4JKEA

Open and closed forms of t1789p human prp8 rnase h-like domain with bound mg ion
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
219
Chain Sequence
LFSQIIWFVDDTNVYRVPIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 68
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkeA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkeA01
4JKBA 4JKGA 4JKAA 4JKHA 4JKDA 3E9PA 3E9OA 4ILJA 4JK9A 4JKGB 3SBGA 4ILGB 3E66A 3ENBA 3SBTA 4JK7A 4JKFA 4JK8A 3E9LA 4JKEA 4ILHA 4JKCA
chains in the Genus database with same CATH superfamily
1HNVA 2QM1A 3UB5A 2EMTA 1LWCA 1VSKA 4ISEA 3OJUA 4FJKA 4GV3A 4AHRA 4LF5K 3W0LA 4I2QA 1CLQA 2A5XA 3CCJN 2NRHA 1BDGA 2XRIA 4A2BA 4YOWA 2P9NB 1VRTA 3SAHA 2FBVA 2Q3SA 4X65K 4B1UB 1I3AA 2OPSA 3ZCMA 4KHPK 2D11A 3THWB 3ZETB 4CESA 4B8AB 1RT3A 3FZFA 4DV2K 4FWKA 1C0FA 1N5YA 5DK5A 4BE2A 4MO4A 5FPEA 1KD1O 4BDZA 5AQWA 1RDCA 4JV5K 4C23A 1NJWA 1LV5A 1Y97A 5D3GA 4DSKA 3VEVA 1O1WA 1Y19B 3AVJA 5FLXO 4WFNL 3LZIA 4GV9A 1WLJA 2Q97A 3K58A 4BQZA 1IKXA 2OTLN 3OYJA 3VA0A 3P4IA 2WH5A 5JVLA 3KHYA 1VQ6N 1RTJA 4JHDB 1RT5A 1Q82O 2YV0X 3BINA 2D0OA 3LDNA 3M1FA 1SZ2A 1NGBA 4O5BA 3LPUA 4H8KA 5BR9A 1LAWA 4GKJK 4GMJB 2HBJA 5CYMA 2WFBA 1BQMA 4FOIA 1WAJA 3C65A 1V4SA 3AVGA 4QS9A 1JLBA 2YX6A 3ENOA 4X66K 4QOZB 1QHAA 3NVKA 4B9UA 5AQYA 3CJ1A 4IO9L 2F8TA 4FJJA 2O8EA 2IC3A 1WSFA 4BR9A 3IRXA 2F8SA 4M41A 4AILC 2RKIA 1LAVA 4CEZA 4DWIA 1BGXT 4FJ8A 2KW4A 2KQ2A 3EEQA 4YY3K 4B9LA 4BGBA 4E1MA 4KREA 4AF1A 3WEEA 4M7YA 1T8EA 4CCHA 5B8HA 3PO5A 4M63C 3VQ4A 3F73A 5CZ2A 4LF4K 2FSKA 2P9KB 3FLVA 1YUWA 3R3LA 1RBUA 4DFKA 3ULEB 4DQSA 3SBGA 3B6PA 3LPTA 1E3MA 1GOAA 3K5MA 3K5NA 1TVRA 2QWRA 1GLDG 3TARA 4KTWA 5KQDA 1IKWA 4CZGA 3H1QA 5BRDA 3QNOA 4CZKA 4KB1A 3OYNA 1J5OA 2WOMA 5BN8A 3LP0A 3DM2A 3O80A 3R9PA 3VQAA 3OYFA 4Z94A 1S9EA 4M3UA 5C12A 4DSEA 3TABA 1D4XA 3ALYA 4J2EA 3MEDA 4DQ8A 4WQ4C 4NCGA 3VGKA 4DSJA 1QVGM 4OLBA 4Z4HA 4CZLA 4LY7A 3MXJA 1GLEG 3VEOA 4ELTA 2G8HA 3WQUA 4OPHA 1NGJA 1VQ5N 1JL2A 1BIUA 3CPEA 4JKAA 4F4KA 4JS5A 4J2DA 4CD1A 3OYAA 2P5GA 2QK9A 3P1GA 1S72N 2DFHA 1ASWA 3HYFA 3A8YA 2HHHK 3H08A 3ID8A 3LM9A 4NYNA 4IKFA 3U3GA 4A57A 5IWAK 2PAVA 1GGOA 1ATNA 4FWMA 4WQ5A 4FJLA 2HHUA 2P51A 2I7PA 4FLVA 1YITN 2E6MA 2QWOA 1ILYA 4FW2A 2Q31A 3SUOA 5E41A 4B1ZA 4ID5A 3T19A 3KWGA 3E9PA 1ZBFA 2XY8A 1HUXA 1HMVA 1MWMA 1VSDA 3TPQA 1F21A 2W6KA 5AQFA 5EXWA 5HBMA 5C10A 2QWMA 4BC4A 3EKSA 1FXXA 1HNXK 4BRLA 3L2UA 1R0AA 1YI2N 3V9WA 3PX4A 1RT6A 4CZHA 4X62K 3ZDTA 1U48A 1ZBUA 2NRRA 3BUZB 4W5RA 4U7BA 4LF7K 3VEYA 4PUOA 3TAFA 3SAGA 4JKHA 4JRQA 1NGDA 4PY5A 4G9ZA 4TKNA 1TL3A 3X23A 2BH1A 1DEJA 4BDPA 1JL1A 4IOXA 4CVNE 1IKVA 3MXIA 5AQOA 1TYQA 1UWBA 5BRHA 3HPGA 1X3MA 4Y0WA 4BRIA 5BR8K 2NZTA 3I8DA 4LH4A 1QSYA 1TUUA 4CERA 1XNRK 4CK1A 1RTDA 1BG3A 2HBMA 2V51B 4Q0BA 3CC2N 3AVKA 4MLHA 3VTIA 3SUNA 5AQIA 2E8AA 4JI1K 3A5LC 2QA4N 3K59A 3NVMA 2QWNA 4CJKA 3QIPA 4HUEA 1Q81O 3HO1A 4BRDA 3SI6A 3LP3A 4NB4A 2D0AA 4PWDA 2DFFA 4YNQA 2YNHA 3MWPA 1SL1A 3FP5A 1NLVA 3G71N 2PYJA 4FLXA 1SS6A 3ZT0A 4E0DA 3D6RA 4B9NA 3FZMA 3O6WA 3MMVA 4WFAL 3CFRA 3AGKA 2UXBK 4B1XB 1XMOK 3VERA 1DKGD 2Z1JA 2HHVA 1MA9B 4I9QA 1VSIA 3JXUA 1K6YA 3HTVA 4FWNA 4BRCA 3CCSN 2P1JA 4XEIA 4BRKA 5EY4A 4YHHK 5ADXA 2QWLA 1U04A 2HHXA 3K5LA 4FJXA 1TK0A 3PLAA 3KKRA 3K9KA 5J2MA 2A1RA 5BRFA 2AL6A 1YTUA 4XIUA 4RW4A 1P90A 4FJNA 1J53A 3AO2A 2XHBA 4CGHA 5M1FA 4JK7A 4KHUA 4PKIA 2ZJQL 3HPHA 1C0MA 4B1YB 1R59O 4KHQA 3AVMA 5EU7A 3CCLN 2E88A 3IVFA 1TYQB 1NKEA 1KAYA 4BROA 4CZEA 3GDQA 5E84A 3NF9A 4J2BA 5KTQA 3FGUA 4CI6A 1RDUA 1A5VA 3SJHA 4DKWA 1TKTA 1S1WA 4FWPA 1LWFA 1WSGA 1BOTO 4BC5A 3AU5A 1VAZA 2ZGZA 3VN5A 1E5WA 3AVIA 4BRFA 1S6QA 3EKUA 4CEDA 2J0MA 4FPBA 1GC7A 4IZ9A 3NBPA 4FK4A 3B8AX 4FJGA 4FJ5A 3TSPA 1FK9A 2BTFA 4DLEA 2HHWA 5AQKA 3HVTA 1IO2A 3D7EO 5SWMA 4B3MK 3EPYA 4E3SA 1Z25A 4DV0K 1M90O 4LC9B 3MEGA 1VK0A 4JYAK 4O8UA 1Q86O 4BR5A 2QWPA 1FW6A 4CYEA 3JS6A 4OGEA 1S5JA 3OJSA 1TV6A 4B9VA 4DR7K 2I7NA 4LFAK 2QWQA 1WAFA 2A42A 3AVBA 4O0IA 4I6MA 3CMAN 2X74A 3IAYA 3QLHA 3O3FA 3NHGA 3VENA 2KLAA 4E1JA 2OPPA 3TTCA 1NJXA 2UUBK 3PX6A 1IV0A 4CJPA 3FZKA 4IO8A 3LM2A 3T1HK 4MFBA 1KLMA 4JI7K 2ASPA 3VQ9A 3FZLA 1D9DA 4H5TA 4I9LA 1GLAG 1J6ZA 2HNYA 1VQ9N 2ETJA 1VSEA 4HCBA 3K9JA 4Q5VA 1X3NA 4FJHA 3AO5A 2KZZA 1IBMK 4CGIA 2OZSA 4FJ7A 3OS1A 1L5UA 3L2WA 4BE1A 4ELUA 1XHZA 3DLEA 2D4WA 1KVAA 2VWKA 2BGGA 2P9KA 4XH1A 1NTIA 3DWLA 3TAQA 4RWTA 4GNIA 3QEPA 5AQLA 4JI6K 3DOLA 2ITMA 4FOEA 5IJMA 1WSIA 4BC3A 5I42A 2PZSA 4GVEA 3WEEB 3D45A 1EX4A 2ZPYA 3OBYA 1D8YA 1TAUA 4HWIA 1RDDA 5CR4A 3MN7A 1TUYA 5BN9A 4JRPA 1N34K 3DLBA 2YHYA 4AHVA 4DUZK 3CCRN 4BRQA 4WFBL 1FKPA 2HNDA 2YNGA 4KV8A 3ID6A 3DLRA 3O9UA 1Y64A 3RTVA 3R1XA 3UE5A 2D0PA 3U8XA 4JS4A 4NXMK 3RR8A 2D0BA 1S1TA 1JLEA 4KRFA 1EQYA 1MK9B 4CJQA 2OANA 4GVMA 4K43A 3SV3A 4LF9K 4HUGA 5HP1A 2E2OA 3T7ZA 1VQLN 5I9EB 1N36K 4KHNA 2D10A 4OX9K 3VQ6A 5BPLA 1ATSA 1J54A 4M3RA 3AGRA 3V4IA 1BA1A 2FF3B 2OPRA 3I55N 1HKBA 4YOTA 3I33A 4H0OA 2G8KA 1Q18A 3NH2A 1ASVA 1N32K 3LDLA 3HOTA 2IVOA 4BR7A 1W2BM 4FWQA 4IWVA 1NG9A 1KCFA 5AQZA 2A40A 2NRZA 3KLHA 3C6TA 1HKCA 2RPIA 4JK8A 4DV5K 1ITGA 3QEWA 2FBYA 1EWQA 4O0JA 3ZSXA 3VOVA 3SMPA 2P5OA 4DFPA 2NRXA 2Q2RA 4WF9L 5KRTA 2WBNA 5AQXA 4CIGA 4CZJA 3O08A 5AQGA 2G8FA 3THWA 2DFEA 3L3UA 3SUPA 2FXUA 2VG7A 3CJ9A 3DRRA 4FW1A 4B9MA 1QS4A 2P9NA 3TR8A 2IIRA 5JS2A 2RN2A 4CF0A 5M1NA 1SUQA 3HM9A 2XY6A 3CMEN 1MK7B 4JKCA 3KTQA 2VYPA 2G8UA 2YKMA 2DY4A 4CJ3A 1Q7YO 4IOCL 3EY1A 3G4SN 4J2AA 1RDAA 5A2QO 3ITHA 2O8BA 4KBOA 1DTTA 1ZBSA 4H0TB 1XMQK 2JWKA 2CH5A 1DLOA 2UXDK 1ISNA 1OH8A 4M3ZA 2P9UA 3HP6A 5T7BA 2ZD1A 1U2VA 1ACAA 2Q0RA 2HB5A 4NXNK 3ASMA 4HDOA 2P9LB 1M1KO 3J7ZO 2J0KA 2YHBA 1GC6A 2NRWA 5JICA 2IDOA 3N4PA 1QE1A 3CPWM 3VQPA 3BGRA 1SL2A 4BDYA 3D2EA 1IH7A 3IKMA 3RMDA 3IUCA 1QZ6A 3KLEA 2G8WA 1S1UA 1B9FA 3WXJA 3O9TA 3AA5X 5HRNA 4FM0A 3OVNA 1JXEA 3GG4A 2E2NA 4FYDA 4DCHA 5AR0A 5AZIA 1BO5O 4CBWA 5F0XA 4FZYA 1QQMA 4E7HA 4EHUA 4TSXA 3KLGA 1V4TA 3GOIA 3NAEA 4NCBA 4YFUA 4B9TA 1NK9A 1OVQA 1HNZK 3VQDA 1BUPA 4H4MA 5CHIA 1NJZA 3SQ1A 3O1WA 4EP5A 1S6PA 3ENHA 1QZ5A 1BQNA 1C0UA 3B6OA 1RFQA 1UOCA 2P9IB 3PIPL 5AQPA 2D5RA 2FDQA 4IOAL 3CC4N 3OBWA 4W5QA 4QAGA 4YOVA 1LOTB 3UKRA 1BL3A 4IG0A 4E89A 3A5OC 1KLNA 1JCGA 3K0SA 1GOBA 5LJWA 1ZYQA 4F8RA 1W9HA 4CJFA 4O55A 3ZX2A 5LMUK 4DV4K 4CF8A 1T44A 4B3OA 4BRNA 1T03A 4E7IA 4N56A 3U8ZA 2AJQA 2A3ZA 3BDPA 2XY5A 2P9PB 2WUSA 3HOSA 3OW2M 1BI4A 5KI6A 5JVGL 3DJCA 1GG3A 3EZWA 5CYQA 3NGIA 1DGKN 4DF4A 2QKBA 3MXMA 5HRRA 3MCPA 5FRNA 1BCOA 1RT4A 4DR4K 3ISNC 4ILHA 2ZJRL 1I94K 1RT1A 3VESA 1BCMA 1S1XA 4LF8K 2R82A 3Q7BA 4HUFA 4DR3K 2O8FB 2GTDA 2ABDA 4DU4A 5SZTA 4CJ7A 5GAHP 4CJRA 3QMLA 4FWRA 3ENBA 2OYQA 3CCMN 5GAGP 3EE8A 3U6FA 1QQNA 1NVLA 2E6LA 3NMUA 4A5BA 3M3ZA 1KVCA 3ZSWA 3O3GA 1HJRA 2Z1GA 1Z6RA 2F9TA 1HR0K 3OA9A 2FJ9A 4B08A 1WUAA 2O8CA 3O9RA 4JKDA 1RTHA 4FJ9A 3NGYA 4E1NA 2YHWA 5FPNA 5BREA 2IGIA 3BF1A 4FLZA 3V9ZA 4DSFA 3S3MA 2AEHA 2W6LA 1TK8A 3I0SA 1Q9XA 4JI4K 3KIOA 3TU5A 5FPDA 3RSEB 5C24A 4RW7A 2HRJA 1T6CA 5FDLA 3VEZA 1EP4A 1ATRA 5AQTA 2JGUA 2CH6A 2FSJA 3ULDA 3AA2A 4CHYA 1UAXA 2F96A 3OYKA 3PO4A 2RE2A 2DIKA 1SGHA 4FVUA 3PVLA 4OPKA 5BPNA 3FZHA 4H4OA 3PY8A 4CIEA 5AZJB 4JI5K 2PY5A 1LCUA 3ATUA 4AHTA 4KPYA 1YAGA 4H0YB 1T3VA 4F3OA 1KRPA 1RBTA 3ZYYX 4LSNA 4BG9A 1JJ2M 1VHXA 4FL9A 4CZIA 4IG3A 1B92A 1BIZA 3I8BA 2VCPA 3CI5A 2GBZA 4IDHA 4DR2K 4QS7A 5C2FA 2ATQA 1NGEA 2O8DA 1P8ZA 1KFSA 3TI0A 3THYB 4FO0A 3AO4A 3WXMB 4FLYA 3CJBA 2HMIA 5JLFA 3AVAA 4CEEA 4F3TA 3QINA 4C8LA 3ZT4A 4DSLA 3PZDA 1K8KA 5C15A 4RW8A 1Q8IA 3AAPA 3JAMO 4OPJA 4NLCA 5FROA 4H0PA 1NGHA 1W0HA 1IBKK 1NOZA 1LW0A 1HB8A 1BU6O 1HPZA 3E9LA 4BVPA 5E26A 4BWJA 1ZC6A 3ZSQA 5GADP 4DTRA 4V19S 1C1BA 2GV9A 3V9SA 4JD2A 3ZSVA 1DT9A 4F9OA 1L3UA 2PYLA 3O9QA 4DQQA 4Z0UA 4CIFA 4ILJA 4KAZA 4EKUA 1NI2A 3VETA 5C2DA 3TAEA 4IJAA 3LDQA 3DI6A 3HI0A 1N8RO 1J19A 2X6NA 1JLGA 3H3NO 3VF4A 4BVOA 1ASUA 1L3VA 5C0YA 3C94A 4KHWA 3OTOK 3DXKB 3NGZA 4OGCA 4KH5A 2IOCA 4E7LA 4CZMA 4QS8A 1GOCA 4RCHA 1NK7A 4FLTA 1YT3A 4FWSA 2GUPA 4NY0A 2QTDA 3CERA 5DMRA 4EP4A 4O44A 2EWSA 2NUBA 4EAHD 2YJFA 4OPAA 2ZQBA 1NGGA 2FC0A 4OKJA 3PSFA 3ZSZA 5KQ8A 2FF6A 5GIOA 3UKUA 2X0SA 2D0CA 3AY9A 3AVFA 3VQCA 3TAMA 3MN9A 3UKUB 4DTMA 1ZBHA 1JXBA 3DLHA 3AA4A 3T69A 4ZRKA 1W97L 3QDKA 1HB6A 1DIKA 3OYLA 4R5PA 1NWKA 1U6ZA 4BE0A 3V81A 5GIPA 5CZ1A 1NBWA 3MN5A 3J7AP 4HTUA 4BG8A 2ASMA 3VA3A 3AO3A 4CGJA 1RBRA 1XHXA 3M8QA 1GLFO 3KLFA 2GELA 4MLEA 4Z4IA 4M3XA 4BRHA 2HBLA 3SQ4A 1TKZA 3O4QA 5JLHA 3QEVA 1JCEA 4N47A 2Q0UA 1BA0A 3DXKA 2KHOA 3H1VX 4MO5A 5K14A 3O8MA 3H45C 4FSVA 5CY4A 3M5RA 1NKCA 2ZE2A 3G9WA 3F5TA 3SMSA 1KFDA 3AARA 4NO7A 3THVA 4ZRJA 5M1OA 5MLCQ 3J81O 2DPNA 1VSMA 2HW3A 4BRGA 1X9WA 3CYMA 3SK3A 3AO1A 3DMJA 1JDEA 4DU3A 3HSCA 1VSJA 4JD2B 4DLGA 4KI6A 1HX1A 3WNHA 1U49A 3IG1A 3ZT1A 4AH9A 1VQMN 3QBWA 1YXQA 2UUCK 1JCFA 1SV5A 3U7DA 1YTAA 4AHUA 4OO1J 1VQKN 3LAKA 3OYDA 1VBHA 5AQSA 4YL8A 3CF5L 2E2PA 3VQ7A 3DOKA 1QSSA 4DQPA 3QB0A 4CJSA 3VF6A 1K8KB 2YVCA 3D2FB 3SPYA 3OY9A 3QFUA 1H1VA 1HJOA 4K8XA 3T1YK 3KK2A 4BQLA 4DXAB 1X9JA 3MECA 5H1SQ 4DTPA 2XY7A 5TKYA 3THYA 3KK7A 1YVUA 1XWLA 3QFPA 4L3QA 2O8DB 4BC2A 3L2VA 1SL0A 3LWMA 5AQQA 3A5NC 4FCYA 3EZ5A 4JLHA 3RWUA 3GBTA 3HL8A 4P7IA 5DM7L 4OLAA 2YHAA 4A2AA 3OYIA 1VQ7N 1QSLA 3KK1A 3CQXA 5GAEP 1NGCA 1UA0A 1MWKA 3L0QA 4DTJA 4JKGA 1QHTA 4C1NK 1OH6A 3KZBA 2P9SB 2W42A 2W40A 1RT7A 2W41A 3U9DA 1VBGA 1NOYA 2KFNA 3MN6A 3CCEN 3MWTA 2VQEK 4CK2A 4IFVA 3T1AA 2ZM6K 5CE3A 1WSEA 3E66A 3SBTA 3KD5E 2J0JA 1NGFA 2BDPA 1RBVA 4M45A 3AVNA 4L8RB 3DLLL 1X1PA 4PHTX 3TSUA 2RQ1A 3RSEA 4B1WB 4C8OA 4GY2B 2X6SA 3S9HA 3NH0A 3H3OB 3VQQA 3QETA 4DHYA 4JEPA 2E1YA 4WCEL 4Z4CA 5AQVA 1IG8A 3QO9A 3CCUN 4RW6A 4CHQA 2IVPA 3QNNA 2EHGA 2QXLA 4LFCK 4GKKK 3L8BA 3BF3A 4DS5A 3OS2A 5LMNK 4EHTA 4FXDA 3WT0A 4DR1K 1Z05A 3O5BA 4I2PA 2Z1HA 3P31A 1DTQA 2F9WA 3L4QA 1ST7A 3PX0A 1SKWA 3CC7N 4M42A 3OS0A 1KVBA 2O8FA 5M1PA 5AQNA 3C7NA 2YNIA 4HTLA 1W7AA 4BR0A 4U67L 3SLCA 1MIXA 3JYTA 4JKEA 3RVCA 3E1YA 3VGLA 3VEXA 3CM5A 4CW7B 4PKHA 4JKBA 1REVA 4WYBA 4CFAA 3IMXA 3RR7A 4EFHA 1RCHA 3U9ZA 4YOXA 3MX2A 4CFBA 3SV4A 2E5LK 3ZEUA 4N41A 4F7GA 1XNQK 4RG8A 3SYZA 1MIZB 3BY5A 2O4IA 3LL3A 1WBDA 1C1CA 3HVRA 4K25A 3VQBA 2WC9A 4ID1A 3CM6A 2HVHA 1ESVA 4JAXA 1ZBLA 4DV6K 2E20A 2QKKA 4CJWA 2G8IA 4W5NA 3DXMA 5F1XA 5BPMA 2CGJA 3TAPA 1YJNN 1C0TA 1KAZA 4DUYK 5JMVA 1K9MO 1IBLK 4EZ9A 3THXB 1FKOA 4BRMA 1YF5L 2P9IA 4RW9A 4LSLA 5IT9O 2I1KA 3SZ2A 4H03B 5HL7L 3GE1A 3THXA 4AM6A 2X78A 4O4GA 3KK3A 1K73O 1L3SA 4FWOA 2I5JA 4IDKA 1WN7A 5F2RA 3DXMB 1G15A 1NK4A 2CGLA 4M7XA 5KPRA 2ZF5O 5AZIB 2VQFK 5HLFA 4ISGA 1KSPA 1YIJN 1VRUA 4KTZA 4Y1CA 4C1NI 2D2QA 4O5FA 1BHLA 3NF6A 4CD3A 3P5JA 3LP1A 4OVLA 2B6AA 3C0BA 3G10A 4UY8O 2FBXA 3O4WA 3ZEUB 5C25A 3S41A 3K5OA 4CHZA 3T3FA 2QXFA 5FPMA 4H0XB 3VQEA 4DF8A 1L3TA 2P9UB 4CBXA 2IVNA 3TTDA 1ZBIA 3P38A 3SCXA 4FJMA 3AVHA 2LSNA 2JWLA 1RTIA 5C42A 2O8BB 2BE2A 3VMFB 1B9DA 2A6AA 4LF6K 3BP8A 3H6EA 3MDQA 4B8CA 4CJEA 3QEIA 3S3OA 4K0KK 1UA1A 1HBKA 3C7NB 1HRHA 4CFCA 3RRGA 3PSIA 3A2FA 2EMSA 3OYMA 3WUHA 2Q1NA 3GL1A 3S3NA 1ZXOA 4CHOA 4CEFA 4MQ3A 1A5WA 2JLEA 2OA8A 4A5AA 1S22A 3SUQA 2HF4A 4KHSA 4C8MA 2XO7A 3V9UA 1GLCG 4ISFA 1EO1A 4KTQA 3KJVA 4HVJA 3WXKA 3CG7A 5LL6Z 4K8ZA 2HHTA 1RDWX 3RMCA 2V7ZA 3LP2A 2WTUA 5LY3A 5M1KA 1U4BA 4DR6K 4B3TK 4JI3K 2F7TA 3K2PA 4PL8A 1CZAN 1XQSC 3NE6A 4DMNA 4JI2K 3HM8A 4CGGA 4Z4FA 4C8NA 3LZJA 3QEXA 4HHTA 3FE1A 4N5SA 3C6AA 5AQHA 2KFZA 3LANA 3QESA 4FK2A 2NRVA 4ZTJA 4KB0A 2PBDA 5KPZA 1SKSA 3CFOA 4CE9A 2G8VA 3CJ7A 2Z1IA 3L2RA 3MAQA 2VWBA 1A5XA 3PIOL 4WQ5C 1U45A 3FFKB 2QI2A 1T6DA 3WQTA 3MCAB 4DB3A 3L4IA 1NGIA 1OH5A 1OVYA 2P9SA 1KQSM 3O9SA 4X64K 4M3YA 1K8AO 4JKGB 3V9XA 4H5WA 4CF9A 1KC8O 3ZX0A 1HLUA 1RGIA 5KPTA 4CJLA 4IFEA 4XH4A 4CBUA 4HDQA 3AV9A 2BUPA 4C8KA 3CXCM 1GLLO 2I1JA 2HHSA 3RMBA 3M8RA 3WNFA 4DFMA 2UXCK 4J8FA 3EO3A 3OHRA 4CF1A 4Y1DA 3F2KA 1HKGA 1OKJA 1HYVA 1YJ9N 1NU0A 3BEXA 1WB9A 3VGMA 2V7YA 2YHXA 2HOEA 2ASOA 3G0ZA 4F2SA 4FM2A 2AA4A 4ZRIA 3NF7A 4B9SA 1E4GT 2A41A 3D2FA 3F9MA 3ZX3A 3V1RA 3C6HA 1T05A 5HRPA 3OYEA 1YJWN 1XC3A 3E9OA 3EYZA 1VSHA 3FR0A 2E2QA 3ZSYA 1MU2A 3CJCA 2YI1A 3I56N 1IG9A 4GV6A 4CEAA 4BREA 1TGOA 1SAZA 4DR5K 2R7YA 4OKEA 3LWLA 3IFRA 3ZT2A 1LWEA 5EVZA 3HZ6A 3U3YA 2A1SA 2HSTA 4I6MB 1NKBA 1J5EK 1YHQN 4CZFA 1CXQA 1XC9A 2BANA 1KAXA 1CZBA 5ELZA 4A61A 1D9FA 1NK8A 2RHKA 2OCEA 5M1QA 2HBKA 4M3WA 1WBBA 1S3XA 4FJIA 3W3DA 3CD6N 3CCQN 2DTUA 1QVFM 4E7KA 1TAQA 2FBTA 4FVMA 4OJRA 1D5AA 4CEOA 3LALA 4PA1A 3VF2A 1TKDA 3P39A 3SAFA 1NNEA 1XI1A 3N4QA 2HVIA 3HJFA 4G1QA 3J7YP 1JKHA 3AU4A 3MEEA 3NFAA 2GX9A 3H46O 2EX3A 4EZ6A 1LW2A 4DTSA 1HYZA 4HCCA 2NRTA 5HROA 2KTQA 3SPZA 1HQEA 1KTQA 3DYAA 1BWFO 4I7FA 2UU9K 3DAWA 4N76A 2O4GA 4XH5A 3WNEA 1XUPO 3R6MA 4FLUA 1QQCA 1HQUA 5HRSA 1NK5A 2PFUA 1VSLA 4LD0A 4UQGA 2HMPA 2ZGYA 4FZZA 5AJ3K 3FLCO 4AM7A 4DTOA 3FFIA 4CK3A 4A62A 1NGAA 3AA3A 2RF2A 3KVGA 3MK6A 2QW9A 4YDUA 2KKZA 1Q9YA 3VTHA 1JLQA 4KH6A 2KZMA 1X9MA 2VGMA 3HT3A 3CHWA 3HBTA 4KHYA 1J9AA 3O4NA 4W5OA 5AQRA 3M8SA 1HYSA 1QTMA 2VWJA 5EX5A 4CJVA 1KXPA 3L2QA 4KFBA 2B4JA 4QCLA 1SKRA 4R79A 3ATVA 1FJGK 3EL2A 2HF3A 4M3TA 4ZTFA 3U4LA 2B5JA 2HNZA 1C0GA 3CFPA 5ADXH 3VQ5A 5KGWA 1KBLA 4CF2A 3TWHA 3EN9A 5FRMA 4RTFD 4DFJA 5EOYA 3SNNA 1NJIO 3VPZA 2YNFA 4NLBA 1NK0A 4AHCA 3DLKA 4CFDA 4ELVA 4CHPA 2VG6A 2CGKA 3AVLA 3AAQA 1WNSA 2COPA 4B9QA 1TK5A 5LJVA 1C1AA 1VQNN 1S1VA 1S9GA 2UYTA 4PQUA 1H4RA 4KKOA 3VQ8A 4ZHRA 1TL1A 1EF1A 5AQUA 3TTFA 4WQ4A 1I39A 1NJYA 4E7JA 3OYHA 4CHNA 3QIJA 4AQYK 5HOOA 4KH4A 3J8AA 3LDSA 3KWIA 4W5TA 3ZSRA 3LDPA 3OYGA 1EWRA 4BGAA 1CZ9A 3G25A 2ZWHA 4BRAA 4IFYA 2OPQA 5AZJA 3BZKA 3A5MC 3TANA 3WA0A 3L3VA 4ICLA 1CXUA 3E01A 4YOYA 4JKFA 4MDBA 5I3UA 4LH5A 4CECA 1RBSA 3EE9A 2YJEA 4Z4GA 3PV8A 3RMAA 2E4LA 2ZJPL 4BR2A 4OKKA 3UIQA 4CJ5A 4FWLA 4YORA 3PUFA 1RDBA 5DM6L 1NM1A 5J1EA 4B1VA 1OH7A 1HNIA 1JLAA 3OYBA 2LBBA 3O3HA 3KD1E 3J80O 3R8EA 4JI0K 2YCHA 5JVHL 1IKYA 1QQOA 2GWJA 2E1ZA 3NH1A 1NK6A 2HHQA 4H5NA 4A59A 1VQPN 1EXQA 3CQYA 2GWKA 2GEMA 3L6QA 3AVCA 2D1KA 3QBXA 3P83D 3SJJA 3CQ8A 1GLBG 4NYFA 3ZLJA 2O8CB 2FSNA 3TSQA 3VEWA 1WSJA 5KGXA 2GUIA 4BY9C 4IEEA 4DV7K 4JI8K 4CJUA 2FLOA 5J2PA 3QIOA 4K41A 4JNEA 3WNGA 1G99A 4GW6A 4F2RA 2QEXN 1EKEA 4H0VB 1HNWK 4CEQA 1RILA 2NNWA 4WE1A 1O13A 3O1BA 4JN4A 1NMNA 2IS3A 1MDUB 4CEBA 1RNHA 1JLCA 3V1OA 3BZCA 3CETA 4Z4EA 4EIAA 4DG1A 4CGFA 3DRSA 4CGDA 1BISA 4BACA 2F4VK 4FK0A 2J4RA 3DLGA 4IEIA 4YOUA 4KI4A 1NMDA 3HP9A 1N6QA 3LDOA 5AQMA 1YVNA 3G6EN 4IBNA 1BI4B 2P9PA 3ZT3A 4DQRA 3D0PA 3SQ0A 3NF8A 3ULEA 4JK9A 3JSMA 4DQIA 3M6GA 3M8PA 3CIPA 2AP1A 2Y1IA 3QICA 4MDAA 3ZSOA 3QERA 2CB8A 2VGNA 1C6VA 1U47A 1VQ4N 2UUAK 4CJ4A 4DSIA 4FPAA 4BRPA 3OYCA 4NCAA 5J2QA 5JS1A 4GXBA 5AQJA 5AFUH 2IAJA 4DS4A 3HSTB 1VSFA 2H3GX 3MX5A 5AFUA 4DTXA 2O8EB 3UKRB 2HE7A 2WONA 4YDUC 3A0IX 3DRPA 4DV1K 4O8KA 4IJNA 3WXLA 3HPOA 4FZXC 1E4FT 1RT2A 4B3RK 1WOQA 1GLJO 1X9SA 4H5VA 4DTNA 3RRHA 3Q7CA 2CQUA 1VQ8N 4CJTA 5J2NA 4AHSA 3NCIA 1VQON 5GINA 1HPMA 2NLXA 2Y1JA 1EETA 4K42A 3LAMA 1SQKA 2Q36A 3C6UA 1JLFA 2ITGA 4JHDA 4H5RA 1KC7A 4ILGB 4B3SK 4BR4A 3CJAA 2V52B 4PKGA 3CCVN 3HXMA 3HRGA 4PL7A 5TKWA 3D2EB 4BWMA 3WXIA 1TKXA 3V1QA 3IDHA 2VG5A 4FM1A 3NDKA 1WSHA 4DV3K 1N33K 1IJJA 4DTUA 2P9LA 3K57A 1T7PA 4E19A 3IS9A 4FLWA 3F9KA 2OTJN 5KRSA 3V6DA 4LFBK 3C95A 1U2VB 3KKSA 3ZETA 4KO0A 3I0RA 2YKNA 4DU1A 1Z26A 4IXCA 3TAGA 3SQ2A 3KLIA 3HK2A 2OZMA
chains in the Genus database with same CATH topology
4EAHD 2QM1A 4J8FA 3EO3A 2YJFA 3OHRA 4OPAA 3F2KA 2EMTA 1NGGA 3UB5A 1HKGA 1OKJA 1NTIA 2P9KA 3DWLA 4ISEA 4XH1A 5KQ8A 4GNIA 4RWTA 1YJ9N 3BEXA 2FF6A 5GIOA 5AQLA 4GV3A 3UKUA 2X0SA 3W0LA 3AY9A 2ITMA 3VGMA 4FOEA 5IJMA 2V7YA 2YHXA 4BC3A 4GVEA 3WEEB 2HOEA 2A5XA 2ASOA 3CCJN 3MN9A 2ZPYA 1BDGA 2NRHA 3OBYA 3UKUB 2AA4A 4A2BA 4HWIA 5CR4A 3MN7A 4ZRKA 1W97L 1TUYA 1HB6A 4ZRIA 3QDKA 2P9NB 5BN9A 3T69A 1DIKA 2YHYA 1NWKA 1U6ZA 1E4GT 3SAHA 2A41A 5GIPA 4BRQA 3CCRN 3D2FA 1NBWA 3F9MA 3MN5A 4WFBL 4BG8A 2ASMA 4B1UB 3ID6A 3O9UA 3ZX3A 1Y64A 2D11A 3ZETB 3C6HA 3R1XA 3FZFA 3UE5A 2D0PA 1YJWN 1XC3A 3E9OA 1GLFO 4FWKA 2GELA 4MLEA 3U8XA 5JICA 4BRHA 1C0FA 2HBLA 3FR0A 2E2QA 4MO4A 5JLHA 5FPEA 1KD1O 1JCEA 3CJCA 1EQYA 2YI1A 3I56N 2Q0UA 1MK9B 2OANA 4K43A 5AQWA 4C23A 1BA0A 4GV6A 3DXKA 2KHOA 2E2OA 3H1VX 4MO5A 3T7ZA 1VQLN 5I9EB 3O8MA 4BREA 3H45C 2D10A 4FSVA 3M5RA 3VEVA 1Y19B 1SAZA 5BPLA 4WFNL 3G9WA 4GV9A 1ATSA 2Q97A 3F5TA 3AGRA 3SMSA 1BA1A 2FF3B 3AARA 3IFRA 4BQZA 3I55N 1HKBA 4NO7A 2OTLN 5EVZA 4ZRJA 3HZ6A 3I33A 4H0OA 4YOTA 5M1OA 2HSTA 1Q18A 4I6MB 5MLCQ 2DPNA 2WH5A 3P4IA 1YHQN 5JVLA 4CZFA 3LDLA 4BRGA 3KHYA 3HOTA 2IVOA 3SK3A 4BR7A 1KAXA 1W2BM 4FWQA 1VQ6N 5ELZA 4IWVA 4JHDB 4A61A 1JDEA 2RHKA 5M1QA 5AQZA 2A40A 1Q82O 2HBKA 3HSCA 2NRZA 3BINA 2D0OA 3LDNA 4JD2B 1HKCA 1SZ2A 1NGBA 3M1FA 4JK8A 1S3XA 3W3DA 5BR9A 1HX1A 3CCQN 3CD6N 2HBJA 2WFBA 4FOIA 1QVFM 1VQMN 3C65A 3QBWA 1V4SA 1YXQA 3VOVA 3SMPA 1JCFA 4QS9A 3U7DA 4OO1J 2NRXA 2Q2RA 1VQKN 4WF9L 1VBHA 2YX6A 3ENOA 5AQSA 2WBNA 5AQXA 4CZJA 3O08A 4YL8A 3CF5L 2E2PA 5AQGA 1QHAA 3VF2A 3NVKA 5AQYA 3CJ1A 3P39A 3QB0A 3SAFA 4IO9L 3VF6A 1K8KB 3N4QA 2YVCA 4BR9A 3D2FB 2FXUA 3CJ9A 3AU4A 3QFUA 1H1VA 1HJOA 2P9NA 2GX9A 2IIRA 3H46O 4BQLA 5M1NA 4DXAB 1X9JA 5H1SQ 5TKYA 3CMEN 1MK7B 4JKCA 4BGBA 3KK7A 3WEEA 4AF1A 4M7YA 3QFPA 2VYPA 4L3QA 5B8HA 4M63C 4BC2A 2NRTA 1Q7YO 4IOCL 3G4SN 5AQQA 2FSKA 3A5NC 1BWFO 2P9KB 3FLVA 1YUWA 3DAWA 3R3LA 4KBOA 3ULEB 1ZBSA 4H0TB 3SBGA 3GBTA 2JWKA 4XH5A 4P7IA 5DM7L 2CH5A 1XUPO 4A2AA 1VQ7N 3R6MA 1ISNA 2P9UA 2QWRA 1GLDG 3CQXA 2PFUA 1U2VA 1ACAA 2Q0RA 5GAEP 2HMPA 1NGCA 5KQDA 2ZGYA 3FLCO 4AM7A 4CZGA 1MWKA 3H1QA 3L0QA 4HDOA 4JKGA 2P9LB 5BRDA 4A62A 4C1NK 1NGAA 3KZBA 4CZKA 3J7ZO 2J0KA 2P9SB 1M1KO 2W40A 2W41A 2NRWA 1GC6A 1VBGA 3U9DA 3O80A 3R9PA 3KVGA 5BN8A 3MK6A 2QW9A 4YDUA 3N4PA 2KKZA 3MN6A 3VTHA 4Z94A 3CPWM 3MWTA 3CCEN 4KH6A 5C12A 2VGMA 1D4XA 3CHWA 3D2EA 3IKMA 5CE3A 3IUCA 1QZ6A 3E66A 3HBTA 4DQ8A 3SBTA 2J0JA 1NGFA 4WQ4C 3WXJA 3O9TA 5AQRA 3VGKA 1QVGM 3DLLL 3GG4A 2E2NA 4CZLA 5AR0A 4DCHA 5AZIA 4PHTX 1BO5O 1GLEG 3TSUA 3VEOA 2RQ1A 3RSEA 4CBWA 5F0XA 5EX5A 4B1WB 1KXPA 3WQUA 1QQMA 4OPHA 4GY2B 1NGJA 1VQ5N 3CPEA 3H3OB 4JKAA 4EHUA 4R79A 4CD1A 1V4TA 3ATVA 3EL2A 3GOIA 4DHYA 2HF3A 4JEPA 3U4LA 2E1YA 4WCEL 1C0GA 1S72N 1BUPA 5AQVA 5ADXH 1IG8A 1KBLA 3A8YA 5CHIA 3CCUN 3O1WA 3EN9A 4RTFD 3ENHA 2IVPA 1QZ5A 3ID8A 5EOYA 3LM9A 2QXLA 1NJIO 4A57A 2PAVA 1RFQA 2P9IB 3VPZA 1GGOA 1ATNA 3BF3A 3PIPL 4NLBA 5AQPA 2FDQA 4FWMA 4WQ5A 4EHTA 3CC4N 4IOAL 3OBWA 2CGKA 4YOVA 1LOTB 2I7PA 3UKRA 3WT0A 3AAQA 1YITN 1Z05A 2QWOA 3O5BA 1ILYA 2Q31A 2COPA 4B1ZA 4B9QA 3KWGA 3E9PA 3P31A 3A5OC 5LJVA 1VQNN 2F9WA 1JCGA 1HUXA 2UYTA 3L4QA 1ST7A 1MWMA 3TPQA 1H4RA 5AQFA 3CC7N 5EXWA 1EF1A 5AQUA 5LJWA 5C10A 3TTFA 2QWMA 4BC4A 4WQ4A 3EKSA 5M1PA 5AQNA 3ZX2A 3C7NA 4BRLA 4HTLA 1YI2N 4BR0A 4U67L 1T44A 4CZHA 3SLCA 1MIXA 4JKEA 3ZDTA 3RVCA 2NRRA 3BUZB 3E1YA 3VGLA 3VEXA 4BRNA 3VEYA 3QIJA 4U7BA 3SAGA 4JKHA 4KH4A 5HOOA 1NGDA 4JKBA 4PKHA 3J8AA 4WYBA 4G9ZA 3KWIA 4TKNA 3U8ZA 3LDPA 2A3ZA 3X23A 4BGAA 3IMXA 2BH1A 1DEJA 2P9PB 3G25A 4IOXA 2WUSA 4EFHA 3HOSA 3U9ZA 2ZWHA 4YOXA 3OW2M 4BRAA 3MX2A 5AQOA 1TYQA 5AZJA 5BRHA 5JVGL 3A5MC 3DJCA 1GG3A 3EZWA 1X3MA 1DGKN 4Y0WA 4BRIA 3ZEUA 3WA0A 2NZTA 4F7GA 4YOYA 4JKFA 3MCPA 4MDBA 1TUUA 1MIZB 3EE9A 2YJEA 4ILHA 2ZJRL 3LL3A 1BG3A 2HBMA 2V51B 2ZJPL 4BR2A 3VESA 4K25A 2WC9A 3CC2N 4FWLA 4MLHA 3VTIA 5AQIA 2R82A 4YORA 5DM6L 1NM1A 3Q7BA 1ESVA 2E8AA 4B1VA 2GTDA 2ABDA 3A5LC 2QA4N 4JAXA 4CJ7A 3NVMA 2E20A 2LBBA 2QWNA 5GAHP 3QMLA 4FWRA 3ENBA 3R8EA 3DXMA 5F1XA 3CCMN 2YCHA 5JVHL 1Q81O 5GAGP 5BPMA 2CGJA 1QQOA 1YJNN 2GWJA 2E1ZA 3EE8A 1QQNA 1NVLA 1KAZA 3NMUA 4A5BA 3M3ZA 4BRDA 4NB4A 5JMVA 4H5NA 4A59A 1VQPN 1K9MO 3MWPA 3FP5A 1NLVA 3CQYA 2GWKA 4BRMA 3G71N 1YF5L 2GEMA 1Z6RA 3L6QA 2F9TA 2P9IA 1SS6A 3D6RA 2FJ9A 3OA9A 2D1KA 1WUAA 3QBXA 2I1KA 3O9RA 4JKDA 1GLBG 3FZMA 2FSNA 3O6WA 3MMVA 3TSQA 2YHWA 5FPNA 4WFAL 3VEWA 5BREA 3AGKA 3BF1A 4H03B 3GE1A 5HL7L 4AM6A 2AEHA 4B1XB 4BY9C 1K73O 4IEEA 4FWOA 2FLOA 1DKGD 3VERA 4K41A 4JNEA 1MA9B 1G99A 3JXUA 2QEXN 3TU5A 5FPDA 3HTVA 4H0VB 4FWNA 4BRCA 5F2RA 3CCSN 3DXMB 3RSEB 4XEIA 2CGLA 4M7XA 5KPRA 2ZF5O 4BRKA 5AZIB 2NNWA 2HRJA 1T6CA 5EY4A 1O13A 2QWLA 3O1BA 4ISGA 3VEZA 4JN4A 5ADXA 1YIJN 3PLAA 1MDUB 3K9KA 2D2QA 1ATRA 4C1NI 5BRFA 4O5FA 5AQTA 4CD3A 2CH6A 2FSJA 3CETA 2AL6A 4EIAA 1P90A 5M1FA 4JK7A 2J4RA 4PKIA 2ZJQL 4IEIA 3C0BA 2RE2A 4YOUA 2DIKA 4B1YB 1SGHA 4FVUA 1R59O 3PVLA 1NMDA 4UY8O 3O4WA 3ZEUB 5BPNA 3LDOA 3S41A 3FZHA 5AQMA 3CCLN 5FPMA 4H0XB 1YVNA 2E88A 3IVFA 5AZJB 3G6EN 1TYQB 2P9UB 1LCUA 3ATUA 1KAYA 2IVNA 2P9PA 3TTDA 4BROA 4CBXA 1YAGA 4CZEA 3GDQA 5E84A 4H0YB 3P38A 1T3VA 3ULEA 4JK9A 3FGUA 2JWLA 3ZYYX 4BG9A 4CI6A 1JJ2M 1RDUA 3VMFB 3M6GA 4FL9A 3CIPA 4CZIA 3SJHA 4DKWA 2AP1A 2A6AA 3I8BA 2VCPA 3BP8A 3CI5A 3H6EA 3MDQA 4IDHA 3QICA 4MDAA 4FWPA 4QS7A 5C2FA 1BOTO 2CB8A 1NGEA 1P8ZA 2VGNA 1HBKA 3C7NB 1VQ4N 4BC5A 4FO0A 3AU5A 3WXMB 3CJBA 1VAZA 5JLFA 4FPAA 4BRPA 2ZGZA 1E5WA 4GXBA 5AQJA 5AFUH 2EMSA 4BRFA 3WUHA 2Q1NA 3PZDA 2H3GX 3GL1A 1K8KA 3EKUA 3MX5A 5AFUA 5C15A 2J0MA 2HE7A 3AAPA 3UKRB 1ZXOA 4YDUC 3A0IX 4IJNA 4H0PA 4FPBA 1NGHA 4NLCA 4O8KA 3WXLA 1GC7A 4IZ9A 1E4FT 1S22A 3B8AX 1HB8A 1BU6O 2HF4A 3TSPA 4A5AA 2BTFA 1WOQA 1GLJO 1GLCG 4H5VA 4ISFA 5AQKA 1EO1A 3E9LA 4BVPA 3WXKA 1VQ8N 3Q7CA 2CQUA 1RDWX 3D7EO 5E26A 1ZC6A 3EPYA 2V7ZA 5LY3A 5M1KA 5GADP 1VQON 5GINA 1M90O 4LC9B 1HPMA 2NLXA 2F7TA 4O8UA 4PL8A 4JD2A 1Q86O 4BR5A 1CZAN 2QWPA 1DT9A 4K42A 1XQSC 4F9OA 4CYEA 3O9QA 3JS6A 1SQKA 2Q36A 4ILJA 3HM8A 4JHDA 4H5RA 4EKUA 2I7NA 1NI2A 1KC7A 4ILGB 3VETA 2QWQA 5C2DA 2A42A 3FE1A 3C6AA 4I6MA 4BR4A 4IJAA 5AQHA 3CJAA 3CMAN 2KLAA 3LDQA 2NRVA 3VENA 3TTCA 2PBDA 2V52B 4E1JA 4PKGA 5KPZA 3HI0A 1N8RO 3FZKA 3CJ7A 4IO8A 3CCVN 3HRGA 3LM2A 1J19A 5TKWA 4PL7A 2VWBA 3D2EB 3H3NO 3VF4A 4BVOA 3WXIA 3PIOL 4WQ5C 5C0YA 3IDHA 3FFKB 2QI2A 1T6DA 2ASPA 3MCAB 3WQTA 4DB3A 3L4IA 3DXKB 1NGIA 3FZLA 4KH5A 1OVYA 2P9SA 4H5TA 1KQSM 4CZMA 3O9SA 1GLAG 4QS8A 1IJJA 1J6ZA 1K8AO 1VQ9N 4JKGB 2P9LA 4RCHA 4H5WA 4YOWA 2OTJN 1KC8O 3K9JA 3ZX0A 1HLUA 1RGIA 5KPTA 1X3NA 4FWSA 4IFEA 1U2VB 4XH4A 4CBUA 4HDQA 2GUPA 4NY0A 2BUPA 2QTDA 3ZETA 3CXCM 3CERA 1GLLO 2I1JA 2EWSA 4IXCA 2D4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKB A;  4JKG A;  4JKA A;  4JKH A;  4JKD A;  3E9P A;  3E9O A;  4ILJ A;  4JK9 A;  4JKG B;  3SBG A;  4ILG B;  3E66 A;  3ENB A;  3SBT A;  4JK7 A;  4JKF A;  4JK8 A;  3E9L A;  4JKE A;  4ILH A;  4JKC A; 
#chains in the Genus database with same CATH topology
 1HNV A;  2QM1 A;  3UB5 A;  2EMT A;  1LWC A;  1VSK A;  4ISE A;  3OJU A;  4FJK A;  4GV3 A;  4AHR A;  4LF5 K;  3W0L A;  4I2Q A;  1CLQ A;  2A5X A;  3CCJ N;  2NRH A;  1BDG A;  2XRI A;  4A2B A;  4YOW A;  2P9N B;  1VRT A;  3SAH A;  2FBV A;  2Q3S A;  4X65 K;  4B1U B;  1I3A A;  2OPS A;  3ZCM A;  4KHP K;  2D11 A;  3THW B;  3ZET B;  4CES A;  4B8A B;  1RT3 A;  3FZF A;  4DV2 K;  4FWK A;  1C0F A;  1N5Y A;  5DK5 A;  4BE2 A;  4MO4 A;  5FPE A;  1KD1 O;  4BDZ A;  5AQW A;  1RDC A;  4JV5 K;  4C23 A;  1NJW A;  1LV5 A;  1Y97 A;  5D3G A;  4DSK A;  3VEV A;  1O1W A;  1Y19 B;  3AVJ A;  5FLX O;  4WFN L;  3LZI A;  4GV9 A;  1WLJ A;  2Q97 A;  3K58 A;  4BQZ A;  1IKX A;  2OTL N;  3OYJ A;  3VA0 A;  3P4I A;  2WH5 A;  5JVL A;  3KHY A;  1VQ6 N;  1RTJ A;  4JHD B;  1RT5 A;  1Q82 O;  2YV0 X;  3BIN A;  2D0O A;  3LDN A;  3M1F A;  1SZ2 A;  1NGB A;  4O5B A;  3LPU A;  4H8K A;  5BR9 A;  1LAW A;  4GKJ K;  4GMJ B;  2HBJ A;  5CYM A;  2WFB A;  1BQM A;  4FOI A;  1WAJ A;  3C65 A;  1V4S A;  3AVG A;  4QS9 A;  1JLB A;  2YX6 A;  3ENO A;  4X66 K;  4QOZ B;  1QHA A;  3NVK A;  4B9U A;  5AQY A;  3CJ1 A;  4IO9 L;  2F8T A;  4FJJ A;  2O8E A;  2IC3 A;  1WSF A;  4BR9 A;  3IRX A;  2F8S A;  4M41 A;  4AIL C;  2RKI A;  1LAV A;  4CEZ A;  4DWI A;  1BGX T;  4FJ8 A;  2KW4 A;  2KQ2 A;  3EEQ A;  4YY3 K;  4B9L A;  4BGB A;  4E1M A;  4KRE A;  4AF1 A;  3WEE A;  4M7Y A;  1T8E A;  4CCH A;  5B8H A;  3PO5 A;  4M63 C;  3VQ4 A;  3F73 A;  5CZ2 A;  4LF4 K;  2FSK A;  2P9K B;  3FLV A;  1YUW A;  3R3L A;  1RBU A;  4DFK A;  3ULE B;  4DQS A;  3SBG A;  3B6P A;  3LPT A;  1E3M A;  1GOA A;  3K5M A;  3K5N A;  1TVR A;  2QWR A;  1GLD G;  3TAR A;  4KTW A;  5KQD A;  1IKW A;  4CZG A;  3H1Q A;  5BRD A;  3QNO A;  4CZK A;  4KB1 A;  3OYN A;  1J5O A;  2WOM A;  5BN8 A;  3LP0 A;  3DM2 A;  3O80 A;  3R9P A;  3VQA A;  3OYF A;  4Z94 A;  1S9E A;  4M3U A;  5C12 A;  4DSE A;  3TAB A;  1D4X A;  3ALY A;  4J2E A;  3MED A;  4DQ8 A;  4WQ4 C;  4NCG A;  3VGK A;  4DSJ A;  1QVG M;  4OLB A;  4Z4H A;  4CZL A;  4LY7 A;  3MXJ A;  1GLE G;  3VEO A;  4ELT A;  2G8H A;  3WQU A;  4OPH A;  1NGJ A;  1VQ5 N;  1JL2 A;  1BIU A;  3CPE A;  4JKA A;  4F4K A;  4JS5 A;  4J2D A;  4CD1 A;  3OYA A;  2P5G A;  2QK9 A;  3P1G A;  1S72 N;  2DFH A;  1ASW A;  3HYF A;  3A8Y A;  2HHH K;  3H08 A;  3ID8 A;  3LM9 A;  4NYN A;  4IKF A;  3U3G A;  4A57 A;  5IWA K;  2PAV A;  1GGO A;  1ATN A;  4FWM A;  4WQ5 A;  4FJL A;  2HHU A;  2P51 A;  2I7P A;  4FLV A;  1YIT N;  2E6M A;  2QWO A;  1ILY A;  4FW2 A;  2Q31 A;  3SUO A;  5E41 A;  4B1Z A;  4ID5 A;  3T19 A;  3KWG A;  3E9P A;  1ZBF A;  2XY8 A;  1HUX A;  1HMV A;  1MWM A;  1VSD A;  3TPQ A;  1F21 A;  2W6K A;  5AQF A;  5EXW A;  5HBM A;  5C10 A;  2QWM A;  4BC4 A;  3EKS A;  1FXX A;  1HNX K;  4BRL A;  3L2U A;  1R0A A;  1YI2 N;  3V9W A;  3PX4 A;  1RT6 A;  4CZH A;  4X62 K;  3ZDT A;  1U48 A;  1ZBU A;  2NRR A;  3BUZ B;  4W5R A;  4U7B A;  4LF7 K;  3VEY A;  4PUO A;  3TAF A;  3SAG A;  4JKH A;  4JRQ A;  1NGD A;  4PY5 A;  4G9Z A;  4TKN A;  1TL3 A;  3X23 A;  2BH1 A;  1DEJ A;  4BDP A;  1JL1 A;  4IOX A;  4CVN E;  1IKV A;  3MXI A;  5AQO A;  1TYQ A;  1UWB A;  5BRH A;  3HPG A;  1X3M A;  4Y0W A;  4BRI A;  5BR8 K;  2NZT A;  3I8D A;  4LH4 A;  1QSY A;  1TUU A;  4CER A;  1XNR K;  4CK1 A;  1RTD A;  1BG3 A;  2HBM A;  2V51 B;  4Q0B A;  3CC2 N;  3AVK A;  4MLH A;  3VTI A;  3SUN A;  5AQI A;  2E8A A;  4JI1 K;  3A5L C;  2QA4 N;  3K59 A;  3NVM A;  2QWN A;  4CJK A;  3QIP A;  4HUE A;  1Q81 O;  3HO1 A;  4BRD A;  3SI6 A;  3LP3 A;  4NB4 A;  2D0A A;  4PWD A;  2DFF A;  4YNQ A;  2YNH A;  3MWP A;  1SL1 A;  3FP5 A;  1NLV A;  3G71 N;  2PYJ A;  4FLX A;  1SS6 A;  3ZT0 A;  4E0D A;  3D6R A;  4B9N A;  3FZM A;  3O6W A;  3MMV A;  4WFA L;  3CFR A;  3AGK A;  2UXB K;  4B1X B;  1XMO K;  3VER A;  1DKG D;  2Z1J A;  2HHV A;  1MA9 B;  4I9Q A;  1VSI A;  3JXU A;  1K6Y A;  3HTV A;  4FWN A;  4BRC A;  3CCS N;  2P1J A;  4XEI A;  4BRK A;  5EY4 A;  4YHH K;  5ADX A;  2QWL A;  1U04 A;  2HHX A;  3K5L A;  4FJX A;  1TK0 A;  3PLA A;  3KKR A;  3K9K A;  5J2M A;  2A1R A;  5BRF A;  2AL6 A;  1YTU A;  4XIU A;  4RW4 A;  1P90 A;  4FJN A;  1J53 A;  3AO2 A;  2XHB A;  4CGH A;  5M1F A;  4JK7 A;  4KHU A;  4PKI A;  2ZJQ L;  3HPH A;  1C0M A;  4B1Y B;  1R59 O;  4KHQ A;  3AVM A;  5EU7 A;  3CCL N;  2E88 A;  3IVF A;  1TYQ B;  1NKE A;  1KAY A;  4BRO A;  4CZE A;  3GDQ A;  5E84 A;  3NF9 A;  4J2B A;  5KTQ A;  3FGU A;  4CI6 A;  1RDU A;  1A5V A;  3SJH A;  4DKW A;  1TKT A;  1S1W A;  4FWP A;  1LWF A;  1WSG A;  1BOT O;  4BC5 A;  3AU5 A;  1VAZ A;  2ZGZ A;  3VN5 A;  1E5W A;  3AVI A;  4BRF A;  1S6Q A;  3EKU A;  4CED A;  2J0M A;  4FPB A;  1GC7 A;  4IZ9 A;  3NBP A;  4FK4 A;  3B8A X;  4FJG A;  4FJ5 A;  3TSP A;  1FK9 A;  2BTF A;  4DLE A;  2HHW A;  5AQK A;  3HVT A;  1IO2 A;  3D7E O;  5SWM A;  4B3M K;  3EPY A;  4E3S A;  1Z25 A;  4DV0 K;  1M90 O;  4LC9 B;  3MEG A;  1VK0 A;  4JYA K;  4O8U A;  1Q86 O;  4BR5 A;  2QWP A;  1FW6 A;  4CYE A;  3JS6 A;  4OGE A;  1S5J A;  3OJS A;  1TV6 A;  4B9V A;  4DR7 K;  2I7N A;  4LFA K;  2QWQ A;  1WAF A;  2A42 A;  3AVB A;  4O0I A;  4I6M A;  3CMA N;  2X74 A;  3IAY A;  3QLH A;  3O3F A;  3NHG A;  3VEN A;  2KLA A;  4E1J A;  2OPP A;  3TTC A;  1NJX A;  2UUB K;  3PX6 A;  1IV0 A;  4CJP A;  3FZK A;  4IO8 A;  3LM2 A;  3T1H K;  4MFB A;  1KLM A;  4JI7 K;  2ASP A;  3VQ9 A;  3FZL A;  1D9D A;  4H5T A;  4I9L A;  1GLA G;  1J6Z A;  2HNY A;  1VQ9 N;  2ETJ A;  1VSE A;  4HCB A;  3K9J A;  4Q5V A;  1X3N A;  4FJH A;  3AO5 A;  2KZZ A;  1IBM K;  4CGI A;  2OZS A;  4FJ7 A;  3OS1 A;  1L5U A;  3L2W A;  4BE1 A;  4ELU A;  1XHZ A;  3DLE A;  2D4W A;  1KVA A;  2VWK A;  2BGG A;  2P9K A;  4XH1 A;  1NTI A;  3DWL A;  3TAQ A;  4RWT A;  4GNI A;  3QEP A;  5AQL A;  4JI6 K;  3DOL A;  2ITM A;  4FOE A;  5IJM A;  1WSI A;  4BC3 A;  5I42 A;  2PZS A;  4GVE A;  3WEE B;  3D45 A;  1EX4 A;  2ZPY A;  3OBY A;  1D8Y A;  1TAU A;  4HWI A;  1RDD A;  5CR4 A;  3MN7 A;  1TUY A;  5BN9 A;  4JRP A;  1N34 K;  3DLB A;  2YHY A;  4AHV A;  4DUZ K;  3CCR N;  4BRQ A;  4WFB L;  1FKP A;  2HND A;  2YNG A;  4KV8 A;  3ID6 A;  3DLR A;  3O9U A;  1Y64 A;  3RTV A;  3R1X A;  3UE5 A;  2D0P A;  3U8X A;  4JS4 A;  4NXM K;  3RR8 A;  2D0B A;  1S1T A;  1JLE A;  4KRF A;  1EQY A;  1MK9 B;  4CJQ A;  2OAN A;  4GVM A;  4K43 A;  3SV3 A;  4LF9 K;  4HUG A;  5HP1 A;  2E2O A;  3T7Z A;  1VQL N;  5I9E B;  1N36 K;  4KHN A;  2D10 A;  4OX9 K;  3VQ6 A;  5BPL A;  1ATS A;  1J54 A;  4M3R A;  3AGR A;  3V4I A;  1BA1 A;  2FF3 B;  2OPR A;  3I55 N;  1HKB A;  4YOT A;  3I33 A;  4H0O A;  2G8K A;  1Q18 A;  3NH2 A;  1ASV A;  1N32 K;  3LDL A;  3HOT A;  2IVO A;  4BR7 A;  1W2B M;  4FWQ A;  4IWV A;  1NG9 A;  1KCF A;  5AQZ A;  2A40 A;  2NRZ A;  3KLH A;  3C6T A;  1HKC A;  2RPI A;  4JK8 A;  4DV5 K;  1ITG A;  3QEW A;  2FBY A;  1EWQ A;  4O0J A;  3ZSX A;  3VOV A;  3SMP A;  2P5O A;  4DFP A;  2NRX A;  2Q2R A;  4WF9 L;  5KRT A;  2WBN A;  5AQX A;  4CIG A;  4CZJ A;  3O08 A;  5AQG A;  2G8F A;  3THW A;  2DFE A;  3L3U A;  3SUP A;  2FXU A;  2VG7 A;  3CJ9 A;  3DRR A;  4FW1 A;  4B9M A;  1QS4 A;  2P9N A;  3TR8 A;  2IIR A;  5JS2 A;  2RN2 A;  4CF0 A;  5M1N A;  1SUQ A;  3HM9 A;  2XY6 A;  3CME N;  1MK7 B;  4JKC A;  3KTQ A;  2VYP A;  2G8U A;  2YKM A;  2DY4 A;  4CJ3 A;  1Q7Y O;  4IOC L;  3EY1 A;  3G4S N;  4J2A A;  1RDA A;  5A2Q O;  3ITH A;  2O8B A;  4KBO A;  1DTT A;  1ZBS A;  4H0T B;  1XMQ K;  2JWK A;  2CH5 A;  1DLO A;  2UXD K;  1ISN A;  1OH8 A;  4M3Z A;  2P9U A;  3HP6 A;  5T7B A;  2ZD1 A;  1U2V A;  1ACA A;  2Q0R A;  2HB5 A;  4NXN K;  3ASM A;  4HDO A;  2P9L B;  1M1K O;  3J7Z O;  2J0K A;  2YHB A;  1GC6 A;  2NRW A;  5JIC A;  2IDO A;  3N4P A;  1QE1 A;  3CPW M;  3VQP A;  3BGR A;  1SL2 A;  4BDY A;  3D2E A;  1IH7 A;  3IKM A;  3RMD A;  3IUC A;  1QZ6 A;  3KLE A;  2G8W A;  1S1U A;  1B9F A;  3WXJ A;  3O9T A;  3AA5 X;  5HRN A;  4FM0 A;  3OVN A;  1JXE A;  3GG4 A;  2E2N A;  4FYD A;  4DCH A;  5AR0 A;  5AZI A;  1BO5 O;  4CBW A;  5F0X A;  4FZY A;  1QQM A;  4E7H A;  4EHU A;  4TSX A;  3KLG A;  1V4T A;  3GOI A;  3NAE A;  4NCB A;  4YFU A;  4B9T A;  1NK9 A;  1OVQ A;  1HNZ K;  3VQD A;  1BUP A;  4H4M A;  5CHI A;  1NJZ A;  3SQ1 A;  3O1W A;  4EP5 A;  1S6P A;  3ENH A;  1QZ5 A;  1BQN A;  1C0U A;  3B6O A;  1RFQ A;  1UOC A;  2P9I B;  3PIP L;  5AQP A;  2D5R A;  2FDQ A;  4IOA L;  3CC4 N;  3OBW A;  4W5Q A;  4QAG A;  4YOV A;  1LOT B;  3UKR A;  1BL3 A;  4IG0 A;  4E89 A;  3A5O C;  1KLN A;  1JCG A;  3K0S A;  1GOB A;  5LJW A;  1ZYQ A;  4F8R A;  1W9H A;  4CJF A;  4O55 A;  3ZX2 A;  5LMU K;  4DV4 K;  4CF8 A;  1T44 A;  4B3O A;  4BRN A;  1T03 A;  4E7I A;  4N56 A;  3U8Z A;  2AJQ A;  2A3Z A;  3BDP A;  2XY5 A;  2P9P B;  2WUS A;  3HOS A;  3OW2 M;  1BI4 A;  5KI6 A;  5JVG L;  3DJC A;  1GG3 A;  3EZW A;  5CYQ A;  3NGI A;  1DGK N;  4DF4 A;  2QKB A;  3MXM A;  5HRR A;  3MCP A;  5FRN A;  1BCO A;  1RT4 A;  4DR4 K;  3ISN C;  4ILH A;  2ZJR L;  1I94 K;  1RT1 A;  3VES A;  1BCM A;  1S1X A;  4LF8 K;  2R82 A;  3Q7B A;  4HUF A;  4DR3 K;  2O8F B;  2GTD A;  2ABD A;  4DU4 A;  5SZT A;  4CJ7 A;  5GAH P;  4CJR A;  3QML A;  4FWR A;  3ENB A;  2OYQ A;  3CCM N;  5GAG P;  3EE8 A;  3U6F A;  1QQN A;  1NVL A;  2E6L A;  3NMU A;  4A5B A;  3M3Z A;  1KVC A;  3ZSW A;  3O3G A;  1HJR A;  2Z1G A;  1Z6R A;  2F9T A;  1HR0 K;  3OA9 A;  2FJ9 A;  4B08 A;  1WUA A;  2O8C A;  3O9R A;  4JKD A;  1RTH A;  4FJ9 A;  3NGY A;  4E1N A;  2YHW A;  5FPN A;  5BRE A;  2IGI A;  3BF1 A;  4FLZ A;  3V9Z A;  4DSF A;  3S3M A;  2AEH A;  2W6L A;  1TK8 A;  3I0S A;  1Q9X A;  4JI4 K;  3KIO A;  3TU5 A;  5FPD A;  3RSE B;  5C24 A;  4RW7 A;  2HRJ A;  1T6C A;  5FDL A;  3VEZ A;  1EP4 A;  1ATR A;  5AQT A;  2JGU A;  2CH6 A;  2FSJ A;  3ULD A;  3AA2 A;  4CHY A;  1UAX A;  2F96 A;  3OYK A;  3PO4 A;  2RE2 A;  2DIK A;  1SGH A;  4FVU A;  3PVL A;  4OPK A;  5BPN A;  3FZH A;  4H4O A;  3PY8 A;  4CIE A;  5AZJ B;  4JI5 K;  2PY5 A;  1LCU A;  3ATU A;  4AHT A;  4KPY A;  1YAG A;  4H0Y B;  1T3V A;  4F3O A;  1KRP A;  1RBT A;  3ZYY X;  4LSN A;  4BG9 A;  1JJ2 M;  1VHX A;  4FL9 A;  4CZI A;  4IG3 A;  1B92 A;  1BIZ A;  3I8B A;  2VCP A;  3CI5 A;  2GBZ A;  4IDH A;  4DR2 K;  4QS7 A;  5C2F A;  2ATQ A;  1NGE A;  2O8D A;  1P8Z A;  1KFS A;  3TI0 A;  3THY B;  4FO0 A;  3AO4 A;  3WXM B;  4FLY A;  3CJB A;  2HMI A;  5JLF A;  3AVA A;  4CEE A;  4F3T A;  3QIN A;  4C8L A;  3ZT4 A;  4DSL A;  3PZD A;  1K8K A;  5C15 A;  4RW8 A;  1Q8I A;  3AAP A;  3JAM O;  4OPJ A;  4NLC A;  5FRO A;  4H0P A;  1NGH A;  1W0H A;  1IBK K;  1NOZ A;  1LW0 A;  1HB8 A;  1BU6 O;  1HPZ A;  3E9L A;  4BVP A;  5E26 A;  4BWJ A;  1ZC6 A;  3ZSQ A;  5GAD P;  4DTR A;  4V19 S;  1C1B A;  2GV9 A;  3V9S A;  4JD2 A;  3ZSV A;  1DT9 A;  4F9O A;  1L3U A;  2PYL A;  3O9Q A;  4DQQ A;  4Z0U A;  4CIF A;  4ILJ A;  4KAZ A;  4EKU A;  1NI2 A;  3VET A;  5C2D A;  3TAE A;  4IJA A;  3LDQ A;  3DI6 A;  3HI0 A;  1N8R O;  1J19 A;  2X6N A;  1JLG A;  3H3N O;  3VF4 A;  4BVO A;  1ASU A;  1L3V A;  5C0Y A;  3C94 A;  4KHW A;  3OTO K;  3DXK B;  3NGZ A;  4OGC A;  4KH5 A;  2IOC A;  4E7L A;  4CZM A;  4QS8 A;  1GOC A;  4RCH A;  1NK7 A;  4FLT A;  1YT3 A;  4FWS A;  2GUP A;  4NY0 A;  2QTD A;  3CER A;  5DMR A;  4EP4 A;  4O44 A;  2EWS A;  2NUB A;  4EAH D;  2YJF A;  4OPA A;  2ZQB A;  1NGG A;  2FC0 A;  4OKJ A;  3PSF A;  3ZSZ A;  5KQ8 A;  2FF6 A;  5GIO A;  3UKU A;  2X0S A;  2D0C A;  3AY9 A;  3AVF A;  3VQC A;  3TAM A;  3MN9 A;  3UKU B;  4DTM A;  1ZBH A;  1JXB A;  3DLH A;  3AA4 A;  3T69 A;  4ZRK A;  1W97 L;  3QDK A;  1HB6 A;  1DIK A;  3OYL A;  4R5P A;  1NWK A;  1U6Z A;  4BE0 A;  3V81 A;  5GIP A;  5CZ1 A;  1NBW A;  3MN5 A;  3J7A P;  4HTU A;  4BG8 A;  2ASM A;  3VA3 A;  3AO3 A;  4CGJ A;  1RBR A;  1XHX A;  3M8Q A;  1GLF O;  3KLF A;  2GEL A;  4MLE A;  4Z4I A;  4M3X A;  4BRH A;  2HBL A;  3SQ4 A;  1TKZ A;  3O4Q A;  5JLH A;  3QEV A;  1JCE A;  4N47 A;  2Q0U A;  1BA0 A;  3DXK A;  2KHO A;  3H1V X;  4MO5 A;  5K14 A;  3O8M A;  3H45 C;  4FSV A;  5CY4 A;  3M5R A;  1NKC A;  2ZE2 A;  3G9W A;  3F5T A;  3SMS A;  1KFD A;  3AAR A;  4NO7 A;  3THV A;  4ZRJ A;  5M1O A;  5MLC Q;  3J81 O;  2DPN A;  1VSM A;  2HW3 A;  4BRG A;  1X9W A;  3CYM A;  3SK3 A;  3AO1 A;  3DMJ A;  1JDE A;  4DU3 A;  3HSC A;  1VSJ A;  4JD2 B;  4DLG A;  4KI6 A;  1HX1 A;  3WNH A;  1U49 A;  3IG1 A;  3ZT1 A;  4AH9 A;  1VQM N;  3QBW A;  1YXQ A;  2UUC K;  1JCF A;  1SV5 A;  3U7D A;  1YTA A;  4AHU A;  4OO1 J;  1VQK N;  3LAK A;  3OYD A;  1VBH A;  5AQS A;  4YL8 A;  3CF5 L;  2E2P A;  3VQ7 A;  3DOK A;  1QSS A;  4DQP A;  3QB0 A;  4CJS A;  3VF6 A;  1K8K B;  2YVC A;  3D2F B;  3SPY A;  3OY9 A;  3QFU A;  1H1V A;  1HJO A;  4K8X A;  3T1Y K;  3KK2 A;  4BQL A;  4DXA B;  1X9J A;  3MEC A;  5H1S Q;  4DTP A;  2XY7 A;  5TKY A;  3THY A;  3KK7 A;  1YVU A;  1XWL A;  3QFP A;  4L3Q A;  2O8D B;  4BC2 A;  3L2V A;  1SL0 A;  3LWM A;  5AQQ A;  3A5N C;  4FCY A;  3EZ5 A;  4JLH A;  3RWU A;  3GBT A;  3HL8 A;  4P7I A;  5DM7 L;  4OLA A;  2YHA A;  4A2A A;  3OYI A;  1VQ7 N;  1QSL A;  3KK1 A;  3CQX A;  5GAE P;  1NGC A;  1UA0 A;  1MWK A;  3L0Q A;  4DTJ A;  4JKG A;  1QHT A;  4C1N K;  1OH6 A;  3KZB A;  2P9S B;  2W42 A;  2W40 A;  1RT7 A;  2W41 A;  3U9D A;  1VBG A;  1NOY A;  2KFN A;  3MN6 A;  3CCE N;  3MWT A;  2VQE K;  4CK2 A;  4IFV A;  3T1A A;  2ZM6 K;  5CE3 A;  1WSE A;  3E66 A;  3SBT A;  3KD5 E;  2J0J A;  1NGF A;  2BDP A;  1RBV A;  4M45 A;  3AVN A;  4L8R B;  3DLL L;  1X1P A;  4PHT X;  3TSU A;  2RQ1 A;  3RSE A;  4B1W B;  4C8O A;  4GY2 B;  2X6S A;  3S9H A;  3NH0 A;  3H3O B;  3VQQ A;  3QET A;  4DHY A;  4JEP A;  2E1Y A;  4WCE L;  4Z4C A;  5AQV A;  1IG8 A;  3QO9 A;  3CCU N;  4RW6 A;  4CHQ A;  2IVP A;  3QNN A;  2EHG A;  2QXL A;  4LFC K;  4GKK K;  3L8B A;  3BF3 A;  4DS5 A;  3OS2 A;  5LMN K;  4EHT A;  4FXD A;  3WT0 A;  4DR1 K;  1Z05 A;  3O5B A;  4I2P A;  2Z1H A;  3P31 A;  1DTQ A;  2F9W A;  3L4Q A;  1ST7 A;  3PX0 A;  1SKW A;  3CC7 N;  4M42 A;  3OS0 A;  1KVB A;  2O8F A;  5M1P A;  5AQN A;  3C7N A;  2YNI A;  4HTL A;  1W7A A;  4BR0 A;  4U67 L;  3SLC A;  1MIX A;  3JYT A;  4JKE A;  3RVC A;  3E1Y A;  3VGL A;  3VEX A;  3CM5 A;  4CW7 B;  4PKH A;  4JKB A;  1REV A;  4WYB A;  4CFA A;  3IMX A;  3RR7 A;  4EFH A;  1RCH A;  3U9Z A;  4YOX A;  3MX2 A;  4CFB A;  3SV4 A;  2E5L K;  3ZEU A;  4N41 A;  4F7G A;  1XNQ K;  4RG8 A;  3SYZ A;  1MIZ B;  3BY5 A;  2O4I A;  3LL3 A;  1WBD A;  1C1C A;  3HVR A;  4K25 A;  3VQB A;  2WC9 A;  4ID1 A;  3CM6 A;  2HVH A;  1ESV A;  4JAX A;  1ZBL A;  4DV6 K;  2E20 A;  2QKK A;  4CJW A;  2G8I A;  4W5N A;  3DXM A;  5F1X A;  5BPM A;  2CGJ A;  3TAP A;  1YJN N;  1C0T A;  1KAZ A;  4DUY K;  5JMV A;  1K9M O;  1IBL K;  4EZ9 A;  3THX B;  1FKO A;  4BRM A;  1YF5 L;  2P9I A;  4RW9 A;  4LSL A;  5IT9 O;  2I1K A;  3SZ2 A;  4H03 B;  5HL7 L;  3GE1 A;  3THX A;  4AM6 A;  2X78 A;  4O4G A;  3KK3 A;  1K73 O;  1L3S A;  4FWO A;  2I5J A;  4IDK A;  1WN7 A;  5F2R A;  3DXM B;  1G15 A;  1NK4 A;  2CGL A;  4M7X A;  5KPR A;  2ZF5 O;  5AZI B;  2VQF K;  5HLF A;  4ISG A;  1KSP A;  1YIJ N;  1VRU A;  4KTZ A;  4Y1C A;  4C1N I;  2D2Q A;  4O5F A;  1BHL A;  3NF6 A;  4CD3 A;  3P5J A;  3LP1 A;  4OVL A;  2B6A A;  3C0B A;  3G10 A;  4UY8 O;  2FBX A;  3O4W A;  3ZEU B;  5C25 A;  3S41 A;  3K5O A;  4CHZ A;  3T3F A;  2QXF A;  5FPM A;  4H0X B;  3VQE A;  4DF8 A;  1L3T A;  2P9U B;  4CBX A;  2IVN A;  3TTD A;  1ZBI A;  3P38 A;  3SCX A;  4FJM A;  3AVH A;  2LSN A;  2JWL A;  1RTI A;  5C42 A;  2O8B B;  2BE2 A;  3VMF B;  1B9D A;  2A6A A;  4LF6 K;  3BP8 A;  3H6E A;  3MDQ A;  4B8C A;  4CJE A;  3QEI A;  3S3O A;  4K0K K;  1UA1 A;  1HBK A;  3C7N B;  1HRH A;  4CFC A;  3RRG A;  3PSI A;  3A2F A;  2EMS A;  3OYM A;  3WUH A;  2Q1N A;  3GL1 A;  3S3N A;  1ZXO A;  4CHO A;  4CEF A;  4MQ3 A;  1A5W A;  2JLE A;  2OA8 A;  4A5A A;  1S22 A;  3SUQ A;  2HF4 A;  4KHS A;  4C8M A;  2XO7 A;  3V9U A;  1GLC G;  4ISF A;  1EO1 A;  4KTQ A;  3KJV A;  4HVJ A;  3WXK A;  3CG7 A;  5LL6 Z;  4K8Z A;  2HHT A;  1RDW X;  3RMC A;  2V7Z A;  3LP2 A;  2WTU A;  5LY3 A;  5M1K A;  1U4B A;  4DR6 K;  4B3T K;  4JI3 K;  2F7T A;  3K2P A;  4PL8 A;  1CZA N;  1XQS C;  3NE6 A;  4DMN A;  4JI2 K;  3HM8 A;  4CGG A;  4Z4F A;  4C8N A;  3LZJ A;  3QEX A;  4HHT A;  3FE1 A;  4N5S A;  3C6A A;  5AQH A;  2KFZ A;  3LAN A;  3QES A;  4FK2 A;  2NRV A;  4ZTJ A;  4KB0 A;  2PBD A;  5KPZ A;  1SKS A;  3CFO A;  4CE9 A;  2G8V A;  3CJ7 A;  2Z1I A;  3L2R A;  3MAQ A;  2VWB A;  1A5X A;  3PIO L;  4WQ5 C;  1U45 A;  3FFK B;  2QI2 A;  1T6D A;  3WQT A;  3MCA B;  4DB3 A;  3L4I A;  1NGI A;  1OH5 A;  1OVY A;  2P9S A;  1KQS M;  3O9S A;  4X64 K;  4M3Y A;  1K8A O;  4JKG B;  3V9X A;  4H5W A;  4CF9 A;  1KC8 O;  3ZX0 A;  1HLU A;  1RGI A;  5KPT A;  4CJL A;  4IFE A;  4XH4 A;  4CBU A;  4HDQ A;  3AV9 A;  2BUP A;  4C8K A;  3CXC M;  1GLL O;  2I1J A;  2HHS A;  3RMB A;  3M8R A;  3WNF A;  4DFM A;  2UXC K;  4J8F A;  3EO3 A;  3OHR A;  4CF1 A;  4Y1D A;  3F2K A;  1HKG A;  1OKJ A;  1HYV A;  1YJ9 N;  1NU0 A;  3BEX A;  1WB9 A;  3VGM A;  2V7Y A;  2YHX A;  2HOE A;  2ASO A;  3G0Z A;  4F2S A;  4FM2 A;  2AA4 A;  4ZRI A;  3NF7 A;  4B9S A;  1E4G T;  2A41 A;  3D2F A;  3F9M A;  3ZX3 A;  3V1R A;  3C6H A;  1T05 A;  5HRP A;  3OYE A;  1YJW N;  1XC3 A;  3E9O A;  3EYZ A;  1VSH A;  3FR0 A;  2E2Q A;  3ZSY A;  1MU2 A;  3CJC A;  2YI1 A;  3I56 N;  1IG9 A;  4GV6 A;  4CEA A;  4BRE A;  1TGO A;  1SAZ A;  4DR5 K;  2R7Y A;  4OKE A;  3LWL A;  3IFR A;  3ZT2 A;  1LWE A;  5EVZ A;  3HZ6 A;  3U3Y A;  2A1S A;  2HST A;  4I6M B;  1NKB A;  1J5E K;  1YHQ N;  4CZF A;  1CXQ A;  1XC9 A;  2BAN A;  1KAX A;  1CZB A;  5ELZ A;  4A61 A;  1D9F A;  1NK8 A;  2RHK A;  2OCE A;  5M1Q A;  2HBK A;  4M3W A;  1WBB A;  1S3X A;  4FJI A;  3W3D A;  3CD6 N;  3CCQ N;  2DTU A;  1QVF M;  4E7K A;  1TAQ A;  2FBT A;  4FVM A;  4OJR A;  1D5A A;  4CEO A;  3LAL A;  4PA1 A;  3VF2 A;  1TKD A;  3P39 A;  3SAF A;  1NNE A;  1XI1 A;  3N4Q A;  2HVI A;  3HJF A;  4G1Q A;  3J7Y P;  1JKH A;  3AU4 A;  3MEE A;  3NFA A;  2GX9 A;  3H46 O;  2EX3 A;  4EZ6 A;  1LW2 A;  4DTS A;  1HYZ A;  4HCC A;  2NRT A;  5HRO A;  2KTQ A;  3SPZ A;  1HQE A;  1KTQ A;  3DYA A;  1BWF O;  4I7F A;  2UU9 K;  3DAW A;  4N76 A;  2O4G A;  4XH5 A;  3WNE A;  1XUP O;  3R6M A;  4FLU A;  1QQC A;  1HQU A;  5HRS A;  1NK5 A;  2PFU A;  1VSL A;  4LD0 A;  4UQG A;  2HMP A;  2ZGY A;  4FZZ A;  5AJ3 K;  3FLC O;  4AM7 A;  4DTO A;  3FFI A;  4CK3 A;  4A62 A;  1NGA A;  3AA3 A;  2RF2 A;  3KVG A;  3MK6 A;  2QW9 A;  4YDU A;  2KKZ A;  1Q9Y A;  3VTH A;  1JLQ A;  4KH6 A;  2KZM A;  1X9M A;  2VGM A;  3HT3 A;  3CHW A;  3HBT A;  4KHY A;  1J9A A;  3O4N A;  4W5O A;  5AQR A;  3M8S A;  1HYS A;  1QTM A;  2VWJ A;  5EX5 A;  4CJV A;  1KXP A;  3L2Q A;  4KFB A;  2B4J A;  4QCL A;  1SKR A;  4R79 A;  3ATV A;  1FJG K;  3EL2 A;  2HF3 A;  4M3T A;  4ZTF A;  3U4L A;  2B5J A;  2HNZ A;  1C0G A;  3CFP A;  5ADX H;  3VQ5 A;  5KGW A;  1KBL A;  4CF2 A;  3TWH A;  3EN9 A;  5FRM A;  4RTF D;  4DFJ A;  5EOY A;  3SNN A;  1NJI O;  3VPZ A;  2YNF A;  4NLB A;  1NK0 A;  4AHC A;  3DLK A;  4CFD A;  4ELV A;  4CHP A;  2VG6 A;  2CGK A;  3AVL A;  3AAQ A;  1WNS A;  2COP A;  4B9Q A;  1TK5 A;  5LJV A;  1C1A A;  1VQN N;  1S1V A;  1S9G A;  2UYT A;  4PQU A;  1H4R A;  4KKO A;  3VQ8 A;  4ZHR A;  1TL1 A;  1EF1 A;  5AQU A;  3TTF A;  4WQ4 A;  1I39 A;  1NJY A;  4E7J A;  3OYH A;  4CHN A;  3QIJ A;  4AQY K;  5HOO A;  4KH4 A;  3J8A A;  3LDS A;  3KWI A;  4W5T A;  3ZSR A;  3LDP A;  3OYG A;  1EWR A;  4BGA A;  1CZ9 A;  3G25 A;  2ZWH A;  4BRA A;  4IFY A;  2OPQ A;  5AZJ A;  3BZK A;  3A5M C;  3TAN A;  3WA0 A;  3L3V A;  4ICL A;  1CXU A;  3E01 A;  4YOY A;  4JKF A;  4MDB A;  5I3U A;  4LH5 A;  4CEC A;  1RBS A;  3EE9 A;  2YJE A;  4Z4G A;  3PV8 A;  3RMA A;  2E4L A;  2ZJP L;  4BR2 A;  4OKK A;  3UIQ A;  4CJ5 A;  4FWL A;  4YOR A;  3PUF A;  1RDB A;  5DM6 L;  1NM1 A;  5J1E A;  4B1V A;  1OH7 A;  1HNI A;  1JLA A;  3OYB A;  2LBB A;  3O3H A;  3KD1 E;  3J80 O;  3R8E A;  4JI0 K;  2YCH A;  5JVH L;  1IKY A;  1QQO A;  2GWJ A;  2E1Z A;  3NH1 A;  1NK6 A;  2HHQ A;  4H5N A;  4A59 A;  1VQP N;  1EXQ A;  3CQY A;  2GWK A;  2GEM A;  3L6Q A;  3AVC A;  2D1K A;  3QBX A;  3P83 D;  3SJJ A;  3CQ8 A;  1GLB G;  4NYF A;  3ZLJ A;  2O8C B;  2FSN A;  3TSQ A;  3VEW A;  1WSJ A;  5KGX A;  2GUI A;  4BY9 C;  4IEE A;  4DV7 K;  4JI8 K;  4CJU A;  2FLO A;  5J2P A;  3QIO A;  4K41 A;  4JNE A;  3WNG A;  1G99 A;  4GW6 A;  4F2R A;  2QEX N;  1EKE A;  4H0V B;  1HNW K;  4CEQ A;  1RIL A;  2NNW A;  4WE1 A;  1O13 A;  3O1B A;  4JN4 A;  1NMN A;  2IS3 A;  1MDU B;  4CEB A;  1RNH A;  1JLC A;  3V1O A;  3BZC A;  3CET A;  4Z4E A;  4EIA A;  4DG1 A;  4CGF A;  3DRS A;  4CGD A;  1BIS A;  4BAC A;  2F4V K;  4FK0 A;  2J4R A;  3DLG A;  4IEI A;  4YOU A;  4KI4 A;  1NMD A;  3HP9 A;  1N6Q A;  3LDO A;  5AQM A;  1YVN A;  3G6E N;  4IBN A;  1BI4 B;  2P9P A;  3ZT3 A;  4DQR A;  3D0P A;  3SQ0 A;  3NF8 A;  3ULE A;  4JK9 A;  3JSM A;  4DQI A;  3M6G A;  3M8P A;  3CIP A;  2AP1 A;  2Y1I A;  3QIC A;  4MDA A;  3ZSO A;  3QER A;  2CB8 A;  2VGN A;  1C6V A;  1U47 A;  1VQ4 N;  2UUA K;  4CJ4 A;  4DSI A;  4FPA A;  4BRP A;  3OYC A;  4NCA A;  5J2Q A;  5JS1 A;  4GXB A;  5AQJ A;  5AFU H;  2IAJ A;  4DS4 A;  3HST B;  1VSF A;  2H3G X;  3MX5 A;  5AFU A;  4DTX A;  2O8E B;  3UKR B;  2HE7 A;  2WON A;  4YDU C;  3A0I X;  3DRP A;  4DV1 K;  4O8K A;  4IJN A;  3WXL A;  3HPO A;  4FZX C;  1E4F T;  1RT2 A;  4B3R K;  1WOQ A;  1GLJ O;  1X9S A;  4H5V A;  4DTN A;  3RRH A;  3Q7C A;  2CQU A;  1VQ8 N;  4CJT A;  5J2N A;  4AHS A;  3NCI A;  1VQO N;  5GIN A;  1HPM A;  2NLX A;  2Y1J A;  1EET A;  4K42 A;  3LAM A;  1SQK A;  2Q36 A;  3C6U A;  1JLF A;  2ITG A;  4JHD A;  4H5R A;  1KC7 A;  4ILG B;  4B3S K;  4BR4 A;  3CJA A;  2V52 B;  4PKG A;  3CCV N;  3HXM A;  3HRG A;  4PL7 A;  5TKW A;  3D2E B;  4BWM A;  3WXI A;  1TKX A;  3V1Q A;  3IDH A;  2VG5 A;  4FM1 A;  3NDK A;  1WSH A;  4DV3 K;  1N33 K;  1IJJ A;  4DTU A;  2P9L A;  3K57 A;  1T7P A;  4E19 A;  3IS9 A;  4FLW A;  3F9K A;  2OTJ N;  5KRS A;  3V6D A;  4LFB K;  3C95 A;  1U2V B;  3KKS A;  3ZET A;  4KO0 A;  3I0R A;  2YKN A;  4DU1 A;  1Z26 A;  4IXC A;  3TAG A;  3SQ2 A;  3KLI A;  3HK2 A;  2OZM A; 
#chains in the Genus database with same CATH homology
 4EAH D;  2QM1 A;  4J8F A;  3EO3 A;  2YJF A;  3OHR A;  4OPA A;  3F2K A;  2EMT A;  1NGG A;  3UB5 A;  1HKG A;  1OKJ A;  1NTI A;  2P9K A;  3DWL A;  4ISE A;  4XH1 A;  5KQ8 A;  4GNI A;  4RWT A;  1YJ9 N;  3BEX A;  2FF6 A;  5GIO A;  5AQL A;  4GV3 A;  3UKU A;  2X0S A;  3W0L A;  3AY9 A;  2ITM A;  3VGM A;  4FOE A;  5IJM A;  2V7Y A;  2YHX A;  4BC3 A;  4GVE A;  3WEE B;  2HOE A;  2A5X A;  2ASO A;  3CCJ N;  3MN9 A;  2ZPY A;  1BDG A;  2NRH A;  3OBY A;  3UKU B;  2AA4 A;  4A2B A;  4HWI A;  5CR4 A;  3MN7 A;  4ZRK A;  1W97 L;  1TUY A;  1HB6 A;  4ZRI A;  3QDK A;  2P9N B;  5BN9 A;  3T69 A;  1DIK A;  2YHY A;  1NWK A;  1U6Z A;  1E4G T;  3SAH A;  2A41 A;  5GIP A;  4BRQ A;  3CCR N;  3D2F A;  1NBW A;  3F9M A;  3MN5 A;  4WFB L;  4BG8 A;  2ASM A;  4B1U B;  3ID6 A;  3O9U A;  3ZX3 A;  1Y64 A;  2D11 A;  3ZET B;  3C6H A;  3R1X A;  3FZF A;  3UE5 A;  2D0P A;  1YJW N;  1XC3 A;  3E9O A;  1GLF O;  4FWK A;  2GEL A;  4MLE A;  3U8X A;  5JIC A;  4BRH A;  1C0F A;  2HBL A;  3FR0 A;  2E2Q A;  4MO4 A;  5JLH A;  5FPE A;  1KD1 O;  1JCE A;  3CJC A;  1EQY A;  2YI1 A;  3I56 N;  2Q0U A;  1MK9 B;  2OAN A;  4K43 A;  5AQW A;  4C23 A;  1BA0 A;  4GV6 A;  3DXK A;  2KHO A;  2E2O A;  3H1V X;  4MO5 A;  3T7Z A;  1VQL N;  5I9E B;  3O8M A;  4BRE A;  3H45 C;  2D10 A;  4FSV A;  3M5R A;  3VEV A;  1Y19 B;  1SAZ A;  5BPL A;  4WFN L;  3G9W A;  4GV9 A;  1ATS A;  2Q97 A;  3F5T A;  3AGR A;  3SMS A;  1BA1 A;  2FF3 B;  3AAR A;  3IFR A;  4BQZ A;  3I55 N;  1HKB A;  4NO7 A;  2OTL N;  5EVZ A;  4ZRJ A;  3HZ6 A;  3I33 A;  4H0O A;  4YOT A;  5M1O A;  2HST A;  1Q18 A;  4I6M B;  5MLC Q;  2DPN A;  2WH5 A;  3P4I A;  1YHQ N;  5JVL A;  4CZF A;  3LDL A;  4BRG A;  3KHY A;  3HOT A;  2IVO A;  3SK3 A;  4BR7 A;  1KAX A;  1W2B M;  4FWQ A;  1VQ6 N;  5ELZ A;  4IWV A;  4JHD B;  4A61 A;  1JDE A;  2RHK A;  5M1Q A;  5AQZ A;  2A40 A;  1Q82 O;  2HBK A;  3HSC A;  2NRZ A;  3BIN A;  2D0O A;  3LDN A;  4JD2 B;  1HKC A;  1SZ2 A;  1NGB A;  3M1F A;  4JK8 A;  1S3X A;  3W3D A;  5BR9 A;  1HX1 A;  3CCQ N;  3CD6 N;  2HBJ A;  2WFB A;  4FOI A;  1QVF M;  1VQM N;  3C65 A;  3QBW A;  1V4S A;  1YXQ A;  3VOV A;  3SMP A;  1JCF A;  4QS9 A;  3U7D A;  4OO1 J;  2NRX A;  2Q2R A;  1VQK N;  4WF9 L;  1VBH A;  2YX6 A;  3ENO A;  5AQS A;  2WBN A;  5AQX A;  4CZJ A;  3O08 A;  4YL8 A;  3CF5 L;  2E2P A;  5AQG A;  1QHA A;  3VF2 A;  3NVK A;  5AQY A;  3CJ1 A;  3P39 A;  3QB0 A;  3SAF A;  4IO9 L;  3VF6 A;  1K8K B;  3N4Q A;  2YVC A;  4BR9 A;  3D2F B;  2FXU A;  3CJ9 A;  3AU4 A;  3QFU A;  1H1V A;  1HJO A;  2P9N A;  2GX9 A;  2IIR A;  3H46 O;  4BQL A;  5M1N A;  4DXA B;  1X9J A;  5H1S Q;  5TKY A;  3CME N;  1MK7 B;  4JKC A;  4BGB A;  3KK7 A;  3WEE A;  4AF1 A;  4M7Y A;  3QFP A;  2VYP A;  4L3Q A;  5B8H A;  4M63 C;  4BC2 A;  2NRT A;  1Q7Y O;  4IOC L;  3G4S N;  5AQQ A;  2FSK A;  3A5N C;  1BWF O;  2P9K B;  3FLV A;  1YUW A;  3DAW A;  3R3L A;  4KBO A;  3ULE B;  1ZBS A;  4H0T B;  3SBG A;  3GBT A;  2JWK A;  4XH5 A;  4P7I A;  5DM7 L;  2CH5 A;  1XUP O;  4A2A A;  1VQ7 N;  3R6M A;  1ISN A;  2P9U A;  2QWR A;  1GLD G;  3CQX A;  2PFU A;  1U2V A;  1ACA A;  2Q0R A;  5GAE P;  2HMP A;  1NGC A;  5KQD A;  2ZGY A;  3FLC O;  4AM7 A;  4CZG A;  1MWK A;  3H1Q A;  3L0Q A;  4HDO A;  4JKG A;  2P9L B;  5BRD A;  4A62 A;  4C1N K;  1NGA A;  3KZB A;  4CZK A;  3J7Z O;  2J0K A;  2P9S B;  1M1K O;  2W40 A;  2W41 A;  2NRW A;  1GC6 A;  1VBG A;  3U9D A;  3O80 A;  3R9P A;  3KVG A;  5BN8 A;  3MK6 A;  2QW9 A;  4YDU A;  3N4P A;  2KKZ A;  3MN6 A;  3VTH A;  4Z94 A;  3CPW M;  3MWT A;  3CCE N;  4KH6 A;  5C12 A;  2VGM A;  1D4X A;  3CHW A;  3D2E A;  3IKM A;  5CE3 A;  3IUC A;  1QZ6 A;  3E66 A;  3HBT A;  4DQ8 A;  3SBT A;  2J0J A;  1NGF A;  4WQ4 C;  3WXJ A;  3O9T A;  5AQR A;  3VGK A;  1QVG M;  3DLL L;  3GG4 A;  2E2N A;  4CZL A;  5AR0 A;  4DCH A;  5AZI A;  4PHT X;  1BO5 O;  1GLE G;  3TSU A;  3VEO A;  2RQ1 A;  3RSE A;  4CBW A;  5F0X A;  5EX5 A;  4B1W B;  1KXP A;  3WQU A;  1QQM A;  4OPH A;  4GY2 B;  1NGJ A;  1VQ5 N;  3CPE A;  3H3O B;  4JKA A;  4EHU A;  4R79 A;  4CD1 A;  1V4T A;  3ATV A;  3EL2 A;  3GOI A;  4DHY A;  2HF3 A;  4JEP A;  3U4L A;  2E1Y A;  4WCE L;  1C0G A;  1S72 N;  1BUP A;  5AQV A;  5ADX H;  1IG8 A;  1KBL A;  3A8Y A;  5CHI A;  3CCU N;  3O1W A;  3EN9 A;  4RTF D;  3ENH A;  2IVP A;  1QZ5 A;  3ID8 A;  5EOY A;  3LM9 A;  2QXL A;  1NJI O;  4A57 A;  2PAV A;  1RFQ A;  2P9I B;  3VPZ A;  1GGO A;  1ATN A;  3BF3 A;  3PIP L;  4NLB A;  5AQP A;  2FDQ A;  4FWM A;  4WQ5 A;  4EHT A;  3CC4 N;  4IOA L;  3OBW A;  2CGK A;  4YOV A;  1LOT B;  2I7P A;  3UKR A;  3WT0 A;  3AAQ A;  1YIT N;  1Z05 A;  2QWO A;  3O5B A;  1ILY A;  2Q31 A;  2COP A;  4B1Z A;  4B9Q A;  3KWG A;  3E9P A;  3P31 A;  3A5O C;  5LJV A;  1VQN N;  2F9W A;  1JCG A;  1HUX A;  2UYT A;  3L4Q A;  1ST7 A;  1MWM A;  3TPQ A;  1H4R A;  5AQF A;  3CC7 N;  5EXW A;  1EF1 A;  5AQU A;  5LJW A;  5C10 A;  3TTF A;  2QWM A;  4BC4 A;  4WQ4 A;  3EKS A;  5M1P A;  5AQN A;  3ZX2 A;  3C7N A;  4BRL A;  4HTL A;  1YI2 N;  4BR0 A;  4U67 L;  1T44 A;  4CZH A;  3SLC A;  1MIX A;  4JKE A;  3ZDT A;  3RVC A;  2NRR A;  3BUZ B;  3E1Y A;  3VGL A;  3VEX A;  4BRN A;  3VEY A;  3QIJ A;  4U7B A;  3SAG A;  4JKH A;  4KH4 A;  5HOO A;  1NGD A;  4JKB A;  4PKH A;  3J8A A;  4WYB A;  4G9Z A;  3KWI A;  4TKN A;  3U8Z A;  3LDP A;  2A3Z A;  3X23 A;  4BGA A;  3IMX A;  2BH1 A;  1DEJ A;  2P9P B;  3G25 A;  4IOX A;  2WUS A;  4EFH A;  3HOS A;  3U9Z A;  2ZWH A;  4YOX A;  3OW2 M;  4BRA A;  3MX2 A;  5AQO A;  1TYQ A;  5AZJ A;  5BRH A;  5JVG L;  3A5M C;  3DJC A;  1GG3 A;  3EZW A;  1X3M A;  1DGK N;  4Y0W A;  4BRI A;  3ZEU A;  3WA0 A;  2NZT A;  4F7G A;  4YOY A;  4JKF A;  3MCP A;  4MDB A;  1TUU A;  1MIZ B;  3EE9 A;  2YJE A;  4ILH A;  2ZJR L;  3LL3 A;  1BG3 A;  2HBM A;  2V51 B;  2ZJP L;  4BR2 A;  3VES A;  4K25 A;  2WC9 A;  3CC2 N;  4FWL A;  4MLH A;  3VTI A;  5AQI A;  2R82 A;  4YOR A;  5DM6 L;  1NM1 A;  3Q7B A;  1ESV A;  2E8A A;  4B1V A;  2GTD A;  2ABD A;  3A5L C;  2QA4 N;  4JAX A;  4CJ7 A;  3NVM A;  2E20 A;  2LBB A;  2QWN A;  5GAH P;  3QML A;  4FWR A;  3ENB A;  3R8E A;  3DXM A;  5F1X A;  3CCM N;  2YCH A;  5JVH L;  1Q81 O;  5GAG P;  5BPM A;  2CGJ A;  1QQO A;  1YJN N;  2GWJ A;  2E1Z A;  3EE8 A;  1QQN A;  1NVL A;  1KAZ A;  3NMU A;  4A5B A;  3M3Z A;  4BRD A;  4NB4 A;  5JMV A;  4H5N A;  4A59 A;  1VQP N;  1K9M O;  3MWP A;  3FP5 A;  1NLV A;  3CQY A;  2GWK A;  4BRM A;  3G71 N;  1YF5 L;  2GEM A;  1Z6R A;  3L6Q A;  2F9T A;  2P9I A;  1SS6 A;  3D6R A;  2FJ9 A;  3OA9 A;  2D1K A;  1WUA A;  3QBX A;  2I1K A;  3O9R A;  4JKD A;  1GLB G;  3FZM A;  2FSN A;  3O6W A;  3MMV A;  3TSQ A;  2YHW A;  5FPN A;  4WFA L;  3VEW A;  5BRE A;  3AGK A;  3BF1 A;  4H03 B;  3GE1 A;  5HL7 L;  4AM6 A;  2AEH A;  4B1X B;  4BY9 C;  1K73 O;  4IEE A;  4FWO A;  2FLO A;  1DKG D;  3VER A;  4K41 A;  4JNE A;  1MA9 B;  1G99 A;  3JXU A;  2QEX N;  3TU5 A;  5FPD A;  3HTV A;  4H0V B;  4FWN A;  4BRC A;  5F2R A;  3CCS N;  3DXM B;  3RSE B;  4XEI A;  2CGL A;  4M7X A;  5KPR A;  2ZF5 O;  4BRK A;  5AZI B;  2NNW A;  2HRJ A;  1T6C A;  5EY4 A;  1O13 A;  2QWL A;  3O1B A;  4ISG A;  3VEZ A;  4JN4 A;  5ADX A;  1YIJ N;  3PLA A;  1MDU B;  3K9K A;  2D2Q A;  1ATR A;  4C1N I;  5BRF A;  4O5F A;  5AQT A;  4CD3 A;  2CH6 A;  2FSJ A;  3CET A;  2AL6 A;  4EIA A;  1P90 A;  5M1F A;  4JK7 A;  2J4R A;  4PKI A;  2ZJQ L;  4IEI A;  3C0B A;  2RE2 A;  4YOU A;  2DIK A;  4B1Y B;  1SGH A;  4FVU A;  1R59 O;  3PVL A;  1NMD A;  4UY8 O;  3O4W A;  3ZEU B;  5BPN A;  3LDO A;  3S41 A;  3FZH A;  5AQM A;  3CCL N;  5FPM A;  4H0X B;  1YVN A;  2E88 A;  3IVF A;  5AZJ B;  3G6E N;  1TYQ B;  2P9U B;  1LCU A;  3ATU A;  1KAY A;  2IVN A;  2P9P A;  3TTD A;  4BRO A;  4CBX A;  1YAG A;  4CZE A;  3GDQ A;  5E84 A;  4H0Y B;  3P38 A;  1T3V A;  3ULE A;  4JK9 A;  3FGU A;  2JWL A;  3ZYY X;  4BG9 A;  4CI6 A;  1JJ2 M;  1RDU A;  3VMF B;  3M6G A;  4FL9 A;  3CIP A;  4CZI A;  3SJH A;  4DKW A;  2AP1 A;  2A6A A;  3I8B A;  2VCP A;  3BP8 A;  3CI5 A;  3H6E A;  3MDQ A;  4IDH A;  3QIC A;  4MDA A;  4FWP A;  4QS7 A;  5C2F A;  1BOT O;  2CB8 A;  1NGE A;  1P8Z A;  2VGN A;  1HBK A;  3C7N B;  1VQ4 N;  4BC5 A;  4FO0 A;  3AU5 A;  3WXM B;  3CJB A;  1VAZ A;  5JLF A;  4FPA A;  4BRP A;  2ZGZ A;  1E5W A;  4GXB A;  5AQJ A;  5AFU H;  2EMS A;  4BRF A;  3WUH A;  2Q1N A;  3PZD A;  2H3G X;  3GL1 A;  1K8K A;  3EKU A;  3MX5 A;  5AFU A;  5C15 A;  2J0M A;  2HE7 A;  3AAP A;  3UKR B;  1ZXO A;  4YDU C;  3A0I X;  4IJN A;  4H0P A;  4FPB A;  1NGH A;  4NLC A;  4O8K A;  3WXL A;  1GC7 A;  4IZ9 A;  1E4F T;  1S22 A;  3B8A X;  1HB8 A;  1BU6 O;  2HF4 A;  3TSP A;  4A5A A;  2BTF A;  1WOQ A;  1GLJ O;  1GLC G;  4H5V A;  4ISF A;  5AQK A;  1EO1 A;  3E9L A;  4BVP A;  3WXK A;  1VQ8 N;  3Q7C A;  2CQU A;  1RDW X;  3D7E O;  5E26 A;  1ZC6 A;  3EPY A;  2V7Z A;  5LY3 A;  5M1K A;  5GAD P;  1VQO N;  5GIN A;  1M90 O;  4LC9 B;  1HPM A;  2NLX A;  2F7T A;  4O8U A;  4PL8 A;  4JD2 A;  1Q86 O;  4BR5 A;  1CZA N;  2QWP A;  1DT9 A;  4K42 A;  1XQS C;  4F9O A;  4CYE A;  3O9Q A;  3JS6 A;  1SQK A;  2Q36 A;  4ILJ A;  3HM8 A;  4JHD A;  4H5R A;  4EKU A;  2I7N A;  1NI2 A;  1KC7 A;  4ILG B;  3VET A;  2QWQ A;  5C2D A;  2A42 A;  3FE1 A;  3C6A A;  4I6M A;  4BR4 A;  4IJA A;  5AQH A;  3CJA A;  3CMA N;  2KLA A;  3LDQ A;  2NRV A;  3VEN A;  3TTC A;  2PBD A;  2V52 B;  4E1J A;  4PKG A;  5KPZ A;  3HI0 A;  1N8R O;  3FZK A;  3CJ7 A;  4IO8 A;  3CCV N;  3HRG A;  3LM2 A;  1J19 A;  5TKW A;  4PL7 A;  2VWB A;  3D2E B;  3H3N O;  3VF4 A;  4BVO A;  3WXI A;  3PIO L;  4WQ5 C;  5C0Y A;  3IDH A;  3FFK B;  2QI2 A;  1T6D A;  2ASP A;  3MCA B;  3WQT A;  4DB3 A;  3L4I A;  3DXK B;  1NGI A;  3FZL A;  4KH5 A;  1OVY A;  2P9S A;  4H5T A;  1KQS M;  4CZM A;  3O9S A;  1GLA G;  4QS8 A;  1IJJ A;  1J6Z A;  1K8A O;  1VQ9 N;  4JKG B;  2P9L A;  4RCH A;  4H5W A;  4YOW A;  2OTJ N;  1KC8 O;  3K9J A;  3ZX0 A;  1HLU A;  1RGI A;  5KPT A;  1X3N A;  4FWS A;  4IFE A;  1U2V B;  4XH4 A;  4CBU A;  4HDQ A;  2GUP A;  4NY0 A;  2BUP A;  2QTD A;  3ZET A;  3CXC M;  3CER A;  1GLL O;  2I1J A;  2EWS A;  4IXC A;  2D4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...