4JKGA

Open and closed forms of mixed t1789p+r1865a and r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
219
Chain Sequence
LFSQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 65
structure length 219
sequence length 220
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkgA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkgA01
4ILHA 4JK8A 4JKGB 4JKAA 3E9LA 3E9OA 4ILJA 4JKHA 3SBTA 4JK7A 3E9PA 3E66A 4ILGB 3SBGA 4JKGA 3ENBA 4JKEA 4JKBA 4JK9A 4JKCA 4JKDA 4JKFA
chains in the Genus database with same CATH superfamily
1NGBA 2VG7A 1XMQK 3NVMA 4R79A 4DQPA 2O4IA 4DS5A 3OYDA 2FBYA 4FWLA 4B1UB 1Q9XA 3JAMO 3AO3A 4DTOA 4BC5A 1L3VA 4FXDA 3VQEA 4WQ5C 4CESA 1S1VA 2KW4A 3SBGA 1BU6O 1RILA 3HPOA 1ZXOA 1RDBA 1NGAA 4DF8A 3IVFA 5HROA 1T44A 3K9KA 3QBWA 2NRHA 1IG8A 2GELA 1HRHA 3U8XA 4GV9A 3MXJA 3A5MC 1XQSC 1KVBA 2FF6A 4CYEA 2FSNA 4FWSA 4CF1A 4KHQA 1TUUA 3L2QA 4YOVA 3AU4A 4ILGB 4C1NK 4CFBA 4FCYA 3LZJA 1XHZA 4CEBA 3KK3A 3U3GA 3AAPA 3LWLA 5M1OA 5C10A 3CC7N 4Y0WA 3NGYA 4HCCA 3THWA 4N56A 4BDPA 4BRCA 4CK1A 2E4LA 1T03A 1I94K 3IG1A 5AQYA 2OPQA 3HPHA 2RHKA 5JVHL 2Q0UA 5SWMA 1NJXA 2OPSA 2V7YA 2OYQA 3MCPA 4JI7K 1NGDA 4K0KK 3CFRA 3THVA 3CCSN 3KK7A 2KHOA 3ZT4A 2J4RA 3K9JA 4GV3A 3TR8A 4FZXC 4H5RA 4HVJA 1S3XA 4DTPA 4CFDA 1Z6RA 4DQQA 4DV1K 2D0AA 4KBOA 5FPDA 3OYCA 1LWFA 5BN9A 3ZSWA 1X9SA 2YHBA 1ST7A 3EN9A 3L2RA 1VQ8N 4DWIA 5F2RA 5CYMA 4DUYK 2ETJA 3ZSZA 1T6DA 2GX9A 1LCUA 4DV2K 3SPYA 4CHQA 3LAKA 1UA1A 1BIUA 3QNOA 2G8FA 2QKBA 4NYNA 2ABDA 1N33K 1HNVA 5H1SQ 4FOEA 4OPJA 2RN2A 1D9FA 2Y1IA 3GDQA 4CFAA 3C94A 5LJWA 1JL2A 3CJ9A 4WFNL 3SUOA 1NKEA 1XWLA 3X23A 2EX3A 3ZSXA 3NCIA 1NK6A 1T7PA 4QOZB 3D2EA 2P51A 3ZEUB 5TKYA 4K8ZA 5IT9O 1OVQA 3KIOA 3HI0A 3ZYYX 2HF4A 4DQRA 5JS1A 1WNSA 4NB4A 2VYPA 3L3VA 4YORA 4B1XB 1RBSA 4JAXA 3ZETB 4DV0K 4KPYA 1HNZK 4E0DA 2HHXA 1NU0A 2XY5A 2IOCA 5JICA 1JLEA 3RSEB 1MK7B 3B6PA 3IUCA 3VEYA 1JDEA 2IIRA 4KREA 4BE2A 4WCEL 2KZMA 2GTDA 1U48A 3AA5X 3CQXA 3VF2A 3ZLJA 5BR8K 1YVNA 4WYBA 1S9GA 5AZJA 4CVNE 1HQUA 3FR0A 4DV6K 4GV6A 1NGFA 2KQ2A 3ITHA 1LOTB 1W97L 1RT2A 3OA9A 1NNEA 2WONA 1C0FA 3G71N 4OGCA 4N41A 3SQ1A 4OKKA 3LDPA 4N47A 2HSTA 2HBMA 5EXWA 5BPLA 1L5UA 4A2AA 3IDHA 3U9DA 4F7GA 1UOCA 4LF8K 3K57A 1S5JA 1NOYA 3JSMA 3SI6A 1QZ6A 2XY8A 4C8NA 2OTLN 1GLFO 2OANA 4E7HA 2RKIA 1B9FA 1SZ2A 1Z05A 2DIKA 3SV3A 2P5OA 3BGRA 1SL2A 4DS4A 3NGZA 2W6KA 2JLEA 1HB6A 4B8AB 1MIXA 4X65K 2JWLA 4M3ZA 3DLRA 4LSLA 4JRQA 2NRTA 3SQ0A 3PSFA 1A5XA 1BA1A 4CJWA 1RDAA 1QHTA 4FJNA 1HUXA 4CJTA 1RDCA 1BO5O 1QQNA 1TVRA 2D0OA 3ENOA 4B9LA 1FXXA 4FPAA 3QINA 2YVCA 2CGKA 3KWIA 1EO1A 4AM7A 2P9NB 3IMXA 1S1UA 1WSIA 2E1YA 3DJCA 4BR0A 5BRHA 3O08A 4JI5K 3TSUA 4Y1DA 2Q1NA 3I8BA 3AVGA 5EU7A 1DGKN 5ELZA 1XMOK 4CHZA 5AZIA 4DSJA 2D10A 4LSNA 3RR8A 1WBDA 3ENHA 3CCEN 1OH5A 1Q86O 2PYLA 4FVMA 1VQ9N 1C0GA 4BQZA 4KHNA 1KTQA 4I6MB 2CH6A 3VQPA 3CM6A 4CIGA 1RBRA 1N8RO 2WBNA 4CW7B 3VEXA 5JVLA 3GE1A 4B9TA 3KKSA 1CXQA 1SS6A 4BE0A 4L8RB 3ZSVA 3VQ9A 1ASWA 3TAGA 4DU1A 3WEEB 3AVNA 3DOKA 3O9UA 3HSCA 1C1BA 4O5FA 1FKOA 3NE6A 5E84A 4DQIA 1HNWK 3TAMA 4OKJA 3HM9A 4DTXA 1Q9YA 2XRIA 3AVIA 1U2VB 3RRGA 3D45A 4FWOA 3CPWM 1ZBIA 1X1PA 1I39A 3QESA 1HBKA 3O5BA 3AVLA 2R82A 1SQKA 5AQPA 4HUFA 4V19S 3TSQA 3CM5A 2KFNA 1NLVA 3L8BA 4JKBA 1E4GT 4E1NA 1SKWA 4UY8O 3THXB 1RT7A 2E20A 2P9PB 3R9PA 4XH1A 3V9XA 4FLYA 5LMNK 3OBYA 3P83D 2P9UB 1Y97A 3HZ6A 1J5EK 1VRTA 3LDNA 4W5OA 2ZJRL 2VQFK 4BRIA 1TYQA 1KXPA 2I7NA 4CGDA 1DT9A 3L2WA 1E3MA 2HNYA 2HOEA 3ZDTA 1ILYA 2YCHA 4BVPA 4F2SA 4H4MA 3CFOA 1KFSA 3S3NA 1KLNA 4RG8A 3JXUA 2VGNA 4K43A 2O8FB 1BL3A 2E5LK 1UWBA 3VQ5A 3OYBA 3ZSOA 3CFPA 1S6QA 3NAEA 2CQUA 3S3OA 1TAQA 4B9UA 4OLBA 3SQ4A 2AJQA 3VESA 1IJJA 2YNHA 3KK2A 4DSIA 4LF6K 3PLAA 3TAFA 5CR4A 3KVGA 4FJHA 4CJVA 3K59A 3KD5E 4JNEA 3NH2A 5AQLA 2NRRA 1ATNA 2YNFA 5F0XA 3KWGA 3VQQA 2A3ZA 4JI3K 3MX5A 2ASPA 2VWBA 3NFAA 1JCFA 3KKRA 2Z1IA 2HMPA 2I5JA 3GOIA 3M3ZA 5AQHA 4F3OA 2P9KB 1OVYA 2GWJA 4CGJA 4E19A 5K14A 4OKEA 4CEEA 4JHDA 4FJXA 4KHWA 3RVCA 3BUZB 4JI4K 4FWMA 4FJ5A 2HVHA 4M3RA 1WOQA 4AHTA 3PX6A 2FBTA 3TAPA 3RR7A 1RBUA 4OPHA 3D6RA 1QE1A 3QB0A 1OH8A 5BPMA 3N4QA 3U7DA 1JLAA 4KHUA 2QM1A 2UYTA 2VG5A 4ILJA 1S72N 1D4XA 1IKXA 3THWB 4F4KA 4U67L 1BA0A 4CEQA 3U9ZA 4RW4A 2G8WA 3V1QA 1DEJA 1VQPN 3OYFA 1X3NA 5IWAK 5FROA 2ASMA 1B9DA 4FW1A 4CEOA 3HYFA 2J0JA 1T6CA 3VF4A 4O0IA 3UKRB 4PA1A 4OJRA 3T1YK 1U49A 2X6NA 4A57A 1BWFO 3HVTA 4BROA 2NLXA 4J2EA 4GY2B 4BC4A 1E5WA 4Z4GA 3C95A 3HXMA 1GOBA 3THYB 1QZ5A 2HHQA 1VQON 5HLFA 4E7LA 3ZCMA 4RCHA 1MDUB 2YHXA 2F8SA 4FJGA 1YXQA 5ADXH 1TK0A 3S9HA 4OX9K 4DTSA 3NF8A 4DKWA 3J7YP 4M3TA 1IV0A 4KB0A 3F9MA 4FJ9A 1U47A 4CBWA 3PO4A 3OYLA 4FK2A 1G15A 1J9AA 4Z4IA 2O8EA 3E01A 4EHUA 3HRGA 2YHAA 1MIZB 2HW3A 4LF9K 4JS5A 1WSGA 3VQ4A 1GC6A 4KI6A 3K5LA 2Z1HA 3OYHA 1BQNA 3E9OA 2E6LA 4X66K 3LM2A 2HBJA 4LF4K 1LW0A 1K8KB 3K5MA 3BDPA 2NNWA 3U4LA 1FKPA 4Z4HA 1ASUA 1ATRA 2OCEA 4CF9A 3HOTA 1NJYA 2V51B 3ZEUA 4B1VA 1NGCA 3S41A 1RCHA 3MN7A 5TKWA 3HPGA 2F9TA 2CGJA 4LFCK 2D4WA 4KB1A 5HRNA 4N76A 1NGIA 1W9HA 5AQGA 3WXKA 3VERA 1LV5A 5LY3A 1CZ9A 1S9EA 2F7TA 4I2PA 3CJBA 3NHGA 3PUFA 1KAYA 3WXLA 2PYJA 3PY8A 3VEVA 4BR5A 1QSSA 3R8EA 3WXMB 3CQYA 3WA0A 4CF0A 1VSIA 4A62A 3FZHA 1GLAG 4CZJA 3QETA 5LJVA 4B9VA 2JGUA 5AZIB 3QDKA 3O6WA 3KZBA 1FJGK 4AM6A 3H3NO 2QWNA 4H0PA 5C12A 3O9QA 5FPEA 4FWNA 2A40A 3VQAA 1HB8A 3DXKA 4A61A 3LP2A 4QS8A 5GINA 4CF8A 4DR3K 3LANA 3VQBA 4CEDA 1RT5A 3U8ZA 1ZC6A 3TPQA 4BY9C 1BHLA 2FSJA 2HHTA 1J6ZA 1JLGA 2F4VK 2P9IB 4L3QA 5KGXA 3EZ5A 4FK0A 4IEEA 4QCLA 2BANA 3CJ1A 5C15A 1RGIA 3H3OB 5HL7L 4M3WA 3WEEA 3HK2A 3OS2A 2E2NA 4E3SA 2UUCK 2FSKA 1VQ6N 1YAGA 2X78A 4CEAA 3CC4N 1D8YA 5AJ3K 4DTRA 1WLJA 2YJFA 4C8OA 3WNFA 1N34K 1HNIA 3DXMA 1NJZA 3D7EO 3SQ2A 3QEWA 1XC9A 5C25A 4YDUA 3T19A 5BN8A 1IKVA 1YHQN 4IXCA 1GGOA 1KVCA 3H1VX 2NUBA 4IFYA 3WT0A 1CLQA 2CH5A 3O4NA 1HJOA 3NF7A 3ZX3A 3NBPA 3TWHA 4BRLA 5J1EA 2P9NA 2A5XA 4PUOA 2QI2A 2B4JA 2GV9A 5BRFA 4MQ3A 4KI4A 4MLHA 4IFVA 4JI8K 3AU5A 4DF4A 4M42A 2DY4A 5CYQA 5J2QA 3DYAA 4CZKA 2WOMA 1C0UA 4CJSA 4M3YA 2KFZA 3MDQA 4KKOA 3NVKA 3BY5A 2HHSA 3C6TA 1JKHA 1W0HA 3SBTA 4K25A 2O8FA 3IFRA 3ATUA 4FLZA 1U45A 3U6FA 4NLCA 2UUBK 2IVNA 3O1WA 1VQKN 1YJWN 3FLCO 1LWCA 3B8AX 3F9KA 1XC3A 2BUPA 4Z0UA 3PVLA 3QEPA 4YY3K 4H0YB 2G8HA 4N5SA 2VCPA 4A59A 3CC2N 4F8RA 2NRWA 2HRJA 4CJ4A 1NOZA 1SAZA 5AQTA 3W0LA 3EE8A 3B6OA 3OYNA 3L6QA 2ITMA 3TI0A 2EWSA 1EWRA 3L0QA 1YTAA 3V9UA 3O3GA 3M8QA 3LM9A 3LP3A 4JD2B 4JHDB 4KRFA 4KFBA 3AA4A 4JKGB 3K0SA 5D3GA 4RW8A 3DRSA 5KGWA 4XIUA 4MDBA 2LSNA 3I0RA 1RFQA 2LBBA 5GIOA 2OTJN 4JI2K 3VQCA 1XUPO 4CHNA 1WBBA 2G8VA 3BF3A 2HF3A 1GLEG 2WC9A 3RMDA 3DLHA 3OYKA 3CYMA 1NTIA 4EP4A 1KC7A 2W6LA 3J8AA 3LPUA 1RTHA 4CD1A 3VA3A 5AQXA 4BDYA 3ISNC 3AY9A 1ZYQA 4O44A 2OPRA 2YHYA 1QQCA 4BRAA 2YKMA 1U6ZA 3WNHA 4EHTA 4CD3A 1HNXK 3DAWA 3AVAA 4ISFA 4AF1A 2O8DA 5IJMA 2D0CA 5HBMA 5JLFA 1X9WA 3ZETA 3O9SA 3AVMA 1Z25A 1H1VA 3L4IA 3THYA 1MA9B 4NLBA 4R5PA 2A1SA 4AHSA 1JLBA 3LZIA 5AQJA 1EF1A 5HRSA 3VPZA 4J2DA 4J8FA 3QEXA 4E1JA 1VSMA 4ZRKA 4CJQA 4BRMA 4G1QA 4FPBA 2QWMA 2P9KA 3R3LA 4ID5A 2IS3A 3QFUA 1EP4A 1Z26A 3QEVA 5AFUA 4BGBA 4NCBA 4JN4A 3AO5A 1IO2A 3H6EA 2JWKA 4DSLA 1RDDA 3CCRN 4FLTA 4DU4A 4F3TA 3PSIA 3VMFB 3WNEA 1NG9A 4YDUC 2V52B 4H0OA 4CZIA 1GLBG 1NK5A 4NO7A 3WUHA 1Q18A 2EHGA 4BR9A 3AAQA 2HHHK 3F73A 4H5NA 4BACA 3KLEA 3C6HA 5AQIA 2VWKA 1K8KA 1LW2A 5GAEP 1VSJA 3NGIA 3TAQA 2DFHA 2QTDA 5KQ8A 1GOCA 4CZFA 3DM2A 5AFUH 5AQRA 4KH4A 3AA3A 4LC9B 3HJFA 3N4PA 1JXBA 4CFCA 1KQSM 3BZKA 1QVFM 3HBTA 1QHAA 2EMTA 1T05A 3K5OA 5KPRA 1KLMA 1BIZA 3H1QA 3LP1A 3K58A 1WSFA 1NVLA 5AQUA 3T7ZA 1MWKA 2F96A 4IJNA 3MECA 5BREA 1XNRK 1NMNA 2WUSA 3PO5A 3MN9A 4FYDA 1BG3A 1BCOA 2UXBK 2HNZA 3VN5A 4BRGA 3JYTA 3THXA 2Q31A 2BTFA 4I9QA 3VF6A 1HKBA 2GUPA 3T1AA 3PV8A 1CZBA 3HT3A 3SMPA 4ZRIA 3QEIA 2B6AA 1IBLK 2NRVA 2HHVA 2E6MA 3ATVA 3TABA 4FZZA 4DFJA 4Z4FA 4JI0K 1QSYA 4BREA 2CB8A 2QEXN 1K73O 4KHSA 4KTZA 3K5NA 4HUEA 4M45A 4DR7K 3UE5A 4CEFA 3ALYA 3LP0A 2QWPA 3T3FA 1SL0A 3H45C 3AO1A 1RTDA 1KSPA 5MLCQ 1TV6A 3LDSA 1RT3A 2WH5A 4DTNA 1E4FT 5BR9A 4BWMA 3OW2M 1EETA 3KLGA 3V9SA 3LDOA 3QO9A 1EXQA 3TTCA 3AVBA 5GAGP 3MCAB 3DXMB 3I55N 3QIPA 5CZ1A 4DR1K 5AQFA 3HOSA 3O9RA 3OYJA 5J2NA 1BUPA 1U4BA 3AO4A 3MEDA 1XHXA 4I2QA 3ENBA 2XY7A 5FRMA 1YI2N 4HTLA 1U2VA 1ASVA 2DTUA 1GLCG 2G8UA 1SL1A 4HCBA 4F2RA 2VQEK 4AHCA 4FM2A 4KH5A 3CMAN 4WF9L 3W3DA 4EIAA 1IKYA 3P5JA 2P1JA 3VEOA 4CGGA 4AHRA 2ZJPL 4ELUA 5AQZA 3UB5A 1NKCA 1ACAA 3SLCA 4EAHD 3WXIA 4B3MK 5M1QA 3OBWA 4YHHK 1HKGA 4M63C 1A5VA 1TYQB 2FC0A 2E88A 1I3AA 3ZT0A 4CIFA 2Q3SA 3SUPA 4H4OA 4PWDA 4HWIA 3DWLA 4ELVA 1YVUA 3ZX0A 3OY9A 1GOAA 3OJUA 1C0MA 4B08A 5ADXA 3QIOA 3V81A 5BPNA 4B9NA 1HKCA 1TKZA 3UKUA 3PIOL 3VTIA 2NRZA 1Y64A 5CE3A 4DQSA 2P9SB 3BINA 4KAZA 1RT6A 4WQ5A 3SYZA 4H8KA 5AQMA 1LAWA 2OA8A 1GLJO 5CY4A 1HLUA 4LY7A 1M90O 3VA0A 4RTFD 3H46O 3PIPL 4JD2A 3G6EN 1RTJA 5M1KA 4JKGA 3OS1A 4LFAK 1SV5A 4YOWA 3PX4A 3CJAA 4BE1A 3SAHA 1LWEA 2ITGA 2AP1A 3MEEA 5CZ2A 1MU2A 3PZDA 3E9LA 2Z1JA 2D0BA 4E7JA 4OGEA 3ZT2A 3J81O 2Z1GA 1QQOA 5LL6Z 1ZBFA 4OPAA 1IH7A 2KLAA 3C6AA 3VTHA 4BR2A 4DFPA 3EYZA 3NH1A 1EX4A 1Q7YO 4CGFA 1GC7A 4MFBA 3D2FA 4GKKK 4ICLA 1VQLN 1EKEA 2QA4N 2ZWHA 1W2BM 1RDUA 1TK8A 4XEIA 3ZSQA 3UKRA 3CG7A 4W5QA 2OZSA 4PY5A 5AQQA 1RTIA 1JCEA 4A5BA 4HDOA 3AA2A 4RWTA 2ZGYA 3C7NA 4ISGA 1J54A 1VQNN 4B9QA 3KLHA 3CF5L 2BH1A 1OH7A 4CK2A 2R7YA 1ZBLA 3KLFA 4FM1A 3TAEA 4JRPA 2FDQA 4CGHA 1QVGM 3VQ6A 2QWRA 3CXCM 4O0JA 3G4SN 3FE1A 3A5NC 1N5YA 3O3FA 3RMBA 3AGRA 1KRPA 4NCAA 2ZQBA 1QTMA 2RQ1A 1HPZA 4MLEA 1BQMA 5SZTA 3QFPA 2O8BB 3O80A 4CEZA 3HO1A 4JK8A 3GL1A 3BP8A 1D5AA 5AQKA 2AL6A 2CGLA 3AVFA 2O4GA 4H0XB 2HHUA 4NXMK 5JS2A 4KTQA 1V4TA 3VQ7A 5FDLA 4K42A 3AVHA 4Q5VA 4Q0BA 3LPTA 4ZTFA 2HB5A 2ZJQL 3EKSA 1KFDA 1HQEA 2IVOA 3HSTB 1R59O 3O4WA 3VOVA 4FLUA 1Q81O 4FSVA 3EL2A 1WB9A 3NH0A 3A8YA 1XI1A 1J53A 5EX5A 4BC2A 2A42A 3DMJA 3O3HA 1YTUA 2E8AA 4DTMA 2Q36A 1WUAA 2A41A 2IAJA 5DM7L 4NYFA 4AHVA 2PY5A 2IC3A 3SJHA 2I1KA 4M7YA 1K8AO 1F21A 1ZBHA 4B1ZA 3V1OA 4EP5A 4CJUA 5AQWA 4JV5K 4FO0A 4CZHA 2OPPA 4O8KA 5C42A 4IDKA 4FLVA 1S1WA 1GLDG 3CCQN 3QNNA 4LH4A 1U04A 3AARA 1DLOA 3SK3A 1QQMA 3E1YA 3NMUA 5A2QO 3VGMA 4BRPA 3DXKB 1TK5A 4C8KA 4DXAB 1VQ4N 5T7BA 3V4IA 3CPEA 4KHPK 4JKFA 3T1HK 5BRDA 1NI2A 3HP6A 1HMVA 3AVJA 3DRRA 2D0PA 1Q8IA 1NKBA 2GEMA 1JLFA 3C0BA 4DSEA 4JYAK 1DIKA 1JLQA 3CJCA 4FJIA 3LWMA 2FF3B 4B1YB 2P9LB 4P7IA 1B92A 1RBTA 3QBXA 4NCGA 2FJ9A 4IO8A 3SNNA 3O4QA 3P31A 3ZX2A 2A1RA 3MK6A 2Q0RA 3JS6A 4DU3A 3LL3A 4DSFA 4CF2A 4FJ7A 1KCFA 4RW7A 3CMEN 1O13A 3D0PA 3E9PA 1VK0A 2XHBA 1WSHA 1Q82O 3CERA 2WTUA 2BE2A 4FWPA 3I56N 2O8CB 1FK9A 3DRPA 4HHTA 1NK8A 2PAVA 3ASMA 4JKEA 4KH6A 4IO9L 3J7ZO 5KPZA 1SUQA 3WNGA 1WAJA 1JL1A 4GW6A 4ZTJA 4YL8A 3CD6N 4FLWA 1HJRA 1WSJA 3FFKB 4DCHA 3EE9A 3OS0A 3GBTA 4JI6K 1GLLO 1TKXA 2NZTA 3MEGA 3ULDA 4JK7A 3QLHA 3Q7BA 4QS7A 4IKFA 3C65A 1T8EA 4IDHA 4CECA 3AVCA 1NJWA 4CJPA 4CJ7A 1J19A 3AV9A 4QAGA 4FL9A 2YHWA 2D11A 5JMVA 1MWMA 5JLHA 3L3UA 3MXMA 4FWKA 4H5WA 3DLGA 3SAGA 3FZFA 2FXUA 2O8DB 3EPYA 4IJAA 3DLEA 4O8UA 3ZT1A 3SUQA 1TKDA 2P9SA 3WXJA 1L3UA 1QS4A 5DMRA 1S1XA 4IG3A 4A5AA 1VBHA 4OVLA 2Q97A 4CK3A 4YOXA 1HX1A 3UIQA 2HE7A 5M1PA 2ZE2A 4ID1A 1P8ZA 1EWQA 5E26A 2D1KA 2RE2A 2W40A 3L2UA 1SKRA 1YJ9N 4B3SK 2HHWA 1IG9A 3A2FA 2BDPA 1NK0A 1NK4A 1FW6A 3FZKA 5AQNA 2I1JA 2IDOA 4C23A 2UXCK 4F9OA 4CZGA 4GXBA 4DHYA 1ITGA 4CJKA 5M1NA 3DLLL 1C0TA 2ZM6K 4DLEA 2Q2RA 3P4IA 3PX0A 3VEWA 1JJ2M 1KAXA 4U7BA 3OJSA 1NGJA 2J0KA 4DUZK 4FVUA 1KD1O 4CBUA 2XY6A 2YI1A 1O1WA 2P5GA 1VSHA 4CJ5A 2WFBA 1K6YA 3KK1A 1J5OA 3O1BA 1N32K 2DFFA 1REVA 3BEXA 5GIPA 3V1RA 4YFUA 1VQ5N 3I8DA 4H0TB 4CIEA 2HBLA 3LDLA 4M3XA 1TL1A 2QWOA 2GUIA 1IKWA 3IAYA 3H08A 1C6VA 2D5RA 3DI6A 4B3TK 4IZ9A 1BOTO 3ULEB 3VQDA 4NXNK 3UKUB 3L2VA 4JLHA 4MO5A 1LAVA 3SMSA 4CZLA 3FLVA 2ZD1A 4DQ8A 3CCLN 1TAUA 2YNIA 2YV0X 5I42A 1NGGA 4WQ4C 3F5TA 2ASOA 4CJRA 5KPTA 5KQDA 3LAMA 2G8KA 3RMAA 2AEHA 3I0SA 1YITN 3QICA 1YIJN 2W42A 3RMCA 3EKUA 4B9SA 4E7IA 3M8RA 4PKIA 1VAZA 2VGMA 4DFKA 1L3SA 3IS9A 5KRTA 5FRNA 3OYEA 4BC3A 4GKJK 1DKGD 5C2FA 3A0IX 5AQVA 5DK5A 4E89A 3NDKA 4YOYA 4LFBK 3EY1A 2RPIA 1SKSA 4Z94A 3EEQA 4X64K 4FJLA 4H0VB 4M41A 1ISNA 4TSXA 3CQ8A 4EZ9A 4BGAA 3VGKA 4KO0A 3IRXA 3C6UA 4J2AA 3FP5A 4YNQA 4FJKA 1CZAN 4DR4K 3CETA 3LDQA 1NK9A 2X0SA 3CCJN 1BI4A 1UAXA 3WQUA 4EZ6A 1N36K 3VENA 1NM1A 5C24A 5FPNA 3VETA 3AVKA 3D2EB 4IOXA 2FBXA 5I9EB 2GWKA 1IBMK 4JK9A 1IBKK 4BG9A 4W5RA 4TKNA 3CHWA 3F2KA 2I7PA 2E1ZA 4B3OA 3VQ8A 2X6SA 4AILC 4PQUA 4WFAL 3TTFA 4M7XA 3MXIA 2F9WA 4K41A 4ZRJA 1VSEA 3RSEA 3KD1E 3OVNA 3CIPA 2YJEA 1BDGA 4GNIA 3ZSYA 4CZMA 1NBWA 1VQ7N 4IWVA 5EOYA 4FW2A 4LF7K 4HDQA 2PBDA 1HYVA 3I33A 2VWJA 2HVIA 4BRKA 2PZSA 3GG4A 1D9DA 4C8LA 4Z4EA 3HTVA 1MK9B 4UQGA 1BISA 3V9WA 5C0YA 3FZLA 2F8TA 4I9LA 5AR0A 4JS4A 5GAHP 1X9JA 4FLXA 4I7FA 1NWKA 3ID6A 3QIJA 5E41A 1KAZA 2G8IA 4CJLA 1OH6A 4B9MA 1T3VA 4CHYA 1VSLA 1TGOA 1WAFA 3MWPA 4BRFA 1HYSA 2VG6A 4FOIA 2E2QA 5GADP 2QWQA 1JCGA 4PL7A 4E7KA 3P39A 1KVAA 1HPMA 2P9LA 3NF9A 2B5JA 4CJEA 2FBVA 2UUAK 2KZZA 2HNDA 4DTJA 4J2BA 4DG1A 4QS9A 4AH9A 4KTWA 1QSLA 1NJIO 3FGUA 4BRQA 2H3GX 3S3MA 1HR0K 2ZF5O 3J7AP 1TL3A 3HL8A 4B8CA 1VHXA 1W7AA 3FFIA 4C8MA 5AQSA 5B8HA 4BDZA 2E2PA 4GVEA 1X9MA 2O8CA 1Y19B 5C2DA 1VBGA 3G25A 3TANA 3M1FA 4BVOA 3CJ7A 1C1CA 3MN6A 1OKJA 2FLOA 3O8MA 4JKHA 2Y1JA 1RNHA 4LF5K 3J80O 2QW9A 2NRXA 2P9UA 4BRHA 5KRSA 4CERA 4IOAL 1BGXT 1ZBUA 4JKDA 4JEPA 1C1AA 3K2PA 4CE9A 4BQLA 1S1TA 3OTOK 4M3UA 3CCUN 4WQ4A 1S22A 3NF6A 4O4GA 4JKAA 3KJVA 3SPZA 4H03B 3G9WA 1VSFA 3SAFA 3SJJA 4RW9A 4LD0A 1NGHA 3AO2A 1XNQK 1JLCA 5M1FA 2BGGA 4E1MA 3EZWA 2OZMA 2A6AA 1CXUA 5J2PA 2W41A 2UXDK 3HM8A 3D2FB 4Y1CA 1V4SA 4BRDA 3RRHA 4FJMA 4CBXA 3HVRA 5F1XA 4FWRA 3WQTA 4IBNA 4EKUA 3SUNA 1NK7A 1VQMN 2HMIA 3MX2A 3L4QA 2ZGZA 3C7NB 4JI1K 5LMUK 1NMDA 5FPMA 4DR6K 3P1GA 3VEZA 4W5NA 4RW6A 4G9ZA 4H5VA 4CJ3A 5DM6L 3FZMA 5JVGL 2QXFA 4IOCL 2E2OA 3SV4A 4DMNA 1WSEA 1KC8O 4ILHA 2DPNA 3KHYA 2AA4A 4WE1A 3Q7CA 1N6QA 1NGEA 4AHUA 2YNGA 4KV8A 3QERA 1ATSA 2O8BA 3TSPA 1TUYA 3V6DA 2QKKA 4C1NI 1WN7A 4NY0A 2GBZA 4MO4A 3VGLA 3A5OC 3EO3A 2ZPYA 4HUGA 3KTQA 5I3UA 1YT3A 2YX6A 4MDAA 5J2MA 5AQOA 4W5TA 4OO1J 3DLBA 1ZBSA 3M8PA 1H4RA 4KHYA 4HTUA 4PHTX 1TKTA 3SZ2A 2RF2A 4DV7K 4FZYA 2HBKA 3KLIA 4XH4A 4IG0A 4DV4K 3TU5A 3LALA 1YJNN 4CJFA 4YOUA 1G99A 4X62K 4PL8A 2ATQA 4ELTA 4OLAA 3OYAA 1A5WA 5EVZA 4A2BA 1EQYA 2COPA 4CCHA 2DFEA 4WFBL 3ZT3A 1YF5L 5FLXO 4BG8A 3CCVN 4CZEA 1RT1A 1VRUA 3BF1A 3CI5A 2KKZA 5AZJB 4AQYK 4FJ8A 2D2QA 4FK4A 4CHPA 2YKNA 2IGIA 4PKHA 4DR2K 1M1KO 5HP1A 4CGIA 4BWJA 3CCMN 4K8XA 2J0MA 3BZCA 3OHRA 3AGKA 1X3MA 4DV3K 3A5LC 5HRPA 4CI6A 4GVMA 4B1WB 4ZHRA 1JXEA 5HRRA 3OYGA 4JKCA 4YOTA 4LH5A 4B3RK 1UA0A 1BI4B 2EMSA 1ESVA 3R1XA 3M8SA 4ISEA 4Z4CA 4DTUA 4FM0A 4DB3A 5CHIA 1HYZA 4DR5K 4O5BA 3M6GA 2UU9K 3E66A 3MWTA 3R6MA 1KBLA 1RT4A 3ULEA 2QK9A 3TARA 3MMVA 1K9MO 3RTVA 3M5RA 3O9TA 2IVPA 4CHOA 2PFUA 4DV5K 4H5TA 5KI6A 1RDWX 3HP9A 5HOOA 3RWUA 5EY4A 4XH5A 3TTDA 3U3YA 2P9PA 4GMJB 1YUWA 1RBVA 2QWLA 4IFEA 1R0AA 4BR4A 5KTQA 4DLGA 4IEIA 4OPKA 3DOLA 3SCXA 2V7ZA 1BCMA 3P38A 3MAQA 2O8EB 1L3TA 4O55A 3IKMA 1SGHA 1DTTA 1VSDA 3MN5A 2P9IA 4BRNA 4FWQA 1DTQA 3DLKA 4DFMA 4I6MA 3OYMA 4EFHA 2XO7A 4BR7A 2KTQA 3OYIA 1P90A 3V9ZA 1S6PA 4DSKA 3QMLA 3T69A 1GG3A 2QXLA 2X74A 3ID8A 3G0ZA 3G10A 1VSKA 3ZSRA 4PKGA 4FJJA
chains in the Genus database with same CATH topology
1NGBA 4IZ9A 1BOTO 3ULEB 4A57A 1BWFO 3UKUB 3NVMA 4R79A 4BROA 3I55N 2NLXA 4MO5A 3SMSA 4GY2B 4BC4A 4CZLA 1E5WA 3FLVA 5AQFA 3HOSA 3O9RA 4FWLA 4B1UB 4DQ8A 3CCLN 1BUPA 1NGGA 4WQ4C 4BC5A 3F5TA 4WQ5C 3SBGA 2ASOA 5KPTA 1BU6O 5KQDA 1QZ5A 3ENBA 2AEHA 4HTLA 1U2VA 1ZXOA 1YI2N 1VQON 4RCHA 1GLCG 1NGAA 1MDUB 2YHXA 3IVFA 1YITN 1T44A 3QICA 1YXQA 1YIJN 5ADXH 3K9KA 3QBWA 3EKUA 2NRHA 4KH5A 1IG8A 3CMAN 2GELA 3U8XA 4GV9A 4PKIA 1VAZA 4WF9L 2VGMA 3W3DA 4DKWA 4EIAA 3VEOA 3A5MC 3F9MA 1XQSC 4BC3A 2FF6A 1DKGD 5C2FA 3A0IX 4CYEA 2FSNA 4FWSA 5AQVA 4CBWA 1TUUA 2ZJPL 5AQZA 3UB5A 4YOYA 4YOVA 3AU4A 4ILGB 4C1NK 1ACAA 3SLCA 4EAHD 3WXIA 3AAPA 5M1QA 5M1OA 4EHUA 3OBWA 4Z94A 3HRGA 5C10A 1MIZB 3CC7N 4H0VB 1HKGA 4Y0WA 1ISNA 1TYQB 4M63C 2E88A 4BRCA 1GC6A 4BGAA 3VGKA 5AQYA 3FP5A 4HWIA 2RHKA 5JVHL 1CZAN 3E9OA 3DWLA 2Q0UA 3LM2A 2HBJA 3ZX0A 3CETA 3LDQA 1K8KB 2X0SA 3CCJN 3WQUA 2NNWA 3U4LA 2V7YA 5ADXA 3VENA 1NM1A 3HOTA 1ATRA 5FPNA 3VETA 3MCPA 5BPNA 1HKCA 2V51B 3D2EB 3ZEUA 4B1VA 1NGCA 3UKUA 4IOXA 1NGDA 3S41A 3VTIA 3PIOL 3MN7A 5TKWA 2GWKA 5I9EB 3CCSN 3KK7A 4JK9A 2KHOA 2F9TA 2NRZA 4BG9A 4TKNA 2CGJA 3CHWA 2D4WA 3F2KA 1Y64A 2J4RA 2I7PA 3K9JA 2E1ZA 5CE3A 4GV3A 2P9SB 3BINA 1NGIA 4WFAL 5AQGA 3WXKA 4H5RA 3TTFA 1S3XA 4M7XA 4WQ5A 1Z6RA 2F9WA 4K41A 3VERA 4ZRJA 5AQMA 5LY3A 3RSEA 4CZMA 3CIPA 1GLJO 1BDGA 2F7TA 1HLUA 2YJEA 1NBWA 3CJBA 4GNIA 1VQ7N 4IWVA 5EOYA 3WXLA 1KAYA 1M90O 4HDQA 4KBOA 4RTFD 3VEVA 5FPDA 4BR5A 2PBDA 3H46O 5BN9A 4JD2A 3I33A 3CQYA 3R8EA 3WXMB 3WA0A 5M1KA 1ST7A 3PIPL 3G6EN 4JKGA 4BRKA 4A62A 3FZHA 1GLAG 4CZJA 3EN9A 1VQ4N 5LJVA 3GG4A 4YOWA 1VQ8N 3HTVA 5AZIB 5F2RA 3CJAA 1MK9B 3QDKA 3O6WA 3KZBA 4AM6A 3SAHA 1T6DA 3H3NO 2QWNA 4H0PA 3FZLA 2AP1A 2GX9A 3O9QA 5C12A 5C0YA 1LCUA 5AR0A 5GAHP 1X9JA 5FPEA 1NWKA 3ID6A 3PZDA 3QIJA 2A40A 4FWNA 1HB8A 3DXKA 4A61A 3E9LA 1KAZA 4QS8A 5GINA 1T3VA 2ABDA 3U8ZA 5H1SQ 1ZC6A 3TPQA 4BY9C 2FSJA 3MWPA 1QQOA 4FOEA 1J6ZA 4BRFA 4OPAA 4FOIA 2E2QA 2P9IB 3GDQA 2KLAA 3C6AA 4L3QA 3VTHA 5LJWA 5GADP 2QWQA 4IEEA 4BR2A 1JCGA 4PL7A 3CJ1A 5C15A 3CJ9A 1Q7YO 1RGIA 3H3OB 3P39A 5HL7L 4WFNL 1HPMA 2P9LA 3WEEA 3X23A 2E2NA 1GC7A 3D2EA 3ZEUB 3D2FA 5TKYA 2FSKA 1VQ6N 3ZYYX 3HI0A 1VQLN 2HF4A 1YAGA 4QS9A 2QA4N 4YORA 2ZWHA 2VYPA 4NB4A 3CC4N 4B1XB 1W2BM 1RDUA 4JAXA 1NJIO 2YJFA 3FGUA 4XEIA 2H3GX 3ZETB 3UKRA 4BRQA 2ZF5O 3DXMA 3D7EO 5JICA 3RSEB 1MK7B 5AQQA 3IUCA 3VEYA 1JDEA 2IIRA 1JCEA 4YDUA 5BN8A 4WCEL 4A5BA 4HDOA 2GTDA 4RWTA 2ZGYA 3C7NA 4IXCA 1YHQN 3CQXA 4ISGA 5AQSA 1GGOA 3VF2A 4B9QA 5B8HA 1VQNN 3H1VX 2E2PA 4GVEA 3WT0A 1YVNA 1Y19B 2BH1A 2CH5A 5C2DA 3CF5L 4WYBA 1VBGA 1HJOA 3G25A 5AZJA 3M1FA 3ZX3A 4BVOA 3CJ7A 3FR0A 2FDQA 3MN6A 4GV6A 1QVGM 1OKJA 2FLOA 1NGFA 3O8MA 4JKHA 4BRLA 2P9NA 2A5XA 2QWRA 3CXCM 1LOTB 1W97L 3G4SN 3FE1A 2QI2A 3A5NC 3OA9A 5BRFA 2QW9A 2NRXA 2P9UA 4BRHA 1C0FA 3G71N 3AGRA 4MLHA 4IOAL 3AU5A 2RQ1A 4MLEA 4JKDA 4JEPA 4BQLA 3QFPA 4CZKA 3O80A 3LDPA 2HSTA 2HBMA 3CCUN 4WQ4A 1S22A 4JK8A 3GL1A 3BP8A 5EXWA 3MDQA 5BPLA 4A2AA 3NVKA 4JKAA 3IDHA 5AQKA 3U9DA 2AL6A 2CGLA 4F7GA 4H03B 3G9WA 4H0XB 3SAFA 3SBTA 1NGHA 4K25A 1QZ6A 5M1FA 3EZWA 3IFRA 2A6AA 3ATUA 2OTLN 1GLFO 1V4TA 2W41A 2OANA 3HM8A 3D2FB 4K42A 1V4SA 4BRDA 1SZ2A 1Z05A 4CBXA 2DIKA 4NLCA 5F1XA 2IVNA 3O1WA 2ZJQL 1VQKN 3EKSA 3FLCO 1YJWN 3B8AX 1HB6A 1XC3A 2BUPA 4FWRA 3WQTA 1MIXA 2IVOA 3PVLA 1R59O 4H0YB 2JWLA 2VCPA 3O4WA 4EKUA 3VOVA 4A59A 1Q81O 3CC2N 2NRTA 2NRWA 2HRJA 4FSVA 3EL2A 1VQMN 1BA1A 3MX2A 3L4QA 2ZGZA 3C7NB 3A8YA 1SAZA 5AQTA 3W0LA 1NMDA 1HUXA 5EX5A 5FPMA 4BC2A 3EE8A 1BO5O 1QQNA 2A42A 2D0OA 3L6QA 2ITMA 3ENOA 4FPAA 2E8AA 3VEZA 2YVCA 2CGKA 3KWIA 4G9ZA 2Q36A 1WUAA 2A41A 4AM7A 4H5VA 2EWSA 1EO1A 3L0QA 2P9NB 3IMXA 5DM6L 5DM7L 4BR0A 2E1YA 3DJCA 5BRHA 3FZMA 5JVGL 3O08A 4IOCL 2E2OA 3SJHA 2I1KA 4M7YA 3LM9A 4JD2B 4JHDB 3TSUA 1K8AO 4B1ZA 1KC8O 4ILHA 4JKGB 2Q1NA 2DPNA 3I8BA 3KHYA 5AQWA 1DGKN 2AA4A 5ELZA 4FO0A 4CZHA 3Q7CA 5AZIA 2D10A 4O8KA 1NGEA 4MDBA 1GLDG 3CCQN 1ATSA 3AARA 1RFQA 3TSPA 2LBBA 5GIOA 2OTJN 3ENHA 3SK3A 1QQMA 1TUYA 3E1YA 3NMUA 4C1NI 1XUPO 3CCEN 3VGMA 1Q86O 4BRPA 3DXKB 4NY0A 4MO4A 4DXAB 1C0GA 4BQZA 3BF3A 3VGLA 1VQ9N 2HF3A 1GLEG 2WC9A 3A5OC 3CPEA 2ZPYA 3EO3A 4JKFA 4I6MB 5BRDA 1NI2A 1NTIA 2CH6A 2YX6A 4MDAA 1KC7A 3J8AA 5AQOA 4OO1J 2D0PA 1ZBSA 1H4RA 4CD1A 1N8RO 2GEMA 2WBNA 3VEXA 5AQXA 5JVLA 3GE1A 3C0BA 3AY9A 4PHTX 1DIKA 1SS6A 3CJCA 2YHYA 2FF3B 4B1YB 4BRAA 4EHTA 2HBKA 1U6ZA 2P9LB 3WEEB 4CD3A 4XH4A 4P7IA 3DAWA 3TU5A 3O9UA 1YJNN 3QBXA 4ISFA 2FJ9A 4IO8A 4AF1A 4YOUA 3HSCA 1G99A 5IJMA 3P31A 4O5FA 4PL8A 3ZX2A 5GAGP 3MK6A 5E84A 5JLFA 2Q0RA 3JS6A 3ZETA 5EVZA 4A2BA 3O9SA 3LL3A 1EQYA 3L4IA 1H1VA 1MA9B 4NLBA 2COPA 1U2VB 3CMEN 3CPWM 4FWOA 4WFBL 1O13A 5AQJA 1EF1A 1YF5L 4BG8A 3E9PA 1HBKA 3O5BA 3CCVN 3VPZA 2R82A 1SQKA 5AQPA 4J8FA 4CZEA 1Q82O 3CERA 4FWPA 3I56N 3TSQA 4E1JA 3BF1A 3CI5A 2KKZA 2PAVA 4KH6A 4JKEA 1NLVA 5AZJB 4IO9L 4JKBA 4ZRKA 3J7ZO 5KPZA 4BRMA 2D2QA 1E4GT 4FPBA 2QWMA 4UY8O 2P9KA 3R3LA 2E20A 2P9PB 3QFUA 3R9PA 4XH1A 4PKHA 4YL8A 1M1KO 3CD6N 5AFUA 3FFKB 4DCHA 3EE9A 4BGBA 3GBTA 3CCMN 3OBYA 4JN4A 2P9UB 3H6EA 3HZ6A 1GLLO 2J0MA 2JWKA 2NZTA 3LDNA 3OHRA 2ZJRL 3CCRN 3AGKA 4BRIA 1X3MA 3VMFB 1TYQA 4YDUC 4JK7A 2V52B 3A5LC 3Q7BA 4H0OA 1KXPA 2I7NA 4QS7A 1DT9A 4CZIA 1GLBG 4CI6A 2HOEA 3C65A 4NO7A 3WUHA 3ZDTA 1Q18A 4IDHA 4BR9A 1ILYA 2YCHA 4B1WB 3AAQA 4CJ7A 1J19A 4BVPA 4H5NA 4JKCA 3C6HA 4FL9A 4YOTA 2YHWA 5AQIA 5GAEP 2D11A 1K8KA 5JMVA 1MWMA 2EMSA 5JLHA 3JXUA 2QTDA 2VGNA 1ESVA 3R1XA 4K43A 5KQ8A 4CZFA 4FWKA 4H5WA 4ISEA 5AFUH 5AQRA 4KH4A 4DB3A 3SAGA 3FZFA 5CHIA 2FXUA 4LC9B 2CQUA 3EPYA 3N4PA 4IJAA 4O8UA 1KQSM 1QVFM 3M6GA 3HBTA 1IJJA 1QHAA 3VESA 2EMTA 3PLAA 3E66A 3MWTA 2P9SA 3WXJA 5CR4A 3KVGA 3R6MA 1KBLA 3ULEA 5KPRA 3H1QA 3MMVA 1K9MO 3M5RA 4JNEA 1NVLA 4A5AA 1VBHA 3O9TA 2IVPA 5AQLA 2Q97A 2NRRA 1ATNA 2PFUA 5AQUA 4YOXA 1HX1A 3T7ZA 4H5TA 2HE7A 5M1PA 1MWKA 5F0XA 1RDWX 3KWGA 2A3ZA 3MX5A 4IJNA 2ASPA 1P8ZA 2VWBA 5BREA 5HOOA 1JCFA 2WUSA 5E26A 2D1KA 2RE2A 2W40A 3MN9A 4XH5A 1BG3A 2HMPA 5EY4A 3TTDA 1YJ9N 3GOIA 3M3ZA 5AQHA 4BRGA 2P9KB 2Q31A 1OVYA 2GWJA 2P9PA 2BTFA 3FZKA 5AQNA 2I1JA 1YUWA 2QWLA 4IFEA 4C23A 4F9OA 4JHDA 4BR4A 4GXBA 4CZGA 4DHYA 4IEIA 3RVCA 3VF6A 1HKBA 2GUPA 3BUZB 3SMPA 4ZRIA 5M1NA 3DLLL 4FWMA 2NRVA 2Q2RA 3P4IA 1WOQA 3VEWA 3ATVA 1JJ2M 4OPHA 2V7ZA 3D6RA 1KAXA 3P38A 3QB0A 4U7BA 1NGJA 4BREA 2J0KA 2CB8A 5BPMA 3IKMA 4FVUA 1SGHA 3N4QA 3U7DA 1K73O 1KD1O 3MN5A 4CBUA 2QEXN 2P9IA 2YI1A 2QM1A 2UYTA 4BRNA 4FWQA 4ILJA 1S72N 3UE5A 2WFBA 1D4XA 4I6MA 2QWPA 4U67L 1BA0A 3H45C 3U9ZA 4EFHA 3O1BA 4BR7A 5MLCQ 1P90A 1DEJA 3BEXA 1VQPN 2WH5A 1X3NA 3QMLA 5GIPA 1VQ5N 3T69A 1GG3A 2ASMA 2QXLA 1E4FT 5BR9A 2J0JA 3ID8A 1T6CA 4H0TB 3VF4A 3OW2M 2HBLA 3LDLA 3LDOA 2QWOA 3TTCA 3UKRB 4PKGA 3MCAB 3DXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILH A;  4JK8 A;  4JKG B;  4JKA A;  3E9L A;  3E9O A;  4ILJ A;  4JKH A;  3SBT A;  4JK7 A;  3E9P A;  3E66 A;  4ILG B;  3SBG A;  4JKG A;  3ENB A;  4JKE A;  4JKB A;  4JK9 A;  4JKC A;  4JKD A;  4JKF A; 
#chains in the Genus database with same CATH topology
 1NGB A;  2VG7 A;  1XMQ K;  3NVM A;  4R79 A;  4DQP A;  2O4I A;  4DS5 A;  3OYD A;  2FBY A;  4FWL A;  4B1U B;  1Q9X A;  3JAM O;  3AO3 A;  4DTO A;  4BC5 A;  1L3V A;  4FXD A;  3VQE A;  4WQ5 C;  4CES A;  1S1V A;  2KW4 A;  3SBG A;  1BU6 O;  1RIL A;  3HPO A;  1ZXO A;  1RDB A;  1NGA A;  4DF8 A;  3IVF A;  5HRO A;  1T44 A;  3K9K A;  3QBW A;  2NRH A;  1IG8 A;  2GEL A;  1HRH A;  3U8X A;  4GV9 A;  3MXJ A;  3A5M C;  1XQS C;  1KVB A;  2FF6 A;  4CYE A;  2FSN A;  4FWS A;  4CF1 A;  4KHQ A;  1TUU A;  3L2Q A;  4YOV A;  3AU4 A;  4ILG B;  4C1N K;  4CFB A;  4FCY A;  3LZJ A;  1XHZ A;  4CEB A;  3KK3 A;  3U3G A;  3AAP A;  3LWL A;  5M1O A;  5C10 A;  3CC7 N;  4Y0W A;  3NGY A;  4HCC A;  3THW A;  4N56 A;  4BDP A;  4BRC A;  4CK1 A;  2E4L A;  1T03 A;  1I94 K;  3IG1 A;  5AQY A;  2OPQ A;  3HPH A;  2RHK A;  5JVH L;  2Q0U A;  5SWM A;  1NJX A;  2OPS A;  2V7Y A;  2OYQ A;  3MCP A;  4JI7 K;  1NGD A;  4K0K K;  3CFR A;  3THV A;  3CCS N;  3KK7 A;  2KHO A;  3ZT4 A;  2J4R A;  3K9J A;  4GV3 A;  3TR8 A;  4FZX C;  4H5R A;  4HVJ A;  1S3X A;  4DTP A;  4CFD A;  1Z6R A;  4DQQ A;  4DV1 K;  2D0A A;  4KBO A;  5FPD A;  3OYC A;  1LWF A;  5BN9 A;  3ZSW A;  1X9S A;  2YHB A;  1ST7 A;  3EN9 A;  3L2R A;  1VQ8 N;  4DWI A;  5F2R A;  5CYM A;  4DUY K;  2ETJ A;  3ZSZ A;  1T6D A;  2GX9 A;  1LCU A;  4DV2 K;  3SPY A;  4CHQ A;  3LAK A;  1UA1 A;  1BIU A;  3QNO A;  2G8F A;  2QKB A;  4NYN A;  2ABD A;  1N33 K;  1HNV A;  5H1S Q;  4FOE A;  4OPJ A;  2RN2 A;  1D9F A;  2Y1I A;  3GDQ A;  4CFA A;  3C94 A;  5LJW A;  1JL2 A;  3CJ9 A;  4WFN L;  3SUO A;  1NKE A;  1XWL A;  3X23 A;  2EX3 A;  3ZSX A;  3NCI A;  1NK6 A;  1T7P A;  4QOZ B;  3D2E A;  2P51 A;  3ZEU B;  5TKY A;  4K8Z A;  5IT9 O;  1OVQ A;  3KIO A;  3HI0 A;  3ZYY X;  2HF4 A;  4DQR A;  5JS1 A;  1WNS A;  4NB4 A;  2VYP A;  3L3V A;  4YOR A;  4B1X B;  1RBS A;  4JAX A;  3ZET B;  4DV0 K;  4KPY A;  1HNZ K;  4E0D A;  2HHX A;  1NU0 A;  2XY5 A;  2IOC A;  5JIC A;  1JLE A;  3RSE B;  1MK7 B;  3B6P A;  3IUC A;  3VEY A;  1JDE A;  2IIR A;  4KRE A;  4BE2 A;  4WCE L;  2KZM A;  2GTD A;  1U48 A;  3AA5 X;  3CQX A;  3VF2 A;  3ZLJ A;  5BR8 K;  1YVN A;  4WYB A;  1S9G A;  5AZJ A;  4CVN E;  1HQU A;  3FR0 A;  4DV6 K;  4GV6 A;  1NGF A;  2KQ2 A;  3ITH A;  1LOT B;  1W97 L;  1RT2 A;  3OA9 A;  1NNE A;  2WON A;  1C0F A;  3G71 N;  4OGC A;  4N41 A;  3SQ1 A;  4OKK A;  3LDP A;  4N47 A;  2HST A;  2HBM A;  5EXW A;  5BPL A;  1L5U A;  4A2A A;  3IDH A;  3U9D A;  4F7G A;  1UOC A;  4LF8 K;  3K57 A;  1S5J A;  1NOY A;  3JSM A;  3SI6 A;  1QZ6 A;  2XY8 A;  4C8N A;  2OTL N;  1GLF O;  2OAN A;  4E7H A;  2RKI A;  1B9F A;  1SZ2 A;  1Z05 A;  2DIK A;  3SV3 A;  2P5O A;  3BGR A;  1SL2 A;  4DS4 A;  3NGZ A;  2W6K A;  2JLE A;  1HB6 A;  4B8A B;  1MIX A;  4X65 K;  2JWL A;  4M3Z A;  3DLR A;  4LSL A;  4JRQ A;  2NRT A;  3SQ0 A;  3PSF A;  1A5X A;  1BA1 A;  4CJW A;  1RDA A;  1QHT A;  4FJN A;  1HUX A;  4CJT A;  1RDC A;  1BO5 O;  1QQN A;  1TVR A;  2D0O A;  3ENO A;  4B9L A;  1FXX A;  4FPA A;  3QIN A;  2YVC A;  2CGK A;  3KWI A;  1EO1 A;  4AM7 A;  2P9N B;  3IMX A;  1S1U A;  1WSI A;  2E1Y A;  3DJC A;  4BR0 A;  5BRH A;  3O08 A;  4JI5 K;  3TSU A;  4Y1D A;  2Q1N A;  3I8B A;  3AVG A;  5EU7 A;  1DGK N;  5ELZ A;  1XMO K;  4CHZ A;  5AZI A;  4DSJ A;  2D10 A;  4LSN A;  3RR8 A;  1WBD A;  3ENH A;  3CCE N;  1OH5 A;  1Q86 O;  2PYL A;  4FVM A;  1VQ9 N;  1C0G A;  4BQZ A;  4KHN A;  1KTQ A;  4I6M B;  2CH6 A;  3VQP A;  3CM6 A;  4CIG A;  1RBR A;  1N8R O;  2WBN A;  4CW7 B;  3VEX A;  5JVL A;  3GE1 A;  4B9T A;  3KKS A;  1CXQ A;  1SS6 A;  4BE0 A;  4L8R B;  3ZSV A;  3VQ9 A;  1ASW A;  3TAG A;  4DU1 A;  3WEE B;  3AVN A;  3DOK A;  3O9U A;  3HSC A;  1C1B A;  4O5F A;  1FKO A;  3NE6 A;  5E84 A;  4DQI A;  1HNW K;  3TAM A;  4OKJ A;  3HM9 A;  4DTX A;  1Q9Y A;  2XRI A;  3AVI A;  1U2V B;  3RRG A;  3D45 A;  4FWO A;  3CPW M;  1ZBI A;  1X1P A;  1I39 A;  3QES A;  1HBK A;  3O5B A;  3AVL A;  2R82 A;  1SQK A;  5AQP A;  4HUF A;  4V19 S;  3TSQ A;  3CM5 A;  2KFN A;  1NLV A;  3L8B A;  4JKB A;  1E4G T;  4E1N A;  1SKW A;  4UY8 O;  3THX B;  1RT7 A;  2E20 A;  2P9P B;  3R9P A;  4XH1 A;  3V9X A;  4FLY A;  5LMN K;  3OBY A;  3P83 D;  2P9U B;  1Y97 A;  3HZ6 A;  1J5E K;  1VRT A;  3LDN A;  4W5O A;  2ZJR L;  2VQF K;  4BRI A;  1TYQ A;  1KXP A;  2I7N A;  4CGD A;  1DT9 A;  3L2W A;  1E3M A;  2HNY A;  2HOE A;  3ZDT A;  1ILY A;  2YCH A;  4BVP A;  4F2S A;  4H4M A;  3CFO A;  1KFS A;  3S3N A;  1KLN A;  4RG8 A;  3JXU A;  2VGN A;  4K43 A;  2O8F B;  1BL3 A;  2E5L K;  1UWB A;  3VQ5 A;  3OYB A;  3ZSO A;  3CFP A;  1S6Q A;  3NAE A;  2CQU A;  3S3O A;  1TAQ A;  4B9U A;  4OLB A;  3SQ4 A;  2AJQ A;  3VES A;  1IJJ A;  2YNH A;  3KK2 A;  4DSI A;  4LF6 K;  3PLA A;  3TAF A;  5CR4 A;  3KVG A;  4FJH A;  4CJV A;  3K59 A;  3KD5 E;  4JNE A;  3NH2 A;  5AQL A;  2NRR A;  1ATN A;  2YNF A;  5F0X A;  3KWG A;  3VQQ A;  2A3Z A;  4JI3 K;  3MX5 A;  2ASP A;  2VWB A;  3NFA A;  1JCF A;  3KKR A;  2Z1I A;  2HMP A;  2I5J A;  3GOI A;  3M3Z A;  5AQH A;  4F3O A;  2P9K B;  1OVY A;  2GWJ A;  4CGJ A;  4E19 A;  5K14 A;  4OKE A;  4CEE A;  4JHD A;  4FJX A;  4KHW A;  3RVC A;  3BUZ B;  4JI4 K;  4FWM A;  4FJ5 A;  2HVH A;  4M3R A;  1WOQ A;  4AHT A;  3PX6 A;  2FBT A;  3TAP A;  3RR7 A;  1RBU A;  4OPH A;  3D6R A;  1QE1 A;  3QB0 A;  1OH8 A;  5BPM A;  3N4Q A;  3U7D A;  1JLA A;  4KHU A;  2QM1 A;  2UYT A;  2VG5 A;  4ILJ A;  1S72 N;  1D4X A;  1IKX A;  3THW B;  4F4K A;  4U67 L;  1BA0 A;  4CEQ A;  3U9Z A;  4RW4 A;  2G8W A;  3V1Q A;  1DEJ A;  1VQP N;  3OYF A;  1X3N A;  5IWA K;  5FRO A;  2ASM A;  1B9D A;  4FW1 A;  4CEO A;  3HYF A;  2J0J A;  1T6C A;  3VF4 A;  4O0I A;  3UKR B;  4PA1 A;  4OJR A;  3T1Y K;  1U49 A;  2X6N A;  4A57 A;  1BWF O;  3HVT A;  4BRO A;  2NLX A;  4J2E A;  4GY2 B;  4BC4 A;  1E5W A;  4Z4G A;  3C95 A;  3HXM A;  1GOB A;  3THY B;  1QZ5 A;  2HHQ A;  1VQO N;  5HLF A;  4E7L A;  3ZCM A;  4RCH A;  1MDU B;  2YHX A;  2F8S A;  4FJG A;  1YXQ A;  5ADX H;  1TK0 A;  3S9H A;  4OX9 K;  4DTS A;  3NF8 A;  4DKW A;  3J7Y P;  4M3T A;  1IV0 A;  4KB0 A;  3F9M A;  4FJ9 A;  1U47 A;  4CBW A;  3PO4 A;  3OYL A;  4FK2 A;  1G15 A;  1J9A A;  4Z4I A;  2O8E A;  3E01 A;  4EHU A;  3HRG A;  2YHA A;  1MIZ B;  2HW3 A;  4LF9 K;  4JS5 A;  1WSG A;  3VQ4 A;  1GC6 A;  4KI6 A;  3K5L A;  2Z1H A;  3OYH A;  1BQN A;  3E9O A;  2E6L A;  4X66 K;  3LM2 A;  2HBJ A;  4LF4 K;  1LW0 A;  1K8K B;  3K5M A;  3BDP A;  2NNW A;  3U4L A;  1FKP A;  4Z4H A;  1ASU A;  1ATR A;  2OCE A;  4CF9 A;  3HOT A;  1NJY A;  2V51 B;  3ZEU A;  4B1V A;  1NGC A;  3S41 A;  1RCH A;  3MN7 A;  5TKW A;  3HPG A;  2F9T A;  2CGJ A;  4LFC K;  2D4W A;  4KB1 A;  5HRN A;  4N76 A;  1NGI A;  1W9H A;  5AQG A;  3WXK A;  3VER A;  1LV5 A;  5LY3 A;  1CZ9 A;  1S9E A;  2F7T A;  4I2P A;  3CJB A;  3NHG A;  3PUF A;  1KAY A;  3WXL A;  2PYJ A;  3PY8 A;  3VEV A;  4BR5 A;  1QSS A;  3R8E A;  3WXM B;  3CQY A;  3WA0 A;  4CF0 A;  1VSI A;  4A62 A;  3FZH A;  1GLA G;  4CZJ A;  3QET A;  5LJV A;  4B9V A;  2JGU A;  5AZI B;  3QDK A;  3O6W A;  3KZB A;  1FJG K;  4AM6 A;  3H3N O;  2QWN A;  4H0P A;  5C12 A;  3O9Q A;  5FPE A;  4FWN A;  2A40 A;  3VQA A;  1HB8 A;  3DXK A;  4A61 A;  3LP2 A;  4QS8 A;  5GIN A;  4CF8 A;  4DR3 K;  3LAN A;  3VQB A;  4CED A;  1RT5 A;  3U8Z A;  1ZC6 A;  3TPQ A;  4BY9 C;  1BHL A;  2FSJ A;  2HHT A;  1J6Z A;  1JLG A;  2F4V K;  2P9I B;  4L3Q A;  5KGX A;  3EZ5 A;  4FK0 A;  4IEE A;  4QCL A;  2BAN A;  3CJ1 A;  5C15 A;  1RGI A;  3H3O B;  5HL7 L;  4M3W A;  3WEE A;  3HK2 A;  3OS2 A;  2E2N A;  4E3S A;  2UUC K;  2FSK A;  1VQ6 N;  1YAG A;  2X78 A;  4CEA A;  3CC4 N;  1D8Y A;  5AJ3 K;  4DTR A;  1WLJ A;  2YJF A;  4C8O A;  3WNF A;  1N34 K;  1HNI A;  3DXM A;  1NJZ A;  3D7E O;  3SQ2 A;  3QEW A;  1XC9 A;  5C25 A;  4YDU A;  3T19 A;  5BN8 A;  1IKV A;  1YHQ N;  4IXC A;  1GGO A;  1KVC A;  3H1V X;  2NUB A;  4IFY A;  3WT0 A;  1CLQ A;  2CH5 A;  3O4N A;  1HJO A;  3NF7 A;  3ZX3 A;  3NBP A;  3TWH A;  4BRL A;  5J1E A;  2P9N A;  2A5X A;  4PUO A;  2QI2 A;  2B4J A;  2GV9 A;  5BRF A;  4MQ3 A;  4KI4 A;  4MLH A;  4IFV A;  4JI8 K;  3AU5 A;  4DF4 A;  4M42 A;  2DY4 A;  5CYQ A;  5J2Q A;  3DYA A;  4CZK A;  2WOM A;  1C0U A;  4CJS A;  4M3Y A;  2KFZ A;  3MDQ A;  4KKO A;  3NVK A;  3BY5 A;  2HHS A;  3C6T A;  1JKH A;  1W0H A;  3SBT A;  4K25 A;  2O8F A;  3IFR A;  3ATU A;  4FLZ A;  1U45 A;  3U6F A;  4NLC A;  2UUB K;  2IVN A;  3O1W A;  1VQK N;  1YJW N;  3FLC O;  1LWC A;  3B8A X;  3F9K A;  1XC3 A;  2BUP A;  4Z0U A;  3PVL A;  3QEP A;  4YY3 K;  4H0Y B;  2G8H A;  4N5S A;  2VCP A;  4A59 A;  3CC2 N;  4F8R A;  2NRW A;  2HRJ A;  4CJ4 A;  1NOZ A;  1SAZ A;  5AQT A;  3W0L A;  3EE8 A;  3B6O A;  3OYN A;  3L6Q A;  2ITM A;  3TI0 A;  2EWS A;  1EWR A;  3L0Q A;  1YTA A;  3V9U A;  3O3G A;  3M8Q A;  3LM9 A;  3LP3 A;  4JD2 B;  4JHD B;  4KRF A;  4KFB A;  3AA4 A;  4JKG B;  3K0S A;  5D3G A;  4RW8 A;  3DRS A;  5KGW A;  4XIU A;  4MDB A;  2LSN A;  3I0R A;  1RFQ A;  2LBB A;  5GIO A;  2OTJ N;  4JI2 K;  3VQC A;  1XUP O;  4CHN A;  1WBB A;  2G8V A;  3BF3 A;  2HF3 A;  1GLE G;  2WC9 A;  3RMD A;  3DLH A;  3OYK A;  3CYM A;  1NTI A;  4EP4 A;  1KC7 A;  2W6L A;  3J8A A;  3LPU A;  1RTH A;  4CD1 A;  3VA3 A;  5AQX A;  4BDY A;  3ISN C;  3AY9 A;  1ZYQ A;  4O44 A;  2OPR A;  2YHY A;  1QQC A;  4BRA A;  2YKM A;  1U6Z A;  3WNH A;  4EHT A;  4CD3 A;  1HNX K;  3DAW A;  3AVA A;  4ISF A;  4AF1 A;  2O8D A;  5IJM A;  2D0C A;  5HBM A;  5JLF A;  1X9W A;  3ZET A;  3O9S A;  3AVM A;  1Z25 A;  1H1V A;  3L4I A;  3THY A;  1MA9 B;  4NLB A;  4R5P A;  2A1S A;  4AHS A;  1JLB A;  3LZI A;  5AQJ A;  1EF1 A;  5HRS A;  3VPZ A;  4J2D A;  4J8F A;  3QEX A;  4E1J A;  1VSM A;  4ZRK A;  4CJQ A;  4BRM A;  4G1Q A;  4FPB A;  2QWM A;  2P9K A;  3R3L A;  4ID5 A;  2IS3 A;  3QFU A;  1EP4 A;  1Z26 A;  3QEV A;  5AFU A;  4BGB A;  4NCB A;  4JN4 A;  3AO5 A;  1IO2 A;  3H6E A;  2JWK A;  4DSL A;  1RDD A;  3CCR N;  4FLT A;  4DU4 A;  4F3T A;  3PSI A;  3VMF B;  3WNE A;  1NG9 A;  4YDU C;  2V52 B;  4H0O A;  4CZI A;  1GLB G;  1NK5 A;  4NO7 A;  3WUH A;  1Q18 A;  2EHG A;  4BR9 A;  3AAQ A;  2HHH K;  3F73 A;  4H5N A;  4BAC A;  3KLE A;  3C6H A;  5AQI A;  2VWK A;  1K8K A;  1LW2 A;  5GAE P;  1VSJ A;  3NGI A;  3TAQ A;  2DFH A;  2QTD A;  5KQ8 A;  1GOC A;  4CZF A;  3DM2 A;  5AFU H;  5AQR A;  4KH4 A;  3AA3 A;  4LC9 B;  3HJF A;  3N4P A;  1JXB A;  4CFC A;  1KQS M;  3BZK A;  1QVF M;  3HBT A;  1QHA A;  2EMT A;  1T05 A;  3K5O A;  5KPR A;  1KLM A;  1BIZ A;  3H1Q A;  3LP1 A;  3K58 A;  1WSF A;  1NVL A;  5AQU A;  3T7Z A;  1MWK A;  2F96 A;  4IJN A;  3MEC A;  5BRE A;  1XNR K;  1NMN A;  2WUS A;  3PO5 A;  3MN9 A;  4FYD A;  1BG3 A;  1BCO A;  2UXB K;  2HNZ A;  3VN5 A;  4BRG A;  3JYT A;  3THX A;  2Q31 A;  2BTF A;  4I9Q A;  3VF6 A;  1HKB A;  2GUP A;  3T1A A;  3PV8 A;  1CZB A;  3HT3 A;  3SMP A;  4ZRI A;  3QEI A;  2B6A A;  1IBL K;  2NRV A;  2HHV A;  2E6M A;  3ATV A;  3TAB A;  4FZZ A;  4DFJ A;  4Z4F A;  4JI0 K;  1QSY A;  4BRE A;  2CB8 A;  2QEX N;  1K73 O;  4KHS A;  4KTZ A;  3K5N A;  4HUE A;  4M45 A;  4DR7 K;  3UE5 A;  4CEF A;  3ALY A;  3LP0 A;  2QWP A;  3T3F A;  1SL0 A;  3H45 C;  3AO1 A;  1RTD A;  1KSP A;  5MLC Q;  1TV6 A;  3LDS A;  1RT3 A;  2WH5 A;  4DTN A;  1E4F T;  5BR9 A;  4BWM A;  3OW2 M;  1EET A;  3KLG A;  3V9S A;  3LDO A;  3QO9 A;  1EXQ A;  3TTC A;  3AVB A;  5GAG P;  3MCA B;  3DXM B;  3I55 N;  3QIP A;  5CZ1 A;  4DR1 K;  5AQF A;  3HOS A;  3O9R A;  3OYJ A;  5J2N A;  1BUP A;  1U4B A;  3AO4 A;  3MED A;  1XHX A;  4I2Q A;  3ENB A;  2XY7 A;  5FRM A;  1YI2 N;  4HTL A;  1U2V A;  1ASV A;  2DTU A;  1GLC G;  2G8U A;  1SL1 A;  4HCB A;  4F2R A;  2VQE K;  4AHC A;  4FM2 A;  4KH5 A;  3CMA N;  4WF9 L;  3W3D A;  4EIA A;  1IKY A;  3P5J A;  2P1J A;  3VEO A;  4CGG A;  4AHR A;  2ZJP L;  4ELU A;  5AQZ A;  3UB5 A;  1NKC A;  1ACA A;  3SLC A;  4EAH D;  3WXI A;  4B3M K;  5M1Q A;  3OBW A;  4YHH K;  1HKG A;  4M63 C;  1A5V A;  1TYQ B;  2FC0 A;  2E88 A;  1I3A A;  3ZT0 A;  4CIF A;  2Q3S A;  3SUP A;  4H4O A;  4PWD A;  4HWI A;  3DWL A;  4ELV A;  1YVU A;  3ZX0 A;  3OY9 A;  1GOA A;  3OJU A;  1C0M A;  4B08 A;  5ADX A;  3QIO A;  3V81 A;  5BPN A;  4B9N A;  1HKC A;  1TKZ A;  3UKU A;  3PIO L;  3VTI A;  2NRZ A;  1Y64 A;  5CE3 A;  4DQS A;  2P9S B;  3BIN A;  4KAZ A;  1RT6 A;  4WQ5 A;  3SYZ A;  4H8K A;  5AQM A;  1LAW A;  2OA8 A;  1GLJ O;  5CY4 A;  1HLU A;  4LY7 A;  1M90 O;  3VA0 A;  4RTF D;  3H46 O;  3PIP L;  4JD2 A;  3G6E N;  1RTJ A;  5M1K A;  4JKG A;  3OS1 A;  4LFA K;  1SV5 A;  4YOW A;  3PX4 A;  3CJA A;  4BE1 A;  3SAH A;  1LWE A;  2ITG A;  2AP1 A;  3MEE A;  5CZ2 A;  1MU2 A;  3PZD A;  3E9L A;  2Z1J A;  2D0B A;  4E7J A;  4OGE A;  3ZT2 A;  3J81 O;  2Z1G A;  1QQO A;  5LL6 Z;  1ZBF A;  4OPA A;  1IH7 A;  2KLA A;  3C6A A;  3VTH A;  4BR2 A;  4DFP A;  3EYZ A;  3NH1 A;  1EX4 A;  1Q7Y O;  4CGF A;  1GC7 A;  4MFB A;  3D2F A;  4GKK K;  4ICL A;  1VQL N;  1EKE A;  2QA4 N;  2ZWH A;  1W2B M;  1RDU A;  1TK8 A;  4XEI A;  3ZSQ A;  3UKR A;  3CG7 A;  4W5Q A;  2OZS A;  4PY5 A;  5AQQ A;  1RTI A;  1JCE A;  4A5B A;  4HDO A;  3AA2 A;  4RWT A;  2ZGY A;  3C7N A;  4ISG A;  1J54 A;  1VQN N;  4B9Q A;  3KLH A;  3CF5 L;  2BH1 A;  1OH7 A;  4CK2 A;  2R7Y A;  1ZBL A;  3KLF A;  4FM1 A;  3TAE A;  4JRP A;  2FDQ A;  4CGH A;  1QVG M;  3VQ6 A;  2QWR A;  3CXC M;  4O0J A;  3G4S N;  3FE1 A;  3A5N C;  1N5Y A;  3O3F A;  3RMB A;  3AGR A;  1KRP A;  4NCA A;  2ZQB A;  1QTM A;  2RQ1 A;  1HPZ A;  4MLE A;  1BQM A;  5SZT A;  3QFP A;  2O8B B;  3O80 A;  4CEZ A;  3HO1 A;  4JK8 A;  3GL1 A;  3BP8 A;  1D5A A;  5AQK A;  2AL6 A;  2CGL A;  3AVF A;  2O4G A;  4H0X B;  2HHU A;  4NXM K;  5JS2 A;  4KTQ A;  1V4T A;  3VQ7 A;  5FDL A;  4K42 A;  3AVH A;  4Q5V A;  4Q0B A;  3LPT A;  4ZTF A;  2HB5 A;  2ZJQ L;  3EKS A;  1KFD A;  1HQE A;  2IVO A;  3HST B;  1R59 O;  3O4W A;  3VOV A;  4FLU A;  1Q81 O;  4FSV A;  3EL2 A;  1WB9 A;  3NH0 A;  3A8Y A;  1XI1 A;  1J53 A;  5EX5 A;  4BC2 A;  2A42 A;  3DMJ A;  3O3H A;  1YTU A;  2E8A A;  4DTM A;  2Q36 A;  1WUA A;  2A41 A;  2IAJ A;  5DM7 L;  4NYF A;  4AHV A;  2PY5 A;  2IC3 A;  3SJH A;  2I1K A;  4M7Y A;  1K8A O;  1F21 A;  1ZBH A;  4B1Z A;  3V1O A;  4EP5 A;  4CJU A;  5AQW A;  4JV5 K;  4FO0 A;  4CZH A;  2OPP A;  4O8K A;  5C42 A;  4IDK A;  4FLV A;  1S1W A;  1GLD G;  3CCQ N;  3QNN A;  4LH4 A;  1U04 A;  3AAR A;  1DLO A;  3SK3 A;  1QQM A;  3E1Y A;  3NMU A;  5A2Q O;  3VGM A;  4BRP A;  3DXK B;  1TK5 A;  4C8K A;  4DXA B;  1VQ4 N;  5T7B A;  3V4I A;  3CPE A;  4KHP K;  4JKF A;  3T1H K;  5BRD A;  1NI2 A;  3HP6 A;  1HMV A;  3AVJ A;  3DRR A;  2D0P A;  1Q8I A;  1NKB A;  2GEM A;  1JLF A;  3C0B A;  4DSE A;  4JYA K;  1DIK A;  1JLQ A;  3CJC A;  4FJI A;  3LWM A;  2FF3 B;  4B1Y B;  2P9L B;  4P7I A;  1B92 A;  1RBT A;  3QBX A;  4NCG A;  2FJ9 A;  4IO8 A;  3SNN A;  3O4Q A;  3P31 A;  3ZX2 A;  2A1R A;  3MK6 A;  2Q0R A;  3JS6 A;  4DU3 A;  3LL3 A;  4DSF A;  4CF2 A;  4FJ7 A;  1KCF A;  4RW7 A;  3CME N;  1O13 A;  3D0P A;  3E9P A;  1VK0 A;  2XHB A;  1WSH A;  1Q82 O;  3CER A;  2WTU A;  2BE2 A;  4FWP A;  3I56 N;  2O8C B;  1FK9 A;  3DRP A;  4HHT A;  1NK8 A;  2PAV A;  3ASM A;  4JKE A;  4KH6 A;  4IO9 L;  3J7Z O;  5KPZ A;  1SUQ A;  3WNG A;  1WAJ A;  1JL1 A;  4GW6 A;  4ZTJ A;  4YL8 A;  3CD6 N;  4FLW A;  1HJR A;  1WSJ A;  3FFK B;  4DCH A;  3EE9 A;  3OS0 A;  3GBT A;  4JI6 K;  1GLL O;  1TKX A;  2NZT A;  3MEG A;  3ULD A;  4JK7 A;  3QLH A;  3Q7B A;  4QS7 A;  4IKF A;  3C65 A;  1T8E A;  4IDH A;  4CEC A;  3AVC A;  1NJW A;  4CJP A;  4CJ7 A;  1J19 A;  3AV9 A;  4QAG A;  4FL9 A;  2YHW A;  2D11 A;  5JMV A;  1MWM A;  5JLH A;  3L3U A;  3MXM A;  4FWK A;  4H5W A;  3DLG A;  3SAG A;  3FZF A;  2FXU A;  2O8D B;  3EPY A;  4IJA A;  3DLE A;  4O8U A;  3ZT1 A;  3SUQ A;  1TKD A;  2P9S A;  3WXJ A;  1L3U A;  1QS4 A;  5DMR A;  1S1X A;  4IG3 A;  4A5A A;  1VBH A;  4OVL A;  2Q97 A;  4CK3 A;  4YOX A;  1HX1 A;  3UIQ A;  2HE7 A;  5M1P A;  2ZE2 A;  4ID1 A;  1P8Z A;  1EWQ A;  5E26 A;  2D1K A;  2RE2 A;  2W40 A;  3L2U A;  1SKR A;  1YJ9 N;  4B3S K;  2HHW A;  1IG9 A;  3A2F A;  2BDP A;  1NK0 A;  1NK4 A;  1FW6 A;  3FZK A;  5AQN A;  2I1J A;  2IDO A;  4C23 A;  2UXC K;  4F9O A;  4CZG A;  4GXB A;  4DHY A;  1ITG A;  4CJK A;  5M1N A;  3DLL L;  1C0T A;  2ZM6 K;  4DLE A;  2Q2R A;  3P4I A;  3PX0 A;  3VEW A;  1JJ2 M;  1KAX A;  4U7B A;  3OJS A;  1NGJ A;  2J0K A;  4DUZ K;  4FVU A;  1KD1 O;  4CBU A;  2XY6 A;  2YI1 A;  1O1W A;  2P5G A;  1VSH A;  4CJ5 A;  2WFB A;  1K6Y A;  3KK1 A;  1J5O A;  3O1B A;  1N32 K;  2DFF A;  1REV A;  3BEX A;  5GIP A;  3V1R A;  4YFU A;  1VQ5 N;  3I8D A;  4H0T B;  4CIE A;  2HBL A;  3LDL A;  4M3X A;  1TL1 A;  2QWO A;  2GUI A;  1IKW A;  3IAY A;  3H08 A;  1C6V A;  2D5R A;  3DI6 A;  4B3T K;  4IZ9 A;  1BOT O;  3ULE B;  3VQD A;  4NXN K;  3UKU B;  3L2V A;  4JLH A;  4MO5 A;  1LAV A;  3SMS A;  4CZL A;  3FLV A;  2ZD1 A;  4DQ8 A;  3CCL N;  1TAU A;  2YNI A;  2YV0 X;  5I42 A;  1NGG A;  4WQ4 C;  3F5T A;  2ASO A;  4CJR A;  5KPT A;  5KQD A;  3LAM A;  2G8K A;  3RMA A;  2AEH A;  3I0S A;  1YIT N;  3QIC A;  1YIJ N;  2W42 A;  3RMC A;  3EKU A;  4B9S A;  4E7I A;  3M8R A;  4PKI A;  1VAZ A;  2VGM A;  4DFK A;  1L3S A;  3IS9 A;  5KRT A;  5FRN A;  3OYE A;  4BC3 A;  4GKJ K;  1DKG D;  5C2F A;  3A0I X;  5AQV A;  5DK5 A;  4E89 A;  3NDK A;  4YOY A;  4LFB K;  3EY1 A;  2RPI A;  1SKS A;  4Z94 A;  3EEQ A;  4X64 K;  4FJL A;  4H0V B;  4M41 A;  1ISN A;  4TSX A;  3CQ8 A;  4EZ9 A;  4BGA A;  3VGK A;  4KO0 A;  3IRX A;  3C6U A;  4J2A A;  3FP5 A;  4YNQ A;  4FJK A;  1CZA N;  4DR4 K;  3CET A;  3LDQ A;  1NK9 A;  2X0S A;  3CCJ N;  1BI4 A;  1UAX A;  3WQU A;  4EZ6 A;  1N36 K;  3VEN A;  1NM1 A;  5C24 A;  5FPN A;  3VET A;  3AVK A;  3D2E B;  4IOX A;  2FBX A;  5I9E B;  2GWK A;  1IBM K;  4JK9 A;  1IBK K;  4BG9 A;  4W5R A;  4TKN A;  3CHW A;  3F2K A;  2I7P A;  2E1Z A;  4B3O A;  3VQ8 A;  2X6S A;  4AIL C;  4PQU A;  4WFA L;  3TTF A;  4M7X A;  3MXI A;  2F9W A;  4K41 A;  4ZRJ A;  1VSE A;  3RSE A;  3KD1 E;  3OVN A;  3CIP A;  2YJE A;  1BDG A;  4GNI A;  3ZSY A;  4CZM A;  1NBW A;  1VQ7 N;  4IWV A;  5EOY A;  4FW2 A;  4LF7 K;  4HDQ A;  2PBD A;  1HYV A;  3I33 A;  2VWJ A;  2HVI A;  4BRK A;  2PZS A;  3GG4 A;  1D9D A;  4C8L A;  4Z4E A;  3HTV A;  1MK9 B;  4UQG A;  1BIS A;  3V9W A;  5C0Y A;  3FZL A;  2F8T A;  4I9L A;  5AR0 A;  4JS4 A;  5GAH P;  1X9J A;  4FLX A;  4I7F A;  1NWK A;  3ID6 A;  3QIJ A;  5E41 A;  1KAZ A;  2G8I A;  4CJL A;  1OH6 A;  4B9M A;  1T3V A;  4CHY A;  1VSL A;  1TGO A;  1WAF A;  3MWP A;  4BRF A;  1HYS A;  2VG6 A;  4FOI A;  2E2Q A;  5GAD P;  2QWQ A;  1JCG A;  4PL7 A;  4E7K A;  3P39 A;  1KVA A;  1HPM A;  2P9L A;  3NF9 A;  2B5J A;  4CJE A;  2FBV A;  2UUA K;  2KZZ A;  2HND A;  4DTJ A;  4J2B A;  4DG1 A;  4QS9 A;  4AH9 A;  4KTW A;  1QSL A;  1NJI O;  3FGU A;  4BRQ A;  2H3G X;  3S3M A;  1HR0 K;  2ZF5 O;  3J7A P;  1TL3 A;  3HL8 A;  4B8C A;  1VHX A;  1W7A A;  3FFI A;  4C8M A;  5AQS A;  5B8H A;  4BDZ A;  2E2P A;  4GVE A;  1X9M A;  2O8C A;  1Y19 B;  5C2D A;  1VBG A;  3G25 A;  3TAN A;  3M1F A;  4BVO A;  3CJ7 A;  1C1C A;  3MN6 A;  1OKJ A;  2FLO A;  3O8M A;  4JKH A;  2Y1J A;  1RNH A;  4LF5 K;  3J80 O;  2QW9 A;  2NRX A;  2P9U A;  4BRH A;  5KRS A;  4CER A;  4IOA L;  1BGX T;  1ZBU A;  4JKD A;  4JEP A;  1C1A A;  3K2P A;  4CE9 A;  4BQL A;  1S1T A;  3OTO K;  4M3U A;  3CCU N;  4WQ4 A;  1S22 A;  3NF6 A;  4O4G A;  4JKA A;  3KJV A;  3SPZ A;  4H03 B;  3G9W A;  1VSF A;  3SAF A;  3SJJ A;  4RW9 A;  4LD0 A;  1NGH A;  3AO2 A;  1XNQ K;  1JLC A;  5M1F A;  2BGG A;  4E1M A;  3EZW A;  2OZM A;  2A6A A;  1CXU A;  5J2P A;  2W41 A;  2UXD K;  3HM8 A;  3D2F B;  4Y1C A;  1V4S A;  4BRD A;  3RRH A;  4FJM A;  4CBX A;  3HVR A;  5F1X A;  4FWR A;  3WQT A;  4IBN A;  4EKU A;  3SUN A;  1NK7 A;  1VQM N;  2HMI A;  3MX2 A;  3L4Q A;  2ZGZ A;  3C7N B;  4JI1 K;  5LMU K;  1NMD A;  5FPM A;  4DR6 K;  3P1G A;  3VEZ A;  4W5N A;  4RW6 A;  4G9Z A;  4H5V A;  4CJ3 A;  5DM6 L;  3FZM A;  5JVG L;  2QXF A;  4IOC L;  2E2O A;  3SV4 A;  4DMN A;  1WSE A;  1KC8 O;  4ILH A;  2DPN A;  3KHY A;  2AA4 A;  4WE1 A;  3Q7C A;  1N6Q A;  1NGE A;  4AHU A;  2YNG A;  4KV8 A;  3QER A;  1ATS A;  2O8B A;  3TSP A;  1TUY A;  3V6D A;  2QKK A;  4C1N I;  1WN7 A;  4NY0 A;  2GBZ A;  4MO4 A;  3VGL A;  3A5O C;  3EO3 A;  2ZPY A;  4HUG A;  3KTQ A;  5I3U A;  1YT3 A;  2YX6 A;  4MDA A;  5J2M A;  5AQO A;  4W5T A;  4OO1 J;  3DLB A;  1ZBS A;  3M8P A;  1H4R A;  4KHY A;  4HTU A;  4PHT X;  1TKT A;  3SZ2 A;  2RF2 A;  4DV7 K;  4FZY A;  2HBK A;  3KLI A;  4XH4 A;  4IG0 A;  4DV4 K;  3TU5 A;  3LAL A;  1YJN N;  4CJF A;  4YOU A;  1G99 A;  4X62 K;  4PL8 A;  2ATQ A;  4ELT A;  4OLA A;  3OYA A;  1A5W A;  5EVZ A;  4A2B A;  1EQY A;  2COP A;  4CCH A;  2DFE A;  4WFB L;  3ZT3 A;  1YF5 L;  5FLX O;  4BG8 A;  3CCV N;  4CZE A;  1RT1 A;  1VRU A;  3BF1 A;  3CI5 A;  2KKZ A;  5AZJ B;  4AQY K;  4FJ8 A;  2D2Q A;  4FK4 A;  4CHP A;  2YKN A;  2IGI A;  4PKH A;  4DR2 K;  1M1K O;  5HP1 A;  4CGI A;  4BWJ A;  3CCM N;  4K8X A;  2J0M A;  3BZC A;  3OHR A;  3AGK A;  1X3M A;  4DV3 K;  3A5L C;  5HRP A;  4CI6 A;  4GVM A;  4B1W B;  4ZHR A;  1JXE A;  5HRR A;  3OYG A;  4JKC A;  4YOT A;  4LH5 A;  4B3R K;  1UA0 A;  1BI4 B;  2EMS A;  1ESV A;  3R1X A;  3M8S A;  4ISE A;  4Z4C A;  4DTU A;  4FM0 A;  4DB3 A;  5CHI A;  1HYZ A;  4DR5 K;  4O5B A;  3M6G A;  2UU9 K;  3E66 A;  3MWT A;  3R6M A;  1KBL A;  1RT4 A;  3ULE A;  2QK9 A;  3TAR A;  3MMV A;  1K9M O;  3RTV A;  3M5R A;  3O9T A;  2IVP A;  4CHO A;  2PFU A;  4DV5 K;  4H5T A;  5KI6 A;  1RDW X;  3HP9 A;  5HOO A;  3RWU A;  5EY4 A;  4XH5 A;  3TTD A;  3U3Y A;  2P9P A;  4GMJ B;  1YUW A;  1RBV A;  2QWL A;  4IFE A;  1R0A A;  4BR4 A;  5KTQ A;  4DLG A;  4IEI A;  4OPK A;  3DOL A;  3SCX A;  2V7Z A;  1BCM A;  3P38 A;  3MAQ A;  2O8E B;  1L3T A;  4O55 A;  3IKM A;  1SGH A;  1DTT A;  1VSD A;  3MN5 A;  2P9I A;  4BRN A;  4FWQ A;  1DTQ A;  3DLK A;  4DFM A;  4I6M A;  3OYM A;  4EFH A;  2XO7 A;  4BR7 A;  2KTQ A;  3OYI A;  1P90 A;  3V9Z A;  1S6P A;  4DSK A;  3QML A;  3T69 A;  1GG3 A;  2QXL A;  2X74 A;  3ID8 A;  3G0Z A;  3G10 A;  1VSK A;  3ZSR A;  4PKG A;  4FJJ A; 
#chains in the Genus database with same CATH homology
 1NGB A;  4IZ9 A;  1BOT O;  3ULE B;  4A57 A;  1BWF O;  3UKU B;  3NVM A;  4R79 A;  4BRO A;  3I55 N;  2NLX A;  4MO5 A;  3SMS A;  4GY2 B;  4BC4 A;  4CZL A;  1E5W A;  3FLV A;  5AQF A;  3HOS A;  3O9R A;  4FWL A;  4B1U B;  4DQ8 A;  3CCL N;  1BUP A;  1NGG A;  4WQ4 C;  4BC5 A;  3F5T A;  4WQ5 C;  3SBG A;  2ASO A;  5KPT A;  1BU6 O;  5KQD A;  1QZ5 A;  3ENB A;  2AEH A;  4HTL A;  1U2V A;  1ZXO A;  1YI2 N;  1VQO N;  4RCH A;  1GLC G;  1NGA A;  1MDU B;  2YHX A;  3IVF A;  1YIT N;  1T44 A;  3QIC A;  1YXQ A;  1YIJ N;  5ADX H;  3K9K A;  3QBW A;  3EKU A;  2NRH A;  4KH5 A;  1IG8 A;  3CMA N;  2GEL A;  3U8X A;  4GV9 A;  4PKI A;  1VAZ A;  4WF9 L;  2VGM A;  3W3D A;  4DKW A;  4EIA A;  3VEO A;  3A5M C;  3F9M A;  1XQS C;  4BC3 A;  2FF6 A;  1DKG D;  5C2F A;  3A0I X;  4CYE A;  2FSN A;  4FWS A;  5AQV A;  4CBW A;  1TUU A;  2ZJP L;  5AQZ A;  3UB5 A;  4YOY A;  4YOV A;  3AU4 A;  4ILG B;  4C1N K;  1ACA A;  3SLC A;  4EAH D;  3WXI A;  3AAP A;  5M1Q A;  5M1O A;  4EHU A;  3OBW A;  4Z94 A;  3HRG A;  5C10 A;  1MIZ B;  3CC7 N;  4H0V B;  1HKG A;  4Y0W A;  1ISN A;  1TYQ B;  4M63 C;  2E88 A;  4BRC A;  1GC6 A;  4BGA A;  3VGK A;  5AQY A;  3FP5 A;  4HWI A;  2RHK A;  5JVH L;  1CZA N;  3E9O A;  3DWL A;  2Q0U A;  3LM2 A;  2HBJ A;  3ZX0 A;  3CET A;  3LDQ A;  1K8K B;  2X0S A;  3CCJ N;  3WQU A;  2NNW A;  3U4L A;  2V7Y A;  5ADX A;  3VEN A;  1NM1 A;  3HOT A;  1ATR A;  5FPN A;  3VET A;  3MCP A;  5BPN A;  1HKC A;  2V51 B;  3D2E B;  3ZEU A;  4B1V A;  1NGC A;  3UKU A;  4IOX A;  1NGD A;  3S41 A;  3VTI A;  3PIO L;  3MN7 A;  5TKW A;  2GWK A;  5I9E B;  3CCS N;  3KK7 A;  4JK9 A;  2KHO A;  2F9T A;  2NRZ A;  4BG9 A;  4TKN A;  2CGJ A;  3CHW A;  2D4W A;  3F2K A;  1Y64 A;  2J4R A;  2I7P A;  3K9J A;  2E1Z A;  5CE3 A;  4GV3 A;  2P9S B;  3BIN A;  1NGI A;  4WFA L;  5AQG A;  3WXK A;  4H5R A;  3TTF A;  1S3X A;  4M7X A;  4WQ5 A;  1Z6R A;  2F9W A;  4K41 A;  3VER A;  4ZRJ A;  5AQM A;  5LY3 A;  3RSE A;  4CZM A;  3CIP A;  1GLJ O;  1BDG A;  2F7T A;  1HLU A;  2YJE A;  1NBW A;  3CJB A;  4GNI A;  1VQ7 N;  4IWV A;  5EOY A;  3WXL A;  1KAY A;  1M90 O;  4HDQ A;  4KBO A;  4RTF D;  3VEV A;  5FPD A;  4BR5 A;  2PBD A;  3H46 O;  5BN9 A;  4JD2 A;  3I33 A;  3CQY A;  3R8E A;  3WXM B;  3WA0 A;  5M1K A;  1ST7 A;  3PIP L;  3G6E N;  4JKG A;  4BRK A;  4A62 A;  3FZH A;  1GLA G;  4CZJ A;  3EN9 A;  1VQ4 N;  5LJV A;  3GG4 A;  4YOW A;  1VQ8 N;  3HTV A;  5AZI B;  5F2R A;  3CJA A;  1MK9 B;  3QDK A;  3O6W A;  3KZB A;  4AM6 A;  3SAH A;  1T6D A;  3H3N O;  2QWN A;  4H0P A;  3FZL A;  2AP1 A;  2GX9 A;  3O9Q A;  5C12 A;  5C0Y A;  1LCU A;  5AR0 A;  5GAH P;  1X9J A;  5FPE A;  1NWK A;  3ID6 A;  3PZD A;  3QIJ A;  2A40 A;  4FWN A;  1HB8 A;  3DXK A;  4A61 A;  3E9L A;  1KAZ A;  4QS8 A;  5GIN A;  1T3V A;  2ABD A;  3U8Z A;  5H1S Q;  1ZC6 A;  3TPQ A;  4BY9 C;  2FSJ A;  3MWP A;  1QQO A;  4FOE A;  1J6Z A;  4BRF A;  4OPA A;  4FOI A;  2E2Q A;  2P9I B;  3GDQ A;  2KLA A;  3C6A A;  4L3Q A;  3VTH A;  5LJW A;  5GAD P;  2QWQ A;  4IEE A;  4BR2 A;  1JCG A;  4PL7 A;  3CJ1 A;  5C15 A;  3CJ9 A;  1Q7Y O;  1RGI A;  3H3O B;  3P39 A;  5HL7 L;  4WFN L;  1HPM A;  2P9L A;  3WEE A;  3X23 A;  2E2N A;  1GC7 A;  3D2E A;  3ZEU B;  3D2F A;  5TKY A;  2FSK A;  1VQ6 N;  3ZYY X;  3HI0 A;  1VQL N;  2HF4 A;  1YAG A;  4QS9 A;  2QA4 N;  4YOR A;  2ZWH A;  2VYP A;  4NB4 A;  3CC4 N;  4B1X B;  1W2B M;  1RDU A;  4JAX A;  1NJI O;  2YJF A;  3FGU A;  4XEI A;  2H3G X;  3ZET B;  3UKR A;  4BRQ A;  2ZF5 O;  3DXM A;  3D7E O;  5JIC A;  3RSE B;  1MK7 B;  5AQQ A;  3IUC A;  3VEY A;  1JDE A;  2IIR A;  1JCE A;  4YDU A;  5BN8 A;  4WCE L;  4A5B A;  4HDO A;  2GTD A;  4RWT A;  2ZGY A;  3C7N A;  4IXC A;  1YHQ N;  3CQX A;  4ISG A;  5AQS A;  1GGO A;  3VF2 A;  4B9Q A;  5B8H A;  1VQN N;  3H1V X;  2E2P A;  4GVE A;  3WT0 A;  1YVN A;  1Y19 B;  2BH1 A;  2CH5 A;  5C2D A;  3CF5 L;  4WYB A;  1VBG A;  1HJO A;  3G25 A;  5AZJ A;  3M1F A;  3ZX3 A;  4BVO A;  3CJ7 A;  3FR0 A;  2FDQ A;  3MN6 A;  4GV6 A;  1QVG M;  1OKJ A;  2FLO A;  1NGF A;  3O8M A;  4JKH A;  4BRL A;  2P9N A;  2A5X A;  2QWR A;  3CXC M;  1LOT B;  1W97 L;  3G4S N;  3FE1 A;  2QI2 A;  3A5N C;  3OA9 A;  5BRF A;  2QW9 A;  2NRX A;  2P9U A;  4BRH A;  1C0F A;  3G71 N;  3AGR A;  4MLH A;  4IOA L;  3AU5 A;  2RQ1 A;  4MLE A;  4JKD A;  4JEP A;  4BQL A;  3QFP A;  4CZK A;  3O80 A;  3LDP A;  2HST A;  2HBM A;  3CCU N;  4WQ4 A;  1S22 A;  4JK8 A;  3GL1 A;  3BP8 A;  5EXW A;  3MDQ A;  5BPL A;  4A2A A;  3NVK A;  4JKA A;  3IDH A;  5AQK A;  3U9D A;  2AL6 A;  2CGL A;  4F7G A;  4H03 B;  3G9W A;  4H0X B;  3SAF A;  3SBT A;  1NGH A;  4K25 A;  1QZ6 A;  5M1F A;  3EZW A;  3IFR A;  2A6A A;  3ATU A;  2OTL N;  1GLF O;  1V4T A;  2W41 A;  2OAN A;  3HM8 A;  3D2F B;  4K42 A;  1V4S A;  4BRD A;  1SZ2 A;  1Z05 A;  4CBX A;  2DIK A;  4NLC A;  5F1X A;  2IVN A;  3O1W A;  2ZJQ L;  1VQK N;  3EKS A;  3FLC O;  1YJW N;  3B8A X;  1HB6 A;  1XC3 A;  2BUP A;  4FWR A;  3WQT A;  1MIX A;  2IVO A;  3PVL A;  1R59 O;  4H0Y B;  2JWL A;  2VCP A;  3O4W A;  4EKU A;  3VOV A;  4A59 A;  1Q81 O;  3CC2 N;  2NRT A;  2NRW A;  2HRJ A;  4FSV A;  3EL2 A;  1VQM N;  1BA1 A;  3MX2 A;  3L4Q A;  2ZGZ A;  3C7N B;  3A8Y A;  1SAZ A;  5AQT A;  3W0L A;  1NMD A;  1HUX A;  5EX5 A;  5FPM A;  4BC2 A;  3EE8 A;  1BO5 O;  1QQN A;  2A42 A;  2D0O A;  3L6Q A;  2ITM A;  3ENO A;  4FPA A;  2E8A A;  3VEZ A;  2YVC A;  2CGK A;  3KWI A;  4G9Z A;  2Q36 A;  1WUA A;  2A41 A;  4AM7 A;  4H5V A;  2EWS A;  1EO1 A;  3L0Q A;  2P9N B;  3IMX A;  5DM6 L;  5DM7 L;  4BR0 A;  2E1Y A;  3DJC A;  5BRH A;  3FZM A;  5JVG L;  3O08 A;  4IOC L;  2E2O A;  3SJH A;  2I1K A;  4M7Y A;  3LM9 A;  4JD2 B;  4JHD B;  3TSU A;  1K8A O;  4B1Z A;  1KC8 O;  4ILH A;  4JKG B;  2Q1N A;  2DPN A;  3I8B A;  3KHY A;  5AQW A;  1DGK N;  2AA4 A;  5ELZ A;  4FO0 A;  4CZH A;  3Q7C A;  5AZI A;  2D10 A;  4O8K A;  1NGE A;  4MDB A;  1GLD G;  3CCQ N;  1ATS A;  3AAR A;  1RFQ A;  3TSP A;  2LBB A;  5GIO A;  2OTJ N;  3ENH A;  3SK3 A;  1QQM A;  1TUY A;  3E1Y A;  3NMU A;  4C1N I;  1XUP O;  3CCE N;  3VGM A;  1Q86 O;  4BRP A;  3DXK B;  4NY0 A;  4MO4 A;  4DXA B;  1C0G A;  4BQZ A;  3BF3 A;  3VGL A;  1VQ9 N;  2HF3 A;  1GLE G;  2WC9 A;  3A5O C;  3CPE A;  2ZPY A;  3EO3 A;  4JKF A;  4I6M B;  5BRD A;  1NI2 A;  1NTI A;  2CH6 A;  2YX6 A;  4MDA A;  1KC7 A;  3J8A A;  5AQO A;  4OO1 J;  2D0P A;  1ZBS A;  1H4R A;  4CD1 A;  1N8R O;  2GEM A;  2WBN A;  3VEX A;  5AQX A;  5JVL A;  3GE1 A;  3C0B A;  3AY9 A;  4PHT X;  1DIK A;  1SS6 A;  3CJC A;  2YHY A;  2FF3 B;  4B1Y B;  4BRA A;  4EHT A;  2HBK A;  1U6Z A;  2P9L B;  3WEE B;  4CD3 A;  4XH4 A;  4P7I A;  3DAW A;  3TU5 A;  3O9U A;  1YJN N;  3QBX A;  4ISF A;  2FJ9 A;  4IO8 A;  4AF1 A;  4YOU A;  3HSC A;  1G99 A;  5IJM A;  3P31 A;  4O5F A;  4PL8 A;  3ZX2 A;  5GAG P;  3MK6 A;  5E84 A;  5JLF A;  2Q0R A;  3JS6 A;  3ZET A;  5EVZ A;  4A2B A;  3O9S A;  3LL3 A;  1EQY A;  3L4I A;  1H1V A;  1MA9 B;  4NLB A;  2COP A;  1U2V B;  3CME N;  3CPW M;  4FWO A;  4WFB L;  1O13 A;  5AQJ A;  1EF1 A;  1YF5 L;  4BG8 A;  3E9P A;  1HBK A;  3O5B A;  3CCV N;  3VPZ A;  2R82 A;  1SQK A;  5AQP A;  4J8F A;  4CZE A;  1Q82 O;  3CER A;  4FWP A;  3I56 N;  3TSQ A;  4E1J A;  3BF1 A;  3CI5 A;  2KKZ A;  2PAV A;  4KH6 A;  4JKE A;  1NLV A;  5AZJ B;  4IO9 L;  4JKB A;  4ZRK A;  3J7Z O;  5KPZ A;  4BRM A;  2D2Q A;  1E4G T;  4FPB A;  2QWM A;  4UY8 O;  2P9K A;  3R3L A;  2E20 A;  2P9P B;  3QFU A;  3R9P A;  4XH1 A;  4PKH A;  4YL8 A;  1M1K O;  3CD6 N;  5AFU A;  3FFK B;  4DCH A;  3EE9 A;  4BGB A;  3GBT A;  3CCM N;  3OBY A;  4JN4 A;  2P9U B;  3H6E A;  3HZ6 A;  1GLL O;  2J0M A;  2JWK A;  2NZT A;  3LDN A;  3OHR A;  2ZJR L;  3CCR N;  3AGK A;  4BRI A;  1X3M A;  3VMF B;  1TYQ A;  4YDU C;  4JK7 A;  2V52 B;  3A5L C;  3Q7B A;  4H0O A;  1KXP A;  2I7N A;  4QS7 A;  1DT9 A;  4CZI A;  1GLB G;  4CI6 A;  2HOE A;  3C65 A;  4NO7 A;  3WUH A;  3ZDT A;  1Q18 A;  4IDH A;  4BR9 A;  1ILY A;  2YCH A;  4B1W B;  3AAQ A;  4CJ7 A;  1J19 A;  4BVP A;  4H5N A;  4JKC A;  3C6H A;  4FL9 A;  4YOT A;  2YHW A;  5AQI A;  5GAE P;  2D11 A;  1K8K A;  5JMV A;  1MWM A;  2EMS A;  5JLH A;  3JXU A;  2QTD A;  2VGN A;  1ESV A;  3R1X A;  4K43 A;  5KQ8 A;  4CZF A;  4FWK A;  4H5W A;  4ISE A;  5AFU H;  5AQR A;  4KH4 A;  4DB3 A;  3SAG A;  3FZF A;  5CHI A;  2FXU A;  4LC9 B;  2CQU A;  3EPY A;  3N4P A;  4IJA A;  4O8U A;  1KQS M;  1QVF M;  3M6G A;  3HBT A;  1IJJ A;  1QHA A;  3VES A;  2EMT A;  3PLA A;  3E66 A;  3MWT A;  2P9S A;  3WXJ A;  5CR4 A;  3KVG A;  3R6M A;  1KBL A;  3ULE A;  5KPR A;  3H1Q A;  3MMV A;  1K9M O;  3M5R A;  4JNE A;  1NVL A;  4A5A A;  1VBH A;  3O9T A;  2IVP A;  5AQL A;  2Q97 A;  2NRR A;  1ATN A;  2PFU A;  5AQU A;  4YOX A;  1HX1 A;  3T7Z A;  4H5T A;  2HE7 A;  5M1P A;  1MWK A;  5F0X A;  1RDW X;  3KWG A;  2A3Z A;  3MX5 A;  4IJN A;  2ASP A;  1P8Z A;  2VWB A;  5BRE A;  5HOO A;  1JCF A;  2WUS A;  5E26 A;  2D1K A;  2RE2 A;  2W40 A;  3MN9 A;  4XH5 A;  1BG3 A;  2HMP A;  5EY4 A;  3TTD A;  1YJ9 N;  3GOI A;  3M3Z A;  5AQH A;  4BRG A;  2P9K B;  2Q31 A;  1OVY A;  2GWJ A;  2P9P A;  2BTF A;  3FZK A;  5AQN A;  2I1J A;  1YUW A;  2QWL A;  4IFE A;  4C23 A;  4F9O A;  4JHD A;  4BR4 A;  4GXB A;  4CZG A;  4DHY A;  4IEI A;  3RVC A;  3VF6 A;  1HKB A;  2GUP A;  3BUZ B;  3SMP A;  4ZRI A;  5M1N A;  3DLL L;  4FWM A;  2NRV A;  2Q2R A;  3P4I A;  1WOQ A;  3VEW A;  3ATV A;  1JJ2 M;  4OPH A;  2V7Z A;  3D6R A;  1KAX A;  3P38 A;  3QB0 A;  4U7B A;  1NGJ A;  4BRE A;  2J0K A;  2CB8 A;  5BPM A;  3IKM A;  4FVU A;  1SGH A;  3N4Q A;  3U7D A;  1K73 O;  1KD1 O;  3MN5 A;  4CBU A;  2QEX N;  2P9I A;  2YI1 A;  2QM1 A;  2UYT A;  4BRN A;  4FWQ A;  4ILJ A;  1S72 N;  3UE5 A;  2WFB A;  1D4X A;  4I6M A;  2QWP A;  4U67 L;  1BA0 A;  3H45 C;  3U9Z A;  4EFH A;  3O1B A;  4BR7 A;  5MLC Q;  1P90 A;  1DEJ A;  3BEX A;  1VQP N;  2WH5 A;  1X3N A;  3QML A;  5GIP A;  1VQ5 N;  3T69 A;  1GG3 A;  2ASM A;  2QXL A;  1E4F T;  5BR9 A;  2J0J A;  3ID8 A;  1T6C A;  4H0T B;  3VF4 A;  3OW2 M;  2HBL A;  3LDL A;  3LDO A;  2QWO A;  3TTC A;  3UKR B;  4PKG A;  3MCA B;  3DXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...