AP 1A5VA 1TK8A 4YDUC 5J2QA 1S5JA 1T6DA 1TYQB 3WQUA 3ZT4A 1TAQA 4CJ5A 1L3VA 4C1NK 1TKZA 5J2PA 4BRIA 3EPYA 3D2EA 3AU4A 4GKKK 4FLYA 2DTUA 3OY9A 3QBXA 2NRWA 3VQCA 1NK4A 4DQPA 3AVIA 3DLGA 1U4BA 1QVGM 1SKRA 4LH4A 5AQIA 3NHGA 3GBTA 1RNHA 1BIUA 2YNIA 1X9WA 2P1JA 4HUEA 4H0OA 2CGJA 4JRQA 3SUPA 5C2FA 1XMQK 1NK7A 3WT0A 1NKCA 1KC7A 4BRMA 1RILA 4ISGA 1RBVA 1XHXA 4O5FA 3AA5X 1SL1A 4O5BA 5JS1A 4KHWA 3OJUA 3C0BA 1ESVA 4BE2A 3DI6A 3I0SA 3LZJA 4OPAA 4CZIA 2A1SA 4BR2A 1KTQA 3C6HA 3T1YK 1HX1A 1ZBHA 1WBDA 3ZSYA
chains in the Genus database with same CATH topology
2HSTA 1JJ2M 3DJCA 3UE5A 1EQYA 2Q0UA 3DXKB 3IDHA 4H0XB 2NZTA 5C2DA 2QWRA 3CD6N 1KAXA 4IO8A 4JN4A 5AQPA 3CF5L 1HB6A 3CQYA 4AF1A 2V52B 3GDQA 4H0YB 4BVOA 3VEYA 2BUPA 4KH5A 1DKGD 2J0JA 5C10A 2AP1A 1U2VB 4B9QA 2FJ9A 1NGEA 2ZGYA 4JK7A 4JKEA 3CIPA 3O8MA 1BUPA 1K8KB 1NGBA 4IEIA 1BG3A 2JWKA 4K42A 4CZKA 2Q2RA 4FVUA 3A5OC 4JKAA 1NI2A 5HL7L 4YOXA 4JEPA 2OTJN 3LDPA 1MK7B 1E4FT 1HPMA 3QMLA 3U7DA 3VF4A 4B1YB 5KPZA 4BRLA 3U8XA 1O13A 3CETA 5AFUH 3CCLN 1X9JA 4DXAB 3O6WA 2CGKA 4K43A 2P9NB 3EZWA 3CERA 3KWIA 5EOYA 1K73O 2Q1NA 1NGHA 1GLAG 2E2QA 3FLCO 3EKSA 5TKYA 2OANA 1WUAA 4CYEA 3CJ7A 4IZ9A 1LCUA 1NGGA 3AAQA 3GOIA 3VF2A 3AU5A 4IEEA 3CPEA 2QTDA 2NNWA 3WQTA 1KAZA 4BRAA 3EL2A 4IOAL 3I33A 1IG8A 4GVEA 2GTDA 4WCEL 4ISEA 1NGIA 4JHDA 3MN7A 1Y64A 4JK9A 4JKBA 4RWTA 5KPTA 3LM9A 2I1JA 4H0VB 5AQRA 1VQ7N 1GLDG 2QWPA 2ZF5O 1HKCA 2COPA 3I8BA 4JHDB 3H1VX 4CD1A 3N4QA 5F0XA 2OTLN 3SMPA 1P90A 3EO3A 5GIOA 3ZETB 4BRKA 2ZJRL 1ATSA 5DM7L 3BEXA 5F2RA 4M7YA 2BH1A 3ENBA 5LJWA 3K9KA 4BG8A 3P39A 4K25A 3O80A 5FPMA 4DQ8A 2AEHA 4BG9A 5ADXA 2IIRA 3CJBA 3DWLA 4M63C 2I7PA 4EAHD 4CZHA 2WFBA 1Q86O 3Q7CA 4B1UB 5CE3A 2E1YA 2KKZA 4GNIA 2CH5A 2VGNA 4EHTA 3FZLA 2A6AA 4WQ4A 5AQOA 5H1SQ 3CHWA 4YDUA 4JKFA 4FO0A 2QWMA 2J4RA 4IJAA 1SAZA 3ZEUA 4BR7A 2D1KA 4DB3A 3HZ6A 4FWKA 3FZKA 4A62A 1GLJO 2ZJPL 1QQNA 5GAHP 2DIKA 3H46O 3Q7BA 4OO1J 3VEVA 3M1FA 5AFUA 2QW9A 5AZJA 4BRNA 1GLBG 2JWLA 2YHYA 2YHXA 3CI5A 1X3MA 2P9IB 5AZJB 1RDUA 5M1FA 3VENA 1GGOA 4KH4A 3CJCA 3TTFA 3G6EN 1SS6A 4CZLA 4BR4A 1MK9B 4BR5A 5E26A 1U6ZA 3MWPA 4B1WB 1M90O 1C0FA 3R1XA 1ACAA 1Z6RA 3UKRA 3ATVA 1VQPN 1RFQA 1DEJA 1GC6A 3A5NC 3QFUA 4Y0WA 4YOWA 4IOCL 2GWKA 4B1VA 3D2FB 4I6MA 5EX5A 3UKRB 3BUZB 1NLVA 3SBGA 3O9SA 4BROA 5AQLA 5AZIA 4I6MB 5KQDA 1S72N 2QM1A 5AQZA 5AQQA 1ATNA 1BO5O 3ZX2A 3PZDA 3BF1A 2ABDA 2WC9A 3BP8A 5AZIB 1YVNA 2YVCA 3O4WA 4BQZA 5M1PA 3TSUA 3QFPA 4MDBA 3HBTA 1QQOA 2YJFA 3TTCA 5BRFA 3A0IX 3C7NB 3PIPL 1MDUB 1MIZB 1YXQA 3HOSA 4NLBA 2QWQA 2HF4A 5AQWA 3LM2A 3MCPA 3WXKA 4BRGA 3AGRA 5ELZA 4BGBA 2R82A 1VQ4N 3O9UA 3IVFA 2NRXA 5EVZA 3D6RA 5BREA 2QA4N 3CCUN 4H5TA 4WYBA 4H5RA 2QI2A 2LBBA 3E1YA 3O1WA 4F9OA 4G9ZA 3GE1A 3QDKA 1JCGA 3WXJA 1HLUA 1MWMA 2NLXA 2P9LA 3J8AA 4FSVA 1OKJA 3VETA 4MO5A 3TPQA 4TKNA 2HE7A 2QWOA 3DXKA 4LC9B 4WQ5C 3CCMN 4BY9C 1QVFM 2P9LB 1VQ9N 1P8ZA 3CJAA 3G4SN 3F2KA 3H45C 2IVPA 4C23A 1GLFO 2CGLA 5BPMA 5GIPA 3FR0A 4FPAA 3EE9A 5JLHA 3FZHA 1U2VA 3LDOA 1RDWX 4HWIA 5JICA 2RE2A 2YHWA 1Q81O 5AQVA 1K8KA 3P38A 5GADP 4YOVA 3OA9A 3CCQN 1VQKN 3CCEN 3U9DA 4H5VA 2WH5A 1GLLO 4BQLA 3L6QA 4BRDA 2NRVA 2GEMA 3VEWA 3SAHA 3DLLL 2P9SB 4L3QA 1QZ5A 4FWQA 4JKCA 3HSCA 3FP5A 3A5LC 1ATRA 5CR4A 1VQ6N 2A5XA 2P9NA 5EY4A 1ZBSA 3I55N 2FLOA 2V7ZA 1M1KO 3T69A 2X0SA 2D2QA 1KXPA 3S41A 2ITMA 5I9EB 3U8ZA 2NRHA 1T6CA 4GV6A 1BOTO 4NO7A 4ZRJA 5AQHA 2FXUA 4MDAA 1Y19B 1ZC6A 4CI6A 5CHIA 3TSPA 3NVMA 5FPDA 4NB4A 3VEZA 1CZAN 4O8UA 2EMSA 3E66A 3C6AA 3EN9A 2RQ1A 3D7EO 2VWBA 5M1KA 2YJEA 3TU5A 1EF1A 4BGAA 3CCJN 1EO1A 2IVNA 2HBJA 2YCHA 1BDGA 3ZETA 3NMUA 2ASOA 5TKWA 2D11A 2EWSA 2P9PB 3UKUA 3C65A 4FWSA 3ULEA 4BVPA 4BC4A 3RSEA 1DGKN 1BA0A 3G25A 2HBKA 3HM8A 3UKUB 3FLVA 3MDQA 3MN6A 1DIKA 3ULEB 4DKWA 2ZJQL 3RSEB 4XEIA 5B8HA 5C15A 3BINA 2WUSA 2PBDA 2VCPA 3FZMA 4FL9A 2A42A 3L4QA 2FSNA 2RHKA 4GY2B 2E2NA 3CJ1A 3EKUA 3GL1A 1V4TA 5C0YA 2NRZA 3P31A 4U7BA 2E88A 5M1QA 4CBXA 5M1NA 5FPNA 1VQ5N 3DAWA 1HKBA 1S22A 4IO9L 2Q31A 3GG4A 4M7XA 5JVGL 1W97L 4EHUA 4HDOA 2H3GX 3IMXA 3O9RA 1XUPO 1T44A 4C1NI 4PKHA 2V7YA 3F5TA 4FWMA 2CH6A 4IDHA 4YORA 4CZEA 1E5WA 4J8FA 3AY9A 4FOEA 1GLEG 5F1XA 1Q7YO 1N8RO 4MLEA 3TTDA 1XC3A 5KQ8A 2P9IA 3ATUA 3MX5A 1T3VA 4H0PA 3MK6A 1KQSM 4QS8A 3R8EA 3B8AX 4H5NA 4U67L 1J19A 4IXCA 3MMVA 5AQJA 3ZYYX 3SAFA 3WUHA 2KHOA 3KK7A 4AM6A 3DXMB 4WFNL 4A2BA 4FOIA 3LL3A 3ZDTA 4ILJA 1NGJA 2AL6A 4FWLA 2I1KA 3D2FA 2D10A 4HTLA 4H5WA 4EFHA 4B1XB 1QZ6A 1Q18A 2E2OA 4ILGB 1IJJA 1VQLN 3O5BA 1YAGA 3QICA 5AQGA 4BREA 2V51B 1R59O 1TUYA 4JKDA 3QBWA 3N4PA 4KH6A 3VGMA 3A8YA 2FSKA 3VTIA 4ILHA 4P7IA 4CJ7A 1NJIO 2GWJA 3C7NA 3VGKA 3OHRA 4YOTA 4HDQA 2ASMA 2NRRA 2J0MA 5JVLA 5DM6L 2Q36A 2DPNA 5AQTA 2IVOA 1HB8A 3FZFA 3ZX0A 3OW2M 4WFBL 4QS9A 3RVCA 1NTIA 1KBLA 1OVYA 2AA4A 3QB0A 5AQUA 4GV3A 4IJNA 5BPNA 1VQMN 4YOUA 4JAXA 4ZRIA 3E9LA 1C0GA 3ID6A 4PHTX 4DHYA 3M3ZA 2QEXN 5BN8A 2VYPA 2BTFA 3CC4N 3MX2A 1HJOA 4RTFD 2VGMA 4A2AA 3CCSN 2ZGZA 3ZX3A 2GUPA 1ZXOA 1SZ2A 2P9KB 3HRGA 1NBWA 4WQ5A 1VQ8N 4JNEA 2CB8A 2HRJA 3CJ9A 2W41A 3FGUA 4PKIA 5AR0A 5BRHA 4QS7A 2FDQA 1KD1O 4A5AA 3O9QA 3VESA 5AQMA 2W40A 5GAEP 4XH1A 5BRDA 3HOTA 3VF6A 3OBYA 1H1VA 3H3NO 3FE1A 5GINA 2P9SA 2HBLA 4NLCA 3PVLA 1X3NA 2D0PA 4BC5A 1QQMA 5AQSA 1YUWA 1ST7A 4JKGB 4JD2B 3M5RA 3JS6A 3SAGA 3KZBA 3R3LA 3NVKA 2D0OA 4BRFA 1MIXA 1NMDA 3O08A 4PKGA 1SGHA 2FF6A 4FPBA 4XH5A 4CZMA 5ADXH 2I7NA 3CC7N 4BC2A 1WOQA 3P4IA 3R6MA 4WFAL 3BF3A 2E1ZA 2QWNA 5JVHL 3R9PA 2A40A 1NM1A 3T7ZA 2E2PA 5C12A 5AQFA 3X23A 5BN9A 3TSQA 3ENOA 4MLHA 4BC3A 2HBMA 4CZGA 3O9TA 4E1JA 3MN9A 3CC2N 4CBUA 4GXBA 1ILYA 4IOXA 2P9PA 3CMEN 4K41A 2ASPA 3E9PA 2F9WA 3MCAB 1Z05A 4YL8A 2GX9A 3VPZA 1VBHA 1XQSC 2FF3B 3AGKA 3ENHA 3I56N 1K9MO 1D4XA 3A5MC 4F7GA 4BRCA 3G9WA 1Q82O 3K9JA 3U9ZA 2F7TA 3KWGA 3CCVN 3J7ZO 2WBNA 3CQXA 1RGIA 4PL7A 1TUUA 4OPHA 1KAYA 1MA9B 1G99A 2QXLA 3SMSA 3VERA 3VMFB 4CZJA 2E8AA 4AM7A 1S3XA 4DCHA 1NGDA 3W0LA 3MWTA 3SK3A 1VBGA 2KLAA 1YIJN 2J0KA 3SBTA 2A3ZA 1NGCA 5M1OA 1KC8O 1YJNN 2ZWHA 4PL8A 4RCHA 5E84A 4BR0A 4KBOA 4CD3A 1YI2N 2D4WA 1J6ZA 3SLCA 2P9UA 3SJHA 3LDNA 5LJVA 2HMPA 2NRTA 1HUXA 4Z94A 1W2BM 3WEEA 5JMVA 5MLCQ 4GV9A 3H1QA 2HF3A 2P9UB 4FWOA 3H6EA 4ISFA 5HOOA 5AQNA 3WEEB 5KPRA 1GC7A 3H3OB 4A5BA 3VEOA 3VGLA 4BRHA 1H4RA 1NGAA 3E9OA 4NY0A 3DXMA 2Q0RA 4IWVA 1V4SA 1QHAA 4FWNA 3KHYA 4XH4A 3AARA 3KVGA 1YJWN 4BRPA 4H03B 4B1ZA 3CMAN 1TYQA 1YITN 3PLAA 4WQ4C 3CPWM 1BWFO 4YDUC 1DT9A 4CBWA 2UYTA 1T6DA 1TYQB 2EMTA 2PFUA 3WQUA 3ZEUB 4IFEA 1VAZA 1SQKA 4C1NK 5BPLA 2PAVA 3WA0A 4FWPA 3WXIA 3QIJA 4BRIA 5EXWA 3EPYA 1JDEA 3D2EA 3AU4A 3VTHA 2CQUA 3VEXA 3JXUA 3L4IA 1VQON 4FWRA 3IUCA 4EKUA 3QBXA 3D2EB 5LY3A 4YOYA 2NRWA 4WF9L 4MO4A 5JLFA 3PIOL 1BA1A 2E20A 3WXLA 1YF5L 1BU6O 4H0TB 4BRQA 1VQNN 1HBKA 4JK8A 3MN5A 4JKHA 2F9TA 2ZPYA 1YJ9N 3UB5A 3EE8A 3AAPA 1QVGM 1JCFA 3IFRA 1HKGA 5AQIA 3LDQA 4CZFA 1YHQN 3GBTA 3CXCM 2P9KA 4A61A 4H0OA 2CGJA 2A41A 2QWLA 5C2FA 3G71N 5GAGP 1E4GT 3IKMA 3F9MA 3WT0A 4R79A 1K8AO 3W3DA 5BR9A 3OBWA 1KC7A 4BRMA 3CCRN 4O8KA 3HI0A 5AQYA 5IJMA 2YX6A 1NGFA 4ISGA 4EIAA 4O5FA 3O1BA 4A59A 1LOTB 3VOVA 1GG3A 3M6GA 1ISNA 1GLCG 3C0BA 4A57A 5FPEA 1ESVA 2Q97A 3ID8A 2HOEA 4OPAA 1NVLA 4CZIA 1MWKA 3U4LA 4BR2A 1JCEA 3C6HA 4JKGA 4JD2A 4BR9A 2YI1A 4ZRKA 2FSJA 5AQXA 3L0QA 1HX1A 5AQKA 3WXMB 4UY8O 3HTVA 3LDLA 1NWKA 2GELA 3FFKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ENB A;  3E9O A;  4JK8 A;  3E66 A;  4JKH A;  4ILJ A;  3E9L A;  3SBT A;  4JK7 A;  4JKE A;  4JKF A;  4JK9 A;  4JKB A;  4JKA A;  4JKG A;  4ILG B;  3SBG A;  4JKC A;  4JKG B;  3E9P A;  4JKD A;  4ILH A; 
#chains in the Genus database with same CATH topology
 2JGU A;  4B8C A;  2Q0U A;  4IFV A;  1KLN A;  3IDH A;  4H0X B;  3E01 A;  1KAX A;  4JN4 A;  1WSH A;  2V52 B;  4BVO A;  3ASM A;  2BUP A;  1DKG D;  2Z1J A;  2J0J A;  2XRI A;  1IBK K;  4FYD A;  4IEI A;  2OPS A;  1K8K B;  1SV5 A;  2ZD1 A;  4FZZ A;  1BG3 A;  2JWK A;  4E7I A;  4K0K K;  4HVJ A;  1JL1 A;  3K59 A;  1TGO A;  3V9X A;  2OTJ N;  4B1Y B;  3ZSO A;  3VF4 A;  4CJF A;  1WB9 A;  3AVF A;  4DXA B;  2DFE A;  1NGH A;  4FW2 A;  4PWD A;  1GLA G;  1QHT A;  4YY3 K;  3HK2 A;  1WUA A;  4CYE A;  1VSK A;  1NGG A;  4IEE A;  4NCG A;  5FRO A;  3HXM A;  3WNH A;  3I33 A;  2HHX A;  2GTD A;  4ISE A;  4JHD A;  4M42 A;  3RRG A;  4H0V B;  1VQ7 N;  5F0X A;  4GW6 A;  2COP A;  1S1W A;  3N4Q A;  4CGJ A;  3VQ6 A;  3SMP A;  1P90 A;  3EO3 A;  3ZET B;  2ZJR L;  1VSL A;  4G1Q A;  3LP0 A;  5DM7 L;  3K5M A;  5E41 A;  5F2R A;  3TAG A;  3K9K A;  4LSL A;  3P39 A;  2VQE K;  4DQ8 A;  2AEH A;  3DWL A;  3IG1 A;  4M63 C;  3MED A;  4KHP K;  2WFB A;  4DU3 A;  4RW4 A;  3V9W A;  4CJR A;  2CH5 A;  2J4R A;  1SAZ A;  1Y97 A;  1XHZ A;  1C1C A;  5HRN A;  3I8D A;  3H46 O;  4OO1 J;  1XMO K;  2BGG A;  5AZJ A;  1N33 K;  2YHY A;  4O0I A;  2P9I B;  3AO1 A;  3CJC A;  1MK9 B;  1QS4 A;  5E26 A;  3ZSZ A;  2G8U A;  3HO1 A;  1C0F A;  3ATV A;  3A5N C;  4Y0W A;  4ZTJ A;  1N5Y A;  3AVN A;  4B1V A;  3UKR B;  3BUZ B;  1W7A A;  4E1M A;  4PY5 A;  5AZI A;  4NXM K;  2QM1 A;  3NFA A;  5AQQ A;  3BP8 A;  1RBR A;  3V9Z A;  3TSU A;  2X6N A;  2YJF A;  3TTC A;  1NJX A;  3A0I X;  4C8O A;  3OYC A;  1MDU B;  3VQ8 A;  1OH7 A;  3O3H A;  1JLB A;  4NLB A;  2D0B A;  3LM2 A;  4JI4 K;  2X74 A;  4HHT A;  4DU1 A;  4H5R A;  2E6L A;  3E1Y A;  3O1W A;  4F9O A;  3NF7 A;  3GE1 A;  3JYT A;  1OKJ A;  3VET A;  3TPQ A;  2Q3S A;  3CCM N;  2VG7 A;  3DXK A;  4WQ5 C;  1TAU A;  4FK2 A;  1QVF M;  1S1V A;  1P8Z A;  2UUA K;  3F2K A;  3SQ0 A;  3KLG A;  1RT5 A;  4CCH A;  4FPA A;  5JLH A;  1U2V A;  5JIC A;  1VRT A;  5FLX O;  4KB0 A;  3P38 A;  5GAD P;  1VQK N;  3U9D A;  4H5V A;  1IV0 A;  3VEW A;  4CEC A;  3JSM A;  4CHQ A;  3AVK A;  1DTT A;  3RTV A;  4W5R A;  4IKF A;  3QEV A;  3T69 A;  3S41 A;  1WN7 A;  3U8Z A;  4CJ4 A;  4GVM A;  1T6C A;  4GV6 A;  3V6D A;  3KLF A;  4ICL A;  3TSP A;  4JLH A;  4DV5 K;  3LZI A;  3E66 A;  4DTS A;  4OKJ A;  3L2R A;  5M1K A;  2YJE A;  4BGA A;  2OCE A;  3NMU A;  5TKW A;  5AJ3 K;  2P9P B;  3TAP A;  3PX6 A;  3RSE A;  3AV9 A;  1BA0 A;  3G25 A;  1SL2 A;  1ZBU A;  1DIK A;  4CHZ A;  2KFZ A;  5I3U A;  3BIN A;  1BIS A;  2VCP A;  2A42 A;  4YNQ A;  5C0Y A;  3HL8 A;  3THW A;  3PX4 A;  4U7B A;  2E88 A;  3DLR A;  4KV8 A;  4CBX A;  1TKD A;  2O4I A;  1HKB A;  4OVL A;  4QAG A;  4E7K A;  1JLE A;  5I42 A;  4HDO A;  1N36 K;  3IMX A;  1XUP O;  1T44 A;  4PKH A;  5T7B A;  1HPZ A;  4YOR A;  1E5W A;  4F8R A;  3SQ4 A;  4BDP A;  1NMN A;  2HVI A;  1XC3 A;  1IO2 A;  2QKK A;  1KQS M;  3S3M A;  4TSX A;  4QS8 A;  2G8K A;  2HNY A;  3MMV A;  5AQJ A;  1BQM A;  4WFN L;  1NJW A;  2ZQB A;  1J54 A;  3LL3 A;  4ILJ A;  4FWL A;  2I1K A;  4EFH A;  4DLG A;  1Q18 A;  3OS1 A;  1HYZ A;  4ILG B;  1VQL N;  3O5B A;  3QIC A;  5AQG A;  4BRE A;  5HRR A;  4JKD A;  3BGR A;  2IGI A;  4DSK A;  2FSK A;  4ILH A;  1NK0 A;  4P7I A;  1NJI O;  2GWJ A;  2ASM A;  2NRR A;  5DM6 L;  4DV7 K;  4CE9 A;  1GOC A;  4CHP A;  2ITG A;  4CEQ A;  3FZF A;  3RVC A;  1NTI A;  1KBL A;  1OVY A;  5AQU A;  2PYL A;  5BPN A;  1FK9 A;  4YOU A;  4YFU A;  4ZRI A;  2GUI A;  2UXD K;  3ID6 A;  4DHY A;  2E5L K;  2QEX N;  2VYP A;  3U3G A;  1HYS A;  3MX2 A;  3MEE A;  4X66 K;  4PQU A;  1IKY A;  2P9K B;  3J80 O;  4DV3 K;  1NBW A;  2Y1I A;  4JNE A;  3U6F A;  3CJ9 A;  3VQA A;  5AR0 A;  2I5J A;  1DTQ A;  2FC0 A;  3ZSW A;  2DFH A;  3HVT A;  1KD1 O;  4BE1 A;  4A5A A;  3O9Q A;  2W40 A;  5GAE P;  1HNI A;  5A2Q O;  3NH2 A;  4XH1 A;  2G8H A;  4CHN A;  2P9S A;  1HQU A;  4FJ5 A;  4QOZ B;  1X3N A;  3QET A;  1BCO A;  5AQS A;  4CJQ A;  4R5P A;  4M3Z A;  1W9H A;  3SAG A;  3NF9 A;  2D0O A;  3LP1 A;  4OJR A;  5IWA K;  1SGH A;  3CC7 N;  1FXX A;  1WOQ A;  4FJL A;  3R6M A;  1OH8 A;  2Y1J A;  4LF7 K;  3AA3 A;  2B5J A;  4KI4 A;  1NM1 A;  1HYV A;  1LW2 A;  1EWR A;  4LF8 K;  3X23 A;  3AA4 A;  4BC3 A;  4Z0U A;  2D0C A;  2IS3 A;  4CZG A;  2KW4 A;  4ELT A;  3LAK A;  4CBU A;  4GXB A;  1ILY A;  4IOX A;  3FFI A;  2LSN A;  3CME N;  3ZT0 A;  4FJX A;  4CGH A;  1KVA A;  5C25 A;  1Z05 A;  5K14 A;  1S6P A;  2GX9 A;  4DF4 A;  1XQS C;  1BI4 A;  3ENH A;  3I56 N;  4F7G A;  1RCH A;  1ASW A;  3K9J A;  3KWG A;  3CCV N;  4DV1 K;  4CFD A;  1RGI A;  1XC9 A;  4NXN K;  1MA9 B;  1G99 A;  2QXL A;  2E8A A;  4AM7 A;  4LY7 A;  4Y1C A;  1NGD A;  2KLA A;  1YIJ N;  1NGC A;  5M1O A;  1KC8 O;  4KBO A;  4CD3 A;  1YI2 N;  2D4W A;  2GBZ A;  3SJJ A;  1J6Z A;  3CFR A;  4CED A;  3LDN A;  4DLE A;  2HMP A;  1W2B M;  4Z94 A;  2PY5 A;  3WEE A;  3QEW A;  5MLC Q;  2P9U B;  3H6E A;  3QEX A;  1C1A A;  3VA0 A;  4BRH A;  2Q0R A;  4IWV A;  1V4S A;  1QHA A;  4FWN A;  4I9Q A;  3V4I A;  1JXE A;  3SCX A;  1YJW N;  3CMA N;  1TYQ A;  3ZT1 A;  1DT9 A;  2EMT A;  2PFU A;  4B9V A;  3T1A A;  1TL3 A;  1SQK A;  1I39 A;  3SUO A;  3ZSV A;  3WA0 A;  3QIJ A;  1JDE A;  3VTH A;  1R0A A;  1VQO N;  4FWR A;  4EKU A;  4YOY A;  5LY3 A;  4B8A B;  3OYG A;  1RTD A;  4K8X A;  3C94 A;  3PIO L;  2BDP A;  3WXL A;  4BRQ A;  3HT3 A;  1BU6 O;  3V9U A;  3RWU A;  4E3S A;  3MN5 A;  4DV6 K;  4JKH A;  2F9T A;  4BE0 A;  1YJ9 N;  3AAP A;  3AO3 A;  1Q9X A;  3M8R A;  3CXC M;  4OGE A;  1L5U A;  4A61 A;  2A41 A;  5GAG P;  1K8A O;  4R79 A;  5BR9 A;  3IRX A;  4L8R B;  3O1B A;  1QSL A;  2EX3 A;  1ISN A;  1GLC G;  2B4J A;  4A57 A;  1UA1 A;  3ID8 A;  2O8C B;  1NVL A;  2F8S A;  4JKG A;  2YI1 A;  4ZRK A;  4FLT A;  1EP4 A;  2RF2 A;  5BR8 K;  3WXM B;  4UY8 O;  3HTV A;  3OYB A;  2GEL A;  1C0M A;  3FFK B;  3WXK A;  2XHB A;  1EQY A;  4FJG A;  2OPP A;  1HB6 A;  3CQY A;  4AF1 A;  3VEY A;  4B9Q A;  4HCB A;  2FJ9 A;  2ZGY A;  2ZM6 K;  3CIP A;  4JKE A;  4KTW A;  4K42 A;  2Q2R A;  1XWL A;  1U04 A;  4JKA A;  1NI2 A;  5HL7 L;  4YOX A;  3LDP A;  1MK7 B;  3QML A;  3SPY A;  5KPZ A;  2YKM A;  3CET A;  4DFM A;  3NF8 A;  3CCL N;  1X9J A;  2CGK A;  2P9N B;  1UWB A;  2Q1N A;  4HCC A;  3FLC O;  3EKS A;  5TKY A;  4EZ9 A;  2RPI A;  5JS2 A;  3AAQ A;  4J2B A;  1RBU A;  2NNW A;  2QTD A;  3WQT A;  4IOA L;  4B3O A;  1IG8 A;  4GVE A;  4FLW A;  3DLB A;  2IOC A;  3MN7 A;  2HVH A;  1ZBL A;  1OVQ A;  3TAF A;  4CJP A;  2QWP A;  3L2U A;  2ZF5 O;  3SPZ A;  3H1V X;  1RDA A;  4Z4C A;  3VQ4 A;  2G8V A;  2KZZ A;  3DMJ A;  4M7Y A;  2BH1 A;  3ENB A;  3CYM A;  3K2P A;  5LJW A;  3MAQ A;  5ADX A;  4BG9 A;  2IIR A;  2YV0 X;  3EZ5 A;  4KO0 A;  4CZH A;  2XO7 A;  5HRO A;  4DQR A;  2FBT A;  4B1U B;  2KKZ A;  3NGZ A;  2VGN A;  4FW1 A;  4WQ4 A;  4KI6 A;  5H1S Q;  4FZX C;  1NOY A;  4DB3 A;  3ZEU A;  4DMN A;  4FWK A;  3P1G A;  1ASU A;  1GLJ O;  2BAN A;  5J2M A;  4O0J A;  1RT7 A;  1GLB G;  4NCB A;  3TWH A;  1X3M A;  1RDU A;  4NYF A;  5FRN A;  1BCM A;  3TTF A;  1BIZ A;  1J53 A;  3ALY A;  2FBY A;  3R1X A;  1ACA A;  3UKR A;  1RFQ A;  4YOW A;  4B9T A;  4M3Y A;  1NLV A;  4FM1 A;  2HHS A;  3NH0 A;  1S72 N;  5AQZ A;  1ATN A;  1YT3 A;  2WC9 A;  4DR6 K;  2YVC A;  3O4W A;  1QE1 A;  4WE1 A;  4MDB A;  1QQO A;  5CYQ A;  3C7N B;  4CIF A;  1MIZ B;  3MCP A;  4BRG A;  3AGR A;  4CK1 A;  1VQ4 N;  1BGX T;  2NRX A;  5EVZ A;  3D6R A;  3V81 A;  4M3W A;  3CCU N;  4H5T A;  1E3M A;  1XNQ K;  3F9K A;  4J2D A;  3ULD A;  4G9Z A;  3HPO A;  1JCG A;  2NLX A;  3J8A A;  4MO5 A;  4TKN A;  2HE7 A;  2QWO A;  1B9F A;  4RG8 A;  4I7F A;  3UIQ A;  3VQB A;  4DSL A;  4DTO A;  1VQ9 N;  2YHB A;  1RT2 A;  3MXM A;  3OYD A;  4C23 A;  1GLF O;  1KVB A;  3EE9 A;  2QK9 A;  4HWI A;  4KHQ A;  4YOV A;  3CCQ N;  4CJW A;  3TAR A;  2WH5 A;  4BQL A;  4CF1 A;  3SAH A;  2GEM A;  4L3Q A;  4C8N A;  1J5E K;  1QZ5 A;  4C8M A;  4CGI A;  4FWQ A;  4JKC A;  3HP6 A;  5CR4 A;  2A5X A;  2Z1H A;  4DV2 K;  2ITM A;  3NBP A;  1N6Q A;  1JL2 A;  4DFJ A;  2NRH A;  4RW9 A;  4ZRJ A;  5CHI A;  4CI6 A;  4KAZ A;  2F8T A;  4DR2 K;  4NB4 A;  3QEP A;  1JKH A;  1CZA N;  3L2W A;  4RW6 A;  2RQ1 A;  4FZY A;  4CK2 A;  1ZBI A;  2ASO A;  4I9L A;  2EWS A;  3RMB A;  3PO5 A;  2E4L A;  3QEI A;  4Z4G A;  3OYI A;  2HBK A;  3HM8 A;  2ZJQ L;  3FLV A;  3ZLJ A;  3KLI A;  2O8E B;  4XEI A;  5C15 A;  4KHN A;  1DLO A;  2PBD A;  4CJS A;  3FZM A;  4FL9 A;  4KTQ A;  2FSN A;  3VQD A;  2E2N A;  3KJV A;  3BY5 A;  3DM2 A;  4DTN A;  4DF8 A;  1QQC A;  5FPN A;  3DAW A;  3KD5 E;  1S22 A;  2Q31 A;  3GG4 A;  1YTU A;  4EHU A;  3S3N A;  1I94 K;  3O4N A;  4C1N I;  1B9D A;  3THY A;  2D0A A;  2CH6 A;  1X1P A;  3PSF A;  4J8F A;  3AY9 A;  1HJR A;  3TTD A;  3ATU A;  4H0P A;  1KLM A;  2W42 A;  1W0H A;  3OYK A;  5HRP A;  1KFS A;  4LD0 A;  3ZYY X;  3WUH A;  2KHO A;  3DXM B;  4FOI A;  5C42 A;  1NGJ A;  4BWJ A;  2AL6 A;  3D2F A;  2Z1G A;  2E2O A;  3VQQ A;  2O8B B;  4KPY A;  1UAX A;  4N5S A;  4F3O A;  5SZT A;  1R59 O;  3QBW A;  2XY6 A;  3PO4 A;  3D0P A;  3VTI A;  4CJ7 A;  1FJG K;  5JVL A;  2Q36 A;  5DMR A;  5AQT A;  1VSJ A;  1LWE A;  2UUC K;  3ZX0 A;  1WSJ A;  3QB0 A;  4B9S A;  2AJQ A;  4GV3 A;  3AVJ A;  2P5G A;  4ZTF A;  4JAX A;  1X9S A;  1C0G A;  1CZ9 A;  1U48 A;  3M3Z A;  1HJO A;  4RTF D;  2VGM A;  4AHU A;  3CCS N;  2ZGZ A;  2Z1I A;  1EKE A;  1ZXO A;  1Q9Y A;  3HRG A;  1IKW A;  4KFB A;  1VQ8 N;  3C6T A;  2RN2 A;  1TV6 A;  2HRJ A;  5DK5 A;  2FDQ A;  1L3T A;  3DRS A;  3HOT A;  1H1V A;  3O3G A;  4NLC A;  3PVL A;  2D0P A;  4BC5 A;  1QQM A;  2KFN A;  1OH6 A;  3P83 D;  1VSE A;  2HHH K;  3KZB A;  1MIX A;  4B9L A;  4CJ3 A;  4PKG A;  2FF6 A;  4CZM A;  4X65 K;  4DUZ K;  2I7N A;  4BC2 A;  2DY4 A;  3QER A;  3O4Q A;  2E1Z A;  2WTU A;  1HNW K;  4EP4 A;  5KGX A;  3TSQ A;  3SV3 A;  3NGI A;  3O3F A;  4LF6 K;  3MN9 A;  4H4O A;  4OKE A;  1Q8I A;  3CG7 A;  4K41 A;  3MCA B;  5SWM A;  2FF3 B;  3AGK A;  4HUF A;  1K9M O;  3THV A;  4FJ8 A;  3G9W A;  1Q82 O;  4B9M A;  1SL0 A;  3J7Z O;  2HHV A;  1KAY A;  4CF2 A;  3VER A;  4DCH A;  3CM6 A;  3MWT A;  1VBG A;  4DG1 A;  4LF9 K;  4DSF A;  4JI8 K;  4FJH A;  3AVM A;  5FRM A;  4BR0 A;  2P9U A;  4N41 A;  3S9H A;  2G8I A;  2HF3 A;  4FJK A;  4FWO A;  2OZS A;  5AQN A;  4I2Q A;  5KPR A;  3OYM A;  3L2Q A;  4F4K A;  4JI1 K;  5HLF A;  4BRP A;  4H03 B;  3PLA A;  1VSD A;  1BWF O;  3I0R A;  4AHC A;  3CPW M;  4CBW A;  1UA0 A;  4H8K A;  3OYJ A;  4FLX A;  1RT6 A;  1VAZ A;  3LWL A;  2PAV A;  4FK4 A;  4FWP A;  3WXI A;  5EXW A;  2CQU A;  3KK3 A;  3VEX A;  3K58 A;  3JXU A;  3L4I A;  5HBM A;  1QSS A;  3IUC A;  3NGY A;  4WF9 L;  4OPK A;  5JLF A;  1BA1 A;  2DFF A;  2E20 A;  1YF5 L;  1YVU A;  3EE8 A;  1JCF A;  3IFR A;  4AHV A;  4CHY A;  3HP9 A;  4CZF A;  3WNG A;  4F2R A;  3DOL A;  3SUQ A;  2QWL A;  5LMU K;  3M8P A;  4IDK A;  4LFB K;  3G71 N;  3F9M A;  3OBW A;  3CCR N;  3HI0 A;  2HHU A;  4EIA A;  4CEB A;  4YHH K;  2VG6 A;  1RT4 A;  1ITG A;  1LOT B;  3VOV A;  4HUG A;  2O8C A;  1GG3 A;  4DTU A;  5FPE A;  2Q97 A;  2HOE A;  1BL3 A;  4I2P A;  1QSY A;  1NOZ A;  1MWK A;  3C95 A;  4BR9 A;  4JD2 A;  2VQF K;  2FSJ A;  3L0Q A;  3THX A;  5AQK A;  4PA1 A;  2O8F A;  3LDL A;  3A5O C;  3VQP A;  3VQ7 A;  1VSI A;  1WAJ A;  3DJC A;  3UE5 A;  2ZE2 A;  3NAE A;  3DXK B;  1WAF A;  3QIN A;  2QWR A;  1LAW A;  3T19 A;  4IO8 A;  3CF5 L;  3KLE A;  2OYQ A;  1G15 A;  3GDQ A;  4H0Y B;  4KH5 A;  2IDO A;  2AP1 A;  1FW6 A;  1U2V B;  3O8M A;  4CZK A;  1NGB A;  3QNO A;  1E4F T;  4DQS A;  4BRL A;  3U8X A;  3KK2 A;  5AFU H;  3BZC A;  5EOY A;  4B9U A;  4AHT A;  4CFB A;  1K73 O;  4C8L A;  3SQ2 A;  3JAM O;  5FDL A;  3TAE A;  3CJ7 A;  3SZ2 A;  3SQ1 A;  3GOI A;  3CPE A;  1KAZ A;  1RBT A;  3EL2 A;  4WCE L;  1NGI A;  1B92 A;  3QNN A;  5KPT A;  3LM9 A;  2I1J A;  3V1O A;  1GLD G;  1HKC A;  4CD1 A;  4AQY K;  3G0Z A;  4LH5 A;  1JLC A;  5GIO A;  1T7P A;  4BRK A;  3BEX A;  4ID5 A;  3LAM A;  4K25 A;  3O80 A;  2JLE A;  3CJB A;  2I7P A;  2PYJ A;  5CZ2 A;  4J2E A;  4M3R A;  3Q7C A;  5C24 A;  5CE3 A;  1RTH A;  2F96 A;  3B6O A;  4EHT A;  1NJY A;  5AQO A;  4DWI A;  4DSI A;  1O1W A;  4JKF A;  4YDU A;  1ZBF A;  2QWM A;  4IJA A;  2UXC K;  2OZM A;  4A62 A;  2ZJP L;  3LWM A;  4IFY A;  5GAH P;  2DIK A;  4O55 A;  3VEV A;  3M1F A;  2GV9 A;  1L3S A;  3HPG A;  2JWL A;  3HVR A;  3HYF A;  2YHX A;  1NKE A;  4CEF A;  4CES A;  4CJT A;  1VRU A;  4KRE A;  3G6E N;  4AIL C;  4BR5 A;  4E7L A;  3MWP A;  4KHS A;  4B1W B;  3C6U A;  1VQP N;  1DEJ A;  1GC6 A;  2HNZ A;  4JI6 K;  3T3F A;  1EXQ A;  1HQE A;  3EEQ A;  3RR8 A;  3TI0 A;  4O44 A;  3ZT2 A;  3SBG A;  5AQL A;  4I6M B;  2HW3 A;  4FM0 A;  4CGD A;  3U3Y A;  4DTM A;  2G8W A;  4BQZ A;  5M1P A;  3QFP A;  5BRF A;  3OTO K;  4DSE A;  3PIP L;  1YXQ A;  1S1U A;  2QWQ A;  2HF4 A;  4OPJ A;  1C0U A;  4BGB A;  3O9U A;  3OS2 A;  1U47 A;  2LBB A;  1TK0 A;  2OPR A;  3WXJ A;  1HLU A;  1MWM A;  4FSV A;  4ZHR A;  3L3V A;  4BY9 C;  4OLA A;  2P9L B;  2IAJ A;  1KVC A;  3D45 A;  3SUN A;  3MEC A;  4B08 A;  3CJA A;  3OYH A;  2X78 A;  3AA2 A;  3H45 C;  2IVP A;  4ELU A;  3FR0 A;  4FLV A;  3LDO A;  1RDW X;  2RE2 A;  2YHW A;  5AQV A;  1K8K A;  1C6V A;  3OA9 A;  5KI6 A;  1A5X A;  3M8Q A;  2P9S B;  3K5L A;  3HSC A;  3FP5 A;  3A5L C;  1ATR A;  1CXU A;  1VQ6 N;  2D5R A;  2FLO A;  2ATQ A;  2QKB A;  1M1K O;  4FCY A;  2E6M A;  2X0S A;  3WNF A;  5I9E B;  1S6Q A;  4NO7 A;  2FXU A;  4MDA A;  4CEE A;  1ZC6 A;  3NE6 A;  3NVM A;  4B3R K;  3VEZ A;  4O8U A;  5EU7 A;  4LSN A;  3TU5 A;  1EF1 A;  1EO1 A;  4RW8 A;  5HRS A;  2YCH A;  1BDG A;  3ZET A;  2UXB K;  1HR0 K;  3DLE A;  4CJU A;  2W6K A;  4FXD A;  4BC4 A;  4CJK A;  1RT3 A;  3UKU B;  3ULE B;  3MN6 A;  1SUQ A;  4DKW A;  4CEO A;  4LFA K;  1BI4 B;  3L4Q A;  1S1T A;  3CJ1 A;  4NYN A;  3EKU A;  1HRH A;  1JXB A;  3GL1 A;  3P31 A;  2O8D B;  3KKS A;  4DQQ A;  5M1Q A;  4CJL A;  5M1N A;  4B3T K;  4M7X A;  4DUY K;  2VWJ A;  2H3G X;  1NK8 A;  1WSG A;  2V7Y A;  4FWM A;  4CJV A;  1N8R O;  4MLE A;  2P9I A;  3MX5 A;  1T3V A;  3MK6 A;  4CJE A;  3HST B;  2KZM A;  3B8A X;  1J19 A;  3OJS A;  4Z4H A;  3AVL A;  3SAF A;  4A2B A;  3AVA A;  4HTL A;  4H5W A;  4CIG A;  4DR7 K;  1REV A;  1C1B A;  4BDZ A;  1NK9 A;  3N4P A;  4DV0 K;  1EET A;  3VGK A;  3HJF A;  1L3U A;  2IVO A;  2WOM A;  1HB8 A;  3LP3 A;  4PUO A;  4QS9 A;  4BDY A;  1J5O A;  4IJN A;  3BDP A;  4PHT X;  4UQG A;  4M3X A;  2YNF A;  1HNZ K;  4W5N A;  1OH5 A;  1IBL K;  2BTF A;  3CC4 N;  4KHY A;  4A2A A;  3CQ8 A;  4IG3 A;  3PSI A;  1SZ2 A;  3OYA A;  4WQ5 A;  4CW7 B;  2CB8 A;  5CZ1 A;  4ELV A;  2W41 A;  4B9N A;  1ZYQ A;  4DU4 A;  4QS7 A;  3QIP A;  4DTR A;  4FJ7 A;  1A5W A;  2VG5 A;  3VES A;  4DS5 A;  4KRF A;  3VA3 A;  4CIE A;  1TVR A;  3OBY A;  4DFK A;  3G10 A;  1JLG A;  1TKT A;  4O4G A;  4CFC A;  5GIN A;  1NK6 A;  4JI0 K;  1ST7 A;  4JKG B;  3L3U A;  3M5R A;  3R3L A;  3ISN C;  1NMD A;  5D3G A;  4XH5 A;  5ADX H;  4C8K A;  1WLJ A;  3LAL A;  5JVH L;  3R9P A;  4DR5 K;  1MU2 A;  5C12 A;  2E2P A;  1RDB A;  1F21 A;  3K5N A;  5BN9 A;  3EY1 A;  1GOB A;  4MLH A;  2HBM A;  3SNN A;  2YHA A;  4M3T A;  3TAM A;  3CC2 N;  2P9P A;  2ASP A;  4NCA A;  4Z4I A;  2X6S A;  3QLH A;  4YL8 A;  1LW0 A;  4EP5 A;  3VPZ A;  1D4X A;  3A5M C;  3LAN A;  4BRC A;  3NCI A;  4F2S A;  1RBS A;  2HHW A;  3CQX A;  3K5O A;  3AVB A;  4OPH A;  4GKJ K;  4CZJ A;  2KTQ A;  1WSF A;  1I3A A;  1IH7 A;  1N34 K;  1WSE A;  2J0K A;  3SBT A;  3K0S A;  2A3Z A;  2A1R A;  4E1N A;  4M45 A;  1YTA A;  3SLC A;  4W5O A;  4OX9 K;  3DYA A;  5LJV A;  3VQ5 A;  2NRT A;  1HUX A;  4J2A A;  3H1Q A;  4M3U A;  4IBN A;  4W5T A;  4ISF A;  5HOO A;  2G8F A;  1GC7 A;  3VEO A;  3VGL A;  1H4R A;  3QIO A;  3KHY A;  4XH4 A;  3KKR A;  3AAR A;  4B1Z A;  4DR3 K;  1YIT N;  4WQ4 C;  1IKX A;  1C0T A;  4KB1 A;  2UYT A;  3ZEU B;  4IFE A;  4OKK A;  4DTJ A;  5BPL A;  1CXQ A;  4ID1 A;  4N47 A;  4V19 S;  4AH9 A;  4FK0 A;  1T05 A;  2F4V K;  4CEZ A;  3D2E B;  1KFD A;  3SYZ A;  2HHT A;  4MO4 A;  3NF6 A;  4H0T B;  1VQN N;  3AO5 A;  1HBK A;  4JK8 A;  2ZPY A;  3UB5 A;  4LF5 K;  1T03 A;  3ZT3 A;  1HKG A;  3LDQ A;  1T8E A;  1YHQ N;  1UOC A;  4CK3 A;  2P9K A;  1S9E A;  1E4G T;  3CFO A;  3IKM A;  2OPQ A;  3W3D A;  3AVG A;  2HND A;  4AHR A;  4O8K A;  5AQY A;  1FKO A;  5IJM A;  2YX6 A;  1NGF A;  1X9M A;  4A59 A;  4MFB A;  3HM9 A;  3M6G A;  2UU9 K;  3PUF A;  3OYF A;  1BHL A;  3U4L A;  3TR8 A;  1JCE A;  5AQX A;  4FJJ A;  4FVM A;  1NWK A;  1RTI A;  2HST A;  1JJ2 M;  3A2F A;  3DLK A;  4BWM A;  2NZT A;  5C2D A;  4JI5 K;  3CD6 N;  5AQP A;  1QTM A;  2FBX A;  3LPT A;  1XI1 A;  5C10 A;  1NGE A;  4JK7 A;  2KQ2 A;  1BUP A;  4FVU A;  3EYZ A;  4JEP A;  4QCL A;  1LWF A;  1HPM A;  3U7D A;  4CGF A;  1O13 A;  3SV4 A;  3CFP A;  1Z25 A;  3O6W A;  1KCF A;  4K43 A;  3EZW A;  3KWI A;  3CER A;  1J9A A;  1JLF A;  2E2Q A;  2OAN A;  4IZ9 A;  3IAY A;  1LCU A;  3ITH A;  3VF2 A;  3AU5 A;  1BQN A;  4B3M K;  4BRA A;  4DTP A;  4IG0 A;  1CLQ A;  4JI3 K;  1Y64 A;  4JK9 A;  4CF0 A;  4JKB A;  4RWT A;  5AQR A;  4JHD B;  2HB5 A;  3I8B A;  2OTL N;  1KSP A;  4CGG A;  2YKN A;  1ATS A;  4BG8 A;  3L2V A;  5FPM A;  4DQI A;  1N32 K;  4EAH D;  3M8S A;  3AO2 A;  1D9F A;  1Q86 O;  2E1Y A;  4GNI A;  4FJI A;  2IC3 A;  2A6A A;  3FZL A;  4KTZ A;  3CHW A;  4FO0 A;  4BR7 A;  3QES A;  2D1K A;  3HZ6 A;  3FZK A;  3S3O A;  3K57 A;  4CFA A;  1QQN A;  2XY7 A;  3Q7B A;  3THY B;  1SKS A;  1KRP A;  5AFU A;  2QW9 A;  3ZSQ A;  4BRN A;  4LF4 K;  3CI5 A;  1RTJ A;  5AZJ B;  5M1F A;  3VEN A;  1GGO A;  4KH4 A;  1JLQ A;  1SS6 A;  4CZL A;  4BR4 A;  1U6Z A;  3P5J A;  3WNE A;  1M90 O;  1TKX A;  1Z6R A;  4CEA A;  3QFU A;  4IOC L;  3OS0 A;  2GWK A;  1VSH A;  1EX4 A;  3D2F B;  4I6M A;  5EX5 A;  3O9S A;  4BRO A;  4Y1D A;  1HNX K;  5KRS A;  5KQD A;  3PY8 A;  1BO5 O;  3ZX2 A;  3PZD A;  3BF1 A;  2ABD A;  5AZI B;  1YVN A;  4E19 A;  3HBT A;  4MQ3 A;  4JI2 K;  3HOS A;  2P51 A;  1U49 A;  1D5A A;  5AQW A;  4DS4 A;  1S9G A;  5ELZ A;  2R82 A;  1JLA A;  3IVF A;  3H08 A;  3J81 O;  2RKI A;  1GOA A;  5BRE A;  2QA4 N;  1WBB A;  4WYB A;  4E89 A;  2QI2 A;  1HNV A;  3QDK A;  4Q5V A;  2P9L A;  4JS5 A;  4LC9 B;  3LPU A;  4CF8 A;  4HTU A;  4DTX A;  3VN5 A;  3DLH A;  3G4S N;  5BPM A;  2CGL A;  4FJN A;  5GIP A;  3V1Q A;  3FZH A;  1TL1 A;  1Q81 O;  4FJ9 A;  5KTQ A;  3B6P A;  1Z26 A;  3CCE N;  1GLL O;  3L6Q A;  4BRD A;  2NRV A;  3DLL L;  4N76 A;  1NU0 A;  3NH1 A;  1D9D A;  3DRR A;  4LFC K;  3TAB A;  5J1E A;  2PZS A;  2P9N A;  5EY4 A;  1ZBS A;  5CY4 A;  3I55 N;  3V9S A;  2V7Z A;  3KTQ A;  2D2Q A;  1KXP A;  2NUB A;  4KKO A;  4F3T A;  3AVH A;  2ETJ A;  2XY8 A;  1BOT O;  1LAV A;  5AQH A;  1Y19 B;  2B6A A;  5FPD A;  4W5Q A;  2EMS A;  3C6A A;  3EN9 A;  3D7E O;  1VSM A;  2VWB A;  3CCJ N;  2IVN A;  2HBJ A;  2D11 A;  3UKU A;  3ULE A;  3RMC A;  3C65 A;  4FWS A;  1WSI A;  4BVP A;  1TK5 A;  4KHU A;  2XY5 A;  3MXJ A;  1DGK N;  3OYL A;  5KGW A;  3PX0 A;  3DOK A;  1NK5 A;  3MDQ A;  4H4M A;  2P5O A;  3RSE B;  5B8H A;  3BZK A;  2WUS A;  2O8D A;  5LL6 Z;  2FBV A;  3QO9 A;  4GY2 B;  2RHK A;  1V4T A;  2NRZ A;  3MEG A;  4OLB A;  4JYA K;  4FJM A;  5IT9 O;  1VQ5 N;  1WNS A;  4EZ6 A;  3THW B;  2O4G A;  4IO9 L;  5JVG L;  1W97 L;  3V1R A;  3O9R A;  3KIO A;  3F5T A;  2HHQ A;  3CM5 A;  4IDH A;  3SI6 A;  4CZE A;  5J2N A;  3IS9 A;  1IBM K;  5F1X A;  4FOE A;  1GLE G;  1Q7Y O;  4Z4F A;  4DV4 K;  5KQ8 A;  4CVN E;  4JI7 K;  4RW7 A;  3L8B A;  4JV5 K;  1IKV A;  3R8E A;  3KK1 A;  4H5N A;  4U67 L;  3OYE A;  4IXC A;  2UUB K;  4CHO A;  3KK7 A;  4AM6 A;  5LMN K;  3ZDT A;  3OYN A;  2D10 A;  1ASV A;  3LP2 A;  1NNE A;  4B1X B;  1QZ6 A;  1NG9 A;  4N56 A;  4B3S K;  4CF9 A;  1IJJ A;  1VHX A;  1YAG A;  3AVC A;  3NDK A;  2OA8 A;  2V51 B;  1TUY A;  4KH6 A;  4Z4E A;  3J7Y P;  3VGM A;  3A8Y A;  1LV5 A;  5KRT A;  1K6Y A;  2W6L A;  3MXI A;  3C7N A;  3LDS A;  3OHR A;  4YOT A;  4HDQ A;  3RR7 A;  2J0M A;  2DPN A;  3VQE A;  1D8Y A;  3OW2 M;  4WFB L;  2AA4 A;  1VQM N;  4OGC A;  3F73 A;  3E9L A;  4DFP A;  1NKB A;  5BN8 A;  3ZX3 A;  2GUP A;  2HMI A;  4E0D A;  4E7J A;  5CYM A;  3OVN A;  3FGU A;  4PKI A;  5BRH A;  1RDD A;  5AQM A;  5BRD A;  3VF6 A;  3H3N O;  3FE1 A;  2R7Y A;  2HBL A;  4DR4 K;  3RMD A;  4DSJ A;  3PV8 A;  1YUW A;  4JD2 B;  2EHG A;  3JS6 A;  3NVK A;  3THX B;  4BRF A;  2O8F B;  3O08 A;  4FPB A;  1RT1 A;  3P4I A;  3RMA A;  4WFA L;  3BF3 A;  2QWN A;  3KD1 E;  2A40 A;  4FLZ A;  3DRP A;  3T7Z A;  2YNG A;  1S1X A;  5AQF A;  1CZB A;  3ENO A;  3O9T A;  4E1J A;  1IG9 A;  3VQ9 A;  3E9P A;  4XIU A;  3HPH A;  3ZSX A;  2F9W A;  4JRP A;  2VWK A;  2O8E A;  4FLU A;  4FM2 A;  1VBH A;  1XNR K;  3TAN A;  3ZSR A;  3U9Z A;  2F7T A;  2WBN A;  3KLH A;  4X64 K;  4PL7 A;  1TUU A;  3T1H K;  3SMS A;  3VMF B;  4AHS A;  1S3X A;  4CER A;  4X62 K;  3W0L A;  3SK3 A;  3RRH A;  4BAC A;  1NJZ A;  1LWC A;  3ZCM A;  4GMJ B;  2WON A;  3TAQ A;  4M41 A;  1FKP A;  1YJN N;  2ZWH A;  4PL8 A;  1RDC A;  3AO4 A;  4RCH A;  5E84 A;  5HP1 A;  1VSF A;  3SJH A;  4Q0B A;  2YNH A;  5JMV A;  4DR1 K;  4GV9 A;  1SKW A;  1EWQ A;  3WEE B;  2BE2 A;  4JS4 A;  3H3O B;  4A5B A;  1NGA A;  3E9O A;  4NY0 A;  1U45 A;  3DXM A;  1VK0 A;  1HMV A;  3KVG A;  2QXF A;  2O8B A;  4E7H A;  4K8Z A;  3J7A P;  1A5V A;  1TK8 A;  4YDU C;  5J2Q A;  1S5J A;  1T6D A;  1TYQ B;  3WQU A;  3ZT4 A;  1TAQ A;  4CJ5 A;  1L3V A;  4C1N K;  1TKZ A;  5J2P A;  4BRI A;  3EPY A;  3D2E A;  3AU4 A;  4GKK K;  4FLY A;  2DTU A;  3OY9 A;  3QBX A;  2NRW A;  3VQC A;  1NK4 A;  4DQP A;  3AVI A;  3DLG A;  1U4B A;  1QVG M;  1SKR A;  4LH4 A;  5AQI A;  3NHG A;  3GBT A;  1RNH A;  1BIU A;  2YNI A;  1X9W A;  2P1J A;  4HUE A;  4H0O A;  2CGJ A;  4JRQ A;  3SUP A;  5C2F A;  1XMQ K;  1NK7 A;  3WT0 A;  1NKC A;  1KC7 A;  4BRM A;  1RIL A;  4ISG A;  1RBV A;  1XHX A;  4O5F A;  3AA5 X;  1SL1 A;  4O5B A;  5JS1 A;  4KHW A;  3OJU A;  3C0B A;  1ESV A;  4BE2 A;  3DI6 A;  3I0S A;  3LZJ A;  4OPA A;  4CZI A;  2A1S A;  4BR2 A;  1KTQ A;  3C6H A;  3T1Y K;  1HX1 A;  1ZBH A;  1WBD A;  3ZSY A; 
#chains in the Genus database with same CATH homology
 2HST A;  1JJ2 M;  3DJC A;  3UE5 A;  1EQY A;  2Q0U A;  3DXK B;  3IDH A;  4H0X B;  2NZT A;  5C2D A;  2QWR A;  3CD6 N;  1KAX A;  4IO8 A;  4JN4 A;  5AQP A;  3CF5 L;  1HB6 A;  3CQY A;  4AF1 A;  2V52 B;  3GDQ A;  4H0Y B;  4BVO A;  3VEY A;  2BUP A;  4KH5 A;  1DKG D;  2J0J A;  5C10 A;  2AP1 A;  1U2V B;  4B9Q A;  2FJ9 A;  1NGE A;  2ZGY A;  4JK7 A;  4JKE A;  3CIP A;  3O8M A;  1BUP A;  1K8K B;  1NGB A;  4IEI A;  1BG3 A;  2JWK A;  4K42 A;  4CZK A;  2Q2R A;  4FVU A;  3A5O C;  4JKA A;  1NI2 A;  5HL7 L;  4YOX A;  4JEP A;  2OTJ N;  3LDP A;  1MK7 B;  1E4F T;  1HPM A;  3QML A;  3U7D A;  3VF4 A;  4B1Y B;  5KPZ A;  4BRL A;  3U8X A;  1O13 A;  3CET A;  5AFU H;  3CCL N;  1X9J A;  4DXA B;  3O6W A;  2CGK A;  4K43 A;  2P9N B;  3EZW A;  3CER A;  3KWI A;  5EOY A;  1K73 O;  2Q1N A;  1NGH A;  1GLA G;  2E2Q A;  3FLC O;  3EKS A;  5TKY A;  2OAN A;  1WUA A;  4CYE A;  3CJ7 A;  4IZ9 A;  1LCU A;  1NGG A;  3AAQ A;  3GOI A;  3VF2 A;  3AU5 A;  4IEE A;  3CPE A;  2QTD A;  2NNW A;  3WQT A;  1KAZ A;  4BRA A;  3EL2 A;  4IOA L;  3I33 A;  1IG8 A;  4GVE A;  2GTD A;  4WCE L;  4ISE A;  1NGI A;  4JHD A;  3MN7 A;  1Y64 A;  4JK9 A;  4JKB A;  4RWT A;  5KPT A;  3LM9 A;  2I1J A;  4H0V B;  5AQR A;  1VQ7 N;  1GLD G;  2QWP A;  2ZF5 O;  1HKC A;  2COP A;  3I8B A;  4JHD B;  3H1V X;  4CD1 A;  3N4Q A;  5F0X A;  2OTL N;  3SMP A;  1P90 A;  3EO3 A;  5GIO A;  3ZET B;  4BRK A;  2ZJR L;  1ATS A;  5DM7 L;  3BEX A;  5F2R A;  4M7Y A;  2BH1 A;  3ENB A;  5LJW A;  3K9K A;  4BG8 A;  3P39 A;  4K25 A;  3O80 A;  5FPM A;  4DQ8 A;  2AEH A;  4BG9 A;  5ADX A;  2IIR A;  3CJB A;  3DWL A;  4M63 C;  2I7P A;  4EAH D;  4CZH A;  2WFB A;  1Q86 O;  3Q7C A;  4B1U B;  5CE3 A;  2E1Y A;  2KKZ A;  4GNI A;  2CH5 A;  2VGN A;  4EHT A;  3FZL A;  2A6A A;  4WQ4 A;  5AQO A;  5H1S Q;  3CHW A;  4YDU A;  4JKF A;  4FO0 A;  2QWM A;  2J4R A;  4IJA A;  1SAZ A;  3ZEU A;  4BR7 A;  2D1K A;  4DB3 A;  3HZ6 A;  4FWK A;  3FZK A;  4A62 A;  1GLJ O;  2ZJP L;  1QQN A;  5GAH P;  2DIK A;  3H46 O;  3Q7B A;  4OO1 J;  3VEV A;  3M1F A;  5AFU A;  2QW9 A;  5AZJ A;  4BRN A;  1GLB G;  2JWL A;  2YHY A;  2YHX A;  3CI5 A;  1X3M A;  2P9I B;  5AZJ B;  1RDU A;  5M1F A;  3VEN A;  1GGO A;  4KH4 A;  3CJC A;  3TTF A;  3G6E N;  1SS6 A;  4CZL A;  4BR4 A;  1MK9 B;  4BR5 A;  5E26 A;  1U6Z A;  3MWP A;  4B1W B;  1M90 O;  1C0F A;  3R1X A;  1ACA A;  1Z6R A;  3UKR A;  3ATV A;  1VQP N;  1RFQ A;  1DEJ A;  1GC6 A;  3A5N C;  3QFU A;  4Y0W A;  4YOW A;  4IOC L;  2GWK A;  4B1V A;  3D2F B;  4I6M A;  5EX5 A;  3UKR B;  3BUZ B;  1NLV A;  3SBG A;  3O9S A;  4BRO A;  5AQL A;  5AZI A;  4I6M B;  5KQD A;  1S72 N;  2QM1 A;  5AQZ A;  5AQQ A;  1ATN A;  1BO5 O;  3ZX2 A;  3PZD A;  3BF1 A;  2ABD A;  2WC9 A;  3BP8 A;  5AZI B;  1YVN A;  2YVC A;  3O4W A;  4BQZ A;  5M1P A;  3TSU A;  3QFP A;  4MDB A;  3HBT A;  1QQO A;  2YJF A;  3TTC A;  5BRF A;  3A0I X;  3C7N B;  3PIP L;  1MDU B;  1MIZ B;  1YXQ A;  3HOS A;  4NLB A;  2QWQ A;  2HF4 A;  5AQW A;  3LM2 A;  3MCP A;  3WXK A;  4BRG A;  3AGR A;  5ELZ A;  4BGB A;  2R82 A;  1VQ4 N;  3O9U A;  3IVF A;  2NRX A;  5EVZ A;  3D6R A;  5BRE A;  2QA4 N;  3CCU N;  4H5T A;  4WYB A;  4H5R A;  2QI2 A;  2LBB A;  3E1Y A;  3O1W A;  4F9O A;  4G9Z A;  3GE1 A;  3QDK A;  1JCG A;  3WXJ A;  1HLU A;  1MWM A;  2NLX A;  2P9L A;  3J8A A;  4FSV A;  1OKJ A;  3VET A;  4MO5 A;  3TPQ A;  4TKN A;  2HE7 A;  2QWO A;  3DXK A;  4LC9 B;  4WQ5 C;  3CCM N;  4BY9 C;  1QVF M;  2P9L B;  1VQ9 N;  1P8Z A;  3CJA A;  3G4S N;  3F2K A;  3H45 C;  2IVP A;  4C23 A;  1GLF O;  2CGL A;  5BPM A;  5GIP A;  3FR0 A;  4FPA A;  3EE9 A;  5JLH A;  3FZH A;  1U2V A;  3LDO A;  1RDW X;  4HWI A;  5JIC A;  2RE2 A;  2YHW A;  1Q81 O;  5AQV A;  1K8K A;  3P38 A;  5GAD P;  4YOV A;  3OA9 A;  3CCQ N;  1VQK N;  3CCE N;  3U9D A;  4H5V A;  2WH5 A;  1GLL O;  4BQL A;  3L6Q A;  4BRD A;  2NRV A;  2GEM A;  3VEW A;  3SAH A;  3DLL L;  2P9S B;  4L3Q A;  1QZ5 A;  4FWQ A;  4JKC A;  3HSC A;  3FP5 A;  3A5L C;  1ATR A;  5CR4 A;  1VQ6 N;  2A5X A;  2P9N A;  5EY4 A;  1ZBS A;  3I55 N;  2FLO A;  2V7Z A;  1M1K O;  3T69 A;  2X0S A;  2D2Q A;  1KXP A;  3S41 A;  2ITM A;  5I9E B;  3U8Z A;  2NRH A;  1T6C A;  4GV6 A;  1BOT O;  4NO7 A;  4ZRJ A;  5AQH A;  2FXU A;  4MDA A;  1Y19 B;  1ZC6 A;  4CI6 A;  5CHI A;  3TSP A;  3NVM A;  5FPD A;  4NB4 A;  3VEZ A;  1CZA N;  4O8U A;  2EMS A;  3E66 A;  3C6A A;  3EN9 A;  2RQ1 A;  3D7E O;  2VWB A;  5M1K A;  2YJE A;  3TU5 A;  1EF1 A;  4BGA A;  3CCJ N;  1EO1 A;  2IVN A;  2HBJ A;  2YCH A;  1BDG A;  3ZET A;  3NMU A;  2ASO A;  5TKW A;  2D11 A;  2EWS A;  2P9P B;  3UKU A;  3C65 A;  4FWS A;  3ULE A;  4BVP A;  4BC4 A;  3RSE A;  1DGK N;  1BA0 A;  3G25 A;  2HBK A;  3HM8 A;  3UKU B;  3FLV A;  3MDQ A;  3MN6 A;  1DIK A;  3ULE B;  4DKW A;  2ZJQ L;  3RSE B;  4XEI A;  5B8H A;  5C15 A;  3BIN A;  2WUS A;  2PBD A;  2VCP A;  3FZM A;  4FL9 A;  2A42 A;  3L4Q A;  2FSN A;  2RHK A;  4GY2 B;  2E2N A;  3CJ1 A;  3EKU A;  3GL1 A;  1V4T A;  5C0Y A;  2NRZ A;  3P31 A;  4U7B A;  2E88 A;  5M1Q A;  4CBX A;  5M1N A;  5FPN A;  1VQ5 N;  3DAW A;  1HKB A;  1S22 A;  4IO9 L;  2Q31 A;  3GG4 A;  4M7X A;  5JVG L;  1W97 L;  4EHU A;  4HDO A;  2H3G X;  3IMX A;  3O9R A;  1XUP O;  1T44 A;  4C1N I;  4PKH A;  2V7Y A;  3F5T A;  4FWM A;  2CH6 A;  4IDH A;  4YOR A;  4CZE A;  1E5W A;  4J8F A;  3AY9 A;  4FOE A;  1GLE G;  5F1X A;  1Q7Y O;  1N8R O;  4MLE A;  3TTD A;  1XC3 A;  5KQ8 A;  2P9I A;  3ATU A;  3MX5 A;  1T3V A;  4H0P A;  3MK6 A;  1KQS M;  4QS8 A;  3R8E A;  3B8A X;  4H5N A;  4U67 L;  1J19 A;  4IXC A;  3MMV A;  5AQJ A;  3ZYY X;  3SAF A;  3WUH A;  2KHO A;  3KK7 A;  4AM6 A;  3DXM B;  4WFN L;  4A2B A;  4FOI A;  3LL3 A;  3ZDT A;  4ILJ A;  1NGJ A;  2AL6 A;  4FWL A;  2I1K A;  3D2F A;  2D10 A;  4HTL A;  4H5W A;  4EFH A;  4B1X B;  1QZ6 A;  1Q18 A;  2E2O A;  4ILG B;  1IJJ A;  1VQL N;  3O5B A;  1YAG A;  3QIC A;  5AQG A;  4BRE A;  2V51 B;  1R59 O;  1TUY A;  4JKD A;  3QBW A;  3N4P A;  4KH6 A;  3VGM A;  3A8Y A;  2FSK A;  3VTI A;  4ILH A;  4P7I A;  4CJ7 A;  1NJI O;  2GWJ A;  3C7N A;  3VGK A;  3OHR A;  4YOT A;  4HDQ A;  2ASM A;  2NRR A;  2J0M A;  5JVL A;  5DM6 L;  2Q36 A;  2DPN A;  5AQT A;  2IVO A;  1HB8 A;  3FZF A;  3ZX0 A;  3OW2 M;  4WFB L;  4QS9 A;  3RVC A;  1NTI A;  1KBL A;  1OVY A;  2AA4 A;  3QB0 A;  5AQU A;  4GV3 A;  4IJN A;  5BPN A;  1VQM N;  4YOU A;  4JAX A;  4ZRI A;  3E9L A;  1C0G A;  3ID6 A;  4PHT X;  4DHY A;  3M3Z A;  2QEX N;  5BN8 A;  2VYP A;  2BTF A;  3CC4 N;  3MX2 A;  1HJO A;  4RTF D;  2VGM A;  4A2A A;  3CCS N;  2ZGZ A;  3ZX3 A;  2GUP A;  1ZXO A;  1SZ2 A;  2P9K B;  3HRG A;  1NBW A;  4WQ5 A;  1VQ8 N;  4JNE A;  2CB8 A;  2HRJ A;  3CJ9 A;  2W41 A;  3FGU A;  4PKI A;  5AR0 A;  5BRH A;  4QS7 A;  2FDQ A;  1KD1 O;  4A5A A;  3O9Q A;  3VES A;  5AQM A;  2W40 A;  5GAE P;  4XH1 A;  5BRD A;  3HOT A;  3VF6 A;  3OBY A;  1H1V A;  3H3N O;  3FE1 A;  5GIN A;  2P9S A;  2HBL A;  4NLC A;  3PVL A;  1X3N A;  2D0P A;  4BC5 A;  1QQM A;  5AQS A;  1YUW A;  1ST7 A;  4JKG B;  4JD2 B;  3M5R A;  3JS6 A;  3SAG A;  3KZB A;  3R3L A;  3NVK A;  2D0O A;  4BRF A;  1MIX A;  1NMD A;  3O08 A;  4PKG A;  1SGH A;  2FF6 A;  4FPB A;  4XH5 A;  4CZM A;  5ADX H;  2I7N A;  3CC7 N;  4BC2 A;  1WOQ A;  3P4I A;  3R6M A;  4WFA L;  3BF3 A;  2E1Z A;  2QWN A;  5JVH L;  3R9P A;  2A40 A;  1NM1 A;  3T7Z A;  2E2P A;  5C12 A;  5AQF A;  3X23 A;  5BN9 A;  3TSQ A;  3ENO A;  4MLH A;  4BC3 A;  2HBM A;  4CZG A;  3O9T A;  4E1J A;  3MN9 A;  3CC2 N;  4CBU A;  4GXB A;  1ILY A;  4IOX A;  2P9P A;  3CME N;  4K41 A;  2ASP A;  3E9P A;  2F9W A;  3MCA B;  1Z05 A;  4YL8 A;  2GX9 A;  3VPZ A;  1VBH A;  1XQS C;  2FF3 B;  3AGK A;  3ENH A;  3I56 N;  1K9M O;  1D4X A;  3A5M C;  4F7G A;  4BRC A;  3G9W A;  1Q82 O;  3K9J A;  3U9Z A;  2F7T A;  3KWG A;  3CCV N;  3J7Z O;  2WBN A;  3CQX A;  1RGI A;  4PL7 A;  1TUU A;  4OPH A;  1KAY A;  1MA9 B;  1G99 A;  2QXL A;  3SMS A;  3VER A;  3VMF B;  4CZJ A;  2E8A A;  4AM7 A;  1S3X A;  4DCH A;  1NGD A;  3W0L A;  3MWT A;  3SK3 A;  1VBG A;  2KLA A;  1YIJ N;  2J0K A;  3SBT A;  2A3Z A;  1NGC A;  5M1O A;  1KC8 O;  1YJN N;  2ZWH A;  4PL8 A;  4RCH A;  5E84 A;  4BR0 A;  4KBO A;  4CD3 A;  1YI2 N;  2D4W A;  1J6Z A;  3SLC A;  2P9U A;  3SJH A;  3LDN A;  5LJV A;  2HMP A;  2NRT A;  1HUX A;  4Z94 A;  1W2B M;  3WEE A;  5JMV A;  5MLC Q;  4GV9 A;  3H1Q A;  2HF3 A;  2P9U B;  4FWO A;  3H6E A;  4ISF A;  5HOO A;  5AQN A;  3WEE B;  5KPR A;  1GC7 A;  3H3O B;  4A5B A;  3VEO A;  3VGL A;  4BRH A;  1H4R A;  1NGA A;  3E9O A;  4NY0 A;  3DXM A;  2Q0R A;  4IWV A;  1V4S A;  1QHA A;  4FWN A;  3KHY A;  4XH4 A;  3AAR A;  3KVG A;  1YJW N;  4BRP A;  4H03 B;  4B1Z A;  3CMA N;  1TYQ A;  1YIT N;  3PLA A;  4WQ4 C;  3CPW M;  1BWF O;  4YDU C;  1DT9 A;  4CBW A;  2UYT A;  1T6D A;  1TYQ B;  2EMT A;  2PFU A;  3WQU A;  3ZEU B;  4IFE A;  1VAZ A;  1SQK A;  4C1N K;  5BPL A;  2PAV A;  3WA0 A;  4FWP A;  3WXI A;  3QIJ A;  4BRI A;  5EXW A;  3EPY A;  1JDE A;  3D2E A;  3AU4 A;  3VTH A;  2CQU A;  3VEX A;  3JXU A;  3L4I A;  1VQO N;  4FWR A;  3IUC A;  4EKU A;  3QBX A;  3D2E B;  5LY3 A;  4YOY A;  2NRW A;  4WF9 L;  4MO4 A;  5JLF A;  3PIO L;  1BA1 A;  2E20 A;  3WXL A;  1YF5 L;  1BU6 O;  4H0T B;  4BRQ A;  1VQN N;  1HBK A;  4JK8 A;  3MN5 A;  4JKH A;  2F9T A;  2ZPY A;  1YJ9 N;  3UB5 A;  3EE8 A;  3AAP A;  1QVG M;  1JCF A;  3IFR A;  1HKG A;  5AQI A;  3LDQ A;  4CZF A;  1YHQ N;  3GBT A;  3CXC M;  2P9K A;  4A61 A;  4H0O A;  2CGJ A;  2A41 A;  2QWL A;  5C2F A;  3G71 N;  5GAG P;  1E4G T;  3IKM A;  3F9M A;  3WT0 A;  4R79 A;  1K8A O;  3W3D A;  5BR9 A;  3OBW A;  1KC7 A;  4BRM A;  3CCR N;  4O8K A;  3HI0 A;  5AQY A;  5IJM A;  2YX6 A;  1NGF A;  4ISG A;  4EIA A;  4O5F A;  3O1B A;  4A59 A;  1LOT B;  3VOV A;  1GG3 A;  3M6G A;  1ISN A;  1GLC G;  3C0B A;  4A57 A;  5FPE A;  1ESV A;  2Q97 A;  3ID8 A;  2HOE A;  4OPA A;  1NVL A;  4CZI A;  1MWK A;  3U4L A;  4BR2 A;  1JCE A;  3C6H A;  4JKG A;  4JD2 A;  4BR9 A;  2YI1 A;  4ZRK A;  2FSJ A;  5AQX A;  3L0Q A;  1HX1 A;  5AQK A;  3WXM B;  4UY8 O;  3HTV A;  3LDL A;  1NWK A;  2GEL A;  3FFK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...