4JKGA

Open and closed forms of mixed t1789p+r1865a and r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
219
Chain Sequence
b'LFSQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 219
sequence length 220
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkgA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkgA01
4JKFA 4JKAA 4JKGB 4JK8A 3ENBA 4JKDA 3E9OA 3E9PA 4JKBA 4JKEA 3SBTA 4ILJA 4ILHA 4ILGB 3E9LA 4JK9A 4JKHA 3SBGA 4JKGA 4JKCA 3E66A 4JK7A
chains in the Genus database with same CATH superfamily
4M3WA 1NTIA 1C1CA 2NRTA 4PL7A 2QKKA 3EL2A 4BDPA 1NGFA 1HJRA 1XC9A 1Q7YO 1HPZA 2YNIA 5C24A 3AA5X 3RMDA 4O8KA 4HUFA 2NRZA 2O4IA 4FO0A 4CGFA 3IKMA 2DFFA 4CHPA 3G4SN 3U6FA 1VSDA 4KKOA 3H3OB 2YI1A 1CLQA 1TGOA 5JICA 4PY5A 2EWSA 4EP5A 5F1XA 3DLBA 3RR7A 2A42A 2BUPA 5AQHA 5M1PA 2YKNA 2PYLA 3W3DA 3IAYA 1VQON 3E9OA 5J2QA 4KH5A 3QBWA 3QESA 4DS4A 4G9ZA 1EKEA 4BWMA 4YY3K 1VQNN 3K0SA 3SNNA 1HJOA 1Y64A 3L2QA 4DV2K 3O9RA 1VHXA 3OYEA 4N47A 1V4SA 4O0IA 2VQFK 1KXPA 1DTQA 3NH2A 4CGDA 5EY4A 1NK5A 3CCRN 5DM7L 4CJTA 3NVKA 2GTDA 4G1QA 2F9TA 3MDQA 4OKJA 3MX5A 4CEBA 1YXQA 1LW0A 2QWLA 3THWB 1RTHA 3DYAA 1WOQA 3VTIA 3LDNA 3S3NA 4ISGA 2I1KA 2ITMA 2YNFA 2P9SB 3DWLA 4JKGA 1FKPA 2A40A 1S9GA 1HKBA 3QNNA 1T6DA 3RRGA 2QA4N 2OPRA 4YFUA 4M3UA 3VQ9A 1VSMA 3G6EN 3O80A 4RW8A 3PIOL 2E2NA 2CQUA 4TKNA 2RE2A 1W2BM 5E26A 3PY8A 3MEGA 3M8SA 5GINA 1VSIA 4E7LA 3EPYA 4M41A 3CFPA 1HYZA 3O3GA 4CF2A 2O4GA 4DR2K 4LF5K 1KLNA 3DLLL 3VETA 2EMTA 4ZRJA 1TK0A 1SQKA 4FK0A 4BGAA 1NI2A 4FZZA 1GLLO 2G8WA 3CMEN 3K5MA 4CEQA 4RW9A 2CGJA 1P90A 1IBLK 2P51A 1BA1A 4I9LA 1CXUA 3U9ZA 4CFAA 2XY7A 4F3TA 1YI2N 1OH8A 4C8MA 1GC6A 1RT3A 3QDKA 4DFKA 3VGMA 4DHYA 3FZMA 4JK8A 4M7XA 3T1HK 4V19S 3V9XA 2I7NA 2B5JA 3HRGA 3SPYA 3WEEB 3L8BA 2OPPA 3LP1A 1QZ6A 4CGJA 2A5XA 4DF8A 1JCFA 3RSEB 3OYDA 5TKYA 4LFBK 5B8HA 3L3UA 3VN5A 3AGKA 5EVZA 3MECA 1KTQA 4XIUA 1DEJA 2GX9A 4H0YB 4ELUA 3MN6A 5IT9O 5CYMA 4A5AA 4BRHA 4I2PA 4E7KA 4JI7K 3C6TA 3MCPA 3QFUA 3EYZA 2ZJQL 3EZ5A 3L6QA 2G8VA 3THYA 3DM2A 2X78A 4Z0UA 3I0RA 4FWOA 4A2BA 5BR9A 1LWEA 2I7PA 1RNHA 4LY7A 1RTDA 2UXCK 2CH5A 3U8ZA 2HHTA 4BRGA 3IS9A 1GLAG 4CW7B 2P9KB 2VCPA 2ZGYA 3SUPA 1MWKA 4C8KA 5FPNA 1YHQN 5HOOA 3W0LA 2V7ZA 2OPSA 3KD1E 2PAVA 1HNIA 2G8FA 3LAKA 3DAWA 4CJVA 4DQIA 1ZBHA 2UXDK 1NJZA 3O1BA 4L8RB 1JLFA 3TANA 1DIKA 1S1XA 3E66A 1C6VA 2E2PA 4IZ9A 1V4TA 1DGKN 3SAHA 4YDUA 1F21A 3P83D 2FBTA 4HHTA 1HX1A 1NWKA 4KB1A 5LJWA 3RWUA 3FP5A 3R3LA 2HBMA 3J7AP 4IXCA 2Y1IA 3C6HA 4A57A 1J6ZA 2IGIA 1HNVA 5JS2A 1NGBA 4TSXA 3ZT3A 4CHQA 2QXLA 3LALA 3JAMO 1L3VA 4Z4EA 4DQRA 3PV8A 1RT7A 1Z05A 3THVA 5BN9A 3EO3A 4E0DA 3OHRA 3CCMN 1M1KO 1VQMN 2Q0RA 3I55N 2YHBA 4IFEA 4DR5K 3SJJA 3HPGA 2QWOA 4OVLA 4DF4A 3JS6A 4LF6K 4WFBL 2O8BB 3EE9A 4RG8A 3L4IA 4KRFA 3F9KA 4CJEA 4FWNA 4H0OA 1NKCA 3PSIA 3WXIA 1EO1A 4JKBA 2JLEA 4CJSA 5C42A 3WNFA 2QTDA 2E2OA 4OX9K 4JAXA 1YVNA 4CJPA 2P5OA 2KQ2A 1WSGA 2NRXA 4FZXC 5C25A 3TWHA 2O8EB 2O8DA 1WB9A 1UWBA 3V1QA 4M42A 1C0UA 4WF9L 5CYQA 3A8YA 4BC3A 3HVRA 4JI3K 2E2QA 4XH1A 4FM2A 3QEWA 1JXEA 3WT0A 2YHXA 2KKZA 1HQEA 5F2RA 3EKSA 1NK4A 2VQEK 1KAYA 4Z4HA 4H0VB 1S72N 3AU5A 4E7JA 1JLCA 3L2UA 4DKWA 3L2WA 4JEPA 1NBWA 2VWKA 4NB4A 4Y1DA 3V9SA 3CPEA 3MMVA 4O0JA 3NHGA 4CGGA 1WSEA 4U67L 1KAXA 2Q31A 1KVBA 3LDSA 2NZTA 2Q2RA 3C0BA 3FLVA 1E5WA 3G10A 3VF6A 4B9UA 2CGLA 5KPZA 5M1NA 1VK0A 1EF1A 3C7NA 2AP1A 4B1WB 1N34K 2HVIA 2NRVA 2J0KA 4I7FA 2HHUA 2OPQA 3H1QA 4F2SA 3H3NO 1BL3A 3ZDTA 4JI2K 4DTRA 4W5TA 3SLCA 3SK3A 1Z26A 3ENBA 1QSYA 4DSJA 4FM1A 3D2FB 2YV0X 1X9SA 1WAJA 3P4IA 1JLAA 5JS1A 5E41A 1LAVA 3DXKB 3HZ6A 4FOEA 5FPEA 3SQ2A 3SQ4A 3AVIA 4CJ5A 3O08A 4NY0A 4AHSA 4JK7A 1W97L 3WQUA 3VQCA 4WFAL 1RT6A 1BIZA 4MDBA 1BU6O 1S3XA 3ZT4A 5HROA 3TAGA 3ZT0A 3C95A 3LP2A 4K43A 1BG3A 3QERA 3Q7CA 4DTMA 3UE5A 2D0OA 3VPZA 4W5OA 1VQ4N 5EU7A 2J0MA 4GKJK 2B4JA 4CK1A 5BPNA 2RPIA 4B1YB 2WFBA 5KPTA 4EFHA 1N33K 3CCQN 3M5RA 2FC0A 1ZBLA 5EXWA 3LPUA 3OYCA 2LBBA 3G9WA 1FXXA 1L5UA 5AQQA 4FCYA 4ZTJA 5JVGL 2NRWA 2HHWA 4BROA 1U49A 1QQOA 4MDAA 3GE1A 4DSKA 4P7IA 1NGDA 5ADXA 1VQLN 4AM6A 4BR9A 4JHDA 1CZ9A 4MLEA 3MXIA 3MN7A 4WQ5A 1GLFO 5CY4A 2F8SA 3HSCA 3PO5A 4OLAA 1D9DA 4JI5K 4JYAK 1RFQA 3FZFA 3QIOA 4I2QA 1ZBIA 3O4WA 5AQFA 1J54A 4BRPA 1BI4A 4QCLA 2FBVA 5AQZA 1NGAA 4EP4A 3KIOA 2YKMA 4YOYA 5JLFA 4WQ5C 4NYNA 3JXUA 2ZF5O 2OANA 4B3OA 5DK5A 5AZIB 5AQIA 1GG3A 3LWMA 3VF4A 2HHXA 3AVCA 2GEMA 1BO5O 4A5BA 4ILGB 1A5VA 4CJUA 2QI2A 2HW3A 3SQ1A 3ZETA 1XNRK 4CERA 5C0YA 3THXB 4CEEA 5SWMA 3A5LC 3DXMB 4CHYA 3K58A 3QETA 4AF1A 1DTTA 3VGLA 4I9QA 4GW6A 2H3GX 1NM1A 3E1YA 3F5TA 3NAEA 2E8AA 3AVNA 1SL1A 1C1AA 2HNZA 2NRRA 1U45A 1EQYA 3EKUA 4OPAA 1RDDA 3GL1A 3O4NA 1JDEA 3AVHA 4I6MA 4FM0A 4BC4A 1QVGM 1QVFM 2KFNA 4B9QA 3ZSVA 4NLCA 3NH0A 3ZEUA 1RT1A 1IG8A 1OH5A 1NKEA 1T05A 1NOYA 1XI1A 2BE2A 3C65A 1ATNA 3OBYA 3PSFA 3KHYA 5KQDA 4GV6A 5AQSA 4CZIA 4GXBA 3L2VA 5J1EA 2KHOA 4EHUA 4JI4K 3K9JA 2OZMA 1RT4A 1YAGA 4CIEA 4NCAA 4FSVA 3OYGA 2ATQA 4FLZA 3IRXA 4KI4A 3ZSZA 2HHSA 3ZSOA 5TKWA 4X64K 1JCEA 1Y97A 3UKRB 1OVYA 3C7NB 3U3GA 3FZLA 4RW6A 1HRHA 2Q3SA 4CEOA 1VSKA 3VQ8A 3LDPA 1IJJA 3VA0A 4YOVA 5HLFA 2P9LB 5D3GA 4DV7K 3HYFA 4JLHA 4FPBA 4PQUA 3V1RA 1BISA 4KPYA 2D2QA 1TYQA 3V9WA 3ZSYA 1U48A 3KK3A 3QEIA 1I3AA 1VRUA 1YJWN 3H1VX 3P1GA 3V1OA 5JMVA 5AQVA 3CCVN 4E19A 2IVOA 3AV9A 4JKHA 3TSUA 1RTJA 3DLKA 5KPRA 4NCBA 3SMPA 1KSPA 4DU4A 1LOTB 2BH1A 1Z25A 3HP9A 5J2PA 1H1VA 1TUUA 3OS0A 4DXAB 3HI0A 1EXQA 3C6UA 5H1SQ 1KC7A 1J19A 4PKHA 3MN5A 1QSLA 1B92A 4RW4A 4NCGA 4DTSA 3D0PA 3SPZA 3CD6N 3T1YK 3DOLA 1JL1A 5FROA 4BVPA 2I1JA 3CC7N 2VGMA 1Q81O 4F3OA 4Y0WA 5AQNA 3VTHA 1L3SA 5J2NA 1B9DA 1MK9B 2NRHA 1GOBA 3VMFB 1WNSA 2KZZA 1CZAN 2D11A 4QAGA 3JYTA 3AO2A 4EAHD 4IOCL 2HF3A 1BA0A 2HHQA 3OW2M 4X62K 1GC7A 2YJEA 3DLRA 3TAFA 4W5QA 3V6DA 3HK2A 4JRPA 1C0MA 4DR3K 3SBGA 1NK9A 2P9IA 1RBUA 1SV5A 3LDLA 3OYLA 1VQPN 4K8ZA 2B6AA 4HCCA 1GLDG 4FL9A 3P31A 1J53A 3QB0A 1I39A 1ISNA 1J9AA 1MU2A 4OGEA 2WUSA 4CE9A 4LF8K 1UA1A 4N41A 3R9PA 5I42A 4H5RA 2VGNA 4BQZA 1VQ6N 3OY9A 2WOMA 5A2QO 1SKWA 4CBXA 3ZT1A 2P9UB 4KH4A 4ZRIA 4FOIA 2ASOA 4DG1A 1IBKK 1YF5L 4OJRA 4PUOA 4WQ4A 3HPHA 1S1VA 3B6OA 4HTLA 2QXFA 1WUAA 4J2BA 1BQMA 4J2AA 4GKKK 2KLAA 5CZ2A 1KAZA 1GLEG 3M8QA 3P39A 4GNIA 3M8RA 2WONA 1KC8O 4WQ4C 1RDWX 3OYIA 1XMOK 1SAZA 1TUYA 4BC2A 5AZJA 1D9FA 4HCBA 5IWAK 3VQ6A 3SQ0A 1K8KA 2IVNA 3VF2A 4PHTX 1C0FA 3BDPA 1XUPO 4FLTA 1RDAA 4LF9K 4DV4K 2ZWHA 3KVGA 1T03A 3PZDA 1RBRA 1SS6A 4L3QA 4OGCA 3ID6A 4JI6K 1JXBA 2GV9A 1HNWK 5AQRA 3N4PA 1REVA 4QS7A 1CZBA 1J5OA 1RBSA 3SZ2A 4BWJA 2O8FA 4KHPK 4J2EA 2BGGA 4DQSA 3VQAA 5FLXO 4BRAA 3LAMA 3LP3A 3RVCA 4CEFA 3T3FA 3AARA 3CJBA 2ASMA 1QSSA 2OYQA 4AHRA 3J7YP 4X65K 3CJ1A 3DLGA 2ZGZA 1ZYQA 4DR7K 1GOAA 1VQ9N 4EHTA 3K59A 5GADP 4N5SA 1T8EA 4UY8O 1ZBUA 3ULEB 3VGKA 2R82A 5AQWA 3HM9A 2E5LK 2R7YA 2HVHA 1HPMA 2P5GA 2ZJPL 5BN8A 2IC3A 3G71N 4KI6A 3OYBA 1TL3A 4CJRA 1J5EK 4KB0A 4AHUA 4H5NA 2YHWA 3HXMA 2HB5A 4FJKA 1GLCG 4JI8K 4DB3A 3KLIA 5M1QA 1NMNA 2QKBA 3EZWA 4PL8A 3NDKA 3TARA 5LY3A 1Q9XA 1E4GT 5AJ3K 4DV6K 2FJ9A 4JD2A 5AQUA 4BC5A 1MIZB 4E3SA 2ZD1A 5FRMA 3L2RA 4KHQA 2VYPA 4CGHA 3LWLA 4RW7A 4AHCA 2IOCA 1VBGA 4IDHA 1QQCA 5SZTA 1UA0A 5LMUK 2OTJN 2IVPA 5C12A 5CHIA 4KHYA 4B3SK 2FSNA 4YOWA 3C6AA 4DCHA 1S22A 1Q86O 1QQMA 3TTFA 4ISEA 2HF4A 1HNXK 5ELZA 4ID1A 4Z4FA 2FBYA 3OA9A 4DTUA 3PIPL 2E20A 1VSEA 3ASMA 2QM1A 1P8ZA 4IEEA 1TK8A 1LV5A 1JKHA 1S6PA 1KFDA 3FLCO 4GV9A 4FLXA 1RILA 1BCMA 1X9WA 3KLEA 5GAEP 4BR7A 4RTFD 4M63C 2NLXA 3RRHA 4YDUC 4CEZA 1WSFA 1KD1O 4FLWA 4K41A 4CJ4A 4IO8A 3CJAA 2VWJA 4U7BA 4GMJB 4FK2A 1FJGK 2O8CA 3AO4A 3O3HA 2QK9A 3OTOK 1BIUA 2GWJA 4CJQA 4IOAL 1G15A 2JWLA 3K57A 4K25A 3LP0A 1W7AA 4N56A 4BRNA 2E4LA 3MXJA 3ENOA 3KK1A 3EE8A 4DR1K 4YOUA 4IO9L 4ILHA 1E3MA 4DWIA 4IJAA 1K73O 2QWPA 1KVAA 3H45C 4OPHA 1HNZK 3QBXA 3LM2A 2PYJA 3KLHA 1UOCA 2HMPA 3J7ZO 3HOSA 4JKGB 4CVNE 4Q5VA 2P9NA 3NGYA 4BRFA 3TPQA 3CCSN 1XC3A 3ITHA 3KZBA 4DV5K 4AQYK 3CCEN 3A5MC 1CXQA 2J0JA 3HVTA 3AVAA 3KD5E 4CK2A 4OPKA 4OKEA 2G8KA 3U9DA 3WA0A 4DFPA 4DSEA 4CJKA 5EOYA 2VG6A 3HL8A 3FR0A 5C2FA 3CJ9A 1WBDA 3K2PA 2G8HA 3TABA 5AQXA 2Z1JA 1U2VA 5AQMA 5AQGA 4R79A 4JI0K 4FJJA 1ITGA 3ZX2A 1RGIA 4ILJA 4H4MA 2PZSA 2QEXN 3AVKA 4MQ3A 1I94K 3CERA 1YJ9N 4FWRA 5BPMA 5AR0A 4ICLA 3QINA 3BY5A 3UKUA 1RT5A 4HUEA 3NMUA 3NCIA 4IBNA 4IFVA 2ZQBA 3QIJA 4BR5A 3LZJA 3A5OC 1NK8A 4BR4A 3CC4N 4LC9B 4K42A 1NOZA 4B08A 1IBMK 3O4QA 2UYTA 2YHAA 3BF1A 1T44A 5GIPA 4E1JA 3B6PA 2D4WA 2V7YA 3D2EA 3DRRA 3KK2A 4O5FA 3PX4A 2JWKA 3BZCA 2YNGA 2P1JA 3GOIA 2F4VK 3MAQA 3FFIA 4BR0A 1EWRA 3THYB 1GOCA 4E7HA 3IFRA 5BR8K 1VQKN 3AO1A 5F0XA 1WSIA 3I33A 3NGIA 4FJIA 2D0AA 2IS3A 3F2KA 1KVCA 4CZFA 1VRTA 1R0AA 2EX3A 2Q36A 1FK9A 3V9UA 5GIOA 3CG7A 2P9PA 1T6CA 2HNDA 1HR0K 3ZX3A 3N4QA 4C8LA 5EX5A 4FJ8A 1HLUA 2NUBA 4GVEA 2ITGA 5JVLA 2UXBK 3EEQA 1MK7B 2X6SA 3DMJA 3KK7A 4PKIA 2DY4A 4CHNA 3AA2A 2FBXA 1ZC6A 4KFBA 3O6WA 3V81A 3WXMB 1YVUA 5BPLA 3LZIA 4B9SA 3MEDA 4DV1K 1JLQA 4H5VA 2BDPA 5LJVA 1QS4A 4QS8A 3M6GA 3CJ7A 3ZCMA 1VQ8N 4YL8A 3AY9A 3PVLA 2AA4A 3LANA 3SUOA 1TK5A 5I3UA 4BDYA 1HYVA 4LFAK 1HB8A 2PFUA 5AQLA 2W41A 3H6EA 3PX0A 4KAZA 3QIPA 4DV3K 1OH6A 4FWPA 3T7ZA 4CJ7A 3AGRA 3CI5A 1TKDA 1RDCA 4A2AA 4CBWA 4DFJA 4LH4A 1RDUA 4CHZA 3BGRA 3LM9A 4NLBA 3SCXA 2AEHA 1WSJA 2D0CA 3ATVA 4MO5A 1WSHA 1T7PA 1OH7A 4KHWA 2HOEA 4FLUA 1GLBG 4CIFA 3VEXA 3DI6A 3ID8A 2WBNA 3HOTA 4DV0K 2E1YA 3DOKA 2COPA 4O8UA 4FWLA 2D5RA 4AILC 2XY8A 5KI6A 1MWMA 4F4KA 2Q0UA 3TAPA 3THWA 2YHYA 5AFUA 3X23A 1ASUA 1Z6RA 1LAWA 3SAGA 5HRPA 4DUZK 3ZSWA 4YOTA 1K6YA 5KGXA 4E1NA 2P9SA 3AAQA 4H0TB 3S3OA 2HHVA 3M3ZA 2O8DB 4JKCA 2XRIA 2ZJRL 3TU5A 4K8XA 4B9NA 3HM8A 1QE1A 3CMAN 2G8IA 3VQ4A 4A62A 4ZHRA 4B9MA 3BF3A 4CECA 4CZJA 4EIAA 5CZ1A 5BRHA 3ENHA 3NGZA 4B9VA 2A6AA 3FGUA 1TKXA 4CIGA 4AHVA 3U7DA 5BRDA 1S1UA 4JK9A 1SGHA 3O9UA 4B1ZA 3D6RA 4BRDA 3VEZA 1ZBFA 4M45A 3C94A 2VWBA 2WC9A 1SKRA 1RTIA 1S5JA 3WXKA 3RMCA 4CYEA 2X0SA 2DFHA 2E88A 4RCHA 1TAUA 1Q82O 1KCFA 4CJFA 3AVJA 1SZ2A 3HT3A 4FLYA 1NGIA 1BDGA 4WCEL 3J81O 1C0TA 4DSIA 3NFAA 5KRTA 3SYZA 4CZLA 1X1PA 1JLBA 2E6LA 4DMNA 2DPNA 2GELA 1B9FA 3QEXA 1BQNA 4CCHA 4LSNA 3U4LA 4DTXA 3M1FA 5LL6Z 5C15A 1NJIO 3CC2N 1IV0A 3NVMA 3WEEA 3QICA 1ATRA 3MWPA 3IUCA 3HO1A 3NF7A 3WNGA 1N6QA 4B1VA 3LDOA 3RSEA 5CR4A 1KRPA 1ASWA 1N8RO 3HTVA 1NG9A 3S3MA 4DTNA 2RF2A 5CE3A 1VSLA 2D0PA 2Y1JA 3OYHA 4YORA 2W40A 3CCLN 1VSFA 2X74A 4DUYK 4GVMA 4AHTA 1NGEA 5BREA 4BVOA 2UU9K 3ATUA 3CFRA 1MIXA 1BHLA 4KTWA 5HBMA 3B8AX 3QFPA 4B3MK 4CBUA 2A1SA 2FF3B 3CQXA 4DQQA 1ILYA 4O55A 3GG4A 3SV3A 3ISNC 3VQBA 4FJGA 5AQPA 3CQ8A 3ULDA 3WUHA 3RMBA 4KH6A 4CESA 3HJFA 4PKGA 3PX6A 4F7GA 1RT2A 2KFZA 4CZMA 4BY9C 4OO1J 3LDQA 2GUIA 3O1WA 3KLFA 2NNWA 1S9EA 1Q18A 4JHDB 1D5AA 4JS4A 2D10A 4R5PA 2GUPA 1XMQK 2QWRA 1NGHA 5AQKA 3OJUA 4B9TA 4OPJA 4N76A 3KWIA 3T69A 1BI4B 4BE2A 3K9KA 1LCUA 4FJLA 3ZYYX 2HRJA 3NF8A 4IEIA 1IKWA 1Y19B 2J4RA 3SMSA 3ZX0A 1X9JA 3SBTA 3A5NC 4RWTA 3AU4A 4H5WA 5KGWA 3CXCM 1Q8IA 4IFYA 4E89A 4O5BA 1LW2A 2ASPA 3K5OA 4Z4IA 1O13A 3U8XA 1X3NA 2ABDA 4DLEA 2BANA 4M3RA 3ZETB 3WQTA 1C1BA 1DKGD 5ADXH 4CEDA 4Q0BA 4B8AB 5DM6L 4BRKA 1N32K 3O9QA 3NE6A 1KFSA 1H4RA 4QOZB 1IKXA 4FWMA 2PY5A 3JSMA 2CH6A 3NF6A 2O8BA 4LFCK 3LL3A 4I6MB 3GBTA 4CZHA 3ZEUB 2ETJA 2D1KA 4YHHK 3AO3A 4DTPA 3OYMA 3CYMA 1NGCA 4IG3A 4JRQA 2Z1HA 4BG8A 2PBDA 4XH5A 2W42A 5AQTA 2O8EA 1U6ZA 4H0XB 2HSTA 3IDHA 3IMXA 4DQ8A 4JI1K 5T7BA 3O9SA 4HTUA 3WXLA 1YTAA 4CF1A 4FJ5A 4BQLA 4FYDA 1LWCA 4CFCA 5AQYA 4JKAA 2CGKA 3NF9A 1YJNN 4KO0A 5AFUH 4AM7A 5FRNA 1K9MO 4ZRKA 3WNHA 5KRSA 3BEXA 4HWIA 1YTUA 4BE0A 2XO7A 5IJMA 3VERA 3TTDA 3MCAB 4JV5K 1QHTA 2BTFA 3MX2A 1NVLA 4FWSA 4HUGA 4C1NK 4BR2A 3VA3A 1QHAA 1VQ7N 4B9LA 1NK6A 1EWQA 1IKVA 1VQ5N 1NK0A 3CFOA 3L0QA 4H8KA 3S9HA 3MWTA 1NJWA 3RR8A 4CZGA 4KHUA 4KREA 3E9PA 1NGJA 3L4QA 5KQ8A 4FVMA 4YOXA 3G25A 2UUCK 1TYQB 3CPWM 2OZSA 4DTOA 3VOVA 4O44A 3ALYA 1SKSA 1MDUB 3H46O 3FZHA 2HE7A 1JL2A 2FSKA 4GY2B 1S1TA 3KWGA 4JKFA 3D2FA 4LF4K 4FW2A 4CHOA 2OA8A 4ELVA 1X9MA 1JCGA 2IAJA 3DXKA 4PWDA 3CETA 3I0SA 3SI6A 4FLVA 3OYJA 2FDQA 1HKCA 3HSTB 5MLCQ 3VEWA 4LF7K 3BINA 3Q7BA 4B8CA 1KQSM 4BGBA 2UUAK 1VSHA 3NH1A 1YUWA 3O9TA 2QWMA 2VG5A 1JLEA 1A5XA 1DT9A 2HMIA 4DQPA 4IJNA 1ZXOA 1VBHA 5M1KA 4FJNA 1RDBA 1ATSA 3QEVA 4MLHA 1KLMA 4FK4A 4FW1A 4OLBA 1U04A 1G99A 1L3TA 3E9LA 2RQ1A 1W0HA 3OVNA 4CJ3A 4FVUA 5M1FA 1S1WA 4FWKA 4M7YA 3R6MA 4BRCA 2KTQA 1X3MA 3EN9A 1R59O 3TAEA 1GLJO 2P9IB 4ID5A 1NGGA 5LMNK 2XY5A 4CZKA 2YNHA 4FJ9A 3QO9A 3HP6A 5AQJA 2FLOA 4B3RK 4Z4CA 4B1XB 3SUQA 3E01A 5HP1A 3PO4A 3F73A 2LSNA 2GBZA 2QW9A 4LH5A 1W9HA 2E6MA 4Z4GA 3OJSA 1NU0A 1FW6A 3V9ZA 4EZ9A 2YVCA 1MA9B 4C1NI 3K5NA 1HYSA 4LSLA 1E4FT 4Z94A 4KV8A 4JS5A 1TKZA 2HBLA 4HDOA 5AZIA 1OVQA 4M3ZA 4NYFA 3D45A 1BCOA 1JLGA 4FXDA 3MK6A 1IKYA 4AH9A 4CF8A 1GGOA 3TTCA 3V4IA 2HBJA 2I5JA 1FKOA 4UQGA 4FJMA 3THXA 5DMRA 4E1MA 5FPDA 3CM5A 3DXMA 3FFKB 3DLEA 3S41A 5J2MA 4A61A 4KBOA 2XHBA 4CD1A 5AZJB 5K14A 4CGIA 3OYNA 1N5YA 1K8KB 1TVRA 4BREA 3ZSQA 1BWFO 2F8TA 1UAXA 3ZSXA 5C2DA 4BRMA 5JLHA 4C8NA 4CF9A 5AQOA 3VEOA 4W5NA 4KTZA 3I8BA 3OS2A 3EY1A 3SV4A 3PLAA 2O8FB 3I56N 4Y1CA 4ISFA 1A5WA 4MFBA 4PA1A 3RMAA 2W6LA 3SJHA 3AA3A 3VQEA 1IO2A 1O1WA 2F7TA 2X6NA 4HDQA 1NLVA 4KHSA 2HBKA 2OTLN 1TV6A 4FJHA 4BG9A 3H08A 5HRSA 2F9WA 3T19A 3U3YA 4NXNK 4CFDA 4B3TK 2Z1IA 3VQ7A 3AVFA 2ZM6K 4F9OA 1QQNA 1TAQA 3AVLA 3O8MA 2CB8A 3KJVA 3CCUN 4H4OA 4KTQA 4JKEA 4X66K 3UKRA 2IIRA 5M1OA 3P5JA 1D4XA 1NMDA 4EZ6A 1YITN 3AVGA 2QWQA 3IVFA 5FDLA 2FSJA 2P9LA 4MO4A 2G8UA 3OYKA 3MEEA 3VEYA 5HRRA 3NBPA 4JD2B 1EETA 2W6KA 1M90O 3VQ5A 3ZT2A 4BDZA 1RBVA 5BRFA 3AAPA 4M3YA 3QNOA 3CQYA 1WAFA 4DFMA 3VENA 4H03B 4F8RA 4F2RA 2ZE2A 3O3FA 4CFBA 4CK3A 2V52B 2Q97A 1JJ2M 4EKUA 1EX4A 4XH4A 2DTUA 3T1AA 3FZKA 2FF6A 1YIJN 3D7EO 4OKKA 4K0KK 4FPAA 5HRNA 1NJXA 4DSLA 4DU1A 4XEIA 4CF0A 3AO5A 5GAHP 3OYFA 3R1XA 4W5RA 3CM6A 3TSQA 3AVBA 3PUFA 3TAQA 3SAFA 2HHHK 3KTQA 1BGXT 3ZLJA 3RTVA 1HKGA 1ST7A 4M3TA 4JN4A 2O8CB 3OS1A 4BACA 1NNEA 1IG9A 2GWKA 1VSJA 1N36K 4HVJA 4FJXA 2WTUA 3CJCA 5FPMA 2KW4A 1HBKA 2YX6A 1HMVA 1NK7A 3ZSRA 4M3XA 1LWFA 2VG7A 4O4GA 1ASVA 2RKIA 4NO7A 1XHXA 3J80O 3QLHA 1YT3A 1QZ5A 2V51B 3L3VA 2EHGA 1D8YA 1EP4A 3A2FA 1HUXA 1U4BA 3HPOA 2D0BA 2P9NB 1XNQK 4IWVA 3KKSA 2OCEA 3OYAA 1XHZA 3TAMA 4J2DA 3CCJN 3WNEA 5KTQA 3AVMA 1NJYA 4NXMK 4LD0A 1XQSC 5I9EB 3A0IX 2P9UA 4BE1A 4IKFA 1TL1A 2XY6A 1WBBA 4DU3A 2A41A 4CJLA 1HQUA 4IOXA 3O5BA 4DTJA 3UB5A 2A3ZA 2YCHA 3MN9A 2A1RA 5GAGP 1U2VB 3VEVA 2F96A 4BRLA 4DSFA 4YNQA 3TR8A 3M8PA 1L3UA 4C23A 1VAZA 2Q1NA 4DR6K 4QS9A 4WE1A 1OKJA 2E1ZA 1QTMA 3CIPA 4BRQA 2RHKA 4WYBA 3WXJA 2EMSA 1KBLA 3J8AA 3VQDA 3UIQA 1BOTO 1SL2A 4JKDA 4H0PA 1RCHA 1ZBSA 2FXUA 1SUQA 3LPTA 3UKUB 3MXMA 3SUNA 2KZMA 2RN2A 2ZPYA 4DR4K 3BZKA 3OBWA 4DS5A 1Q9YA 3GDQA 2DIKA 1WN7A 1ESVA 3AA4A 3TSPA 4CZEA 3P38A 4BRIA 5C10A 5HL7L 3VQPA 4IG0A 4ZTFA 4CEAA 4E7IA 2Z1GA 3D2EB 4ELTA 3CF5L 4GV3A 1IH7A 4CJWA 1BUPA 4FZYA 1SL0A 3VQQA 4C8OA 1DLOA 2IDOA 4CI6A 1TKTA 3KLGA 5E84A 1S6QA 2DFEA 3R8EA 3G0ZA 1NKBA 3VESA 1RBTA 3DJCA 3DRPA 3FE1A 3ULEA 4A59A 3QEPA 3HBTA 3BP8A 4B1UB 4FJ7A 4KHNA 4CD3A 4J8FA 2AL6A 1T3VA 1K8AO 3IG1A 4FWQA 2P9PB 4DLGA 2AJQA 3KKRA 2WH5A 1XWLA 5JVHL 2HNYA 3QMLA 4H5TA 2UUBK 3CHWA 1HB6A 3TI0A 4JNEA 3K5LA 3DRSA 2JGUA 3BUZB 2YJFA 4IDKA 4WFNL 3I8DA 1ACAA 3DLHA 3F9MA 2P9KA 1C0GA 1WLJA 1U47A 2QWNA
chains in the Genus database with same CATH topology
3MWTA 5AQZA 1NTIA 1NGAA 2NRTA 4PL7A 3EL2A 4CZGA 4YOYA 1NGFA 3E9PA 5JLFA 1Q7YO 1NGJA 4WQ5C 5AQXA 1U2VA 3L4QA 5AQMA 3JXUA 5AQGA 2ZF5O 4R79A 5KQ8A 2OANA 4YOXA 3G25A 1TYQB 4O8KA 2NRZA 5AZIB 3CPWM 5AQIA 4FO0A 3IKMA 1GG3A 3ZX2A 1RGIA 3VF4A 3VOVA 3G4SN 4ILJA 2GEMA 2QEXN 1MDUB 1BO5O 3H3OB 3H46O 3FZHA 4ILGB 4A5BA 2YI1A 2HE7A 3CERA 3CJ9A 2FSKA 2QI2A 4FWRA 4GY2B 3ZETA 5AR0A 5BPMA 1YJ9N 5JICA 5C0YA 2EWSA 5F1XA 2A42A 2BUPA 3KWGA 5AQHA 5M1PA 3A5LC 4JKFA 3D2FA 3DXMB 3W3DA 1VQON 3UKUA 4AF1A 3VGLA 3E9OA 2H3GX 4KH5A 3NMUA 1NM1A 3E1YA 3F5TA 3QBWA 4G9ZA 1JCGA 3QIJA 2E8AA 3DXKA 4BR5A 3A5OC 3CETA 1VQNN 1HJOA 2NRRA 4BR4A 3CC4N 1EQYA 1Y64A 3EKUA 4LC9B 4OPAA 4K42A 2FDQA 3O9RA 3GL1A 1JDEA 1HKCA 2UYTA 4I6MA 5MLCQ 1V4SA 4BC4A 1QVGM 1QVFM 3BF1A 3VEWA 4B9QA 3BINA 3Q7BA 1T44A 5GIPA 1KXPA 4NLCA 4E1JA 3ZEUA 1KQSM 4BGBA 2D4WA 2V7YA 3D2EA 1IG8A 5EY4A 4O5FA 3CCRN 5DM7L 1YUWA 2JWKA 3C65A 3NVKA 3O9TA 1ATNA 3OBYA 2QWMA 2GTDA 3KHYA 3GOIA 2F9TA 5KQDA 1DT9A 3MDQA 3MX5A 4GV6A 1YXQA 1ZXOA 1VBHA 4IJNA 4BR0A 5M1KA 5AQSA 1ATSA 4CZIA 4GXBA 3IFRA 4MLHA 2QWLA 1VQKN 5F0XA 2KHOA 1G99A 1WOQA 3I33A 3VTIA 3LDNA 3E9LA 2RQ1A 4EHUA 4FVUA 5M1FA 4ISGA 4FWKA 2I1KA 4M7YA 2ITMA 3F2KA 4CZFA 2P9SB 3R6MA 4BRCA 3DWLA 4JKGA 1X3MA 2A40A 1R59O 2Q36A 3EN9A 3K9JA 5GIOA 1GLJO 2P9IB 1YAGA 1HKBA 1NGGA 1T6CA 2P9PA 1T6DA 2QA4N 4FSVA 3G6EN 3O80A 3ZX3A 4CZKA 3PIOL 3N4QA 5EX5A 2E2NA 1HLUA 2CQUA 4GVEA 4TKNA 2RE2A 5JVLA 1W2BM 5E26A 5AQJA 2FLOA 1MK7B 5TKWA 4B1XB 1JCEA 3KK7A 5GINA 4PKIA 3EPYA 3UKRB 1OVYA 3C7NB 2QW9A 1ZC6A 3FZLA 3O6WA 3LDPA 1IJJA 3DLLL 3VETA 3WXMB 5BPLA 2YVCA 1MA9B 4C1NI 2P9LB 4YOVA 2EMTA 4ZRJA 1E4FT 1Q81O 1SQKA 4H5VA 4BGAA 1NI2A 4Z94A 5LJVA 4FPBA 4QS8A 2D2QA 1TYQA 2HBLA 4HDOA 1GLLO 3CJ7A 3M6GA 5AZIA 1VQ8N 3CMEN 4YL8A 3AY9A 3PVLA 2AA4A 1YJWN 3H1VX 2CGJA 3HOTA 1P90A 3MK6A 1BA1A 3U9ZA 1GGOA 3TTCA 5JMVA 5AQVA 1HB8A 3CCVN 2HBJA 1YI2N 2PFUA 5AQLA 2W41A 2IVOA 3H6EA 4JKHA 3TSUA 5FPDA 4FWPA 3DXMA 3T7ZA 4CJ7A 3FFKB 3AGRA 3CI5A 3SMPA 5KPRA 1GC6A 3S41A 3QDKA 4A2AA 1LOTB 4KBOA 3VGMA 4A61A 4CBWA 3FZMA 4CD1A 4DHYA 4JK8A 4M7XA 2BH1A 5AZJB 1K8AO 1RDUA 1H1VA 1TUUA 2I7NA 4DXAB 3HI0A 1K8KB 4BREA 3HRGA 3LM9A 3WEEB 5H1SQ 1BWFO 1KC7A 4NLBA 1J19A 1QZ6A 3MN5A 2AEHA 4PKHA 3ZX0A 3ATVA 2A5XA 4MO5A 1JCFA 3RSEB 3CD6N 5TKYA 5B8HA 5C2DA 2HOEA 1GLBG 4BVPA 4BRMA 5JLHA 3VEXA 2I1JA 3ID8A 3AGKA 2WBNA 2VGMA 5AQOA 5EVZA 3VEOA 1DEJA 4Y0WA 2GX9A 3I8BA 2E1YA 5AQNA 3VTHA 2COPA 4O8UA 4H0YB 4FWLA 3PLAA 1MK9B 2NRHA 3MN6A 4A5AA 4BRHA 3I56N 3VMFB 1CZAN 3MCPA 3QFUA 4ISFA 2ZJQL 2D11A 1MWMA 3L6QA 3O4WA 4EAHD 3SJHA 4IOCL 2Q0UA 2HF3A 1BA0A 2YHYA 5AFUA 2F7TA 4FWOA 3X23A 4HDQA 1Z6RA 4A2BA 5BR9A 1NLVA 3SAGA 2HBKA 3OW2M 2OTLN 4YOTA 1GC7A 2YJEA 4BG9A 2I7PA 2P9SA 2CH5A 2F9WA 3U8ZA 3AAQA 3SBGA 4H0TB 2P9IA 4BRGA 3LDLA 1GLAG 3M3ZA 1VQPN 4JKCA 2P9KB 2VCPA 2ZJRL 2ZGYA 3TU5A 1GLDG 1MWKA 3HM8A 4FL9A 4F9OA 5FPNA 1QQNA 3P31A 1YHQN 5HOOA 3W0LA 2V7ZA 3O8MA 3QB0A 2PAVA 1ISNA 3CMAN 2CB8A 4A62A 3BF3A 3CCUN 4JKEA 4CZJA 2WUSA 3UKRA 4EIAA 2IIRA 5M1OA 5BRHA 3ENHA 3DAWA 1D4XA 2A6AA 3FGUA 1NMDA 3R9PA 1YITN 3U7DA 4H5RA 5BRDA 2QWQA 3IVFA 2FSJA 2P9LA 4JK9A 1SGHA 2QWNA 3O1BA 4MO4A 3O9UA 4B1ZA 1DIKA 2VGNA 3D6RA 4BQZA 3E66A 1VQ6N 4BRDA 3VEYA 2E2PA 4IZ9A 3VEZA 4CBXA 1V4TA 1DGKN 2P9UB 4KH4A 3SAHA 2VWBA 4ZRIA 4YDUA 2WC9A 4FOIA 3WXKA 2ASOA 4CYEA 1YF5L 2X0SA 4JD2B 1HX1A 1NWKA 2E88A 4WQ4A 1M90O 4RCHA 5LJWA 5BRFA 3AAPA 4HTLA 3FP5A 3CQYA 1Q82O 3R3LA 1WUAA 1SZ2A 2HBMA 4IXCA 2KLAA 3C6HA 1NGIA 3VENA 4A57A 1KAZA 1GLEG 1BDGA 4H03B 4WCEL 1J6ZA 4CZLA 2V52B 3P39A 1NGBA 2QXLA 2Q97A 4GNIA 1JJ2M 1KC8O 4WQ4C 1RDWX 2DPNA 2GELA 1SAZA 4EKUA 1TUYA 1Z05A 4XH4A 4BC2A 5AZJA 3U4LA 3FZKA 2FF6A 3M1FA 5BN9A 1YIJN 3EO3A 3D7EO 5C15A 1K8KA 1NJIO 3CC2N 3OHRA 2IVNA 3VF2A 3NVMA 4PHTX 1C0FA 3WEEA 3CCMN 1XUPO 3QICA 1ATRA 3MWPA 3IUCA 4FPAA 1M1KO 1VQMN 2Q0RA 2ZWHA 3KVGA 4B1VA 3I55N 3LDOA 3PZDA 3RSEA 1SS6A 4L3QA 4XEIA 5CR4A 4IFEA 1N8RO 3HTVA 3ID6A 5GAHP 3R1XA 2QWOA 5AQRA 3N4PA 3TSQA 5CE3A 4QS7A 2D0PA 3JS6A 3SAFA 4WFBL 3CC7N 4YORA 3EE9A 2W40A 3L4IA 3CCQN 3CCLN 4FWNA 1HKGA 4H0OA 1ST7A 4BRAA 4JN4A 1NGEA 5BREA 3WXIA 3RVCA 4BVOA 1EO1A 3AARA 4JKBA 3CJBA 2ASMA 3ATUA 2GWKA 2QTDA 2E2OA 1MIXA 4JAXA 1YVNA 3CJCA 3CJ1A 5FPMA 2NRXA 3B8AX 3QFPA 2ZGZA 1HBKA 2YX6A 4CBUA 2FF3B 1K73O 3CQXA 1ILYA 3GG4A 1VQ9N 4EHTA 4WF9L 5AQPA 4NO7A 3A8YA 4BC3A 3WUHA 5GADP 4UY8O 1QZ5A 2V51B 3ULEB 3VGKA 2R82A 2E2QA 4KH6A 4XH1A 5AQWA 3WT0A 1HUXA 2YHXA 4PKGA 2KKZA 4DCHA 4F7GA 5F2RA 3EKSA 1HPMA 1KAYA 4H0VB 2P9NB 4CZMA 4BY9C 4OO1J 3LDQA 3AU5A 1S72N 2ZJPL 5BN8A 3G71N 4IWVA 3O1WA 4DKWA 4JEPA 1NBWA 2NNWA 1Q18A 4NB4A 4H5NA 2YHWA 4JHDB 1GLCG 3CPEA 3CCJN 2D10A 3MMVA 4DB3A 2GUPA 5M1QA 2QWRA 3EZWA 4PL8A 1XQSC 4U67L 5LY3A 1KAXA 3A0IX 1NGHA 2P9UA 5AQKA 5I9EB 1E4GT 2A41A 2Q31A 2FJ9A 4JD2A 5AQUA 4BC5A 1MIZB 2NZTA 3O5BA 4IOXA 2Q2RA 3KWIA 3UB5A 3T69A 3C0BA 3K9KA 1LCUA 2A3ZA 3FLVA 1E5WA 3VF6A 3ZYYX 2YCHA 2CGLA 2HRJA 3MN9A 4IEIA 2VYPA 5KPZA 5GAGP 1Y19B 1U2VB 2J4RA 3SMSA 1VBGA 3VEVA 1X9JA 1EF1A 3C7NA 4IDHA 2AP1A 4BRLA 5M1NA 3SBTA 4B1WB 3A5NC 4RWTA 3AU4A 4H5WA 4C23A 3CXCM 1VAZA 2OTJN 2IVPA 2NRVA 2J0KA 2Q1NA 4QS9A 5C12A 5CHIA 1OKJA 3H1QA 2FSNA 2ASPA 4YOWA 3C6AA 1O13A 2E1ZA 3U8XA 1X3NA 1S22A 2ABDA 3H3NO 3CIPA 1QQMA 3TTFA 4ISEA 2HF4A 4BRQA 2RHKA 1Q86O 3ZDTA 5ELZA 4WYBA 3ZETB 3WQTA 3SLCA 3WXJA 2EMSA 1KBLA 1DKGD 3J8AA 3SK3A 1BOTO 5ADXH 3ENBA 5DM6L 4JKDA 4H0PA 1ZBSA 3OA9A 2FXUA 3D2FB 4BRKA 3PIPL 3O9QA 2E20A 3UKUB 1H4RA 3P4IA 2QM1A 1P8ZA 2ZPYA 4FWMA 4IEEA 3OBWA 3DXKB 3FLCO 3HZ6A 4GV9A 4FOEA 5FPEA 2CH6A 3GDQA 5GAEP 4BR7A 3O08A 4RTFD 2DIKA 4NY0A 2NLXA 4M63C 1ESVA 3TSPA 3LL3A 4I6MB 3GBTA 1W97L 4YDUC 1KD1O 3WQUA 4CZEA 4K41A 3P38A 4WFAL 4IO8A 3CJAA 4BRIA 5C10A 4U7BA 5HL7L 4MDBA 3ZEUB 4CZHA 1BU6O 1S3XA 2D1KA 3D2EB 3CF5L 4GV3A 4K43A 2GWJA 1BG3A 4IOAL 1BUPA 1NGCA 2JWLA 3Q7CA 3UE5A 2D0OA 3VPZA 4BG8A 1VQ4N 2PBDA 2J0MA 4K25A 4XH5A 5AQTA 4BRNA 4CI6A 3ENOA 1U6ZA 5BPNA 3EE8A 2HSTA 4H0XB 2WFBA 5E84A 3IDHA 4B1YB 3R8EA 5KPTA 4YOUA 4IO9L 4ILHA 4EFHA 3VESA 3DJCA 3IMXA 3M5RA 4IJAA 2QWPA 3O9SA 3FE1A 5EXWA 3H45C 3ULEA 4A59A 4DQ8A 2LBBA 3G9WA 4OPHA 3HBTA 3BP8A 3QBXA 3LM2A 3WXLA 5AQQA 4B1UB 4BQLA 5JVGL 2HMPA 4CD3A 2NRWA 4J8FA 2AL6A 1T3VA 5AQYA 4JKAA 4JKGB 2CGKA 3J7ZO 3HOSA 5AFUH 4AM7A 4FWQA 2P9NA 4BROA 2P9PB 1QQOA 1YJNN 1K9MO 4BRFA 4ZRKA 4MDAA 3TPQA 3CCSN 1XC3A 3GE1A 3KZBA 2WH5A 4P7IA 3BEXA 5JVHL 3CCEN 1NGDA 3A5MC 4HWIA 5ADXA 3QMLA 2J0JA 4H5TA 5IJMA 1VQLN 4AM6A 3VERA 4BR9A 4JHDA 4MLEA 3TTDA 3U9DA 3CHWA 1HB6A 3MCAB 3MN7A 3WA0A 4JNEA 1GLFO 4WQ5A 2BTFA 3BUZB 3MX2A 2YJFA 1NVLA 3HSCA 4WFNL 1ACAA 4FWSA 4C1NK 4BR2A 1QHAA 1VQ7N 3F9MA 2P9KA 1C0GA 5EOYA 1VQ5N 1RFQA 3FR0A 3FZFA 3L0QA 5C2FA 4JK7A 5AQFA 4BRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKF A;  4JKA A;  4JKG B;  4JK8 A;  3ENB A;  4JKD A;  3E9O A;  3E9P A;  4JKB A;  4JKE A;  3SBT A;  4ILJ A;  4ILH A;  4ILG B;  3E9L A;  4JK9 A;  4JKH A;  3SBG A;  4JKG A;  4JKC A;  3E66 A;  4JK7 A; 
#chains in the Genus database with same CATH topology
 4M3W A;  1NTI A;  1C1C A;  2NRT A;  4PL7 A;  2QKK A;  3EL2 A;  4BDP A;  1NGF A;  1HJR A;  1XC9 A;  1Q7Y O;  1HPZ A;  2YNI A;  5C24 A;  3AA5 X;  3RMD A;  4O8K A;  4HUF A;  2NRZ A;  2O4I A;  4FO0 A;  4CGF A;  3IKM A;  2DFF A;  4CHP A;  3G4S N;  3U6F A;  1VSD A;  4KKO A;  3H3O B;  2YI1 A;  1CLQ A;  1TGO A;  5JIC A;  4PY5 A;  2EWS A;  4EP5 A;  5F1X A;  3DLB A;  3RR7 A;  2A42 A;  2BUP A;  5AQH A;  5M1P A;  2YKN A;  2PYL A;  3W3D A;  3IAY A;  1VQO N;  3E9O A;  5J2Q A;  4KH5 A;  3QBW A;  3QES A;  4DS4 A;  4G9Z A;  1EKE A;  4BWM A;  4YY3 K;  1VQN N;  3K0S A;  3SNN A;  1HJO A;  1Y64 A;  3L2Q A;  4DV2 K;  3O9R A;  1VHX A;  3OYE A;  4N47 A;  1V4S A;  4O0I A;  2VQF K;  1KXP A;  1DTQ A;  3NH2 A;  4CGD A;  5EY4 A;  1NK5 A;  3CCR N;  5DM7 L;  4CJT A;  3NVK A;  2GTD A;  4G1Q A;  2F9T A;  3MDQ A;  4OKJ A;  3MX5 A;  4CEB A;  1YXQ A;  1LW0 A;  2QWL A;  3THW B;  1RTH A;  3DYA A;  1WOQ A;  3VTI A;  3LDN A;  3S3N A;  4ISG A;  2I1K A;  2ITM A;  2YNF A;  2P9S B;  3DWL A;  4JKG A;  1FKP A;  2A40 A;  1S9G A;  1HKB A;  3QNN A;  1T6D A;  3RRG A;  2QA4 N;  2OPR A;  4YFU A;  4M3U A;  3VQ9 A;  1VSM A;  3G6E N;  3O80 A;  4RW8 A;  3PIO L;  2E2N A;  2CQU A;  4TKN A;  2RE2 A;  1W2B M;  5E26 A;  3PY8 A;  3MEG A;  3M8S A;  5GIN A;  1VSI A;  4E7L A;  3EPY A;  4M41 A;  3CFP A;  1HYZ A;  3O3G A;  4CF2 A;  2O4G A;  4DR2 K;  4LF5 K;  1KLN A;  3DLL L;  3VET A;  2EMT A;  4ZRJ A;  1TK0 A;  1SQK A;  4FK0 A;  4BGA A;  1NI2 A;  4FZZ A;  1GLL O;  2G8W A;  3CME N;  3K5M A;  4CEQ A;  4RW9 A;  2CGJ A;  1P90 A;  1IBL K;  2P51 A;  1BA1 A;  4I9L A;  1CXU A;  3U9Z A;  4CFA A;  2XY7 A;  4F3T A;  1YI2 N;  1OH8 A;  4C8M A;  1GC6 A;  1RT3 A;  3QDK A;  4DFK A;  3VGM A;  4DHY A;  3FZM A;  4JK8 A;  4M7X A;  3T1H K;  4V19 S;  3V9X A;  2I7N A;  2B5J A;  3HRG A;  3SPY A;  3WEE B;  3L8B A;  2OPP A;  3LP1 A;  1QZ6 A;  4CGJ A;  2A5X A;  4DF8 A;  1JCF A;  3RSE B;  3OYD A;  5TKY A;  4LFB K;  5B8H A;  3L3U A;  3VN5 A;  3AGK A;  5EVZ A;  3MEC A;  1KTQ A;  4XIU A;  1DEJ A;  2GX9 A;  4H0Y B;  4ELU A;  3MN6 A;  5IT9 O;  5CYM A;  4A5A A;  4BRH A;  4I2P A;  4E7K A;  4JI7 K;  3C6T A;  3MCP A;  3QFU A;  3EYZ A;  2ZJQ L;  3EZ5 A;  3L6Q A;  2G8V A;  3THY A;  3DM2 A;  2X78 A;  4Z0U A;  3I0R A;  4FWO A;  4A2B A;  5BR9 A;  1LWE A;  2I7P A;  1RNH A;  4LY7 A;  1RTD A;  2UXC K;  2CH5 A;  3U8Z A;  2HHT A;  4BRG A;  3IS9 A;  1GLA G;  4CW7 B;  2P9K B;  2VCP A;  2ZGY A;  3SUP A;  1MWK A;  4C8K A;  5FPN A;  1YHQ N;  5HOO A;  3W0L A;  2V7Z A;  2OPS A;  3KD1 E;  2PAV A;  1HNI A;  2G8F A;  3LAK A;  3DAW A;  4CJV A;  4DQI A;  1ZBH A;  2UXD K;  1NJZ A;  3O1B A;  4L8R B;  1JLF A;  3TAN A;  1DIK A;  1S1X A;  3E66 A;  1C6V A;  2E2P A;  4IZ9 A;  1V4T A;  1DGK N;  3SAH A;  4YDU A;  1F21 A;  3P83 D;  2FBT A;  4HHT A;  1HX1 A;  1NWK A;  4KB1 A;  5LJW A;  3RWU A;  3FP5 A;  3R3L A;  2HBM A;  3J7A P;  4IXC A;  2Y1I A;  3C6H A;  4A57 A;  1J6Z A;  2IGI A;  1HNV A;  5JS2 A;  1NGB A;  4TSX A;  3ZT3 A;  4CHQ A;  2QXL A;  3LAL A;  3JAM O;  1L3V A;  4Z4E A;  4DQR A;  3PV8 A;  1RT7 A;  1Z05 A;  3THV A;  5BN9 A;  3EO3 A;  4E0D A;  3OHR A;  3CCM N;  1M1K O;  1VQM N;  2Q0R A;  3I55 N;  2YHB A;  4IFE A;  4DR5 K;  3SJJ A;  3HPG A;  2QWO A;  4OVL A;  4DF4 A;  3JS6 A;  4LF6 K;  4WFB L;  2O8B B;  3EE9 A;  4RG8 A;  3L4I A;  4KRF A;  3F9K A;  4CJE A;  4FWN A;  4H0O A;  1NKC A;  3PSI A;  3WXI A;  1EO1 A;  4JKB A;  2JLE A;  4CJS A;  5C42 A;  3WNF A;  2QTD A;  2E2O A;  4OX9 K;  4JAX A;  1YVN A;  4CJP A;  2P5O A;  2KQ2 A;  1WSG A;  2NRX A;  4FZX C;  5C25 A;  3TWH A;  2O8E B;  2O8D A;  1WB9 A;  1UWB A;  3V1Q A;  4M42 A;  1C0U A;  4WF9 L;  5CYQ A;  3A8Y A;  4BC3 A;  3HVR A;  4JI3 K;  2E2Q A;  4XH1 A;  4FM2 A;  3QEW A;  1JXE A;  3WT0 A;  2YHX A;  2KKZ A;  1HQE A;  5F2R A;  3EKS A;  1NK4 A;  2VQE K;  1KAY A;  4Z4H A;  4H0V B;  1S72 N;  3AU5 A;  4E7J A;  1JLC A;  3L2U A;  4DKW A;  3L2W A;  4JEP A;  1NBW A;  2VWK A;  4NB4 A;  4Y1D A;  3V9S A;  3CPE A;  3MMV A;  4O0J A;  3NHG A;  4CGG A;  1WSE A;  4U67 L;  1KAX A;  2Q31 A;  1KVB A;  3LDS A;  2NZT A;  2Q2R A;  3C0B A;  3FLV A;  1E5W A;  3G10 A;  3VF6 A;  4B9U A;  2CGL A;  5KPZ A;  5M1N A;  1VK0 A;  1EF1 A;  3C7N A;  2AP1 A;  4B1W B;  1N34 K;  2HVI A;  2NRV A;  2J0K A;  4I7F A;  2HHU A;  2OPQ A;  3H1Q A;  4F2S A;  3H3N O;  1BL3 A;  3ZDT A;  4JI2 K;  4DTR A;  4W5T A;  3SLC A;  3SK3 A;  1Z26 A;  3ENB A;  1QSY A;  4DSJ A;  4FM1 A;  3D2F B;  2YV0 X;  1X9S A;  1WAJ A;  3P4I A;  1JLA A;  5JS1 A;  5E41 A;  1LAV A;  3DXK B;  3HZ6 A;  4FOE A;  5FPE A;  3SQ2 A;  3SQ4 A;  3AVI A;  4CJ5 A;  3O08 A;  4NY0 A;  4AHS A;  4JK7 A;  1W97 L;  3WQU A;  3VQC A;  4WFA L;  1RT6 A;  1BIZ A;  4MDB A;  1BU6 O;  1S3X A;  3ZT4 A;  5HRO A;  3TAG A;  3ZT0 A;  3C95 A;  3LP2 A;  4K43 A;  1BG3 A;  3QER A;  3Q7C A;  4DTM A;  3UE5 A;  2D0O A;  3VPZ A;  4W5O A;  1VQ4 N;  5EU7 A;  2J0M A;  4GKJ K;  2B4J A;  4CK1 A;  5BPN A;  2RPI A;  4B1Y B;  2WFB A;  5KPT A;  4EFH A;  1N33 K;  3CCQ N;  3M5R A;  2FC0 A;  1ZBL A;  5EXW A;  3LPU A;  3OYC A;  2LBB A;  3G9W A;  1FXX A;  1L5U A;  5AQQ A;  4FCY A;  4ZTJ A;  5JVG L;  2NRW A;  2HHW A;  4BRO A;  1U49 A;  1QQO A;  4MDA A;  3GE1 A;  4DSK A;  4P7I A;  1NGD A;  5ADX A;  1VQL N;  4AM6 A;  4BR9 A;  4JHD A;  1CZ9 A;  4MLE A;  3MXI A;  3MN7 A;  4WQ5 A;  1GLF O;  5CY4 A;  2F8S A;  3HSC A;  3PO5 A;  4OLA A;  1D9D A;  4JI5 K;  4JYA K;  1RFQ A;  3FZF A;  3QIO A;  4I2Q A;  1ZBI A;  3O4W A;  5AQF A;  1J54 A;  4BRP A;  1BI4 A;  4QCL A;  2FBV A;  5AQZ A;  1NGA A;  4EP4 A;  3KIO A;  2YKM A;  4YOY A;  5JLF A;  4WQ5 C;  4NYN A;  3JXU A;  2ZF5 O;  2OAN A;  4B3O A;  5DK5 A;  5AZI B;  5AQI A;  1GG3 A;  3LWM A;  3VF4 A;  2HHX A;  3AVC A;  2GEM A;  1BO5 O;  4A5B A;  4ILG B;  1A5V A;  4CJU A;  2QI2 A;  2HW3 A;  3SQ1 A;  3ZET A;  1XNR K;  4CER A;  5C0Y A;  3THX B;  4CEE A;  5SWM A;  3A5L C;  3DXM B;  4CHY A;  3K58 A;  3QET A;  4AF1 A;  1DTT A;  3VGL A;  4I9Q A;  4GW6 A;  2H3G X;  1NM1 A;  3E1Y A;  3F5T A;  3NAE A;  2E8A A;  3AVN A;  1SL1 A;  1C1A A;  2HNZ A;  2NRR A;  1U45 A;  1EQY A;  3EKU A;  4OPA A;  1RDD A;  3GL1 A;  3O4N A;  1JDE A;  3AVH A;  4I6M A;  4FM0 A;  4BC4 A;  1QVG M;  1QVF M;  2KFN A;  4B9Q A;  3ZSV A;  4NLC A;  3NH0 A;  3ZEU A;  1RT1 A;  1IG8 A;  1OH5 A;  1NKE A;  1T05 A;  1NOY A;  1XI1 A;  2BE2 A;  3C65 A;  1ATN A;  3OBY A;  3PSF A;  3KHY A;  5KQD A;  4GV6 A;  5AQS A;  4CZI A;  4GXB A;  3L2V A;  5J1E A;  2KHO A;  4EHU A;  4JI4 K;  3K9J A;  2OZM A;  1RT4 A;  1YAG A;  4CIE A;  4NCA A;  4FSV A;  3OYG A;  2ATQ A;  4FLZ A;  3IRX A;  4KI4 A;  3ZSZ A;  2HHS A;  3ZSO A;  5TKW A;  4X64 K;  1JCE A;  1Y97 A;  3UKR B;  1OVY A;  3C7N B;  3U3G A;  3FZL A;  4RW6 A;  1HRH A;  2Q3S A;  4CEO A;  1VSK A;  3VQ8 A;  3LDP A;  1IJJ A;  3VA0 A;  4YOV A;  5HLF A;  2P9L B;  5D3G A;  4DV7 K;  3HYF A;  4JLH A;  4FPB A;  4PQU A;  3V1R A;  1BIS A;  4KPY A;  2D2Q A;  1TYQ A;  3V9W A;  3ZSY A;  1U48 A;  3KK3 A;  3QEI A;  1I3A A;  1VRU A;  1YJW N;  3H1V X;  3P1G A;  3V1O A;  5JMV A;  5AQV A;  3CCV N;  4E19 A;  2IVO A;  3AV9 A;  4JKH A;  3TSU A;  1RTJ A;  3DLK A;  5KPR A;  4NCB A;  3SMP A;  1KSP A;  4DU4 A;  1LOT B;  2BH1 A;  1Z25 A;  3HP9 A;  5J2P A;  1H1V A;  1TUU A;  3OS0 A;  4DXA B;  3HI0 A;  1EXQ A;  3C6U A;  5H1S Q;  1KC7 A;  1J19 A;  4PKH A;  3MN5 A;  1QSL A;  1B92 A;  4RW4 A;  4NCG A;  4DTS A;  3D0P A;  3SPZ A;  3CD6 N;  3T1Y K;  3DOL A;  1JL1 A;  5FRO A;  4BVP A;  2I1J A;  3CC7 N;  2VGM A;  1Q81 O;  4F3O A;  4Y0W A;  5AQN A;  3VTH A;  1L3S A;  5J2N A;  1B9D A;  1MK9 B;  2NRH A;  1GOB A;  3VMF B;  1WNS A;  2KZZ A;  1CZA N;  2D11 A;  4QAG A;  3JYT A;  3AO2 A;  4EAH D;  4IOC L;  2HF3 A;  1BA0 A;  2HHQ A;  3OW2 M;  4X62 K;  1GC7 A;  2YJE A;  3DLR A;  3TAF A;  4W5Q A;  3V6D A;  3HK2 A;  4JRP A;  1C0M A;  4DR3 K;  3SBG A;  1NK9 A;  2P9I A;  1RBU A;  1SV5 A;  3LDL A;  3OYL A;  1VQP N;  4K8Z A;  2B6A A;  4HCC A;  1GLD G;  4FL9 A;  3P31 A;  1J53 A;  3QB0 A;  1I39 A;  1ISN A;  1J9A A;  1MU2 A;  4OGE A;  2WUS A;  4CE9 A;  4LF8 K;  1UA1 A;  4N41 A;  3R9P A;  5I42 A;  4H5R A;  2VGN A;  4BQZ A;  1VQ6 N;  3OY9 A;  2WOM A;  5A2Q O;  1SKW A;  4CBX A;  3ZT1 A;  2P9U B;  4KH4 A;  4ZRI A;  4FOI A;  2ASO A;  4DG1 A;  1IBK K;  1YF5 L;  4OJR A;  4PUO A;  4WQ4 A;  3HPH A;  1S1V A;  3B6O A;  4HTL A;  2QXF A;  1WUA A;  4J2B A;  1BQM A;  4J2A A;  4GKK K;  2KLA A;  5CZ2 A;  1KAZ A;  1GLE G;  3M8Q A;  3P39 A;  4GNI A;  3M8R A;  2WON A;  1KC8 O;  4WQ4 C;  1RDW X;  3OYI A;  1XMO K;  1SAZ A;  1TUY A;  4BC2 A;  5AZJ A;  1D9F A;  4HCB A;  5IWA K;  3VQ6 A;  3SQ0 A;  1K8K A;  2IVN A;  3VF2 A;  4PHT X;  1C0F A;  3BDP A;  1XUP O;  4FLT A;  1RDA A;  4LF9 K;  4DV4 K;  2ZWH A;  3KVG A;  1T03 A;  3PZD A;  1RBR A;  1SS6 A;  4L3Q A;  4OGC A;  3ID6 A;  4JI6 K;  1JXB A;  2GV9 A;  1HNW K;  5AQR A;  3N4P A;  1REV A;  4QS7 A;  1CZB A;  1J5O A;  1RBS A;  3SZ2 A;  4BWJ A;  2O8F A;  4KHP K;  4J2E A;  2BGG A;  4DQS A;  3VQA A;  5FLX O;  4BRA A;  3LAM A;  3LP3 A;  3RVC A;  4CEF A;  3T3F A;  3AAR A;  3CJB A;  2ASM A;  1QSS A;  2OYQ A;  4AHR A;  3J7Y P;  4X65 K;  3CJ1 A;  3DLG A;  2ZGZ A;  1ZYQ A;  4DR7 K;  1GOA A;  1VQ9 N;  4EHT A;  3K59 A;  5GAD P;  4N5S A;  1T8E A;  4UY8 O;  1ZBU A;  3ULE B;  3VGK A;  2R82 A;  5AQW A;  3HM9 A;  2E5L K;  2R7Y A;  2HVH A;  1HPM A;  2P5G A;  2ZJP L;  5BN8 A;  2IC3 A;  3G71 N;  4KI6 A;  3OYB A;  1TL3 A;  4CJR A;  1J5E K;  4KB0 A;  4AHU A;  4H5N A;  2YHW A;  3HXM A;  2HB5 A;  4FJK A;  1GLC G;  4JI8 K;  4DB3 A;  3KLI A;  5M1Q A;  1NMN A;  2QKB A;  3EZW A;  4PL8 A;  3NDK A;  3TAR A;  5LY3 A;  1Q9X A;  1E4G T;  5AJ3 K;  4DV6 K;  2FJ9 A;  4JD2 A;  5AQU A;  4BC5 A;  1MIZ B;  4E3S A;  2ZD1 A;  5FRM A;  3L2R A;  4KHQ A;  2VYP A;  4CGH A;  3LWL A;  4RW7 A;  4AHC A;  2IOC A;  1VBG A;  4IDH A;  1QQC A;  5SZT A;  1UA0 A;  5LMU K;  2OTJ N;  2IVP A;  5C12 A;  5CHI A;  4KHY A;  4B3S K;  2FSN A;  4YOW A;  3C6A A;  4DCH A;  1S22 A;  1Q86 O;  1QQM A;  3TTF A;  4ISE A;  2HF4 A;  1HNX K;  5ELZ A;  4ID1 A;  4Z4F A;  2FBY A;  3OA9 A;  4DTU A;  3PIP L;  2E20 A;  1VSE A;  3ASM A;  2QM1 A;  1P8Z A;  4IEE A;  1TK8 A;  1LV5 A;  1JKH A;  1S6P A;  1KFD A;  3FLC O;  4GV9 A;  4FLX A;  1RIL A;  1BCM A;  1X9W A;  3KLE A;  5GAE P;  4BR7 A;  4RTF D;  4M63 C;  2NLX A;  3RRH A;  4YDU C;  4CEZ A;  1WSF A;  1KD1 O;  4FLW A;  4K41 A;  4CJ4 A;  4IO8 A;  3CJA A;  2VWJ A;  4U7B A;  4GMJ B;  4FK2 A;  1FJG K;  2O8C A;  3AO4 A;  3O3H A;  2QK9 A;  3OTO K;  1BIU A;  2GWJ A;  4CJQ A;  4IOA L;  1G15 A;  2JWL A;  3K57 A;  4K25 A;  3LP0 A;  1W7A A;  4N56 A;  4BRN A;  2E4L A;  3MXJ A;  3ENO A;  3KK1 A;  3EE8 A;  4DR1 K;  4YOU A;  4IO9 L;  4ILH A;  1E3M A;  4DWI A;  4IJA A;  1K73 O;  2QWP A;  1KVA A;  3H45 C;  4OPH A;  1HNZ K;  3QBX A;  3LM2 A;  2PYJ A;  3KLH A;  1UOC A;  2HMP A;  3J7Z O;  3HOS A;  4JKG B;  4CVN E;  4Q5V A;  2P9N A;  3NGY A;  4BRF A;  3TPQ A;  3CCS N;  1XC3 A;  3ITH A;  3KZB A;  4DV5 K;  4AQY K;  3CCE N;  3A5M C;  1CXQ A;  2J0J A;  3HVT A;  3AVA A;  3KD5 E;  4CK2 A;  4OPK A;  4OKE A;  2G8K A;  3U9D A;  3WA0 A;  4DFP A;  4DSE A;  4CJK A;  5EOY A;  2VG6 A;  3HL8 A;  3FR0 A;  5C2F A;  3CJ9 A;  1WBD A;  3K2P A;  2G8H A;  3TAB A;  5AQX A;  2Z1J A;  1U2V A;  5AQM A;  5AQG A;  4R79 A;  4JI0 K;  4FJJ A;  1ITG A;  3ZX2 A;  1RGI A;  4ILJ A;  4H4M A;  2PZS A;  2QEX N;  3AVK A;  4MQ3 A;  1I94 K;  3CER A;  1YJ9 N;  4FWR A;  5BPM A;  5AR0 A;  4ICL A;  3QIN A;  3BY5 A;  3UKU A;  1RT5 A;  4HUE A;  3NMU A;  3NCI A;  4IBN A;  4IFV A;  2ZQB A;  3QIJ A;  4BR5 A;  3LZJ A;  3A5O C;  1NK8 A;  4BR4 A;  3CC4 N;  4LC9 B;  4K42 A;  1NOZ A;  4B08 A;  1IBM K;  3O4Q A;  2UYT A;  2YHA A;  3BF1 A;  1T44 A;  5GIP A;  4E1J A;  3B6P A;  2D4W A;  2V7Y A;  3D2E A;  3DRR A;  3KK2 A;  4O5F A;  3PX4 A;  2JWK A;  3BZC A;  2YNG A;  2P1J A;  3GOI A;  2F4V K;  3MAQ A;  3FFI A;  4BR0 A;  1EWR A;  3THY B;  1GOC A;  4E7H A;  3IFR A;  5BR8 K;  1VQK N;  3AO1 A;  5F0X A;  1WSI A;  3I33 A;  3NGI A;  4FJI A;  2D0A A;  2IS3 A;  3F2K A;  1KVC A;  4CZF A;  1VRT A;  1R0A A;  2EX3 A;  2Q36 A;  1FK9 A;  3V9U A;  5GIO A;  3CG7 A;  2P9P A;  1T6C A;  2HND A;  1HR0 K;  3ZX3 A;  3N4Q A;  4C8L A;  5EX5 A;  4FJ8 A;  1HLU A;  2NUB A;  4GVE A;  2ITG A;  5JVL A;  2UXB K;  3EEQ A;  1MK7 B;  2X6S A;  3DMJ A;  3KK7 A;  4PKI A;  2DY4 A;  4CHN A;  3AA2 A;  2FBX A;  1ZC6 A;  4KFB A;  3O6W A;  3V81 A;  3WXM B;  1YVU A;  5BPL A;  3LZI A;  4B9S A;  3MED A;  4DV1 K;  1JLQ A;  4H5V A;  2BDP A;  5LJV A;  1QS4 A;  4QS8 A;  3M6G A;  3CJ7 A;  3ZCM A;  1VQ8 N;  4YL8 A;  3AY9 A;  3PVL A;  2AA4 A;  3LAN A;  3SUO A;  1TK5 A;  5I3U A;  4BDY A;  1HYV A;  4LFA K;  1HB8 A;  2PFU A;  5AQL A;  2W41 A;  3H6E A;  3PX0 A;  4KAZ A;  3QIP A;  4DV3 K;  1OH6 A;  4FWP A;  3T7Z A;  4CJ7 A;  3AGR A;  3CI5 A;  1TKD A;  1RDC A;  4A2A A;  4CBW A;  4DFJ A;  4LH4 A;  1RDU A;  4CHZ A;  3BGR A;  3LM9 A;  4NLB A;  3SCX A;  2AEH A;  1WSJ A;  2D0C A;  3ATV A;  4MO5 A;  1WSH A;  1T7P A;  1OH7 A;  4KHW A;  2HOE A;  4FLU A;  1GLB G;  4CIF A;  3VEX A;  3DI6 A;  3ID8 A;  2WBN A;  3HOT A;  4DV0 K;  2E1Y A;  3DOK A;  2COP A;  4O8U A;  4FWL A;  2D5R A;  4AIL C;  2XY8 A;  5KI6 A;  1MWM A;  4F4K A;  2Q0U A;  3TAP A;  3THW A;  2YHY A;  5AFU A;  3X23 A;  1ASU A;  1Z6R A;  1LAW A;  3SAG A;  5HRP A;  4DUZ K;  3ZSW A;  4YOT A;  1K6Y A;  5KGX A;  4E1N A;  2P9S A;  3AAQ A;  4H0T B;  3S3O A;  2HHV A;  3M3Z A;  2O8D B;  4JKC A;  2XRI A;  2ZJR L;  3TU5 A;  4K8X A;  4B9N A;  3HM8 A;  1QE1 A;  3CMA N;  2G8I A;  3VQ4 A;  4A62 A;  4ZHR A;  4B9M A;  3BF3 A;  4CEC A;  4CZJ A;  4EIA A;  5CZ1 A;  5BRH A;  3ENH A;  3NGZ A;  4B9V A;  2A6A A;  3FGU A;  1TKX A;  4CIG A;  4AHV A;  3U7D A;  5BRD A;  1S1U A;  4JK9 A;  1SGH A;  3O9U A;  4B1Z A;  3D6R A;  4BRD A;  3VEZ A;  1ZBF A;  4M45 A;  3C94 A;  2VWB A;  2WC9 A;  1SKR A;  1RTI A;  1S5J A;  3WXK A;  3RMC A;  4CYE A;  2X0S A;  2DFH A;  2E88 A;  4RCH A;  1TAU A;  1Q82 O;  1KCF A;  4CJF A;  3AVJ A;  1SZ2 A;  3HT3 A;  4FLY A;  1NGI A;  1BDG A;  4WCE L;  3J81 O;  1C0T A;  4DSI A;  3NFA A;  5KRT A;  3SYZ A;  4CZL A;  1X1P A;  1JLB A;  2E6L A;  4DMN A;  2DPN A;  2GEL A;  1B9F A;  3QEX A;  1BQN A;  4CCH A;  4LSN A;  3U4L A;  4DTX A;  3M1F A;  5LL6 Z;  5C15 A;  1NJI O;  3CC2 N;  1IV0 A;  3NVM A;  3WEE A;  3QIC A;  1ATR A;  3MWP A;  3IUC A;  3HO1 A;  3NF7 A;  3WNG A;  1N6Q A;  4B1V A;  3LDO A;  3RSE A;  5CR4 A;  1KRP A;  1ASW A;  1N8R O;  3HTV A;  1NG9 A;  3S3M A;  4DTN A;  2RF2 A;  5CE3 A;  1VSL A;  2D0P A;  2Y1J A;  3OYH A;  4YOR A;  2W40 A;  3CCL N;  1VSF A;  2X74 A;  4DUY K;  4GVM A;  4AHT A;  1NGE A;  5BRE A;  4BVO A;  2UU9 K;  3ATU A;  3CFR A;  1MIX A;  1BHL A;  4KTW A;  5HBM A;  3B8A X;  3QFP A;  4B3M K;  4CBU A;  2A1S A;  2FF3 B;  3CQX A;  4DQQ A;  1ILY A;  4O55 A;  3GG4 A;  3SV3 A;  3ISN C;  3VQB A;  4FJG A;  5AQP A;  3CQ8 A;  3ULD A;  3WUH A;  3RMB A;  4KH6 A;  4CES A;  3HJF A;  4PKG A;  3PX6 A;  4F7G A;  1RT2 A;  2KFZ A;  4CZM A;  4BY9 C;  4OO1 J;  3LDQ A;  2GUI A;  3O1W A;  3KLF A;  2NNW A;  1S9E A;  1Q18 A;  4JHD B;  1D5A A;  4JS4 A;  2D10 A;  4R5P A;  2GUP A;  1XMQ K;  2QWR A;  1NGH A;  5AQK A;  3OJU A;  4B9T A;  4OPJ A;  4N76 A;  3KWI A;  3T69 A;  1BI4 B;  4BE2 A;  3K9K A;  1LCU A;  4FJL A;  3ZYY X;  2HRJ A;  3NF8 A;  4IEI A;  1IKW A;  1Y19 B;  2J4R A;  3SMS A;  3ZX0 A;  1X9J A;  3SBT A;  3A5N C;  4RWT A;  3AU4 A;  4H5W A;  5KGW A;  3CXC M;  1Q8I A;  4IFY A;  4E89 A;  4O5B A;  1LW2 A;  2ASP A;  3K5O A;  4Z4I A;  1O13 A;  3U8X A;  1X3N A;  2ABD A;  4DLE A;  2BAN A;  4M3R A;  3ZET B;  3WQT A;  1C1B A;  1DKG D;  5ADX H;  4CED A;  4Q0B A;  4B8A B;  5DM6 L;  4BRK A;  1N32 K;  3O9Q A;  3NE6 A;  1KFS A;  1H4R A;  4QOZ B;  1IKX A;  4FWM A;  2PY5 A;  3JSM A;  2CH6 A;  3NF6 A;  2O8B A;  4LFC K;  3LL3 A;  4I6M B;  3GBT A;  4CZH A;  3ZEU B;  2ETJ A;  2D1K A;  4YHH K;  3AO3 A;  4DTP A;  3OYM A;  3CYM A;  1NGC A;  4IG3 A;  4JRQ A;  2Z1H A;  4BG8 A;  2PBD A;  4XH5 A;  2W42 A;  5AQT A;  2O8E A;  1U6Z A;  4H0X B;  2HST A;  3IDH A;  3IMX A;  4DQ8 A;  4JI1 K;  5T7B A;  3O9S A;  4HTU A;  3WXL A;  1YTA A;  4CF1 A;  4FJ5 A;  4BQL A;  4FYD A;  1LWC A;  4CFC A;  5AQY A;  4JKA A;  2CGK A;  3NF9 A;  1YJN N;  4KO0 A;  5AFU H;  4AM7 A;  5FRN A;  1K9M O;  4ZRK A;  3WNH A;  5KRS A;  3BEX A;  4HWI A;  1YTU A;  4BE0 A;  2XO7 A;  5IJM A;  3VER A;  3TTD A;  3MCA B;  4JV5 K;  1QHT A;  2BTF A;  3MX2 A;  1NVL A;  4FWS A;  4HUG A;  4C1N K;  4BR2 A;  3VA3 A;  1QHA A;  1VQ7 N;  4B9L A;  1NK6 A;  1EWQ A;  1IKV A;  1VQ5 N;  1NK0 A;  3CFO A;  3L0Q A;  4H8K A;  3S9H A;  3MWT A;  1NJW A;  3RR8 A;  4CZG A;  4KHU A;  4KRE A;  3E9P A;  1NGJ A;  3L4Q A;  5KQ8 A;  4FVM A;  4YOX A;  3G25 A;  2UUC K;  1TYQ B;  3CPW M;  2OZS A;  4DTO A;  3VOV A;  4O44 A;  3ALY A;  1SKS A;  1MDU B;  3H46 O;  3FZH A;  2HE7 A;  1JL2 A;  2FSK A;  4GY2 B;  1S1T A;  3KWG A;  4JKF A;  3D2F A;  4LF4 K;  4FW2 A;  4CHO A;  2OA8 A;  4ELV A;  1X9M A;  1JCG A;  2IAJ A;  3DXK A;  4PWD A;  3CET A;  3I0S A;  3SI6 A;  4FLV A;  3OYJ A;  2FDQ A;  1HKC A;  3HST B;  5MLC Q;  3VEW A;  4LF7 K;  3BIN A;  3Q7B A;  4B8C A;  1KQS M;  4BGB A;  2UUA K;  1VSH A;  3NH1 A;  1YUW A;  3O9T A;  2QWM A;  2VG5 A;  1JLE A;  1A5X A;  1DT9 A;  2HMI A;  4DQP A;  4IJN A;  1ZXO A;  1VBH A;  5M1K A;  4FJN A;  1RDB A;  1ATS A;  3QEV A;  4MLH A;  1KLM A;  4FK4 A;  4FW1 A;  4OLB A;  1U04 A;  1G99 A;  1L3T A;  3E9L A;  2RQ1 A;  1W0H A;  3OVN A;  4CJ3 A;  4FVU A;  5M1F A;  1S1W A;  4FWK A;  4M7Y A;  3R6M A;  4BRC A;  2KTQ A;  1X3M A;  3EN9 A;  1R59 O;  3TAE A;  1GLJ O;  2P9I B;  4ID5 A;  1NGG A;  5LMN K;  2XY5 A;  4CZK A;  2YNH A;  4FJ9 A;  3QO9 A;  3HP6 A;  5AQJ A;  2FLO A;  4B3R K;  4Z4C A;  4B1X B;  3SUQ A;  3E01 A;  5HP1 A;  3PO4 A;  3F73 A;  2LSN A;  2GBZ A;  2QW9 A;  4LH5 A;  1W9H A;  2E6M A;  4Z4G A;  3OJS A;  1NU0 A;  1FW6 A;  3V9Z A;  4EZ9 A;  2YVC A;  1MA9 B;  4C1N I;  3K5N A;  1HYS A;  4LSL A;  1E4F T;  4Z94 A;  4KV8 A;  4JS5 A;  1TKZ A;  2HBL A;  4HDO A;  5AZI A;  1OVQ A;  4M3Z A;  4NYF A;  3D45 A;  1BCO A;  1JLG A;  4FXD A;  3MK6 A;  1IKY A;  4AH9 A;  4CF8 A;  1GGO A;  3TTC A;  3V4I A;  2HBJ A;  2I5J A;  1FKO A;  4UQG A;  4FJM A;  3THX A;  5DMR A;  4E1M A;  5FPD A;  3CM5 A;  3DXM A;  3FFK B;  3DLE A;  3S41 A;  5J2M A;  4A61 A;  4KBO A;  2XHB A;  4CD1 A;  5AZJ B;  5K14 A;  4CGI A;  3OYN A;  1N5Y A;  1K8K B;  1TVR A;  4BRE A;  3ZSQ A;  1BWF O;  2F8T A;  1UAX A;  3ZSX A;  5C2D A;  4BRM A;  5JLH A;  4C8N A;  4CF9 A;  5AQO A;  3VEO A;  4W5N A;  4KTZ A;  3I8B A;  3OS2 A;  3EY1 A;  3SV4 A;  3PLA A;  2O8F B;  3I56 N;  4Y1C A;  4ISF A;  1A5W A;  4MFB A;  4PA1 A;  3RMA A;  2W6L A;  3SJH A;  3AA3 A;  3VQE A;  1IO2 A;  1O1W A;  2F7T A;  2X6N A;  4HDQ A;  1NLV A;  4KHS A;  2HBK A;  2OTL N;  1TV6 A;  4FJH A;  4BG9 A;  3H08 A;  5HRS A;  2F9W A;  3T19 A;  3U3Y A;  4NXN K;  4CFD A;  4B3T K;  2Z1I A;  3VQ7 A;  3AVF A;  2ZM6 K;  4F9O A;  1QQN A;  1TAQ A;  3AVL A;  3O8M A;  2CB8 A;  3KJV A;  3CCU N;  4H4O A;  4KTQ A;  4JKE A;  4X66 K;  3UKR A;  2IIR A;  5M1O A;  3P5J A;  1D4X A;  1NMD A;  4EZ6 A;  1YIT N;  3AVG A;  2QWQ A;  3IVF A;  5FDL A;  2FSJ A;  2P9L A;  4MO4 A;  2G8U A;  3OYK A;  3MEE A;  3VEY A;  5HRR A;  3NBP A;  4JD2 B;  1EET A;  2W6K A;  1M90 O;  3VQ5 A;  3ZT2 A;  4BDZ A;  1RBV A;  5BRF A;  3AAP A;  4M3Y A;  3QNO A;  3CQY A;  1WAF A;  4DFM A;  3VEN A;  4H03 B;  4F8R A;  4F2R A;  2ZE2 A;  3O3F A;  4CFB A;  4CK3 A;  2V52 B;  2Q97 A;  1JJ2 M;  4EKU A;  1EX4 A;  4XH4 A;  2DTU A;  3T1A A;  3FZK A;  2FF6 A;  1YIJ N;  3D7E O;  4OKK A;  4K0K K;  4FPA A;  5HRN A;  1NJX A;  4DSL A;  4DU1 A;  4XEI A;  4CF0 A;  3AO5 A;  5GAH P;  3OYF A;  3R1X A;  4W5R A;  3CM6 A;  3TSQ A;  3AVB A;  3PUF A;  3TAQ A;  3SAF A;  2HHH K;  3KTQ A;  1BGX T;  3ZLJ A;  3RTV A;  1HKG A;  1ST7 A;  4M3T A;  4JN4 A;  2O8C B;  3OS1 A;  4BAC A;  1NNE A;  1IG9 A;  2GWK A;  1VSJ A;  1N36 K;  4HVJ A;  4FJX A;  2WTU A;  3CJC A;  5FPM A;  2KW4 A;  1HBK A;  2YX6 A;  1HMV A;  1NK7 A;  3ZSR A;  4M3X A;  1LWF A;  2VG7 A;  4O4G A;  1ASV A;  2RKI A;  4NO7 A;  1XHX A;  3J80 O;  3QLH A;  1YT3 A;  1QZ5 A;  2V51 B;  3L3V A;  2EHG A;  1D8Y A;  1EP4 A;  3A2F A;  1HUX A;  1U4B A;  3HPO A;  2D0B A;  2P9N B;  1XNQ K;  4IWV A;  3KKS A;  2OCE A;  3OYA A;  1XHZ A;  3TAM A;  4J2D A;  3CCJ N;  3WNE A;  5KTQ A;  3AVM A;  1NJY A;  4NXM K;  4LD0 A;  1XQS C;  5I9E B;  3A0I X;  2P9U A;  4BE1 A;  4IKF A;  1TL1 A;  2XY6 A;  1WBB A;  4DU3 A;  2A41 A;  4CJL A;  1HQU A;  4IOX A;  3O5B A;  4DTJ A;  3UB5 A;  2A3Z A;  2YCH A;  3MN9 A;  2A1R A;  5GAG P;  1U2V B;  3VEV A;  2F96 A;  4BRL A;  4DSF A;  4YNQ A;  3TR8 A;  3M8P A;  1L3U A;  4C23 A;  1VAZ A;  2Q1N A;  4DR6 K;  4QS9 A;  4WE1 A;  1OKJ A;  2E1Z A;  1QTM A;  3CIP A;  4BRQ A;  2RHK A;  4WYB A;  3WXJ A;  2EMS A;  1KBL A;  3J8A A;  3VQD A;  3UIQ A;  1BOT O;  1SL2 A;  4JKD A;  4H0P A;  1RCH A;  1ZBS A;  2FXU A;  1SUQ A;  3LPT A;  3UKU B;  3MXM A;  3SUN A;  2KZM A;  2RN2 A;  2ZPY A;  4DR4 K;  3BZK A;  3OBW A;  4DS5 A;  1Q9Y A;  3GDQ A;  2DIK A;  1WN7 A;  1ESV A;  3AA4 A;  3TSP A;  4CZE A;  3P38 A;  4BRI A;  5C10 A;  5HL7 L;  3VQP A;  4IG0 A;  4ZTF A;  4CEA A;  4E7I A;  2Z1G A;  3D2E B;  4ELT A;  3CF5 L;  4GV3 A;  1IH7 A;  4CJW A;  1BUP A;  4FZY A;  1SL0 A;  3VQQ A;  4C8O A;  1DLO A;  2IDO A;  4CI6 A;  1TKT A;  3KLG A;  5E84 A;  1S6Q A;  2DFE A;  3R8E A;  3G0Z A;  1NKB A;  3VES A;  1RBT A;  3DJC A;  3DRP A;  3FE1 A;  3ULE A;  4A59 A;  3QEP A;  3HBT A;  3BP8 A;  4B1U B;  4FJ7 A;  4KHN A;  4CD3 A;  4J8F A;  2AL6 A;  1T3V A;  1K8A O;  3IG1 A;  4FWQ A;  2P9P B;  4DLG A;  2AJQ A;  3KKR A;  2WH5 A;  1XWL A;  5JVH L;  2HNY A;  3QML A;  4H5T A;  2UUB K;  3CHW A;  1HB6 A;  3TI0 A;  4JNE A;  3K5L A;  3DRS A;  2JGU A;  3BUZ B;  2YJF A;  4IDK A;  4WFN L;  3I8D A;  1ACA A;  3DLH A;  3F9M A;  2P9K A;  1C0G A;  1WLJ A;  1U47 A;  2QWN A; 
#chains in the Genus database with same CATH homology
 3MWT A;  5AQZ A;  1NTI A;  1NGA A;  2NRT A;  4PL7 A;  3EL2 A;  4CZG A;  4YOY A;  1NGF A;  3E9P A;  5JLF A;  1Q7Y O;  1NGJ A;  4WQ5 C;  5AQX A;  1U2V A;  3L4Q A;  5AQM A;  3JXU A;  5AQG A;  2ZF5 O;  4R79 A;  5KQ8 A;  2OAN A;  4YOX A;  3G25 A;  1TYQ B;  4O8K A;  2NRZ A;  5AZI B;  3CPW M;  5AQI A;  4FO0 A;  3IKM A;  1GG3 A;  3ZX2 A;  1RGI A;  3VF4 A;  3VOV A;  3G4S N;  4ILJ A;  2GEM A;  2QEX N;  1MDU B;  1BO5 O;  3H3O B;  3H46 O;  3FZH A;  4ILG B;  4A5B A;  2YI1 A;  2HE7 A;  3CER A;  3CJ9 A;  2FSK A;  2QI2 A;  4FWR A;  4GY2 B;  3ZET A;  5AR0 A;  5BPM A;  1YJ9 N;  5JIC A;  5C0Y A;  2EWS A;  5F1X A;  2A42 A;  2BUP A;  3KWG A;  5AQH A;  5M1P A;  3A5L C;  4JKF A;  3D2F A;  3DXM B;  3W3D A;  1VQO N;  3UKU A;  4AF1 A;  3VGL A;  3E9O A;  2H3G X;  4KH5 A;  3NMU A;  1NM1 A;  3E1Y A;  3F5T A;  3QBW A;  4G9Z A;  1JCG A;  3QIJ A;  2E8A A;  3DXK A;  4BR5 A;  3A5O C;  3CET A;  1VQN N;  1HJO A;  2NRR A;  4BR4 A;  3CC4 N;  1EQY A;  1Y64 A;  3EKU A;  4LC9 B;  4OPA A;  4K42 A;  2FDQ A;  3O9R A;  3GL1 A;  1JDE A;  1HKC A;  2UYT A;  4I6M A;  5MLC Q;  1V4S A;  4BC4 A;  1QVG M;  1QVF M;  3BF1 A;  3VEW A;  4B9Q A;  3BIN A;  3Q7B A;  1T44 A;  5GIP A;  1KXP A;  4NLC A;  4E1J A;  3ZEU A;  1KQS M;  4BGB A;  2D4W A;  2V7Y A;  3D2E A;  1IG8 A;  5EY4 A;  4O5F A;  3CCR N;  5DM7 L;  1YUW A;  2JWK A;  3C65 A;  3NVK A;  3O9T A;  1ATN A;  3OBY A;  2QWM A;  2GTD A;  3KHY A;  3GOI A;  2F9T A;  5KQD A;  1DT9 A;  3MDQ A;  3MX5 A;  4GV6 A;  1YXQ A;  1ZXO A;  1VBH A;  4IJN A;  4BR0 A;  5M1K A;  5AQS A;  1ATS A;  4CZI A;  4GXB A;  3IFR A;  4MLH A;  2QWL A;  1VQK N;  5F0X A;  2KHO A;  1G99 A;  1WOQ A;  3I33 A;  3VTI A;  3LDN A;  3E9L A;  2RQ1 A;  4EHU A;  4FVU A;  5M1F A;  4ISG A;  4FWK A;  2I1K A;  4M7Y A;  2ITM A;  3F2K A;  4CZF A;  2P9S B;  3R6M A;  4BRC A;  3DWL A;  4JKG A;  1X3M A;  2A40 A;  1R59 O;  2Q36 A;  3EN9 A;  3K9J A;  5GIO A;  1GLJ O;  2P9I B;  1YAG A;  1HKB A;  1NGG A;  1T6C A;  2P9P A;  1T6D A;  2QA4 N;  4FSV A;  3G6E N;  3O80 A;  3ZX3 A;  4CZK A;  3PIO L;  3N4Q A;  5EX5 A;  2E2N A;  1HLU A;  2CQU A;  4GVE A;  4TKN A;  2RE2 A;  5JVL A;  1W2B M;  5E26 A;  5AQJ A;  2FLO A;  1MK7 B;  5TKW A;  4B1X B;  1JCE A;  3KK7 A;  5GIN A;  4PKI A;  3EPY A;  3UKR B;  1OVY A;  3C7N B;  2QW9 A;  1ZC6 A;  3FZL A;  3O6W A;  3LDP A;  1IJJ A;  3DLL L;  3VET A;  3WXM B;  5BPL A;  2YVC A;  1MA9 B;  4C1N I;  2P9L B;  4YOV A;  2EMT A;  4ZRJ A;  1E4F T;  1Q81 O;  1SQK A;  4H5V A;  4BGA A;  1NI2 A;  4Z94 A;  5LJV A;  4FPB A;  4QS8 A;  2D2Q A;  1TYQ A;  2HBL A;  4HDO A;  1GLL O;  3CJ7 A;  3M6G A;  5AZI A;  1VQ8 N;  3CME N;  4YL8 A;  3AY9 A;  3PVL A;  2AA4 A;  1YJW N;  3H1V X;  2CGJ A;  3HOT A;  1P90 A;  3MK6 A;  1BA1 A;  3U9Z A;  1GGO A;  3TTC A;  5JMV A;  5AQV A;  1HB8 A;  3CCV N;  2HBJ A;  1YI2 N;  2PFU A;  5AQL A;  2W41 A;  2IVO A;  3H6E A;  4JKH A;  3TSU A;  5FPD A;  4FWP A;  3DXM A;  3T7Z A;  4CJ7 A;  3FFK B;  3AGR A;  3CI5 A;  3SMP A;  5KPR A;  1GC6 A;  3S41 A;  3QDK A;  4A2A A;  1LOT B;  4KBO A;  3VGM A;  4A61 A;  4CBW A;  3FZM A;  4CD1 A;  4DHY A;  4JK8 A;  4M7X A;  2BH1 A;  5AZJ B;  1K8A O;  1RDU A;  1H1V A;  1TUU A;  2I7N A;  4DXA B;  3HI0 A;  1K8K B;  4BRE A;  3HRG A;  3LM9 A;  3WEE B;  5H1S Q;  1BWF O;  1KC7 A;  4NLB A;  1J19 A;  1QZ6 A;  3MN5 A;  2AEH A;  4PKH A;  3ZX0 A;  3ATV A;  2A5X A;  4MO5 A;  1JCF A;  3RSE B;  3CD6 N;  5TKY A;  5B8H A;  5C2D A;  2HOE A;  1GLB G;  4BVP A;  4BRM A;  5JLH A;  3VEX A;  2I1J A;  3ID8 A;  3AGK A;  2WBN A;  2VGM A;  5AQO A;  5EVZ A;  3VEO A;  1DEJ A;  4Y0W A;  2GX9 A;  3I8B A;  2E1Y A;  5AQN A;  3VTH A;  2COP A;  4O8U A;  4H0Y B;  4FWL A;  3PLA A;  1MK9 B;  2NRH A;  3MN6 A;  4A5A A;  4BRH A;  3I56 N;  3VMF B;  1CZA N;  3MCP A;  3QFU A;  4ISF A;  2ZJQ L;  2D11 A;  1MWM A;  3L6Q A;  3O4W A;  4EAH D;  3SJH A;  4IOC L;  2Q0U A;  2HF3 A;  1BA0 A;  2YHY A;  5AFU A;  2F7T A;  4FWO A;  3X23 A;  4HDQ A;  1Z6R A;  4A2B A;  5BR9 A;  1NLV A;  3SAG A;  2HBK A;  3OW2 M;  2OTL N;  4YOT A;  1GC7 A;  2YJE A;  4BG9 A;  2I7P A;  2P9S A;  2CH5 A;  2F9W A;  3U8Z A;  3AAQ A;  3SBG A;  4H0T B;  2P9I A;  4BRG A;  3LDL A;  1GLA G;  3M3Z A;  1VQP N;  4JKC A;  2P9K B;  2VCP A;  2ZJR L;  2ZGY A;  3TU5 A;  1GLD G;  1MWK A;  3HM8 A;  4FL9 A;  4F9O A;  5FPN A;  1QQN A;  3P31 A;  1YHQ N;  5HOO A;  3W0L A;  2V7Z A;  3O8M A;  3QB0 A;  2PAV A;  1ISN A;  3CMA N;  2CB8 A;  4A62 A;  3BF3 A;  3CCU N;  4JKE A;  4CZJ A;  2WUS A;  3UKR A;  4EIA A;  2IIR A;  5M1O A;  5BRH A;  3ENH A;  3DAW A;  1D4X A;  2A6A A;  3FGU A;  1NMD A;  3R9P A;  1YIT N;  3U7D A;  4H5R A;  5BRD A;  2QWQ A;  3IVF A;  2FSJ A;  2P9L A;  4JK9 A;  1SGH A;  2QWN A;  3O1B A;  4MO4 A;  3O9U A;  4B1Z A;  1DIK A;  2VGN A;  3D6R A;  4BQZ A;  3E66 A;  1VQ6 N;  4BRD A;  3VEY A;  2E2P A;  4IZ9 A;  3VEZ A;  4CBX A;  1V4T A;  1DGK N;  2P9U B;  4KH4 A;  3SAH A;  2VWB A;  4ZRI A;  4YDU A;  2WC9 A;  4FOI A;  3WXK A;  2ASO A;  4CYE A;  1YF5 L;  2X0S A;  4JD2 B;  1HX1 A;  1NWK A;  2E88 A;  4WQ4 A;  1M90 O;  4RCH A;  5LJW A;  5BRF A;  3AAP A;  4HTL A;  3FP5 A;  3CQY A;  1Q82 O;  3R3L A;  1WUA A;  1SZ2 A;  2HBM A;  4IXC A;  2KLA A;  3C6H A;  1NGI A;  3VEN A;  4A57 A;  1KAZ A;  1GLE G;  1BDG A;  4H03 B;  4WCE L;  1J6Z A;  4CZL A;  2V52 B;  3P39 A;  1NGB A;  2QXL A;  2Q97 A;  4GNI A;  1JJ2 M;  1KC8 O;  4WQ4 C;  1RDW X;  2DPN A;  2GEL A;  1SAZ A;  4EKU A;  1TUY A;  1Z05 A;  4XH4 A;  4BC2 A;  5AZJ A;  3U4L A;  3FZK A;  2FF6 A;  3M1F A;  5BN9 A;  1YIJ N;  3EO3 A;  3D7E O;  5C15 A;  1K8K A;  1NJI O;  3CC2 N;  3OHR A;  2IVN A;  3VF2 A;  3NVM A;  4PHT X;  1C0F A;  3WEE A;  3CCM N;  1XUP O;  3QIC A;  1ATR A;  3MWP A;  3IUC A;  4FPA A;  1M1K O;  1VQM N;  2Q0R A;  2ZWH A;  3KVG A;  4B1V A;  3I55 N;  3LDO A;  3PZD A;  3RSE A;  1SS6 A;  4L3Q A;  4XEI A;  5CR4 A;  4IFE A;  1N8R O;  3HTV A;  3ID6 A;  5GAH P;  3R1X A;  2QWO A;  5AQR A;  3N4P A;  3TSQ A;  5CE3 A;  4QS7 A;  2D0P A;  3JS6 A;  3SAF A;  4WFB L;  3CC7 N;  4YOR A;  3EE9 A;  2W40 A;  3L4I A;  3CCQ N;  3CCL N;  4FWN A;  1HKG A;  4H0O A;  1ST7 A;  4BRA A;  4JN4 A;  1NGE A;  5BRE A;  3WXI A;  3RVC A;  4BVO A;  1EO1 A;  3AAR A;  4JKB A;  3CJB A;  2ASM A;  3ATU A;  2GWK A;  2QTD A;  2E2O A;  1MIX A;  4JAX A;  1YVN A;  3CJC A;  3CJ1 A;  5FPM A;  2NRX A;  3B8A X;  3QFP A;  2ZGZ A;  1HBK A;  2YX6 A;  4CBU A;  2FF3 B;  1K73 O;  3CQX A;  1ILY A;  3GG4 A;  1VQ9 N;  4EHT A;  4WF9 L;  5AQP A;  4NO7 A;  3A8Y A;  4BC3 A;  3WUH A;  5GAD P;  4UY8 O;  1QZ5 A;  2V51 B;  3ULE B;  3VGK A;  2R82 A;  2E2Q A;  4KH6 A;  4XH1 A;  5AQW A;  3WT0 A;  1HUX A;  2YHX A;  4PKG A;  2KKZ A;  4DCH A;  4F7G A;  5F2R A;  3EKS A;  1HPM A;  1KAY A;  4H0V B;  2P9N B;  4CZM A;  4BY9 C;  4OO1 J;  3LDQ A;  3AU5 A;  1S72 N;  2ZJP L;  5BN8 A;  3G71 N;  4IWV A;  3O1W A;  4DKW A;  4JEP A;  1NBW A;  2NNW A;  1Q18 A;  4NB4 A;  4H5N A;  2YHW A;  4JHD B;  1GLC G;  3CPE A;  3CCJ N;  2D10 A;  3MMV A;  4DB3 A;  2GUP A;  5M1Q A;  2QWR A;  3EZW A;  4PL8 A;  1XQS C;  4U67 L;  5LY3 A;  1KAX A;  3A0I X;  1NGH A;  2P9U A;  5AQK A;  5I9E B;  1E4G T;  2A41 A;  2Q31 A;  2FJ9 A;  4JD2 A;  5AQU A;  4BC5 A;  1MIZ B;  2NZT A;  3O5B A;  4IOX A;  2Q2R A;  3KWI A;  3UB5 A;  3T69 A;  3C0B A;  3K9K A;  1LCU A;  2A3Z A;  3FLV A;  1E5W A;  3VF6 A;  3ZYY X;  2YCH A;  2CGL A;  2HRJ A;  3MN9 A;  4IEI A;  2VYP A;  5KPZ A;  5GAG P;  1Y19 B;  1U2V B;  2J4R A;  3SMS A;  1VBG A;  3VEV A;  1X9J A;  1EF1 A;  3C7N A;  4IDH A;  2AP1 A;  4BRL A;  5M1N A;  3SBT A;  4B1W B;  3A5N C;  4RWT A;  3AU4 A;  4H5W A;  4C23 A;  3CXC M;  1VAZ A;  2OTJ N;  2IVP A;  2NRV A;  2J0K A;  2Q1N A;  4QS9 A;  5C12 A;  5CHI A;  1OKJ A;  3H1Q A;  2FSN A;  2ASP A;  4YOW A;  3C6A A;  1O13 A;  2E1Z A;  3U8X A;  1X3N A;  1S22 A;  2ABD A;  3H3N O;  3CIP A;  1QQM A;  3TTF A;  4ISE A;  2HF4 A;  4BRQ A;  2RHK A;  1Q86 O;  3ZDT A;  5ELZ A;  4WYB A;  3ZET B;  3WQT A;  3SLC A;  3WXJ A;  2EMS A;  1KBL A;  1DKG D;  3J8A A;  3SK3 A;  1BOT O;  5ADX H;  3ENB A;  5DM6 L;  4JKD A;  4H0P A;  1ZBS A;  3OA9 A;  2FXU A;  3D2F B;  4BRK A;  3PIP L;  3O9Q A;  2E20 A;  3UKU B;  1H4R A;  3P4I A;  2QM1 A;  1P8Z A;  2ZPY A;  4FWM A;  4IEE A;  3OBW A;  3DXK B;  3FLC O;  3HZ6 A;  4GV9 A;  4FOE A;  5FPE A;  2CH6 A;  3GDQ A;  5GAE P;  4BR7 A;  3O08 A;  4RTF D;  2DIK A;  4NY0 A;  2NLX A;  4M63 C;  1ESV A;  3TSP A;  3LL3 A;  4I6M B;  3GBT A;  1W97 L;  4YDU C;  1KD1 O;  3WQU A;  4CZE A;  4K41 A;  3P38 A;  4WFA L;  4IO8 A;  3CJA A;  4BRI A;  5C10 A;  4U7B A;  5HL7 L;  4MDB A;  3ZEU B;  4CZH A;  1BU6 O;  1S3X A;  2D1K A;  3D2E B;  3CF5 L;  4GV3 A;  4K43 A;  2GWJ A;  1BG3 A;  4IOA L;  1BUP A;  1NGC A;  2JWL A;  3Q7C A;  3UE5 A;  2D0O A;  3VPZ A;  4BG8 A;  1VQ4 N;  2PBD A;  2J0M A;  4K25 A;  4XH5 A;  5AQT A;  4BRN A;  4CI6 A;  3ENO A;  1U6Z A;  5BPN A;  3EE8 A;  2HST A;  4H0X B;  2WFB A;  5E84 A;  3IDH A;  4B1Y B;  3R8E A;  5KPT A;  4YOU A;  4IO9 L;  4ILH A;  4EFH A;  3VES A;  3DJC A;  3IMX A;  3M5R A;  4IJA A;  2QWP A;  3O9S A;  3FE1 A;  5EXW A;  3H45 C;  3ULE A;  4A59 A;  4DQ8 A;  2LBB A;  3G9W A;  4OPH A;  3HBT A;  3BP8 A;  3QBX A;  3LM2 A;  3WXL A;  5AQQ A;  4B1U B;  4BQL A;  5JVG L;  2HMP A;  4CD3 A;  2NRW A;  4J8F A;  2AL6 A;  1T3V A;  5AQY A;  4JKA A;  4JKG B;  2CGK A;  3J7Z O;  3HOS A;  5AFU H;  4AM7 A;  4FWQ A;  2P9N A;  4BRO A;  2P9P B;  1QQO A;  1YJN N;  1K9M O;  4BRF A;  4ZRK A;  4MDA A;  3TPQ A;  3CCS N;  1XC3 A;  3GE1 A;  3KZB A;  2WH5 A;  4P7I A;  3BEX A;  5JVH L;  3CCE N;  1NGD A;  3A5M C;  4HWI A;  5ADX A;  3QML A;  2J0J A;  4H5T A;  5IJM A;  1VQL N;  4AM6 A;  3VER A;  4BR9 A;  4JHD A;  4MLE A;  3TTD A;  3U9D A;  3CHW A;  1HB6 A;  3MCA B;  3MN7 A;  3WA0 A;  4JNE A;  1GLF O;  4WQ5 A;  2BTF A;  3BUZ B;  3MX2 A;  2YJF A;  1NVL A;  3HSC A;  4WFN L;  1ACA A;  4FWS A;  4C1N K;  4BR2 A;  1QHA A;  1VQ7 N;  3F9M A;  2P9K A;  1C0G A;  5EOY A;  1VQ5 N;  1RFQ A;  3FR0 A;  3FZF A;  3L0Q A;  5C2F A;  4JK7 A;  5AQF A;  4BRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...