4JKEA

Open and closed forms of t1789p human prp8 rnase h-like domain with bound mg ion
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
219
Chain Sequence
LFSQIIWFVDDTNVYRVPIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 68
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkeA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkeA01
4JK9A 4JK7A 4ILGB 4JKAA 4JKCA 4ILHA 3E66A 3ENBA 4ILJA 3SBGA 4JK8A 3SBTA 3E9OA 3E9LA 3E9PA 4JKHA 4JKGA 4JKBA 4JKFA 4JKEA 4JKGB 4JKDA
chains in the Genus database with same CATH superfamily
4BR9A 3LDOA 3QO9A 5JVHL 1VSDA 4B9UA 2YHAA 1HBKA 1ATNA 3AAQA 5FRNA 3N4QA 3J7AP 3MWTA 2I5JA 3ID8A 5EVZA 4YOVA 4TSXA 3E1YA 3WT0A 1DLOA 5HP1A 1JJ2M 4ELTA 4XH5A 5AQTA 3QIJA 4C1NI 3HK2A 5CE3A 4DV4K 2VQEK 4CJVA 1HNVA 4BG9A 4NO7A 1GLAG 3PV8A 4J2BA 2JWKA 2YHXA 4ISFA 2E1YA 2O8BB 3MMVA 3OW2M 3BEXA 4JI1K 1VQ9N 1K8KB 1NTIA 2CH6A 4AHUA 3R3LA 1JLGA 4DUZK 1GLJO 4CJ3A 1EO1A 1NGBA 4B9QA 1LCUA 4JI5K 4E19A 5AZJA 2Z1JA 1A5WA 2UXCK 3CJAA 4K41A 4B9MA 3DOKA 3K0SA 3PSIA 4Y1CA 3O9SA 3SQ1A 2PFUA 3CJBA 2KZZA 3U8XA 4B3OA 3EKUA 4H0TB 4NYFA 4W5OA 1RBSA 4U67L 4DTSA 5HROA 3HP9A 3BDPA 1Y97A 1SQKA 2RHKA 3HVRA 3OYMA 2RF2A 5AJ3K 4Z4FA 5IWAK 4H5NA 1EQYA 3DOLA 3KVGA 3AVFA 4FJKA 4CJWA 4DMNA 3RSEA 3SV3A 1NK9A 2OZSA 1VAZA 4DV3K 3AU5A 4CGJA 1ZBHA 2GBZA 1VQ6N 2B6AA 3EEQA 2E2OA 3VQEA 1VSMA 1Q8IA 1OH7A 2NRXA 3WXIA 2VG6A 3L8BA 1KQSM 2ABDA 3OS2A 4AHCA 4QOZB 1TGOA 4AILC 5ELZA 3Q7CA 3SPYA 2E4LA 3PSFA 5CY4A 4IXCA 3NF6A 4DFKA 5DMRA 5M1PA 3SLCA 3SAGA 4CJFA 4K8ZA 2GWJA 3QETA 2YKNA 5AQXA 3QFUA 1JXEA 1D4XA 1S9GA 1VRUA 1NJZA 3TANA 2COPA 3SUPA 4HVJA 4CHNA 4BDPA 5AFUA 3NF8A 3ZSVA 4WFAL 4LF7K 4NCBA 3HZ6A 1T8EA 3KLEA 1BISA 4BVOA 3DLRA 3LDNA 3MWPA 1EKEA 3HPOA 2DPNA 5JVLA 4CF1A 1OH6A 1BA1A 5SZTA 4F2RA 4JLHA 2PYJA 2F8SA 2HHUA 3THXB 3HSTB 4CJ7A 4AHVA 2P9PB 2WTUA 1VRTA 4FW2A 4KAZA 2YI1A 4IFEA 4DWIA 5E84A 3DYAA 4QS7A 4ZRIA 3LP3A 3K59A 4DQRA 4QS9A 3VQAA 2D0PA 3FP5A 3ZSOA 4E1MA 3NVKA 3L3UA 3HPGA 3VQ6A 4CK3A 3F9MA 3L2WA 3BY5A 2E6MA 1YI2N 4M3UA 5J1EA 3UIQA 5C12A 1EETA 2YHBA 1GLCG 1U2VA 4PQUA 3D2FA 4ISGA 2PYLA 4B3RK 1X1PA 5KGXA 3TTDA 1WSIA 4GKJK 4CFBA 1IBKK 1OVQA 4CZJA 1BI4A 4DTOA 2DFEA 3WXMB 4N47A 5I42A 5HLFA 2W40A 1MU2A 3LM2A 3HP6A 3CF5L 1JLEA 4KBOA 3T1YK 4PWDA 4HUFA 2O8EA 5KPRA 3DLEA 1NGFA 4DR5K 4JKCA 4A61A 3C65A 3G10A 3OYCA 1X9JA 1RT2A 3H08A 3WNGA 3ZSRA 2IAJA 1SGHA 4OKEA 4WFNL 4DUYK 3AA3A 1BIZA 3L0QA 2WFBA 4DSEA 1CZBA 3LP0A 3IG1A 1IBMK 4V19S 1W9HA 5KRTA 3C6UA 3ZSXA 1HMVA 1NK4A 4M42A 4JKFA 3DMJA 1L3VA 4JKDA 1TVRA 5FLXO 1Q81O 1NBWA 3ATVA 4BR0A 3V9UA 4BRIA 4FLVA 3AA2A 3B8AX 3VF2A 3VQ7A 3J80O 4YDUA 3SCXA 1CZAN 2XRIA 4IG3A 3C0BA 3PLAA 3O80A 1IKXA 3KLGA 4DV6K 1SZ2A 1RNHA 4B1UB 4YL8A 1HLUA 1NK6A 4CZLA 3DXMA 3KIOA 1JDEA 1WAJA 1TYQB 5J2NA 1B92A 4O8KA 5D3GA 2GEMA 4KREA 1L3UA 3IDHA 3VQ8A 4DTNA 4FWPA 3AY9A 4DR3K 2ZJPL 4DTUA 4F3OA 1JLQA 1SL1A 3GDQA 3HTVA 4RW4A 3B6OA 2HOEA 2OTLN 4CEAA 4GMJB 4EP5A 5ADXH 3KK3A 4C8NA 4YNQA 5AZIA 2O8FA 3ZYYX 3TAFA 1QHAA 4AF1A 4PL7A 3OJUA 2YJFA 3R1XA 2HHXA 4CZHA 4GKKK 4YOYA 5AQPA 3T69A 5DK5A 1ZBLA 4FJ5A 4FZZA 4KKOA 4KV8A 1B9DA 2ATQA 3D0PA 2OCEA 3THWA 2X6NA 3ZDTA 1SV5A 5C0YA 2GUPA 2HBKA 3B6PA 1HUXA 3O8MA 3VQ4A 1HB6A 3CJ9A 2ZPYA 4CJKA 2Q3SA 1UA0A 1NGGA 3OHRA 3HPHA 3T7ZA 4BRFA 1NGIA 3ZSWA 3DLLL 4BRHA 1QQNA 1WSGA 1J5EK 5M1NA 4CEFA 1Z6RA 3SQ4A 2D0CA 3O5BA 5JS1A 3VPZA 3THWB 3TARA 3CI5A 5AQQA 3T1HK 3V9SA 2V51B 3DLHA 2NRHA 1XMOK 4NY0A 1S1WA 3E9PA 1XI1A 2FLOA 4A5BA 2G8HA 3ZETB 2HHQA 3MN7A 2ETJA 3P31A 3TPQA 2R82A 3KKRA 1TV6A 4KI4A 5JICA 5FPNA 1J5OA 1VQNN 3C7NB 4H5WA 3ZT0A 3RR7A 3NE6A 4FLYA 3OS1A 5LJVA 3OYBA 3SMSA 4DXAB 1KLNA 4LH4A 2QK9A 1EP4A 4EFHA 3WXLA 2P9UA 2Y1JA 3AO2A 3JYTA 1L3TA 5HRSA 5CZ1A 4QAGA 2HNDA 3AVHA 4YFUA 3CPWM 4JI3K 1JL2A 5FPEA 3ALYA 4GV3A 2YHWA 2QKBA 4GXBA 2FJ9A 3VEWA 3VF6A 2J4RA 1REVA 4O4GA 1NK5A 4CJQA 4CECA 4FM2A 4KPYA 1VQ7N 3WNFA 2HHTA 3V1OA 3QERA 1LWEA 4AH9A 1HPMA 4CEZA 4BWJA 1K73O 4LFCK 3UB5A 3FZLA 3NGYA 3DJCA 3AVCA 2F4VK 4JYAK 2EMTA 4O8UA 2JLEA 2B4JA 3VENA 2D0AA 3AVLA 2NRTA 1D9FA 4Z4EA 1VQ5N 2ZJRL 4LC9B 5LY3A 1WAFA 4JKHA 2HHSA 1N36K 1JKHA 4BR2A 2YV0X 4FWMA 1P8ZA 3HOSA 4H0YB 3VOVA 4DS4A 4K43A 4CBWA 4CJSA 3TR8A 3VEYA 4FCYA 2EMSA 1RTDA 4Z4CA 3BZCA 4CGIA 3O3GA 3RVCA 4PKGA 4JI8K 1NMNA 3RMCA 2QXFA 4B8AB 4CF2A 5GAHP 4DCHA 1UWBA 3DM2A 3NDKA 4IWVA 4PA1A 1L5UA 1LW2A 4CF9A 1RILA 4JHDA 1LV5A 3IRXA 4WCEL 1VBHA 1CXUA 4GW6A 2O4GA 2VWJA 1U47A 5EOYA 3V6DA 3N4PA 1NMDA 2ASMA 1HKGA 3I8DA 2WBNA 5GINA 4CGFA 4XH4A 2OYQA 2KKZA 4OLBA 5J2MA 3HO1A 2X78A 3EO3A 4B9LA 4OX9K 4B3MK 3OA9A 1GOCA 3CFOA 1WN7A 3CG7A 1VQ8N 3QEIA 2E88A 1NK8A 4MLEA 3TSPA 3HBTA 3CETA 3LM9A 1N8RO 3HM8A 1WUAA 3DLKA 3EYZA 1QQMA 4EAHD 3CCRN 2ZJQL 2KW4A 3AO5A 3O9TA 1ESVA 2OANA 1TAQA 5BN8A 1U49A 4L8RB 2FBTA 4FOIA 3O6WA 5C15A 3SUQA 4QCLA 3KK7A 4FYDA 3BF1A 1FKOA 4LY7A 3HSCA 4Z94A 5AR0A 2FSNA 4WQ5A 3D2EB 2XHBA 5JMVA 5KTQA 2HE7A 3OBWA 4FWQA 1CLQA 4O55A 1V4TA 2F7TA 4YY3K 4FZYA 4AM6A 4DV5K 1E5WA 5C2DA 4H8KA 4BGBA 3NBPA 2GWKA 1NNEA 1QE1A 3IS9A 3OYEA 1ZC6A 4IJAA 3DLBA 2PY5A 4MLHA 1JCGA 2O8CB 5AFUH 1RFQA 2OZMA 4EP4A 3ZX3A 2P9NA 1Z05A 1LAWA 5HRRA 1TL3A 4RW9A 1BGXT 4CZIA 1HJOA 1NJYA 4JK8A 4M7XA 4HUEA 3FZMA 4FO0A 3OYNA 4DQ8A 4ZTJA 2HMIA 4B3SK 4N56A 1T05A 4NLCA 1K6YA 2ASPA 5KPTA 3SK3A 2FF6A 3VQBA 4WFBL 3GBTA 5HRPA 3VQDA 3LZIA 4KFBA 4YOUA 4AM7A 3HJFA 3L2UA 3M8QA 3LANA 1NLVA 2A41A 1QS4A 2P9NB 4EHTA 3M5RA 3BZKA 3FLCO 4HTLA 1C0UA 3LDPA 4B8CA 4I9LA 5AQMA 1GLLO 2D2QA 4LFBK 3ZEUA 2E1ZA 1HYVA 3V1QA 3M1FA 4R79A 1TKZA 3ZCMA 4M45A 4BRQA 1T3VA 4DFPA 3V81A 2QW9A 3MXIA 2IOCA 3CFPA 1K8KA 3VA3A 3H1VX 4DQPA 4HCCA 4C8KA 3KWIA 4O5BA 1SL0A 1J53A 3U3YA 3L6QA 1TUYA 5AQZA 4W5TA 1FW6A 4IDHA 5F2RA 1SKWA 4B9TA 5SWMA 1S1UA 4Y1DA 1U48A 1YITN 3PUFA 1XQSC 4FM1A 1GOBA 2YVCA 3MCPA 2AA4A 4DS5A 4FSVA 3ZEUB 1XNRK 1RDBA 4DFJA 4A57A 5BRDA 3I8BA 3KK2A 4DV7K 1QQCA 4IKFA 5KPZA 4FWSA 3IUCA 2KFNA 3FGUA 1Q18A 5I9EB 1VQ4N 3T1AA 1EWQA 3DRSA 1BCOA 1YT3A 4E7IA 4JI7K 3E01A 1NOZA 3PO4A 1N33K 3H45C 1IG9A 3EZ5A 3TAQA 2IS3A 4CEEA 3ISNC 3SQ0A 3AVMA 3CCEN 3ZT2A 4OPAA 3RTVA 3VEOA 3MDQA 1A5XA 1BCMA 4DTXA 3LPUA 1BHLA 2ITGA 4DB3A 3U8ZA 1RBRA 2AJQA 2Q97A 2ZWHA 3H46O 4EIAA 1W2BM 1HNXK 1ASWA 2G8WA 3GL1A 1WB9A 5A2QO 1BQNA 4BRMA 3CCUN 4F3TA 4MFBA 4NXNK 4FPAA 1CXQA 5TKWA 3BP8A 1LWFA 3RMBA 1KSPA 4BVPA 3AO4A 4G1QA 3LDLA 1U4BA 2D0BA 1MWMA 1O1WA 1HB8A 3V4IA 3OS0A 4DF8A 5FRMA 2AP1A 4A5AA 1Q82O 4BQZA 1W7AA 2HRJA 4NYNA 1HYZA 4PUOA 3CPEA 3O08A 2CQUA 3THXA 3OYHA 3E9LA 1JXBA 4KH4A 3TWHA 2DFFA 2CGKA 1BA0A 2J0KA 2P9PA 4XEIA 3K5MA 1OH5A 1YHQN 3P5JA 3CCLN 5M1KA 4F4KA 4BE2A 3H1QA 3CJ7A 4HDOA 3DRPA 5BPMA 1GLDG 4O5FA 1QTMA 4K25A 1HRHA 4J2EA 4I2PA 4CW7B 3M8SA 1GC6A 1NJXA 3S9HA 2YX6A 2CH5A 3A5LC 4GVMA 5EXWA 1RT4A 3VQCA 1J6ZA 1LOTB 1M1KO 4EKUA 4HDQA 4H0OA 1RT7A 3OYGA 5BPNA 5K14A 5GIOA 3SJHA 1JLCA 4CEQA 2PZSA 3CJ1A 4H0PA 2I1KA 4WQ4C 4IO9L 4MDBA 1R0AA 2HHWA 4A62A 3C6TA 4DQQA 3LWLA 3MXMA 4B1YB 2P9SB 1MA9B 5BPLA 3U7DA 2Q2RA 4I9QA 4H0XB 2I1JA 3T3FA 2FBYA 4OO1J 4CGDA 4JI4K 3THVA 3FFKB 1YJ9N 4KHYA 2CGLA 2CB8A 4DLGA 1IKYA 5KRSA 3P39A 3J7YP 3QNOA 4CJ4A 1SS6A 4IZ9A 2BGGA 3WEEB 2XY7A 4F9OA 3SBGA 2IC3A 2IDOA 1NJIO 4E1JA 1HYSA 4LF5K 3OYLA 3O4WA 3QMLA 3EE9A 3CJCA 1XHXA 4OKKA 4BC3A 2E5LK 2E8AA 2QA4N 4LF4K 1B9FA 3OJSA 1S22A 4BE1A 4KHUA 5AQSA 3KD5E 2IVNA 5M1QA 4X65K 2DY4A 2QTDA 4DLEA 1D8YA 4DTMA 1DGKN 1HQEA 1QSLA 4DSLA 4FXDA 3KHYA 2HBJA 4BC4A 5MLCQ 3L2QA 2BDPA 3PO5A 5HRNA 3OYFA 5M1OA 4E89A 5GADP 3VERA 2BTFA 4G9ZA 1C1BA 5KQ8A 1DTQA 4IDKA 3VQ9A 4FLXA 2HVHA 1QSSA 3BF3A 4CESA 1I39A 5AQVA 1TYQA 3LWMA 4FK2A 4ILGB 1ILYA 3U3GA 3ASMA 3A0IX 4B08A 5C10A 2GUIA 1YTAA 4FJ7A 4LF8K 4TKNA 2NRRA 5CHIA 2QWOA 3AVKA 4LFAK 4CD1A 3U6FA 5AQJA 5C42A 3RWUA 2FSJA 4O0JA 1ISNA 1RBVA 1T03A 2VWBA 4X66K 3G6EN 4Y0WA 2D5RA 3A5OC 3LALA 3P38A 1RT6A 2E2NA 2WOMA 4FJMA 2X74A 3DLGA 4CCHA 1W97L 4DSFA 3W0LA 2RE2A 1S1VA 4B9SA 1YVUA 4DV2K 2DIKA 5IJMA 5F1XA 1YTUA 2P9IB 2D4WA 3MECA 1NK7A 3VTIA 3NFAA 4H03B 1VSEA 5E41A 4BRLA 1MK9B 3FZFA 3JS6A 3LZJA 4IG0A 4DU3A 4AHSA 3VF4A 1X3MA 1GLFO 4BRGA 2P5GA 4N76A 1QSYA 2HVIA 1NI2A 1X9SA 4E7JA 3V1RA 1KVAA 3HRGA 3CERA 3EE8A 4JS5A 1IV0A 5JLFA 5EX5A 1BU6O 2D1KA 1WBDA 1WSFA 4WE1A 3C95A 4J2AA 3SUOA 3TAGA 4HHTA 2GX9A 1TKDA 4JKBA 1RTIA 3ZETA 4IEIA 4ISEA 3CYMA 4FJJA 2VCPA 5EU7A 3WNHA 1HPZA 3VQ5A 4H4MA 4GNIA 4B9VA 1XHZA 1O13A 4DR2K 4FK0A 3C7NA 3P4IA 4ZTFA 4KO0A 1HQUA 3MEDA 4O0IA 4CBUA 3WA0A 3KZBA 4CIGA 4U7BA 1WBBA 3AAPA 4ID5A 4HTUA 1K9MO 1RBUA 2V7ZA 2G8IA 3IMXA 4JAXA 4FL9A 4BRAA 3L4IA 3OTOK 1TL1A 2NZTA 2WH5A 1NGDA 1C0GA 3NF7A 4I2QA 1S9EA 3SMPA 5AQLA 1NKEA 5C25A 2OTJN 2IGIA 1S72N 4DKWA 4OPHA 3UKRB 4IBNA 3G25A 4E7HA 4E7KA 4RW7A 3DXKB 3HM9A 3CC7N 2KFZA 3VQPA 1KFSA 3ZSZA 4DU1A 2YNFA 4DV0K 2G8FA 3IKMA 3D6RA 1KLMA 1GLEG 1BDGA 3AV9A 3EN9A 5LMNK 4K0KK 4DR4K 4IOCL 1A5VA 4AHTA 1F21A 2WUSA 4C23A 1MDUB 2Q0RA 3D45A 4BRPA 1D5AA 2QWLA 1C1AA 3S41A 2DTUA 3QLHA 3ITHA 4E3SA 2YCHA 3AO3A 3H6EA 1C1CA 4MDAA 1VBGA 3KJVA 2QKKA 2ASOA 4H4OA 4DF4A 3ZX0A 1U6ZA 5BR8K 1ZBFA 2NUBA 2ZQBA 2RQ1A 5I3UA 4YDUC 2HNZA 3WNEA 4ZRJA 4CZEA 4CJ5A 4FLTA 1TK0A 2GTDA 2VGMA 4E0DA 1YUWA 1VQPN 1JCEA 1HX1A 1T44A 3FR0A 3LAMA 4BACA 4JD2B 1Y19B 1C0FA 1S3XA 2IVPA 4R5PA 3JXUA 4M3WA 3WXJA 4HCBA 3K9JA 2P9KB 2IIRA 2Z1HA 3U4LA 4KHPK 5FDLA 4F7GA 4W5NA 2FSKA 5ADXA 3V9XA 2BE2A 2DFHA 1RDAA 2P9LB 5LJWA 5B8HA 4BREA 2ITMA 3OYJA 4FZXC 2Z1GA 1MK7B 1NKBA 3HYFA 5CZ2A 4EZ9A 3TSUA 5LL6Z 1X3NA 4CFCA 3LP2A 2R7YA 1KAZA 3VN5A 3CIPA 1GOAA 4O44A 3D2EA 3NHGA 3QBXA 2E6LA 1ZYQA 2LBBA 1QVGM 3VETA 4YHHK 4F2SA 1J54A 4H5TA 1TKTA 4BG8A 3AO1A 1TKXA 3VEZA 2J0JA 4FWRA 1N34K 3NGZA 3M8RA 2RKIA 3TAPA 2O8CA 3SUNA 1IO2A 1XC3A 1QZ6A 4IO8A 4BC5A 4FK4A 2XO7A 2XY5A 3PX4A 3X23A 3LDQA 1ZBIA 3M3ZA 2HMPA 2A6AA 4OKJA 2G8VA 4DTRA 1EX4A 2GV9A 3CMAN 1NKCA 2A5XA 3AVGA 2NRZA 3TAEA 3OBYA 1S6PA 3I0RA 3OYAA 2O8DB 5FROA 4M3TA 3K5OA 2B5JA 3LDSA 4FJ8A 4ZRKA 3Q7BA 1H4RA 4B9NA 2JWLA 4LF9K 3GOIA 4JN4A 2VWKA 3QBWA 4KH6A 4CHQA 2HHVA 1XNQK 1NOYA 4J8FA 3CC2N 3BUZB 1U45A 2OPRA 5FPMA 1VSFA 3MX2A 2E2QA 1WLJA 3QICA 1ITGA 1FKPA 3GE1A 1RT1A 2ZD1A 3SYZA 1RT5A 1DKGD 4LSNA 2W6LA 4JI6K 1LWCA 1JLFA 2Q36A 3UKUB 4CF8A 3PX0A 4CK2A 4ID1A 2AL6A 4MQ3A 3C94A 1NM1A 3MN9A 3WQUA 2OA8A 4CJEA 1VQON 3O9UA 1DEJA 3I56N 3KTQA 1I94K 4LD0A 1TUUA 1BQMA 1XMQK 1Q7YO 3QNNA 2QWNA 3ULEB 4JEPA 1R59O 4WF9L 3O4QA 3M6GA 3CMEN 4JK9A 1RDCA 3KLHA 3THYA 1NVLA 4OJRA 1E3MA 3VESA 3MN6A 2ZM6K 4DQSA 3I55N 3S3NA 5C24A 3WUHA 3W3DA 3MX5A 4JNEA 3G71N 1NG9A 5AQRA 5T7BA 2NRWA 3PIOL 1NJWA 1NU0A 1UAXA 3K5NA 1G15A 3DRRA 4JKGB 3AVJA 3NMUA 2I7PA 2VGNA 3HVTA 2F96A 1BO5O 2BUPA 3NH1A 4W5QA 3RRHA 3DAWA 3KD1E 1RDWX 3THYB 1RTJA 3CXCM 3ZSQA 1YJNN 3E66A 4CHPA 2FDQA 4A2AA 1IKWA 1YVNA 5KQDA 2HNYA 1HNWK 1NGAA 2D10A 5BR9A 4L3QA 3FLVA 3KK1A 3I33A 1BG3A 1XC9A 1VQMN 3EL2A 4DSJA 3I0SA 2QWPA 2Q1NA 3TTCA 4CZGA 2WONA 4IJNA 5KI6A 3MCAB 1L3SA 1KAXA 3CCVN 3CHWA 3IAYA 4KI6A 4FJHA 3R8EA 1BUPA 3OVNA 1QHTA 1VQKN 3T19A 2LSNA 4PHTX 4CHZA 2BANA 1C6VA 3O3HA 4B3TK 3VEXA 3OY9A 1M90O 2W41A 3SJJA 1S6QA 1KC7A 3AGKA 4RCHA 5J2QA 4RWTA 2QWRA 2V52B 5DM6L 3UE5A 5GIPA 1YIJN 5AQKA 4EHUA 4FJIA 1DTTA 2KHOA 1W0HA 3TU5A 3QEVA 1GG3A 5AQNA 1KAYA 4FWNA 3CQ8A 3QFPA 2NLXA 5AZJB 3ULDA 3CM6A 2UU9K 1SUQA 4CZFA 3AVAA 3PZDA 1TK8A 1P90A 1IKVA 2W42A 4WQ5C 3G4SN 1E4FT 4KB1A 4HUGA 3LL3A 4OLAA 2X0SA 1GGOA 3J8AA 3A8YA 3J81O 1SL2A 5AQIA 3RSEB 4DG1A 3QDKA 2ZF5O 3AVBA 4A2BA 2P9SA 4RW6A 4GY2B 4CHOA 3CFRA 2EWSA 4B1XB 1NK0A 1Z25A 2G8KA 4M41A 3ZT3A 4RTFD 2ZGZA 4AQYK 3CM5A 4YOXA 2WC9A 1BWFO 3QIOA 1KTQA 1OVYA 4N41A 2VQFK 1JL1A 3ID6A 3L2VA 2F9WA 4IOXA 4KHQA 1RDUA 1SKRA 3WEEA 2VG7A 4CEDA 3FZKA 3CD6N 2EX3A 1ATSA 4FPBA 2HBMA 4IFYA 1NGHA 1HNZK 1VSJA 1YJWN 2D0OA 4NXMK 4FLWA 3U9ZA 4FW1A 3KWGA 1UOCA 2RPIA 3RR8A 3ENOA 1S1TA 3L2RA 2ZGYA 4FLUA 3K58A 3RRGA 3FFIA 1FXXA 4CJLA 1Q9XA 4ELUA 3NH2A 3ZLJA 2UUAK 3O9QA 1WSHA 1KVBA 1FJGK 3ENBA 4ILJA 1YF5L 3SNNA 2E2PA 2UUCK 4XH1A 4BWMA 2YNIA 1VSKA 5FPDA 4DFMA 4PKHA 1QZ5A 3CQXA 4GV6A 1HR0K 3MK6A 1Q9YA 3TI0A 4OGEA 4JKEA 2FBXA 3HL8A 3DWLA 3VA0A 3S3OA 5IT9O 4BR5A 3GG4A 4CF0A 4JRQA 3QB0A 2QI2A 1BOTO 4B1WB 2NRVA 5M1FA 3SAHA 3HXMA 1U04A 4CEBA 4C8LA 1KCFA 4ZHRA 4K8XA 1FK9A 3C6AA 3F2KA 1ATRA 1X9WA 2FXUA 5CR4A 2QEXN 2FBVA 4P7IA 2OPPA 1BL3A 2VG5A 1VQLN 4FVUA 3V9WA 1E4GT 1RGIA 1U2VB 4CE9A 3D2FB 5BN9A 1EF1A 4KHSA 3MAQA 3CC4N 4C8MA 2P1JA 2AEHA 2OPSA 1TK5A 3O1BA 4FOEA 1BI4B 2EHGA 3ZT1A 2P9IA 3SV4A 1C0TA 3AA4A 4LF6K 5AQGA 4X62K 1WNSA 3ZX2A 4BGAA 4CJUA 1KRPA 4FM0A 2H3GX 2HBLA 4LSLA 4C8OA 3WQTA 2O8EB 2A3ZA 4BRCA 4DTPA 3O4NA 5TKYA 3ZT4A 4OVLA 4KB0A 1NGCA 1ZBSA 3J7ZO 3G0ZA 4M63C 1JCFA 4FVMA 1KC8O 5BRHA 3BINA 2Z1IA 4FJNA 4NCGA 4JI0K 5JLHA 2KQ2A 4CJRA 1T6CA 1NGJA 3OYDA 2UYTA 3RMDA 1ST7A 2Q31A 3CCJN 4CFDA 3TAMA 3SQ2A 5CYQA 4E7LA 2KZMA 1QVFM 1MWKA 2JGUA 3NVMA 3K57A 1N32K 3FZHA 3U9DA 4CIFA 4OPJA 4MO4A 5BREA 3F9KA 4Q5VA 1V4SA 3CCQN 1IJJA 4FWLA 3MEEA 1QQOA 4CIEA 4CZMA 5GAEP 1ZBUA 3DXMB 1BIUA 1LW0A 3DI6A 2A40A 2XY6A 4K42A 1UA1A 1HJRA 5KGWA 2CGJA 1Q86O 2P5OA 1IBLK 4CJTA 3QEPA 3CCSN 4B1ZA 1MIXA 2HSTA 5AZIB 2O8FB 4BC2A 3TSQA 2HW3A 3VMFB 2HF3A 4CGHA 5HBMA 3R9PA 3IVFA 5AQYA 3EY1A 4KTQA 4RG8A 3UKRA 3LAKA 3DXKA 3SBTA 2FC0A 3KKSA 3HT3A 3QEWA 4F8RA 3A2FA 1IG8A 3QESA 2UXDK 1H1VA 3K2PA 3O9RA 2UUBK 4JV5K 4I6MA 4FLZA 4IFVA 1JLAA 3NGIA 4NCAA 5HL7L 3SAFA 4BQLA 2FF3B 5F0XA 3A5NC 2D11A 3A5MC 2J0MA 2IVOA 2QM1A 2YJEA 3HI0A 3NF9A 4IEEA 5AQWA 2YNHA 1OKJA 4BRKA 1YXQA 1OH8A 2O4IA 1SKSA 4BR7A 4DR7K 5J2PA 4I6MB 1T6DA 3S3MA 4CEOA 3O1WA 3VGKA 3QIPA 3WXKA 4CD3A 2YHYA 1N6QA 4M3XA 2YNGA 4KTZA 3NH0A 2QWQA 4B1VA 1K8AO 2RN2A 4KH5A 2VYPA 1XUPO 4RW8A 1RT3A 4BRNA 3MN5A 4KHNA 4JD2A 1HKCA 5AQHA 1VSHA 2P9KA 4N5SA 3ENHA 3P83D 4XIUA 5EY4A 1LAVA 5C2FA 1G99A 2OPQA 3F5TA 5LMUK 1KFDA 4DR6K 4OPKA 2G8UA 3PX6A 1RBTA 2P9UB 4CERA 4JK7A 4BRDA 2V7YA 2HF4A 4CK1A 4DHYA 4Z0UA 4PL8A 1WSEA 2BH1A 2P9LA 2HB5A 4OGCA 1WOQA 4QS8A 5H1SQ 3SZ2A 4M3YA 4PY5A 4JS4A 3E9OA 4YOWA 3VTHA 3V9ZA 3VEVA 4J2DA 1S1XA 1VSIA 1ZXOA 4CI6A 3PY8A 4YOTA 3M8PA 5HOOA 4GVEA 4W5RA 3G9WA 3L4QA 3AARA 3TABA 4JKAA 4LH5A 1IH7A 4A59A 4M3ZA 1GLBG 4NB4A 3SPZA 3H3NO 4CFAA 2UXBK 4ELVA 2NNWA 1Z26A 4KHWA 4AHRA 4Z4GA 1ASUA 2Y1IA 4DQIA 4ICLA 4BR4A 4BDYA 3K5LA 1CZ9A 2Q0UA 4CZKA 3P1GA 4KTWA 1NGEA 4Q0BA 4MO5A 1WSJA 2QWMA 3L3VA 4CVNE 1T7PA 4BDZA 2HHHK 1DT9A 4IOAL 3CCMN 3JAMO 3K9KA 1Y64A 1EXQA 1GC7A 4FWKA 5JS2A 2O8DA 5GAGP 4X64K 3OYKA 1XWLA 5AQOA 1KVCA 3R6MA 4M7YA 3AVIA 3VQQA 4BROA 1RCHA 3KLIA 2XY8A 4JHDB 4NLBA 4BY9C 4DSKA 3TTFA 1DIKA 4FWOA 4ILHA 4H0VB 3EPYA 4EZ6A 1D9DA 4HWIA 4CYEA 4M3RA 4CJPA 3NAEA 4FJLA 1KXPA 3MEGA 3AA5X 4BE0A 1X9MA 3F73A 5AQUA 1ASVA 2ZE2A 3QINA 3MXJA 3VGMA 1MIZB 3D7EO 3EZWA 4H5VA 4DV1K 3SI6A 1VHXA 2P51A 3AU4A 4I7FA 4Z4IA 1RDDA 2E20A 3UKUA 3NCIA 3RMAA 1YAGA 4FJ9A 2KLAA 1I3AA 1VSLA 1C0MA 4DU4A 1N5YA 4FJXA 2A42A 1HNIA 5CYMA 2YKMA 3JSMA 3ULEA 2A1SA 2GELA 1KBLA 4UY8O 1ACAA 1J9AA 4CHYA 4E1NA 1S5JA 5DM7L 3OYIA 3QEXA 3AVNA 1RTHA 4CBXA 4UQGA 3PVLA 3ATUA 2X6SA 3VGLA 1TAUA 3H3OB 1EWRA 4WQ4A 3IFRA 4CGGA 1VK0A 4WYBA 3FE1A 5JVGL 2A1RA 4DTJA 4DSIA 3ZSYA 4JKGA 2PAVA 5E26A 3EKSA 4YORA 4FJGA 3PIPL 4H5RA 3LP1A 2W6KA 5AQFA 3O3FA 2F8TA 4JI2K 1NWKA 2KTQA 3AGRA 3LPTA 1KD1O 3CQYA 1JLBA 2QXLA 4PKIA 4KRFA 3BGRA 4GV9A 4C1NK 2PBDA 4JRPA 4DR1K 3C6HA 3KLFA 1HKBA 2O8BA 2I7NA 3HOTA 2F9TA 1SAZA 4Z4HA 5BRFA 1J19A
chains in the Genus database with same CATH topology
2ZGYA 4BR9A 3LDOA 5JVHL 2VCPA 4JHDA 1HBKA 1ATNA 3AAQA 4GNIA 3N4QA 3MWTA 5EVZA 3ID8A 4WCEL 4YOVA 3E1YA 1VBHA 3WT0A 1JJ2M 3O9QA 1O13A 4XH5A 3QIJA 5AQTA 5EOYA 3ENBA 4ILJA 1YF5L 3N4PA 2E2PA 4C1NI 1NMDA 2ASMA 1HKGA 5CE3A 2WBNA 3C7NA 3P4IA 5GINA 4XH1A 4XH4A 4BG9A 4NO7A 1GLAG 4CBUA 2JWKA 2KKZA 4PKHA 2YHXA 4ISFA 5FPDA 1QZ5A 2E1YA 3CQXA 4GV6A 3WA0A 3KZBA 3EO3A 3MK6A 3OA9A 3MMVA 4U7BA 3OW2M 3AAPA 4JKEA 3DWLA 1VQ8N 2E88A 3BEXA 4MLEA 4BR5A 3GG4A 3TSPA 1VQ9N 1K9MO 1K8KB 1NTIA 2CH6A 3HBTA 3R3LA 3CETA 3LM9A 2V7ZA 3QB0A 1N8RO 1GLJO 3IMXA 4JAXA 2QI2A 3HM8A 4FL9A 1BOTO 1NGBA 4B9QA 1WUAA 2NRVA 4B1WB 1LCUA 4BRAA 5M1FA 3SAHA 3L4IA 5AZJA 1QQMA 4EAHD 3CCRN 2ZJQL 3CJAA 4K41A 3O9TA 1ESVA 2OANA 2NZTA 3O9SA 2PFUA 3CJBA 2WH5A 1NGDA 3C6AA 3F2KA 1ATRA 5BN8A 2FXUA 5CR4A 3U8XA 4FOIA 2QEXN 1C0GA 3EKUA 3O6WA 5C15A 4P7IA 4H0TB 3SMPA 3KK7A 1VQLN 4FVUA 3BF1A 4U67L 3HSCA 5AQLA 1E4GT 4Z94A 1RGIA 1SQKA 2RHKA 2OTJN 5AR0A 1U2VB 2FSNA 3D2FB 1EQYA 4H5NA 4WQ5A 5BN9A 1S72N 3D2EB 3KVGA 5JMVA 1EF1A 4DKWA 4OPHA 2HE7A 3OBWA 4FWQA 3RSEA 3UKRB 3G25A 3CC4N 1VAZA 3AU5A 2AEHA 1V4TA 2F7TA 1VQ6N 3DXKB 3O1BA 2E2OA 4FOEA 3CC7N 4AM6A 2NRXA 3WXIA 2P9IA 1E5WA 5C2DA 1KQSM 4BGBA 2GWKA 2ABDA 3IKMA 3D6RA 5AQGA 5ELZA 1GLEG 3Q7CA 1BDGA 3EN9A 1ZC6A 3ZX2A 4BGAA 4IJAA 4IXCA 5M1PA 3SLCA 4IOCL 4MLHA 1JCGA 3SAGA 2H3GX 2HBLA 5AFUH 2GWJA 2WUSA 4C23A 1MDUB 3WQTA 1RFQA 5AQXA 2A3ZA 2Q0RA 3ZX3A 4BRCA 2P9NA 4BRPA 1Z05A 3QFUA 2QWLA 3S41A 4CZIA 1D4XA 1HJOA 5TKYA 2COPA 4JK8A 4M7XA 3FZMA 4FO0A 1NGCA 1ZBSA 3J7ZO 2YCHA 4DQ8A 4M63C 1JCFA 3H6EA 5AFUA 5BRHA 1KC8O 3BINA 4MDAA 1VBGA 2ASOA 4WFAL 4NLCA 2ASPA 5KPTA 3SK3A 3ZX0A 2FF6A 5JLHA 1U6ZA 4WFBL 3GBTA 1T6CA 1NGJA 2RQ1A 3HZ6A 2UYTA 4YDUC 1ST7A 4ZRJA 2Q31A 4CZEA 4BVOA 3CCJN 3LDNA 4YOUA 3MWPA 4AM7A 1QVFM 1MWKA 2GTDA 2DPNA 5JVLA 1NLVA 2VGMA 2A41A 1YUWA 2P9NB 1VQPN 1BA1A 1JCEA 1HX1A 1T44A 4EHTA 3M5RA 1EO1A 3FR0A 3NVMA 4HTLA 3FLCO 4JD2B 1Y19B 1C0FA 3FZHA 3U9DA 1S3XA 2IVPA 3LDPA 4MO4A 5BREA 3JXUA 3WXJA 4CJ7A 5AQMA 3K9JA 2P9KB 1V4SA 3CCQN 1IJJA 1GLLO 2IIRA 2D2QA 2P9PB 4FWLA 3ZEUA 1QQOA 2E1ZA 3U4LA 3M1FA 4R79A 4CZMA 5GAEP 2YI1A 4BRQA 4F7GA 1T3VA 4IFEA 3DXMB 2QW9A 1K8KA 5E84A 2A40A 2FSKA 3H1VX 4QS7A 3KWIA 5ADXA 4ZRIA 3L6QA 1TUYA 4K42A 5AQZA 2P9LB 2CGJA 5LJWA 1Q86O 4QS9A 4IDHA 5F2RA 5B8HA 2D0PA 4BREA 2ITMA 3FP5A 3NVKA 1MK7B 3F9MA 3CCSN 1YITN 1XQSC 3TSUA 1YI2N 2YVCA 3MCPA 2AA4A 4B1ZA 1MIXA 2HSTA 5AZIB 1X3NA 4FSVA 3ZEUB 4BC2A 5C12A 3TSQA 4A57A 1GLCG 1U2VA 1KAZA 3D2FA 3CIPA 5BRDA 4ISGA 3I8BA 3VMFB 2HF3A 3D2EA 3R9PA 3IVFA 3QBXA 5AQYA 3TTDA 3UKRA 2LBBA 1QVGM 5KPZA 4FWSA 3VETA 3IUCA 3DXKA 3SBTA 3FGUA 4CZJA 1Q18A 5I9EB 1VQ4N 1IG8A 1H1VA 3O9RA 4H5TA 4I6MA 3WXMB 4BG8A 3VEZA 2J0JA 3H45C 3SAFA 2W40A 5HL7L 4FWRA 3LM2A 4BQLA 3CF5L 4KBOA 2FF3B 5F0XA 3A5NC 2D11A 3A5MC 3CCEN 1XC3A 1QZ6A 4OPAA 5KPRA 2J0MA 3VEOA 1NGFA 2IVOA 3MDQA 4JKCA 2QM1A 2YJEA 3HI0A 3C65A 4IO8A 4A61A 4BC5A 1X9JA 4IEEA 4DB3A 3U8ZA 1SGHA 3X23A 2Q97A 2ZWHA 3H46O 3LDQA 5AQWA 4EIAA 1W2BM 3M3ZA 4WFNL 1OKJA 2HMPA 3GL1A 4BRKA 2A6AA 4BRMA 3CCUN 1YXQA 3L0QA 2WFBA 4BR7A 4FPAA 3CMAN 4I6MB 1T6DA 2A5XA 5TKWA 3O1WA 3VGKA 3BP8A 4JKFA 2NRZA 4BVPA 3OBYA 4JKDA 3WXKA 4CD3A 2YHYA 3LDLA 1Q81O 1NBWA 2QWQA 3ATVA 4BR0A 1MWMA 1HB8A 4BRIA 4B1VA 1K8AO 4ZRKA 4KH5A 2AP1A 3Q7BA 4A5AA 1Q82O 1H4RA 4BQZA 2JWLA 2VYPA 1XUPO 2HRJA 3B8AX 3VF2A 3GOIA 4BRNA 4JN4A 4KH6A 3MN5A 3CPEA 3QBWA 4YDUA 4JD2A 1CZAN 1HKCA 2CQUA 3O08A 5AQHA 4J8FA 3C0BA 3CC2N 3E9LA 3BUZB 4KH4A 3PLAA 2P9KA 2CGKA 3ENHA 1BA0A 2J0KA 3O80A 2P9PA 5FPMA 5EY4A 5C2FA 4XEIA 1G99A 1SZ2A 3F5TA 3MX2A 4YL8A 1HLUA 4B1UB 4CZLA 2E2QA 1YHQN 3CCLN 3QICA 5M1KA 3DXMA 2P9UB 3GE1A 3H1QA 1JDEA 4JK7A 1TYQB 4HDOA 2V7YA 3CJ7A 4BRDA 2HF4A 4O8KA 1GLDG 2GEMA 4O5FA 5BPMA 4DHYA 3IDHA 4K25A 4PL8A 2BH1A 4FWPA 1DKGD 2P9LA 3AY9A 1WOQA 4QS8A 5H1SQ 2ZJPL 3UKUB 2Q36A 2AL6A 3GDQA 3HTVA 1GC6A 3E9OA 2HOEA 1NM1A 2CH5A 2YX6A 3MN9A 4YOWA 3VTHA 2OTLN 3VEVA 3WQUA 1VQON 3A5LC 5EXWA 3O9UA 1DEJA 1J6ZA 3I56N 5ADXH 1ZXOA 4CI6A 1LOTB 1M1KO 1TUUA 4EKUA 4YOTA 4HDQA 5AZIA 3ZYYX 5HOOA 4GVEA 3G9WA 3L4QA 1QHAA 4H0OA 4AF1A 2QWNA 3ULEB 4JEPA 5BPNA 3AARA 4PL7A 1R59O 2YJFA 5GIOA 3R1XA 3SJHA 4WF9L 3M6GA 4CZHA 4JK9A 4YOYA 5AQPA 3CMEN 3CJ1A 4H0PA 3T69A 2I1KA 4WQ4C 4JKAA 1NVLA 4IO9L 4MDBA 3MN6A 3VESA 4A59A 4A62A 1GLBG 3I55N 4NB4A 3H3NO 3WUHA 3W3DA 3MX5A 4JNEA 3G71N 5AQRA 4B1YB 2NRWA 3PIOL 2P9SB 1MA9B 5BPLA 3U7DA 3ZDTA 2NNWA 2Q2RA 5C0YA 4H0XB 2I1JA 2GUPA 2HBKA 3O8MA 1HUXA 1HB6A 3CJ9A 2ZPYA 4OO1J 1Q7YO 3FFKB 4BR4A 1YJ9N 4JKGB 3NMUA 1NGGA 3OHRA 2CGLA 2CB8A 2I7PA 2VGNA 3T7ZA 1BO5O 1NGIA 2BUPA 2Q0UA 4BRFA 3DLLL 3P39A 4CZKA 4BRHA 1QQNA 3DAWA 1NGEA 1RDWX 1SS6A 4IZ9A 3CXCM 1YJNN 5M1NA 4MO5A 2QWMA 3E66A 3WEEB 4F9OA 3SBGA 2FDQA 1Z6RA 1DT9A 4A2AA 1NJIO 1YVNA 3O5BA 4E1JA 5KQDA 3VPZA 3O4WA 3QMLA 4IOAL 1NGAA 3CI5A 3EE9A 5AQQA 3CJCA 3CCMN 2D10A 5BR9A 4L3QA 2V51B 3FLVA 3K9KA 1Y64A 2E8AA 1BG3A 2NRHA 3I33A 4NY0A 4BC3A 2QA4N 3E9PA 1VQMN 1S22A 2FLOA 3EL2A 1GC7A 4FWKA 5AQSA 4A5BA 2IVNA 3ZETB 5GAGP 2QWPA 2Q1NA 3MN7A 5AQOA 3R6MA 4M7YA 2QTDA 5M1QA 4IJNA 3P31A 3TTCA 4BROA 3TPQA 4CZGA 4JHDB 4NLBA 3MCAB 1KAXA 3CCVN 3CHWA 4BY9C 1DGKN 3TTFA 1DIKA 4FWOA 2R82A 3R8EA 4ILHA 1BUPA 4H0VB 3KHYA 2HBJA 3EPYA 4BC4A 5MLCQ 1VQKN 5JICA 5FPNA 4PHTX 4HWIA 1VQNN 4CYEA 3C7NB 5M1OA 4H5WA 5GADP 3VERA 1KXPA 2BTFA 3VEXA 1M90O 5AQUA 4G9ZA 2W41A 5KQ8A 5LJVA 3VGMA 3SMSA 1KC7A 1MIZB 3AGKA 3D7EO 4DXAB 3BF3A 3EZWA 4H5VA 4RCHA 4RWTA 2QWRA 2V52B 5AQVA 5DM6L 4EFHA 3UE5A 2P9UA 3WXLA 5GIPA 1YIJN 1TYQA 5AQKA 4ILGB 4EHUA 1ILYA 2KHOA 3AU4A 3TU5A 1GG3A 3A0IX 5C10A 3CPWM 2E20A 5AQNA 1KAYA 4FWNA 3UKUA 4TKNA 1YAGA 5FPEA 2NRRA 3QFPA 2NLXA 2KLAA 5AZJB 4GV3A 2YHWA 5CHIA 2QWOA 4GXBA 2FJ9A 3VEWA 3VF6A 2J4RA 4CZFA 4CD1A 3PZDA 2A42A 1P90A 5AQJA 4WQ5C 3G4SN 2FSJA 1E4FT 3ULEA 3LL3A 1VQ7N 1ISNA 2GELA 1KBLA 4UY8O 1ACAA 2X0SA 1GGOA 2VWBA 3J8AA 5DM7L 1HPMA 3A8YA 3G6EN 1K73O 4Y0WA 3A5OC 3UB5A 3FZLA 3P38A 3DJCA 2E2NA 5AQIA 4CBXA 2EMTA 4O8UA 3PVLA 3ATUA 3RSEB 3VGLA 3VENA 1W97L 3QDKA 2ZF5O 3W0LA 2RE2A 4A2BA 2P9SA 2NRTA 3H3OB 4GY2B 4WQ4A 3IFRA 2EWSA 2DIKA 5IJMA 5F1XA 4WYBA 4B1XB 1VQ5N 3FE1A 2P9IB 4LC9B 5LY3A 2D4WA 2ZJRL 5JVGL 4RTFD 2ZGZA 4H03B 4JKHA 3VTIA 4YOXA 4JKGA 2PAVA 1MK9B 4BRLA 5E26A 3EKSA 2WC9A 3FZFA 4BR2A 1BWFO 3JS6A 4YORA 1OVYA 4FWMA 3PIPL 1P8ZA 3VF4A 1X3MA 1GLFO 4H5RA 5AQFA 4BRGA 3HOSA 4H0YB 3VOVA 1NI2A 3ID6A 2F9WA 4K43A 4IOXA 4CBWA 1RDUA 1NWKA 3AGRA 3WEEA 1KD1O 3CQYA 3FZKA 2QXLA 3CD6N 3HRGA 4PKIA 3VEYA 3CERA 1ATSA 3EE8A 2EMSA 4FPBA 2HBMA 5JLFA 1NGHA 5EX5A 4GV9A 4C1NK 1YJWN 1BU6O 2D1KA 2D0OA 2PBDA 3C6HA 3U9ZA 1HKBA 2I7NA 3RVCA 4PKGA 3HOTA 2F9TA 1SAZA 3KWGA 2GX9A 5GAHP 4DCHA 4JKBA 3ENOA 4IWVA 3ZETA 5BRFA 4IEIA 1J19A 4ISEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK9 A;  4JK7 A;  4ILG B;  4JKA A;  4JKC A;  4ILH A;  3E66 A;  3ENB A;  4ILJ A;  3SBG A;  4JK8 A;  3SBT A;  3E9O A;  3E9L A;  3E9P A;  4JKH A;  4JKG A;  4JKB A;  4JKF A;  4JKE A;  4JKG B;  4JKD A; 
#chains in the Genus database with same CATH topology
 4BR9 A;  3LDO A;  3QO9 A;  5JVH L;  1VSD A;  4B9U A;  2YHA A;  1HBK A;  1ATN A;  3AAQ A;  5FRN A;  3N4Q A;  3J7A P;  3MWT A;  2I5J A;  3ID8 A;  5EVZ A;  4YOV A;  4TSX A;  3E1Y A;  3WT0 A;  1DLO A;  5HP1 A;  1JJ2 M;  4ELT A;  4XH5 A;  5AQT A;  3QIJ A;  4C1N I;  3HK2 A;  5CE3 A;  4DV4 K;  2VQE K;  4CJV A;  1HNV A;  4BG9 A;  4NO7 A;  1GLA G;  3PV8 A;  4J2B A;  2JWK A;  2YHX A;  4ISF A;  2E1Y A;  2O8B B;  3MMV A;  3OW2 M;  3BEX A;  4JI1 K;  1VQ9 N;  1K8K B;  1NTI A;  2CH6 A;  4AHU A;  3R3L A;  1JLG A;  4DUZ K;  1GLJ O;  4CJ3 A;  1EO1 A;  1NGB A;  4B9Q A;  1LCU A;  4JI5 K;  4E19 A;  5AZJ A;  2Z1J A;  1A5W A;  2UXC K;  3CJA A;  4K41 A;  4B9M A;  3DOK A;  3K0S A;  3PSI A;  4Y1C A;  3O9S A;  3SQ1 A;  2PFU A;  3CJB A;  2KZZ A;  3U8X A;  4B3O A;  3EKU A;  4H0T B;  4NYF A;  4W5O A;  1RBS A;  4U67 L;  4DTS A;  5HRO A;  3HP9 A;  3BDP A;  1Y97 A;  1SQK A;  2RHK A;  3HVR A;  3OYM A;  2RF2 A;  5AJ3 K;  4Z4F A;  5IWA K;  4H5N A;  1EQY A;  3DOL A;  3KVG A;  3AVF A;  4FJK A;  4CJW A;  4DMN A;  3RSE A;  3SV3 A;  1NK9 A;  2OZS A;  1VAZ A;  4DV3 K;  3AU5 A;  4CGJ A;  1ZBH A;  2GBZ A;  1VQ6 N;  2B6A A;  3EEQ A;  2E2O A;  3VQE A;  1VSM A;  1Q8I A;  1OH7 A;  2NRX A;  3WXI A;  2VG6 A;  3L8B A;  1KQS M;  2ABD A;  3OS2 A;  4AHC A;  4QOZ B;  1TGO A;  4AIL C;  5ELZ A;  3Q7C A;  3SPY A;  2E4L A;  3PSF A;  5CY4 A;  4IXC A;  3NF6 A;  4DFK A;  5DMR A;  5M1P A;  3SLC A;  3SAG A;  4CJF A;  4K8Z A;  2GWJ A;  3QET A;  2YKN A;  5AQX A;  3QFU A;  1JXE A;  1D4X A;  1S9G A;  1VRU A;  1NJZ A;  3TAN A;  2COP A;  3SUP A;  4HVJ A;  4CHN A;  4BDP A;  5AFU A;  3NF8 A;  3ZSV A;  4WFA L;  4LF7 K;  4NCB A;  3HZ6 A;  1T8E A;  3KLE A;  1BIS A;  4BVO A;  3DLR A;  3LDN A;  3MWP A;  1EKE A;  3HPO A;  2DPN A;  5JVL A;  4CF1 A;  1OH6 A;  1BA1 A;  5SZT A;  4F2R A;  4JLH A;  2PYJ A;  2F8S A;  2HHU A;  3THX B;  3HST B;  4CJ7 A;  4AHV A;  2P9P B;  2WTU A;  1VRT A;  4FW2 A;  4KAZ A;  2YI1 A;  4IFE A;  4DWI A;  5E84 A;  3DYA A;  4QS7 A;  4ZRI A;  3LP3 A;  3K59 A;  4DQR A;  4QS9 A;  3VQA A;  2D0P A;  3FP5 A;  3ZSO A;  4E1M A;  3NVK A;  3L3U A;  3HPG A;  3VQ6 A;  4CK3 A;  3F9M A;  3L2W A;  3BY5 A;  2E6M A;  1YI2 N;  4M3U A;  5J1E A;  3UIQ A;  5C12 A;  1EET A;  2YHB A;  1GLC G;  1U2V A;  4PQU A;  3D2F A;  4ISG A;  2PYL A;  4B3R K;  1X1P A;  5KGX A;  3TTD A;  1WSI A;  4GKJ K;  4CFB A;  1IBK K;  1OVQ A;  4CZJ A;  1BI4 A;  4DTO A;  2DFE A;  3WXM B;  4N47 A;  5I42 A;  5HLF A;  2W40 A;  1MU2 A;  3LM2 A;  3HP6 A;  3CF5 L;  1JLE A;  4KBO A;  3T1Y K;  4PWD A;  4HUF A;  2O8E A;  5KPR A;  3DLE A;  1NGF A;  4DR5 K;  4JKC A;  4A61 A;  3C65 A;  3G10 A;  3OYC A;  1X9J A;  1RT2 A;  3H08 A;  3WNG A;  3ZSR A;  2IAJ A;  1SGH A;  4OKE A;  4WFN L;  4DUY K;  3AA3 A;  1BIZ A;  3L0Q A;  2WFB A;  4DSE A;  1CZB A;  3LP0 A;  3IG1 A;  1IBM K;  4V19 S;  1W9H A;  5KRT A;  3C6U A;  3ZSX A;  1HMV A;  1NK4 A;  4M42 A;  4JKF A;  3DMJ A;  1L3V A;  4JKD A;  1TVR A;  5FLX O;  1Q81 O;  1NBW A;  3ATV A;  4BR0 A;  3V9U A;  4BRI A;  4FLV A;  3AA2 A;  3B8A X;  3VF2 A;  3VQ7 A;  3J80 O;  4YDU A;  3SCX A;  1CZA N;  2XRI A;  4IG3 A;  3C0B A;  3PLA A;  3O80 A;  1IKX A;  3KLG A;  4DV6 K;  1SZ2 A;  1RNH A;  4B1U B;  4YL8 A;  1HLU A;  1NK6 A;  4CZL A;  3DXM A;  3KIO A;  1JDE A;  1WAJ A;  1TYQ B;  5J2N A;  1B92 A;  4O8K A;  5D3G A;  2GEM A;  4KRE A;  1L3U A;  3IDH A;  3VQ8 A;  4DTN A;  4FWP A;  3AY9 A;  4DR3 K;  2ZJP L;  4DTU A;  4F3O A;  1JLQ A;  1SL1 A;  3GDQ A;  3HTV A;  4RW4 A;  3B6O A;  2HOE A;  2OTL N;  4CEA A;  4GMJ B;  4EP5 A;  5ADX H;  3KK3 A;  4C8N A;  4YNQ A;  5AZI A;  2O8F A;  3ZYY X;  3TAF A;  1QHA A;  4AF1 A;  4PL7 A;  3OJU A;  2YJF A;  3R1X A;  2HHX A;  4CZH A;  4GKK K;  4YOY A;  5AQP A;  3T69 A;  5DK5 A;  1ZBL A;  4FJ5 A;  4FZZ A;  4KKO A;  4KV8 A;  1B9D A;  2ATQ A;  3D0P A;  2OCE A;  3THW A;  2X6N A;  3ZDT A;  1SV5 A;  5C0Y A;  2GUP A;  2HBK A;  3B6P A;  1HUX A;  3O8M A;  3VQ4 A;  1HB6 A;  3CJ9 A;  2ZPY A;  4CJK A;  2Q3S A;  1UA0 A;  1NGG A;  3OHR A;  3HPH A;  3T7Z A;  4BRF A;  1NGI A;  3ZSW A;  3DLL L;  4BRH A;  1QQN A;  1WSG A;  1J5E K;  5M1N A;  4CEF A;  1Z6R A;  3SQ4 A;  2D0C A;  3O5B A;  5JS1 A;  3VPZ A;  3THW B;  3TAR A;  3CI5 A;  5AQQ A;  3T1H K;  3V9S A;  2V51 B;  3DLH A;  2NRH A;  1XMO K;  4NY0 A;  1S1W A;  3E9P A;  1XI1 A;  2FLO A;  4A5B A;  2G8H A;  3ZET B;  2HHQ A;  3MN7 A;  2ETJ A;  3P31 A;  3TPQ A;  2R82 A;  3KKR A;  1TV6 A;  4KI4 A;  5JIC A;  5FPN A;  1J5O A;  1VQN N;  3C7N B;  4H5W A;  3ZT0 A;  3RR7 A;  3NE6 A;  4FLY A;  3OS1 A;  5LJV A;  3OYB A;  3SMS A;  4DXA B;  1KLN A;  4LH4 A;  2QK9 A;  1EP4 A;  4EFH A;  3WXL A;  2P9U A;  2Y1J A;  3AO2 A;  3JYT A;  1L3T A;  5HRS A;  5CZ1 A;  4QAG A;  2HND A;  3AVH A;  4YFU A;  3CPW M;  4JI3 K;  1JL2 A;  5FPE A;  3ALY A;  4GV3 A;  2YHW A;  2QKB A;  4GXB A;  2FJ9 A;  3VEW A;  3VF6 A;  2J4R A;  1REV A;  4O4G A;  1NK5 A;  4CJQ A;  4CEC A;  4FM2 A;  4KPY A;  1VQ7 N;  3WNF A;  2HHT A;  3V1O A;  3QER A;  1LWE A;  4AH9 A;  1HPM A;  4CEZ A;  4BWJ A;  1K73 O;  4LFC K;  3UB5 A;  3FZL A;  3NGY A;  3DJC A;  3AVC A;  2F4V K;  4JYA K;  2EMT A;  4O8U A;  2JLE A;  2B4J A;  3VEN A;  2D0A A;  3AVL A;  2NRT A;  1D9F A;  4Z4E A;  1VQ5 N;  2ZJR L;  4LC9 B;  5LY3 A;  1WAF A;  4JKH A;  2HHS A;  1N36 K;  1JKH A;  4BR2 A;  2YV0 X;  4FWM A;  1P8Z A;  3HOS A;  4H0Y B;  3VOV A;  4DS4 A;  4K43 A;  4CBW A;  4CJS A;  3TR8 A;  3VEY A;  4FCY A;  2EMS A;  1RTD A;  4Z4C A;  3BZC A;  4CGI A;  3O3G A;  3RVC A;  4PKG A;  4JI8 K;  1NMN A;  3RMC A;  2QXF A;  4B8A B;  4CF2 A;  5GAH P;  4DCH A;  1UWB A;  3DM2 A;  3NDK A;  4IWV A;  4PA1 A;  1L5U A;  1LW2 A;  4CF9 A;  1RIL A;  4JHD A;  1LV5 A;  3IRX A;  4WCE L;  1VBH A;  1CXU A;  4GW6 A;  2O4G A;  2VWJ A;  1U47 A;  5EOY A;  3V6D A;  3N4P A;  1NMD A;  2ASM A;  1HKG A;  3I8D A;  2WBN A;  5GIN A;  4CGF A;  4XH4 A;  2OYQ A;  2KKZ A;  4OLB A;  5J2M A;  3HO1 A;  2X78 A;  3EO3 A;  4B9L A;  4OX9 K;  4B3M K;  3OA9 A;  1GOC A;  3CFO A;  1WN7 A;  3CG7 A;  1VQ8 N;  3QEI A;  2E88 A;  1NK8 A;  4MLE A;  3TSP A;  3HBT A;  3CET A;  3LM9 A;  1N8R O;  3HM8 A;  1WUA A;  3DLK A;  3EYZ A;  1QQM A;  4EAH D;  3CCR N;  2ZJQ L;  2KW4 A;  3AO5 A;  3O9T A;  1ESV A;  2OAN A;  1TAQ A;  5BN8 A;  1U49 A;  4L8R B;  2FBT A;  4FOI A;  3O6W A;  5C15 A;  3SUQ A;  4QCL A;  3KK7 A;  4FYD A;  3BF1 A;  1FKO A;  4LY7 A;  3HSC A;  4Z94 A;  5AR0 A;  2FSN A;  4WQ5 A;  3D2E B;  2XHB A;  5JMV A;  5KTQ A;  2HE7 A;  3OBW A;  4FWQ A;  1CLQ A;  4O55 A;  1V4T A;  2F7T A;  4YY3 K;  4FZY A;  4AM6 A;  4DV5 K;  1E5W A;  5C2D A;  4H8K A;  4BGB A;  3NBP A;  2GWK A;  1NNE A;  1QE1 A;  3IS9 A;  3OYE A;  1ZC6 A;  4IJA A;  3DLB A;  2PY5 A;  4MLH A;  1JCG A;  2O8C B;  5AFU H;  1RFQ A;  2OZM A;  4EP4 A;  3ZX3 A;  2P9N A;  1Z05 A;  1LAW A;  5HRR A;  1TL3 A;  4RW9 A;  1BGX T;  4CZI A;  1HJO A;  1NJY A;  4JK8 A;  4M7X A;  4HUE A;  3FZM A;  4FO0 A;  3OYN A;  4DQ8 A;  4ZTJ A;  2HMI A;  4B3S K;  4N56 A;  1T05 A;  4NLC A;  1K6Y A;  2ASP A;  5KPT A;  3SK3 A;  2FF6 A;  3VQB A;  4WFB L;  3GBT A;  5HRP A;  3VQD A;  3LZI A;  4KFB A;  4YOU A;  4AM7 A;  3HJF A;  3L2U A;  3M8Q A;  3LAN A;  1NLV A;  2A41 A;  1QS4 A;  2P9N B;  4EHT A;  3M5R A;  3BZK A;  3FLC O;  4HTL A;  1C0U A;  3LDP A;  4B8C A;  4I9L A;  5AQM A;  1GLL O;  2D2Q A;  4LFB K;  3ZEU A;  2E1Z A;  1HYV A;  3V1Q A;  3M1F A;  4R79 A;  1TKZ A;  3ZCM A;  4M45 A;  4BRQ A;  1T3V A;  4DFP A;  3V81 A;  2QW9 A;  3MXI A;  2IOC A;  3CFP A;  1K8K A;  3VA3 A;  3H1V X;  4DQP A;  4HCC A;  4C8K A;  3KWI A;  4O5B A;  1SL0 A;  1J53 A;  3U3Y A;  3L6Q A;  1TUY A;  5AQZ A;  4W5T A;  1FW6 A;  4IDH A;  5F2R A;  1SKW A;  4B9T A;  5SWM A;  1S1U A;  4Y1D A;  1U48 A;  1YIT N;  3PUF A;  1XQS C;  4FM1 A;  1GOB A;  2YVC A;  3MCP A;  2AA4 A;  4DS5 A;  4FSV A;  3ZEU B;  1XNR K;  1RDB A;  4DFJ A;  4A57 A;  5BRD A;  3I8B A;  3KK2 A;  4DV7 K;  1QQC A;  4IKF A;  5KPZ A;  4FWS A;  3IUC A;  2KFN A;  3FGU A;  1Q18 A;  5I9E B;  1VQ4 N;  3T1A A;  1EWQ A;  3DRS A;  1BCO A;  1YT3 A;  4E7I A;  4JI7 K;  3E01 A;  1NOZ A;  3PO4 A;  1N33 K;  3H45 C;  1IG9 A;  3EZ5 A;  3TAQ A;  2IS3 A;  4CEE A;  3ISN C;  3SQ0 A;  3AVM A;  3CCE N;  3ZT2 A;  4OPA A;  3RTV A;  3VEO A;  3MDQ A;  1A5X A;  1BCM A;  4DTX A;  3LPU A;  1BHL A;  2ITG A;  4DB3 A;  3U8Z A;  1RBR A;  2AJQ A;  2Q97 A;  2ZWH A;  3H46 O;  4EIA A;  1W2B M;  1HNX K;  1ASW A;  2G8W A;  3GL1 A;  1WB9 A;  5A2Q O;  1BQN A;  4BRM A;  3CCU N;  4F3T A;  4MFB A;  4NXN K;  4FPA A;  1CXQ A;  5TKW A;  3BP8 A;  1LWF A;  3RMB A;  1KSP A;  4BVP A;  3AO4 A;  4G1Q A;  3LDL A;  1U4B A;  2D0B A;  1MWM A;  1O1W A;  1HB8 A;  3V4I A;  3OS0 A;  4DF8 A;  5FRM A;  2AP1 A;  4A5A A;  1Q82 O;  4BQZ A;  1W7A A;  2HRJ A;  4NYN A;  1HYZ A;  4PUO A;  3CPE A;  3O08 A;  2CQU A;  3THX A;  3OYH A;  3E9L A;  1JXB A;  4KH4 A;  3TWH A;  2DFF A;  2CGK A;  1BA0 A;  2J0K A;  2P9P A;  4XEI A;  3K5M A;  1OH5 A;  1YHQ N;  3P5J A;  3CCL N;  5M1K A;  4F4K A;  4BE2 A;  3H1Q A;  3CJ7 A;  4HDO A;  3DRP A;  5BPM A;  1GLD G;  4O5F A;  1QTM A;  4K25 A;  1HRH A;  4J2E A;  4I2P A;  4CW7 B;  3M8S A;  1GC6 A;  1NJX A;  3S9H A;  2YX6 A;  2CH5 A;  3A5L C;  4GVM A;  5EXW A;  1RT4 A;  3VQC A;  1J6Z A;  1LOT B;  1M1K O;  4EKU A;  4HDQ A;  4H0O A;  1RT7 A;  3OYG A;  5BPN A;  5K14 A;  5GIO A;  3SJH A;  1JLC A;  4CEQ A;  2PZS A;  3CJ1 A;  4H0P A;  2I1K A;  4WQ4 C;  4IO9 L;  4MDB A;  1R0A A;  2HHW A;  4A62 A;  3C6T A;  4DQQ A;  3LWL A;  3MXM A;  4B1Y B;  2P9S B;  1MA9 B;  5BPL A;  3U7D A;  2Q2R A;  4I9Q A;  4H0X B;  2I1J A;  3T3F A;  2FBY A;  4OO1 J;  4CGD A;  4JI4 K;  3THV A;  3FFK B;  1YJ9 N;  4KHY A;  2CGL A;  2CB8 A;  4DLG A;  1IKY A;  5KRS A;  3P39 A;  3J7Y P;  3QNO A;  4CJ4 A;  1SS6 A;  4IZ9 A;  2BGG A;  3WEE B;  2XY7 A;  4F9O A;  3SBG A;  2IC3 A;  2IDO A;  1NJI O;  4E1J A;  1HYS A;  4LF5 K;  3OYL A;  3O4W A;  3QML A;  3EE9 A;  3CJC A;  1XHX A;  4OKK A;  4BC3 A;  2E5L K;  2E8A A;  2QA4 N;  4LF4 K;  1B9F A;  3OJS A;  1S22 A;  4BE1 A;  4KHU A;  5AQS A;  3KD5 E;  2IVN A;  5M1Q A;  4X65 K;  2DY4 A;  2QTD A;  4DLE A;  1D8Y A;  4DTM A;  1DGK N;  1HQE A;  1QSL A;  4DSL A;  4FXD A;  3KHY A;  2HBJ A;  4BC4 A;  5MLC Q;  3L2Q A;  2BDP A;  3PO5 A;  5HRN A;  3OYF A;  5M1O A;  4E89 A;  5GAD P;  3VER A;  2BTF A;  4G9Z A;  1C1B A;  5KQ8 A;  1DTQ A;  4IDK A;  3VQ9 A;  4FLX A;  2HVH A;  1QSS A;  3BF3 A;  4CES A;  1I39 A;  5AQV A;  1TYQ A;  3LWM A;  4FK2 A;  4ILG B;  1ILY A;  3U3G A;  3ASM A;  3A0I X;  4B08 A;  5C10 A;  2GUI A;  1YTA A;  4FJ7 A;  4LF8 K;  4TKN A;  2NRR A;  5CHI A;  2QWO A;  3AVK A;  4LFA K;  4CD1 A;  3U6F A;  5AQJ A;  5C42 A;  3RWU A;  2FSJ A;  4O0J A;  1ISN A;  1RBV A;  1T03 A;  2VWB A;  4X66 K;  3G6E N;  4Y0W A;  2D5R A;  3A5O C;  3LAL A;  3P38 A;  1RT6 A;  2E2N A;  2WOM A;  4FJM A;  2X74 A;  3DLG A;  4CCH A;  1W97 L;  4DSF A;  3W0L A;  2RE2 A;  1S1V A;  4B9S A;  1YVU A;  4DV2 K;  2DIK A;  5IJM A;  5F1X A;  1YTU A;  2P9I B;  2D4W A;  3MEC A;  1NK7 A;  3VTI A;  3NFA A;  4H03 B;  1VSE A;  5E41 A;  4BRL A;  1MK9 B;  3FZF A;  3JS6 A;  3LZJ A;  4IG0 A;  4DU3 A;  4AHS A;  3VF4 A;  1X3M A;  1GLF O;  4BRG A;  2P5G A;  4N76 A;  1QSY A;  2HVI A;  1NI2 A;  1X9S A;  4E7J A;  3V1R A;  1KVA A;  3HRG A;  3CER A;  3EE8 A;  4JS5 A;  1IV0 A;  5JLF A;  5EX5 A;  1BU6 O;  2D1K A;  1WBD A;  1WSF A;  4WE1 A;  3C95 A;  4J2A A;  3SUO A;  3TAG A;  4HHT A;  2GX9 A;  1TKD A;  4JKB A;  1RTI A;  3ZET A;  4IEI A;  4ISE A;  3CYM A;  4FJJ A;  2VCP A;  5EU7 A;  3WNH A;  1HPZ A;  3VQ5 A;  4H4M A;  4GNI A;  4B9V A;  1XHZ A;  1O13 A;  4DR2 K;  4FK0 A;  3C7N A;  3P4I A;  4ZTF A;  4KO0 A;  1HQU A;  3MED A;  4O0I A;  4CBU A;  3WA0 A;  3KZB A;  4CIG A;  4U7B A;  1WBB A;  3AAP A;  4ID5 A;  4HTU A;  1K9M O;  1RBU A;  2V7Z A;  2G8I A;  3IMX A;  4JAX A;  4FL9 A;  4BRA A;  3L4I A;  3OTO K;  1TL1 A;  2NZT A;  2WH5 A;  1NGD A;  1C0G A;  3NF7 A;  4I2Q A;  1S9E A;  3SMP A;  5AQL A;  1NKE A;  5C25 A;  2OTJ N;  2IGI A;  1S72 N;  4DKW A;  4OPH A;  3UKR B;  4IBN A;  3G25 A;  4E7H A;  4E7K A;  4RW7 A;  3DXK B;  3HM9 A;  3CC7 N;  2KFZ A;  3VQP A;  1KFS A;  3ZSZ A;  4DU1 A;  2YNF A;  4DV0 K;  2G8F A;  3IKM A;  3D6R A;  1KLM A;  1GLE G;  1BDG A;  3AV9 A;  3EN9 A;  5LMN K;  4K0K K;  4DR4 K;  4IOC L;  1A5V A;  4AHT A;  1F21 A;  2WUS A;  4C23 A;  1MDU B;  2Q0R A;  3D45 A;  4BRP A;  1D5A A;  2QWL A;  1C1A A;  3S41 A;  2DTU A;  3QLH A;  3ITH A;  4E3S A;  2YCH A;  3AO3 A;  3H6E A;  1C1C A;  4MDA A;  1VBG A;  3KJV A;  2QKK A;  2ASO A;  4H4O A;  4DF4 A;  3ZX0 A;  1U6Z A;  5BR8 K;  1ZBF A;  2NUB A;  2ZQB A;  2RQ1 A;  5I3U A;  4YDU C;  2HNZ A;  3WNE A;  4ZRJ A;  4CZE A;  4CJ5 A;  4FLT A;  1TK0 A;  2GTD A;  2VGM A;  4E0D A;  1YUW A;  1VQP N;  1JCE A;  1HX1 A;  1T44 A;  3FR0 A;  3LAM A;  4BAC A;  4JD2 B;  1Y19 B;  1C0F A;  1S3X A;  2IVP A;  4R5P A;  3JXU A;  4M3W A;  3WXJ A;  4HCB A;  3K9J A;  2P9K B;  2IIR A;  2Z1H A;  3U4L A;  4KHP K;  5FDL A;  4F7G A;  4W5N A;  2FSK A;  5ADX A;  3V9X A;  2BE2 A;  2DFH A;  1RDA A;  2P9L B;  5LJW A;  5B8H A;  4BRE A;  2ITM A;  3OYJ A;  4FZX C;  2Z1G A;  1MK7 B;  1NKB A;  3HYF A;  5CZ2 A;  4EZ9 A;  3TSU A;  5LL6 Z;  1X3N A;  4CFC A;  3LP2 A;  2R7Y A;  1KAZ A;  3VN5 A;  3CIP A;  1GOA A;  4O44 A;  3D2E A;  3NHG A;  3QBX A;  2E6L A;  1ZYQ A;  2LBB A;  1QVG M;  3VET A;  4YHH K;  4F2S A;  1J54 A;  4H5T A;  1TKT A;  4BG8 A;  3AO1 A;  1TKX A;  3VEZ A;  2J0J A;  4FWR A;  1N34 K;  3NGZ A;  3M8R A;  2RKI A;  3TAP A;  2O8C A;  3SUN A;  1IO2 A;  1XC3 A;  1QZ6 A;  4IO8 A;  4BC5 A;  4FK4 A;  2XO7 A;  2XY5 A;  3PX4 A;  3X23 A;  3LDQ A;  1ZBI A;  3M3Z A;  2HMP A;  2A6A A;  4OKJ A;  2G8V A;  4DTR A;  1EX4 A;  2GV9 A;  3CMA N;  1NKC A;  2A5X A;  3AVG A;  2NRZ A;  3TAE A;  3OBY A;  1S6P A;  3I0R A;  3OYA A;  2O8D B;  5FRO A;  4M3T A;  3K5O A;  2B5J A;  3LDS A;  4FJ8 A;  4ZRK A;  3Q7B A;  1H4R A;  4B9N A;  2JWL A;  4LF9 K;  3GOI A;  4JN4 A;  2VWK A;  3QBW A;  4KH6 A;  4CHQ A;  2HHV A;  1XNQ K;  1NOY A;  4J8F A;  3CC2 N;  3BUZ B;  1U45 A;  2OPR A;  5FPM A;  1VSF A;  3MX2 A;  2E2Q A;  1WLJ A;  3QIC A;  1ITG A;  1FKP A;  3GE1 A;  1RT1 A;  2ZD1 A;  3SYZ A;  1RT5 A;  1DKG D;  4LSN A;  2W6L A;  4JI6 K;  1LWC A;  1JLF A;  2Q36 A;  3UKU B;  4CF8 A;  3PX0 A;  4CK2 A;  4ID1 A;  2AL6 A;  4MQ3 A;  3C94 A;  1NM1 A;  3MN9 A;  3WQU A;  2OA8 A;  4CJE A;  1VQO N;  3O9U A;  1DEJ A;  3I56 N;  3KTQ A;  1I94 K;  4LD0 A;  1TUU A;  1BQM A;  1XMQ K;  1Q7Y O;  3QNN A;  2QWN A;  3ULE B;  4JEP A;  1R59 O;  4WF9 L;  3O4Q A;  3M6G A;  3CME N;  4JK9 A;  1RDC A;  3KLH A;  3THY A;  1NVL A;  4OJR A;  1E3M A;  3VES A;  3MN6 A;  2ZM6 K;  4DQS A;  3I55 N;  3S3N A;  5C24 A;  3WUH A;  3W3D A;  3MX5 A;  4JNE A;  3G71 N;  1NG9 A;  5AQR A;  5T7B A;  2NRW A;  3PIO L;  1NJW A;  1NU0 A;  1UAX A;  3K5N A;  1G15 A;  3DRR A;  4JKG B;  3AVJ A;  3NMU A;  2I7P A;  2VGN A;  3HVT A;  2F96 A;  1BO5 O;  2BUP A;  3NH1 A;  4W5Q A;  3RRH A;  3DAW A;  3KD1 E;  1RDW X;  3THY B;  1RTJ A;  3CXC M;  3ZSQ A;  1YJN N;  3E66 A;  4CHP A;  2FDQ A;  4A2A A;  1IKW A;  1YVN A;  5KQD A;  2HNY A;  1HNW K;  1NGA A;  2D10 A;  5BR9 A;  4L3Q A;  3FLV A;  3KK1 A;  3I33 A;  1BG3 A;  1XC9 A;  1VQM N;  3EL2 A;  4DSJ A;  3I0S A;  2QWP A;  2Q1N A;  3TTC A;  4CZG A;  2WON A;  4IJN A;  5KI6 A;  3MCA B;  1L3S A;  1KAX A;  3CCV N;  3CHW A;  3IAY A;  4KI6 A;  4FJH A;  3R8E A;  1BUP A;  3OVN A;  1QHT A;  1VQK N;  3T19 A;  2LSN A;  4PHT X;  4CHZ A;  2BAN A;  1C6V A;  3O3H A;  4B3T K;  3VEX A;  3OY9 A;  1M90 O;  2W41 A;  3SJJ A;  1S6Q A;  1KC7 A;  3AGK A;  4RCH A;  5J2Q A;  4RWT A;  2QWR A;  2V52 B;  5DM6 L;  3UE5 A;  5GIP A;  1YIJ N;  5AQK A;  4EHU A;  4FJI A;  1DTT A;  2KHO A;  1W0H A;  3TU5 A;  3QEV A;  1GG3 A;  5AQN A;  1KAY A;  4FWN A;  3CQ8 A;  3QFP A;  2NLX A;  5AZJ B;  3ULD A;  3CM6 A;  2UU9 K;  1SUQ A;  4CZF A;  3AVA A;  3PZD A;  1TK8 A;  1P90 A;  1IKV A;  2W42 A;  4WQ5 C;  3G4S N;  1E4F T;  4KB1 A;  4HUG A;  3LL3 A;  4OLA A;  2X0S A;  1GGO A;  3J8A A;  3A8Y A;  3J81 O;  1SL2 A;  5AQI A;  3RSE B;  4DG1 A;  3QDK A;  2ZF5 O;  3AVB A;  4A2B A;  2P9S A;  4RW6 A;  4GY2 B;  4CHO A;  3CFR A;  2EWS A;  4B1X B;  1NK0 A;  1Z25 A;  2G8K A;  4M41 A;  3ZT3 A;  4RTF D;  2ZGZ A;  4AQY K;  3CM5 A;  4YOX A;  2WC9 A;  1BWF O;  3QIO A;  1KTQ A;  1OVY A;  4N41 A;  2VQF K;  1JL1 A;  3ID6 A;  3L2V A;  2F9W A;  4IOX A;  4KHQ A;  1RDU A;  1SKR A;  3WEE A;  2VG7 A;  4CED A;  3FZK A;  3CD6 N;  2EX3 A;  1ATS A;  4FPB A;  2HBM A;  4IFY A;  1NGH A;  1HNZ K;  1VSJ A;  1YJW N;  2D0O A;  4NXM K;  4FLW A;  3U9Z A;  4FW1 A;  3KWG A;  1UOC A;  2RPI A;  3RR8 A;  3ENO A;  1S1T A;  3L2R A;  2ZGY A;  4FLU A;  3K58 A;  3RRG A;  3FFI A;  1FXX A;  4CJL A;  1Q9X A;  4ELU A;  3NH2 A;  3ZLJ A;  2UUA K;  3O9Q A;  1WSH A;  1KVB A;  1FJG K;  3ENB A;  4ILJ A;  1YF5 L;  3SNN A;  2E2P A;  2UUC K;  4XH1 A;  4BWM A;  2YNI A;  1VSK A;  5FPD A;  4DFM A;  4PKH A;  1QZ5 A;  3CQX A;  4GV6 A;  1HR0 K;  3MK6 A;  1Q9Y A;  3TI0 A;  4OGE A;  4JKE A;  2FBX A;  3HL8 A;  3DWL A;  3VA0 A;  3S3O A;  5IT9 O;  4BR5 A;  3GG4 A;  4CF0 A;  4JRQ A;  3QB0 A;  2QI2 A;  1BOT O;  4B1W B;  2NRV A;  5M1F A;  3SAH A;  3HXM A;  1U04 A;  4CEB A;  4C8L A;  1KCF A;  4ZHR A;  4K8X A;  1FK9 A;  3C6A A;  3F2K A;  1ATR A;  1X9W A;  2FXU A;  5CR4 A;  2QEX N;  2FBV A;  4P7I A;  2OPP A;  1BL3 A;  2VG5 A;  1VQL N;  4FVU A;  3V9W A;  1E4G T;  1RGI A;  1U2V B;  4CE9 A;  3D2F B;  5BN9 A;  1EF1 A;  4KHS A;  3MAQ A;  3CC4 N;  4C8M A;  2P1J A;  2AEH A;  2OPS A;  1TK5 A;  3O1B A;  4FOE A;  1BI4 B;  2EHG A;  3ZT1 A;  2P9I A;  3SV4 A;  1C0T A;  3AA4 A;  4LF6 K;  5AQG A;  4X62 K;  1WNS A;  3ZX2 A;  4BGA A;  4CJU A;  1KRP A;  4FM0 A;  2H3G X;  2HBL A;  4LSL A;  4C8O A;  3WQT A;  2O8E B;  2A3Z A;  4BRC A;  4DTP A;  3O4N A;  5TKY A;  3ZT4 A;  4OVL A;  4KB0 A;  1NGC A;  1ZBS A;  3J7Z O;  3G0Z A;  4M63 C;  1JCF A;  4FVM A;  1KC8 O;  5BRH A;  3BIN A;  2Z1I A;  4FJN A;  4NCG A;  4JI0 K;  5JLH A;  2KQ2 A;  4CJR A;  1T6C A;  1NGJ A;  3OYD A;  2UYT A;  3RMD A;  1ST7 A;  2Q31 A;  3CCJ N;  4CFD A;  3TAM A;  3SQ2 A;  5CYQ A;  4E7L A;  2KZM A;  1QVF M;  1MWK A;  2JGU A;  3NVM A;  3K57 A;  1N32 K;  3FZH A;  3U9D A;  4CIF A;  4OPJ A;  4MO4 A;  5BRE A;  3F9K A;  4Q5V A;  1V4S A;  3CCQ N;  1IJJ A;  4FWL A;  3MEE A;  1QQO A;  4CIE A;  4CZM A;  5GAE P;  1ZBU A;  3DXM B;  1BIU A;  1LW0 A;  3DI6 A;  2A40 A;  2XY6 A;  4K42 A;  1UA1 A;  1HJR A;  5KGW A;  2CGJ A;  1Q86 O;  2P5O A;  1IBL K;  4CJT A;  3QEP A;  3CCS N;  4B1Z A;  1MIX A;  2HST A;  5AZI B;  2O8F B;  4BC2 A;  3TSQ A;  2HW3 A;  3VMF B;  2HF3 A;  4CGH A;  5HBM A;  3R9P A;  3IVF A;  5AQY A;  3EY1 A;  4KTQ A;  4RG8 A;  3UKR A;  3LAK A;  3DXK A;  3SBT A;  2FC0 A;  3KKS A;  3HT3 A;  3QEW A;  4F8R A;  3A2F A;  1IG8 A;  3QES A;  2UXD K;  1H1V A;  3K2P A;  3O9R A;  2UUB K;  4JV5 K;  4I6M A;  4FLZ A;  4IFV A;  1JLA A;  3NGI A;  4NCA A;  5HL7 L;  3SAF A;  4BQL A;  2FF3 B;  5F0X A;  3A5N C;  2D11 A;  3A5M C;  2J0M A;  2IVO A;  2QM1 A;  2YJE A;  3HI0 A;  3NF9 A;  4IEE A;  5AQW A;  2YNH A;  1OKJ A;  4BRK A;  1YXQ A;  1OH8 A;  2O4I A;  1SKS A;  4BR7 A;  4DR7 K;  5J2P A;  4I6M B;  1T6D A;  3S3M A;  4CEO A;  3O1W A;  3VGK A;  3QIP A;  3WXK A;  4CD3 A;  2YHY A;  1N6Q A;  4M3X A;  2YNG A;  4KTZ A;  3NH0 A;  2QWQ A;  4B1V A;  1K8A O;  2RN2 A;  4KH5 A;  2VYP A;  1XUP O;  4RW8 A;  1RT3 A;  4BRN A;  3MN5 A;  4KHN A;  4JD2 A;  1HKC A;  5AQH A;  1VSH A;  2P9K A;  4N5S A;  3ENH A;  3P83 D;  4XIU A;  5EY4 A;  1LAV A;  5C2F A;  1G99 A;  2OPQ A;  3F5T A;  5LMU K;  1KFD A;  4DR6 K;  4OPK A;  2G8U A;  3PX6 A;  1RBT A;  2P9U B;  4CER A;  4JK7 A;  4BRD A;  2V7Y A;  2HF4 A;  4CK1 A;  4DHY A;  4Z0U A;  4PL8 A;  1WSE A;  2BH1 A;  2P9L A;  2HB5 A;  4OGC A;  1WOQ A;  4QS8 A;  5H1S Q;  3SZ2 A;  4M3Y A;  4PY5 A;  4JS4 A;  3E9O A;  4YOW A;  3VTH A;  3V9Z A;  3VEV A;  4J2D A;  1S1X A;  1VSI A;  1ZXO A;  4CI6 A;  3PY8 A;  4YOT A;  3M8P A;  5HOO A;  4GVE A;  4W5R A;  3G9W A;  3L4Q A;  3AAR A;  3TAB A;  4JKA A;  4LH5 A;  1IH7 A;  4A59 A;  4M3Z A;  1GLB G;  4NB4 A;  3SPZ A;  3H3N O;  4CFA A;  2UXB K;  4ELV A;  2NNW A;  1Z26 A;  4KHW A;  4AHR A;  4Z4G A;  1ASU A;  2Y1I A;  4DQI A;  4ICL A;  4BR4 A;  4BDY A;  3K5L A;  1CZ9 A;  2Q0U A;  4CZK A;  3P1G A;  4KTW A;  1NGE A;  4Q0B A;  4MO5 A;  1WSJ A;  2QWM A;  3L3V A;  4CVN E;  1T7P A;  4BDZ A;  2HHH K;  1DT9 A;  4IOA L;  3CCM N;  3JAM O;  3K9K A;  1Y64 A;  1EXQ A;  1GC7 A;  4FWK A;  5JS2 A;  2O8D A;  5GAG P;  4X64 K;  3OYK A;  1XWL A;  5AQO A;  1KVC A;  3R6M A;  4M7Y A;  3AVI A;  3VQQ A;  4BRO A;  1RCH A;  3KLI A;  2XY8 A;  4JHD B;  4NLB A;  4BY9 C;  4DSK A;  3TTF A;  1DIK A;  4FWO A;  4ILH A;  4H0V B;  3EPY A;  4EZ6 A;  1D9D A;  4HWI A;  4CYE A;  4M3R A;  4CJP A;  3NAE A;  4FJL A;  1KXP A;  3MEG A;  3AA5 X;  4BE0 A;  1X9M A;  3F73 A;  5AQU A;  1ASV A;  2ZE2 A;  3QIN A;  3MXJ A;  3VGM A;  1MIZ B;  3D7E O;  3EZW A;  4H5V A;  4DV1 K;  3SI6 A;  1VHX A;  2P51 A;  3AU4 A;  4I7F A;  4Z4I A;  1RDD A;  2E20 A;  3UKU A;  3NCI A;  3RMA A;  1YAG A;  4FJ9 A;  2KLA A;  1I3A A;  1VSL A;  1C0M A;  4DU4 A;  1N5Y A;  4FJX A;  2A42 A;  1HNI A;  5CYM A;  2YKM A;  3JSM A;  3ULE A;  2A1S A;  2GEL A;  1KBL A;  4UY8 O;  1ACA A;  1J9A A;  4CHY A;  4E1N A;  1S5J A;  5DM7 L;  3OYI A;  3QEX A;  3AVN A;  1RTH A;  4CBX A;  4UQG A;  3PVL A;  3ATU A;  2X6S A;  3VGL A;  1TAU A;  3H3O B;  1EWR A;  4WQ4 A;  3IFR A;  4CGG A;  1VK0 A;  4WYB A;  3FE1 A;  5JVG L;  2A1R A;  4DTJ A;  4DSI A;  3ZSY A;  4JKG A;  2PAV A;  5E26 A;  3EKS A;  4YOR A;  4FJG A;  3PIP L;  4H5R A;  3LP1 A;  2W6K A;  5AQF A;  3O3F A;  2F8T A;  4JI2 K;  1NWK A;  2KTQ A;  3AGR A;  3LPT A;  1KD1 O;  3CQY A;  1JLB A;  2QXL A;  4PKI A;  4KRF A;  3BGR A;  4GV9 A;  4C1N K;  2PBD A;  4JRP A;  4DR1 K;  3C6H A;  3KLF A;  1HKB A;  2O8B A;  2I7N A;  3HOT A;  2F9T A;  1SAZ A;  4Z4H A;  5BRF A;  1J19 A; 
#chains in the Genus database with same CATH homology
 2ZGY A;  4BR9 A;  3LDO A;  5JVH L;  2VCP A;  4JHD A;  1HBK A;  1ATN A;  3AAQ A;  4GNI A;  3N4Q A;  3MWT A;  5EVZ A;  3ID8 A;  4WCE L;  4YOV A;  3E1Y A;  1VBH A;  3WT0 A;  1JJ2 M;  3O9Q A;  1O13 A;  4XH5 A;  3QIJ A;  5AQT A;  5EOY A;  3ENB A;  4ILJ A;  1YF5 L;  3N4P A;  2E2P A;  4C1N I;  1NMD A;  2ASM A;  1HKG A;  5CE3 A;  2WBN A;  3C7N A;  3P4I A;  5GIN A;  4XH1 A;  4XH4 A;  4BG9 A;  4NO7 A;  1GLA G;  4CBU A;  2JWK A;  2KKZ A;  4PKH A;  2YHX A;  4ISF A;  5FPD A;  1QZ5 A;  2E1Y A;  3CQX A;  4GV6 A;  3WA0 A;  3KZB A;  3EO3 A;  3MK6 A;  3OA9 A;  3MMV A;  4U7B A;  3OW2 M;  3AAP A;  4JKE A;  3DWL A;  1VQ8 N;  2E88 A;  3BEX A;  4MLE A;  4BR5 A;  3GG4 A;  3TSP A;  1VQ9 N;  1K9M O;  1K8K B;  1NTI A;  2CH6 A;  3HBT A;  3R3L A;  3CET A;  3LM9 A;  2V7Z A;  3QB0 A;  1N8R O;  1GLJ O;  3IMX A;  4JAX A;  2QI2 A;  3HM8 A;  4FL9 A;  1BOT O;  1NGB A;  4B9Q A;  1WUA A;  2NRV A;  4B1W B;  1LCU A;  4BRA A;  5M1F A;  3SAH A;  3L4I A;  5AZJ A;  1QQM A;  4EAH D;  3CCR N;  2ZJQ L;  3CJA A;  4K41 A;  3O9T A;  1ESV A;  2OAN A;  2NZT A;  3O9S A;  2PFU A;  3CJB A;  2WH5 A;  1NGD A;  3C6A A;  3F2K A;  1ATR A;  5BN8 A;  2FXU A;  5CR4 A;  3U8X A;  4FOI A;  2QEX N;  1C0G A;  3EKU A;  3O6W A;  5C15 A;  4P7I A;  4H0T B;  3SMP A;  3KK7 A;  1VQL N;  4FVU A;  3BF1 A;  4U67 L;  3HSC A;  5AQL A;  1E4G T;  4Z94 A;  1RGI A;  1SQK A;  2RHK A;  2OTJ N;  5AR0 A;  1U2V B;  2FSN A;  3D2F B;  1EQY A;  4H5N A;  4WQ5 A;  5BN9 A;  1S72 N;  3D2E B;  3KVG A;  5JMV A;  1EF1 A;  4DKW A;  4OPH A;  2HE7 A;  3OBW A;  4FWQ A;  3RSE A;  3UKR B;  3G25 A;  3CC4 N;  1VAZ A;  3AU5 A;  2AEH A;  1V4T A;  2F7T A;  1VQ6 N;  3DXK B;  3O1B A;  2E2O A;  4FOE A;  3CC7 N;  4AM6 A;  2NRX A;  3WXI A;  2P9I A;  1E5W A;  5C2D A;  1KQS M;  4BGB A;  2GWK A;  2ABD A;  3IKM A;  3D6R A;  5AQG A;  5ELZ A;  1GLE G;  3Q7C A;  1BDG A;  3EN9 A;  1ZC6 A;  3ZX2 A;  4BGA A;  4IJA A;  4IXC A;  5M1P A;  3SLC A;  4IOC L;  4MLH A;  1JCG A;  3SAG A;  2H3G X;  2HBL A;  5AFU H;  2GWJ A;  2WUS A;  4C23 A;  1MDU B;  3WQT A;  1RFQ A;  5AQX A;  2A3Z A;  2Q0R A;  3ZX3 A;  4BRC A;  2P9N A;  4BRP A;  1Z05 A;  3QFU A;  2QWL A;  3S41 A;  4CZI A;  1D4X A;  1HJO A;  5TKY A;  2COP A;  4JK8 A;  4M7X A;  3FZM A;  4FO0 A;  1NGC A;  1ZBS A;  3J7Z O;  2YCH A;  4DQ8 A;  4M63 C;  1JCF A;  3H6E A;  5AFU A;  5BRH A;  1KC8 O;  3BIN A;  4MDA A;  1VBG A;  2ASO A;  4WFA L;  4NLC A;  2ASP A;  5KPT A;  3SK3 A;  3ZX0 A;  2FF6 A;  5JLH A;  1U6Z A;  4WFB L;  3GBT A;  1T6C A;  1NGJ A;  2RQ1 A;  3HZ6 A;  2UYT A;  4YDU C;  1ST7 A;  4ZRJ A;  2Q31 A;  4CZE A;  4BVO A;  3CCJ N;  3LDN A;  4YOU A;  3MWP A;  4AM7 A;  1QVF M;  1MWK A;  2GTD A;  2DPN A;  5JVL A;  1NLV A;  2VGM A;  2A41 A;  1YUW A;  2P9N B;  1VQP N;  1BA1 A;  1JCE A;  1HX1 A;  1T44 A;  4EHT A;  3M5R A;  1EO1 A;  3FR0 A;  3NVM A;  4HTL A;  3FLC O;  4JD2 B;  1Y19 B;  1C0F A;  3FZH A;  3U9D A;  1S3X A;  2IVP A;  3LDP A;  4MO4 A;  5BRE A;  3JXU A;  3WXJ A;  4CJ7 A;  5AQM A;  3K9J A;  2P9K B;  1V4S A;  3CCQ N;  1IJJ A;  1GLL O;  2IIR A;  2D2Q A;  2P9P B;  4FWL A;  3ZEU A;  1QQO A;  2E1Z A;  3U4L A;  3M1F A;  4R79 A;  4CZM A;  5GAE P;  2YI1 A;  4BRQ A;  4F7G A;  1T3V A;  4IFE A;  3DXM B;  2QW9 A;  1K8K A;  5E84 A;  2A40 A;  2FSK A;  3H1V X;  4QS7 A;  3KWI A;  5ADX A;  4ZRI A;  3L6Q A;  1TUY A;  4K42 A;  5AQZ A;  2P9L B;  2CGJ A;  5LJW A;  1Q86 O;  4QS9 A;  4IDH A;  5F2R A;  5B8H A;  2D0P A;  4BRE A;  2ITM A;  3FP5 A;  3NVK A;  1MK7 B;  3F9M A;  3CCS N;  1YIT N;  1XQS C;  3TSU A;  1YI2 N;  2YVC A;  3MCP A;  2AA4 A;  4B1Z A;  1MIX A;  2HST A;  5AZI B;  1X3N A;  4FSV A;  3ZEU B;  4BC2 A;  5C12 A;  3TSQ A;  4A57 A;  1GLC G;  1U2V A;  1KAZ A;  3D2F A;  3CIP A;  5BRD A;  4ISG A;  3I8B A;  3VMF B;  2HF3 A;  3D2E A;  3R9P A;  3IVF A;  3QBX A;  5AQY A;  3TTD A;  3UKR A;  2LBB A;  1QVG M;  5KPZ A;  4FWS A;  3VET A;  3IUC A;  3DXK A;  3SBT A;  3FGU A;  4CZJ A;  1Q18 A;  5I9E B;  1VQ4 N;  1IG8 A;  1H1V A;  3O9R A;  4H5T A;  4I6M A;  3WXM B;  4BG8 A;  3VEZ A;  2J0J A;  3H45 C;  3SAF A;  2W40 A;  5HL7 L;  4FWR A;  3LM2 A;  4BQL A;  3CF5 L;  4KBO A;  2FF3 B;  5F0X A;  3A5N C;  2D11 A;  3A5M C;  3CCE N;  1XC3 A;  1QZ6 A;  4OPA A;  5KPR A;  2J0M A;  3VEO A;  1NGF A;  2IVO A;  3MDQ A;  4JKC A;  2QM1 A;  2YJE A;  3HI0 A;  3C65 A;  4IO8 A;  4A61 A;  4BC5 A;  1X9J A;  4IEE A;  4DB3 A;  3U8Z A;  1SGH A;  3X23 A;  2Q97 A;  2ZWH A;  3H46 O;  3LDQ A;  5AQW A;  4EIA A;  1W2B M;  3M3Z A;  4WFN L;  1OKJ A;  2HMP A;  3GL1 A;  4BRK A;  2A6A A;  4BRM A;  3CCU N;  1YXQ A;  3L0Q A;  2WFB A;  4BR7 A;  4FPA A;  3CMA N;  4I6M B;  1T6D A;  2A5X A;  5TKW A;  3O1W A;  3VGK A;  3BP8 A;  4JKF A;  2NRZ A;  4BVP A;  3OBY A;  4JKD A;  3WXK A;  4CD3 A;  2YHY A;  3LDL A;  1Q81 O;  1NBW A;  2QWQ A;  3ATV A;  4BR0 A;  1MWM A;  1HB8 A;  4BRI A;  4B1V A;  1K8A O;  4ZRK A;  4KH5 A;  2AP1 A;  3Q7B A;  4A5A A;  1Q82 O;  1H4R A;  4BQZ A;  2JWL A;  2VYP A;  1XUP O;  2HRJ A;  3B8A X;  3VF2 A;  3GOI A;  4BRN A;  4JN4 A;  4KH6 A;  3MN5 A;  3CPE A;  3QBW A;  4YDU A;  4JD2 A;  1CZA N;  1HKC A;  2CQU A;  3O08 A;  5AQH A;  4J8F A;  3C0B A;  3CC2 N;  3E9L A;  3BUZ B;  4KH4 A;  3PLA A;  2P9K A;  2CGK A;  3ENH A;  1BA0 A;  2J0K A;  3O80 A;  2P9P A;  5FPM A;  5EY4 A;  5C2F A;  4XEI A;  1G99 A;  1SZ2 A;  3F5T A;  3MX2 A;  4YL8 A;  1HLU A;  4B1U B;  4CZL A;  2E2Q A;  1YHQ N;  3CCL N;  3QIC A;  5M1K A;  3DXM A;  2P9U B;  3GE1 A;  3H1Q A;  1JDE A;  4JK7 A;  1TYQ B;  4HDO A;  2V7Y A;  3CJ7 A;  4BRD A;  2HF4 A;  4O8K A;  1GLD G;  2GEM A;  4O5F A;  5BPM A;  4DHY A;  3IDH A;  4K25 A;  4PL8 A;  2BH1 A;  4FWP A;  1DKG D;  2P9L A;  3AY9 A;  1WOQ A;  4QS8 A;  5H1S Q;  2ZJP L;  3UKU B;  2Q36 A;  2AL6 A;  3GDQ A;  3HTV A;  1GC6 A;  3E9O A;  2HOE A;  1NM1 A;  2CH5 A;  2YX6 A;  3MN9 A;  4YOW A;  3VTH A;  2OTL N;  3VEV A;  3WQU A;  1VQO N;  3A5L C;  5EXW A;  3O9U A;  1DEJ A;  1J6Z A;  3I56 N;  5ADX H;  1ZXO A;  4CI6 A;  1LOT B;  1M1K O;  1TUU A;  4EKU A;  4YOT A;  4HDQ A;  5AZI A;  3ZYY X;  5HOO A;  4GVE A;  3G9W A;  3L4Q A;  1QHA A;  4H0O A;  4AF1 A;  2QWN A;  3ULE B;  4JEP A;  5BPN A;  3AAR A;  4PL7 A;  1R59 O;  2YJF A;  5GIO A;  3R1X A;  3SJH A;  4WF9 L;  3M6G A;  4CZH A;  4JK9 A;  4YOY A;  5AQP A;  3CME N;  3CJ1 A;  4H0P A;  3T69 A;  2I1K A;  4WQ4 C;  4JKA A;  1NVL A;  4IO9 L;  4MDB A;  3MN6 A;  3VES A;  4A59 A;  4A62 A;  1GLB G;  3I55 N;  4NB4 A;  3H3N O;  3WUH A;  3W3D A;  3MX5 A;  4JNE A;  3G71 N;  5AQR A;  4B1Y B;  2NRW A;  3PIO L;  2P9S B;  1MA9 B;  5BPL A;  3U7D A;  3ZDT A;  2NNW A;  2Q2R A;  5C0Y A;  4H0X B;  2I1J A;  2GUP A;  2HBK A;  3O8M A;  1HUX A;  1HB6 A;  3CJ9 A;  2ZPY A;  4OO1 J;  1Q7Y O;  3FFK B;  4BR4 A;  1YJ9 N;  4JKG B;  3NMU A;  1NGG A;  3OHR A;  2CGL A;  2CB8 A;  2I7P A;  2VGN A;  3T7Z A;  1BO5 O;  1NGI A;  2BUP A;  2Q0U A;  4BRF A;  3DLL L;  3P39 A;  4CZK A;  4BRH A;  1QQN A;  3DAW A;  1NGE A;  1RDW X;  1SS6 A;  4IZ9 A;  3CXC M;  1YJN N;  5M1N A;  4MO5 A;  2QWM A;  3E66 A;  3WEE B;  4F9O A;  3SBG A;  2FDQ A;  1Z6R A;  1DT9 A;  4A2A A;  1NJI O;  1YVN A;  3O5B A;  4E1J A;  5KQD A;  3VPZ A;  3O4W A;  3QML A;  4IOA L;  1NGA A;  3CI5 A;  3EE9 A;  5AQQ A;  3CJC A;  3CCM N;  2D10 A;  5BR9 A;  4L3Q A;  2V51 B;  3FLV A;  3K9K A;  1Y64 A;  2E8A A;  1BG3 A;  2NRH A;  3I33 A;  4NY0 A;  4BC3 A;  2QA4 N;  3E9P A;  1VQM N;  1S22 A;  2FLO A;  3EL2 A;  1GC7 A;  4FWK A;  5AQS A;  4A5B A;  2IVN A;  3ZET B;  5GAG P;  2QWP A;  2Q1N A;  3MN7 A;  5AQO A;  3R6M A;  4M7Y A;  2QTD A;  5M1Q A;  4IJN A;  3P31 A;  3TTC A;  4BRO A;  3TPQ A;  4CZG A;  4JHD B;  4NLB A;  3MCA B;  1KAX A;  3CCV N;  3CHW A;  4BY9 C;  1DGK N;  3TTF A;  1DIK A;  4FWO A;  2R82 A;  3R8E A;  4ILH A;  1BUP A;  4H0V B;  3KHY A;  2HBJ A;  3EPY A;  4BC4 A;  5MLC Q;  1VQK N;  5JIC A;  5FPN A;  4PHT X;  4HWI A;  1VQN N;  4CYE A;  3C7N B;  5M1O A;  4H5W A;  5GAD P;  3VER A;  1KXP A;  2BTF A;  3VEX A;  1M90 O;  5AQU A;  4G9Z A;  2W41 A;  5KQ8 A;  5LJV A;  3VGM A;  3SMS A;  1KC7 A;  1MIZ B;  3AGK A;  3D7E O;  4DXA B;  3BF3 A;  3EZW A;  4H5V A;  4RCH A;  4RWT A;  2QWR A;  2V52 B;  5AQV A;  5DM6 L;  4EFH A;  3UE5 A;  2P9U A;  3WXL A;  5GIP A;  1YIJ N;  1TYQ A;  5AQK A;  4ILG B;  4EHU A;  1ILY A;  2KHO A;  3AU4 A;  3TU5 A;  1GG3 A;  3A0I X;  5C10 A;  3CPW M;  2E20 A;  5AQN A;  1KAY A;  4FWN A;  3UKU A;  4TKN A;  1YAG A;  5FPE A;  2NRR A;  3QFP A;  2NLX A;  2KLA A;  5AZJ B;  4GV3 A;  2YHW A;  5CHI A;  2QWO A;  4GXB A;  2FJ9 A;  3VEW A;  3VF6 A;  2J4R A;  4CZF A;  4CD1 A;  3PZD A;  2A42 A;  1P90 A;  5AQJ A;  4WQ5 C;  3G4S N;  2FSJ A;  1E4F T;  3ULE A;  3LL3 A;  1VQ7 N;  1ISN A;  2GEL A;  1KBL A;  4UY8 O;  1ACA A;  2X0S A;  1GGO A;  2VWB A;  3J8A A;  5DM7 L;  1HPM A;  3A8Y A;  3G6E N;  1K73 O;  4Y0W A;  3A5O C;  3UB5 A;  3FZL A;  3P38 A;  3DJC A;  2E2N A;  5AQI A;  4CBX A;  2EMT A;  4O8U A;  3PVL A;  3ATU A;  3RSE B;  3VGL A;  3VEN A;  1W97 L;  3QDK A;  2ZF5 O;  3W0L A;  2RE2 A;  4A2B A;  2P9S A;  2NRT A;  3H3O B;  4GY2 B;  4WQ4 A;  3IFR A;  2EWS A;  2DIK A;  5IJM A;  5F1X A;  4WYB A;  4B1X B;  1VQ5 N;  3FE1 A;  2P9I B;  4LC9 B;  5LY3 A;  2D4W A;  2ZJR L;  5JVG L;  4RTF D;  2ZGZ A;  4H03 B;  4JKH A;  3VTI A;  4YOX A;  4JKG A;  2PAV A;  1MK9 B;  4BRL A;  5E26 A;  3EKS A;  2WC9 A;  3FZF A;  4BR2 A;  1BWF O;  3JS6 A;  4YOR A;  1OVY A;  4FWM A;  3PIP L;  1P8Z A;  3VF4 A;  1X3M A;  1GLF O;  4H5R A;  5AQF A;  4BRG A;  3HOS A;  4H0Y B;  3VOV A;  1NI2 A;  3ID6 A;  2F9W A;  4K43 A;  4IOX A;  4CBW A;  1RDU A;  1NWK A;  3AGR A;  3WEE A;  1KD1 O;  3CQY A;  3FZK A;  2QXL A;  3CD6 N;  3HRG A;  4PKI A;  3VEY A;  3CER A;  1ATS A;  3EE8 A;  2EMS A;  4FPB A;  2HBM A;  5JLF A;  1NGH A;  5EX5 A;  4GV9 A;  4C1N K;  1YJW N;  1BU6 O;  2D1K A;  2D0O A;  2PBD A;  3C6H A;  3U9Z A;  1HKB A;  2I7N A;  3RVC A;  4PKG A;  3HOT A;  2F9T A;  1SAZ A;  3KWG A;  2GX9 A;  5GAH P;  4DCH A;  4JKB A;  3ENO A;  4IWV A;  3ZET A;  5BRF A;  4IEI A;  1J19 A;  4ISE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...