4JKGA

Open and closed forms of mixed t1789p+r1865a and r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
219
Chain Sequence
LFSQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 219
sequence length 220
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkgA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkgA01
4ILGB 4ILJA 3E66A 4ILHA 4JKCA 3E9PA 3ENBA 4JKEA 4JKFA 4JKHA 4JK8A 3SBGA 4JKGA 4JK9A 4JKBA 3SBTA 3E9OA 4JK7A 4JKAA 3E9LA 4JKDA 4JKGB
chains in the Genus database with same CATH superfamily
1D5AA 4IG3A 4FWOA 3SUQA 2QWMA 2D2QA 5GAEP 1HNVA 3OBWA 2IOCA 5ELZA 2FF3B 4MLHA 3G71N 1XQSC 2Y1IA 1GLCG 2VYPA 3VQ9A 3SPZA 1S9EA 1YVUA 3AVCA 3QFUA 4WE1A 1HPZA 2NRTA 5AQHA 4E7JA 4BROA 1IBMK 2OYQA 1Z05A 3CHWA 2E1YA 2GELA 3GOIA 3O3HA 1RT6A 3ENOA 3K5LA 4JD2A 2YNFA 4QAGA 3OBYA 1LAWA 3TAFA 2CH5A 4YOTA 2EWSA 4BVOA 3CJAA 1ZC6A 1MU2A 1REVA 1X9JA 3SPYA 5JS2A 2OPPA 3OYLA 2PFUA 4DLEA 1ZYQA 5FRMA 4H5TA 3THYB 3VA0A 3CC2N 1SL0A 1WAFA 4AILC 1HLUA 4FOIA 3VTHA 1NK9A 3SBGA 1EKEA 3KWIA 3OJSA 2QWPA 4JK9A 3RWUA 1WSFA 4ZRJA 2O4GA 4JN4A 2P9SA 1X3NA 4CESA 2HHTA 2V51B 3MX2A 4DQPA 4J8FA 1ATNA 3SUPA 4JHDA 2A41A 2NZTA 3TSQA 3O4QA 4AHCA 4C1NI 4IDHA 4KH5A 1RDDA 4PL8A 4KI4A 2P51A 4CJ5A 3OYIA 4JI0K 3EZ5A 3DOLA 4JEPA 1G99A 3JS6A 3QNNA 1NJWA 1S6QA 4MQ3A 4NB4A 3L4QA 4CI6A 2Q1NA 3RRHA 3NH2A 4K0KK 2B5JA 1BA1A 4CJKA 3WT0A 2KW4A 4IWVA 3HPHA 3ZSRA 4CFCA 2B4JA 4CE9A 4CK2A 2G8FA 4U67L 1ZXOA 4WCEL 1WNSA 2ZPYA 1VSFA 3R9PA 4IFVA 5JVLA 4DB3A 1QQNA 1NU0A 1KAXA 3DRRA 4C8KA 2O8CA 4FJGA 2J4RA 4JKGA 1YF5L 4OPHA 1SL1A 4AHSA 5BPNA 3C6AA 2CH6A 3TU5A 3VEYA 2PAVA 3VEOA 1JLCA 3VQQA 4DTRA 5AQSA 4JI7K 1CLQA 3TAPA 3QEPA 3VERA 4FJMA 1SKWA 2VG7A 1C0FA 5AZJB 4FWNA 4M3RA 3E9PA 1U6ZA 4C1NK 1QQOA 3ZSXA 3L2RA 4FJ9A 1RT2A 3TAMA 1IKYA 5CY4A 3LWLA 4CHYA 3LP2A 3O8MA 1XNQK 1B9FA 2PYLA 1VSKA 1EF1A 3NH0A 1QSYA 3QICA 4MO5A 4B3MK 4FWRA 4FJIA 3E66A 1NG9A 2CGLA 4RW7A 4CEAA 4I9QA 3TTFA 1NOYA 1TKTA 1BISA 3O4WA 2G8VA 4KHYA 3LWMA 3SMSA 3AO4A 3CYMA 4DR6K 3KVGA 4BR2A 2P9NA 2O8EA 4KHQA 3DI6A 4BRPA 4OGCA 4LF4K 3O4NA 1TL3A 4JD2B 4ILJA 1BL3A 3CM5A 4BQLA 4PWDA 3P1GA 1TAQA 4C8NA 2BH1A 2J0MA 5AQJA 3HT3A 1VRTA 3OTOK 2AA4A 4CJ7A 1ILYA 2GX9A 2QWNA 3AAPA 5KQ8A 1VBGA 2I1JA 3D7EO 4R79A 4J2AA 5AFUA 4M3UA 1RDWX 4CZFA 3TPQA 1XHZA 2ASMA 5IT9O 4CHQA 2KZMA 1QVGM 1S1WA 2P9SB 3P31A 4H0YB 4NLCA 1HJOA 4IG0A 1KQSM 1RTHA 1TV6A 4ISEA 4B1ZA 1J53A 3PSIA 1I3AA 5CZ2A 4BRHA 3C95A 2D0CA 3JSMA 1VQ5N 2GBZA 4CGGA 1VSMA 1S1UA 1RGIA 3OVNA 5AQQA 4BWMA 1L3TA 1KRPA 1GOCA 2UUAK 3MN7A 1N33K 3SI6A 3MAQA 4FSVA 4DTNA 3DYAA 4LF8K 1LWFA 5EVZA 2RKIA 3OYBA 1LCUA 3AU5A 2P9PB 1N8RO 3KK7A 4PL7A 3TAEA 1GC7A 2P9UA 4IJAA 3SV3A 3GL1A 1BCOA 3V9XA 4CZMA 3H6EA 3P39A 3FZHA 3CQ8A 3SV4A 4CEQA 4B08A 4Z4GA 4JS5A 4BG8A 3P4IA 1R59O 2HBLA 2X6SA 3P5JA 4GKKK 4GV3A 3AVAA 1CZAN 2VWKA 4B8CA 2IVNA 3FGUA 3TSUA 2I7PA 1R0AA 5J1EA 3HSTB 4E7KA 4IBNA 3U4LA 2GUPA 2V52B 2E20A 4OKJA 3RRGA 2BUPA 4NCBA 3JYTA 3R8EA 4M45A 4F2RA 3CCJN 2FBXA 1QZ5A 4EP5A 1HQUA 3AO5A 2GEMA 4FCYA 4W5TA 1J5EK 3CIPA 1KXPA 3L3UA 4CIGA 2YJFA 4I9LA 4M3WA 3TABA 1S5JA 4A5AA 4XIUA 1TKXA 1JLBA 3EKUA 3KK1A 2GWJA 2QWQA 1U45A 3MX5A 3U9DA 1RT5A 1Q9XA 4CF1A 2DFHA 5KGWA 3S41A 3I55N 3IVFA 3CFPA 3HTVA 3JAMO 3CJ7A 3FZLA 2FSJA 4WFNL 1XI1A 1Q82O 2NUBA 2AL6A 2FBVA 4CHOA 2FSNA 3WXMB 1RDCA 3IAYA 3VQ7A 4KH4A 5AQWA 4IOCL 2G8KA 5EY4A 5FPDA 3WEEA 1LW2A 2IS3A 3I8BA 1NNEA 3TARA 3DLRA 2UXBK 2KFZA 4O0IA 4B1XB 3WNEA 2Q3SA 5EOYA 4BRLA 3A5NC 3GDQA 3SQ1A 1JL1A 4M3YA 4B9UA 2EMSA 2AJQA 4AHRA 3WNHA 1WBBA 4Q5VA 4ZTJA 2P9NB 4J2EA 4O0JA 1NK7A 4XH1A 3J7ZO 3AVJA 3EKSA 2WONA 1FXXA 1OH7A 4OX9K 2G8IA 4DTPA 2E2OA 1ISNA 4CD3A 2W40A 4BDZA 3M8RA 3C6UA 4J2BA 3F2KA 2VQFK 1NJIO 3U6FA 3PIPL 1NJZA 4M7XA 3BP8A 4JI5K 2HHHK 5BREA 4QS7A 4CEZA 1XMOK 5LJWA 4EKUA 1F21A 2YHXA 4I6MA 5T7BA 4DTJA 4CGHA 3WXKA 4JRQA 4DTMA 1ZBLA 3VQBA 2IAJA 3GE1A 3ID6A 3MXIA 1WSGA 2GWKA 1NKBA 3P38A 1V4SA 2UUCK 4BRKA 4Z94A 4B9NA 4XEIA 4UY8O 3AA2A 4EZ9A 4CJ4A 4O4GA 1EP4A 4JKHA 4JKDA 4G1QA 3D0PA 4GNIA 3LDLA 4KREA 1HBKA 2AEHA 2HBKA 1RT4A 4FJHA 1HB6A 4DV3K 1NK4A 5EXWA 2RHKA 3ZSQA 5M1PA 5CYMA 1HYSA 2HOEA 3R3LA 1QQCA 5BPMA 1HRHA 4CZHA 2KHOA 1VQPN 1NMNA 4DCHA 3OS0A 3OYMA 4KFBA 3ZT2A 3I8DA 2YNGA 3ZEUA 3QEIA 3T7ZA 1RDUA 2HBMA 2QXFA 1Q81O 4E19A 4DF8A 3UE5A 1YTAA 3BF3A 4JLHA 1NGGA 3BINA 5C15A 4Y1DA 4A5BA 4DV7K 5M1FA 1IH7A 3EE8A 4OJRA 4BACA 2HF3A 1VSJA 4Z4HA 4DR7K 4YOUA 4E7HA 4BRNA 1HKGA 3K5NA 5ADXA 5KPTA 4LF7K 1TKZA 5AQIA 1KVBA 2FBTA 3KK2A 4PA1A 3BDPA 1E3MA 4FWKA 4BR0A 3SAFA 1VRUA 4K25A 3ZDTA 5AQYA 1ZBHA 4IZ9A 3RMAA 1YI2N 2HNYA 4IFYA 3VEWA 3A5LC 4DQ8A 1RT3A 5M1NA 2V7ZA 2XY7A 4KH6A 2KFNA 2RN2A 3VEVA 4CJLA 4HUGA 4JAXA 4BRFA 4H0XB 4F4KA 4BVPA 3W3DA 1NGCA 4CHPA 1P8ZA 4CW7B 5TKYA 4FVMA 3WNGA 5FPEA 3DWLA 5AQRA 4BRMA 4CZEA 4W5NA 4HCCA 4JS4A 4LD0A 3QO9A 1WB9A 3L2VA 1RILA 2ZWHA 3MDQA 4WQ5C 3OYAA 1SAZA 1Z6RA 1L3UA 4CJPA 1GLLO 3LDSA 5M1QA 4WFAL 1EWQA 5J2NA 2Q31A 1P90A 2FSKA 3L2QA 2HHWA 1Y64A 2BANA 4JKBA 1NK0A 2OTLN 4NYNA 2O8BB 5D3GA 4YOXA 4I6MB 1VQ8N 3WA0A 2O8DA 1E5WA 1X1PA 3AO3A 4BREA 1TK0A 4KHUA 3LPTA 1OVYA 4LF9K 1N5YA 1SV5A 4FYDA 2XRIA 3TTDA 3G25A 1NBWA 1D4XA 2QEXN 1SQKA 4B1UB 2O8FA 4HDQA 4CEEA 3O9UA 2ABDA 4OPKA 5A2QO 2DFEA 2YHAA 3U8XA 5HRPA 4O5BA 2QKKA 1CZBA 4LF5K 2IIRA 4ELTA 4IO8A 2HNZA 3UIQA 4CF8A 1YJWN 2YCHA 3L3VA 3LDNA 1UA0A 3AVBA 3CFOA 3EE9A 2D0PA 4DKWA 5J2PA 4DXAB 5IJMA 4DV5K 4H0PA 2ZM6K 5EX5A 3TTCA 2FBYA 4AHTA 3PX4A 1EXQA 3HPGA 3OYCA 3PSFA 1S72N 4CZLA 1ZBSA 3MN5A 3AA3A 1U47A 5M1OA 3QEXA 4E89A 2P9LA 5B8HA 2HHUA 3MEGA 2EHGA 2ITMA 1U2VA 1KD1O 2YVCA 3VQPA 1LWCA 2X6NA 1YAGA 1B9DA 4MO4A 2KZZA 3SUOA 1TK8A 3VTIA 3FE1A 4KTQA 5C12A 5GAGP 4AH9A 1RDBA 4YY3K 4CEDA 4YOVA 2IDOA 3VGLA 3OYJA 3M8QA 4DQSA 3SNNA 4BRIA 3FFIA 2E2PA 4FK0A 3D2FB 4FJXA 1VQON 3MECA 4PHTX 3K57A 4FLVA 1QVFM 1OH5A 2DFFA 3VGKA 3UKUA 1W7AA 5FDLA 2D5RA 2YHBA 3ZT4A 3ZT3A 3U3GA 4KTWA 3D45A 3DLGA 4ID1A 4HTUA 1FKOA 5JICA 3AAQA 5C10A 5GIOA 3AO1A 3IUCA 3PUFA 1VQ7N 2WBNA 1Q9YA 1C0MA 4CD1A 4GMJB 3ULDA 3M1FA 3DMJA 2HHQA 1XC9A 2YNIA 3UB5A 4FLXA 5CR4A 5JVGL 4B9LA 4HTLA 3M6GA 1QE1A 1S1XA 4LY7A 3KIOA 1KTQA 3EO3A 5FLXO 1JLEA 1LAVA 3NAEA 2ZJRL 1WSIA 3FZKA 1ATSA 5AQKA 1VBHA 3DXMA 3HM8A 1ZBIA 4KTZA 5AJ3K 3HP9A 4MDBA 4FJJA 3ZETA 4CHZA 4CZGA 3KLEA 4FJKA 1MWKA 1RTJA 2O8DB 4DSKA 4FWSA 4DQQA 2GTDA 3KLIA 2F8TA 2CQUA 1KAYA 4F9OA 4DSFA 4BC4A 2HMPA 3LDPA 3MK6A 4KHWA 1T6CA 1NM1A 4C8LA 3H45C 1KLNA 4CHNA 5KGXA 4N56A 3SZ2A 3KLFA 4GXBA 2HRJA 1OVQA 2O8FB 4ZRKA 5KI6A 1FJGK 4M63C 2XHBA 3MCAB 1W2BM 2OPQA 5EU7A 4PKGA 4N47A 1HNWK 3F9MA 1UA1A 1IBKK 3ZX0A 3NBPA 3H3NO 4ICLA 2G8UA 2YI1A 5C25A 3N4QA 5CHIA 1RFQA 4W5QA 4DR4K 1MWMA 3L2WA 5AQPA 3S3MA 2X0SA 3D2EA 3AVMA 2BTFA 1RBSA 5HP1A 3OYEA 2E6LA 4NXMK 4W5OA 3CCQN 2CB8A 1EO1A 3MXJA 3SJJA 4H4OA 3F5TA 3KD5E 1NJXA 3BF1A 4WQ5A 5KQDA 3PZDA 3IMXA 2E88A 1NWKA 3FZFA 4JKAA 5E41A 4V19S 3OS2A 4A2AA 4IXCA 1O13A 3OYNA 3NHGA 2W6KA 4BRQA 4HVJA 4OPJA 1XWLA 4JRPA 4JI4K 4RW4A 3ZT0A 4DR2K 4OO1J 2NRRA 2ASPA 1KC8O 1JLFA 1K9MO 2A42A 1SGHA 4JI8K 3RMCA 3AARA 1HB8A 2RE2A 3HL8A 4FM1A 1A5VA 2ATQA 1X9SA 3NCIA 3U8ZA 3UKUB 1ASWA 4IEIA 5JLHA 4B3SK 2PBDA 2VGNA 5ADXH 1NTIA 1JXEA 1O1WA 3QLHA 5KRTA 1Y19B 3UKRA 4IJNA 1C1AA 1LWEA 3W0LA 1CXQA 2EX3A 2W41A 4RW9A 3LM2A 4DU3A 1SKSA 2Z1IA 3ZX2A 1WBDA 3I0SA 3LDQA 3ZSYA 2VQEK 3THWA 2D11A 1VQKN 4JKEA 4X65K 4DSEA 3V1RA 1S3XA 3V4IA 4JHDB 4BE0A 2XY6A 4L3QA 2HF4A 4F3TA 3HOSA 3DXMB 2V7YA 5M1KA 3M3ZA 2F4VK 2FF6A 3L8BA 3ZETB 2ZGZA 3AO2A 3Q7CA 2HB5A 5FROA 3VEXA 4CJTA 3CQYA 2HHVA 1EWRA 5DM6L 2DY4A 3V81A 1GLEG 4EHTA 3DRPA 1NGEA 4K43A 4DQRA 4B3OA 1BO5O 1BCMA 4BG9A 5JLFA 3GBTA 4BRGA 1XNRK 3ZCMA 5F2RA 4LC9B 4YDUC 2O8CB 4DR1K 1Q7YO 4WF9L 4CJRA 4JKGB 3N4PA 1XMQK 2D10A 4RTFD 3EL2A 2X74A 4OLAA 5AQTA 5J2QA 1C1CA 3O9TA 3DLHA 3CCMN 1UWBA 1IBLK 4CIFA 2W6LA 1S1TA 4ISGA 1DTTA 3D2EB 1TAUA 3PY8A 4AHVA 2YV0X 2B6AA 4CF2A 3KJVA 5BRDA 3R1XA 1GLBG 1WUAA 3C7NA 4DSLA 4CJ3A 3LP0A 4B8AB 4DTUA 2HSTA 1LW0A 3WQTA 4EHUA 3QNOA 3VPZA 3G10A 1T03A 4M3ZA 1WSEA 1H4RA 2ITGA 4JV5K 1JLAA 2Y1JA 3L4IA 4JI6K 2IVOA 4B9TA 5DK5A 5AR0A 4EIAA 4FZXC 1MK9B 4KPYA 5DMRA 5TKWA 3LL3A 4GVEA 1FK9A 5HLFA 1BIUA 1DKGD 3O3FA 4RCHA 1M90O 3JXUA 2KQ2A 4MDAA 5CZ1A 1JJ2M 2HW3A 2PZSA 4CCHA 2P5OA 4LFAK 2ZQBA 4FJ8A 3HSCA 5C0YA 4FLYA 2O8EB 4CYEA 2VCPA 1XHXA 2F9WA 4BC2A 1VSHA 4OGEA 5I3UA 2QM1A 4BRAA 3VF6A 1MA9B 4R5PA 3IFRA 2NRWA 4KB1A 5HBMA 5F1XA 1JLGA 3ZSOA 3J81O 1VQMN 3KD1E 1JCFA 1VQ9N 1BA0A 4ILHA 2QWLA 3DLKA 3UKRB 5I9EB 3A2FA 4Z4CA 3F73A 1IG8A 2QA4N 3NH1A 4DHYA 1WSJA 2GUIA 1QZ6A 5AQUA 4DV0K 3GG4A 2HHXA 1GGOA 3KZBA 3THWB 5AQZA 3AVIA 1BGXT 5AQOA 3OYHA 2G8HA 4GW6A 1NGFA 3CMAN 3OYKA 3AVLA 1LV5A 4AF1A 3BUZB 1QS4A 3C0BA 4O8KA 2P5GA 4CFAA 2UU9K 1TYQA 3ATUA 4I2QA 4BGBA 1BI4A 3HOTA 3E9OA 2UUBK 1RDAA 2Q0UA 3VA3A 4E3SA 4BE1A 2P9UB 4CBXA 4WQ4A 1SKRA 4TSXA 3EZWA 1D8YA 3J7AP 1GOAA 3CCEN 4FWLA 5LL6Z 4Z4EA 1ASUA 3O9RA 4NLBA 1HNXK 3CMEN 4I2PA 4WFBL 3VN5A 1QTMA 3G6EN 3EPYA 1Z25A 1C0UA 4B1WB 3OYFA 1VAZA 3CERA 3SQ4A 4MFBA 1MIZB 2COPA 3NF7A 4NO7A 4H5RA 4H03B 1ZBUA 3WUHA 2QXLA 2I5JA 5AQFA 3K2PA 4U7BA 4Q0BA 4FLWA 2LBBA 1DTQA 1TL1A 2Q36A 4FVUA 5KPRA 3FLCO 3CJ9A 2A40A 2F96A 3ENBA 4YORA 3TAGA 4JK8A 3O5BA 4O8UA 2W42A 3SYZA 2AP1A 3C7NB 4UQGA 4Z0UA 3FFKB 5AQXA 4LF6K 3SQ2A 4EZ6A 2D0BA 1YHQN 3J7YP 3CJBA 1WSHA 3K5MA 3PX6A 3C6TA 3KWGA 1C6VA 4QOZB 2RPIA 3QFPA 3OY9A 4YOWA 3NF8A 2E6MA 3DXKA 3OYGA 1YXQA 4HUEA 3WEEB 4H5WA 4TKNA 3MMVA 4CF9A 1HUXA 4H0OA 3E1YA 4ZTFA 4NCAA 3HJFA 3S3NA 3KK3A 3CCSN 1J54A 3V9UA 1HNIA 4FPBA 1I94K 3V6DA 3MXMA 3ZLJA 3SLCA 1NK8A 1HMVA 4DFKA 4L8RB 3E01A 1IV0A 3AVGA 3ZSZA 4H5VA 3NMUA 2BE2A 2NNWA 4IKFA 4NCGA 3B8AX 2QKBA 4DS5A 4B9SA 3VQ8A 4FLUA 4YDUA 3THYA 2HE7A 1UAXA 3EYZA 2GV9A 4FW2A 4CJEA 4CEBA 3A8YA 4GY2B 4M3XA 2WC9A 3ASMA 1QSSA 4QCLA 4M41A 3CM6A 1RBUA 4B1YB 2NLXA 4DS4A 1H1VA 3LAMA 1U49A 1JCEA 1S6PA 1BWFO 4FZYA 1BQNA 2LSNA 4KO0A 3KHYA 4RW8A 2YHYA 4NYFA 3QIJA 4DV1K 4ELVA 3HP6A 2HHSA 4HUFA 1RT1A 3K9JA 2QWRA 3CXCM 1IO2A 3TSPA 1GG3A 2D1KA 4ID5A 3AVHA 1D9DA 1VSEA 1SZ2A 4CGJA 2XO7A 3V9WA 5C2DA 5AFUH 3NGYA 2F8SA 4JI3K 1TYQB 1BOTO 1NKEA 3PO4A 3KLGA 3U9ZA 4E0DA 1K6YA 5LMUK 1IG9A 4FZZA 4J2DA 3VQEA 2WFBA 4DWIA 4N76A 3HVRA 3AGRA 3CFRA 1YVNA 3THXA 3K59A 3CG7A 4RG8A 3NF6A 4FJLA 4KHPK 4BR5A 1E4FT 4E1JA 3ZEUB 3WXJA 4H5NA 4IOXA 2QI2A 1BG3A 3FP5A 1KVCA 3G9WA 1A5XA 3TAQA 4DV2K 4IOAL 1ACAA 2RQ1A 3ZSWA 3X23A 1ESVA 4HCBA 1BHLA 1T44A 4EFHA 1GOBA 3PO5A 1IJJA 3SAHA 2ZF5O 3QINA 1GLJO 5C42A 3OA9A 4QS9A 1ZBFA 3IDHA 1RCHA 1HX1A 4DLGA 1DIKA 3RSEA 4P7IA 1W97L 3SCXA 2O4IA 2YKMA 1LOTB 1HKCA 3RVCA 2QW9A 4OKEA 1KFSA 4Y1CA 4BGAA 3SK3A 1N34K 3T1HK 3RTVA 3CQXA 1RBRA 3DXKB 4CJSA 1C1BA 4JI2K 2HVIA 5BRFA 2Q2RA 4Z4IA 3QEVA 1X9WA 2RF2A 4DFJA 2FJ9A 3C65A 5KPZA 3KLHA 3KTQA 2NRZA 2WUSA 5BN9A 4AQYK 4N5SA 3FLVA 4GV6A 2ZE2A 4CECA 4FWQA 3HRGA 2A1RA 4RW6A 1NMDA 2HMIA 3ULEA 4H0TB 4ZHRA 2YNHA 3IS9A 2P9IA 5H1SQ 2VWJA 2KKZA 4MLEA 3SJHA 1FKPA 3DLEA 5J2MA 3LAKA 3QIOA 5JVHL 1DT9A 4CGFA 1W9HA 5HOOA 3IRXA 1VQNN 2WOMA 1YJNN 4DQIA 2E1ZA 4CBWA 3QEWA 3TANA 3VGMA 1HYZA 1QSLA 2HBJA 2Z1JA 5BR9A 4FW1A 1D9FA 3DLLL 1QQMA 4LFCK 3A5MC 1SS6A 2UXDK 1BDGA 3WXLA 3LP3A 3HYFA 3QIPA 1ATRA 4DR5K 1Q86O 3VQ6A 1JDEA 4DU1A 1HYVA 4H8KA 4KHNA 3HO1A 1RTIA 1L5UA 2Q0RA 3U7DA 2ASOA 5AZIA 3CPEA 1S9GA 2I7NA 4LFBK 1TKDA 1ITGA 1J19A 3TI0A 1BUPA 3BZKA 3Q7BA 3PV8A 2P9PA 1NVLA 4A62A 1B92A 4LSLA 4FJNA 3OW2M 3T3FA 3MN6A 3WXIA 2ZJQL 1MK7B 5JS1A 2VGMA 4CF0A 2OANA 1HJRA 1GLDG 1NGHA 3F9KA 5C24A 3THXB 4B1VA 1NGIA 3O3GA 1T3VA 3VF2A 4BY9C 3VEZA 4B9MA 3KKRA 3LM9A 4CEFA 4E7LA 4C8MA 4NXNK 4OKKA 3CC7N 4ELUA 4BC3A 3ATVA 3CI5A 3G4SN 5F0XA 3U3YA 2EMTA 4CGDA 1X3MA 1QHTA 3WQUA 2P9LB 3HI0A 3M8SA 4WYBA 5LMNK 3NDKA 3O9SA 3V9ZA 1U2VB 4EP4A 4O5FA 4RWTA 3TR8A 4DF4A 1M1KO 2FDQA 3HBTA 2E2QA 1DGKN 4WQ4C 2CGJA 2ZGYA 5KTQA 2BDPA 4H4MA 1K8AO 2NRVA 3NGZA 4DSJA 3RSEB 4XH5A 3MCPA 1JCGA 5FPMA 1NK5A 3VESA 2IC3A 2D0OA 1I39A 4DFMA 3K0SA 2PYJA 1JKHA 3CC4N 3EN9A 1J6ZA 1NGAA 3MEEA 3PX0A 2UYTA 5BR8K 4KV8A 3DRSA 3ZSVA 4DTOA 3K9KA 3I33A 4CERA 1RBTA 1YJ9N 2KTQA 2E8AA 3AV9A 1A5WA 2JWKA 5AQLA 4DTXA 2Q97A 3CJ1A 3HPOA 3H1QA 4JK7A 1U48A 2UXCK 4AM7A 1VQ4N 3EEQA 4CVNE 4F3OA 1EQYA 5AQMA 1NGDA 3A5OC 3NVMA 5HL7L 3OS1A 5GAHP 4B3TK 3ULEB 2VWBA 2P9IB 4GV9A 1Y97A 2HNDA 5IWAK 4JYAK 2A3ZA 3CPWM 2OTJN 2ETJA 1QHAA 3K58A 1GLFO 5MLCQ 3I56N 4A57A 1YT3A 4KKOA 2CGKA 3VQ4A 3B6OA 4ZRIA 3AY9A 4O44A 2A1SA 3LPUA 4ISFA 1L3SA 4N41A 2D4WA 5CYQA 1FW6A 4LH4A 5AQGA 4CEOA 1OH8A 2J0JA 3IKMA 3HZ6A 3O1BA 4OLBA 2ZD1A 3OJUA 1VSLA 3LZJA 3P83D 4FL9A 1S22A 4FWMA 1OH6A 3LZIA 1BU6O 3K5OA 4KAZA 3H08A 4I7FA 2OZSA 4YL8A 5AZIB 3NE6A 3ID8A 1HKBA 1KC7A 1TUYA 4A61A 2VG5A 1WN7A 1OKJA 2IVPA 1NK6A 1SL2A 4DMNA 2DTUA 1Z26A 1EETA 1J9AA 3CCRN 4FK2A 3NGIA 4FPAA 4CJVA 4Z4FA 4JKCA 4YFUA 5FPNA 4KB0A 4PKIA 1KCFA 3NFAA 3AGKA 5LJVA 4DTSA 2P9KA 3RR8A 1JLQA 3M5RA 3ZT1A 2A5XA 4FOEA 1IKXA 4QS8A 1E4GT 2OA8A 4W5RA 2QTDA 3VMFB 2QK9A 4HWIA 1NGBA 3SUNA 3CD6N 2YKNA 5CE3A 4DV4K 4BR7A 3T69A 4X62K 3O08A 1WOQA 2YHWA 4IO9L 3NF9A 3VQAA 4DU4A 3MN9A 1C0GA 3DLBA 4CIEA 4PY5A 1K8KA 2WTUA 1RNHA 4HDOA 4Y0WA 4PKHA 4IEEA 3RMBA 1S1VA 1KBLA 1KFDA 5I42A 4DSIA 2YX6A 1KLMA 4C8OA 4BWJA 3AA5X 5BN8A 3ZYYX 1T7PA 3MWTA 4PUOA 5E26A 2DPNA 3DJCA 1JXBA 4CJFA 4BDPA 4A2BA 5HRNA 4CZIA 3PIOL 4FLTA 3QERA 4X66K 4CK3A 1GC6A 1VSIA 1VK0A 2JGUA 5K14A 1TGOA 4NY0A 4M7YA 4KHSA 2IGIA 2P1JA 4XH4A 3ENHA 3BEXA 1VQ6N 1W0HA 3AVNA 3O9QA 3IG1A 4BDYA 1SUQA 1N6QA 4F8RA 3LDOA 3QMLA 4F7GA 1NKCA 3R6MA 5DM7L 4E7IA 3G0ZA 3L2UA 3H1VX 3KKSA 4CK1A 3AVFA 4M3TA 4LH5A 1EX4A 3S3OA 4DR3K 1YTUA 4FM2A 4JNEA 3VQCA 2OPRA 4KRFA 3QESA 4YNQA 3O1WA 2BGGA 4OVLA 3C94A 1U04A 1Q8IA 5AQVA 4AHUA 2O8BA 1U4BA 4K8XA 4DG1A 3D6RA 1KAZA 2OZMA 2PY5A 4BRDA 4K42A 2F7TA 2Z1GA 3HXMA 1GLAG 3ALYA 3ITHA 3QB0A 4PQUA 4CFBA 4B9QA 5HRSA 3T1AA 2E4LA 3SQ0A 4HHTA 2D0AA 2NRHA 4K8ZA 5GINA 3TWHA 4BQZA 4O55A 1JL2A 1HNZK 4JI1K 1HR0K 1YITN 1NOZA 3PLAA 3AA4A 3VF4A 1HQEA 3I0RA 3RMDA 4CJUA 4KI6A 1IKVA 1TVRA 3VQ5A 1CXUA 2P9KB 3A0IX 4X64K 4FK4A 5JMVA 4FM0A 5HRRA 1NGJA 4FO0A 3J8AA 1V4TA 3H3OB 5BRHA 1YIJN 5AQNA 4DUYK 4FJ7A 2G8WA 1MIXA 2OPSA 4M42A 2A6AA 2R7YA 4GKJK 4IDKA 5FRNA 1K8KB 5HROA 1TK5A 2JWLA 4CGIA 2X78A 4BE2A 2NRXA 1WLJA 3PVLA 3BY5A 2VG6A 5SZTA 1DEJA 3FR0A 4BR4A 3WNFA 3SAGA 1RTDA 1G15A 3MWPA 1ASVA 4FWPA 3V1OA 3O80A 3SBTA 3D2FA 4YHHK 4CZKA 1TUUA 5BPLA 2R82A 3O6WA 4BRCA 3OHRA 4DFPA 4YOYA 3AVKA 3CJCA 3QETA 1XUPO 3OYDA 1IKWA 4B9VA 4E1NA 3S9HA 4CJWA 3SMPA 3AU4A 3LP1A 1BIZA 4BR9A 3BGRA 4CBUA 2Z1HA 4F2SA 3L6QA 1KSPA 3C6HA 3DOKA 1VHXA 4C23A 2H3GX 2I1KA 3QBXA 1T6DA 4K41A 1X9MA 1VQLN 3DAWA 1NI2A 3H46O 3THVA 3VOVA 1T05A 3BZCA 4KBOA 5KRSA 2E2NA 1HPMA 1K73O 2XY8A 4CZJA 4IFEA 3ISNC 4G9ZA 3VETA 4JKFA 3CCUN 2FXUA 2FLOA 5C2FA 1J5OA 1VSDA 4E1MA 2XY5A 1T8EA 1BQMA 1C0TA 3V9SA 3VENA 1XC3A 1L3VA 4DV6K 3FZMA 4FJ5A 3E9LA 1YUWA 1Q18A 2YJEA 1DLOA 1CZ9A 3LALA 1N36K 4A59A 3CF5L 4GVMA 3CETA 3DM2A 4CFDA 1BI4B 3NVKA 1N32K 1ST7A 1MDUB 2WH5A 3HVTA 4AM6A 3L0QA 3T19A 5SWMA 3LANA 2ZJPL 3CCVN 2FC0A 4OPAA 1RBVA 3V1QA 2JLEA 2E5LK 4FXDA 2F9TA 4FLZA 1KVAA 3HM9A 1NJYA 2QWOA 2OCEA 3EY1A 4H0VB 4ILGB 1UOCA 4EAHD 3M8PA 3CCLN 5GADP 1NLVA 2KLAA 2HVHA 5E84A 4BC5A 2J0KA 3VQDA 3RR7A 1RT7A 5AZJA 4DUZK 3T1YK 4B3RK 3ZX3A 4CJQA 3QDKA 5LY3A 5GIPA 4LSNA 2DIKA 3B6PA 3QBWA 3J80O 1WAJA 3HK2A 3MEDA
chains in the Genus database with same CATH topology
3O9SA 4YOUA 1U2VB 4FWOA 2HSTA 2QWMA 4O5FA 1HKGA 4BRNA 2D2QA 3WQTA 4EHUA 4RWTA 5GAEP 5ADXA 5KPTA 1M1KO 3OBWA 5ELZA 3VPZA 2FDQA 1H4RA 2E2QA 3HBTA 1DGKN 4WQ4C 2CGJA 5AQIA 2FF3B 4MLHA 3G71N 1XQSC 2ZGYA 3L4IA 2IVOA 1GLCG 1K8AO 2NRVA 2VYPA 3RSEB 5AR0A 4EIAA 4XH5A 1MK9B 3MCPA 1JCGA 4FWKA 3QFUA 4BR0A 3SAFA 2NRTA 4K25A 5FPMA 5TKWA 3LL3A 3VESA 3ZDTA 2D0OA 5AQHA 4BROA 4GVEA 5AQYA 1DKGD 4IZ9A 4RCHA 3CC4N 3EN9A 1YI2N 1M90O 1J6ZA 3JXUA 4MDAA 1JJ2M 1NGAA 3VEWA 3A5LC 4DQ8A 1Z05A 3HSCA 2UYTA 5M1NA 3CHWA 2V7ZA 2E1YA 2GELA 3GOIA 4KH6A 3K9KA 3I33A 3VEVA 5C0YA 3ENOA 4JAXA 1YJ9N 4BRFA 4JD2A 2E8AA 3OBYA 4CYEA 2JWKA 2VCPA 4H0XB 5AQLA 2F9WA 3W3DA 4BC2A 4BVPA 1NGCA 2CH5A 1P8ZA 2Q97A 3CJ1A 5TKYA 3H1QA 4JK7A 4YOTA 4AM7A 2QM1A 1VQ4N 4BRAA 2EWSA 4BVOA 3CJAA 3VF6A 1ZC6A 1MA9B 5FPEA 3DWLA 5AQRA 4BRMA 4CZEA 3IFRA 1X9JA 2NRWA 2ZWHA 1EQYA 5AQMA 1NGDA 3MDQA 5F1XA 2PFUA 3A5OC 3NVMA 4WQ5C 5HL7L 4H5TA 1VQMN 5GAHP 1SAZA 1JCFA 3ULEB 1VQ9N 3CC2N 1BA0A 2VWBA 1Z6RA 2P9IB 4ILHA 4GV9A 2QWLA 1HLUA 1GLLO 4FOIA 3VTHA 5M1QA 4WFAL 3SBGA 2A3ZA 3CPWM 4FVUA 3UKRB 3KWIA 5I9EB 2OTJN 2QWPA 2Q31A 4JK9A 1P90A 2FSKA 1QHAA 1Y64A 1GLFO 1IG8A 4JKBA 4A57A 5MLCQ 4ZRJA 3I56N 4JN4A 2QA4N 2P9SA 1X3NA 4DHYA 2CGKA 1QZ6A 5AQUA 2OTLN 2V51B 3GG4A 3MX2A 1GGOA 3KZBA 1ATNA 4J8FA 5AQZA 4JHDA 4ZRIA 2A41A 3AY9A 2NZTA 3TSQA 4YOXA 4I6MB 4ISFA 5AQOA 4C1NI 3WA0A 2D4WA 4IDHA 4KH5A 1VQ8N 4PL8A 1E5WA 4BREA 5AQGA 1NGFA 3CMAN 1OVYA 2J0JA 4AF1A 3BUZB 3IKMA 4JEPA 1G99A 3TTDA 3G25A 3C0BA 3HZ6A 3O1BA 4O8KA 3JS6A 1NBWA 1D4XA 4FL9A 2QEXN 1TYQA 1S22A 4NB4A 1SQKA 4FWMA 4B1UB 3ATUA 3L4QA 4BGBA 4HDQA 1BU6O 4CI6A 3HOTA 3O9UA 2ABDA 3E9OA 2Q1NA 4YL8A 5AZIB 3ID8A 1HKBA 3U8XA 1KC7A 1BA1A 1TUYA 2Q0UA 4A61A 3WT0A 4IWVA 1OKJA 2P9UB 2IVPA 4CBXA 4WQ4A 3EZWA 4U67L 1ZXOA 4WCEL 2IIRA 2ZPYA 3R9PA 4FWLA 3CCEN 5JVLA 4IO8A 4DB3A 3O9RA 4NLBA 3CCRN 1QQNA 1YJWN 4FPAA 2YCHA 4JKCA 3LDNA 5FPNA 4PKIA 3CMEN 3AGKA 1KAXA 5LJVA 2P9KA 4WFBL 3M5RA 2J4RA 3G6EN 4JKGA 3EE9A 3EPYA 1YF5L 4OPHA 2D0PA 2A5XA 4FOEA 4B1WB 4QS8A 1E4GT 1VAZA 3CERA 5BPNA 4DKWA 3C6AA 1MIZB 2CH6A 3TU5A 2COPA 3VEYA 2QTDA 4NO7A 3VMFB 2PAVA 3VEOA 4H5RA 4DXAB 5IJMA 4H03B 3WUHA 4HWIA 1NGBA 2QXLA 5AQSA 3CD6N 4H0PA 5AQFA 5EX5A 3TTCA 4U7BA 5CE3A 4BR7A 2LBBA 3T69A 3VERA 2Q36A 4CZLA 3O08A 1ZBSA 1C0FA 1WOQA 2YHWA 5AZJB 5KPRA 3FLCO 4IO9L 4FWNA 3MN5A 3CJ9A 3MN9A 2A40A 1C0GA 3E9PA 3ENBA 1U6ZA 4YORA 4C1NK 1QQOA 5M1OA 4JK8A 2P9LA 3O5BA 4O8UA 5B8HA 1K8KA 2ITMA 1U2VA 2AP1A 1KD1O 2YVCA 4HDOA 3C7NB 4Y0WA 1YAGA 4PKHA 3FFKB 4IEEA 3O8MA 4MO4A 5AQXA 1KBLA 3VTIA 3FE1A 1YHQN 2YX6A 3CJBA 5C12A 5GAGP 1EF1A 3KWGA 5BN8A 3QICA 4MO5A 3MWTA 3ZYYX 4YOVA 3QFPA 5E26A 4FWRA 3VGLA 4YOWA 3DXKA 2DPNA 3E66A 3DJCA 1YXQA 2CGLA 4BRIA 2E2PA 3WEEB 4H5WA 3D2FB 3TTFA 4TKNA 4A2BA 3O4WA 3MMVA 4CZIA 3PIOL 1HUXA 4H0OA 1VQON 3E1YA 4PHTX 1GC6A 1QVFM 3SMSA 3VGKA 3UKUA 3CCSN 4NY0A 4M7YA 4FPBA 3ENHA 3KVGA 3BEXA 4XH4A 4BR2A 2P9NA 1VQ6N 3SLCA 3O9QA 4BRPA 3LDOA 3QMLA 4JD2B 4F7GA 4H5VA 5JICA 3AAQA 4ILJA 4BQLA 3R6MA 5C10A 5GIOA 5DM7L 3IUCA 3NMUA 1VQ7N 2WBNA 2BH1A 3H1VX 2J0MA 2NNWA 5AQJA 3B8AX 4CD1A 2AA4A 3M1FA 4CJ7A 1ILYA 2GX9A 4YDUA 2QWNA 2HE7A 3AAPA 4JNEA 3UB5A 5KQ8A 1VBGA 2I1JA 3D7EO 5CR4A 5JVGL 4HTLA 3O1WA 3M6GA 4R79A 3A8YA 4GY2B 5AFUA 2WC9A 1RDWX 4CZFA 3TPQA 3EO3A 4B1YB 2ASMA 2NLXA 2ZJRL 1H1VA 3FZKA 5AQVA 1ATSA 5AQKA 1VBHA 3DXMA 1JCEA 3HM8A 1QVGM 2P9SB 3P31A 4H0YB 3D6RA 1HJOA 1KAZA 4MDBA 4NLCA 1BWFO 4BRDA 4K42A 3ZETA 1KQSM 4CZGA 4ISEA 4B1ZA 2F7TA 3KHYA 1GLAG 2YHYA 1MWKA 4BRHA 3QIJA 1VQ5N 4FWSA 3QB0A 1RGIA 2GTDA 5AQQA 3K9JA 2CQUA 1KAYA 2QWRA 4F9OA 3CXCM 4BC4A 2HMPA 3LDPA 1GG3A 3TSPA 2D1KA 3MK6A 4B9QA 3MN7A 1T6CA 1NM1A 1SZ2A 3H45C 5C2DA 4FSVA 5AFUH 2NRHA 5EVZA 4GXBA 2HRJA 1TYQB 1BOTO 1LCUA 5GINA 3AU5A 2P9PB 4BQZA 1N8RO 3KK7A 4PL7A 4ZRKA 3U9ZA 1GC7A 2P9UA 4M63C 4IJAA 3MCAB 1W2BM 3GL1A 2WFBA 4CZMA 3H6EA 3P39A 3AGRA 3FZHA 4PKGA 1YVNA 1YITN 3PLAA 3F9MA 4BG8A 3P4IA 1R59O 2HBLA 3VF4A 4GV3A 3ZX0A 1CZAN 4BR5A 3H3NO 2IVNA 3FGUA 3TSUA 1E4FT 2I7PA 2YI1A 4E1JA 3ZEUB 3N4QA 3WXJA 5CHIA 1RFQA 1MWMA 2P9KB 5AQPA 2X0SA 3U4LA 4H5NA 3D2EA 2BTFA 2GUPA 2V52B 2E20A 3A0IX 4IOXA 2BUPA 2QI2A 1BG3A 3R8EA 3CCJN 3FP5A 1QZ5A 5JMVA 3G9WA 3CCQN 2GEMA 2CB8A 3CIPA 1ACAA 1NGJA 2RQ1A 4IOAL 1KXPA 4FO0A 1EO1A 3X23A 3J8AA 1ESVA 1V4TA 3H3OB 2YJFA 3F5TA 5BRHA 1YIJN 3BF1A 5AQNA 4WQ5A 4A5AA 1T44A 5KQDA 4EFHA 3EKUA 3PZDA 2GWJA 1IJJA 2QWQA 3IMXA 2E88A 3MX5A 1NWKA 3U9DA 3SAHA 1MIXA 2ZF5O 3FZFA 1GLJO 4JKAA 2A6AA 3OA9A 4QS9A 4A2AA 1K8KB 3IDHA 3S41A 1HX1A 3IVFA 4IXCA 2JWLA 1DIKA 1O13A 3RSEA 4P7IA 3I55N 3HTVA 1W97L 3CJ7A 3FZLA 2NRXA 1LOTB 3PVLA 2FSJA 4WFNL 1Q82O 4BRQA 2AL6A 2FSNA 1HKCA 3RVCA 2QW9A 3WXMB 1DEJA 3FR0A 4BR4A 3SAGA 4KH4A 5AQWA 4IOCL 3MWPA 4BGAA 4FWPA 3SK3A 5EY4A 4OO1J 3O80A 5FPDA 2NRRA 3WEEA 3SBTA 2ASPA 3D2FA 3CQXA 1KC8O 3DXKB 4CZKA 1TUUA 3I8BA 5BPLA 2R82A 3O6WA 2A42A 4BRCA 1K9MO 1SGHA 3OHRA 4B1XB 5BRFA 4YOYA 2Q2RA 1S72N 3CJCA 1XUPO 5EOYA 4BRLA 3AARA 1HB8A 3A5NC 3GDQA 2FJ9A 3C65A 2RE2A 5KPZA 2NRZA 2WUSA 5BN9A 2EMSA 3U8ZA 3UKUB 3SMPA 3FLVA 3AU4A 4IEIA 2PBDA 5JLHA 4GV6A 4BR9A 4FWQA 4CBUA 2P9NB 2VGNA 5ADXH 1NTIA 3HRGA 3L6QA 3C6HA 1NMDA 4XH1A 4H0TB 3ULEA 3J7ZO 4C23A 1Y19B 3EKSA 2H3GX 2P9IA 2I1KA 5H1SQ 3QBXA 2KKZA 4MLEA 1T6DA 3SJHA 4K41A 2E2OA 1ISNA 3UKRA 1VQLN 3DAWA 4CD3A 5JVHL 1DT9A 2W40A 1NI2A 3H46O 4IJNA 5HOOA 3F2KA 3VOVA 3W0LA 1NJIO 2W41A 4KBOA 1VQNN 1YJNN 3LM2A 2E2NA 3PIPL 1HPMA 2E1ZA 4CBWA 1K73O 4M7XA 3BP8A 3LDQA 3ZX2A 3VGMA 4IFEA 4CZJA 5BREA 4QS7A 4G9ZA 2D11A 3VETA 4JKFA 1VQKN 5LJWA 4JKEA 2HBJA 4EKUA 3CCUN 2FXUA 2YHXA 2FLOA 4I6MA 5BR9A 5C2FA 1S3XA 3DLLL 1QQMA 4JHDB 3WXKA 3A5MC 1SS6A 1BDGA 3WXLA 4L3QA 3VENA 1XC3A 2HF4A 3GE1A 3ID6A 3HOSA 3DXMB 2V7YA 1ATRA 5M1KA 3FZMA 3M3ZA 2GWKA 1Q86O 2FF6A 3P38A 1V4SA 1JDEA 4BRKA 4Z94A 4XEIA 4UY8O 3ZETB 3E9LA 1YUWA 1Q18A 2YJEA 2ZGZA 3Q7CA 2Q0RA 4JKHA 4JKDA 3U7DA 2ASOA 3VEXA 4A59A 5AZIA 4GNIA 3CF5L 3CQYA 3CPEA 3LDLA 2I7NA 3CETA 3NVKA 1HBKA 1J19A 1ST7A 2AEHA 2HBKA 1MDUB 5DM6L 1BUPA 2WH5A 1GLEG 3Q7BA 4EHTA 1NGEA 4K43A 4AM6A 1BO5O 2P9PA 3L0QA 1HB6A 1NVLA 4A62A 4BG9A 5JLFA 2ZJPL 3GBTA 4BRGA 3CCVN 3OW2M 3MN6A 4OPAA 5EXWA 2RHKA 5F2RA 3WXIA 5M1PA 2HOEA 2ZJQL 3R3LA 1MK7B 5BPMA 2VGMA 2OANA 4CZHA 4LC9B 2KHOA 1GLDG 1NGHA 4YDUC 1VQPN 2F9TA 4DCHA 1Q7YO 2QWOA 4WF9L 4JKGB 3N4PA 4H0VB 4ILGB 4EAHD 2D10A 1NGIA 4RTFD 4B1VA 3ZEUA 3EL2A 1T3VA 3VF2A 3CCLN 4BY9C 5GADP 3VEZA 1NLVA 3T7ZA 5AQTA 2KLAA 3O9TA 1RDUA 2HBMA 3LM9A 3CCMN 5E84A 4BC5A 2J0KA 1Q81O 4ISGA 3UE5A 5AZJA 3BF3A 3D2EB 3CC7N 1NGGA 3BINA 3ZX3A 3QDKA 4BC3A 5C15A 4A5BA 3ATVA 3CI5A 5LY3A 3G4SN 5BRDA 3R1XA 5F0XA 5GIPA 2EMTA 5M1FA 2DIKA 3QBWA 1X3MA 1GLBG 1WUAA 3C7NA 2P9LB 3EE8A 3WQUA 2HF3A 3HI0A 4WYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILG B;  4ILJ A;  3E66 A;  4ILH A;  4JKC A;  3E9P A;  3ENB A;  4JKE A;  4JKF A;  4JKH A;  4JK8 A;  3SBG A;  4JKG A;  4JK9 A;  4JKB A;  3SBT A;  3E9O A;  4JK7 A;  4JKA A;  3E9L A;  4JKD A;  4JKG B; 
#chains in the Genus database with same CATH topology
 1D5A A;  4IG3 A;  4FWO A;  3SUQ A;  2QWM A;  2D2Q A;  5GAE P;  1HNV A;  3OBW A;  2IOC A;  5ELZ A;  2FF3 B;  4MLH A;  3G71 N;  1XQS C;  2Y1I A;  1GLC G;  2VYP A;  3VQ9 A;  3SPZ A;  1S9E A;  1YVU A;  3AVC A;  3QFU A;  4WE1 A;  1HPZ A;  2NRT A;  5AQH A;  4E7J A;  4BRO A;  1IBM K;  2OYQ A;  1Z05 A;  3CHW A;  2E1Y A;  2GEL A;  3GOI A;  3O3H A;  1RT6 A;  3ENO A;  3K5L A;  4JD2 A;  2YNF A;  4QAG A;  3OBY A;  1LAW A;  3TAF A;  2CH5 A;  4YOT A;  2EWS A;  4BVO A;  3CJA A;  1ZC6 A;  1MU2 A;  1REV A;  1X9J A;  3SPY A;  5JS2 A;  2OPP A;  3OYL A;  2PFU A;  4DLE A;  1ZYQ A;  5FRM A;  4H5T A;  3THY B;  3VA0 A;  3CC2 N;  1SL0 A;  1WAF A;  4AIL C;  1HLU A;  4FOI A;  3VTH A;  1NK9 A;  3SBG A;  1EKE A;  3KWI A;  3OJS A;  2QWP A;  4JK9 A;  3RWU A;  1WSF A;  4ZRJ A;  2O4G A;  4JN4 A;  2P9S A;  1X3N A;  4CES A;  2HHT A;  2V51 B;  3MX2 A;  4DQP A;  4J8F A;  1ATN A;  3SUP A;  4JHD A;  2A41 A;  2NZT A;  3TSQ A;  3O4Q A;  4AHC A;  4C1N I;  4IDH A;  4KH5 A;  1RDD A;  4PL8 A;  4KI4 A;  2P51 A;  4CJ5 A;  3OYI A;  4JI0 K;  3EZ5 A;  3DOL A;  4JEP A;  1G99 A;  3JS6 A;  3QNN A;  1NJW A;  1S6Q A;  4MQ3 A;  4NB4 A;  3L4Q A;  4CI6 A;  2Q1N A;  3RRH A;  3NH2 A;  4K0K K;  2B5J A;  1BA1 A;  4CJK A;  3WT0 A;  2KW4 A;  4IWV A;  3HPH A;  3ZSR A;  4CFC A;  2B4J A;  4CE9 A;  4CK2 A;  2G8F A;  4U67 L;  1ZXO A;  4WCE L;  1WNS A;  2ZPY A;  1VSF A;  3R9P A;  4IFV A;  5JVL A;  4DB3 A;  1QQN A;  1NU0 A;  1KAX A;  3DRR A;  4C8K A;  2O8C A;  4FJG A;  2J4R A;  4JKG A;  1YF5 L;  4OPH A;  1SL1 A;  4AHS A;  5BPN A;  3C6A A;  2CH6 A;  3TU5 A;  3VEY A;  2PAV A;  3VEO A;  1JLC A;  3VQQ A;  4DTR A;  5AQS A;  4JI7 K;  1CLQ A;  3TAP A;  3QEP A;  3VER A;  4FJM A;  1SKW A;  2VG7 A;  1C0F A;  5AZJ B;  4FWN A;  4M3R A;  3E9P A;  1U6Z A;  4C1N K;  1QQO A;  3ZSX A;  3L2R A;  4FJ9 A;  1RT2 A;  3TAM A;  1IKY A;  5CY4 A;  3LWL A;  4CHY A;  3LP2 A;  3O8M A;  1XNQ K;  1B9F A;  2PYL A;  1VSK A;  1EF1 A;  3NH0 A;  1QSY A;  3QIC A;  4MO5 A;  4B3M K;  4FWR A;  4FJI A;  3E66 A;  1NG9 A;  2CGL A;  4RW7 A;  4CEA A;  4I9Q A;  3TTF A;  1NOY A;  1TKT A;  1BIS A;  3O4W A;  2G8V A;  4KHY A;  3LWM A;  3SMS A;  3AO4 A;  3CYM A;  4DR6 K;  3KVG A;  4BR2 A;  2P9N A;  2O8E A;  4KHQ A;  3DI6 A;  4BRP A;  4OGC A;  4LF4 K;  3O4N A;  1TL3 A;  4JD2 B;  4ILJ A;  1BL3 A;  3CM5 A;  4BQL A;  4PWD A;  3P1G A;  1TAQ A;  4C8N A;  2BH1 A;  2J0M A;  5AQJ A;  3HT3 A;  1VRT A;  3OTO K;  2AA4 A;  4CJ7 A;  1ILY A;  2GX9 A;  2QWN A;  3AAP A;  5KQ8 A;  1VBG A;  2I1J A;  3D7E O;  4R79 A;  4J2A A;  5AFU A;  4M3U A;  1RDW X;  4CZF A;  3TPQ A;  1XHZ A;  2ASM A;  5IT9 O;  4CHQ A;  2KZM A;  1QVG M;  1S1W A;  2P9S B;  3P31 A;  4H0Y B;  4NLC A;  1HJO A;  4IG0 A;  1KQS M;  1RTH A;  1TV6 A;  4ISE A;  4B1Z A;  1J53 A;  3PSI A;  1I3A A;  5CZ2 A;  4BRH A;  3C95 A;  2D0C A;  3JSM A;  1VQ5 N;  2GBZ A;  4CGG A;  1VSM A;  1S1U A;  1RGI A;  3OVN A;  5AQQ A;  4BWM A;  1L3T A;  1KRP A;  1GOC A;  2UUA K;  3MN7 A;  1N33 K;  3SI6 A;  3MAQ A;  4FSV A;  4DTN A;  3DYA A;  4LF8 K;  1LWF A;  5EVZ A;  2RKI A;  3OYB A;  1LCU A;  3AU5 A;  2P9P B;  1N8R O;  3KK7 A;  4PL7 A;  3TAE A;  1GC7 A;  2P9U A;  4IJA A;  3SV3 A;  3GL1 A;  1BCO A;  3V9X A;  4CZM A;  3H6E A;  3P39 A;  3FZH A;  3CQ8 A;  3SV4 A;  4CEQ A;  4B08 A;  4Z4G A;  4JS5 A;  4BG8 A;  3P4I A;  1R59 O;  2HBL A;  2X6S A;  3P5J A;  4GKK K;  4GV3 A;  3AVA A;  1CZA N;  2VWK A;  4B8C A;  2IVN A;  3FGU A;  3TSU A;  2I7P A;  1R0A A;  5J1E A;  3HST B;  4E7K A;  4IBN A;  3U4L A;  2GUP A;  2V52 B;  2E20 A;  4OKJ A;  3RRG A;  2BUP A;  4NCB A;  3JYT A;  3R8E A;  4M45 A;  4F2R A;  3CCJ N;  2FBX A;  1QZ5 A;  4EP5 A;  1HQU A;  3AO5 A;  2GEM A;  4FCY A;  4W5T A;  1J5E K;  3CIP A;  1KXP A;  3L3U A;  4CIG A;  2YJF A;  4I9L A;  4M3W A;  3TAB A;  1S5J A;  4A5A A;  4XIU A;  1TKX A;  1JLB A;  3EKU A;  3KK1 A;  2GWJ A;  2QWQ A;  1U45 A;  3MX5 A;  3U9D A;  1RT5 A;  1Q9X A;  4CF1 A;  2DFH A;  5KGW A;  3S41 A;  3I55 N;  3IVF A;  3CFP A;  3HTV A;  3JAM O;  3CJ7 A;  3FZL A;  2FSJ A;  4WFN L;  1XI1 A;  1Q82 O;  2NUB A;  2AL6 A;  2FBV A;  4CHO A;  2FSN A;  3WXM B;  1RDC A;  3IAY A;  3VQ7 A;  4KH4 A;  5AQW A;  4IOC L;  2G8K A;  5EY4 A;  5FPD A;  3WEE A;  1LW2 A;  2IS3 A;  3I8B A;  1NNE A;  3TAR A;  3DLR A;  2UXB K;  2KFZ A;  4O0I A;  4B1X B;  3WNE A;  2Q3S A;  5EOY A;  4BRL A;  3A5N C;  3GDQ A;  3SQ1 A;  1JL1 A;  4M3Y A;  4B9U A;  2EMS A;  2AJQ A;  4AHR A;  3WNH A;  1WBB A;  4Q5V A;  4ZTJ A;  2P9N B;  4J2E A;  4O0J A;  1NK7 A;  4XH1 A;  3J7Z O;  3AVJ A;  3EKS A;  2WON A;  1FXX A;  1OH7 A;  4OX9 K;  2G8I A;  4DTP A;  2E2O A;  1ISN A;  4CD3 A;  2W40 A;  4BDZ A;  3M8R A;  3C6U A;  4J2B A;  3F2K A;  2VQF K;  1NJI O;  3U6F A;  3PIP L;  1NJZ A;  4M7X A;  3BP8 A;  4JI5 K;  2HHH K;  5BRE A;  4QS7 A;  4CEZ A;  1XMO K;  5LJW A;  4EKU A;  1F21 A;  2YHX A;  4I6M A;  5T7B A;  4DTJ A;  4CGH A;  3WXK A;  4JRQ A;  4DTM A;  1ZBL A;  3VQB A;  2IAJ A;  3GE1 A;  3ID6 A;  3MXI A;  1WSG A;  2GWK A;  1NKB A;  3P38 A;  1V4S A;  2UUC K;  4BRK A;  4Z94 A;  4B9N A;  4XEI A;  4UY8 O;  3AA2 A;  4EZ9 A;  4CJ4 A;  4O4G A;  1EP4 A;  4JKH A;  4JKD A;  4G1Q A;  3D0P A;  4GNI A;  3LDL A;  4KRE A;  1HBK A;  2AEH A;  2HBK A;  1RT4 A;  4FJH A;  1HB6 A;  4DV3 K;  1NK4 A;  5EXW A;  2RHK A;  3ZSQ A;  5M1P A;  5CYM A;  1HYS A;  2HOE A;  3R3L A;  1QQC A;  5BPM A;  1HRH A;  4CZH A;  2KHO A;  1VQP N;  1NMN A;  4DCH A;  3OS0 A;  3OYM A;  4KFB A;  3ZT2 A;  3I8D A;  2YNG A;  3ZEU A;  3QEI A;  3T7Z A;  1RDU A;  2HBM A;  2QXF A;  1Q81 O;  4E19 A;  4DF8 A;  3UE5 A;  1YTA A;  3BF3 A;  4JLH A;  1NGG A;  3BIN A;  5C15 A;  4Y1D A;  4A5B A;  4DV7 K;  5M1F A;  1IH7 A;  3EE8 A;  4OJR A;  4BAC A;  2HF3 A;  1VSJ A;  4Z4H A;  4DR7 K;  4YOU A;  4E7H A;  4BRN A;  1HKG A;  3K5N A;  5ADX A;  5KPT A;  4LF7 K;  1TKZ A;  5AQI A;  1KVB A;  2FBT A;  3KK2 A;  4PA1 A;  3BDP A;  1E3M A;  4FWK A;  4BR0 A;  3SAF A;  1VRU A;  4K25 A;  3ZDT A;  5AQY A;  1ZBH A;  4IZ9 A;  3RMA A;  1YI2 N;  2HNY A;  4IFY A;  3VEW A;  3A5L C;  4DQ8 A;  1RT3 A;  5M1N A;  2V7Z A;  2XY7 A;  4KH6 A;  2KFN A;  2RN2 A;  3VEV A;  4CJL A;  4HUG A;  4JAX A;  4BRF A;  4H0X B;  4F4K A;  4BVP A;  3W3D A;  1NGC A;  4CHP A;  1P8Z A;  4CW7 B;  5TKY A;  4FVM A;  3WNG A;  5FPE A;  3DWL A;  5AQR A;  4BRM A;  4CZE A;  4W5N A;  4HCC A;  4JS4 A;  4LD0 A;  3QO9 A;  1WB9 A;  3L2V A;  1RIL A;  2ZWH A;  3MDQ A;  4WQ5 C;  3OYA A;  1SAZ A;  1Z6R A;  1L3U A;  4CJP A;  1GLL O;  3LDS A;  5M1Q A;  4WFA L;  1EWQ A;  5J2N A;  2Q31 A;  1P90 A;  2FSK A;  3L2Q A;  2HHW A;  1Y64 A;  2BAN A;  4JKB A;  1NK0 A;  2OTL N;  4NYN A;  2O8B B;  5D3G A;  4YOX A;  4I6M B;  1VQ8 N;  3WA0 A;  2O8D A;  1E5W A;  1X1P A;  3AO3 A;  4BRE A;  1TK0 A;  4KHU A;  3LPT A;  1OVY A;  4LF9 K;  1N5Y A;  1SV5 A;  4FYD A;  2XRI A;  3TTD A;  3G25 A;  1NBW A;  1D4X A;  2QEX N;  1SQK A;  4B1U B;  2O8F A;  4HDQ A;  4CEE A;  3O9U A;  2ABD A;  4OPK A;  5A2Q O;  2DFE A;  2YHA A;  3U8X A;  5HRP A;  4O5B A;  2QKK A;  1CZB A;  4LF5 K;  2IIR A;  4ELT A;  4IO8 A;  2HNZ A;  3UIQ A;  4CF8 A;  1YJW N;  2YCH A;  3L3V A;  3LDN A;  1UA0 A;  3AVB A;  3CFO A;  3EE9 A;  2D0P A;  4DKW A;  5J2P A;  4DXA B;  5IJM A;  4DV5 K;  4H0P A;  2ZM6 K;  5EX5 A;  3TTC A;  2FBY A;  4AHT A;  3PX4 A;  1EXQ A;  3HPG A;  3OYC A;  3PSF A;  1S72 N;  4CZL A;  1ZBS A;  3MN5 A;  3AA3 A;  1U47 A;  5M1O A;  3QEX A;  4E89 A;  2P9L A;  5B8H A;  2HHU A;  3MEG A;  2EHG A;  2ITM A;  1U2V A;  1KD1 O;  2YVC A;  3VQP A;  1LWC A;  2X6N A;  1YAG A;  1B9D A;  4MO4 A;  2KZZ A;  3SUO A;  1TK8 A;  3VTI A;  3FE1 A;  4KTQ A;  5C12 A;  5GAG P;  4AH9 A;  1RDB A;  4YY3 K;  4CED A;  4YOV A;  2IDO A;  3VGL A;  3OYJ A;  3M8Q A;  4DQS A;  3SNN A;  4BRI A;  3FFI A;  2E2P A;  4FK0 A;  3D2F B;  4FJX A;  1VQO N;  3MEC A;  4PHT X;  3K57 A;  4FLV A;  1QVF M;  1OH5 A;  2DFF A;  3VGK A;  3UKU A;  1W7A A;  5FDL A;  2D5R A;  2YHB A;  3ZT4 A;  3ZT3 A;  3U3G A;  4KTW A;  3D45 A;  3DLG A;  4ID1 A;  4HTU A;  1FKO A;  5JIC A;  3AAQ A;  5C10 A;  5GIO A;  3AO1 A;  3IUC A;  3PUF A;  1VQ7 N;  2WBN A;  1Q9Y A;  1C0M A;  4CD1 A;  4GMJ B;  3ULD A;  3M1F A;  3DMJ A;  2HHQ A;  1XC9 A;  2YNI A;  3UB5 A;  4FLX A;  5CR4 A;  5JVG L;  4B9L A;  4HTL A;  3M6G A;  1QE1 A;  1S1X A;  4LY7 A;  3KIO A;  1KTQ A;  3EO3 A;  5FLX O;  1JLE A;  1LAV A;  3NAE A;  2ZJR L;  1WSI A;  3FZK A;  1ATS A;  5AQK A;  1VBH A;  3DXM A;  3HM8 A;  1ZBI A;  4KTZ A;  5AJ3 K;  3HP9 A;  4MDB A;  4FJJ A;  3ZET A;  4CHZ A;  4CZG A;  3KLE A;  4FJK A;  1MWK A;  1RTJ A;  2O8D B;  4DSK A;  4FWS A;  4DQQ A;  2GTD A;  3KLI A;  2F8T A;  2CQU A;  1KAY A;  4F9O A;  4DSF A;  4BC4 A;  2HMP A;  3LDP A;  3MK6 A;  4KHW A;  1T6C A;  1NM1 A;  4C8L A;  3H45 C;  1KLN A;  4CHN A;  5KGX A;  4N56 A;  3SZ2 A;  3KLF A;  4GXB A;  2HRJ A;  1OVQ A;  2O8F B;  4ZRK A;  5KI6 A;  1FJG K;  4M63 C;  2XHB A;  3MCA B;  1W2B M;  2OPQ A;  5EU7 A;  4PKG A;  4N47 A;  1HNW K;  3F9M A;  1UA1 A;  1IBK K;  3ZX0 A;  3NBP A;  3H3N O;  4ICL A;  2G8U A;  2YI1 A;  5C25 A;  3N4Q A;  5CHI A;  1RFQ A;  4W5Q A;  4DR4 K;  1MWM A;  3L2W A;  5AQP A;  3S3M A;  2X0S A;  3D2E A;  3AVM A;  2BTF A;  1RBS A;  5HP1 A;  3OYE A;  2E6L A;  4NXM K;  4W5O A;  3CCQ N;  2CB8 A;  1EO1 A;  3MXJ A;  3SJJ A;  4H4O A;  3F5T A;  3KD5 E;  1NJX A;  3BF1 A;  4WQ5 A;  5KQD A;  3PZD A;  3IMX A;  2E88 A;  1NWK A;  3FZF A;  4JKA A;  5E41 A;  4V19 S;  3OS2 A;  4A2A A;  4IXC A;  1O13 A;  3OYN A;  3NHG A;  2W6K A;  4BRQ A;  4HVJ A;  4OPJ A;  1XWL A;  4JRP A;  4JI4 K;  4RW4 A;  3ZT0 A;  4DR2 K;  4OO1 J;  2NRR A;  2ASP A;  1KC8 O;  1JLF A;  1K9M O;  2A42 A;  1SGH A;  4JI8 K;  3RMC A;  3AAR A;  1HB8 A;  2RE2 A;  3HL8 A;  4FM1 A;  1A5V A;  2ATQ A;  1X9S A;  3NCI A;  3U8Z A;  3UKU B;  1ASW A;  4IEI A;  5JLH A;  4B3S K;  2PBD A;  2VGN A;  5ADX H;  1NTI A;  1JXE A;  1O1W A;  3QLH A;  5KRT A;  1Y19 B;  3UKR A;  4IJN A;  1C1A A;  1LWE A;  3W0L A;  1CXQ A;  2EX3 A;  2W41 A;  4RW9 A;  3LM2 A;  4DU3 A;  1SKS A;  2Z1I A;  3ZX2 A;  1WBD A;  3I0S A;  3LDQ A;  3ZSY A;  2VQE K;  3THW A;  2D11 A;  1VQK N;  4JKE A;  4X65 K;  4DSE A;  3V1R A;  1S3X A;  3V4I A;  4JHD B;  4BE0 A;  2XY6 A;  4L3Q A;  2HF4 A;  4F3T A;  3HOS A;  3DXM B;  2V7Y A;  5M1K A;  3M3Z A;  2F4V K;  2FF6 A;  3L8B A;  3ZET B;  2ZGZ A;  3AO2 A;  3Q7C A;  2HB5 A;  5FRO A;  3VEX A;  4CJT A;  3CQY A;  2HHV A;  1EWR A;  5DM6 L;  2DY4 A;  3V81 A;  1GLE G;  4EHT A;  3DRP A;  1NGE A;  4K43 A;  4DQR A;  4B3O A;  1BO5 O;  1BCM A;  4BG9 A;  5JLF A;  3GBT A;  4BRG A;  1XNR K;  3ZCM A;  5F2R A;  4LC9 B;  4YDU C;  2O8C B;  4DR1 K;  1Q7Y O;  4WF9 L;  4CJR A;  4JKG B;  3N4P A;  1XMQ K;  2D10 A;  4RTF D;  3EL2 A;  2X74 A;  4OLA A;  5AQT A;  5J2Q A;  1C1C A;  3O9T A;  3DLH A;  3CCM N;  1UWB A;  1IBL K;  4CIF A;  2W6L A;  1S1T A;  4ISG A;  1DTT A;  3D2E B;  1TAU A;  3PY8 A;  4AHV A;  2YV0 X;  2B6A A;  4CF2 A;  3KJV A;  5BRD A;  3R1X A;  1GLB G;  1WUA A;  3C7N A;  4DSL A;  4CJ3 A;  3LP0 A;  4B8A B;  4DTU A;  2HST A;  1LW0 A;  3WQT A;  4EHU A;  3QNO A;  3VPZ A;  3G10 A;  1T03 A;  4M3Z A;  1WSE A;  1H4R A;  2ITG A;  4JV5 K;  1JLA A;  2Y1J A;  3L4I A;  4JI6 K;  2IVO A;  4B9T A;  5DK5 A;  5AR0 A;  4EIA A;  4FZX C;  1MK9 B;  4KPY A;  5DMR A;  5TKW A;  3LL3 A;  4GVE A;  1FK9 A;  5HLF A;  1BIU A;  1DKG D;  3O3F A;  4RCH A;  1M90 O;  3JXU A;  2KQ2 A;  4MDA A;  5CZ1 A;  1JJ2 M;  2HW3 A;  2PZS A;  4CCH A;  2P5O A;  4LFA K;  2ZQB A;  4FJ8 A;  3HSC A;  5C0Y A;  4FLY A;  2O8E B;  4CYE A;  2VCP A;  1XHX A;  2F9W A;  4BC2 A;  1VSH A;  4OGE A;  5I3U A;  2QM1 A;  4BRA A;  3VF6 A;  1MA9 B;  4R5P A;  3IFR A;  2NRW A;  4KB1 A;  5HBM A;  5F1X A;  1JLG A;  3ZSO A;  3J81 O;  1VQM N;  3KD1 E;  1JCF A;  1VQ9 N;  1BA0 A;  4ILH A;  2QWL A;  3DLK A;  3UKR B;  5I9E B;  3A2F A;  4Z4C A;  3F73 A;  1IG8 A;  2QA4 N;  3NH1 A;  4DHY A;  1WSJ A;  2GUI A;  1QZ6 A;  5AQU A;  4DV0 K;  3GG4 A;  2HHX A;  1GGO A;  3KZB A;  3THW B;  5AQZ A;  3AVI A;  1BGX T;  5AQO A;  3OYH A;  2G8H A;  4GW6 A;  1NGF A;  3CMA N;  3OYK A;  3AVL A;  1LV5 A;  4AF1 A;  3BUZ B;  1QS4 A;  3C0B A;  4O8K A;  2P5G A;  4CFA A;  2UU9 K;  1TYQ A;  3ATU A;  4I2Q A;  4BGB A;  1BI4 A;  3HOT A;  3E9O A;  2UUB K;  1RDA A;  2Q0U A;  3VA3 A;  4E3S A;  4BE1 A;  2P9U B;  4CBX A;  4WQ4 A;  1SKR A;  4TSX A;  3EZW A;  1D8Y A;  3J7A P;  1GOA A;  3CCE N;  4FWL A;  5LL6 Z;  4Z4E A;  1ASU A;  3O9R A;  4NLB A;  1HNX K;  3CME N;  4I2P A;  4WFB L;  3VN5 A;  1QTM A;  3G6E N;  3EPY A;  1Z25 A;  1C0U A;  4B1W B;  3OYF A;  1VAZ A;  3CER A;  3SQ4 A;  4MFB A;  1MIZ B;  2COP A;  3NF7 A;  4NO7 A;  4H5R A;  4H03 B;  1ZBU A;  3WUH A;  2QXL A;  2I5J A;  5AQF A;  3K2P A;  4U7B A;  4Q0B A;  4FLW A;  2LBB A;  1DTQ A;  1TL1 A;  2Q36 A;  4FVU A;  5KPR A;  3FLC O;  3CJ9 A;  2A40 A;  2F96 A;  3ENB A;  4YOR A;  3TAG A;  4JK8 A;  3O5B A;  4O8U A;  2W42 A;  3SYZ A;  2AP1 A;  3C7N B;  4UQG A;  4Z0U A;  3FFK B;  5AQX A;  4LF6 K;  3SQ2 A;  4EZ6 A;  2D0B A;  1YHQ N;  3J7Y P;  3CJB A;  1WSH A;  3K5M A;  3PX6 A;  3C6T A;  3KWG A;  1C6V A;  4QOZ B;  2RPI A;  3QFP A;  3OY9 A;  4YOW A;  3NF8 A;  2E6M A;  3DXK A;  3OYG A;  1YXQ A;  4HUE A;  3WEE B;  4H5W A;  4TKN A;  3MMV A;  4CF9 A;  1HUX A;  4H0O A;  3E1Y A;  4ZTF A;  4NCA A;  3HJF A;  3S3N A;  3KK3 A;  3CCS N;  1J54 A;  3V9U A;  1HNI A;  4FPB A;  1I94 K;  3V6D A;  3MXM A;  3ZLJ A;  3SLC A;  1NK8 A;  1HMV A;  4DFK A;  4L8R B;  3E01 A;  1IV0 A;  3AVG A;  3ZSZ A;  4H5V A;  3NMU A;  2BE2 A;  2NNW A;  4IKF A;  4NCG A;  3B8A X;  2QKB A;  4DS5 A;  4B9S A;  3VQ8 A;  4FLU A;  4YDU A;  3THY A;  2HE7 A;  1UAX A;  3EYZ A;  2GV9 A;  4FW2 A;  4CJE A;  4CEB A;  3A8Y A;  4GY2 B;  4M3X A;  2WC9 A;  3ASM A;  1QSS A;  4QCL A;  4M41 A;  3CM6 A;  1RBU A;  4B1Y B;  2NLX A;  4DS4 A;  1H1V A;  3LAM A;  1U49 A;  1JCE A;  1S6P A;  1BWF O;  4FZY A;  1BQN A;  2LSN A;  4KO0 A;  3KHY A;  4RW8 A;  2YHY A;  4NYF A;  3QIJ A;  4DV1 K;  4ELV A;  3HP6 A;  2HHS A;  4HUF A;  1RT1 A;  3K9J A;  2QWR A;  3CXC M;  1IO2 A;  3TSP A;  1GG3 A;  2D1K A;  4ID5 A;  3AVH A;  1D9D A;  1VSE A;  1SZ2 A;  4CGJ A;  2XO7 A;  3V9W A;  5C2D A;  5AFU H;  3NGY A;  2F8S A;  4JI3 K;  1TYQ B;  1BOT O;  1NKE A;  3PO4 A;  3KLG A;  3U9Z A;  4E0D A;  1K6Y A;  5LMU K;  1IG9 A;  4FZZ A;  4J2D A;  3VQE A;  2WFB A;  4DWI A;  4N76 A;  3HVR A;  3AGR A;  3CFR A;  1YVN A;  3THX A;  3K59 A;  3CG7 A;  4RG8 A;  3NF6 A;  4FJL A;  4KHP K;  4BR5 A;  1E4F T;  4E1J A;  3ZEU B;  3WXJ A;  4H5N A;  4IOX A;  2QI2 A;  1BG3 A;  3FP5 A;  1KVC A;  3G9W A;  1A5X A;  3TAQ A;  4DV2 K;  4IOA L;  1ACA A;  2RQ1 A;  3ZSW A;  3X23 A;  1ESV A;  4HCB A;  1BHL A;  1T44 A;  4EFH A;  1GOB A;  3PO5 A;  1IJJ A;  3SAH A;  2ZF5 O;  3QIN A;  1GLJ O;  5C42 A;  3OA9 A;  4QS9 A;  1ZBF A;  3IDH A;  1RCH A;  1HX1 A;  4DLG A;  1DIK A;  3RSE A;  4P7I A;  1W97 L;  3SCX A;  2O4I A;  2YKM A;  1LOT B;  1HKC A;  3RVC A;  2QW9 A;  4OKE A;  1KFS A;  4Y1C A;  4BGA A;  3SK3 A;  1N34 K;  3T1H K;  3RTV A;  3CQX A;  1RBR A;  3DXK B;  4CJS A;  1C1B A;  4JI2 K;  2HVI A;  5BRF A;  2Q2R A;  4Z4I A;  3QEV A;  1X9W A;  2RF2 A;  4DFJ A;  2FJ9 A;  3C65 A;  5KPZ A;  3KLH A;  3KTQ A;  2NRZ A;  2WUS A;  5BN9 A;  4AQY K;  4N5S A;  3FLV A;  4GV6 A;  2ZE2 A;  4CEC A;  4FWQ A;  3HRG A;  2A1R A;  4RW6 A;  1NMD A;  2HMI A;  3ULE A;  4H0T B;  4ZHR A;  2YNH A;  3IS9 A;  2P9I A;  5H1S Q;  2VWJ A;  2KKZ A;  4MLE A;  3SJH A;  1FKP A;  3DLE A;  5J2M A;  3LAK A;  3QIO A;  5JVH L;  1DT9 A;  4CGF A;  1W9H A;  5HOO A;  3IRX A;  1VQN N;  2WOM A;  1YJN N;  4DQI A;  2E1Z A;  4CBW A;  3QEW A;  3TAN A;  3VGM A;  1HYZ A;  1QSL A;  2HBJ A;  2Z1J A;  5BR9 A;  4FW1 A;  1D9F A;  3DLL L;  1QQM A;  4LFC K;  3A5M C;  1SS6 A;  2UXD K;  1BDG A;  3WXL A;  3LP3 A;  3HYF A;  3QIP A;  1ATR A;  4DR5 K;  1Q86 O;  3VQ6 A;  1JDE A;  4DU1 A;  1HYV A;  4H8K A;  4KHN A;  3HO1 A;  1RTI A;  1L5U A;  2Q0R A;  3U7D A;  2ASO A;  5AZI A;  3CPE A;  1S9G A;  2I7N A;  4LFB K;  1TKD A;  1ITG A;  1J19 A;  3TI0 A;  1BUP A;  3BZK A;  3Q7B A;  3PV8 A;  2P9P A;  1NVL A;  4A62 A;  1B92 A;  4LSL A;  4FJN A;  3OW2 M;  3T3F A;  3MN6 A;  3WXI A;  2ZJQ L;  1MK7 B;  5JS1 A;  2VGM A;  4CF0 A;  2OAN A;  1HJR A;  1GLD G;  1NGH A;  3F9K A;  5C24 A;  3THX B;  4B1V A;  1NGI A;  3O3G A;  1T3V A;  3VF2 A;  4BY9 C;  3VEZ A;  4B9M A;  3KKR A;  3LM9 A;  4CEF A;  4E7L A;  4C8M A;  4NXN K;  4OKK A;  3CC7 N;  4ELU A;  4BC3 A;  3ATV A;  3CI5 A;  3G4S N;  5F0X A;  3U3Y A;  2EMT A;  4CGD A;  1X3M A;  1QHT A;  3WQU A;  2P9L B;  3HI0 A;  3M8S A;  4WYB A;  5LMN K;  3NDK A;  3O9S A;  3V9Z A;  1U2V B;  4EP4 A;  4O5F A;  4RWT A;  3TR8 A;  4DF4 A;  1M1K O;  2FDQ A;  3HBT A;  2E2Q A;  1DGK N;  4WQ4 C;  2CGJ A;  2ZGY A;  5KTQ A;  2BDP A;  4H4M A;  1K8A O;  2NRV A;  3NGZ A;  4DSJ A;  3RSE B;  4XH5 A;  3MCP A;  1JCG A;  5FPM A;  1NK5 A;  3VES A;  2IC3 A;  2D0O A;  1I39 A;  4DFM A;  3K0S A;  2PYJ A;  1JKH A;  3CC4 N;  3EN9 A;  1J6Z A;  1NGA A;  3MEE A;  3PX0 A;  2UYT A;  5BR8 K;  4KV8 A;  3DRS A;  3ZSV A;  4DTO A;  3K9K A;  3I33 A;  4CER A;  1RBT A;  1YJ9 N;  2KTQ A;  2E8A A;  3AV9 A;  1A5W A;  2JWK A;  5AQL A;  4DTX A;  2Q97 A;  3CJ1 A;  3HPO A;  3H1Q A;  4JK7 A;  1U48 A;  2UXC K;  4AM7 A;  1VQ4 N;  3EEQ A;  4CVN E;  4F3O A;  1EQY A;  5AQM A;  1NGD A;  3A5O C;  3NVM A;  5HL7 L;  3OS1 A;  5GAH P;  4B3T K;  3ULE B;  2VWB A;  2P9I B;  4GV9 A;  1Y97 A;  2HND A;  5IWA K;  4JYA K;  2A3Z A;  3CPW M;  2OTJ N;  2ETJ A;  1QHA A;  3K58 A;  1GLF O;  5MLC Q;  3I56 N;  4A57 A;  1YT3 A;  4KKO A;  2CGK A;  3VQ4 A;  3B6O A;  4ZRI A;  3AY9 A;  4O44 A;  2A1S A;  3LPU A;  4ISF A;  1L3S A;  4N41 A;  2D4W A;  5CYQ A;  1FW6 A;  4LH4 A;  5AQG A;  4CEO A;  1OH8 A;  2J0J A;  3IKM A;  3HZ6 A;  3O1B A;  4OLB A;  2ZD1 A;  3OJU A;  1VSL A;  3LZJ A;  3P83 D;  4FL9 A;  1S22 A;  4FWM A;  1OH6 A;  3LZI A;  1BU6 O;  3K5O A;  4KAZ A;  3H08 A;  4I7F A;  2OZS A;  4YL8 A;  5AZI B;  3NE6 A;  3ID8 A;  1HKB A;  1KC7 A;  1TUY A;  4A61 A;  2VG5 A;  1WN7 A;  1OKJ A;  2IVP A;  1NK6 A;  1SL2 A;  4DMN A;  2DTU A;  1Z26 A;  1EET A;  1J9A A;  3CCR N;  4FK2 A;  3NGI A;  4FPA A;  4CJV A;  4Z4F A;  4JKC A;  4YFU A;  5FPN A;  4KB0 A;  4PKI A;  1KCF A;  3NFA A;  3AGK A;  5LJV A;  4DTS A;  2P9K A;  3RR8 A;  1JLQ A;  3M5R A;  3ZT1 A;  2A5X A;  4FOE A;  1IKX A;  4QS8 A;  1E4G T;  2OA8 A;  4W5R A;  2QTD A;  3VMF B;  2QK9 A;  4HWI A;  1NGB A;  3SUN A;  3CD6 N;  2YKN A;  5CE3 A;  4DV4 K;  4BR7 A;  3T69 A;  4X62 K;  3O08 A;  1WOQ A;  2YHW A;  4IO9 L;  3NF9 A;  3VQA A;  4DU4 A;  3MN9 A;  1C0G A;  3DLB A;  4CIE A;  4PY5 A;  1K8K A;  2WTU A;  1RNH A;  4HDO A;  4Y0W A;  4PKH A;  4IEE A;  3RMB A;  1S1V A;  1KBL A;  1KFD A;  5I42 A;  4DSI A;  2YX6 A;  1KLM A;  4C8O A;  4BWJ A;  3AA5 X;  5BN8 A;  3ZYY X;  1T7P A;  3MWT A;  4PUO A;  5E26 A;  2DPN A;  3DJC A;  1JXB A;  4CJF A;  4BDP A;  4A2B A;  5HRN A;  4CZI A;  3PIO L;  4FLT A;  3QER A;  4X66 K;  4CK3 A;  1GC6 A;  1VSI A;  1VK0 A;  2JGU A;  5K14 A;  1TGO A;  4NY0 A;  4M7Y A;  4KHS A;  2IGI A;  2P1J A;  4XH4 A;  3ENH A;  3BEX A;  1VQ6 N;  1W0H A;  3AVN A;  3O9Q A;  3IG1 A;  4BDY A;  1SUQ A;  1N6Q A;  4F8R A;  3LDO A;  3QML A;  4F7G A;  1NKC A;  3R6M A;  5DM7 L;  4E7I A;  3G0Z A;  3L2U A;  3H1V X;  3KKS A;  4CK1 A;  3AVF A;  4M3T A;  4LH5 A;  1EX4 A;  3S3O A;  4DR3 K;  1YTU A;  4FM2 A;  4JNE A;  3VQC A;  2OPR A;  4KRF A;  3QES A;  4YNQ A;  3O1W A;  2BGG A;  4OVL A;  3C94 A;  1U04 A;  1Q8I A;  5AQV A;  4AHU A;  2O8B A;  1U4B A;  4K8X A;  4DG1 A;  3D6R A;  1KAZ A;  2OZM A;  2PY5 A;  4BRD A;  4K42 A;  2F7T A;  2Z1G A;  3HXM A;  1GLA G;  3ALY A;  3ITH A;  3QB0 A;  4PQU A;  4CFB A;  4B9Q A;  5HRS A;  3T1A A;  2E4L A;  3SQ0 A;  4HHT A;  2D0A A;  2NRH A;  4K8Z A;  5GIN A;  3TWH A;  4BQZ A;  4O55 A;  1JL2 A;  1HNZ K;  4JI1 K;  1HR0 K;  1YIT N;  1NOZ A;  3PLA A;  3AA4 A;  3VF4 A;  1HQE A;  3I0R A;  3RMD A;  4CJU A;  4KI6 A;  1IKV A;  1TVR A;  3VQ5 A;  1CXU A;  2P9K B;  3A0I X;  4X64 K;  4FK4 A;  5JMV A;  4FM0 A;  5HRR A;  1NGJ A;  4FO0 A;  3J8A A;  1V4T A;  3H3O B;  5BRH A;  1YIJ N;  5AQN A;  4DUY K;  4FJ7 A;  2G8W A;  1MIX A;  2OPS A;  4M42 A;  2A6A A;  2R7Y A;  4GKJ K;  4IDK A;  5FRN A;  1K8K B;  5HRO A;  1TK5 A;  2JWL A;  4CGI A;  2X78 A;  4BE2 A;  2NRX A;  1WLJ A;  3PVL A;  3BY5 A;  2VG6 A;  5SZT A;  1DEJ A;  3FR0 A;  4BR4 A;  3WNF A;  3SAG A;  1RTD A;  1G15 A;  3MWP A;  1ASV A;  4FWP A;  3V1O A;  3O80 A;  3SBT A;  3D2F A;  4YHH K;  4CZK A;  1TUU A;  5BPL A;  2R82 A;  3O6W A;  4BRC A;  3OHR A;  4DFP A;  4YOY A;  3AVK A;  3CJC A;  3QET A;  1XUP O;  3OYD A;  1IKW A;  4B9V A;  4E1N A;  3S9H A;  4CJW A;  3SMP A;  3AU4 A;  3LP1 A;  1BIZ A;  4BR9 A;  3BGR A;  4CBU A;  2Z1H A;  4F2S A;  3L6Q A;  1KSP A;  3C6H A;  3DOK A;  1VHX A;  4C23 A;  2H3G X;  2I1K A;  3QBX A;  1T6D A;  4K41 A;  1X9M A;  1VQL N;  3DAW A;  1NI2 A;  3H46 O;  3THV A;  3VOV A;  1T05 A;  3BZC A;  4KBO A;  5KRS A;  2E2N A;  1HPM A;  1K73 O;  2XY8 A;  4CZJ A;  4IFE A;  3ISN C;  4G9Z A;  3VET A;  4JKF A;  3CCU N;  2FXU A;  2FLO A;  5C2F A;  1J5O A;  1VSD A;  4E1M A;  2XY5 A;  1T8E A;  1BQM A;  1C0T A;  3V9S A;  3VEN A;  1XC3 A;  1L3V A;  4DV6 K;  3FZM A;  4FJ5 A;  3E9L A;  1YUW A;  1Q18 A;  2YJE A;  1DLO A;  1CZ9 A;  3LAL A;  1N36 K;  4A59 A;  3CF5 L;  4GVM A;  3CET A;  3DM2 A;  4CFD A;  1BI4 B;  3NVK A;  1N32 K;  1ST7 A;  1MDU B;  2WH5 A;  3HVT A;  4AM6 A;  3L0Q A;  3T19 A;  5SWM A;  3LAN A;  2ZJP L;  3CCV N;  2FC0 A;  4OPA A;  1RBV A;  3V1Q A;  2JLE A;  2E5L K;  4FXD A;  2F9T A;  4FLZ A;  1KVA A;  3HM9 A;  1NJY A;  2QWO A;  2OCE A;  3EY1 A;  4H0V B;  4ILG B;  1UOC A;  4EAH D;  3M8P A;  3CCL N;  5GAD P;  1NLV A;  2KLA A;  2HVH A;  5E84 A;  4BC5 A;  2J0K A;  3VQD A;  3RR7 A;  1RT7 A;  5AZJ A;  4DUZ K;  3T1Y K;  4B3R K;  3ZX3 A;  4CJQ A;  3QDK A;  5LY3 A;  5GIP A;  4LSN A;  2DIK A;  3B6P A;  3QBW A;  3J80 O;  1WAJ A;  3HK2 A;  3MED A; 
#chains in the Genus database with same CATH homology
 3O9S A;  4YOU A;  1U2V B;  4FWO A;  2HST A;  2QWM A;  4O5F A;  1HKG A;  4BRN A;  2D2Q A;  3WQT A;  4EHU A;  4RWT A;  5GAE P;  5ADX A;  5KPT A;  1M1K O;  3OBW A;  5ELZ A;  3VPZ A;  2FDQ A;  1H4R A;  2E2Q A;  3HBT A;  1DGK N;  4WQ4 C;  2CGJ A;  5AQI A;  2FF3 B;  4MLH A;  3G71 N;  1XQS C;  2ZGY A;  3L4I A;  2IVO A;  1GLC G;  1K8A O;  2NRV A;  2VYP A;  3RSE B;  5AR0 A;  4EIA A;  4XH5 A;  1MK9 B;  3MCP A;  1JCG A;  4FWK A;  3QFU A;  4BR0 A;  3SAF A;  2NRT A;  4K25 A;  5FPM A;  5TKW A;  3LL3 A;  3VES A;  3ZDT A;  2D0O A;  5AQH A;  4BRO A;  4GVE A;  5AQY A;  1DKG D;  4IZ9 A;  4RCH A;  3CC4 N;  3EN9 A;  1YI2 N;  1M90 O;  1J6Z A;  3JXU A;  4MDA A;  1JJ2 M;  1NGA A;  3VEW A;  3A5L C;  4DQ8 A;  1Z05 A;  3HSC A;  2UYT A;  5M1N A;  3CHW A;  2V7Z A;  2E1Y A;  2GEL A;  3GOI A;  4KH6 A;  3K9K A;  3I33 A;  3VEV A;  5C0Y A;  3ENO A;  4JAX A;  1YJ9 N;  4BRF A;  4JD2 A;  2E8A A;  3OBY A;  4CYE A;  2JWK A;  2VCP A;  4H0X B;  5AQL A;  2F9W A;  3W3D A;  4BC2 A;  4BVP A;  1NGC A;  2CH5 A;  1P8Z A;  2Q97 A;  3CJ1 A;  5TKY A;  3H1Q A;  4JK7 A;  4YOT A;  4AM7 A;  2QM1 A;  1VQ4 N;  4BRA A;  2EWS A;  4BVO A;  3CJA A;  3VF6 A;  1ZC6 A;  1MA9 B;  5FPE A;  3DWL A;  5AQR A;  4BRM A;  4CZE A;  3IFR A;  1X9J A;  2NRW A;  2ZWH A;  1EQY A;  5AQM A;  1NGD A;  3MDQ A;  5F1X A;  2PFU A;  3A5O C;  3NVM A;  4WQ5 C;  5HL7 L;  4H5T A;  1VQM N;  5GAH P;  1SAZ A;  1JCF A;  3ULE B;  1VQ9 N;  3CC2 N;  1BA0 A;  2VWB A;  1Z6R A;  2P9I B;  4ILH A;  4GV9 A;  2QWL A;  1HLU A;  1GLL O;  4FOI A;  3VTH A;  5M1Q A;  4WFA L;  3SBG A;  2A3Z A;  3CPW M;  4FVU A;  3UKR B;  3KWI A;  5I9E B;  2OTJ N;  2QWP A;  2Q31 A;  4JK9 A;  1P90 A;  2FSK A;  1QHA A;  1Y64 A;  1GLF O;  1IG8 A;  4JKB A;  4A57 A;  5MLC Q;  4ZRJ A;  3I56 N;  4JN4 A;  2QA4 N;  2P9S A;  1X3N A;  4DHY A;  2CGK A;  1QZ6 A;  5AQU A;  2OTL N;  2V51 B;  3GG4 A;  3MX2 A;  1GGO A;  3KZB A;  1ATN A;  4J8F A;  5AQZ A;  4JHD A;  4ZRI A;  2A41 A;  3AY9 A;  2NZT A;  3TSQ A;  4YOX A;  4I6M B;  4ISF A;  5AQO A;  4C1N I;  3WA0 A;  2D4W A;  4IDH A;  4KH5 A;  1VQ8 N;  4PL8 A;  1E5W A;  4BRE A;  5AQG A;  1NGF A;  3CMA N;  1OVY A;  2J0J A;  4AF1 A;  3BUZ B;  3IKM A;  4JEP A;  1G99 A;  3TTD A;  3G25 A;  3C0B A;  3HZ6 A;  3O1B A;  4O8K A;  3JS6 A;  1NBW A;  1D4X A;  4FL9 A;  2QEX N;  1TYQ A;  1S22 A;  4NB4 A;  1SQK A;  4FWM A;  4B1U B;  3ATU A;  3L4Q A;  4BGB A;  4HDQ A;  1BU6 O;  4CI6 A;  3HOT A;  3O9U A;  2ABD A;  3E9O A;  2Q1N A;  4YL8 A;  5AZI B;  3ID8 A;  1HKB A;  3U8X A;  1KC7 A;  1BA1 A;  1TUY A;  2Q0U A;  4A61 A;  3WT0 A;  4IWV A;  1OKJ A;  2P9U B;  2IVP A;  4CBX A;  4WQ4 A;  3EZW A;  4U67 L;  1ZXO A;  4WCE L;  2IIR A;  2ZPY A;  3R9P A;  4FWL A;  3CCE N;  5JVL A;  4IO8 A;  4DB3 A;  3O9R A;  4NLB A;  3CCR N;  1QQN A;  1YJW N;  4FPA A;  2YCH A;  4JKC A;  3LDN A;  5FPN A;  4PKI A;  3CME N;  3AGK A;  1KAX A;  5LJV A;  2P9K A;  4WFB L;  3M5R A;  2J4R A;  3G6E N;  4JKG A;  3EE9 A;  3EPY A;  1YF5 L;  4OPH A;  2D0P A;  2A5X A;  4FOE A;  4B1W B;  4QS8 A;  1E4G T;  1VAZ A;  3CER A;  5BPN A;  4DKW A;  3C6A A;  1MIZ B;  2CH6 A;  3TU5 A;  2COP A;  3VEY A;  2QTD A;  4NO7 A;  3VMF B;  2PAV A;  3VEO A;  4H5R A;  4DXA B;  5IJM A;  4H03 B;  3WUH A;  4HWI A;  1NGB A;  2QXL A;  5AQS A;  3CD6 N;  4H0P A;  5AQF A;  5EX5 A;  3TTC A;  4U7B A;  5CE3 A;  4BR7 A;  2LBB A;  3T69 A;  3VER A;  2Q36 A;  4CZL A;  3O08 A;  1ZBS A;  1C0F A;  1WOQ A;  2YHW A;  5AZJ B;  5KPR A;  3FLC O;  4IO9 L;  4FWN A;  3MN5 A;  3CJ9 A;  3MN9 A;  2A40 A;  1C0G A;  3E9P A;  3ENB A;  1U6Z A;  4YOR A;  4C1N K;  1QQO A;  5M1O A;  4JK8 A;  2P9L A;  3O5B A;  4O8U A;  5B8H A;  1K8K A;  2ITM A;  1U2V A;  2AP1 A;  1KD1 O;  2YVC A;  4HDO A;  3C7N B;  4Y0W A;  1YAG A;  4PKH A;  3FFK B;  4IEE A;  3O8M A;  4MO4 A;  5AQX A;  1KBL A;  3VTI A;  3FE1 A;  1YHQ N;  2YX6 A;  3CJB A;  5C12 A;  5GAG P;  1EF1 A;  3KWG A;  5BN8 A;  3QIC A;  4MO5 A;  3MWT A;  3ZYY X;  4YOV A;  3QFP A;  5E26 A;  4FWR A;  3VGL A;  4YOW A;  3DXK A;  2DPN A;  3E66 A;  3DJC A;  1YXQ A;  2CGL A;  4BRI A;  2E2P A;  3WEE B;  4H5W A;  3D2F B;  3TTF A;  4TKN A;  4A2B A;  3O4W A;  3MMV A;  4CZI A;  3PIO L;  1HUX A;  4H0O A;  1VQO N;  3E1Y A;  4PHT X;  1GC6 A;  1QVF M;  3SMS A;  3VGK A;  3UKU A;  3CCS N;  4NY0 A;  4M7Y A;  4FPB A;  3ENH A;  3KVG A;  3BEX A;  4XH4 A;  4BR2 A;  2P9N A;  1VQ6 N;  3SLC A;  3O9Q A;  4BRP A;  3LDO A;  3QML A;  4JD2 B;  4F7G A;  4H5V A;  5JIC A;  3AAQ A;  4ILJ A;  4BQL A;  3R6M A;  5C10 A;  5GIO A;  5DM7 L;  3IUC A;  3NMU A;  1VQ7 N;  2WBN A;  2BH1 A;  3H1V X;  2J0M A;  2NNW A;  5AQJ A;  3B8A X;  4CD1 A;  2AA4 A;  3M1F A;  4CJ7 A;  1ILY A;  2GX9 A;  4YDU A;  2QWN A;  2HE7 A;  3AAP A;  4JNE A;  3UB5 A;  5KQ8 A;  1VBG A;  2I1J A;  3D7E O;  5CR4 A;  5JVG L;  4HTL A;  3O1W A;  3M6G A;  4R79 A;  3A8Y A;  4GY2 B;  5AFU A;  2WC9 A;  1RDW X;  4CZF A;  3TPQ A;  3EO3 A;  4B1Y B;  2ASM A;  2NLX A;  2ZJR L;  1H1V A;  3FZK A;  5AQV A;  1ATS A;  5AQK A;  1VBH A;  3DXM A;  1JCE A;  3HM8 A;  1QVG M;  2P9S B;  3P31 A;  4H0Y B;  3D6R A;  1HJO A;  1KAZ A;  4MDB A;  4NLC A;  1BWF O;  4BRD A;  4K42 A;  3ZET A;  1KQS M;  4CZG A;  4ISE A;  4B1Z A;  2F7T A;  3KHY A;  1GLA G;  2YHY A;  1MWK A;  4BRH A;  3QIJ A;  1VQ5 N;  4FWS A;  3QB0 A;  1RGI A;  2GTD A;  5AQQ A;  3K9J A;  2CQU A;  1KAY A;  2QWR A;  4F9O A;  3CXC M;  4BC4 A;  2HMP A;  3LDP A;  1GG3 A;  3TSP A;  2D1K A;  3MK6 A;  4B9Q A;  3MN7 A;  1T6C A;  1NM1 A;  1SZ2 A;  3H45 C;  5C2D A;  4FSV A;  5AFU H;  2NRH A;  5EVZ A;  4GXB A;  2HRJ A;  1TYQ B;  1BOT O;  1LCU A;  5GIN A;  3AU5 A;  2P9P B;  4BQZ A;  1N8R O;  3KK7 A;  4PL7 A;  4ZRK A;  3U9Z A;  1GC7 A;  2P9U A;  4M63 C;  4IJA A;  3MCA B;  1W2B M;  3GL1 A;  2WFB A;  4CZM A;  3H6E A;  3P39 A;  3AGR A;  3FZH A;  4PKG A;  1YVN A;  1YIT N;  3PLA A;  3F9M A;  4BG8 A;  3P4I A;  1R59 O;  2HBL A;  3VF4 A;  4GV3 A;  3ZX0 A;  1CZA N;  4BR5 A;  3H3N O;  2IVN A;  3FGU A;  3TSU A;  1E4F T;  2I7P A;  2YI1 A;  4E1J A;  3ZEU B;  3N4Q A;  3WXJ A;  5CHI A;  1RFQ A;  1MWM A;  2P9K B;  5AQP A;  2X0S A;  3U4L A;  4H5N A;  3D2E A;  2BTF A;  2GUP A;  2V52 B;  2E20 A;  3A0I X;  4IOX A;  2BUP A;  2QI2 A;  1BG3 A;  3R8E A;  3CCJ N;  3FP5 A;  1QZ5 A;  5JMV A;  3G9W A;  3CCQ N;  2GEM A;  2CB8 A;  3CIP A;  1ACA A;  1NGJ A;  2RQ1 A;  4IOA L;  1KXP A;  4FO0 A;  1EO1 A;  3X23 A;  3J8A A;  1ESV A;  1V4T A;  3H3O B;  2YJF A;  3F5T A;  5BRH A;  1YIJ N;  3BF1 A;  5AQN A;  4WQ5 A;  4A5A A;  1T44 A;  5KQD A;  4EFH A;  3EKU A;  3PZD A;  2GWJ A;  1IJJ A;  2QWQ A;  3IMX A;  2E88 A;  3MX5 A;  1NWK A;  3U9D A;  3SAH A;  1MIX A;  2ZF5 O;  3FZF A;  1GLJ O;  4JKA A;  2A6A A;  3OA9 A;  4QS9 A;  4A2A A;  1K8K B;  3IDH A;  3S41 A;  1HX1 A;  3IVF A;  4IXC A;  2JWL A;  1DIK A;  1O13 A;  3RSE A;  4P7I A;  3I55 N;  3HTV A;  1W97 L;  3CJ7 A;  3FZL A;  2NRX A;  1LOT B;  3PVL A;  2FSJ A;  4WFN L;  1Q82 O;  4BRQ A;  2AL6 A;  2FSN A;  1HKC A;  3RVC A;  2QW9 A;  3WXM B;  1DEJ A;  3FR0 A;  4BR4 A;  3SAG A;  4KH4 A;  5AQW A;  4IOC L;  3MWP A;  4BGA A;  4FWP A;  3SK3 A;  5EY4 A;  4OO1 J;  3O80 A;  5FPD A;  2NRR A;  3WEE A;  3SBT A;  2ASP A;  3D2F A;  3CQX A;  1KC8 O;  3DXK B;  4CZK A;  1TUU A;  3I8B A;  5BPL A;  2R82 A;  3O6W A;  2A42 A;  4BRC A;  1K9M O;  1SGH A;  3OHR A;  4B1X B;  5BRF A;  4YOY A;  2Q2R A;  1S72 N;  3CJC A;  1XUP O;  5EOY A;  4BRL A;  3AAR A;  1HB8 A;  3A5N C;  3GDQ A;  2FJ9 A;  3C65 A;  2RE2 A;  5KPZ A;  2NRZ A;  2WUS A;  5BN9 A;  2EMS A;  3U8Z A;  3UKU B;  3SMP A;  3FLV A;  3AU4 A;  4IEI A;  2PBD A;  5JLH A;  4GV6 A;  4BR9 A;  4FWQ A;  4CBU A;  2P9N B;  2VGN A;  5ADX H;  1NTI A;  3HRG A;  3L6Q A;  3C6H A;  1NMD A;  4XH1 A;  4H0T B;  3ULE A;  3J7Z O;  4C23 A;  1Y19 B;  3EKS A;  2H3G X;  2P9I A;  2I1K A;  5H1S Q;  3QBX A;  2KKZ A;  4MLE A;  1T6D A;  3SJH A;  4K41 A;  2E2O A;  1ISN A;  3UKR A;  1VQL N;  3DAW A;  4CD3 A;  5JVH L;  1DT9 A;  2W40 A;  1NI2 A;  3H46 O;  4IJN A;  5HOO A;  3F2K A;  3VOV A;  3W0L A;  1NJI O;  2W41 A;  4KBO A;  1VQN N;  1YJN N;  3LM2 A;  2E2N A;  3PIP L;  1HPM A;  2E1Z A;  4CBW A;  1K73 O;  4M7X A;  3BP8 A;  3LDQ A;  3ZX2 A;  3VGM A;  4IFE A;  4CZJ A;  5BRE A;  4QS7 A;  4G9Z A;  2D11 A;  3VET A;  4JKF A;  1VQK N;  5LJW A;  4JKE A;  2HBJ A;  4EKU A;  3CCU N;  2FXU A;  2YHX A;  2FLO A;  4I6M A;  5BR9 A;  5C2F A;  1S3X A;  3DLL L;  1QQM A;  4JHD B;  3WXK A;  3A5M C;  1SS6 A;  1BDG A;  3WXL A;  4L3Q A;  3VEN A;  1XC3 A;  2HF4 A;  3GE1 A;  3ID6 A;  3HOS A;  3DXM B;  2V7Y A;  1ATR A;  5M1K A;  3FZM A;  3M3Z A;  2GWK A;  1Q86 O;  2FF6 A;  3P38 A;  1V4S A;  1JDE A;  4BRK A;  4Z94 A;  4XEI A;  4UY8 O;  3ZET B;  3E9L A;  1YUW A;  1Q18 A;  2YJE A;  2ZGZ A;  3Q7C A;  2Q0R A;  4JKH A;  4JKD A;  3U7D A;  2ASO A;  3VEX A;  4A59 A;  5AZI A;  4GNI A;  3CF5 L;  3CQY A;  3CPE A;  3LDL A;  2I7N A;  3CET A;  3NVK A;  1HBK A;  1J19 A;  1ST7 A;  2AEH A;  2HBK A;  1MDU B;  5DM6 L;  1BUP A;  2WH5 A;  1GLE G;  3Q7B A;  4EHT A;  1NGE A;  4K43 A;  4AM6 A;  1BO5 O;  2P9P A;  3L0Q A;  1HB6 A;  1NVL A;  4A62 A;  4BG9 A;  5JLF A;  2ZJP L;  3GBT A;  4BRG A;  3CCV N;  3OW2 M;  3MN6 A;  4OPA A;  5EXW A;  2RHK A;  5F2R A;  3WXI A;  5M1P A;  2HOE A;  2ZJQ L;  3R3L A;  1MK7 B;  5BPM A;  2VGM A;  2OAN A;  4CZH A;  4LC9 B;  2KHO A;  1GLD G;  1NGH A;  4YDU C;  1VQP N;  2F9T A;  4DCH A;  1Q7Y O;  2QWO A;  4WF9 L;  4JKG B;  3N4P A;  4H0V B;  4ILG B;  4EAH D;  2D10 A;  1NGI A;  4RTF D;  4B1V A;  3ZEU A;  3EL2 A;  1T3V A;  3VF2 A;  3CCL N;  4BY9 C;  5GAD P;  3VEZ A;  1NLV A;  3T7Z A;  5AQT A;  2KLA A;  3O9T A;  1RDU A;  2HBM A;  3LM9 A;  3CCM N;  5E84 A;  4BC5 A;  2J0K A;  1Q81 O;  4ISG A;  3UE5 A;  5AZJ A;  3BF3 A;  3D2E B;  3CC7 N;  1NGG A;  3BIN A;  3ZX3 A;  3QDK A;  4BC3 A;  5C15 A;  4A5B A;  3ATV A;  3CI5 A;  5LY3 A;  3G4S N;  5BRD A;  3R1X A;  5F0X A;  5GIP A;  2EMT A;  5M1F A;  2DIK A;  3QBW A;  1X3M A;  1GLB G;  1WUA A;  3C7N A;  2P9L B;  3EE8 A;  3WQU A;  2HF3 A;  3HI0 A;  4WYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...