4JKGA

Open and closed forms of mixed t1789p+r1865a and r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
219
Chain Sequence
LFSQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 65
structure length 219
sequence length 220
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkgA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkgA01
4JKBA 3E9LA 3E66A 4JKDA 3SBTA 4ILJA 3SBGA 4JKAA 3E9OA 4JKEA 3E9PA 4JK9A 4JKGB 4ILHA 4JKFA 4ILGB 4JK7A 4JKCA 3ENBA 4JK8A 4JKGA 4JKHA
chains in the Genus database with same CATH superfamily
1KC7A 2P9PB 2D2QA 4NCGA 4Z0UA 4ID5A 1RT5A 3N4PA 4LF6K 1LWEA 3AVHA 4DTXA 1A5WA 5TKYA 3SAHA 3WQTA 3BP8A 3TAGA 3TAMA 3WT0A 2QWNA 5HRNA 2W40A 3ENHA 1BHLA 3FZFA 4DV5K 5AQJA 4CJ4A 1SL2A 2CQUA 1OKJA 4JI4K 4M3YA 5C25A 3ZLJA 3D45A 4JKGA 3S9HA 3AO1A 3MXIA 2YJEA 3K5NA 4JV5K 1Q9YA 1REVA 5AZIB 4OKKA 3RSEB 4H03B 5F0XA 3C7NA 4JYAK 2ZWHA 1SKRA 3DLKA 3CD6N 2YCHA 1OH8A 4CBXA 3ALYA 1ILYA 4K0KK 5KI6A 4RW9A 2UUBK 4FJ8A 2COPA 3C6TA 2JWLA 4CZFA 1JXBA 5HOOA 2A1RA 3H1VX 1RBRA 3CQXA 1OH7A 3U8XA 5LY3A 2FC0A 4OJRA 3TAQA 1VHXA 4C23A 4J2BA 3HPHA 3AV9A 4E89A 3DRRA 2OZSA 1ATNA 1S1TA 4CJUA 2UXCK 2Y1JA 1KAXA 4UY8O 1CXQA 2HNDA 4DB3A 4N47A 1X9MA 2VQEK 4CHYA 1GG3A 2O4IA 4YOUA 3UKRB 4KHPK 3FZLA 4X65K 2PYJA 2PBDA 3V6DA 3MEGA 1BU6O 4PA1A 5AQQA 4FLZA 4MLEA 1C0TA 3FZKA 4M3TA 4DR2K 1HR0K 3A5NC 4CJFA 1KFSA 3LP3A 4L8RB 5FRNA 4IFVA 3VQAA 4FVUA 5AQSA 3ZX2A 2IC3A 3V1OA 3DMJA 3A2FA 4JI8K 3HL8A 4JRPA 3G0ZA 2ZQBA 1YJWN 4CGIA 1HNZK 3RMBA 4CHOA 1U45A 1L3SA 3R8EA 3BEXA 2V7YA 3UKRA 4EFHA 3K5OA 4CZMA 2FDQA 3PO5A 1N36K 3DXKA 4FWSA 1IG8A 3IMXA 4I7FA 1IJJA 3U8ZA 5DM7L 1WOQA 4IOCL 3CCLN 2Q0UA 3HOSA 3TSPA 3O1WA 3MN5A 4H4OA 5AQZA 3WNEA 1DTTA 4JI6K 4FJ7A 3O3GA 4YNQA 1HUXA 4FPAA 2QTDA 3IS9A 3KK1A 3QFUA 4CIFA 3PSFA 3LWLA 1BWFO 3VESA 4CF1A 4DTUA 1Y97A 3QB0A 1HMVA 1HRHA 2QWRA 4ZHRA 2F8SA 3ZT2A 3T7ZA 1NGHA 3WA0A 1X3NA 3T19A 1BUPA 4M45A 3AA5X 2HNZA 3CCEN 1HLUA 4G9ZA 3ENOA 5JLFA 2YKNA 1MIXA 2A3ZA 1YTUA 4PL8A 2OCEA 3DLHA 4N76A 4CJEA 1BQMA 1VQ8N 3PZDA 1NGCA 1X3MA 3O1BA 4RWTA 2RPIA 5JS2A 2X74A 2X6SA 4BE1A 3PX4A 2RN2A 1Q82O 1IBLK 3KLEA 5AQUA 1YIJN 3WEEB 1VQ7N 1TL1A 4BRLA 2DFEA 3I55N 2Q2RA 4DUYK 4WCEL 5BRHA 3SCXA 3Q7BA 1S1UA 3V9XA 1JCGA 4DV2K 4RCHA 2VWKA 4B3OA 2Q0RA 1DTQA 3J7ZO 2FSKA 4DSLA 4MLHA 3VF4A 3KLHA 3VGMA 4LF9K 3C65A 2WFBA 4FJNA 3SLCA 4XH4A 2FF6A 3CIPA 3GL1A 3ATVA 5CYMA 3HBTA 4B3TK 4FOEA 4CJTA 3NH1A 1SQKA 4Z4EA 4HDOA 1UAXA 4A5BA 2CGJA 3KLFA 2IIRA 1WAFA 1S5JA 4U67L 4NYFA 3PUFA 4EHUA 1MU2A 2P9NB 4LSLA 3LDOA 4G1QA 3C0BA 5FRMA 3HYFA 1E4FT 3HZ6A 2DFHA 5DM6L 4DF4A 3PY8A 4CZGA 4CD3A 2UUAK 3F73A 2Z1JA 4J2DA 3FLVA 1V4TA 5KRSA 3LZJA 4KV8A 4LF4K 1VQ6N 1RT7A 3Q7CA 4YY3K 1LOTB 4LF5K 4Z4HA 4F2SA 2VWBA 2FBVA 3SZ2A 3VOVA 2O8EB 2A40A 2BH1A 4BQLA 5A2QO 3CQYA 1HYSA 2Q1NA 4JS5A 2BANA 3THWA 1BG3A 1UA1A 3TSQA 2PYLA 4MFBA 5AQNA 3D6RA 2VGNA 2DY4A 3EY1A 4N41A 1ZBSA 3HRGA 1FK9A 4IO9L 4JN4A 3I56N 3CXCM 3EE9A 1T6DA 4OPJA 3AAQA 3AVLA 1TKDA 4B1UB 3ID6A 3A5LC 3HT3A 1QZ6A 3K5LA 3E66A 4M3UA 1BA1A 1CZ9A 3ISNC 1NG9A 1D9DA 3LL3A 1HYVA 3CPEA 1WBBA 2YI1A 1VQON 5KGXA 3L4QA 4WQ4C 1MWMA 1LAVA 2A5XA 3VMFB 2Q31A 1GLFO 1O13A 4BRGA 3SQ0A 3DLRA 4HWIA 2OPQA 4XH5A 3ZX3A 3RMCA 4FM2A 3CC2N 4I6MB 3SV4A 1RT6A 2YHWA 1ST7A 3D2FB 2NNWA 3RMAA 3LDSA 2VG7A 4LH5A 3ULEA 2YJFA 3OY9A 3MK6A 2HHSA 4FVMA 3QETA 1NGIA 1K8KB 3BGRA 3VEYA 1R59O 1R0AA 1KVAA 1B9DA 4PL7A 3WXKA 3FP5A 1XHXA 3VQPA 4CGJA 4KHUA 1LCUA 2O8FA 1N33K 4JD2A 4FJLA 2YNHA 1SL1A 3SUQA 1NGEA 1NJWA 3JSMA 1DLOA 3TTCA 1TKTA 2E1ZA 2R7YA 3QNNA 3VERA 1BA0A 4AHTA 3SJHA 4C8OA 3SNNA 4OLBA 4B1ZA 3W3DA 1H4RA 4CGFA 3CG7A 3CCVN 3SAFA 4B3MK 5C42A 2F96A 4OGCA 5FDLA 5AJ3K 4JD2B 3TWHA 1GOBA 4LD0A 4CJ3A 1ZBFA 2O4GA 4ZRKA 4ISGA 4BVPA 4H0PA 1VSDA 3AO4A 4FJMA 5AQOA 4F2RA 2J0JA 4KBOA 1RCHA 3ZSRA 4ELUA 4DS4A 4H5NA 1QTMA 4FWKA 2E6MA 4CESA 3AO2A 1NVLA 4FPBA 4PWDA 4B9MA 2P9PA 3OW2M 1W9HA 1C0MA 3HPOA 1MIZB 1LWFA 4CJPA 3NVKA 1QS4A 1U49A 3A5OC 1K6YA 3FZHA 5M1PA 3DAWA 4OPHA 5KQDA 2FBTA 3HI0A 4CFBA 4DV7K 1T7PA 3VGLA 3C6AA 3K57A 1VQ9N 3M1FA 3NVMA 4JKGB 3P39A 4B08A 1HB6A 4I2PA 1XNRK 3SAGA 4IEEA 3VQ8A 5J2NA 2E8AA 4CJWA 4B3SK 2ZF5O 2V51B 5CHIA 4KH5A 1EKEA 2P9KB 3TAFA 3SYZA 4FJIA 1ZBIA 3TSUA 4OVLA 2B5JA 4ID1A 4WF9L 4H0VB 2BGGA 4M3XA 3O5BA 3VGKA 4F3TA 3L0QA 4PQUA 1MK7B 4GKJK 1VBGA 5EOYA 2E6LA 4MO5A 1NLVA 3A5MC 2OTJN 1ZXOA 1NMNA 3V1RA 4CEQA 2HHVA 2GBZA 1NWKA 3SV3A 4M3WA 2D11A 4IFYA 4PKHA 1J9AA 3IRXA 4FWOA 4O0JA 3CJCA 2E20A 1RDUA 1P90A 1ZBLA 2FBXA 5KPTA 1RT2A 2E88A 4DR3K 5TKWA 1SUQA 4DR5K 1B92A 5GINA 3I8DA 2P9SA 3PX0A 4H8KA 2E5LK 5T7BA 1NGDA 3THVA 4BE0A 3I0RA 4Q0BA 2Z1HA 1RBTA 4HTUA 4BRCA 2AP1A 4FJXA 4Y1DA 3WXLA 3HP9A 4KH4A 1BISA 1Z6RA 3LDNA 4ELTA 4CF8A 1CXUA 3MN6A 2HBJA 3LP0A 4KH6A 3IDHA 5BRFA 2NRHA 4X64K 4DU1A 4ELVA 1FKPA 4CJKA 2D10A 2XO7A 4RW7A 1NTIA 3NMUA 4I2QA 1HNVA 2IAJA 1IO2A 5EY4A 3P38A 2ZGZA 4FOIA 3O8MA 3M3ZA 4CD1A 3OBYA 1EETA 4KRFA 5BPNA 3P4IA 1HPMA 3CJ1A 4JAXA 2P5OA 4C8KA 2GUPA 1LW0A 4DSFA 4Z4FA 4GKKK 1SKWA 1XQSC 3ZSZA 3J7AP 4O44A 4K43A 3RVCA 5M1FA 2LSNA 2HSTA 3OVNA 3D7EO 1NK5A 4BR0A 3U6FA 4B9UA 5AQRA 3EE8A 4FJGA 4BG8A 5AQFA 5FROA 4DHYA 4JK7A 3AA2A 4CHNA 2PAVA 4DSEA 4FK2A 5K14A 3KHYA 3R3LA 3CCRN 2GUIA 1MA9B 1VSKA 1GLCG 4B1XB 2WBNA 5J2PA 1IKYA 4DXAB 2A6AA 1RT4A 3KWGA 4FJHA 2HHXA 4YFUA 5CYQA 1KRPA 4FYDA 1WAJA 3CJBA 3VTHA 4IZ9A 3QEVA 4B1VA 5GAHP 2P5GA 4O5BA 1VQMN 1NGJA 3BZCA 4DSJA 3DM2A 5GIOA 1S72N 2FSNA 3VQ9A 1XNQK 5AQXA 3OJUA 2A41A 1JLAA 4OPKA 5J2QA 1QE1A 3CJ7A 4FWLA 1IV0A 1KFDA 1TAUA 3H45C 1I3AA 4PKGA 4FJKA 4IWVA 3VEVA 4DMNA 4JKFA 2EMSA 5C2DA 1NK0A 3VQ6A 3F5TA 3AU5A 1D5AA 3CCSN 2P9LA 4LC9B 4I9LA 3LDLA 4LF7K 5KGWA 4WFNL 1C1CA 5HP1A 4C8MA 3D2FA 3QO9A 1ISNA 1HKGA 3EKUA 5EVZA 3CC7N 2YKMA 3CJ9A 4PKIA 5FPEA 4B8CA 4BR2A 3THXB 2ZD1A 1J19A 2H3GX 1DKGD 4YOXA 1JLBA 5SWMA 4Q5VA 4OPAA 4CI6A 1RT3A 3O4NA 2F9TA 5JLHA 3ZT3A 4FM1A 3AY9A 3LDQA 4CJLA 1W97L 4CJ5A 4CK2A 3OYDA 4IG0A 3THXA 2D0PA 4H5TA 4B9LA 3K58A 1C0UA 4CE9A 3GDQA 4DLEA 1HNWK 1NMDA 3MN9A 4TSXA 4B1YB 4E7JA 3ATUA 5AQVA 5KPRA 3G25A 4DR4K 2E2OA 4CIGA 2QW9A 5BPLA 4LFBK 3L3UA 3LZIA 1KVCA 3O08A 4B9VA 4FZZA 2PFUA 3WEEA 3OA9A 3ZEUB 2OA8A 4GMJB 3MWTA 3DRPA 4GXBA 3AVIA 4BDPA 3U7DA 3O4QA 1YTAA 3PO4A 1C6VA 1W2BM 1GC6A 4DQRA 2EHGA 2O8DB 3GE1A 4KB0A 1JLGA 4A61A 3HSCA 4BACA 4ILJA 4FWNA 4BDZA 4M41A 4NCAA 1MDUB 3EL2A 3DLEA 2D0BA 2I7NA 3E9PA 3RRGA 1L3VA 2O8CA 3MCAB 4IOAL 2IVOA 4DQ8A 3CFRA 3L6QA 4ICLA 2P9UB 4ZRIA 5CR4A 1J5EK 3V9UA 2W41A 3SUOA 3ZT1A 2QWQA 4IJAA 2O8DA 4K8XA 3NDKA 1DIKA 3QDKA 4AHUA 3CMAN 3CFOA 2A1SA 1QQNA 1VSJA 4KHNA 2YNGA 5EU7A 3KWIA 4Y1CA 3SUPA 3T1AA 2NZTA 1QZ5A 3S3OA 4BVOA 4GVMA 1VK0A 3WUHA 4BQZA 3HXMA 1YVUA 1HNXK 5LMUK 4K42A 3ZT0A 1BCOA 4JI3K 4CBWA 5F1XA 1N34K 2HBMA 3SBGA 1JLFA 4WFAL 2IDOA 4E7KA 3CQ8A 4BGBA 3F9MA 1U48A 5FPMA 1BL3A 2IVNA 4CEFA 3LP1A 3SMPA 3RMDA 1Z26A 2G8HA 1WUAA 3IKMA 4RW4A 1EF1A 2HE7A 4FZYA 5ADXH 3OBWA 2O8BA 2DIKA 2YVCA 3N4QA 4JK8A 3ASMA 4B1WB 3IUCA 3DJCA 2I1JA 5FPDA 3O9TA 2QXFA 2QKBA 4C1NI 4DWIA 2BE2A 3S3MA 1TL3A 3HM9A 2GTDA 2W6LA 2JGUA 1WSGA 1X9WA 1YAGA 1IKWA 1QSLA 2VQFK 3OYIA 5JVLA 1TGOA 1TYQB 1XC3A 4BREA 1QVFM 4P7IA 2EX3A 5M1OA 3LP2A 3QIJA 3J8AA 2P9IA 4KI4A 3UB5A 2KTQA 3FZMA 1S1XA 3DXMA 1NK4A 1UWBA 3MAQA 1FXXA 1WLJA 4E7IA 2GELA 3HPGA 2KFZA 2Y1IA 3MEEA 5I9EB 4O55A 3OYFA 4K25A 1TYQA 2VG5A 3IVFA 3B6PA 4ILGB 4H0TB 4HUFA 1TUUA 3VEWA 1GGOA 1E3MA 5GADP 3M6GA 3BZKA 4CGDA 2A42A 4BRPA 3LM9A 4JNEA 4CHZA 2VGMA 1Q9XA 1DT9A 4FLWA 3VN5A 3NE6A 4JI1K 4Y0WA 3AO3A 4HTLA 3DXKB 4O8UA 4X66K 3EEQA 2AL6A 3ZT4A 4WQ5C 3F2KA 1WSEA 4CEEA 3QICA 1RTIA 1C0FA 3W0LA 4DTJA 3ZSXA 4FK4A 3H3OB 4FSVA 1WNSA 2HBLA 3ZETA 4RTFD 1QHTA 2RHKA 3KVGA 1K8KA 3HTVA 3ZSYA 3NH0A 3KK2A 4JKDA 3ULEB 1Q81O 4XH1A 5GAGP 5C12A 4OKJA 5AQLA 1HJOA 3DRSA 2YHYA 1YUWA 2PZSA 1NKCA 1GC7A 2D0OA 1OH5A 4M42A 2BDPA 2VWJA 4QAGA 4AHSA 5C15A 1QQOA 2FBYA 1RDCA 3CHWA 4DSIA 1A5XA 4PY5A 4JRQA 1J6ZA 2KKZA 4BRFA 3I0SA 1NJYA 2G8FA 1C1AA 1YF5L 4BRIA 4CFCA 4NY0A 2IGIA 2GV9A 4ISEA 4K8ZA 3EN9A 3H08A 1KXPA 3D2EB 4WQ5A 5FLXO 1BO5O 1QSYA 4CK3A 3MDQA 4KFBA 5BN8A 2WTUA 4M63C 4CVNE 1VSLA 4EIAA 4CGGA 4HHTA 1NK9A 2GWJA 2FLOA 3EPYA 2HHUA 4LFCK 4CJQA 3L2WA 3J7YP 3L2QA 1C1BA 4BRDA 2B4JA 2OZMA 1N6QA 5AR0A 4DR7K 5AZIA 4E1MA 3K0SA 1QQCA 1VQLN 4CF0A 2ASPA 3AU4A 3QFPA 2YX6A 1YI2N 4C8LA 3EYZA 3HVRA 3AVBA 3P1GA 1CZAN 3IFRA 3VQEA 2OTLN 1GLJO 1EXQA 5ELZA 5EXWA 5EX5A 5H1SQ 3THYA 1WB9A 1RBVA 3U9DA 4FM0A 1KD1O 1HBKA 4IDHA 5HBMA 4GNIA 2P9SB 3TABA 3KIOA 4JKAA 1RDDA 3DXMB 1KAZA 1G15A 3FE1A 4FWMA 4FW2A 3OYJA 2P9NA 4AF1A 2X78A 4M7YA 4YDUA 4F4KA 4FLUA 1NGBA 4O4GA 4R5PA 4ILHA 5JICA 3SK3A 2RF2A 1D8YA 3O9UA 3NHGA 3VQ4A 2HB5A 5GIPA 1TK0A 3OYBA 3J80O 3KK7A 3WNHA 3THWB 4MDAA 5GAEP 2I5JA 2HF4A 2YHXA 1S3XA 3QLHA 1XI1A 2QI2A 4OGEA 4W5QA 2NRRA 1JXEA 5M1NA 3VF6A 4FXDA 4BWJA 3ZSQA 4HUGA 2O8BB 1YXQA 5E84A 3KTQA 5M1KA 3MXMA 3E1YA 3CCUN 4A2BA 3C94A 4F9OA 1P8ZA 1SKSA 4DV1K 2X0SA 1Q86O 4CHQA 3VF2A 3AVCA 2ASOA 4BGAA 5SZTA 4NXNK 1ATSA 2EMTA 4KHYA 3AARA 2ITMA 3QMLA 1BDGA 3ZSVA 4CEOA 4E3SA 3OYNA 1U47A 4KPYA 4CEAA 3FR0A 3U4LA 2KZZA 1C0GA 3QBWA 1SS6A 1VRTA 1HKBA 1X1PA 3WNGA 2O8CB 1L3UA 4BG9A 3NAEA 2W6KA 4E7LA 3NCIA 4DTSA 3KKSA 3CYMA 1NNEA 4JKHA 1HPZA 3VEXA 4CJVA 5IWAK 1SGHA 1FJGK 1XUPO 2ZPYA 2QA4N 3CERA 1MWKA 3I33A 1WSIA 5J1EA 3KKRA 4DV4K 4CFAA 2D4WA 1GLAG 5LJWA 3T69A 4CHPA 3VQ7A 2HW3A 1XC9A 1NOYA 1NU0A 5B8HA 3EKSA 1Q8IA 4BRQA 4DTPA 3MMVA 3D0PA 1EWQA 3MN7A 4DU3A 1RGIA 3QEIA 5D3GA 4O5FA 3VQQA 4AHVA 4NCBA 1RDWX 1JL2A 2AJQA 4A5AA 2HVHA 1ZYQA 1QSSA 3ENBA 4WFBL 1KAYA 3GOIA 1E5WA 1HB8A 3JXUA 4YOYA 4PUOA 4B9TA 2CGLA 2OPSA 1DGKN 4B9NA 1OVQA 4CZIA 3OYAA 3FFIA 3B6OA 3MX2A 1T03A 4BR9A 4QOZB 2Q3SA 3SQ4A 3UKUB 1LAWA 1J53A 3NF9A 3AA4A 5BR9A 5HROA 3OYEA 2RQ1A 4GVEA 3OS2A 4KREA 2RKIA 3C7NB 3OYGA 1VSHA 1RFQA 4NLCA 4EP5A 3VQBA 5C24A 2E1YA 3CJAA 4AM7A 1TKXA 3SI6A 2WOMA 4B9QA 1Q18A 3O6WA 5DK5A 3V9SA 3RR8A 5HRRA 3V81A 4FWQA 2IOCA 5AFUA 4KTQA 2Q97A 3EO3A 4CF9A 3SMSA 4FWRA 3O3HA 3ZSWA 1S1WA 3AVNA 3DLGA 2VYPA 4DG1A 4EKUA 4NXMK 3ZSOA 4OO1J 3MXJA 5M1QA 2IS3A 1K9MO 3IG1A 3VQCA 3LWMA 3G4SN 2KHOA 5KPZA 4E19A 3F9KA 3TTFA 1JLCA 2GEMA 5I3UA 1KC8O 2F9WA 1Y64A 1IBMK 2HRJA 3H3NO 3PIPL 1S9GA 3VENA 4DQQA 3M8PA 3TR8A 2O8EA 4JKEA 3ZDTA 2NRWA 3S3NA 4IOXA 3FFKB 3HOTA 4CGHA 4CZEA 2YHBA 3PIOL 3HVTA 2NRTA 3BUZB 3LANA 4AH9A 4N56A 3HO1A 2B6AA 2KQ2A 4DFMA 2QXLA 3MEDA 1GLDG 1EQYA 5IJMA 4CECA 3U9ZA 3G6EN 5CY4A 3V1QA 2XY5A 3OS0A 4CEDA 2Z1GA 2NRVA 1YT3A 4A2AA 3WXMB 2J4RA 4NB4A 1RDAA 3H46O 3LAKA 4CZKA 3V4IA 1U4BA 1JCEA 1ESVA 3L4IA 1ACAA 3CETA 1VQPN 1ASUA 4KAZA 4DSKA 3TAEA 4ZTJA 3CI5A 4EAHD 4BDYA 2YNFA 3T1HK 3QEXA 3ZEUA 3HM8A 2NRXA 3ITHA 3MECA 4M3ZA 1TVRA 4JKCA 2NUBA 1KVBA 4FJ5A 2AA4A 5F2RA 4DF8A 4CF2A 3K5MA 1JKHA 3ZETB 1T05A 3VTIA 3VETA 1SAZA 1BCMA 3OJSA 1OVYA 1K8AO 3CCQN 1JCFA 4DR1K 2ASMA 5AQPA 1GLEG 1XHZA 4RG8A 4CCHA 3QINA 3FGUA 1BIZA 5AZJB 3VEOA 3EZ5A 3QESA 2XY7A 4KKOA 3TARA 1JL1A 1J5OA 4BY9C 1O1WA 1S6QA 3WNFA 5BRDA 1WSJA 2CH5A 1H1VA 1BOTO 3HSTB 3PVLA 2DFFA 1ATRA 2G8WA 3KD5E 1Z25A 2P9UA 5DMRA 4OLAA 2ZM6K 1NGAA 3DLBA 4FL9A 1XMQK 5AZJA 4QS9A 4F7GA 3CFPA 4FJ9A 3V9WA 4ZRJA 3TTDA 4DS5A 3K2PA 4IFEA 4DTOA 4W5TA 2KFNA 3AVMA 5JVHL 3M8QA 1V4SA 3V9ZA 2E4LA 4KO0A 4TKNA 4QCLA 4FLTA 3C6UA 3C95A 4HCBA 1M90O 3QEWA 3OHRA 1VAZA 2WONA 4JK9A 4BR5A 2YV0X 5AQHA 1T6CA 2F8TA 3LALA 2HMIA 2UUCK 1VQ4N 1TUYA 1HQUA 1N32K 4H5WA 4FW1A 3QERA 1X9SA 1RNHA 4XIUA 1D4XA 1S1VA 1KBLA 3E9OA 1NBWA 2HNYA 4BRKA 4JI2K 2VCPA 3IAYA 4N5SA 4H0XB 3NGZA 1E4GT 1VQ5N 3BY5A 1KQSM 3NF6A 1JDEA 1ZC6A 2DPNA 3NFAA 4J8FA 2HMPA 2E2PA 4E1JA 4DUZK 1W7AA 4JHDA 3G10A 4E1NA 5C2FA 1TV6A 1NKBA 4CERA 1IBKK 4AQYK 3H6EA 2J0MA 3DOKA 4IXCA 3CCMN 4CW7B 4DTNA 3ZX0A 3O9RA 1NK6A 4J2EA 4ISFA 1HX1A 5AQYA 3WQUA 3NH2A 2KZMA 1ITGA 4DFJA 2Q36A 3CCJN 4BROA 3CM6A 3TANA 2I1KA 4MDBA 2E2NA 4Z4GA 3KJVA 3AO5A 3T1YK 1WN7A 1MK9B 4BR4A 4JHDB 3FLCO 4IEIA 1EX4A 4IJNA 1L5UA 1KSPA 3GBTA 4PHTX 2QEXN 3MWPA 4CEZA 1NJZA 4V19S 2GX9A 4CZJA 3K59A 4M3RA 3TAPA 4IKFA 4FLYA 3QEPA 1KTQA 4EZ6A 2XRIA 4K41A 1ASWA 4O0IA 2UXBK 4W5NA 3QIOA 3KLIA 4LY7A 4JI0K 4Z4CA 3PX6A 4U7BA 4J2AA 4KTZA 3DI6A 1TAQA 4DR6K 4R79A 1YHQN 4FWPA 1I39A 1EWRA 2CGKA 4EP4A 1EO1A 2FXUA 1T44A 4HCCA 5MLCQ 2F7TA 4CFDA 1NGFA 3RRHA 1NOZA 4H0OA 4YOVA 4B8AB 2HOEA 5AQIA 4BC2A 4ZTFA 2D0AA 5HRSA 1TK8A 2R82A 5BPMA 3UIQA 1CLQA 2BUPA 1VSFA 3OYMA 3SQ1A 4IBNA 1WBDA 3K9JA 3KD1E 5C0YA 3LM2A 4H0YB 3SJJA 4AHCA 4GV6A 1M1KO 1SV5A 3O80A 4JI5K 4BC5A 3I8BA 3T3FA 4DU4A 3HK2A 3AGRA 2CB8A 3H1QA 5HLFA 3M8RA 5KRTA 2HBKA 3G9WA 2YNIA 3AVGA 5ADXA 1YITN 4YHHK 3TI0A 3BF1A 4GY2B 3D2EA 1S6PA 2ZJPL 1QHAA 5FPNA 3JYTA 2WH5A 1QQMA 5LL6Z 3EZWA 1S22A 3GG4A 1YJ9N 1NM1A 3AVJA 4LH4A 2AEHA 2QWPA 1HNIA 2ZE2A 4AILC 3B8AX 1IG9A 5AQGA 5CE3A 1RT1A 3NGIA 4W5RA 4W5OA 2FJ9A 3SQ2A 4EZ9A 3TU5A 3LAMA 4KTWA 4KHSA 5AQMA 3BINA 5E41A 3CM5A 1RTDA 4WYBA 3VA0A 2P9KA 4DFPA 2D5RA 2QKKA 1RDBA 3P31A 2GWKA 3OYKA 2P1JA 1ZBHA 4GW6A 1RILA 5LJVA 1LW2A 4LF8K 2ETJA 4CYEA 2Z1IA 1HQEA 1XWLA 2KLAA 4RW8A 1JJ2M 3DWLA 4BRAA 5AFUH 2QM1A 4Z4IA 5BREA 4OX9K 3NBPA 1QVGM 3ULDA 2ZGYA 4BR7A 5KQ8A 1UA0A 3UE5A 2HHHK 3KZBA 3S41A 1D9FA 3P5JA 2XY6A 2XY8A 4E0DA 2F4VK 2PY5A 3KLGA 1LWCA 4FCYA 3E01A 1A5VA 5JS1A 4YDUC 3HP6A 2P51A 4IG3A 4O8KA 2KW4A 3WXIA 1YVNA 4NYNA 3TPQA 4FLVA 2V7ZA 4NO7A 1WSFA 2G8UA 1BI4B 4DLGA 4BRNA 2P9IB 4KHWA 4GV3A 2G8VA 1SZ2A 1GOCA 2UYTA 4F8RA 3NF7A 2EWSA 3HJFA 2QWLA 3OYHA 4AM6A 3A8YA 4YL8A 1B9FA 1ZBUA 4DV0K 1U2VB 2QWOA 5LMNK 3CF5L 4XEIA 1JLEA 1VQKN 3X23A 1RBSA 4RW6A 1NJXA 1SL0A 4KI6A 1TKZA 5HL7L 3LPUA 4JKBA 3R9PA 4E7HA 5HRPA 2O8FB 3AVAA 5KTQA 1VSMA 2WUSA 4H4MA 4HVJA 4DCHA 4DFKA 3QIPA 4MO4A 4JS4A 4IDKA 1BQNA 5E26A 2OANA 2OPPA 3R6MA 3PLAA 1NK7A 1KCFA 1HKCA 3MCPA 1IKXA 4LSNA 4HUEA 4WE1A 1LV5A 1BGXT 1UOCA 2BTFA 2WC9A 3PSIA 4A57A 2ITGA 5IT9O 4YOTA 3A0IX 1L3TA 3OYCA 4JI7K 3O4WA 4DV6K 4HDQA 1X9JA 1U04A 2RE2A 3KK3A 1IKVA 3BF3A 4FK0A 3VA3A 4DQIA 1KLNA 1RBUA 2QK9A 2ABDA 4CJ7A 1NKEA 3VQDA 4CIEA 3OS1A 4M7XA 1I94K 3OTOK 3G71N 3O9SA 3DLLL 1RTJA 3CMEN 4FO0A 4F3OA 2E2QA 2CH6A 4I9QA 3AGKA 3AVFA 3AA3A 4CZLA 2LBBA 4A62A 4CJSA 3VQ5A 3SPYA 3RTVA 2X6NA 3QNOA 5I42A 2JLEA 2I7PA 1VRUA 3CPWM 5AQTA 1NI2A 3L2VA 4B9SA 4FLXA 4JLHA 3MX5A 1FKOA 3UKUA 3L2UA 1RTHA 3JS6A 3U3GA 4AHRA 1EP4A 3LDPA 3LPTA 1HJRA 4DTMA 1VQNN 5C10A 2ZJQL 3RR7A 3NGYA 1ASVA 2HHTA 5AQWA 3M5RA 4QS7A 1GLLO 4C1NK 4A59A 3U3YA 1JLQA 4BC3A 2HHQA 5JVGL 3O3FA 1Z05A 1TK5A 3BDPA 1S9EA 2UXDK 4OKEA 2W42A 3THYB 3SBTA 1K73O 4JEPA 4KHQA 2P9LB 3VPZA 3L8BA 3P83D 4WQ4A 3JAMO 5BR8K 2IVPA 1VBHA 3NF8A 1GOAA 1NGGA 1U2VA 1KLMA 4NLBA 3SUNA 3AVKA 1DEJA 4CEBA 3DYAA 4BRMA 5AQKA 3E9LA 4DV3K 2V52B 1BIUA 1XMOK 2G8KA 5BN9A 4DQPA 4DTRA 1IH7A 2NRZA 5JMVA 1GLBG 4CZHA 4L3QA 4GV9A 2ZJRL 3RWUA 4FJJA 4I6MA 3SPZA 4BWMA 1T3VA 1YJNN 3L2RA 2UU9K 4MQ3A 1VSIA 3PV8A 4B3RK 2DTUA 1N8RO 2FSJA 3R1XA 3CC4N 4C8NA 4BRHA 1CZBA 2NLXA 2OPRA 1VSEA 4YOWA 4Z94A 2VG6A 2HVIA 2QWMA 2HHWA 2D0CA 4DKWA 4DQSA 1U6ZA 4QS8A 1NK8A 3QBXA 3K9KA 1BI4A 2HF3A 1HYZA 1Y19B 1T8EA 1NJIO 2XHBA 4KB1A 2JWKA 2G8IA 2J0KA 5CZ2A 5CZ1A 3WXJA 4EHTA 4LFAK 2OYQA 1N5YA 4CJRA 3VEZA 3OYLA 2FF3B 4H5RA 1F21A 2YHAA 4X62K 2ATQA 3ZCMA 3DOLA 2D1KA 4FZXC 1OH6A 1J54A 3ID8A 4BC4A 3M8SA 4IO8A 4CK1A 4UQGA 1W0HA 4H5VA 4CBUA 4BE2A 1FW6A 3AAPA 1G99A 1WSHA 4YORA 3C6HA 3O9QA 3L3VA 3RSEA 3ZYYX 5J2MA 3J81O 1Q7YO
chains in the Genus database with same CATH topology
1KC7A 2P9PB 2D2QA 1J6ZA 2KKZA 4BRFA 1NWKA 2D11A 1YF5L 5C2FA 3N4PA 4BRIA 4PKHA 4NY0A 4ISEA 4FWOA 3CJCA 3EN9A 1KXPA 3D2EB 2J0MA 3H6EA 1BO5O 4IXCA 4WQ5A 2E20A 5TKYA 3SAHA 3WQTA 3BP8A 3MDQA 1RDUA 3CCMN 1P90A 5BN8A 4M63C 3WT0A 2QWNA 4EIAA 2W40A 3ZX0A 3ENHA 2GWJA 3O9RA 5KPTA 2FLOA 3EPYA 3FZFA 5AQJA 2E88A 2CQUA 1HX1A 1OKJA 4ISFA 5AQYA 3WQUA 4BRDA 5TKWA 4JKGA 2Q36A 3CCJN 5AR0A 4BROA 5GINA 5AZIA 2P9SA 2YJEA 1NGDA 2I1KA 1VQLN 2ASPA 2E2NA 3AU4A 3QFPA 4MDBA 4H03B 5AZIB 3RSEB 4BRCA 5F0XA 2YX6A 3C7NA 1YI2N 2AP1A 1MK9B 4BR4A 4JHDB 2ZWHA 3CD6N 2YCHA 1CZAN 3FLCO 4IEIA 3IFRA 4CBXA 1ILYA 3WXLA 4IJNA 4KH4A 2OTLN 1GLJO 1Z6RA 2COPA 3GBTA 3LDNA 2JWLA 3MWPA 4CZFA 4PHTX 5ELZA 2QEXN 2GX9A 2HBJA 3MN6A 5EXWA 5EX5A 4CZJA 5HOOA 4KH6A 3IDHA 5BRFA 5H1SQ 3H1VX 3CQXA 2NRHA 3U9DA 3U8XA 5LY3A 1KD1O 4K41A 1HBKA 2D10A 4IDHA 4GNIA 2P9SB 4C23A 1NTIA 4JKAA 3NMUA 4U7BA 3DXMB 1KAZA 1ATNA 3FE1A 5EY4A 4R79A 4FWMA 1YHQN 4FWPA 3P38A 2P9NA 2ZGZA 4AF1A 2CGKA 4FOIA 1KAXA 3O8MA 4M7YA 1NGBA 3M3ZA 4YDUA 4UY8O 4CD1A 1EO1A 2FXUA 1T44A 3OBYA 4DB3A 5BPNA 3P4IA 1HPMA 2F7TA 5MLCQ 4ILHA 1NGFA 5JICA 1GG3A 4YOUA 4H0OA 3SK3A 4YOVA 2HOEA 3CJ1A 3O9UA 4JAXA 3UKRB 2GUPA 3FZLA 5AQIA 5GIPA 4BC2A 3KK7A 4MDAA 5GAEP 2PBDA 1XQSC 1BU6O 5AQQA 2HF4A 2YHXA 1S3XA 2R82A 5BPMA 2QI2A 4K43A 2BUPA 4MLEA 3RVCA 2NRRA 5M1NA 3FZKA 5M1FA 3VF6A 3K9JA 5C0YA 2HSTA 3LM2A 4H0YB 4GV6A 3D7EO 1YXQA 5E84A 3A5NC 1M1KO 3R8EA 4BR0A 3O80A 5M1KA 3E1YA 4BC5A 5AQRA 3I8BA 3EE8A 3CCUN 4BG8A 5AQFA 4A2BA 4F9OA 1P8ZA 4FVUA 4DHYA 3AGRA 5AQSA 2CB8A 4JK7A 3H1QA 3ZX2A 2X0SA 2PAVA 1Q86O 3VF2A 2HBKA 3KHYA 3R3LA 2ASOA 4BGAA 3G9WA 3CCRN 1ATSA 1YITN 1MA9B 5ADXA 2EMTA 1GLCG 3AARA 2ITMA 3QMLA 1BDGA 3BF1A 2WBNA 4GY2B 4B1XB 1YJWN 3D2EA 2ZJPL 1QHAA 4DXAB 3BEXA 2V7YA 2WH5A 1QQMA 2A6AA 3EZWA 1S22A 3FR0A 3GG4A 3U4LA 3UKRA 4EFHA 1NM1A 1YJ9N 1C0GA 3QBWA 2AEHA 2FDQA 1SS6A 3KWGA 4CZMA 2QWPA 3DXKA 4FWSA 1HKBA 3B8AX 5AQGA 3CJBA 3VTHA 1IG8A 4IZ9A 5CE3A 3IMXA 4BG9A 2FJ9A 1IJJA 4B1VA 3U8ZA 5GAHP 3TU5A 5DM7L 1WOQA 4IOCL 1VQMN 3CCLN 1NGJA 2Q0UA 5AQMA 3HOSA 3BINA 3TSPA 3O1WA 4JKHA 3VEXA 4WYBA 3MN5A 5AQZA 5FPNA 2P9KA 5GIOA 1S72N 2FSNA 1SGHA 3P31A 5AQXA 1HUXA 2GWKA 1XUPO 2A41A 4FPAA 2ZPYA 2QA4N 2QTDA 3CERA 3QFUA 1MWKA 3CJ7A 3I33A 1BWFO 4FWLA 3VESA 5LJVA 3H45C 4PKGA 4CYEA 3QB0A 2QWRA 4IWVA 3VEVA 2D4WA 4JKFA 1GLAG 2EMSA 2KLAA 5C2DA 5LJWA 1JJ2M 3T7ZA 3T69A 1NGHA 3F5TA 3AU5A 3WA0A 1X3NA 3DWLA 4BRAA 3CCSN 1BUPA 2P9LA 4LC9B 3LDLA 5AFUH 2QM1A 4WFNL 5B8HA 5BREA 3CCEN 3D2FA 3EKSA 1ISNA 1HLUA 1HKGA 3EKUA 3ENOA 4BRQA 5EVZA 3MMVA 5JLFA 2ZGYA 1QVGM 3CC7N 1MIXA 3MN7A 4BR7A 5KQ8A 3CJ9A 1RGIA 2A3ZA 4PKIA 3UE5A 5FPEA 4PL8A 3KZBA 3S41A 4O5FA 4BR2A 1RDWX 1VQ8N 3PZDA 4A5AA 1NGCA 1J19A 3ENBA 1X3MA 1KAYA 2H3GX 3GOIA 1E5WA 1HB8A 3JXUA 4YDUC 1DKGD 4WFBL 3O1BA 4RWTA 4YOYA 4YOXA 4O8KA 2CGLA 1DGKN 1YVNA 3WXIA 4OPAA 4CI6A 4CZIA 3TPQA 2V7ZA 4NO7A 3MX2A 1Q82O 2F9TA 5AQUA 4BR9A 4E1JA 3WEEB 2P9IB 4BRNA 3UKUB 5JLHA 4BRLA 5BR9A 1VQ7N 3AY9A 4GV3A 3I55N 3LDQA 1W97L 1SZ2A 2Q2RA 2UYTA 4WCEL 2RQ1A 4GVEA 5BRHA 3C7NB 2EWSA 2QWLA 1RFQA 4NLCA 4AM6A 2E1YA 3CJAA 3Q7BA 4AM7A 3A8YA 4YL8A 1JCGA 2D0PA 4H5TA 4RCHA 1U2VB 2QWOA 4B9QA 1Q18A 2Q0RA 4XEIA 3J7ZO 3CF5L 2FSKA 3GDQA 1VQKN 3O6WA 3X23A 4MLHA 3VF4A 3VGMA 1NMDA 3C65A 2WFBA 3MN9A 4FWQA 3SLCA 4XH4A 2FF6A 4B1YB 3ATUA 3CIPA 3GL1A 5AFUA 5AQVA 5HL7L 3ATVA 5KPRA 3HBTA 4JKBA 3G25A 4FOEA 3R9PA 2E2OA 2Q97A 2QW9A 1SQKA 5BPLA 4HDOA 3EO3A 3O08A 4A5BA 2CGJA 3SMSA 2IIRA 2WUSA 2PFUA 4FWRA 3OA9A 3WEEA 3ZEUB 4U67L 4DCHA 4EHUA 2P9NB 1YIJN 3LDOA 4MO4A 2VYPA 3C0BA 3MWTA 3HZ6A 4EKUA 1E4FT 5E26A 5DM6L 4GXBA 4OO1J 2OANA 4CZGA 3R6MA 5M1QA 1K9MO 4CD3A 3PLAA 3U7DA 3FLVA 1V4TA 1HKCA 3MCPA 3G4SN 1VQ6N 1W2BM 1GC6A 2KHOA 5KPZA 3TTFA 3Q7CA 2GEMA 1LOTB 3GE1A 4A61A 1KC8O 2F9WA 1Y64A 2BTFA 2HRJA 3HSCA 2VWBA 4ILJA 2WC9A 3H3NO 3PIPL 4FWNA 3VOVA 2A40A 2BH1A 3VENA 4A57A 4BQLA 3CQYA 1MDUB 4YOTA 3EL2A 2Q1NA 3A0IX 4JKEA 1BG3A 2I7NA 3O4WA 3TSQA 3E9PA 3ZDTA 2NRWA 5AQNA 4HDQA 1X9JA 2RE2A 4G9ZA 3D6RA 2VGNA 3BF3A 3MCAB 4IOXA 3FFKB 4IOAL 2IVOA 4DQ8A 3HOTA 3L6QA 1ZBSA 2P9UB 4CZEA 2ABDA 4ZRIA 3HRGA 5CR4A 4CJ7A 3PIOL 2W41A 4IO9L 4JN4A 4M7XA 2NRTA 3BUZB 3O9SA 3I56N 3EE9A 3CXCM 1T6DA 3G71N 3DLLL 3CMEN 3AAQA 4FO0A 2QWQA 4IJAA 2E2QA 1DIKA 3QDKA 2QXLA 3CMAN 4B1UB 2CH6A 3ID6A 3A5LC 1QZ6A 3E66A 3AGKA 1BA1A 1QQNA 1GLDG 1EQYA 4CZLA 5IJMA 2LBBA 3KWIA 4A62A 3LL3A 3U9ZA 3G6EN 2NZTA 3CPEA 1QZ5A 2YI1A 4BVOA 1VQON 3L4QA 2I7PA 4WQ4C 2NRVA 3CPWM 5AQTA 1NI2A 4A2AA 3WUHA 3WXMB 4BQZA 1MWMA 2A5XA 2J4RA 4NB4A 3VMFB 2Q31A 3H46O 1GLFO 1O13A 4BRGA 4HWIA 3MX5A 4K42A 4XH5A 3UKUA 4CZKA 3ZX3A 1JCEA 1ESVA 3JS6A 4CBWA 3CC2N 4I6MB 5F1XA 3LDPA 2HBMA 2YHWA 1ST7A 3D2FB 3L4IA 1ACAA 3SBGA 2NNWA 3CETA 1VQPN 1VQNN 4WFAL 5C10A 2ZJQL 5AQWA 4BGBA 3M5RA 3ULEA 2YJFA 4QS7A 1GLLO 3F9MA 3MK6A 5FPMA 2IVNA 3SMPA 1NGIA 1WUAA 1K8KB 3VEYA 3CI5A 4A59A 3IKMA 1R59O 1EF1A 4C1NK 4EAHD 2HE7A 4PL7A 3WXKA 4BC3A 3FP5A 3ZEUA 3HM8A 2NRXA 3OBWA 5ADXH 5JVGL 2DIKA 1Z05A 4JKCA 2YVCA 3N4QA 4JK8A 4B1WB 3IUCA 3DJCA 1LCUA 2I1JA 2AA4A 3O9TA 5F2RA 5FPDA 4JD2A 4C1NI 3SBTA 1K73O 4JEPA 1NGEA 2P9LB 3ZETB 2GTDA 3VPZA 3TTCA 2E1ZA 3VETA 1SAZA 3VTIA 4WQ4A 3VERA 1BA0A 1YAGA 3SJHA 1OVYA 1K8AO 3CCQN 1JCFA 2IVPA 4B1ZA 5JVLA 1VBHA 2ASMA 5AQPA 1NGGA 1GLEG 1U2VA 3W3DA 1H4RA 4NLBA 3FGUA 1TYQB 5AZJB 3VEOA 1XC3A 3SAFA 1DEJA 4BREA 3CCVN 1QVFM 4P7IA 4BRMA 5AQKA 4JD2B 5M1OA 3E9LA 4BY9C 3QIJA 3J8AA 2P9IA 3UB5A 4ZRKA 2V52B 4ISGA 4BVPA 3FZMA 4H0PA 3DXMA 5AQOA 5BRDA 5BN9A 2J0JA 2CH5A 2GELA 4KBOA 1H1VA 1BOTO 2NRZA 5JMVA 4H5NA 1GLBG 3PVLA 4FWKA 5I9EB 1ATRA 4CZHA 4L3QA 4GV9A 2P9UA 2ZJRL 1NVLA 4FPBA 4K25A 4I6MA 1NGAA 2P9PA 4FL9A 3OW2M 1TYQA 1T3VA 4F7GA 3IVFA 4QS9A 5AZJA 4ILGB 1YJNN 4H0TB 1TUUA 3VEWA 4ZRJA 1MIZB 3TTDA 1GGOA 4IFEA 5GADP 3M6GA 2FSJA 3R1XA 3CC4N 1N8RO 2A42A 3NVKA 3A5OC 4BRHA 4BRPA 3FZHA 3LM9A 5JVHL 5M1PA 3DAWA 4JNEA 4OPHA 1V4SA 2VGMA 5KQDA 2NLXA 4YOWA 1DT9A 4Z94A 3HI0A 4TKNA 4Y0WA 3VGLA 4HTLA 3DXKB 2QWMA 4O8UA 1M90O 3C6AA 3OHRA 1VQ9N 1VAZA 4BR5A 4JK9A 3M1FA 4DKWA 2AL6A 5AQHA 1U6ZA 4QS8A 1T6CA 4WQ5C 3F2KA 3NVMA 3QBXA 4JKGB 2HF3A 3K9KA 3P39A 3QICA 1HB6A 1C0FA 3W0LA 1Y19B 1NJIO 1VQ4N 1TUYA 3H3OB 4FSVA 4IEEA 4H5WA 3SAGA 2HBLA 2JWKA 3ZETA 4RTFD 2J0KA 2E8AA 2RHKA 1D4XA 3KVGA 1K8KA 3HTVA 3WXJA 2ZF5O 4EHTA 1KBLA 2V51B 4JKDA 3ULEB 5CHIA 4KH5A 3VEZA 2FF3B 4H5RA 1Q81O 4XH1A 3E9OA 1NBWA 2P9KB 5GAGP 4BRKA 5C12A 5AQLA 1HJOA 2VCPA 2YHYA 3TSUA 1YUWA 2D1KA 4H0XB 1E4GT 3ID8A 4WF9L 4H0VB 1GC7A 4BC4A 2D0OA 4IO8A 4H5VA 3O5BA 3VGKA 4CBUA 3L0QA 1VQ5N 1MK7B 1KQSM 3AAPA 1G99A 4YORA 1VBGA 3C6HA 3O9QA 5EOYA 1JDEA 1QQOA 3RSEA 5C15A 4MO5A 1ZC6A 2DPNA 1NLVA 3ZYYX 3A5MC 3CHWA 2HMPA 4J8FA 1ZXOA 2E2PA 2OTJN 4JHDA 1Q7YO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKB A;  3E9L A;  3E66 A;  4JKD A;  3SBT A;  4ILJ A;  3SBG A;  4JKA A;  3E9O A;  4JKE A;  3E9P A;  4JK9 A;  4JKG B;  4ILH A;  4JKF A;  4ILG B;  4JK7 A;  4JKC A;  3ENB A;  4JK8 A;  4JKG A;  4JKH A; 
#chains in the Genus database with same CATH topology
 1KC7 A;  2P9P B;  2D2Q A;  4NCG A;  4Z0U A;  4ID5 A;  1RT5 A;  3N4P A;  4LF6 K;  1LWE A;  3AVH A;  4DTX A;  1A5W A;  5TKY A;  3SAH A;  3WQT A;  3BP8 A;  3TAG A;  3TAM A;  3WT0 A;  2QWN A;  5HRN A;  2W40 A;  3ENH A;  1BHL A;  3FZF A;  4DV5 K;  5AQJ A;  4CJ4 A;  1SL2 A;  2CQU A;  1OKJ A;  4JI4 K;  4M3Y A;  5C25 A;  3ZLJ A;  3D45 A;  4JKG A;  3S9H A;  3AO1 A;  3MXI A;  2YJE A;  3K5N A;  4JV5 K;  1Q9Y A;  1REV A;  5AZI B;  4OKK A;  3RSE B;  4H03 B;  5F0X A;  3C7N A;  4JYA K;  2ZWH A;  1SKR A;  3DLK A;  3CD6 N;  2YCH A;  1OH8 A;  4CBX A;  3ALY A;  1ILY A;  4K0K K;  5KI6 A;  4RW9 A;  2UUB K;  4FJ8 A;  2COP A;  3C6T A;  2JWL A;  4CZF A;  1JXB A;  5HOO A;  2A1R A;  3H1V X;  1RBR A;  3CQX A;  1OH7 A;  3U8X A;  5LY3 A;  2FC0 A;  4OJR A;  3TAQ A;  1VHX A;  4C23 A;  4J2B A;  3HPH A;  3AV9 A;  4E89 A;  3DRR A;  2OZS A;  1ATN A;  1S1T A;  4CJU A;  2UXC K;  2Y1J A;  1KAX A;  4UY8 O;  1CXQ A;  2HND A;  4DB3 A;  4N47 A;  1X9M A;  2VQE K;  4CHY A;  1GG3 A;  2O4I A;  4YOU A;  3UKR B;  4KHP K;  3FZL A;  4X65 K;  2PYJ A;  2PBD A;  3V6D A;  3MEG A;  1BU6 O;  4PA1 A;  5AQQ A;  4FLZ A;  4MLE A;  1C0T A;  3FZK A;  4M3T A;  4DR2 K;  1HR0 K;  3A5N C;  4CJF A;  1KFS A;  3LP3 A;  4L8R B;  5FRN A;  4IFV A;  3VQA A;  4FVU A;  5AQS A;  3ZX2 A;  2IC3 A;  3V1O A;  3DMJ A;  3A2F A;  4JI8 K;  3HL8 A;  4JRP A;  3G0Z A;  2ZQB A;  1YJW N;  4CGI A;  1HNZ K;  3RMB A;  4CHO A;  1U45 A;  1L3S A;  3R8E A;  3BEX A;  2V7Y A;  3UKR A;  4EFH A;  3K5O A;  4CZM A;  2FDQ A;  3PO5 A;  1N36 K;  3DXK A;  4FWS A;  1IG8 A;  3IMX A;  4I7F A;  1IJJ A;  3U8Z A;  5DM7 L;  1WOQ A;  4IOC L;  3CCL N;  2Q0U A;  3HOS A;  3TSP A;  3O1W A;  3MN5 A;  4H4O A;  5AQZ A;  3WNE A;  1DTT A;  4JI6 K;  4FJ7 A;  3O3G A;  4YNQ A;  1HUX A;  4FPA A;  2QTD A;  3IS9 A;  3KK1 A;  3QFU A;  4CIF A;  3PSF A;  3LWL A;  1BWF O;  3VES A;  4CF1 A;  4DTU A;  1Y97 A;  3QB0 A;  1HMV A;  1HRH A;  2QWR A;  4ZHR A;  2F8S A;  3ZT2 A;  3T7Z A;  1NGH A;  3WA0 A;  1X3N A;  3T19 A;  1BUP A;  4M45 A;  3AA5 X;  2HNZ A;  3CCE N;  1HLU A;  4G9Z A;  3ENO A;  5JLF A;  2YKN A;  1MIX A;  2A3Z A;  1YTU A;  4PL8 A;  2OCE A;  3DLH A;  4N76 A;  4CJE A;  1BQM A;  1VQ8 N;  3PZD A;  1NGC A;  1X3M A;  3O1B A;  4RWT A;  2RPI A;  5JS2 A;  2X74 A;  2X6S A;  4BE1 A;  3PX4 A;  2RN2 A;  1Q82 O;  1IBL K;  3KLE A;  5AQU A;  1YIJ N;  3WEE B;  1VQ7 N;  1TL1 A;  4BRL A;  2DFE A;  3I55 N;  2Q2R A;  4DUY K;  4WCE L;  5BRH A;  3SCX A;  3Q7B A;  1S1U A;  3V9X A;  1JCG A;  4DV2 K;  4RCH A;  2VWK A;  4B3O A;  2Q0R A;  1DTQ A;  3J7Z O;  2FSK A;  4DSL A;  4MLH A;  3VF4 A;  3KLH A;  3VGM A;  4LF9 K;  3C65 A;  2WFB A;  4FJN A;  3SLC A;  4XH4 A;  2FF6 A;  3CIP A;  3GL1 A;  3ATV A;  5CYM A;  3HBT A;  4B3T K;  4FOE A;  4CJT A;  3NH1 A;  1SQK A;  4Z4E A;  4HDO A;  1UAX A;  4A5B A;  2CGJ A;  3KLF A;  2IIR A;  1WAF A;  1S5J A;  4U67 L;  4NYF A;  3PUF A;  4EHU A;  1MU2 A;  2P9N B;  4LSL A;  3LDO A;  4G1Q A;  3C0B A;  5FRM A;  3HYF A;  1E4F T;  3HZ6 A;  2DFH A;  5DM6 L;  4DF4 A;  3PY8 A;  4CZG A;  4CD3 A;  2UUA K;  3F73 A;  2Z1J A;  4J2D A;  3FLV A;  1V4T A;  5KRS A;  3LZJ A;  4KV8 A;  4LF4 K;  1VQ6 N;  1RT7 A;  3Q7C A;  4YY3 K;  1LOT B;  4LF5 K;  4Z4H A;  4F2S A;  2VWB A;  2FBV A;  3SZ2 A;  3VOV A;  2O8E B;  2A40 A;  2BH1 A;  4BQL A;  5A2Q O;  3CQY A;  1HYS A;  2Q1N A;  4JS5 A;  2BAN A;  3THW A;  1BG3 A;  1UA1 A;  3TSQ A;  2PYL A;  4MFB A;  5AQN A;  3D6R A;  2VGN A;  2DY4 A;  3EY1 A;  4N41 A;  1ZBS A;  3HRG A;  1FK9 A;  4IO9 L;  4JN4 A;  3I56 N;  3CXC M;  3EE9 A;  1T6D A;  4OPJ A;  3AAQ A;  3AVL A;  1TKD A;  4B1U B;  3ID6 A;  3A5L C;  3HT3 A;  1QZ6 A;  3K5L A;  3E66 A;  4M3U A;  1BA1 A;  1CZ9 A;  3ISN C;  1NG9 A;  1D9D A;  3LL3 A;  1HYV A;  3CPE A;  1WBB A;  2YI1 A;  1VQO N;  5KGX A;  3L4Q A;  4WQ4 C;  1MWM A;  1LAV A;  2A5X A;  3VMF B;  2Q31 A;  1GLF O;  1O13 A;  4BRG A;  3SQ0 A;  3DLR A;  4HWI A;  2OPQ A;  4XH5 A;  3ZX3 A;  3RMC A;  4FM2 A;  3CC2 N;  4I6M B;  3SV4 A;  1RT6 A;  2YHW A;  1ST7 A;  3D2F B;  2NNW A;  3RMA A;  3LDS A;  2VG7 A;  4LH5 A;  3ULE A;  2YJF A;  3OY9 A;  3MK6 A;  2HHS A;  4FVM A;  3QET A;  1NGI A;  1K8K B;  3BGR A;  3VEY A;  1R59 O;  1R0A A;  1KVA A;  1B9D A;  4PL7 A;  3WXK A;  3FP5 A;  1XHX A;  3VQP A;  4CGJ A;  4KHU A;  1LCU A;  2O8F A;  1N33 K;  4JD2 A;  4FJL A;  2YNH A;  1SL1 A;  3SUQ A;  1NGE A;  1NJW A;  3JSM A;  1DLO A;  3TTC A;  1TKT A;  2E1Z A;  2R7Y A;  3QNN A;  3VER A;  1BA0 A;  4AHT A;  3SJH A;  4C8O A;  3SNN A;  4OLB A;  4B1Z A;  3W3D A;  1H4R A;  4CGF A;  3CG7 A;  3CCV N;  3SAF A;  4B3M K;  5C42 A;  2F96 A;  4OGC A;  5FDL A;  5AJ3 K;  4JD2 B;  3TWH A;  1GOB A;  4LD0 A;  4CJ3 A;  1ZBF A;  2O4G A;  4ZRK A;  4ISG A;  4BVP A;  4H0P A;  1VSD A;  3AO4 A;  4FJM A;  5AQO A;  4F2R A;  2J0J A;  4KBO A;  1RCH A;  3ZSR A;  4ELU A;  4DS4 A;  4H5N A;  1QTM A;  4FWK A;  2E6M A;  4CES A;  3AO2 A;  1NVL A;  4FPB A;  4PWD A;  4B9M A;  2P9P A;  3OW2 M;  1W9H A;  1C0M A;  3HPO A;  1MIZ B;  1LWF A;  4CJP A;  3NVK A;  1QS4 A;  1U49 A;  3A5O C;  1K6Y A;  3FZH A;  5M1P A;  3DAW A;  4OPH A;  5KQD A;  2FBT A;  3HI0 A;  4CFB A;  4DV7 K;  1T7P A;  3VGL A;  3C6A A;  3K57 A;  1VQ9 N;  3M1F A;  3NVM A;  4JKG B;  3P39 A;  4B08 A;  1HB6 A;  4I2P A;  1XNR K;  3SAG A;  4IEE A;  3VQ8 A;  5J2N A;  2E8A A;  4CJW A;  4B3S K;  2ZF5 O;  2V51 B;  5CHI A;  4KH5 A;  1EKE A;  2P9K B;  3TAF A;  3SYZ A;  4FJI A;  1ZBI A;  3TSU A;  4OVL A;  2B5J A;  4ID1 A;  4WF9 L;  4H0V B;  2BGG A;  4M3X A;  3O5B A;  3VGK A;  4F3T A;  3L0Q A;  4PQU A;  1MK7 B;  4GKJ K;  1VBG A;  5EOY A;  2E6L A;  4MO5 A;  1NLV A;  3A5M C;  2OTJ N;  1ZXO A;  1NMN A;  3V1R A;  4CEQ A;  2HHV A;  2GBZ A;  1NWK A;  3SV3 A;  4M3W A;  2D11 A;  4IFY A;  4PKH A;  1J9A A;  3IRX A;  4FWO A;  4O0J A;  3CJC A;  2E20 A;  1RDU A;  1P90 A;  1ZBL A;  2FBX A;  5KPT A;  1RT2 A;  2E88 A;  4DR3 K;  5TKW A;  1SUQ A;  4DR5 K;  1B92 A;  5GIN A;  3I8D A;  2P9S A;  3PX0 A;  4H8K A;  2E5L K;  5T7B A;  1NGD A;  3THV A;  4BE0 A;  3I0R A;  4Q0B A;  2Z1H A;  1RBT A;  4HTU A;  4BRC A;  2AP1 A;  4FJX A;  4Y1D A;  3WXL A;  3HP9 A;  4KH4 A;  1BIS A;  1Z6R A;  3LDN A;  4ELT A;  4CF8 A;  1CXU A;  3MN6 A;  2HBJ A;  3LP0 A;  4KH6 A;  3IDH A;  5BRF A;  2NRH A;  4X64 K;  4DU1 A;  4ELV A;  1FKP A;  4CJK A;  2D10 A;  2XO7 A;  4RW7 A;  1NTI A;  3NMU A;  4I2Q A;  1HNV A;  2IAJ A;  1IO2 A;  5EY4 A;  3P38 A;  2ZGZ A;  4FOI A;  3O8M A;  3M3Z A;  4CD1 A;  3OBY A;  1EET A;  4KRF A;  5BPN A;  3P4I A;  1HPM A;  3CJ1 A;  4JAX A;  2P5O A;  4C8K A;  2GUP A;  1LW0 A;  4DSF A;  4Z4F A;  4GKK K;  1SKW A;  1XQS C;  3ZSZ A;  3J7A P;  4O44 A;  4K43 A;  3RVC A;  5M1F A;  2LSN A;  2HST A;  3OVN A;  3D7E O;  1NK5 A;  4BR0 A;  3U6F A;  4B9U A;  5AQR A;  3EE8 A;  4FJG A;  4BG8 A;  5AQF A;  5FRO A;  4DHY A;  4JK7 A;  3AA2 A;  4CHN A;  2PAV A;  4DSE A;  4FK2 A;  5K14 A;  3KHY A;  3R3L A;  3CCR N;  2GUI A;  1MA9 B;  1VSK A;  1GLC G;  4B1X B;  2WBN A;  5J2P A;  1IKY A;  4DXA B;  2A6A A;  1RT4 A;  3KWG A;  4FJH A;  2HHX A;  4YFU A;  5CYQ A;  1KRP A;  4FYD A;  1WAJ A;  3CJB A;  3VTH A;  4IZ9 A;  3QEV A;  4B1V A;  5GAH P;  2P5G A;  4O5B A;  1VQM N;  1NGJ A;  3BZC A;  4DSJ A;  3DM2 A;  5GIO A;  1S72 N;  2FSN A;  3VQ9 A;  1XNQ K;  5AQX A;  3OJU A;  2A41 A;  1JLA A;  4OPK A;  5J2Q A;  1QE1 A;  3CJ7 A;  4FWL A;  1IV0 A;  1KFD A;  1TAU A;  3H45 C;  1I3A A;  4PKG A;  4FJK A;  4IWV A;  3VEV A;  4DMN A;  4JKF A;  2EMS A;  5C2D A;  1NK0 A;  3VQ6 A;  3F5T A;  3AU5 A;  1D5A A;  3CCS N;  2P9L A;  4LC9 B;  4I9L A;  3LDL A;  4LF7 K;  5KGW A;  4WFN L;  1C1C A;  5HP1 A;  4C8M A;  3D2F A;  3QO9 A;  1ISN A;  1HKG A;  3EKU A;  5EVZ A;  3CC7 N;  2YKM A;  3CJ9 A;  4PKI A;  5FPE A;  4B8C A;  4BR2 A;  3THX B;  2ZD1 A;  1J19 A;  2H3G X;  1DKG D;  4YOX A;  1JLB A;  5SWM A;  4Q5V A;  4OPA A;  4CI6 A;  1RT3 A;  3O4N A;  2F9T A;  5JLH A;  3ZT3 A;  4FM1 A;  3AY9 A;  3LDQ A;  4CJL A;  1W97 L;  4CJ5 A;  4CK2 A;  3OYD A;  4IG0 A;  3THX A;  2D0P A;  4H5T A;  4B9L A;  3K58 A;  1C0U A;  4CE9 A;  3GDQ A;  4DLE A;  1HNW K;  1NMD A;  3MN9 A;  4TSX A;  4B1Y B;  4E7J A;  3ATU A;  5AQV A;  5KPR A;  3G25 A;  4DR4 K;  2E2O A;  4CIG A;  2QW9 A;  5BPL A;  4LFB K;  3L3U A;  3LZI A;  1KVC A;  3O08 A;  4B9V A;  4FZZ A;  2PFU A;  3WEE A;  3OA9 A;  3ZEU B;  2OA8 A;  4GMJ B;  3MWT A;  3DRP A;  4GXB A;  3AVI A;  4BDP A;  3U7D A;  3O4Q A;  1YTA A;  3PO4 A;  1C6V A;  1W2B M;  1GC6 A;  4DQR A;  2EHG A;  2O8D B;  3GE1 A;  4KB0 A;  1JLG A;  4A61 A;  3HSC A;  4BAC A;  4ILJ A;  4FWN A;  4BDZ A;  4M41 A;  4NCA A;  1MDU B;  3EL2 A;  3DLE A;  2D0B A;  2I7N A;  3E9P A;  3RRG A;  1L3V A;  2O8C A;  3MCA B;  4IOA L;  2IVO A;  4DQ8 A;  3CFR A;  3L6Q A;  4ICL A;  2P9U B;  4ZRI A;  5CR4 A;  1J5E K;  3V9U A;  2W41 A;  3SUO A;  3ZT1 A;  2QWQ A;  4IJA A;  2O8D A;  4K8X A;  3NDK A;  1DIK A;  3QDK A;  4AHU A;  3CMA N;  3CFO A;  2A1S A;  1QQN A;  1VSJ A;  4KHN A;  2YNG A;  5EU7 A;  3KWI A;  4Y1C A;  3SUP A;  3T1A A;  2NZT A;  1QZ5 A;  3S3O A;  4BVO A;  4GVM A;  1VK0 A;  3WUH A;  4BQZ A;  3HXM A;  1YVU A;  1HNX K;  5LMU K;  4K42 A;  3ZT0 A;  1BCO A;  4JI3 K;  4CBW A;  5F1X A;  1N34 K;  2HBM A;  3SBG A;  1JLF A;  4WFA L;  2IDO A;  4E7K A;  3CQ8 A;  4BGB A;  3F9M A;  1U48 A;  5FPM A;  1BL3 A;  2IVN A;  4CEF A;  3LP1 A;  3SMP A;  3RMD A;  1Z26 A;  2G8H A;  1WUA A;  3IKM A;  4RW4 A;  1EF1 A;  2HE7 A;  4FZY A;  5ADX H;  3OBW A;  2O8B A;  2DIK A;  2YVC A;  3N4Q A;  4JK8 A;  3ASM A;  4B1W B;  3IUC A;  3DJC A;  2I1J A;  5FPD A;  3O9T A;  2QXF A;  2QKB A;  4C1N I;  4DWI A;  2BE2 A;  3S3M A;  1TL3 A;  3HM9 A;  2GTD A;  2W6L A;  2JGU A;  1WSG A;  1X9W A;  1YAG A;  1IKW A;  1QSL A;  2VQF K;  3OYI A;  5JVL A;  1TGO A;  1TYQ B;  1XC3 A;  4BRE A;  1QVF M;  4P7I A;  2EX3 A;  5M1O A;  3LP2 A;  3QIJ A;  3J8A A;  2P9I A;  4KI4 A;  3UB5 A;  2KTQ A;  3FZM A;  1S1X A;  3DXM A;  1NK4 A;  1UWB A;  3MAQ A;  1FXX A;  1WLJ A;  4E7I A;  2GEL A;  3HPG A;  2KFZ A;  2Y1I A;  3MEE A;  5I9E B;  4O55 A;  3OYF A;  4K25 A;  1TYQ A;  2VG5 A;  3IVF A;  3B6P A;  4ILG B;  4H0T B;  4HUF A;  1TUU A;  3VEW A;  1GGO A;  1E3M A;  5GAD P;  3M6G A;  3BZK A;  4CGD A;  2A42 A;  4BRP A;  3LM9 A;  4JNE A;  4CHZ A;  2VGM A;  1Q9X A;  1DT9 A;  4FLW A;  3VN5 A;  3NE6 A;  4JI1 K;  4Y0W A;  3AO3 A;  4HTL A;  3DXK B;  4O8U A;  4X66 K;  3EEQ A;  2AL6 A;  3ZT4 A;  4WQ5 C;  3F2K A;  1WSE A;  4CEE A;  3QIC A;  1RTI A;  1C0F A;  3W0L A;  4DTJ A;  3ZSX A;  4FK4 A;  3H3O B;  4FSV A;  1WNS A;  2HBL A;  3ZET A;  4RTF D;  1QHT A;  2RHK A;  3KVG A;  1K8K A;  3HTV A;  3ZSY A;  3NH0 A;  3KK2 A;  4JKD A;  3ULE B;  1Q81 O;  4XH1 A;  5GAG P;  5C12 A;  4OKJ A;  5AQL A;  1HJO A;  3DRS A;  2YHY A;  1YUW A;  2PZS A;  1NKC A;  1GC7 A;  2D0O A;  1OH5 A;  4M42 A;  2BDP A;  2VWJ A;  4QAG A;  4AHS A;  5C15 A;  1QQO A;  2FBY A;  1RDC A;  3CHW A;  4DSI A;  1A5X A;  4PY5 A;  4JRQ A;  1J6Z A;  2KKZ A;  4BRF A;  3I0S A;  1NJY A;  2G8F A;  1C1A A;  1YF5 L;  4BRI A;  4CFC A;  4NY0 A;  2IGI A;  2GV9 A;  4ISE A;  4K8Z A;  3EN9 A;  3H08 A;  1KXP A;  3D2E B;  4WQ5 A;  5FLX O;  1BO5 O;  1QSY A;  4CK3 A;  3MDQ A;  4KFB A;  5BN8 A;  2WTU A;  4M63 C;  4CVN E;  1VSL A;  4EIA A;  4CGG A;  4HHT A;  1NK9 A;  2GWJ A;  2FLO A;  3EPY A;  2HHU A;  4LFC K;  4CJQ A;  3L2W A;  3J7Y P;  3L2Q A;  1C1B A;  4BRD A;  2B4J A;  2OZM A;  1N6Q A;  5AR0 A;  4DR7 K;  5AZI A;  4E1M A;  3K0S A;  1QQC A;  1VQL N;  4CF0 A;  2ASP A;  3AU4 A;  3QFP A;  2YX6 A;  1YI2 N;  4C8L A;  3EYZ A;  3HVR A;  3AVB A;  3P1G A;  1CZA N;  3IFR A;  3VQE A;  2OTL N;  1GLJ O;  1EXQ A;  5ELZ A;  5EXW A;  5EX5 A;  5H1S Q;  3THY A;  1WB9 A;  1RBV A;  3U9D A;  4FM0 A;  1KD1 O;  1HBK A;  4IDH A;  5HBM A;  4GNI A;  2P9S B;  3TAB A;  3KIO A;  4JKA A;  1RDD A;  3DXM B;  1KAZ A;  1G15 A;  3FE1 A;  4FWM A;  4FW2 A;  3OYJ A;  2P9N A;  4AF1 A;  2X78 A;  4M7Y A;  4YDU A;  4F4K A;  4FLU A;  1NGB A;  4O4G A;  4R5P A;  4ILH A;  5JIC A;  3SK3 A;  2RF2 A;  1D8Y A;  3O9U A;  3NHG A;  3VQ4 A;  2HB5 A;  5GIP A;  1TK0 A;  3OYB A;  3J80 O;  3KK7 A;  3WNH A;  3THW B;  4MDA A;  5GAE P;  2I5J A;  2HF4 A;  2YHX A;  1S3X A;  3QLH A;  1XI1 A;  2QI2 A;  4OGE A;  4W5Q A;  2NRR A;  1JXE A;  5M1N A;  3VF6 A;  4FXD A;  4BWJ A;  3ZSQ A;  4HUG A;  2O8B B;  1YXQ A;  5E84 A;  3KTQ A;  5M1K A;  3MXM A;  3E1Y A;  3CCU N;  4A2B A;  3C94 A;  4F9O A;  1P8Z A;  1SKS A;  4DV1 K;  2X0S A;  1Q86 O;  4CHQ A;  3VF2 A;  3AVC A;  2ASO A;  4BGA A;  5SZT A;  4NXN K;  1ATS A;  2EMT A;  4KHY A;  3AAR A;  2ITM A;  3QML A;  1BDG A;  3ZSV A;  4CEO A;  4E3S A;  3OYN A;  1U47 A;  4KPY A;  4CEA A;  3FR0 A;  3U4L A;  2KZZ A;  1C0G A;  3QBW A;  1SS6 A;  1VRT A;  1HKB A;  1X1P A;  3WNG A;  2O8C B;  1L3U A;  4BG9 A;  3NAE A;  2W6K A;  4E7L A;  3NCI A;  4DTS A;  3KKS A;  3CYM A;  1NNE A;  4JKH A;  1HPZ A;  3VEX A;  4CJV A;  5IWA K;  1SGH A;  1FJG K;  1XUP O;  2ZPY A;  2QA4 N;  3CER A;  1MWK A;  3I33 A;  1WSI A;  5J1E A;  3KKR A;  4DV4 K;  4CFA A;  2D4W A;  1GLA G;  5LJW A;  3T69 A;  4CHP A;  3VQ7 A;  2HW3 A;  1XC9 A;  1NOY A;  1NU0 A;  5B8H A;  3EKS A;  1Q8I A;  4BRQ A;  4DTP A;  3MMV A;  3D0P A;  1EWQ A;  3MN7 A;  4DU3 A;  1RGI A;  3QEI A;  5D3G A;  4O5F A;  3VQQ A;  4AHV A;  4NCB A;  1RDW X;  1JL2 A;  2AJQ A;  4A5A A;  2HVH A;  1ZYQ A;  1QSS A;  3ENB A;  4WFB L;  1KAY A;  3GOI A;  1E5W A;  1HB8 A;  3JXU A;  4YOY A;  4PUO A;  4B9T A;  2CGL A;  2OPS A;  1DGK N;  4B9N A;  1OVQ A;  4CZI A;  3OYA A;  3FFI A;  3B6O A;  3MX2 A;  1T03 A;  4BR9 A;  4QOZ B;  2Q3S A;  3SQ4 A;  3UKU B;  1LAW A;  1J53 A;  3NF9 A;  3AA4 A;  5BR9 A;  5HRO A;  3OYE A;  2RQ1 A;  4GVE A;  3OS2 A;  4KRE A;  2RKI A;  3C7N B;  3OYG A;  1VSH A;  1RFQ A;  4NLC A;  4EP5 A;  3VQB A;  5C24 A;  2E1Y A;  3CJA A;  4AM7 A;  1TKX A;  3SI6 A;  2WOM A;  4B9Q A;  1Q18 A;  3O6W A;  5DK5 A;  3V9S A;  3RR8 A;  5HRR A;  3V81 A;  4FWQ A;  2IOC A;  5AFU A;  4KTQ A;  2Q97 A;  3EO3 A;  4CF9 A;  3SMS A;  4FWR A;  3O3H A;  3ZSW A;  1S1W A;  3AVN A;  3DLG A;  2VYP A;  4DG1 A;  4EKU A;  4NXM K;  3ZSO A;  4OO1 J;  3MXJ A;  5M1Q A;  2IS3 A;  1K9M O;  3IG1 A;  3VQC A;  3LWM A;  3G4S N;  2KHO A;  5KPZ A;  4E19 A;  3F9K A;  3TTF A;  1JLC A;  2GEM A;  5I3U A;  1KC8 O;  2F9W A;  1Y64 A;  1IBM K;  2HRJ A;  3H3N O;  3PIP L;  1S9G A;  3VEN A;  4DQQ A;  3M8P A;  3TR8 A;  2O8E A;  4JKE A;  3ZDT A;  2NRW A;  3S3N A;  4IOX A;  3FFK B;  3HOT A;  4CGH A;  4CZE A;  2YHB A;  3PIO L;  3HVT A;  2NRT A;  3BUZ B;  3LAN A;  4AH9 A;  4N56 A;  3HO1 A;  2B6A A;  2KQ2 A;  4DFM A;  2QXL A;  3MED A;  1GLD G;  1EQY A;  5IJM A;  4CEC A;  3U9Z A;  3G6E N;  5CY4 A;  3V1Q A;  2XY5 A;  3OS0 A;  4CED A;  2Z1G A;  2NRV A;  1YT3 A;  4A2A A;  3WXM B;  2J4R A;  4NB4 A;  1RDA A;  3H46 O;  3LAK A;  4CZK A;  3V4I A;  1U4B A;  1JCE A;  1ESV A;  3L4I A;  1ACA A;  3CET A;  1VQP N;  1ASU A;  4KAZ A;  4DSK A;  3TAE A;  4ZTJ A;  3CI5 A;  4EAH D;  4BDY A;  2YNF A;  3T1H K;  3QEX A;  3ZEU A;  3HM8 A;  2NRX A;  3ITH A;  3MEC A;  4M3Z A;  1TVR A;  4JKC A;  2NUB A;  1KVB A;  4FJ5 A;  2AA4 A;  5F2R A;  4DF8 A;  4CF2 A;  3K5M A;  1JKH A;  3ZET B;  1T05 A;  3VTI A;  3VET A;  1SAZ A;  1BCM A;  3OJS A;  1OVY A;  1K8A O;  3CCQ N;  1JCF A;  4DR1 K;  2ASM A;  5AQP A;  1GLE G;  1XHZ A;  4RG8 A;  4CCH A;  3QIN A;  3FGU A;  1BIZ A;  5AZJ B;  3VEO A;  3EZ5 A;  3QES A;  2XY7 A;  4KKO A;  3TAR A;  1JL1 A;  1J5O A;  4BY9 C;  1O1W A;  1S6Q A;  3WNF A;  5BRD A;  1WSJ A;  2CH5 A;  1H1V A;  1BOT O;  3HST B;  3PVL A;  2DFF A;  1ATR A;  2G8W A;  3KD5 E;  1Z25 A;  2P9U A;  5DMR A;  4OLA A;  2ZM6 K;  1NGA A;  3DLB A;  4FL9 A;  1XMQ K;  5AZJ A;  4QS9 A;  4F7G A;  3CFP A;  4FJ9 A;  3V9W A;  4ZRJ A;  3TTD A;  4DS5 A;  3K2P A;  4IFE A;  4DTO A;  4W5T A;  2KFN A;  3AVM A;  5JVH L;  3M8Q A;  1V4S A;  3V9Z A;  2E4L A;  4KO0 A;  4TKN A;  4QCL A;  4FLT A;  3C6U A;  3C95 A;  4HCB A;  1M90 O;  3QEW A;  3OHR A;  1VAZ A;  2WON A;  4JK9 A;  4BR5 A;  2YV0 X;  5AQH A;  1T6C A;  2F8T A;  3LAL A;  2HMI A;  2UUC K;  1VQ4 N;  1TUY A;  1HQU A;  1N32 K;  4H5W A;  4FW1 A;  3QER A;  1X9S A;  1RNH A;  4XIU A;  1D4X A;  1S1V A;  1KBL A;  3E9O A;  1NBW A;  2HNY A;  4BRK A;  4JI2 K;  2VCP A;  3IAY A;  4N5S A;  4H0X B;  3NGZ A;  1E4G T;  1VQ5 N;  3BY5 A;  1KQS M;  3NF6 A;  1JDE A;  1ZC6 A;  2DPN A;  3NFA A;  4J8F A;  2HMP A;  2E2P A;  4E1J A;  4DUZ K;  1W7A A;  4JHD A;  3G10 A;  4E1N A;  5C2F A;  1TV6 A;  1NKB A;  4CER A;  1IBK K;  4AQY K;  3H6E A;  2J0M A;  3DOK A;  4IXC A;  3CCM N;  4CW7 B;  4DTN A;  3ZX0 A;  3O9R A;  1NK6 A;  4J2E A;  4ISF A;  1HX1 A;  5AQY A;  3WQU A;  3NH2 A;  2KZM A;  1ITG A;  4DFJ A;  2Q36 A;  3CCJ N;  4BRO A;  3CM6 A;  3TAN A;  2I1K A;  4MDB A;  2E2N A;  4Z4G A;  3KJV A;  3AO5 A;  3T1Y K;  1WN7 A;  1MK9 B;  4BR4 A;  4JHD B;  3FLC O;  4IEI A;  1EX4 A;  4IJN A;  1L5U A;  1KSP A;  3GBT A;  4PHT X;  2QEX N;  3MWP A;  4CEZ A;  1NJZ A;  4V19 S;  2GX9 A;  4CZJ A;  3K59 A;  4M3R A;  3TAP A;  4IKF A;  4FLY A;  3QEP A;  1KTQ A;  4EZ6 A;  2XRI A;  4K41 A;  1ASW A;  4O0I A;  2UXB K;  4W5N A;  3QIO A;  3KLI A;  4LY7 A;  4JI0 K;  4Z4C A;  3PX6 A;  4U7B A;  4J2A A;  4KTZ A;  3DI6 A;  1TAQ A;  4DR6 K;  4R79 A;  1YHQ N;  4FWP A;  1I39 A;  1EWR A;  2CGK A;  4EP4 A;  1EO1 A;  2FXU A;  1T44 A;  4HCC A;  5MLC Q;  2F7T A;  4CFD A;  1NGF A;  3RRH A;  1NOZ A;  4H0O A;  4YOV A;  4B8A B;  2HOE A;  5AQI A;  4BC2 A;  4ZTF A;  2D0A A;  5HRS A;  1TK8 A;  2R82 A;  5BPM A;  3UIQ A;  1CLQ A;  2BUP A;  1VSF A;  3OYM A;  3SQ1 A;  4IBN A;  1WBD A;  3K9J A;  3KD1 E;  5C0Y A;  3LM2 A;  4H0Y B;  3SJJ A;  4AHC A;  4GV6 A;  1M1K O;  1SV5 A;  3O80 A;  4JI5 K;  4BC5 A;  3I8B A;  3T3F A;  4DU4 A;  3HK2 A;  3AGR A;  2CB8 A;  3H1Q A;  5HLF A;  3M8R A;  5KRT A;  2HBK A;  3G9W A;  2YNI A;  3AVG A;  5ADX A;  1YIT N;  4YHH K;  3TI0 A;  3BF1 A;  4GY2 B;  3D2E A;  1S6P A;  2ZJP L;  1QHA A;  5FPN A;  3JYT A;  2WH5 A;  1QQM A;  5LL6 Z;  3EZW A;  1S22 A;  3GG4 A;  1YJ9 N;  1NM1 A;  3AVJ A;  4LH4 A;  2AEH A;  2QWP A;  1HNI A;  2ZE2 A;  4AIL C;  3B8A X;  1IG9 A;  5AQG A;  5CE3 A;  1RT1 A;  3NGI A;  4W5R A;  4W5O A;  2FJ9 A;  3SQ2 A;  4EZ9 A;  3TU5 A;  3LAM A;  4KTW A;  4KHS A;  5AQM A;  3BIN A;  5E41 A;  3CM5 A;  1RTD A;  4WYB A;  3VA0 A;  2P9K A;  4DFP A;  2D5R A;  2QKK A;  1RDB A;  3P31 A;  2GWK A;  3OYK A;  2P1J A;  1ZBH A;  4GW6 A;  1RIL A;  5LJV A;  1LW2 A;  4LF8 K;  2ETJ A;  4CYE A;  2Z1I A;  1HQE A;  1XWL A;  2KLA A;  4RW8 A;  1JJ2 M;  3DWL A;  4BRA A;  5AFU H;  2QM1 A;  4Z4I A;  5BRE A;  4OX9 K;  3NBP A;  1QVG M;  3ULD A;  2ZGY A;  4BR7 A;  5KQ8 A;  1UA0 A;  3UE5 A;  2HHH K;  3KZB A;  3S41 A;  1D9F A;  3P5J A;  2XY6 A;  2XY8 A;  4E0D A;  2F4V K;  2PY5 A;  3KLG A;  1LWC A;  4FCY A;  3E01 A;  1A5V A;  5JS1 A;  4YDU C;  3HP6 A;  2P51 A;  4IG3 A;  4O8K A;  2KW4 A;  3WXI A;  1YVN A;  4NYN A;  3TPQ A;  4FLV A;  2V7Z A;  4NO7 A;  1WSF A;  2G8U A;  1BI4 B;  4DLG A;  4BRN A;  2P9I B;  4KHW A;  4GV3 A;  2G8V A;  1SZ2 A;  1GOC A;  2UYT A;  4F8R A;  3NF7 A;  2EWS A;  3HJF A;  2QWL A;  3OYH A;  4AM6 A;  3A8Y A;  4YL8 A;  1B9F A;  1ZBU A;  4DV0 K;  1U2V B;  2QWO A;  5LMN K;  3CF5 L;  4XEI A;  1JLE A;  1VQK N;  3X23 A;  1RBS A;  4RW6 A;  1NJX A;  1SL0 A;  4KI6 A;  1TKZ A;  5HL7 L;  3LPU A;  4JKB A;  3R9P A;  4E7H A;  5HRP A;  2O8F B;  3AVA A;  5KTQ A;  1VSM A;  2WUS A;  4H4M A;  4HVJ A;  4DCH A;  4DFK A;  3QIP A;  4MO4 A;  4JS4 A;  4IDK A;  1BQN A;  5E26 A;  2OAN A;  2OPP A;  3R6M A;  3PLA A;  1NK7 A;  1KCF A;  1HKC A;  3MCP A;  1IKX A;  4LSN A;  4HUE A;  4WE1 A;  1LV5 A;  1BGX T;  1UOC A;  2BTF A;  2WC9 A;  3PSI A;  4A57 A;  2ITG A;  5IT9 O;  4YOT A;  3A0I X;  1L3T A;  3OYC A;  4JI7 K;  3O4W A;  4DV6 K;  4HDQ A;  1X9J A;  1U04 A;  2RE2 A;  3KK3 A;  1IKV A;  3BF3 A;  4FK0 A;  3VA3 A;  4DQI A;  1KLN A;  1RBU A;  2QK9 A;  2ABD A;  4CJ7 A;  1NKE A;  3VQD A;  4CIE A;  3OS1 A;  4M7X A;  1I94 K;  3OTO K;  3G71 N;  3O9S A;  3DLL L;  1RTJ A;  3CME N;  4FO0 A;  4F3O A;  2E2Q A;  2CH6 A;  4I9Q A;  3AGK A;  3AVF A;  3AA3 A;  4CZL A;  2LBB A;  4A62 A;  4CJS A;  3VQ5 A;  3SPY A;  3RTV A;  2X6N A;  3QNO A;  5I42 A;  2JLE A;  2I7P A;  1VRU A;  3CPW M;  5AQT A;  1NI2 A;  3L2V A;  4B9S A;  4FLX A;  4JLH A;  3MX5 A;  1FKO A;  3UKU A;  3L2U A;  1RTH A;  3JS6 A;  3U3G A;  4AHR A;  1EP4 A;  3LDP A;  3LPT A;  1HJR A;  4DTM A;  1VQN N;  5C10 A;  2ZJQ L;  3RR7 A;  3NGY A;  1ASV A;  2HHT A;  5AQW A;  3M5R A;  4QS7 A;  1GLL O;  4C1N K;  4A59 A;  3U3Y A;  1JLQ A;  4BC3 A;  2HHQ A;  5JVG L;  3O3F A;  1Z05 A;  1TK5 A;  3BDP A;  1S9E A;  2UXD K;  4OKE A;  2W42 A;  3THY B;  3SBT A;  1K73 O;  4JEP A;  4KHQ A;  2P9L B;  3VPZ A;  3L8B A;  3P83 D;  4WQ4 A;  3JAM O;  5BR8 K;  2IVP A;  1VBH A;  3NF8 A;  1GOA A;  1NGG A;  1U2V A;  1KLM A;  4NLB A;  3SUN A;  3AVK A;  1DEJ A;  4CEB A;  3DYA A;  4BRM A;  5AQK A;  3E9L A;  4DV3 K;  2V52 B;  1BIU A;  1XMO K;  2G8K A;  5BN9 A;  4DQP A;  4DTR A;  1IH7 A;  2NRZ A;  5JMV A;  1GLB G;  4CZH A;  4L3Q A;  4GV9 A;  2ZJR L;  3RWU A;  4FJJ A;  4I6M A;  3SPZ A;  4BWM A;  1T3V A;  1YJN N;  3L2R A;  2UU9 K;  4MQ3 A;  1VSI A;  3PV8 A;  4B3R K;  2DTU A;  1N8R O;  2FSJ A;  3R1X A;  3CC4 N;  4C8N A;  4BRH A;  1CZB A;  2NLX A;  2OPR A;  1VSE A;  4YOW A;  4Z94 A;  2VG6 A;  2HVI A;  2QWM A;  2HHW A;  2D0C A;  4DKW A;  4DQS A;  1U6Z A;  4QS8 A;  1NK8 A;  3QBX A;  3K9K A;  1BI4 A;  2HF3 A;  1HYZ A;  1Y19 B;  1T8E A;  1NJI O;  2XHB A;  4KB1 A;  2JWK A;  2G8I A;  2J0K A;  5CZ2 A;  5CZ1 A;  3WXJ A;  4EHT A;  4LFA K;  2OYQ A;  1N5Y A;  4CJR A;  3VEZ A;  3OYL A;  2FF3 B;  4H5R A;  1F21 A;  2YHA A;  4X62 K;  2ATQ A;  3ZCM A;  3DOL A;  2D1K A;  4FZX C;  1OH6 A;  1J54 A;  3ID8 A;  4BC4 A;  3M8S A;  4IO8 A;  4CK1 A;  4UQG A;  1W0H A;  4H5V A;  4CBU A;  4BE2 A;  1FW6 A;  3AAP A;  1G99 A;  1WSH A;  4YOR A;  3C6H A;  3O9Q A;  3L3V A;  3RSE A;  3ZYY X;  5J2M A;  3J81 O;  1Q7Y O; 
#chains in the Genus database with same CATH homology
 1KC7 A;  2P9P B;  2D2Q A;  1J6Z A;  2KKZ A;  4BRF A;  1NWK A;  2D11 A;  1YF5 L;  5C2F A;  3N4P A;  4BRI A;  4PKH A;  4NY0 A;  4ISE A;  4FWO A;  3CJC A;  3EN9 A;  1KXP A;  3D2E B;  2J0M A;  3H6E A;  1BO5 O;  4IXC A;  4WQ5 A;  2E20 A;  5TKY A;  3SAH A;  3WQT A;  3BP8 A;  3MDQ A;  1RDU A;  3CCM N;  1P90 A;  5BN8 A;  4M63 C;  3WT0 A;  2QWN A;  4EIA A;  2W40 A;  3ZX0 A;  3ENH A;  2GWJ A;  3O9R A;  5KPT A;  2FLO A;  3EPY A;  3FZF A;  5AQJ A;  2E88 A;  2CQU A;  1HX1 A;  1OKJ A;  4ISF A;  5AQY A;  3WQU A;  4BRD A;  5TKW A;  4JKG A;  2Q36 A;  3CCJ N;  5AR0 A;  4BRO A;  5GIN A;  5AZI A;  2P9S A;  2YJE A;  1NGD A;  2I1K A;  1VQL N;  2ASP A;  2E2N A;  3AU4 A;  3QFP A;  4MDB A;  4H03 B;  5AZI B;  3RSE B;  4BRC A;  5F0X A;  2YX6 A;  3C7N A;  1YI2 N;  2AP1 A;  1MK9 B;  4BR4 A;  4JHD B;  2ZWH A;  3CD6 N;  2YCH A;  1CZA N;  3FLC O;  4IEI A;  3IFR A;  4CBX A;  1ILY A;  3WXL A;  4IJN A;  4KH4 A;  2OTL N;  1GLJ O;  1Z6R A;  2COP A;  3GBT A;  3LDN A;  2JWL A;  3MWP A;  4CZF A;  4PHT X;  5ELZ A;  2QEX N;  2GX9 A;  2HBJ A;  3MN6 A;  5EXW A;  5EX5 A;  4CZJ A;  5HOO A;  4KH6 A;  3IDH A;  5BRF A;  5H1S Q;  3H1V X;  3CQX A;  2NRH A;  3U9D A;  3U8X A;  5LY3 A;  1KD1 O;  4K41 A;  1HBK A;  2D10 A;  4IDH A;  4GNI A;  2P9S B;  4C23 A;  1NTI A;  4JKA A;  3NMU A;  4U7B A;  3DXM B;  1KAZ A;  1ATN A;  3FE1 A;  5EY4 A;  4R79 A;  4FWM A;  1YHQ N;  4FWP A;  3P38 A;  2P9N A;  2ZGZ A;  4AF1 A;  2CGK A;  4FOI A;  1KAX A;  3O8M A;  4M7Y A;  1NGB A;  3M3Z A;  4YDU A;  4UY8 O;  4CD1 A;  1EO1 A;  2FXU A;  1T44 A;  3OBY A;  4DB3 A;  5BPN A;  3P4I A;  1HPM A;  2F7T A;  5MLC Q;  4ILH A;  1NGF A;  5JIC A;  1GG3 A;  4YOU A;  4H0O A;  3SK3 A;  4YOV A;  2HOE A;  3CJ1 A;  3O9U A;  4JAX A;  3UKR B;  2GUP A;  3FZL A;  5AQI A;  5GIP A;  4BC2 A;  3KK7 A;  4MDA A;  5GAE P;  2PBD A;  1XQS C;  1BU6 O;  5AQQ A;  2HF4 A;  2YHX A;  1S3X A;  2R82 A;  5BPM A;  2QI2 A;  4K43 A;  2BUP A;  4MLE A;  3RVC A;  2NRR A;  5M1N A;  3FZK A;  5M1F A;  3VF6 A;  3K9J A;  5C0Y A;  2HST A;  3LM2 A;  4H0Y B;  4GV6 A;  3D7E O;  1YXQ A;  5E84 A;  3A5N C;  1M1K O;  3R8E A;  4BR0 A;  3O80 A;  5M1K A;  3E1Y A;  4BC5 A;  5AQR A;  3I8B A;  3EE8 A;  3CCU N;  4BG8 A;  5AQF A;  4A2B A;  4F9O A;  1P8Z A;  4FVU A;  4DHY A;  3AGR A;  5AQS A;  2CB8 A;  4JK7 A;  3H1Q A;  3ZX2 A;  2X0S A;  2PAV A;  1Q86 O;  3VF2 A;  2HBK A;  3KHY A;  3R3L A;  2ASO A;  4BGA A;  3G9W A;  3CCR N;  1ATS A;  1YIT N;  1MA9 B;  5ADX A;  2EMT A;  1GLC G;  3AAR A;  2ITM A;  3QML A;  1BDG A;  3BF1 A;  2WBN A;  4GY2 B;  4B1X B;  1YJW N;  3D2E A;  2ZJP L;  1QHA A;  4DXA B;  3BEX A;  2V7Y A;  2WH5 A;  1QQM A;  2A6A A;  3EZW A;  1S22 A;  3FR0 A;  3GG4 A;  3U4L A;  3UKR A;  4EFH A;  1NM1 A;  1YJ9 N;  1C0G A;  3QBW A;  2AEH A;  2FDQ A;  1SS6 A;  3KWG A;  4CZM A;  2QWP A;  3DXK A;  4FWS A;  1HKB A;  3B8A X;  5AQG A;  3CJB A;  3VTH A;  1IG8 A;  4IZ9 A;  5CE3 A;  3IMX A;  4BG9 A;  2FJ9 A;  1IJJ A;  4B1V A;  3U8Z A;  5GAH P;  3TU5 A;  5DM7 L;  1WOQ A;  4IOC L;  1VQM N;  3CCL N;  1NGJ A;  2Q0U A;  5AQM A;  3HOS A;  3BIN A;  3TSP A;  3O1W A;  4JKH A;  3VEX A;  4WYB A;  3MN5 A;  5AQZ A;  5FPN A;  2P9K A;  5GIO A;  1S72 N;  2FSN A;  1SGH A;  3P31 A;  5AQX A;  1HUX A;  2GWK A;  1XUP O;  2A41 A;  4FPA A;  2ZPY A;  2QA4 N;  2QTD A;  3CER A;  3QFU A;  1MWK A;  3CJ7 A;  3I33 A;  1BWF O;  4FWL A;  3VES A;  5LJV A;  3H45 C;  4PKG A;  4CYE A;  3QB0 A;  2QWR A;  4IWV A;  3VEV A;  2D4W A;  4JKF A;  1GLA G;  2EMS A;  2KLA A;  5C2D A;  5LJW A;  1JJ2 M;  3T7Z A;  3T69 A;  1NGH A;  3F5T A;  3AU5 A;  3WA0 A;  1X3N A;  3DWL A;  4BRA A;  3CCS N;  1BUP A;  2P9L A;  4LC9 B;  3LDL A;  5AFU H;  2QM1 A;  4WFN L;  5B8H A;  5BRE A;  3CCE N;  3D2F A;  3EKS A;  1ISN A;  1HLU A;  1HKG A;  3EKU A;  3ENO A;  4BRQ A;  5EVZ A;  3MMV A;  5JLF A;  2ZGY A;  1QVG M;  3CC7 N;  1MIX A;  3MN7 A;  4BR7 A;  5KQ8 A;  3CJ9 A;  1RGI A;  2A3Z A;  4PKI A;  3UE5 A;  5FPE A;  4PL8 A;  3KZB A;  3S41 A;  4O5F A;  4BR2 A;  1RDW X;  1VQ8 N;  3PZD A;  4A5A A;  1NGC A;  1J19 A;  3ENB A;  1X3M A;  1KAY A;  2H3G X;  3GOI A;  1E5W A;  1HB8 A;  3JXU A;  4YDU C;  1DKG D;  4WFB L;  3O1B A;  4RWT A;  4YOY A;  4YOX A;  4O8K A;  2CGL A;  1DGK N;  1YVN A;  3WXI A;  4OPA A;  4CI6 A;  4CZI A;  3TPQ A;  2V7Z A;  4NO7 A;  3MX2 A;  1Q82 O;  2F9T A;  5AQU A;  4BR9 A;  4E1J A;  3WEE B;  2P9I B;  4BRN A;  3UKU B;  5JLH A;  4BRL A;  5BR9 A;  1VQ7 N;  3AY9 A;  4GV3 A;  3I55 N;  3LDQ A;  1W97 L;  1SZ2 A;  2Q2R A;  2UYT A;  4WCE L;  2RQ1 A;  4GVE A;  5BRH A;  3C7N B;  2EWS A;  2QWL A;  1RFQ A;  4NLC A;  4AM6 A;  2E1Y A;  3CJA A;  3Q7B A;  4AM7 A;  3A8Y A;  4YL8 A;  1JCG A;  2D0P A;  4H5T A;  4RCH A;  1U2V B;  2QWO A;  4B9Q A;  1Q18 A;  2Q0R A;  4XEI A;  3J7Z O;  3CF5 L;  2FSK A;  3GDQ A;  1VQK N;  3O6W A;  3X23 A;  4MLH A;  3VF4 A;  3VGM A;  1NMD A;  3C65 A;  2WFB A;  3MN9 A;  4FWQ A;  3SLC A;  4XH4 A;  2FF6 A;  4B1Y B;  3ATU A;  3CIP A;  3GL1 A;  5AFU A;  5AQV A;  5HL7 L;  3ATV A;  5KPR A;  3HBT A;  4JKB A;  3G25 A;  4FOE A;  3R9P A;  2E2O A;  2Q97 A;  2QW9 A;  1SQK A;  5BPL A;  4HDO A;  3EO3 A;  3O08 A;  4A5B A;  2CGJ A;  3SMS A;  2IIR A;  2WUS A;  2PFU A;  4FWR A;  3OA9 A;  3WEE A;  3ZEU B;  4U67 L;  4DCH A;  4EHU A;  2P9N B;  1YIJ N;  3LDO A;  4MO4 A;  2VYP A;  3C0B A;  3MWT A;  3HZ6 A;  4EKU A;  1E4F T;  5E26 A;  5DM6 L;  4GXB A;  4OO1 J;  2OAN A;  4CZG A;  3R6M A;  5M1Q A;  1K9M O;  4CD3 A;  3PLA A;  3U7D A;  3FLV A;  1V4T A;  1HKC A;  3MCP A;  3G4S N;  1VQ6 N;  1W2B M;  1GC6 A;  2KHO A;  5KPZ A;  3TTF A;  3Q7C A;  2GEM A;  1LOT B;  3GE1 A;  4A61 A;  1KC8 O;  2F9W A;  1Y64 A;  2BTF A;  2HRJ A;  3HSC A;  2VWB A;  4ILJ A;  2WC9 A;  3H3N O;  3PIP L;  4FWN A;  3VOV A;  2A40 A;  2BH1 A;  3VEN A;  4A57 A;  4BQL A;  3CQY A;  1MDU B;  4YOT A;  3EL2 A;  2Q1N A;  3A0I X;  4JKE A;  1BG3 A;  2I7N A;  3O4W A;  3TSQ A;  3E9P A;  3ZDT A;  2NRW A;  5AQN A;  4HDQ A;  1X9J A;  2RE2 A;  4G9Z A;  3D6R A;  2VGN A;  3BF3 A;  3MCA B;  4IOX A;  3FFK B;  4IOA L;  2IVO A;  4DQ8 A;  3HOT A;  3L6Q A;  1ZBS A;  2P9U B;  4CZE A;  2ABD A;  4ZRI A;  3HRG A;  5CR4 A;  4CJ7 A;  3PIO L;  2W41 A;  4IO9 L;  4JN4 A;  4M7X A;  2NRT A;  3BUZ B;  3O9S A;  3I56 N;  3EE9 A;  3CXC M;  1T6D A;  3G71 N;  3DLL L;  3CME N;  3AAQ A;  4FO0 A;  2QWQ A;  4IJA A;  2E2Q A;  1DIK A;  3QDK A;  2QXL A;  3CMA N;  4B1U B;  2CH6 A;  3ID6 A;  3A5L C;  1QZ6 A;  3E66 A;  3AGK A;  1BA1 A;  1QQN A;  1GLD G;  1EQY A;  4CZL A;  5IJM A;  2LBB A;  3KWI A;  4A62 A;  3LL3 A;  3U9Z A;  3G6E N;  2NZT A;  3CPE A;  1QZ5 A;  2YI1 A;  4BVO A;  1VQO N;  3L4Q A;  2I7P A;  4WQ4 C;  2NRV A;  3CPW M;  5AQT A;  1NI2 A;  4A2A A;  3WUH A;  3WXM B;  4BQZ A;  1MWM A;  2A5X A;  2J4R A;  4NB4 A;  3VMF B;  2Q31 A;  3H46 O;  1GLF O;  1O13 A;  4BRG A;  4HWI A;  3MX5 A;  4K42 A;  4XH5 A;  3UKU A;  4CZK A;  3ZX3 A;  1JCE A;  1ESV A;  3JS6 A;  4CBW A;  3CC2 N;  4I6M B;  5F1X A;  3LDP A;  2HBM A;  2YHW A;  1ST7 A;  3D2F B;  3L4I A;  1ACA A;  3SBG A;  2NNW A;  3CET A;  1VQP N;  1VQN N;  4WFA L;  5C10 A;  2ZJQ L;  5AQW A;  4BGB A;  3M5R A;  3ULE A;  2YJF A;  4QS7 A;  1GLL O;  3F9M A;  3MK6 A;  5FPM A;  2IVN A;  3SMP A;  1NGI A;  1WUA A;  1K8K B;  3VEY A;  3CI5 A;  4A59 A;  3IKM A;  1R59 O;  1EF1 A;  4C1N K;  4EAH D;  2HE7 A;  4PL7 A;  3WXK A;  4BC3 A;  3FP5 A;  3ZEU A;  3HM8 A;  2NRX A;  3OBW A;  5ADX H;  5JVG L;  2DIK A;  1Z05 A;  4JKC A;  2YVC A;  3N4Q A;  4JK8 A;  4B1W B;  3IUC A;  3DJC A;  1LCU A;  2I1J A;  2AA4 A;  3O9T A;  5F2R A;  5FPD A;  4JD2 A;  4C1N I;  3SBT A;  1K73 O;  4JEP A;  1NGE A;  2P9L B;  3ZET B;  2GTD A;  3VPZ A;  3TTC A;  2E1Z A;  3VET A;  1SAZ A;  3VTI A;  4WQ4 A;  3VER A;  1BA0 A;  1YAG A;  3SJH A;  1OVY A;  1K8A O;  3CCQ N;  1JCF A;  2IVP A;  4B1Z A;  5JVL A;  1VBH A;  2ASM A;  5AQP A;  1NGG A;  1GLE G;  1U2V A;  3W3D A;  1H4R A;  4NLB A;  3FGU A;  1TYQ B;  5AZJ B;  3VEO A;  1XC3 A;  3SAF A;  1DEJ A;  4BRE A;  3CCV N;  1QVF M;  4P7I A;  4BRM A;  5AQK A;  4JD2 B;  5M1O A;  3E9L A;  4BY9 C;  3QIJ A;  3J8A A;  2P9I A;  3UB5 A;  4ZRK A;  2V52 B;  4ISG A;  4BVP A;  3FZM A;  4H0P A;  3DXM A;  5AQO A;  5BRD A;  5BN9 A;  2J0J A;  2CH5 A;  2GEL A;  4KBO A;  1H1V A;  1BOT O;  2NRZ A;  5JMV A;  4H5N A;  1GLB G;  3PVL A;  4FWK A;  5I9E B;  1ATR A;  4CZH A;  4L3Q A;  4GV9 A;  2P9U A;  2ZJR L;  1NVL A;  4FPB A;  4K25 A;  4I6M A;  1NGA A;  2P9P A;  4FL9 A;  3OW2 M;  1TYQ A;  1T3V A;  4F7G A;  3IVF A;  4QS9 A;  5AZJ A;  4ILG B;  1YJN N;  4H0T B;  1TUU A;  3VEW A;  4ZRJ A;  1MIZ B;  3TTD A;  1GGO A;  4IFE A;  5GAD P;  3M6G A;  2FSJ A;  3R1X A;  3CC4 N;  1N8R O;  2A42 A;  3NVK A;  3A5O C;  4BRH A;  4BRP A;  3FZH A;  3LM9 A;  5JVH L;  5M1P A;  3DAW A;  4JNE A;  4OPH A;  1V4S A;  2VGM A;  5KQD A;  2NLX A;  4YOW A;  1DT9 A;  4Z94 A;  3HI0 A;  4TKN A;  4Y0W A;  3VGL A;  4HTL A;  3DXK B;  2QWM A;  4O8U A;  1M90 O;  3C6A A;  3OHR A;  1VQ9 N;  1VAZ A;  4BR5 A;  4JK9 A;  3M1F A;  4DKW A;  2AL6 A;  5AQH A;  1U6Z A;  4QS8 A;  1T6C A;  4WQ5 C;  3F2K A;  3NVM A;  3QBX A;  4JKG B;  2HF3 A;  3K9K A;  3P39 A;  3QIC A;  1HB6 A;  1C0F A;  3W0L A;  1Y19 B;  1NJI O;  1VQ4 N;  1TUY A;  3H3O B;  4FSV A;  4IEE A;  4H5W A;  3SAG A;  2HBL A;  2JWK A;  3ZET A;  4RTF D;  2J0K A;  2E8A A;  2RHK A;  1D4X A;  3KVG A;  1K8K A;  3HTV A;  3WXJ A;  2ZF5 O;  4EHT A;  1KBL A;  2V51 B;  4JKD A;  3ULE B;  5CHI A;  4KH5 A;  3VEZ A;  2FF3 B;  4H5R A;  1Q81 O;  4XH1 A;  3E9O A;  1NBW A;  2P9K B;  5GAG P;  4BRK A;  5C12 A;  5AQL A;  1HJO A;  2VCP A;  2YHY A;  3TSU A;  1YUW A;  2D1K A;  4H0X B;  1E4G T;  3ID8 A;  4WF9 L;  4H0V B;  1GC7 A;  4BC4 A;  2D0O A;  4IO8 A;  4H5V A;  3O5B A;  3VGK A;  4CBU A;  3L0Q A;  1VQ5 N;  1MK7 B;  1KQS M;  3AAP A;  1G99 A;  4YOR A;  1VBG A;  3C6H A;  3O9Q A;  5EOY A;  1JDE A;  1QQO A;  3RSE A;  5C15 A;  4MO5 A;  1ZC6 A;  2DPN A;  1NLV A;  3ZYY X;  3A5M C;  3CHW A;  2HMP A;  4J8F A;  1ZXO A;  2E2P A;  2OTJ N;  4JHD A;  1Q7Y O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...