4JKGA

Open and closed forms of mixed t1789p+r1865a and r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
219
Chain Sequence
LFSQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 219
sequence length 220
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkgA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkgA01
4JKGB 3ENBA 3E9OA 3E9PA 4JKBA 3SBTA 4ILHA 4JK9A 4ILJA 3SBGA 4JKHA 4JKDA 3E9LA 4JKAA 4JKEA 4JK7A 4JKFA 4ILGB 3E66A 4JKCA 4JK8A 4JKGA
chains in the Genus database with same CATH superfamily
1E4GT 2QKBA 4AQYK 1VQKN 1TKTA 1ZYQA 3LM9A 4ZTFA 1A5VA 1KFDA 1KLNA 4F7GA 4LSNA 3KWIA 4OX9K 3O08A 4AHSA 2P9PA 4KBOA 1MWMA 1RT2A 4MO4A 5DM6L 4A57A 5C0YA 3ZSYA 1BGXT 3LPTA 1TKXA 2BE2A 1BO5O 3QBXA 5KRTA 3FZHA 4DSLA 1FXXA 1R59O 1X3MA 3ZX2A 3ZDTA 3NMUA 2F7TA 4B1XB 2PFUA 4C8OA 3V9XA 4I7FA 4CGGA 4DMNA 2G8UA 2D5RA 2Z1HA 3CJ7A 3D2FB 4JKDA 1C0TA 1X9JA 2W40A 1N34K 2CQUA 1QQCA 3O3FA 1JCGA 2GUPA 5LMUK 1BISA 5FPEA 3HVRA 1LCUA 4J2BA 1U4BA 4HTLA 2HHUA 5HP1A 4B1ZA 5CZ1A 1GC7A 4O0IA 3OBYA 5EY4A 5DM7L 4M3WA 5BR8K 1VQ8N 4KKOA 3V81A 5ADXA 4FW2A 2COPA 4CCHA 4FJHA 4CJ7A 3LDQA 4ID5A 3KLHA 4CJFA 4DWIA 2E1YA 3EO3A 4QCLA 1NJZA 5HOOA 1ILYA 1LAVA 2FSKA 2BTFA 4HWIA 3RMBA 2V7ZA 3AO3A 4ELVA 2IVNA 2JWLA 4Z4EA 2X78A 1NKBA 3TTCA 1VSFA 2OA8A 3L0QA 2HF4A 4YL8A 5I42A 1NK4A 3VQEA 4DSFA 1IKYA 2X74A 4B08A 1DT9A 3D45A 1ZBFA 4MLEA 3CC4N 1TK8A 4CZGA 3H46O 4YOXA 2A6AA 1DTQA 3L8BA 4EAHD 4A2AA 1HBKA 3DLBA 5HBMA 1J5EK 2WC9A 1X9WA 4W5NA 2IVPA 4C8NA 4GV3A 5KTQA 4FJIA 2YNGA 1EWRA 3NH1A 5AQYA 4OKEA 4CHZA 3H08A 3E9OA 2B6AA 2KW4A 5EOYA 1QVFM 1KLMA 2OCEA 5KGWA 2I7PA 1NJXA 3FGUA 4DR2K 1BIUA 3LM2A 3NF7A 3VEVA 4CEDA 3J8AA 4CW7B 4F3TA 1C0UA 2Q97A 4AHVA 1TK0A 3CC7N 4DSIA 4DR7K 2IS3A 1KRPA 3P1GA 4PHTX 3OS2A 1X1PA 4Z4GA 1RDDA 3G9WA 3DOLA 3LZIA 2HMPA 2J4RA 4MO5A 1XI1A 2OTJN 1KD1O 2J0KA 2FBXA 4H0YB 3MXJA 3EZ5A 4CF8A 3THVA 3K58A 1SV5A 4J8FA 3MN6A 1GG3A 3KLEA 1HNVA 4CHPA 2P9LB 3ATUA 3F5TA 2A40A 1L3UA 1JCEA 3CCSN 1ATRA 4OKJA 4CZHA 2KTQA 1HX1A 4JKBA 4I2PA 1BG3A 3NE6A 1HQUA 1VAZA 3B6OA 1YTUA 5AQNA 1QQMA 2NRWA 3AA3A 3I8BA 4CECA 1Z25A 2OPPA 4BWJA 5AQUA 1VQMN 5BPLA 4BRAA 4U67L 1EXQA 1G15A 1LOTB 2HBJA 3BZCA 3ENOA 1JLBA 5F0XA 3WXLA 1N36K 5HRSA 3ZT3A 4B3TK 4YOVA 4W5TA 1BU6O 3OYFA 1CLQA 4JKGB 4FVUA 3VN5A 1WNSA 2EMSA 2ASPA 2RPIA 3CG7A 3EL2A 3VQAA 5HROA 4CGHA 3OYGA 1ATSA 3O6WA 3G6EN 2FSNA 3TAEA 3NDKA 3A5OC 2GUIA 4WQ5C 4FWRA 1WB9A 1S5JA 2Q31A 4F3OA 5C25A 1SZ2A 4FPAA 1B92A 2HB5A 3LL3A 4ILGB 4DR5K 3HJFA 1WBDA 4F4KA 5AFUA 1RTJA 1MA9B 1HB8A 1SUQA 2E2OA 2E8AA 1S1TA 5DMRA 2YNHA 1LAWA 1HQEA 1YTAA 3OBWA 1JJ2M 3CETA 4PA1A 1IKWA 3OA9A 4CD3A 1S22A 4B9UA 5AZIB 1GOAA 3O8MA 3MX2A 5AQLA 2WONA 4FM0A 1A5XA 4A61A 4EHUA 4W5QA 1NBWA 2NRTA 1NGCA 2WBNA 4F2SA 2O8CA 1HYZA 3UE5A 3P31A 4KHNA 4JD2A 2E4LA 4KTQA 4A5BA 4AM7A 4Z4CA 4NY0A 3V1RA 1DIKA 3OYIA 3AY9A 2UYTA 3R8EA 4DTNA 3QEPA 4H4MA 1RT7A 1VSLA 4FM2A 3SUNA 2QW9A 3RSEB 4K0KK 2YHBA 4E7JA 4EKUA 2GELA 3O80A 5KPTA 1M90O 3TANA 2P9UA 4E7HA 3PX0A 1ZBSA 3B8AX 3P38A 4CGFA 3OY9A 1ZBUA 2VQFK 1F21A 5AQSA 1MIXA 4CJ3A 1L3VA 1RBRA 3DLLL 2P51A 4BE0A 2DFFA 1QE1A 4RW6A 1TKDA 5FRMA 4HTUA 2B4JA 1VQ5N 5CYQA 3QERA 1N33K 2QWQA 4QS8A 4M7XA 3KK7A 4RCHA 4DG1A 3DMJA 3LDNA 5CYMA 3VGLA 1NGIA 1E5WA 1GC6A 3DLGA 4KHWA 1BQMA 2HSTA 1WSFA 3CMEN 4GKJK 3ID8A 3OW2M 3CI5A 3DLHA 2E1ZA 3VQ4A 4LF8K 1Q9YA 3O9SA 4LF6K 3Q7CA 4FJLA 1MWKA 5BRFA 3JYTA 3HXMA 3FFIA 4BVPA 4CF1A 1FJGK 3MCAB 3AVJA 1KC8O 3LPUA 4CJKA 2BUPA 3DLKA 1S6PA 4CF9A 1X9MA 4YOWA 2FF3B 3ZYYX 5AZJB 3CCJN 3BF1A 1NI2A 4O4GA 5A2QO 3MX5A 2X6SA 3CM5A 1BI4A 4E1NA 4CF2A 4PKGA 1TKZA 4FLUA 1J53A 1K8KA 3D6RA 4BE1A 1OH6A 1NGJA 4FL9A 3CJAA 4IFYA 3S3OA 2Z1IA 3C95A 5AQXA 3L6QA 2NRHA 4CHOA 4B3OA 1J9AA 2NNWA 4IJAA 3T7ZA 1MIZB 1IKVA 3TABA 1ZBLA 3BZKA 2UUBK 4LFCK 3F9KA 3I0SA 3QEIA 3T69A 1I39A 1N6QA 1CXQA 3UKUB 1N8RO 1KTQA 1W97L 1KAXA 5AQPA 4KHYA 4H5RA 3THWB 2P9SB 3KD1E 5AZIA 4KB1A 3THXA 3L2WA 4BDZA 4ISFA 4MDAA 1N32K 4RWTA 3IDHA 2HMIA 4B9LA 1J6ZA 4BR2A 3HRGA 3CC2N 3F9MA 3J81O 3SJHA 2IOCA 3EE8A 3W3DA 3VQBA 4B8AB 3I8DA 1K73O 4CZEA 1C6VA 1C0FA 5F1XA 3C65A 1RT5A 3DXKB 4IBNA 4JS4A 4FWLA 4NCAA 4BQLA 3HI0A 3QIJA 4QAGA 5FRNA 4IEIA 4JI7K 1VQ9N 1D8YA 2HRJA 4E0DA 2CGKA 4H0OA 4JYAK 1REVA 1WBBA 4IOAL 1YT3A 2VGMA 4DTRA 3BINA 3VEWA 2ZM6K 4GVEA 3AVCA 3VEXA 2NRXA 3C6UA 1S6QA 3L2UA 4ICLA 5DK5A 3TPQA 3HM8A 5GAHP 4X65K 4CJUA 3DAWA 4O0JA 3U7DA 3NVKA 2P9PB 4JI5K 1YITN 4DU3A 4CJVA 4JK7A 4NB4A 5EU7A 4BDPA 3OYHA 3VQDA 2ZJPL 2O8EA 3LDSA 3QEWA 3GL1A 1YJWN 1W0HA 1G99A 1RGIA 1S9GA 4C1NK 3AGRA 4CEFA 1VSJA 4B9MA 4EZ6A 3UKRB 2Y1IA 3O9TA 4CJTA 4R5PA 1HRHA 1Z6RA 1VHXA 1S1WA 4BRCA 3SQ2A 2PYJA 3GE1A 2E20A 1LV5A 4QS7A 3VQCA 1VSMA 3AO1A 3U9DA 1UA1A 1OVQA 4EP5A 2Q2RA 4DS5A 5C24A 3DRRA 3HBTA 1GLLO 3OYLA 5EX5A 2A1RA 3L4QA 1JL2A 1JKHA 3IUCA 3PSIA 3HO1A 4CHYA 5I3UA 1N5YA 3O9QA 4YFUA 3AVAA 3IMXA 3CFPA 1GLJO 4IDKA 3HP6A 5TKYA 1O1WA 2NRRA 4CZFA 1NM1A 3SV3A 4V19S 3VA0A 5J1EA 2YJEA 3CCMN 4CJ4A 4R79A 2EHGA 4OJRA 5C15A 4LF7K 4I6MA 3PX4A 4BVOA 1RNHA 3AA2A 1JCFA 3QIOA 4NXMK 4FW1A 4RW8A 2OZSA 2NRZA 1C0GA 3S3NA 4YDUA 4DUYK 1JLQA 2X6NA 2P9NA 4K25A 5AQMA 4CEOA 1DLOA 4M3UA 2O8FA 3M8RA 2UUCK 5IT9O 3TSPA 4FK2A 3KD5E 4WFBL 4DFMA 3M5RA 3DRSA 4O8KA 5M1PA 3FZKA 4WF9L 3CJBA 4M3ZA 1YXQA 4GV6A 4B3RK 1D9FA 2VYPA 1JLEA 3VOVA 1J54A 4CI6A 4DHYA 3SI6A 3EEQA 2D10A 2HBKA 3KIOA 4EP4A 2AEHA 2HF3A 3EKUA 3O1BA 2E2NA 4UQGA 5J2NA 1XNQK 1FKPA 1V4TA 2WUSA 5CE3A 3KK3A 2ZF5O 4CE9A 3BUZB 3VTIA 2P1JA 2UXBK 2KHOA 2WH5A 4BQZA 4CJSA 1NLVA 1EX4A 3OHRA 2ZPYA 5E26A 3CQXA 4KB0A 5M1KA 2NRVA 2ZGYA 2XRIA 3UKRA 1LW2A 1WAJA 4BG8A 1S1UA 4M63C 4CJ5A 1RCHA 4DV6K 3PSFA 4FJ7A 3OYAA 1S3XA 4CJWA 2I7NA 4C23A 3OYKA 5TKWA 4CJPA 1K8AO 3SQ4A 3AGKA 2A3ZA 2ZGZA 2JLEA 3ENBA 2FDQA 4FLTA 2R82A 3V9UA 3K59A 5FPMA 4PWDA 5EVZA 4ILHA 1Q82O 4FZXC 3O3HA 2P9KA 1TAUA 1HKCA 4GMJB 3IRXA 3QMLA 3NGYA 4KH4A 3WNHA 3CD6N 2P5GA 4E7IA 1S1XA 1HMVA 2LBBA 1HNIA 4WQ4A 2HW3A 4MLHA 2KQ2A 3AVFA 2XY5A 5C2FA 2EMTA 3WNEA 4NYNA 4A59A 3V4IA 4KI6A 4GVMA 1XMQK 1ESVA 3ZETA 1KCFA 4DR1K 1SS6A 3MK6A 4CESA 4ID1A 3K5LA 2QWLA 3KTQA 3TI0A 4Q0BA 2QA4N 2HHQA 4H5WA 4CHQA 3THYA 3OS0A 3WQTA 2KZZA 4EIAA 4JHDA 3M8SA 1VSIA 1NK9A 1RFQA 1W9HA 5BN9A 4CIFA 3QB0A 4DXAB 2FXUA 3R3LA 4DTSA 2ABDA 5FROA 1XQSC 3OYNA 3L2VA 3ZSWA 4JAXA 4FLYA 3CMAN 1HKBA 2XY8A 3AVNA 3VQ6A 5HLFA 3QETA 3JXUA 2J0JA 1BA0A 4K42A 2RN2A 4BRMA 4QOZB 1UOCA 2O8CB 3K0SA 4LF5K 2GEMA 3G0ZA 5D3GA 1VQ4N 3OTOK 3AVLA 4JD2B 1NMDA 4ZHRA 4DQ8A 2YHYA 3HSCA 2XHBA 4FLZA 1D9DA 1TL1A 3K9KA 2QM1A 3QEXA 1YJNN 3RRGA 4E7KA 2Q36A 1VK0A 4N47A 3EKSA 4OO1J 3T19A 2CH6A 4DQSA 4DR6K 4DQIA 2JGUA 3BEXA 1EP4A 1QQNA 2P9UB 3HTVA 5C2DA 3AO4A 3CIPA 1NJWA 4HDOA 3C6AA 3SYZA 3R9PA 5K14A 5JVHL 3GOIA 3O9RA 3CFOA 2HNDA 5B8HA 3RMCA 1BDGA 3E9LA 3ZCMA 3WXIA 1U6ZA 1Q9XA 2Y1JA 4DFKA 1TGOA 4FOIA 2HHXA 4NCGA 3D2EA 4FJXA 3FR0A 5J2MA 1HPMA 4GNIA 5CY4A 3OYDA 3M8QA 3HSTB 2YKNA 1M1KO 4CJQA 4CBXA 1HNWK 4IWVA 4N41A 4FJ8A 4F8RA 4K8XA 3VESA 2O4IA 1R0AA 1VQ6N 5AJ3K 3ID6A 5LY3A 4BR5A 3PUFA 3C6HA 2Z1JA 4KTZA 4IOCL 3SK3A 4DV2K 2VWJA 2PY5A 2G8WA 2QK9A 4CZMA 3OVNA 3U4LA 2GV9A 2ASMA 5KPZA 5M1QA 3CFRA 4H0XB 2VWKA 1SGHA 1BI4B 1T8EA 1K8KB 1XWLA 3JSMA 1NK5A 4LFBK 1MK9B 1HPZA 4IEEA 3SMPA 3CQYA 4PKIA 3VF2A 3U3YA 2BGGA 4DSJA 1NG9A 1HR0K 1HLUA 4E7LA 4JKAA 1NJIO 4Y0WA 2A42A 2VWBA 2H3GX 1YF5L 3V1OA 4H0TB 4BRKA 2PZSA 4CYEA 2O8DA 4MFBA 4PUOA 4G9ZA 1RILA 4CZJA 3VA3A 1B9FA 1KXPA 4AILC 1NK6A 3RMAA 5ELZA 1ZBHA 2BDPA 1VBGA 4FWMA 1NK0A 2XY7A 4Z0UA 4BWMA 5SWMA 2A41A 2Q3SA 3SBGA 3NCIA 4A5AA 4HUGA 4RW7A 1HUXA 4FJ5A 4YNQA 3VETA 3A5LC 3THXB 3SLCA 1ST7A 3LP0A 2G8IA 3LAKA 4WFNL 1GLDG 1BL3A 2HHHK 3HPHA 4BR0A 4B9TA 2DTUA 3QBWA 1SL1A 1RDAA 4CEEA 3IS9A 1RTIA 1SL2A 3Q7BA 3HP9A 4NXNK 3UIQA 4DV4K 2FBVA 1QHAA 1V4SA 3DXMA 3HYFA 1SL0A 1TYQB 4BACA 3CQ8A 3CCLN 4HUEA 4OPKA 3ZT1A 2E2QA 5C10A 3VENA 4JKFA 2FLOA 4H5NA 2OTLN 5CZ2A 4DTMA 3VQPA 4FM1A 2IVOA 4CIEA 5JVLA 1Q7YO 4FXDA 4CBUA 3NH2A 3L2RA 5CR4A 4CIGA 3ASMA 2D1KA 4LC9B 4LFAK 3QESA 1NJYA 1VQLN 4Z4IA 4LD0A 4ISGA 4BRQA 1XMOK 3M6GA 3OYEA 5JS2A 2ZJRL 1S72N 3RR7A 1FK9A 3P39A 3ULEA 1OH7A 3KKRA 3X23A 1IO2A 4FVMA 1RBUA 2YHXA 4WQ5A 3SZ2A 2O8EB 3HL8A 2QWRA 5HRPA 1QVGM 3VQ5A 4JN4A 4Z4HA 2A1SA 4FO0A 4OLAA 3MXIA 3MAQA 2F8SA 3O4WA 1NGBA 3AVKA 3K2PA 3WXKA 1NOZA 4KREA 5GINA 2NLXA 3N4PA 1U47A 4FJKA 1QSLA 3KWGA 5HRNA 4HCCA 2I1KA 4JI3K 3MXMA 4RG8A 1ASVA 4O8UA 2ZD1A 1BWFO 4JV5K 4ZRIA 1IBLK 4CJLA 4X64K 3S41A 4KV8A 3RTVA 3KK1A 2YKMA 3WXMB 3PIPL 1HNZK 1NU0A 1RBTA 3PO4A 2RQ1A 4B9VA 5KRSA 4KHQA 3DLRA 4JNEA 3LP3A 3O1WA 4DV3K 4DQQA 5FLXO 4JEPA 4OKKA 4OVLA 3QFPA 2RE2A 1EKEA 3HVTA 4I2QA 3G71N 1GOCA 1O13A 1KAYA 2YX6A 3ZT0A 3H45C 1P8ZA 4BROA 4DLGA 1U04A 4E1MA 1OH5A 4LH4A 2VG7A 1CZAN 1RT1A 2YNIA 3NF9A 2G8HA 5AQTA 5GADP 4BRGA 1JXBA 4PY5A 4I6MB 2QXLA 1D4XA 1Q86O 3QINA 4CEAA 1QQOA 4B9NA 3OYJA 4HVJA 3LWMA 1JL1A 2P9IA 2P9NB 4IG0A 3ATVA 4FSVA 2O8FB 3ZSOA 3ZT2A 4N5SA 4PL7A 3FZFA 3K9JA 4H5VA 4JI1K 3VEOA 4LF4K 3ZT4A 1TUYA 4O44A 4N76A 1OKJA 5H1SQ 1TYQA 3NVMA 5JLFA 2BANA 1NOYA 4BRIA 1U45A 4CHNA 3DI6A 4FWOA 4CFCA 3HM9A 4PQUA 2F9WA 2JWKA 2RF2A 3WXJA 4DTJA 1QS4A 1YJ9N 3CJ9A 3FZMA 1BQNA 3J80O 1J19A 3PX6A 1UA0A 4C1NI 2OPRA 1Y64A 1IG8A 4CD1A 1P90A 4KH5A 1RT3A 1SKWA 3ENHA 1TV6A 4OPJA 2FC0A 3FLVA 2XY6A 2OYQA 3FE1A 1VRTA 4XH1A 4AHCA 1L5UA 2E6MA 3MWTA 5AQGA 3ALYA 4IZ9A 3L2QA 1IBMK 2XO7A 1NVLA 2AA4A 4RW9A 4IXCA 1T6DA 4U7BA 3A8YA 4CEZA 4A62A 5BPMA 1H1VA 1HKGA 4DU1A 1BOTO 4DFPA 3QNNA 2CH5A 3SAHA 3H3OB 3A5MC 4EFHA 5F2RA 3DWLA 4ZRJA 4B8CA 3LAMA 1Z05A 3MN5A 1GLFO 5C12A 3J7AP 3P4IA 4G1QA 4J2EA 3A0IX 3PVLA 4B9QA 4FLXA 3KHYA 4WCEL 3U3GA 3VQ8A 4ZTJA 4A2BA 4FJ9A 1BIZA 3O3GA 3E01A 2V51B 2KFZA 2IC3A 3AO2A 2P9KB 2ITMA 4B3MK 2J0MA 3VGMA 3LDLA 4BY9C 1NGHA 1NKEA 4Z4FA 1ITGA 3L3VA 3EY1A 3BDPA 3AVIA 2YHWA 4TSXA 3AVGA 3W0LA 4BRLA 3V9ZA 3TAPA 2PYLA 1T03A 3M3ZA 4O55A 3KLFA 4KTWA 3ZSRA 4NCBA 2Q0UA 3AU4A 3VQ7A 4BR4A 4N56A 1C1AA 4BDYA 3V9SA 3CPWM 3FP5A 4DUZK 2IIRA 3MCPA 3ZEUB 2AP1A 5J2PA 3QEVA 3ZETB 4C8MA 1ATNA 4FK4A 1S9EA 3K5NA 1HJRA 4W5OA 3HK2A 3EZWA 3C7NA 1CZBA 4I9LA 4J2DA 1YVNA 1IV0A 2HVIA 3THYB 4DS4A 4JHDB 2DPNA 4CGDA 1RDBA 2HVHA 3QNOA 4IFVA 5M1OA 2KZMA 4FJNA 1QSSA 4DQPA 4RTFD 3VF4A 2E5LK 3R6MA 4HHTA 3AU5A 3MDQA 1KC7A 2ASOA 4FWPA 2OZMA 2QKKA 4CK1A 4KAZA 3ULDA 1IH7A 1K6YA 1NWKA 1RDUA 4DQRA 4IOXA 2KKZA 1W7AA 3SPYA 3QIPA 3RWUA 3LP2A 5GAGP 1MU2A 4BE2A 5AQKA 2ATQA 1T05A 4DKWA 1NKCA 3CXCM 5AQJA 4M3YA 4IO9L 3AA4A 3C0BA 1WSJA 3F2KA 5GIPA 1L3SA 2QEXN 3I56N 2O8BA 1HB6A 1QHTA 1J5OA 4B1WB 1RT4A 3H6EA 1HNXK 5ADXH 4KFBA 5J2QA 1WSHA 3DOKA 4K8ZA 3MN9A 3MN7A 3SMSA 4AHTA 2FBYA 2WFBA 4YOUA 3AV9A 4I9QA 2YJFA 1I3AA 1ZXOA 1NGFA 3KLIA 1JLFA 1UWBA 1WUAA 1TUUA 1JLAA 3D2EB 3A5NC 4CK2A 3QFUA 1ASUA 1RTDA 5AR0A 1VQ7N 4GW6A 4GY2B 4M3XA 1X3NA 4ZRKA 2FBTA 3H3NO 5EXWA 4C8KA 2FSJA 3AVBA 2IDOA 2OPQA 3LANA 4H0PA 1LWFA 1JXEA 3JAMO 3CCVN 3I55N 1Q81O 4CK3A 3NGZA 4BC2A 5AQQA 2D0CA 3VERA 1FW6A 5FDLA 4J2AA 2VGNA 2D4WA 2VG6A 4LY7A 1EF1A 1VSKA 3AO5A 3ZEUA 4B1UB 1ZC6A 4Z94A 1YIJN 2W41A 1VSEA 4L8RB 2I1JA 4DV7K 3L3UA 4E3SA 4WYBA 1EQYA 3O5BA 5JMVA 2OPSA 3NF6A 3HPGA 4M45A 5KQDA 4YORA 1KSPA 3IFRA 1XHZA 2E2PA 3ISNC 1SKRA 2O8DB 3IG1A 4JI2K 5AQZA 3IAYA 4ISEA 4FJMA 1W2BM 1UAXA 4OPHA 3VPZA 4H0VB 1T7PA 3SUPA 3WNFA 3CM6A 4LSLA 4CFBA 3TAGA 4AF1A 4DV0K 5IWAK 3EN9A 3VTHA 2HNZA 2QXFA 4DTPA 4EZ9A 1YI2N 3K5MA 1U49A 3QO9A 1XC3A 3KK2A 3DRPA 2GBZA 4CZLA 1KFSA 3IVFA 3LALA 3WEEA 1RDCA 1WN7A 3CERA 1LWEA 3IKMA 5BN8A 1SKSA 2FF6A 4DTUA 4BC5A 1ZBIA 5KPRA 5GAEP 1ACAA 4CGJA 4DR4K 3EE9A 3TARA 3TTFA 4FLVA 2QWMA 4CVNE 3ITHA 3DXMB 1GOBA 1VQNN 3I0RA 1VSDA 1YHQN 2F8TA 4CZKA 4DU4A 1FKOA 3NHGA 1TL3A 3E66A 2V7YA 4GV9A 1VBHA 4DF8A 4O5BA 1OH8A 1D5AA 3LDPA 1KBLA 1T3VA 3CCUN 2NUBA 4H03B 3AAPA 3LP1A 3AVMA 3OJSA 2DY4A 3VQ9A 4OGCA 3OYBA 3I33A 5HL7L 3TAMA 2G8KA 3GBTA 3MEGA 3B6PA 4DF4A 4O5FA 4UY8O 4XIUA 4AHUA 3KZBA 4AM6A 2G8FA 1YUWA 3ULEB 4YHHK 4KHPK 5E84A 3WUHA 2D11A 1GLBG 5BREA 1VQPN 2Q0RA 2ZJQL 3OS1A 3CCEN 4K43A 3U8ZA 3G25A 3ZSVA 4GKKK 1EWQA 4QS9A 3SQ1A 1Y19B 3CHWA 3CCRN 3D2FA 3FLCO 2F96A 3PZDA 2EX3A 2DFHA 2YCHA 3H1QA 5AFUH 3OYMA 2GWJA 4MDBA 1JDEA 4KPYA 1Z26A 3SCXA 4BRHA 1E4FT 5BR9A 4PKHA 3V1QA 3S3MA 4H8KA 4X66K 4FPBA 4BR9A 5C42A 1CXUA 4FCYA 3U8XA 1DEJA 3NAEA 1QZ6A 4IKFA 3C94A 3JS6A 1JLCA 4JS5A 4XEIA 3QLHA 2UXCK 4WFAL 4FWKA 1DTTA 3BP8A 4XH5A 4FOEA 4CFDA 2FJ9A 3AVHA 3SBTA 2GTDA 3E1YA 2ZE2A 4JI8K 5AQVA 4LH5A 5T7BA 1WOQA 4CJRA 5AQHA 1HYSA 1QTMA 3RVCA 3KVGA 3WNGA 5E41A 1QZ5A 1T6CA 1K9MO 3R1XA 2V52B 1A5WA 2OANA 2AL6A 3SUOA 4AHRA 3S9HA 2Q1NA 4DTOA 2QTDA 1I94K 5BPNA 4M3RA 3HZ6A 4IFEA 1IJJA 1VSHA 3O4QA 2P9IB 3HOSA 2HHVA 3A2FA 1KQSM 4DR3K 1NK8A 4FZYA 1XC9A 3CCQN 3SNNA 3RMDA 3DJCA 4H5TA 4NLBA 1IBKK 4BREA 5LL6Z 3PIOL 2X0SA 1VQON 3HOTA 3D7EO 1U2VB 1MDUB 5JVGL 1U48A 3AAQA 5LJVA 1H4RA 4KHSA 1B9DA 5AQOA 3RR8A 5M1FA 3VEZA 1DKGD 1IG9A 2R7YA 3H1VX 4IG3A 5JLHA 3SJJA 3FZLA 3T1HK 3WT0A 3M8PA 3BGRA 3LZJA 4ILJA 1OVYA 3AARA 2E88A 1YAGA 3GG4A 4B3SK 2HNYA 4NLCA 4FWNA 5FPNA 4CEBA 4L3QA 2GWKA 4LF9K 1NK7A 2QWOA 4FJGA 1RBVA 4F9OA 1WSEA 4BRDA 3LWLA 3E9PA 4JI6K 4KO0A 4OGEA 4YY3K 1GLAG 4E89A 2D0BA 3DLEA 1XHXA 2D0OA 4HDQA 2G8VA 2VG5A 4AH9A 4CGIA 1MK7B 4JI0K 3NF8A 4IO8A 2P9LA 4CF0A 3KJVA 3HPOA 3SUQA 3PLAA 1RBSA 5HRRA 5AQIA 3MEDA 2YVCA 1C1BA 3OYCA 4H4OA 1KVAA 5JICA 5I9EB 2BH1A 4JK9A 3N4QA 2I5JA 5M1NA 4JKHA 1X9SA 2YHAA 1GGOA 4FK0A 1LW0A 5KQ8A 2HBMA 2YV0X 3LDOA 3P5JA 4OPAA 4JRPA 2KFNA 1E3MA 4DLEA 4DSKA 4CJEA 4F2RA 4JKGA 4BRPA 3VMFB 3UB5A 3TAQA 1BCMA 4M3TA 4HCBA 2HBLA 2YI1A 4FYDA 3PY8A 2QWPA 2HHWA 3C6TA 1DGKN 3U9ZA 1BCOA 2RKIA 2WTUA 1NGAA 2DFEA 2E6LA 3V6DA 4OLBA 5LJWA 1BUPA 4EHTA 1NGDA 4XH4A 1EO1A 1VRUA 3FFKB 3C7NB 3EYZA 5LMNK 5CHIA 4YOYA 2GX9A 3K5OA 2W6LA 3SAFA 1QSYA 4BC4A 1XNRK 3NFAA 3P83D 3TAFA 1TK5A 3MECA 4BGAA 4KI4A 1Y97A 1BA1A 4JKEA 1U2VA 5AQWA 3CJCA 4CZIA 3NH0A 4X62K 3BY5A 2UUAK 2IGIA 3WA0A 4ELUA 3O9UA 3MEEA 1C1CA 3VGKA 4FWSA 1RTHA 3D0PA 2QI2A 3DM2A 4CERA 2HE7A 1WAFA 2QWNA 3O4NA 4DFJA 3HT3A 4KHUA 3RSEA 4YOTA 1Q8IA 5AQFA 4E1JA 4C8LA 2LSNA 3SAGA 4E19A 2B5JA 5KI6A 3U6FA 4JKCA 2O8BB 1YVUA 5FPDA 2CGLA 4Y1CA 1NTIA 1TAQA 4CBWA 1KVCA 1JLGA 4BGBA 2CB8A 4MQ3A 4ELTA 1SQKA 2IAJA 4YDUC 4B1VA 4JRQA 1XUPO 1C0MA 2UXDK 1HYVA 2ZWHA 4BC3A 2A5XA 2NZTA 3QDKA 4DB3A 3RRHA 4FLWA 3K57A 3VQQA 3PO5A 5IJMA 2CGJA 1WLJA 3NGIA 4JK8A 4KH6A 3GDQA 2WOMA 5BRHA 4Y1DA 4DV1K 3TSUA 4TKNA 1NMNA 3J7YP 1GLEG 3PV8A 5BRDA 4BR7A 3TU5A 3CF5L 1ASWA 1WSIA 5MLCQ 3G10A 3ZX3A 3QICA 3T1AA 3ZX0A 3KLGA 4Q5VA 4M42A 1GLCG 3NBPA 1CZ9A 3TWHA 2AJQA 1EETA 1SAZA 3EPYA 1HJOA 2KLAA 2UU9K 5AZJA 4B9SA 4DSEA 4GXBA 3VEYA 5JS1A 4IJNA 3F73A 2F4VK 3SQ0A 5AQRA 4HUFA 2O4GA 3ZSXA 2P5OA 4DCHA 3TTDA 3BF3A 4CFAA 1TVRA 5KGXA 2ETJA 4BRNA 3L4IA 4FZZA 3CYMA 1WSGA 4WE1A 4PL8A 2YNFA 3MWPA 1RT6A 2D2QA 2Z1GA 1NNEA 4P7IA 1Q18A 2PBDA 3MMVA 3V9WA 3M1FA 1LWCA 1BHLA 3J7ZO 1IKXA 3TR8A 3T1YK 3DYAA 1L3TA 3UKUA 1NGEA 1T44A 3THWA 4CEQA 1KAZA 2P9SA 2D0PA 2RHKA 2HHSA 4M7YA 3G4SN 2W42A 3ZSZA 2D0AA 4RW4A 2ZQBA 3AA5X 2VQEK 3T3FA 4BRFA 2HOEA 3CPEA 4K41A 2F9TA 4NO7A 3TSQA 3SPZA 4JI4K 3OJUA 4JLHA 4DV5K 3VF6A 5SZTA 3WEEB 1NGGA 2ITGA 4NYFA 4WQ4C 4BG9A 1KVBA 3DXKA 4FJJA 4DTXA 1S1VA 2EWSA 5GIOA 2HHTA 1ISNA 4B1YB 3SV4A 2DIKA 4KRFA 3CJ1A 4IDHA 3KKSA 4M41A 2W6KA 4W5RA 1RDWX 3ZLJA 3ZSQA 2VCPA 2PAVA 3WQUA 4FWQA
chains in the Genus database with same CATH topology
4GV9A 1VBHA 1E4GT 2IVOA 4IOAL 3LDPA 1KBLA 1T3VA 2VGMA 3BINA 3VEWA 3CCUN 5JVLA 1VQKN 4GVEA 4H03B 1Q7YO 3LM9A 4CBUA 3VEXA 5CR4A 2NRXA 3AAPA 4F7GA 2D1KA 4LC9B 3KWIA 3HM8A 3TPQA 5GAHP 3I33A 3O08A 5HL7L 1VQLN 3DAWA 3GBTA 2P9PA 3U7DA 4KBOA 4ISGA 4BRQA 3NVKA 4O5FA 4UY8O 2P9PB 1MWMA 3M6GA 1YITN 4MO4A 5DM6L 3KZBA 2ZJRL 1S72N 4AM6A 4JK7A 4NB4A 4A57A 3P39A 3ULEA 5C0YA 3X23A 2ZJPL 1YUWA 3ULEB 1BO5O 3QBXA 3GL1A 5E84A 2YHXA 4WQ5A 3WUHA 2D11A 1GLBG 1YJWN 5BREA 1VQPN 2QWRA 3FZHA 1G99A 2Q0RA 2ZJQL 1QVGM 1R59O 1RGIA 4JN4A 4C1NK 4FO0A 3CCEN 4K43A 1X3MA 3ZX2A 3AGRA 3ZDTA 3NMUA 2F7TA 4B1XB 3U8ZA 3G25A 2PFUA 3O4WA 1NGBA 3UKRB 3O9TA 4QS9A 1Y19B 3WXKA 3CHWA 3CCRN 1Z6RA 3D2FA 3FLCO 5GINA 2NLXA 3N4PA 3CJ7A 3D2FB 4JKDA 3KWGA 2I1KA 3PZDA 3H1QA 2YCHA 5AFUH 1X9JA 4O8UA 2W40A 4BRCA 2GWJA 4MDBA 1JDEA 1BWFO 2CQUA 4ZRIA 3GE1A 1JCGA 2E20A 2GUPA 3S41A 4BRHA 1E4FT 5BR9A 4PKHA 4QS7A 5FPEA 1LCUA 3WXMB 3PIPL 4HTLA 3U9DA 4B1ZA 1GC7A 2RQ1A 3OBYA 2Q2RA 5EY4A 4FPBA 5DM7L 4JNEA 3O1WA 1VQ8N 5ADXA 4JEPA 3HBTA 2COPA 4BR9A 3QFPA 2RE2A 1GLLO 3U8XA 1DEJA 4CJ7A 5EX5A 3L4QA 3G71N 3IUCA 3LDQA 1QZ6A 2E1YA 1O13A 1KAYA 3EO3A 3JS6A 2YX6A 4XEIA 5HOOA 4WFAL 1ILYA 3H45C 4FWKA 1P8ZA 3BP8A 2FSKA 4XH5A 2BTFA 3O9QA 4FOEA 4HWIA 2V7ZA 2FJ9A 4BROA 3IMXA 2IVNA 2JWLA 3SBTA 1GLJO 2GTDA 3E1YA 5AQVA 3TTCA 1CZAN 5TKYA 2NRRA 4CZFA 1NM1A 1WOQA 3L0QA 2HF4A 5AQHA 2YJEA 3CCMN 4YL8A 3RVCA 3KVGA 4R79A 1QZ5A 5C15A 5AQTA 1T6CA 4I6MA 1K9MO 4BVOA 5GADP 4BRGA 4A61A 3R1XA 4I6MB 1JCFA 2QXLA 2OANA 2AL6A 2V52B 1D4XA 1Q86O 1DT9A 1QQOA 4MLEA 2NRZA 3CC4N 1C0GA 2Q1NA 4CZGA 3H46O 4YDUA 2QTDA 4YOXA 2A6AA 4EAHD 2P9NA 4K25A 5AQMA 4A2AA 5BPNA 2P9IA 3HZ6A 4IFEA 1HBKA 2P9NB 1IJJA 2P9IB 3ATVA 3HOSA 4FSVA 3TSPA 4WFBL 3M5RA 4PL7A 3FZFA 3K9JA 1KQSM 4H5VA 4O8KA 3VEOA 5M1PA 3FZKA 3CCQN 4WF9L 1TUYA 3CJBA 1OKJA 5H1SQ 1TYQA 2WC9A 3NVMA 5JLFA 2IVPA 1YXQA 3DJCA 4H5TA 4BRIA 4NLBA 4GV3A 4GV6A 4BREA 4FWOA 3PIOL 2X0SA 1VQON 3HOTA 3D7EO 1U2VB 1MDUB 5JVGL 5AQYA 3AAQA 2F9WA 2JWKA 3WXJA 5LJVA 1H4RA 3CJ9A 1YJ9N 3FZMA 3E9OA 2VYPA 5EOYA 1J19A 5AQOA 1QVFM 4C1NI 1Y64A 5M1FA 3VEZA 1DKGD 3VOVA 1IG8A 3H1VX 4CD1A 4CI6A 5JLHA 2I7PA 1P90A 4DHYA 3FGUA 4KH5A 2D10A 3FZLA 2HBKA 3WT0A 3LM2A 3VEVA 2AEHA 3ENHA 2HF3A 4ILJA 3EKUA 2E2NA 3J8AA 3O1BA 2Q97A 1OVYA 3AARA 3CC7N 2E88A 1V4TA 1YAGA 2WUSA 3FLVA 2ZF5O 3GG4A 5CE3A 3BUZB 4NLCA 4FWNA 3FE1A 3VTIA 4XH1A 4PHTX 5FPNA 2KHOA 3MWTA 5AQGA 3G9WA 4L3QA 4IZ9A 2GWKA 2WH5A 4BQZA 1NVLA 2AA4A 2QWOA 1NLVA 2HMPA 4F9OA 4IXCA 1T6DA 3OHRA 4BRDA 3E9PA 2J4RA 4MO5A 2ZPYA 4U7BA 5E26A 2OTJN 3A8YA 3CQXA 1KD1O 4A62A 5BPMA 2J0KA 1H1VA 1GLAG 5M1KA 2NRVA 2ZGYA 1HKGA 4H0YB 3UKRA 1BOTO 4BG8A 4M63C 2D0OA 4HDQA 2CH5A 3SAHA 3H3OB 3A5MC 4J8FA 4EFHA 3MN6A 1MK7B 1GG3A 1S3XA 4IO8A 2P9LA 5F2RA 3DWLA 4ZRJA 2I7NA 4C23A 2P9LB 5TKWA 3ATUA 3PLAA 1Z05A 3F5TA 1GLFO 2A40A 3MN5A 5C12A 1JCEA 5AQIA 1K8AO 3P4IA 2YVCA 3AGKA 2A3ZA 2ZGZA 3CCSN 3A0IX 1ATRA 3PVLA 4B9QA 4CZHA 3ENBA 2FDQA 3KHYA 4WCEL 2R82A 1HX1A 4JKBA 5FPMA 1BG3A 4A2BA 1VAZA 5EVZA 4ILHA 1Q82O 5AQNA 1QQMA 2NRWA 5I9EB 2BH1A 3I8BA 5JICA 4JK9A 2P9KA 3N4QA 1HKCA 2V51B 5M1NA 2P9KB 2ITMA 2J0MA 3VGMA 4JKHA 5AQUA 3LDLA 3QMLA 4BY9C 4KH4A 1VQMN 1NGHA 1GGOA 5BPLA 4BRAA 4U67L 5KQ8A 1LOTB 2HBMA 2HBJA 3ENOA 3LDOA 4OPAA 5F0XA 3CD6N 3WXLA 2LBBA 4WQ4A 2YHWA 4MLHA 3W0LA 4BRLA 4YOVA 4JKGA 1BU6O 4BRPA 3VMFB 4JKGB 3M3ZA 3UB5A 2EMTA 5C2FA 2EMSA 4FVUA 2ASPA 3EL2A 2Q0UA 3AU4A 4BR4A 2HBLA 2YI1A 2QWPA 1ATSA 4A59A 1DGKN 3O6WA 3U9ZA 3G6EN 2FSNA 1ESVA 3CPWM 3A5OC 3ZETA 3FP5A 2IIRA 1NGAA 3MCPA 2AP1A 4WQ5C 1SS6A 3MK6A 3ZETB 3ZEUB 4FWRA 5KQDA 2QWLA 1ATNA 2Q31A 5LJWA 2QA4N 1BUPA 1SZ2A 4EHTA 4FPAA 1NGDA 4XH4A 3EZWA 3C7NA 1EO1A 4H5WA 3LL3A 4ILGB 3FFKB 3C7NB 3WQTA 5CHIA 1YVNA 4EIAA 4JHDA 5AFUA 1MA9B 1RFQA 4JHDB 4YOYA 5BN9A 2DPNA 1HB8A 3QB0A 2E2OA 2E8AA 2GX9A 4DXAB 3SAFA 5M1OA 4BC4A 2FXUA 3R3LA 2ABDA 3OBWA 1JJ2M 3CETA 1XQSC 4RTFD 3VF4A 3OA9A 3R6MA 3AU5A 4CD3A 4JAXA 3MDQA 1KC7A 2ASOA 4FWPA 1HKBA 1S22A 3CMAN 5AZIB 3O8MA 4BGAA 3MX2A 5AQLA 1BA1A 4JKEA 3JXUA 2J0JA 1U2VA 1BA0A 1NWKA 1RDUA 5AQWA 3CJCA 4K42A 1NBWA 2NRTA 4CZIA 4EHUA 1NGCA 2WBNA 4BRMA 4IOXA 2KKZA 3UE5A 3P31A 3WA0A 3O9UA 2GEMA 3VGKA 4JD2A 4FWSA 4A5BA 1VQ4N 4JD2B 4AM7A 1NMDA 5GAGP 4NY0A 2QI2A 4DQ8A 1DIKA 2YHYA 5AQKA 4DKWA 3AY9A 2UYTA 2HE7A 3HSCA 5AQJA 3R8EA 2QWNA 3CXCM 4IO9L 3K9KA 2QM1A 3RSEA 1YJNN 3C0BA 4YOTA 4E1JA 5AQFA 2Q36A 2QW9A 3EKSA 3RSEB 4OO1J 5GIPA 3F2KA 3SAGA 2CH6A 2QEXN 4EKUA 2GELA 3I56N 3BEXA 1HB6A 4JKCA 3O80A 5KPTA 1M90O 2P9UA 5FPDA 2CGLA 1QQNA 4B1WB 2P9UB 1ZBSA 3B8AX 3HTVA 5C2DA 3CIPA 1NTIA 4HDOA 3P38A 4CBWA 4BGBA 2CB8A 3H6EA 3C6AA 5AQSA 1MIXA 3R9PA 5ADXH 1SQKA 3DLLL 4YDUC 4B1VA 5JVHL 3MN9A 3MN7A 3SMSA 3GOIA 1XUPO 3O9RA 2WFBA 2ZWHA 4YOUA 4BC3A 5B8HA 2A5XA 2NZTA 3QDKA 2YJFA 4DB3A 1VQ5N 1BDGA 1ZXOA 3E9LA 2QWQA 4QS8A 1NGFA 4M7XA 3KK7A 5IJMA 2CGJA 4RCHA 3WXIA 1U6ZA 3LDNA 3VGLA 4JK8A 1NGIA 1E5WA 4FOIA 1GC6A 3GDQA 3D2EA 4KH6A 5BRHA 1WUAA 1TUUA 2HSTA 1NJIO 3D2EB 3CMEN 3A5NC 3FR0A 3TSUA 4TKNA 1HPMA 3ID8A 1GLEG 3CI5A 3QFUA 4GNIA 3OW2M 5AR0A 1VQ7N 4GY2B 5BRDA 1M1KO 4CBXA 4BR7A 4IWVA 1X3NA 4ZRKA 2E1ZA 3H3NO 3TU5A 5EXWA 3CF5L 3O9SA 2FSJA 3VESA 5MLCQ 3ZX3A 3QICA 3Q7CA 3ZX0A 1VQ6N 3ID6A 1MWKA 5BRFA 4H0PA 5LY3A 4BR5A 3C6HA 3CCVN 1GLCG 4BVPA 3I55N 3SK3A 4IOCL 1Q81O 3MCAB 4BC2A 1KC8O 1SAZA 3EPYA 4CZMA 1HJOA 2BUPA 2KLAA 5AQQA 3VERA 5AZJA 3U4LA 4YOWA 2FF3B 3ZYYX 5AZJB 4GXBA 2ASMA 3VEYA 5M1QA 2VGNA 3BF1A 1NI2A 5KPZA 3CCJN 4H0XB 3MX5A 4IJNA 2D4WA 5AQRA 4PKGA 1EF1A 1SGHA 1K8KA 3ZEUA 4B1UB 3D6RA 1ZC6A 4DCHA 4Z94A 3TTDA 1K8KB 2W41A 1NGJA 2I1JA 3BF3A 4FL9A 1YIJN 3CJAA 1MK9B 4IEEA 3SMPA 3CQYA 4PKIA 3VF2A 4BRNA 3L4IA 4WYBA 1EQYA 3O5BA 5JMVA 1HLUA 4PL8A 4JKAA 5AQXA 4YORA 3L6QA 2A42A 3IFRA 2VWBA 3MWPA 4Y0WA 2NRHA 2D2QA 2H3GX 4P7IA 1Q18A 1YF5L 4H0TB 4BRKA 4CYEA 2PBDA 2E2PA 2NNWA 3MMVA 4IJAA 4G9ZA 3M1FA 3T7ZA 3J7ZO 1MIZB 4CZJA 5AQZA 1KXPA 4ISEA 3T69A 3UKUA 5ELZA 3UKUB 1N8RO 1W2BM 1VBGA 1NGEA 1KAXA 1W97L 4FWMA 4OPHA 1T44A 5AQPA 3VPZA 4H0VB 1KAZA 2A41A 4H5RA 3SBGA 2P9SA 2D0PA 4A5AA 2RHKA 4M7YA 2P9SB 3G4SN 5AZIA 4AF1A 1HUXA 3VETA 4ISFA 3A5LC 3EN9A 4MDAA 3VTHA 3SLCA 4RWTA 1ST7A 3IDHA 1YI2N 4BRFA 2HOEA 4WFNL 1XC3A 1J6ZA 1GLDG 3CPEA 4BR2A 4CZLA 4K41A 2F9TA 3HRGA 4NO7A 3IVFA 3TSQA 3CC2N 4BR0A 3F9MA 3SJHA 3WEEA 3EE8A 3CERA 3IKMA 3W3DA 5BN8A 2FF6A 3VF6A 3WEEB 1NGGA 3QBWA 1K73O 4CZEA 4WQ4C 4BC5A 4BG9A 1C0FA 5KPRA 3DXKA 5GAEP 5F1XA 3C65A 3Q7BA 2EWSA 1ACAA 3DXKB 5GIOA 4FWLA 3EE9A 4BQLA 1ISNA 4B1YB 3HI0A 1QHAA 1V4SA 3QIJA 3TTFA 2QWMA 3DXMA 2DIKA 4IEIA 3CJ1A 4IDHA 1TYQB 3DXMB 3CCLN 1VQNN 1VQ9N 2E2QA 1YHQN 2HRJA 1RDWX 5C10A 3VENA 4CZKA 4JKFA 2FLOA 2CGKA 4H0OA 4H5NA 3E66A 2OTLN 2VCPA 2PAVA 2V7YA 3WQUA 4FWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKG B;  3ENB A;  3E9O A;  3E9P A;  4JKB A;  3SBT A;  4ILH A;  4JK9 A;  4ILJ A;  3SBG A;  4JKH A;  4JKD A;  3E9L A;  4JKA A;  4JKE A;  4JK7 A;  4JKF A;  4ILG B;  3E66 A;  4JKC A;  4JK8 A;  4JKG A; 
#chains in the Genus database with same CATH topology
 1E4G T;  2QKB A;  4AQY K;  1VQK N;  1TKT A;  1ZYQ A;  3LM9 A;  4ZTF A;  1A5V A;  1KFD A;  1KLN A;  4F7G A;  4LSN A;  3KWI A;  4OX9 K;  3O08 A;  4AHS A;  2P9P A;  4KBO A;  1MWM A;  1RT2 A;  4MO4 A;  5DM6 L;  4A57 A;  5C0Y A;  3ZSY A;  1BGX T;  3LPT A;  1TKX A;  2BE2 A;  1BO5 O;  3QBX A;  5KRT A;  3FZH A;  4DSL A;  1FXX A;  1R59 O;  1X3M A;  3ZX2 A;  3ZDT A;  3NMU A;  2F7T A;  4B1X B;  2PFU A;  4C8O A;  3V9X A;  4I7F A;  4CGG A;  4DMN A;  2G8U A;  2D5R A;  2Z1H A;  3CJ7 A;  3D2F B;  4JKD A;  1C0T A;  1X9J A;  2W40 A;  1N34 K;  2CQU A;  1QQC A;  3O3F A;  1JCG A;  2GUP A;  5LMU K;  1BIS A;  5FPE A;  3HVR A;  1LCU A;  4J2B A;  1U4B A;  4HTL A;  2HHU A;  5HP1 A;  4B1Z A;  5CZ1 A;  1GC7 A;  4O0I A;  3OBY A;  5EY4 A;  5DM7 L;  4M3W A;  5BR8 K;  1VQ8 N;  4KKO A;  3V81 A;  5ADX A;  4FW2 A;  2COP A;  4CCH A;  4FJH A;  4CJ7 A;  3LDQ A;  4ID5 A;  3KLH A;  4CJF A;  4DWI A;  2E1Y A;  3EO3 A;  4QCL A;  1NJZ A;  5HOO A;  1ILY A;  1LAV A;  2FSK A;  2BTF A;  4HWI A;  3RMB A;  2V7Z A;  3AO3 A;  4ELV A;  2IVN A;  2JWL A;  4Z4E A;  2X78 A;  1NKB A;  3TTC A;  1VSF A;  2OA8 A;  3L0Q A;  2HF4 A;  4YL8 A;  5I42 A;  1NK4 A;  3VQE A;  4DSF A;  1IKY A;  2X74 A;  4B08 A;  1DT9 A;  3D45 A;  1ZBF A;  4MLE A;  3CC4 N;  1TK8 A;  4CZG A;  3H46 O;  4YOX A;  2A6A A;  1DTQ A;  3L8B A;  4EAH D;  4A2A A;  1HBK A;  3DLB A;  5HBM A;  1J5E K;  2WC9 A;  1X9W A;  4W5N A;  2IVP A;  4C8N A;  4GV3 A;  5KTQ A;  4FJI A;  2YNG A;  1EWR A;  3NH1 A;  5AQY A;  4OKE A;  4CHZ A;  3H08 A;  3E9O A;  2B6A A;  2KW4 A;  5EOY A;  1QVF M;  1KLM A;  2OCE A;  5KGW A;  2I7P A;  1NJX A;  3FGU A;  4DR2 K;  1BIU A;  3LM2 A;  3NF7 A;  3VEV A;  4CED A;  3J8A A;  4CW7 B;  4F3T A;  1C0U A;  2Q97 A;  4AHV A;  1TK0 A;  3CC7 N;  4DSI A;  4DR7 K;  2IS3 A;  1KRP A;  3P1G A;  4PHT X;  3OS2 A;  1X1P A;  4Z4G A;  1RDD A;  3G9W A;  3DOL A;  3LZI A;  2HMP A;  2J4R A;  4MO5 A;  1XI1 A;  2OTJ N;  1KD1 O;  2J0K A;  2FBX A;  4H0Y B;  3MXJ A;  3EZ5 A;  4CF8 A;  3THV A;  3K58 A;  1SV5 A;  4J8F A;  3MN6 A;  1GG3 A;  3KLE A;  1HNV A;  4CHP A;  2P9L B;  3ATU A;  3F5T A;  2A40 A;  1L3U A;  1JCE A;  3CCS N;  1ATR A;  4OKJ A;  4CZH A;  2KTQ A;  1HX1 A;  4JKB A;  4I2P A;  1BG3 A;  3NE6 A;  1HQU A;  1VAZ A;  3B6O A;  1YTU A;  5AQN A;  1QQM A;  2NRW A;  3AA3 A;  3I8B A;  4CEC A;  1Z25 A;  2OPP A;  4BWJ A;  5AQU A;  1VQM N;  5BPL A;  4BRA A;  4U67 L;  1EXQ A;  1G15 A;  1LOT B;  2HBJ A;  3BZC A;  3ENO A;  1JLB A;  5F0X A;  3WXL A;  1N36 K;  5HRS A;  3ZT3 A;  4B3T K;  4YOV A;  4W5T A;  1BU6 O;  3OYF A;  1CLQ A;  4JKG B;  4FVU A;  3VN5 A;  1WNS A;  2EMS A;  2ASP A;  2RPI A;  3CG7 A;  3EL2 A;  3VQA A;  5HRO A;  4CGH A;  3OYG A;  1ATS A;  3O6W A;  3G6E N;  2FSN A;  3TAE A;  3NDK A;  3A5O C;  2GUI A;  4WQ5 C;  4FWR A;  1WB9 A;  1S5J A;  2Q31 A;  4F3O A;  5C25 A;  1SZ2 A;  4FPA A;  1B92 A;  2HB5 A;  3LL3 A;  4ILG B;  4DR5 K;  3HJF A;  1WBD A;  4F4K A;  5AFU A;  1RTJ A;  1MA9 B;  1HB8 A;  1SUQ A;  2E2O A;  2E8A A;  1S1T A;  5DMR A;  2YNH A;  1LAW A;  1HQE A;  1YTA A;  3OBW A;  1JJ2 M;  3CET A;  4PA1 A;  1IKW A;  3OA9 A;  4CD3 A;  1S22 A;  4B9U A;  5AZI B;  1GOA A;  3O8M A;  3MX2 A;  5AQL A;  2WON A;  4FM0 A;  1A5X A;  4A61 A;  4EHU A;  4W5Q A;  1NBW A;  2NRT A;  1NGC A;  2WBN A;  4F2S A;  2O8C A;  1HYZ A;  3UE5 A;  3P31 A;  4KHN A;  4JD2 A;  2E4L A;  4KTQ A;  4A5B A;  4AM7 A;  4Z4C A;  4NY0 A;  3V1R A;  1DIK A;  3OYI A;  3AY9 A;  2UYT A;  3R8E A;  4DTN A;  3QEP A;  4H4M A;  1RT7 A;  1VSL A;  4FM2 A;  3SUN A;  2QW9 A;  3RSE B;  4K0K K;  2YHB A;  4E7J A;  4EKU A;  2GEL A;  3O80 A;  5KPT A;  1M90 O;  3TAN A;  2P9U A;  4E7H A;  3PX0 A;  1ZBS A;  3B8A X;  3P38 A;  4CGF A;  3OY9 A;  1ZBU A;  2VQF K;  1F21 A;  5AQS A;  1MIX A;  4CJ3 A;  1L3V A;  1RBR A;  3DLL L;  2P51 A;  4BE0 A;  2DFF A;  1QE1 A;  4RW6 A;  1TKD A;  5FRM A;  4HTU A;  2B4J A;  1VQ5 N;  5CYQ A;  3QER A;  1N33 K;  2QWQ A;  4QS8 A;  4M7X A;  3KK7 A;  4RCH A;  4DG1 A;  3DMJ A;  3LDN A;  5CYM A;  3VGL A;  1NGI A;  1E5W A;  1GC6 A;  3DLG A;  4KHW A;  1BQM A;  2HST A;  1WSF A;  3CME N;  4GKJ K;  3ID8 A;  3OW2 M;  3CI5 A;  3DLH A;  2E1Z A;  3VQ4 A;  4LF8 K;  1Q9Y A;  3O9S A;  4LF6 K;  3Q7C A;  4FJL A;  1MWK A;  5BRF A;  3JYT A;  3HXM A;  3FFI A;  4BVP A;  4CF1 A;  1FJG K;  3MCA B;  3AVJ A;  1KC8 O;  3LPU A;  4CJK A;  2BUP A;  3DLK A;  1S6P A;  4CF9 A;  1X9M A;  4YOW A;  2FF3 B;  3ZYY X;  5AZJ B;  3CCJ N;  3BF1 A;  1NI2 A;  4O4G A;  5A2Q O;  3MX5 A;  2X6S A;  3CM5 A;  1BI4 A;  4E1N A;  4CF2 A;  4PKG A;  1TKZ A;  4FLU A;  1J53 A;  1K8K A;  3D6R A;  4BE1 A;  1OH6 A;  1NGJ A;  4FL9 A;  3CJA A;  4IFY A;  3S3O A;  2Z1I A;  3C95 A;  5AQX A;  3L6Q A;  2NRH A;  4CHO A;  4B3O A;  1J9A A;  2NNW A;  4IJA A;  3T7Z A;  1MIZ B;  1IKV A;  3TAB A;  1ZBL A;  3BZK A;  2UUB K;  4LFC K;  3F9K A;  3I0S A;  3QEI A;  3T69 A;  1I39 A;  1N6Q A;  1CXQ A;  3UKU B;  1N8R O;  1KTQ A;  1W97 L;  1KAX A;  5AQP A;  4KHY A;  4H5R A;  3THW B;  2P9S B;  3KD1 E;  5AZI A;  4KB1 A;  3THX A;  3L2W A;  4BDZ A;  4ISF A;  4MDA A;  1N32 K;  4RWT A;  3IDH A;  2HMI A;  4B9L A;  1J6Z A;  4BR2 A;  3HRG A;  3CC2 N;  3F9M A;  3J81 O;  3SJH A;  2IOC A;  3EE8 A;  3W3D A;  3VQB A;  4B8A B;  3I8D A;  1K73 O;  4CZE A;  1C6V A;  1C0F A;  5F1X A;  3C65 A;  1RT5 A;  3DXK B;  4IBN A;  4JS4 A;  4FWL A;  4NCA A;  4BQL A;  3HI0 A;  3QIJ A;  4QAG A;  5FRN A;  4IEI A;  4JI7 K;  1VQ9 N;  1D8Y A;  2HRJ A;  4E0D A;  2CGK A;  4H0O A;  4JYA K;  1REV A;  1WBB A;  4IOA L;  1YT3 A;  2VGM A;  4DTR A;  3BIN A;  3VEW A;  2ZM6 K;  4GVE A;  3AVC A;  3VEX A;  2NRX A;  3C6U A;  1S6Q A;  3L2U A;  4ICL A;  5DK5 A;  3TPQ A;  3HM8 A;  5GAH P;  4X65 K;  4CJU A;  3DAW A;  4O0J A;  3U7D A;  3NVK A;  2P9P B;  4JI5 K;  1YIT N;  4DU3 A;  4CJV A;  4JK7 A;  4NB4 A;  5EU7 A;  4BDP A;  3OYH A;  3VQD A;  2ZJP L;  2O8E A;  3LDS A;  3QEW A;  3GL1 A;  1YJW N;  1W0H A;  1G99 A;  1RGI A;  1S9G A;  4C1N K;  3AGR A;  4CEF A;  1VSJ A;  4B9M A;  4EZ6 A;  3UKR B;  2Y1I A;  3O9T A;  4CJT A;  4R5P A;  1HRH A;  1Z6R A;  1VHX A;  1S1W A;  4BRC A;  3SQ2 A;  2PYJ A;  3GE1 A;  2E20 A;  1LV5 A;  4QS7 A;  3VQC A;  1VSM A;  3AO1 A;  3U9D A;  1UA1 A;  1OVQ A;  4EP5 A;  2Q2R A;  4DS5 A;  5C24 A;  3DRR A;  3HBT A;  1GLL O;  3OYL A;  5EX5 A;  2A1R A;  3L4Q A;  1JL2 A;  1JKH A;  3IUC A;  3PSI A;  3HO1 A;  4CHY A;  5I3U A;  1N5Y A;  3O9Q A;  4YFU A;  3AVA A;  3IMX A;  3CFP A;  1GLJ O;  4IDK A;  3HP6 A;  5TKY A;  1O1W A;  2NRR A;  4CZF A;  1NM1 A;  3SV3 A;  4V19 S;  3VA0 A;  5J1E A;  2YJE A;  3CCM N;  4CJ4 A;  4R79 A;  2EHG A;  4OJR A;  5C15 A;  4LF7 K;  4I6M A;  3PX4 A;  4BVO A;  1RNH A;  3AA2 A;  1JCF A;  3QIO A;  4NXM K;  4FW1 A;  4RW8 A;  2OZS A;  2NRZ A;  1C0G A;  3S3N A;  4YDU A;  4DUY K;  1JLQ A;  2X6N A;  2P9N A;  4K25 A;  5AQM A;  4CEO A;  1DLO A;  4M3U A;  2O8F A;  3M8R A;  2UUC K;  5IT9 O;  3TSP A;  4FK2 A;  3KD5 E;  4WFB L;  4DFM A;  3M5R A;  3DRS A;  4O8K A;  5M1P A;  3FZK A;  4WF9 L;  3CJB A;  4M3Z A;  1YXQ A;  4GV6 A;  4B3R K;  1D9F A;  2VYP A;  1JLE A;  3VOV A;  1J54 A;  4CI6 A;  4DHY A;  3SI6 A;  3EEQ A;  2D10 A;  2HBK A;  3KIO A;  4EP4 A;  2AEH A;  2HF3 A;  3EKU A;  3O1B A;  2E2N A;  4UQG A;  5J2N A;  1XNQ K;  1FKP A;  1V4T A;  2WUS A;  5CE3 A;  3KK3 A;  2ZF5 O;  4CE9 A;  3BUZ B;  3VTI A;  2P1J A;  2UXB K;  2KHO A;  2WH5 A;  4BQZ A;  4CJS A;  1NLV A;  1EX4 A;  3OHR A;  2ZPY A;  5E26 A;  3CQX A;  4KB0 A;  5M1K A;  2NRV A;  2ZGY A;  2XRI A;  3UKR A;  1LW2 A;  1WAJ A;  4BG8 A;  1S1U A;  4M63 C;  4CJ5 A;  1RCH A;  4DV6 K;  3PSF A;  4FJ7 A;  3OYA A;  1S3X A;  4CJW A;  2I7N A;  4C23 A;  3OYK A;  5TKW A;  4CJP A;  1K8A O;  3SQ4 A;  3AGK A;  2A3Z A;  2ZGZ A;  2JLE A;  3ENB A;  2FDQ A;  4FLT A;  2R82 A;  3V9U A;  3K59 A;  5FPM A;  4PWD A;  5EVZ A;  4ILH A;  1Q82 O;  4FZX C;  3O3H A;  2P9K A;  1TAU A;  1HKC A;  4GMJ B;  3IRX A;  3QML A;  3NGY A;  4KH4 A;  3WNH A;  3CD6 N;  2P5G A;  4E7I A;  1S1X A;  1HMV A;  2LBB A;  1HNI A;  4WQ4 A;  2HW3 A;  4MLH A;  2KQ2 A;  3AVF A;  2XY5 A;  5C2F A;  2EMT A;  3WNE A;  4NYN A;  4A59 A;  3V4I A;  4KI6 A;  4GVM A;  1XMQ K;  1ESV A;  3ZET A;  1KCF A;  4DR1 K;  1SS6 A;  3MK6 A;  4CES A;  4ID1 A;  3K5L A;  2QWL A;  3KTQ A;  3TI0 A;  4Q0B A;  2QA4 N;  2HHQ A;  4H5W A;  4CHQ A;  3THY A;  3OS0 A;  3WQT A;  2KZZ A;  4EIA A;  4JHD A;  3M8S A;  1VSI A;  1NK9 A;  1RFQ A;  1W9H A;  5BN9 A;  4CIF A;  3QB0 A;  4DXA B;  2FXU A;  3R3L A;  4DTS A;  2ABD A;  5FRO A;  1XQS C;  3OYN A;  3L2V A;  3ZSW A;  4JAX A;  4FLY A;  3CMA N;  1HKB A;  2XY8 A;  3AVN A;  3VQ6 A;  5HLF A;  3QET A;  3JXU A;  2J0J A;  1BA0 A;  4K42 A;  2RN2 A;  4BRM A;  4QOZ B;  1UOC A;  2O8C B;  3K0S A;  4LF5 K;  2GEM A;  3G0Z A;  5D3G A;  1VQ4 N;  3OTO K;  3AVL A;  4JD2 B;  1NMD A;  4ZHR A;  4DQ8 A;  2YHY A;  3HSC A;  2XHB A;  4FLZ A;  1D9D A;  1TL1 A;  3K9K A;  2QM1 A;  3QEX A;  1YJN N;  3RRG A;  4E7K A;  2Q36 A;  1VK0 A;  4N47 A;  3EKS A;  4OO1 J;  3T19 A;  2CH6 A;  4DQS A;  4DR6 K;  4DQI A;  2JGU A;  3BEX A;  1EP4 A;  1QQN A;  2P9U B;  3HTV A;  5C2D A;  3AO4 A;  3CIP A;  1NJW A;  4HDO A;  3C6A A;  3SYZ A;  3R9P A;  5K14 A;  5JVH L;  3GOI A;  3O9R A;  3CFO A;  2HND A;  5B8H A;  3RMC A;  1BDG A;  3E9L A;  3ZCM A;  3WXI A;  1U6Z A;  1Q9X A;  2Y1J A;  4DFK A;  1TGO A;  4FOI A;  2HHX A;  4NCG A;  3D2E A;  4FJX A;  3FR0 A;  5J2M A;  1HPM A;  4GNI A;  5CY4 A;  3OYD A;  3M8Q A;  3HST B;  2YKN A;  1M1K O;  4CJQ A;  4CBX A;  1HNW K;  4IWV A;  4N41 A;  4FJ8 A;  4F8R A;  4K8X A;  3VES A;  2O4I A;  1R0A A;  1VQ6 N;  5AJ3 K;  3ID6 A;  5LY3 A;  4BR5 A;  3PUF A;  3C6H A;  2Z1J A;  4KTZ A;  4IOC L;  3SK3 A;  4DV2 K;  2VWJ A;  2PY5 A;  2G8W A;  2QK9 A;  4CZM A;  3OVN A;  3U4L A;  2GV9 A;  2ASM A;  5KPZ A;  5M1Q A;  3CFR A;  4H0X B;  2VWK A;  1SGH A;  1BI4 B;  1T8E A;  1K8K B;  1XWL A;  3JSM A;  1NK5 A;  4LFB K;  1MK9 B;  1HPZ A;  4IEE A;  3SMP A;  3CQY A;  4PKI A;  3VF2 A;  3U3Y A;  2BGG A;  4DSJ A;  1NG9 A;  1HR0 K;  1HLU A;  4E7L A;  4JKA A;  1NJI O;  4Y0W A;  2A42 A;  2VWB A;  2H3G X;  1YF5 L;  3V1O A;  4H0T B;  4BRK A;  2PZS A;  4CYE A;  2O8D A;  4MFB A;  4PUO A;  4G9Z A;  1RIL A;  4CZJ A;  3VA3 A;  1B9F A;  1KXP A;  4AIL C;  1NK6 A;  3RMA A;  5ELZ A;  1ZBH A;  2BDP A;  1VBG A;  4FWM A;  1NK0 A;  2XY7 A;  4Z0U A;  4BWM A;  5SWM A;  2A41 A;  2Q3S A;  3SBG A;  3NCI A;  4A5A A;  4HUG A;  4RW7 A;  1HUX A;  4FJ5 A;  4YNQ A;  3VET A;  3A5L C;  3THX B;  3SLC A;  1ST7 A;  3LP0 A;  2G8I A;  3LAK A;  4WFN L;  1GLD G;  1BL3 A;  2HHH K;  3HPH A;  4BR0 A;  4B9T A;  2DTU A;  3QBW A;  1SL1 A;  1RDA A;  4CEE A;  3IS9 A;  1RTI A;  1SL2 A;  3Q7B A;  3HP9 A;  4NXN K;  3UIQ A;  4DV4 K;  2FBV A;  1QHA A;  1V4S A;  3DXM A;  3HYF A;  1SL0 A;  1TYQ B;  4BAC A;  3CQ8 A;  3CCL N;  4HUE A;  4OPK A;  3ZT1 A;  2E2Q A;  5C10 A;  3VEN A;  4JKF A;  2FLO A;  4H5N A;  2OTL N;  5CZ2 A;  4DTM A;  3VQP A;  4FM1 A;  2IVO A;  4CIE A;  5JVL A;  1Q7Y O;  4FXD A;  4CBU A;  3NH2 A;  3L2R A;  5CR4 A;  4CIG A;  3ASM A;  2D1K A;  4LC9 B;  4LFA K;  3QES A;  1NJY A;  1VQL N;  4Z4I A;  4LD0 A;  4ISG A;  4BRQ A;  1XMO K;  3M6G A;  3OYE A;  5JS2 A;  2ZJR L;  1S72 N;  3RR7 A;  1FK9 A;  3P39 A;  3ULE A;  1OH7 A;  3KKR A;  3X23 A;  1IO2 A;  4FVM A;  1RBU A;  2YHX A;  4WQ5 A;  3SZ2 A;  2O8E B;  3HL8 A;  2QWR A;  5HRP A;  1QVG M;  3VQ5 A;  4JN4 A;  4Z4H A;  2A1S A;  4FO0 A;  4OLA A;  3MXI A;  3MAQ A;  2F8S A;  3O4W A;  1NGB A;  3AVK A;  3K2P A;  3WXK A;  1NOZ A;  4KRE A;  5GIN A;  2NLX A;  3N4P A;  1U47 A;  4FJK A;  1QSL A;  3KWG A;  5HRN A;  4HCC A;  2I1K A;  4JI3 K;  3MXM A;  4RG8 A;  1ASV A;  4O8U A;  2ZD1 A;  1BWF O;  4JV5 K;  4ZRI A;  1IBL K;  4CJL A;  4X64 K;  3S41 A;  4KV8 A;  3RTV A;  3KK1 A;  2YKM A;  3WXM B;  3PIP L;  1HNZ K;  1NU0 A;  1RBT A;  3PO4 A;  2RQ1 A;  4B9V A;  5KRS A;  4KHQ A;  3DLR A;  4JNE A;  3LP3 A;  3O1W A;  4DV3 K;  4DQQ A;  5FLX O;  4JEP A;  4OKK A;  4OVL A;  3QFP A;  2RE2 A;  1EKE A;  3HVT A;  4I2Q A;  3G71 N;  1GOC A;  1O13 A;  1KAY A;  2YX6 A;  3ZT0 A;  3H45 C;  1P8Z A;  4BRO A;  4DLG A;  1U04 A;  4E1M A;  1OH5 A;  4LH4 A;  2VG7 A;  1CZA N;  1RT1 A;  2YNI A;  3NF9 A;  2G8H A;  5AQT A;  5GAD P;  4BRG A;  1JXB A;  4PY5 A;  4I6M B;  2QXL A;  1D4X A;  1Q86 O;  3QIN A;  4CEA A;  1QQO A;  4B9N A;  3OYJ A;  4HVJ A;  3LWM A;  1JL1 A;  2P9I A;  2P9N B;  4IG0 A;  3ATV A;  4FSV A;  2O8F B;  3ZSO A;  3ZT2 A;  4N5S A;  4PL7 A;  3FZF A;  3K9J A;  4H5V A;  4JI1 K;  3VEO A;  4LF4 K;  3ZT4 A;  1TUY A;  4O44 A;  4N76 A;  1OKJ A;  5H1S Q;  1TYQ A;  3NVM A;  5JLF A;  2BAN A;  1NOY A;  4BRI A;  1U45 A;  4CHN A;  3DI6 A;  4FWO A;  4CFC A;  3HM9 A;  4PQU A;  2F9W A;  2JWK A;  2RF2 A;  3WXJ A;  4DTJ A;  1QS4 A;  1YJ9 N;  3CJ9 A;  3FZM A;  1BQN A;  3J80 O;  1J19 A;  3PX6 A;  1UA0 A;  4C1N I;  2OPR A;  1Y64 A;  1IG8 A;  4CD1 A;  1P90 A;  4KH5 A;  1RT3 A;  1SKW A;  3ENH A;  1TV6 A;  4OPJ A;  2FC0 A;  3FLV A;  2XY6 A;  2OYQ A;  3FE1 A;  1VRT A;  4XH1 A;  4AHC A;  1L5U A;  2E6M A;  3MWT A;  5AQG A;  3ALY A;  4IZ9 A;  3L2Q A;  1IBM K;  2XO7 A;  1NVL A;  2AA4 A;  4RW9 A;  4IXC A;  1T6D A;  4U7B A;  3A8Y A;  4CEZ A;  4A62 A;  5BPM A;  1H1V A;  1HKG A;  4DU1 A;  1BOT O;  4DFP A;  3QNN A;  2CH5 A;  3SAH A;  3H3O B;  3A5M C;  4EFH A;  5F2R A;  3DWL A;  4ZRJ A;  4B8C A;  3LAM A;  1Z05 A;  3MN5 A;  1GLF O;  5C12 A;  3J7A P;  3P4I A;  4G1Q A;  4J2E A;  3A0I X;  3PVL A;  4B9Q A;  4FLX A;  3KHY A;  4WCE L;  3U3G A;  3VQ8 A;  4ZTJ A;  4A2B A;  4FJ9 A;  1BIZ A;  3O3G A;  3E01 A;  2V51 B;  2KFZ A;  2IC3 A;  3AO2 A;  2P9K B;  2ITM A;  4B3M K;  2J0M A;  3VGM A;  3LDL A;  4BY9 C;  1NGH A;  1NKE A;  4Z4F A;  1ITG A;  3L3V A;  3EY1 A;  3BDP A;  3AVI A;  2YHW A;  4TSX A;  3AVG A;  3W0L A;  4BRL A;  3V9Z A;  3TAP A;  2PYL A;  1T03 A;  3M3Z A;  4O55 A;  3KLF A;  4KTW A;  3ZSR A;  4NCB A;  2Q0U A;  3AU4 A;  3VQ7 A;  4BR4 A;  4N56 A;  1C1A A;  4BDY A;  3V9S A;  3CPW M;  3FP5 A;  4DUZ K;  2IIR A;  3MCP A;  3ZEU B;  2AP1 A;  5J2P A;  3QEV A;  3ZET B;  4C8M A;  1ATN A;  4FK4 A;  1S9E A;  3K5N A;  1HJR A;  4W5O A;  3HK2 A;  3EZW A;  3C7N A;  1CZB A;  4I9L A;  4J2D A;  1YVN A;  1IV0 A;  2HVI A;  3THY B;  4DS4 A;  4JHD B;  2DPN A;  4CGD A;  1RDB A;  2HVH A;  3QNO A;  4IFV A;  5M1O A;  2KZM A;  4FJN A;  1QSS A;  4DQP A;  4RTF D;  3VF4 A;  2E5L K;  3R6M A;  4HHT A;  3AU5 A;  3MDQ A;  1KC7 A;  2ASO A;  4FWP A;  2OZM A;  2QKK A;  4CK1 A;  4KAZ A;  3ULD A;  1IH7 A;  1K6Y A;  1NWK A;  1RDU A;  4DQR A;  4IOX A;  2KKZ A;  1W7A A;  3SPY A;  3QIP A;  3RWU A;  3LP2 A;  5GAG P;  1MU2 A;  4BE2 A;  5AQK A;  2ATQ A;  1T05 A;  4DKW A;  1NKC A;  3CXC M;  5AQJ A;  4M3Y A;  4IO9 L;  3AA4 A;  3C0B A;  1WSJ A;  3F2K A;  5GIP A;  1L3S A;  2QEX N;  3I56 N;  2O8B A;  1HB6 A;  1QHT A;  1J5O A;  4B1W B;  1RT4 A;  3H6E A;  1HNX K;  5ADX H;  4KFB A;  5J2Q A;  1WSH A;  3DOK A;  4K8Z A;  3MN9 A;  3MN7 A;  3SMS A;  4AHT A;  2FBY A;  2WFB A;  4YOU A;  3AV9 A;  4I9Q A;  2YJF A;  1I3A A;  1ZXO A;  1NGF A;  3KLI A;  1JLF A;  1UWB A;  1WUA A;  1TUU A;  1JLA A;  3D2E B;  3A5N C;  4CK2 A;  3QFU A;  1ASU A;  1RTD A;  5AR0 A;  1VQ7 N;  4GW6 A;  4GY2 B;  4M3X A;  1X3N A;  4ZRK A;  2FBT A;  3H3N O;  5EXW A;  4C8K A;  2FSJ A;  3AVB A;  2IDO A;  2OPQ A;  3LAN A;  4H0P A;  1LWF A;  1JXE A;  3JAM O;  3CCV N;  3I55 N;  1Q81 O;  4CK3 A;  3NGZ A;  4BC2 A;  5AQQ A;  2D0C A;  3VER A;  1FW6 A;  5FDL A;  4J2A A;  2VGN A;  2D4W A;  2VG6 A;  4LY7 A;  1EF1 A;  1VSK A;  3AO5 A;  3ZEU A;  4B1U B;  1ZC6 A;  4Z94 A;  1YIJ N;  2W41 A;  1VSE A;  4L8R B;  2I1J A;  4DV7 K;  3L3U A;  4E3S A;  4WYB A;  1EQY A;  3O5B A;  5JMV A;  2OPS A;  3NF6 A;  3HPG A;  4M45 A;  5KQD A;  4YOR A;  1KSP A;  3IFR A;  1XHZ A;  2E2P A;  3ISN C;  1SKR A;  2O8D B;  3IG1 A;  4JI2 K;  5AQZ A;  3IAY A;  4ISE A;  4FJM A;  1W2B M;  1UAX A;  4OPH A;  3VPZ A;  4H0V B;  1T7P A;  3SUP A;  3WNF A;  3CM6 A;  4LSL A;  4CFB A;  3TAG A;  4AF1 A;  4DV0 K;  5IWA K;  3EN9 A;  3VTH A;  2HNZ A;  2QXF A;  4DTP A;  4EZ9 A;  1YI2 N;  3K5M A;  1U49 A;  3QO9 A;  1XC3 A;  3KK2 A;  3DRP A;  2GBZ A;  4CZL A;  1KFS A;  3IVF A;  3LAL A;  3WEE A;  1RDC A;  1WN7 A;  3CER A;  1LWE A;  3IKM A;  5BN8 A;  1SKS A;  2FF6 A;  4DTU A;  4BC5 A;  1ZBI A;  5KPR A;  5GAE P;  1ACA A;  4CGJ A;  4DR4 K;  3EE9 A;  3TAR A;  3TTF A;  4FLV A;  2QWM A;  4CVN E;  3ITH A;  3DXM B;  1GOB A;  1VQN N;  3I0R A;  1VSD A;  1YHQ N;  2F8T A;  4CZK A;  4DU4 A;  1FKO A;  3NHG A;  1TL3 A;  3E66 A;  2V7Y A;  4GV9 A;  1VBH A;  4DF8 A;  4O5B A;  1OH8 A;  1D5A A;  3LDP A;  1KBL A;  1T3V A;  3CCU N;  2NUB A;  4H03 B;  3AAP A;  3LP1 A;  3AVM A;  3OJS A;  2DY4 A;  3VQ9 A;  4OGC A;  3OYB A;  3I33 A;  5HL7 L;  3TAM A;  2G8K A;  3GBT A;  3MEG A;  3B6P A;  4DF4 A;  4O5F A;  4UY8 O;  4XIU A;  4AHU A;  3KZB A;  4AM6 A;  2G8F A;  1YUW A;  3ULE B;  4YHH K;  4KHP K;  5E84 A;  3WUH A;  2D11 A;  1GLB G;  5BRE A;  1VQP N;  2Q0R A;  2ZJQ L;  3OS1 A;  3CCE N;  4K43 A;  3U8Z A;  3G25 A;  3ZSV A;  4GKK K;  1EWQ A;  4QS9 A;  3SQ1 A;  1Y19 B;  3CHW A;  3CCR N;  3D2F A;  3FLC O;  2F96 A;  3PZD A;  2EX3 A;  2DFH A;  2YCH A;  3H1Q A;  5AFU H;  3OYM A;  2GWJ A;  4MDB A;  1JDE A;  4KPY A;  1Z26 A;  3SCX A;  4BRH A;  1E4F T;  5BR9 A;  4PKH A;  3V1Q A;  3S3M A;  4H8K A;  4X66 K;  4FPB A;  4BR9 A;  5C42 A;  1CXU A;  4FCY A;  3U8X A;  1DEJ A;  3NAE A;  1QZ6 A;  4IKF A;  3C94 A;  3JS6 A;  1JLC A;  4JS5 A;  4XEI A;  3QLH A;  2UXC K;  4WFA L;  4FWK A;  1DTT A;  3BP8 A;  4XH5 A;  4FOE A;  4CFD A;  2FJ9 A;  3AVH A;  3SBT A;  2GTD A;  3E1Y A;  2ZE2 A;  4JI8 K;  5AQV A;  4LH5 A;  5T7B A;  1WOQ A;  4CJR A;  5AQH A;  1HYS A;  1QTM A;  3RVC A;  3KVG A;  3WNG A;  5E41 A;  1QZ5 A;  1T6C A;  1K9M O;  3R1X A;  2V52 B;  1A5W A;  2OAN A;  2AL6 A;  3SUO A;  4AHR A;  3S9H A;  2Q1N A;  4DTO A;  2QTD A;  1I94 K;  5BPN A;  4M3R A;  3HZ6 A;  4IFE A;  1IJJ A;  1VSH A;  3O4Q A;  2P9I B;  3HOS A;  2HHV A;  3A2F A;  1KQS M;  4DR3 K;  1NK8 A;  4FZY A;  1XC9 A;  3CCQ N;  3SNN A;  3RMD A;  3DJC A;  4H5T A;  4NLB A;  1IBK K;  4BRE A;  5LL6 Z;  3PIO L;  2X0S A;  1VQO N;  3HOT A;  3D7E O;  1U2V B;  1MDU B;  5JVG L;  1U48 A;  3AAQ A;  5LJV A;  1H4R A;  4KHS A;  1B9D A;  5AQO A;  3RR8 A;  5M1F A;  3VEZ A;  1DKG D;  1IG9 A;  2R7Y A;  3H1V X;  4IG3 A;  5JLH A;  3SJJ A;  3FZL A;  3T1H K;  3WT0 A;  3M8P A;  3BGR A;  3LZJ A;  4ILJ A;  1OVY A;  3AAR A;  2E88 A;  1YAG A;  3GG4 A;  4B3S K;  2HNY A;  4NLC A;  4FWN A;  5FPN A;  4CEB A;  4L3Q A;  2GWK A;  4LF9 K;  1NK7 A;  2QWO A;  4FJG A;  1RBV A;  4F9O A;  1WSE A;  4BRD A;  3LWL A;  3E9P A;  4JI6 K;  4KO0 A;  4OGE A;  4YY3 K;  1GLA G;  4E89 A;  2D0B A;  3DLE A;  1XHX A;  2D0O A;  4HDQ A;  2G8V A;  2VG5 A;  4AH9 A;  4CGI A;  1MK7 B;  4JI0 K;  3NF8 A;  4IO8 A;  2P9L A;  4CF0 A;  3KJV A;  3HPO A;  3SUQ A;  3PLA A;  1RBS A;  5HRR A;  5AQI A;  3MED A;  2YVC A;  1C1B A;  3OYC A;  4H4O A;  1KVA A;  5JIC A;  5I9E B;  2BH1 A;  4JK9 A;  3N4Q A;  2I5J A;  5M1N A;  4JKH A;  1X9S A;  2YHA A;  1GGO A;  4FK0 A;  1LW0 A;  5KQ8 A;  2HBM A;  2YV0 X;  3LDO A;  3P5J A;  4OPA A;  4JRP A;  2KFN A;  1E3M A;  4DLE A;  4DSK A;  4CJE A;  4F2R A;  4JKG A;  4BRP A;  3VMF B;  3UB5 A;  3TAQ A;  1BCM A;  4M3T A;  4HCB A;  2HBL A;  2YI1 A;  4FYD A;  3PY8 A;  2QWP A;  2HHW A;  3C6T A;  1DGK N;  3U9Z A;  1BCO A;  2RKI A;  2WTU A;  1NGA A;  2DFE A;  2E6L A;  3V6D A;  4OLB A;  5LJW A;  1BUP A;  4EHT A;  1NGD A;  4XH4 A;  1EO1 A;  1VRU A;  3FFK B;  3C7N B;  3EYZ A;  5LMN K;  5CHI A;  4YOY A;  2GX9 A;  3K5O A;  2W6L A;  3SAF A;  1QSY A;  4BC4 A;  1XNR K;  3NFA A;  3P83 D;  3TAF A;  1TK5 A;  3MEC A;  4BGA A;  4KI4 A;  1Y97 A;  1BA1 A;  4JKE A;  1U2V A;  5AQW A;  3CJC A;  4CZI A;  3NH0 A;  4X62 K;  3BY5 A;  2UUA K;  2IGI A;  3WA0 A;  4ELU A;  3O9U A;  3MEE A;  1C1C A;  3VGK A;  4FWS A;  1RTH A;  3D0P A;  2QI2 A;  3DM2 A;  4CER A;  2HE7 A;  1WAF A;  2QWN A;  3O4N A;  4DFJ A;  3HT3 A;  4KHU A;  3RSE A;  4YOT A;  1Q8I A;  5AQF A;  4E1J A;  4C8L A;  2LSN A;  3SAG A;  4E19 A;  2B5J A;  5KI6 A;  3U6F A;  4JKC A;  2O8B B;  1YVU A;  5FPD A;  2CGL A;  4Y1C A;  1NTI A;  1TAQ A;  4CBW A;  1KVC A;  1JLG A;  4BGB A;  2CB8 A;  4MQ3 A;  4ELT A;  1SQK A;  2IAJ A;  4YDU C;  4B1V A;  4JRQ A;  1XUP O;  1C0M A;  2UXD K;  1HYV A;  2ZWH A;  4BC3 A;  2A5X A;  2NZT A;  3QDK A;  4DB3 A;  3RRH A;  4FLW A;  3K57 A;  3VQQ A;  3PO5 A;  5IJM A;  2CGJ A;  1WLJ A;  3NGI A;  4JK8 A;  4KH6 A;  3GDQ A;  2WOM A;  5BRH A;  4Y1D A;  4DV1 K;  3TSU A;  4TKN A;  1NMN A;  3J7Y P;  1GLE G;  3PV8 A;  5BRD A;  4BR7 A;  3TU5 A;  3CF5 L;  1ASW A;  1WSI A;  5MLC Q;  3G10 A;  3ZX3 A;  3QIC A;  3T1A A;  3ZX0 A;  3KLG A;  4Q5V A;  4M42 A;  1GLC G;  3NBP A;  1CZ9 A;  3TWH A;  2AJQ A;  1EET A;  1SAZ A;  3EPY A;  1HJO A;  2KLA A;  2UU9 K;  5AZJ A;  4B9S A;  4DSE A;  4GXB A;  3VEY A;  5JS1 A;  4IJN A;  3F73 A;  2F4V K;  3SQ0 A;  5AQR A;  4HUF A;  2O4G A;  3ZSX A;  2P5O A;  4DCH A;  3TTD A;  3BF3 A;  4CFA A;  1TVR A;  5KGX A;  2ETJ A;  4BRN A;  3L4I A;  4FZZ A;  3CYM A;  1WSG A;  4WE1 A;  4PL8 A;  2YNF A;  3MWP A;  1RT6 A;  2D2Q A;  2Z1G A;  1NNE A;  4P7I A;  1Q18 A;  2PBD A;  3MMV A;  3V9W A;  3M1F A;  1LWC A;  1BHL A;  3J7Z O;  1IKX A;  3TR8 A;  3T1Y K;  3DYA A;  1L3T A;  3UKU A;  1NGE A;  1T44 A;  3THW A;  4CEQ A;  1KAZ A;  2P9S A;  2D0P A;  2RHK A;  2HHS A;  4M7Y A;  3G4S N;  2W42 A;  3ZSZ A;  2D0A A;  4RW4 A;  2ZQB A;  3AA5 X;  2VQE K;  3T3F A;  4BRF A;  2HOE A;  3CPE A;  4K41 A;  2F9T A;  4NO7 A;  3TSQ A;  3SPZ A;  4JI4 K;  3OJU A;  4JLH A;  4DV5 K;  3VF6 A;  5SZT A;  3WEE B;  1NGG A;  2ITG A;  4NYF A;  4WQ4 C;  4BG9 A;  1KVB A;  3DXK A;  4FJJ A;  4DTX A;  1S1V A;  2EWS A;  5GIO A;  2HHT A;  1ISN A;  4B1Y B;  3SV4 A;  2DIK A;  4KRF A;  3CJ1 A;  4IDH A;  3KKS A;  4M41 A;  2W6K A;  4W5R A;  1RDW X;  3ZLJ A;  3ZSQ A;  2VCP A;  2PAV A;  3WQU A;  4FWQ A; 
#chains in the Genus database with same CATH homology
 4GV9 A;  1VBH A;  1E4G T;  2IVO A;  4IOA L;  3LDP A;  1KBL A;  1T3V A;  2VGM A;  3BIN A;  3VEW A;  3CCU N;  5JVL A;  1VQK N;  4GVE A;  4H03 B;  1Q7Y O;  3LM9 A;  4CBU A;  3VEX A;  5CR4 A;  2NRX A;  3AAP A;  4F7G A;  2D1K A;  4LC9 B;  3KWI A;  3HM8 A;  3TPQ A;  5GAH P;  3I33 A;  3O08 A;  5HL7 L;  1VQL N;  3DAW A;  3GBT A;  2P9P A;  3U7D A;  4KBO A;  4ISG A;  4BRQ A;  3NVK A;  4O5F A;  4UY8 O;  2P9P B;  1MWM A;  3M6G A;  1YIT N;  4MO4 A;  5DM6 L;  3KZB A;  2ZJR L;  1S72 N;  4AM6 A;  4JK7 A;  4NB4 A;  4A57 A;  3P39 A;  3ULE A;  5C0Y A;  3X23 A;  2ZJP L;  1YUW A;  3ULE B;  1BO5 O;  3QBX A;  3GL1 A;  5E84 A;  2YHX A;  4WQ5 A;  3WUH A;  2D11 A;  1GLB G;  1YJW N;  5BRE A;  1VQP N;  2QWR A;  3FZH A;  1G99 A;  2Q0R A;  2ZJQ L;  1QVG M;  1R59 O;  1RGI A;  4JN4 A;  4C1N K;  4FO0 A;  3CCE N;  4K43 A;  1X3M A;  3ZX2 A;  3AGR A;  3ZDT A;  3NMU A;  2F7T A;  4B1X B;  3U8Z A;  3G25 A;  2PFU A;  3O4W A;  1NGB A;  3UKR B;  3O9T A;  4QS9 A;  1Y19 B;  3WXK A;  3CHW A;  3CCR N;  1Z6R A;  3D2F A;  3FLC O;  5GIN A;  2NLX A;  3N4P A;  3CJ7 A;  3D2F B;  4JKD A;  3KWG A;  2I1K A;  3PZD A;  3H1Q A;  2YCH A;  5AFU H;  1X9J A;  4O8U A;  2W40 A;  4BRC A;  2GWJ A;  4MDB A;  1JDE A;  1BWF O;  2CQU A;  4ZRI A;  3GE1 A;  1JCG A;  2E20 A;  2GUP A;  3S41 A;  4BRH A;  1E4F T;  5BR9 A;  4PKH A;  4QS7 A;  5FPE A;  1LCU A;  3WXM B;  3PIP L;  4HTL A;  3U9D A;  4B1Z A;  1GC7 A;  2RQ1 A;  3OBY A;  2Q2R A;  5EY4 A;  4FPB A;  5DM7 L;  4JNE A;  3O1W A;  1VQ8 N;  5ADX A;  4JEP A;  3HBT A;  2COP A;  4BR9 A;  3QFP A;  2RE2 A;  1GLL O;  3U8X A;  1DEJ A;  4CJ7 A;  5EX5 A;  3L4Q A;  3G71 N;  3IUC A;  3LDQ A;  1QZ6 A;  2E1Y A;  1O13 A;  1KAY A;  3EO3 A;  3JS6 A;  2YX6 A;  4XEI A;  5HOO A;  4WFA L;  1ILY A;  3H45 C;  4FWK A;  1P8Z A;  3BP8 A;  2FSK A;  4XH5 A;  2BTF A;  3O9Q A;  4FOE A;  4HWI A;  2V7Z A;  2FJ9 A;  4BRO A;  3IMX A;  2IVN A;  2JWL A;  3SBT A;  1GLJ O;  2GTD A;  3E1Y A;  5AQV A;  3TTC A;  1CZA N;  5TKY A;  2NRR A;  4CZF A;  1NM1 A;  1WOQ A;  3L0Q A;  2HF4 A;  5AQH A;  2YJE A;  3CCM N;  4YL8 A;  3RVC A;  3KVG A;  4R79 A;  1QZ5 A;  5C15 A;  5AQT A;  1T6C A;  4I6M A;  1K9M O;  4BVO A;  5GAD P;  4BRG A;  4A61 A;  3R1X A;  4I6M B;  1JCF A;  2QXL A;  2OAN A;  2AL6 A;  2V52 B;  1D4X A;  1Q86 O;  1DT9 A;  1QQO A;  4MLE A;  2NRZ A;  3CC4 N;  1C0G A;  2Q1N A;  4CZG A;  3H46 O;  4YDU A;  2QTD A;  4YOX A;  2A6A A;  4EAH D;  2P9N A;  4K25 A;  5AQM A;  4A2A A;  5BPN A;  2P9I A;  3HZ6 A;  4IFE A;  1HBK A;  2P9N B;  1IJJ A;  2P9I B;  3ATV A;  3HOS A;  4FSV A;  3TSP A;  4WFB L;  3M5R A;  4PL7 A;  3FZF A;  3K9J A;  1KQS M;  4H5V A;  4O8K A;  3VEO A;  5M1P A;  3FZK A;  3CCQ N;  4WF9 L;  1TUY A;  3CJB A;  1OKJ A;  5H1S Q;  1TYQ A;  2WC9 A;  3NVM A;  5JLF A;  2IVP A;  1YXQ A;  3DJC A;  4H5T A;  4BRI A;  4NLB A;  4GV3 A;  4GV6 A;  4BRE A;  4FWO A;  3PIO L;  2X0S A;  1VQO N;  3HOT A;  3D7E O;  1U2V B;  1MDU B;  5JVG L;  5AQY A;  3AAQ A;  2F9W A;  2JWK A;  3WXJ A;  5LJV A;  1H4R A;  3CJ9 A;  1YJ9 N;  3FZM A;  3E9O A;  2VYP A;  5EOY A;  1J19 A;  5AQO A;  1QVF M;  4C1N I;  1Y64 A;  5M1F A;  3VEZ A;  1DKG D;  3VOV A;  1IG8 A;  3H1V X;  4CD1 A;  4CI6 A;  5JLH A;  2I7P A;  1P90 A;  4DHY A;  3FGU A;  4KH5 A;  2D10 A;  3FZL A;  2HBK A;  3WT0 A;  3LM2 A;  3VEV A;  2AEH A;  3ENH A;  2HF3 A;  4ILJ A;  3EKU A;  2E2N A;  3J8A A;  3O1B A;  2Q97 A;  1OVY A;  3AAR A;  3CC7 N;  2E88 A;  1V4T A;  1YAG A;  2WUS A;  3FLV A;  2ZF5 O;  3GG4 A;  5CE3 A;  3BUZ B;  4NLC A;  4FWN A;  3FE1 A;  3VTI A;  4XH1 A;  4PHT X;  5FPN A;  2KHO A;  3MWT A;  5AQG A;  3G9W A;  4L3Q A;  4IZ9 A;  2GWK A;  2WH5 A;  4BQZ A;  1NVL A;  2AA4 A;  2QWO A;  1NLV A;  2HMP A;  4F9O A;  4IXC A;  1T6D A;  3OHR A;  4BRD A;  3E9P A;  2J4R A;  4MO5 A;  2ZPY A;  4U7B A;  5E26 A;  2OTJ N;  3A8Y A;  3CQX A;  1KD1 O;  4A62 A;  5BPM A;  2J0K A;  1H1V A;  1GLA G;  5M1K A;  2NRV A;  2ZGY A;  1HKG A;  4H0Y B;  3UKR A;  1BOT O;  4BG8 A;  4M63 C;  2D0O A;  4HDQ A;  2CH5 A;  3SAH A;  3H3O B;  3A5M C;  4J8F A;  4EFH A;  3MN6 A;  1MK7 B;  1GG3 A;  1S3X A;  4IO8 A;  2P9L A;  5F2R A;  3DWL A;  4ZRJ A;  2I7N A;  4C23 A;  2P9L B;  5TKW A;  3ATU A;  3PLA A;  1Z05 A;  3F5T A;  1GLF O;  2A40 A;  3MN5 A;  5C12 A;  1JCE A;  5AQI A;  1K8A O;  3P4I A;  2YVC A;  3AGK A;  2A3Z A;  2ZGZ A;  3CCS N;  3A0I X;  1ATR A;  3PVL A;  4B9Q A;  4CZH A;  3ENB A;  2FDQ A;  3KHY A;  4WCE L;  2R82 A;  1HX1 A;  4JKB A;  5FPM A;  1BG3 A;  4A2B A;  1VAZ A;  5EVZ A;  4ILH A;  1Q82 O;  5AQN A;  1QQM A;  2NRW A;  5I9E B;  2BH1 A;  3I8B A;  5JIC A;  4JK9 A;  2P9K A;  3N4Q A;  1HKC A;  2V51 B;  5M1N A;  2P9K B;  2ITM A;  2J0M A;  3VGM A;  4JKH A;  5AQU A;  3LDL A;  3QML A;  4BY9 C;  4KH4 A;  1VQM N;  1NGH A;  1GGO A;  5BPL A;  4BRA A;  4U67 L;  5KQ8 A;  1LOT B;  2HBM A;  2HBJ A;  3ENO A;  3LDO A;  4OPA A;  5F0X A;  3CD6 N;  3WXL A;  2LBB A;  4WQ4 A;  2YHW A;  4MLH A;  3W0L A;  4BRL A;  4YOV A;  4JKG A;  1BU6 O;  4BRP A;  3VMF B;  4JKG B;  3M3Z A;  3UB5 A;  2EMT A;  5C2F A;  2EMS A;  4FVU A;  2ASP A;  3EL2 A;  2Q0U A;  3AU4 A;  4BR4 A;  2HBL A;  2YI1 A;  2QWP A;  1ATS A;  4A59 A;  1DGK N;  3O6W A;  3U9Z A;  3G6E N;  2FSN A;  1ESV A;  3CPW M;  3A5O C;  3ZET A;  3FP5 A;  2IIR A;  1NGA A;  3MCP A;  2AP1 A;  4WQ5 C;  1SS6 A;  3MK6 A;  3ZET B;  3ZEU B;  4FWR A;  5KQD A;  2QWL A;  1ATN A;  2Q31 A;  5LJW A;  2QA4 N;  1BUP A;  1SZ2 A;  4EHT A;  4FPA A;  1NGD A;  4XH4 A;  3EZW A;  3C7N A;  1EO1 A;  4H5W A;  3LL3 A;  4ILG B;  3FFK B;  3C7N B;  3WQT A;  5CHI A;  1YVN A;  4EIA A;  4JHD A;  5AFU A;  1MA9 B;  1RFQ A;  4JHD B;  4YOY A;  5BN9 A;  2DPN A;  1HB8 A;  3QB0 A;  2E2O A;  2E8A A;  2GX9 A;  4DXA B;  3SAF A;  5M1O A;  4BC4 A;  2FXU A;  3R3L A;  2ABD A;  3OBW A;  1JJ2 M;  3CET A;  1XQS C;  4RTF D;  3VF4 A;  3OA9 A;  3R6M A;  3AU5 A;  4CD3 A;  4JAX A;  3MDQ A;  1KC7 A;  2ASO A;  4FWP A;  1HKB A;  1S22 A;  3CMA N;  5AZI B;  3O8M A;  4BGA A;  3MX2 A;  5AQL A;  1BA1 A;  4JKE A;  3JXU A;  2J0J A;  1U2V A;  1BA0 A;  1NWK A;  1RDU A;  5AQW A;  3CJC A;  4K42 A;  1NBW A;  2NRT A;  4CZI A;  4EHU A;  1NGC A;  2WBN A;  4BRM A;  4IOX A;  2KKZ A;  3UE5 A;  3P31 A;  3WA0 A;  3O9U A;  2GEM A;  3VGK A;  4JD2 A;  4FWS A;  4A5B A;  1VQ4 N;  4JD2 B;  4AM7 A;  1NMD A;  5GAG P;  4NY0 A;  2QI2 A;  4DQ8 A;  1DIK A;  2YHY A;  5AQK A;  4DKW A;  3AY9 A;  2UYT A;  2HE7 A;  3HSC A;  5AQJ A;  3R8E A;  2QWN A;  3CXC M;  4IO9 L;  3K9K A;  2QM1 A;  3RSE A;  1YJN N;  3C0B A;  4YOT A;  4E1J A;  5AQF A;  2Q36 A;  2QW9 A;  3EKS A;  3RSE B;  4OO1 J;  5GIP A;  3F2K A;  3SAG A;  2CH6 A;  2QEX N;  4EKU A;  2GEL A;  3I56 N;  3BEX A;  1HB6 A;  4JKC A;  3O80 A;  5KPT A;  1M90 O;  2P9U A;  5FPD A;  2CGL A;  1QQN A;  4B1W B;  2P9U B;  1ZBS A;  3B8A X;  3HTV A;  5C2D A;  3CIP A;  1NTI A;  4HDO A;  3P38 A;  4CBW A;  4BGB A;  2CB8 A;  3H6E A;  3C6A A;  5AQS A;  1MIX A;  3R9P A;  5ADX H;  1SQK A;  3DLL L;  4YDU C;  4B1V A;  5JVH L;  3MN9 A;  3MN7 A;  3SMS A;  3GOI A;  1XUP O;  3O9R A;  2WFB A;  2ZWH A;  4YOU A;  4BC3 A;  5B8H A;  2A5X A;  2NZT A;  3QDK A;  2YJF A;  4DB3 A;  1VQ5 N;  1BDG A;  1ZXO A;  3E9L A;  2QWQ A;  4QS8 A;  1NGF A;  4M7X A;  3KK7 A;  5IJM A;  2CGJ A;  4RCH A;  3WXI A;  1U6Z A;  3LDN A;  3VGL A;  4JK8 A;  1NGI A;  1E5W A;  4FOI A;  1GC6 A;  3GDQ A;  3D2E A;  4KH6 A;  5BRH A;  1WUA A;  1TUU A;  2HST A;  1NJI O;  3D2E B;  3CME N;  3A5N C;  3FR0 A;  3TSU A;  4TKN A;  1HPM A;  3ID8 A;  1GLE G;  3CI5 A;  3QFU A;  4GNI A;  3OW2 M;  5AR0 A;  1VQ7 N;  4GY2 B;  5BRD A;  1M1K O;  4CBX A;  4BR7 A;  4IWV A;  1X3N A;  4ZRK A;  2E1Z A;  3H3N O;  3TU5 A;  5EXW A;  3CF5 L;  3O9S A;  2FSJ A;  3VES A;  5MLC Q;  3ZX3 A;  3QIC A;  3Q7C A;  3ZX0 A;  1VQ6 N;  3ID6 A;  1MWK A;  5BRF A;  4H0P A;  5LY3 A;  4BR5 A;  3C6H A;  3CCV N;  1GLC G;  4BVP A;  3I55 N;  3SK3 A;  4IOC L;  1Q81 O;  3MCA B;  4BC2 A;  1KC8 O;  1SAZ A;  3EPY A;  4CZM A;  1HJO A;  2BUP A;  2KLA A;  5AQQ A;  3VER A;  5AZJ A;  3U4L A;  4YOW A;  2FF3 B;  3ZYY X;  5AZJ B;  4GXB A;  2ASM A;  3VEY A;  5M1Q A;  2VGN A;  3BF1 A;  1NI2 A;  5KPZ A;  3CCJ N;  4H0X B;  3MX5 A;  4IJN A;  2D4W A;  5AQR A;  4PKG A;  1EF1 A;  1SGH A;  1K8K A;  3ZEU A;  4B1U B;  3D6R A;  1ZC6 A;  4DCH A;  4Z94 A;  3TTD A;  1K8K B;  2W41 A;  1NGJ A;  2I1J A;  3BF3 A;  4FL9 A;  1YIJ N;  3CJA A;  1MK9 B;  4IEE A;  3SMP A;  3CQY A;  4PKI A;  3VF2 A;  4BRN A;  3L4I A;  4WYB A;  1EQY A;  3O5B A;  5JMV A;  1HLU A;  4PL8 A;  4JKA A;  5AQX A;  4YOR A;  3L6Q A;  2A42 A;  3IFR A;  2VWB A;  3MWP A;  4Y0W A;  2NRH A;  2D2Q A;  2H3G X;  4P7I A;  1Q18 A;  1YF5 L;  4H0T B;  4BRK A;  4CYE A;  2PBD A;  2E2P A;  2NNW A;  3MMV A;  4IJA A;  4G9Z A;  3M1F A;  3T7Z A;  3J7Z O;  1MIZ B;  4CZJ A;  5AQZ A;  1KXP A;  4ISE A;  3T69 A;  3UKU A;  5ELZ A;  3UKU B;  1N8R O;  1W2B M;  1VBG A;  1NGE A;  1KAX A;  1W97 L;  4FWM A;  4OPH A;  1T44 A;  5AQP A;  3VPZ A;  4H0V B;  1KAZ A;  2A41 A;  4H5R A;  3SBG A;  2P9S A;  2D0P A;  4A5A A;  2RHK A;  4M7Y A;  2P9S B;  3G4S N;  5AZI A;  4AF1 A;  1HUX A;  3VET A;  4ISF A;  3A5L C;  3EN9 A;  4MDA A;  3VTH A;  3SLC A;  4RWT A;  1ST7 A;  3IDH A;  1YI2 N;  4BRF A;  2HOE A;  4WFN L;  1XC3 A;  1J6Z A;  1GLD G;  3CPE A;  4BR2 A;  4CZL A;  4K41 A;  2F9T A;  3HRG A;  4NO7 A;  3IVF A;  3TSQ A;  3CC2 N;  4BR0 A;  3F9M A;  3SJH A;  3WEE A;  3EE8 A;  3CER A;  3IKM A;  3W3D A;  5BN8 A;  2FF6 A;  3VF6 A;  3WEE B;  1NGG A;  3QBW A;  1K73 O;  4CZE A;  4WQ4 C;  4BC5 A;  4BG9 A;  1C0F A;  5KPR A;  3DXK A;  5GAE P;  5F1X A;  3C65 A;  3Q7B A;  2EWS A;  1ACA A;  3DXK B;  5GIO A;  4FWL A;  3EE9 A;  4BQL A;  1ISN A;  4B1Y B;  3HI0 A;  1QHA A;  1V4S A;  3QIJ A;  3TTF A;  2QWM A;  3DXM A;  2DIK A;  4IEI A;  3CJ1 A;  4IDH A;  1TYQ B;  3DXM B;  3CCL N;  1VQN N;  1VQ9 N;  2E2Q A;  1YHQ N;  2HRJ A;  1RDW X;  5C10 A;  3VEN A;  4CZK A;  4JKF A;  2FLO A;  2CGK A;  4H0O A;  4H5N A;  3E66 A;  2OTL N;  2VCP A;  2PAV A;  2V7Y A;  3WQU A;  4FWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...