4JKGB

Open and closed forms of mixed t1789p+r1865a and r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
214
Chain Sequence
LFSNQIIWFVDDTNVYRVPIHKLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 66
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkgB02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkgB01
4JKHA 3E9PA 4JKAA 4JK7A 4JKBA 4ILGB 4JKGB 4JK9A 3E9OA 4JKGA 3SBTA 3SBGA 4JK8A 4JKFA 4JKCA 3E9LA 3ENBA 4ILJA 4JKEA 4ILHA 4JKDA 3E66A
chains in the Genus database with same CATH superfamily
1YXQA 3EO3A 1X9WA 3A5NC 4A59A 1MIXA 3BZKA 5MLCQ 4DFKA 1QHTA 4CBXA 3J7ZO 1KAYA 3T1HK 3PSIA 2KZZA 5M1NA 1LWFA 2ITGA 3C6TA 4BRPA 3O08A 3UKRA 1L3VA 4JKCA 3M8RA 2QEXN 1CXUA 3HO1A 1WSFA 1ZXOA 3QINA 4BC3A 1VSFA 1JLFA 3QB0A 4KKOA 3CMAN 4ILHA 2O8BB 1JL2A 2O8CA 3SUOA 1RGIA 4BQZA 2XY5A 4YNQA 1NGGA 2Q97A 3AGRA 4DFPA 3PIOL 4ZRJA 3AVKA 3L3UA 3I0SA 4KH6A 3DXKA 4ELTA 1U47A 4QAGA 4M63C 1W97L 2IVOA 1HUXA 1KVBA 3U9DA 4DS5A 4YHHK 3PX6A 2WUSA 4YL8A 5AQUA 4GV6A 2VGMA 4DV4K 2JGUA 1D9FA 3LP1A 3CETA 3OS0A 4K0KK 3CF5L 2VWBA 3ID6A 1QZ5A 4FO0A 1IKYA 3HM8A 2P9UA 3LDQA 1ZBIA 3Q7BA 3LANA 4BRAA 2HBMA 3V9ZA 3AY9A 4Y1CA 2ZM6K 3V9XA 3NVKA 4O5FA 2IC3A 1RBSA 3HSTB 3G0ZA 3L0QA 4HUGA 4PQUA 3FZHA 1N8RO 1HRHA 4E1NA 4DXAB 3IUCA 4O0JA 3VF6A 1E5WA 4U67L 4DTJA 2YNIA 4DV5K 1VQ7N 3SQ0A 4E7JA 3O6WA 3L2VA 2BE2A 3L2WA 2QKKA 1IG8A 3RMAA 4NY0A 4MDAA 1RT6A 2FC0A 5C12A 1QSLA 4KTZA 4L3QA 3BINA 5M1KA 2HB5A 3HOTA 3VOVA 4BGAA 4M3XA 5C24A 4B3MK 4EZ6A 2P9SB 4CEQA 4KHUA 3G10A 4ELVA 3K5LA 3GE1A 4NCAA 1GOCA 2GELA 5HRNA 4JKHA 1S6QA 1P90A 1KD1O 4J2EA 1NVLA 1BISA 2HBKA 3O3FA 1HPMA 2PZSA 4DSEA 2FBTA 3W3DA 1RBUA 4DSIA 4WYBA 5C10A 3NGYA 5AJ3K 4BDZA 1K73O 2D0PA 1BI4B 5BN8A 4FJ8A 3AV9A 2EMTA 2W6LA 2JWLA 4CJLA 4DCHA 3CCSN 4CGIA 4Z0UA 2OCEA 4B9QA 3SQ4A 3CJ9A 1NOYA 3VF4A 2F7TA 5HRRA 3K9JA 1XC9A 1J54A 3LPUA 1RDCA 2ZE2A 4XH1A 2P9LA 5CY4A 2J0KA 3TAMA 3UKRB 4CEDA 2DY4A 3E9PA 5BRFA 1YHQN 3NF6A 1TKDA 3WXIA 3OYNA 3J80O 1ZC6A 4E1MA 3QIJA 3FZKA 3AA5X 1HNIA 1VSEA 2QWQA 3O1WA 3JXUA 3M6GA 4IG3A 1QTMA 3SLCA 2ZJQL 5A2QO 3ISNC 1RDDA 4CHPA 4DU4A 4LF6K 4JI3K 4FLZA 3QIPA 4CFBA 1KLMA 3P5JA 2QA4N 4Z4IA 3HM9A 1BCOA 3NVMA 3P38A 4AM7A 4CZJA 4FVUA 2G8KA 3G25A 1Q18A 4K43A 5CHIA 4HCCA 4XH4A 4E7HA 2LBBA 4JRQA 4JRPA 4F3OA 1TK8A 3AO4A 4FJXA 2F8SA 2YHWA 2KTQA 4FWRA 3NBPA 1WBBA 3AA3A 5BPLA 1FK9A 3VEYA 3KK2A 1GC7A 4FWLA 3MN9A 4LH5A 4F2SA 4LF9K 3OYJA 1SGHA 1WLJA 1YTAA 3V9UA 3NGIA 2O4IA 1WSJA 1WNSA 2B4JA 2CB8A 1Q82O 2XY8A 1IBMK 2NRRA 3DM2A 4A61A 4W5OA 3U8ZA 3TSUA 2NRZA 3HPOA 4ID1A 4WFBL 3ENOA 3O3HA 1VBHA 4RW7A 1VAZA 5HROA 1NGAA 1KQSM 3ZYYX 5AQIA 2E20A 1NGDA 4A2BA 5C15A 4F8RA 1T03A 4WCEL 1B92A 1J9AA 2UUCK 4OLBA 1T8EA 5JS1A 5CYQA 4H5VA 1RT1A 5BREA 1RT5A 4FK4A 4IFVA 4Z4CA 5AZJA 3BZCA 4LFAK 3L4QA 1TV6A 2ASPA 1YF5L 1REVA 4KHYA 3PY8A 3WNHA 3ID8A 1NG9A 4DV0K 4AILC 4K25A 2G8FA 3DLHA 3ZSOA 2NLXA 4BRNA 4BREA 2HW3A 3T1YK 4DTRA 4CGHA 4M3RA 1B9DA 2KKZA 3VERA 1D9DA 4B1YB 2V7YA 4CJ7A 3P83D 4FXDA 2QK9A 4IEIA 4JN4A 4Z94A 2GUIA 3U3YA 2YNGA 2XY6A 4H5NA 3EYZA 4FLXA 3CHWA 2HVIA 3J7AP 3RMDA 1NM1A 1U2VB 2OPSA 4FWOA 1I94K 3ZSQA 2OTJN 3FLVA 4O44A 4CF8A 2Q0UA 3C7NB 1G15A 4K8XA 3ITHA 3VQBA 3SCXA 4JKGB 4FM2A 3DOKA 3L2UA 1WAFA 4FJNA 5ADXA 1V4TA 2EMSA 5HL7L 3THVA 4KB0A 1VQLN 2EWSA 5CZ1A 3THXA 5LMUK 4KHWA 4B1WB 1KAZA 4RCHA 3QEPA 3NE6A 4OVLA 3VGKA 3MCAB 3ZLJA 3F2KA 3W0LA 4CGJA 2IAJA 3LM9A 4DF8A 3OYFA 1IG9A 1XC3A 3VEXA 4BRFA 1GG3A 1KFSA 4FPBA 4DFMA 4B1XB 4DTSA 4HCBA 1LWCA 4E19A 4PA1A 3VQ5A 4B3OA 3MCPA 4BE0A 1SS6A 4DR4K 4DTOA 1SL1A 3OY9A 2QM1A 1EKEA 4FK0A 2OPPA 1P8ZA 4FJ9A 2B6AA 2J0JA 5HRSA 1GOAA 1Q7YO 2DIKA 3I33A 4JI0K 4B3RK 4NO7A 1BG3A 1WB9A 1C0TA 5AQNA 3D2EB 4N47A 3CFOA 4CHYA 3CQYA 1U6ZA 1U2VA 3EKUA 1FKPA 4CF0A 4DQQA 2H3GX 3HBTA 3P31A 4CK2A 5E41A 1RBTA 4DQ8A 5JLHA 3SYZA 4IOXA 2P9KB 2B5JA 2Q1NA 4DTPA 3NHGA 1GLFO 3DRRA 4C8LA 1D5AA 4ILGB 5LY3A 2OPRA 5D3GA 3SPYA 4CBUA 1S9EA 1EXQA 3E9LA 4XIUA 4ILJA 2OANA 3NH1A 1E3MA 4OGCA 4CJQA 2ZGZA 2KLAA 3QEXA 2IGIA 3PO5A 4O55A 3NMUA 3NF7A 3HRGA 4KHSA 1CXQA 3I0RA 3K0SA 2W6KA 3IRXA 3AVMA 3PX4A 2QWPA 2D5RA 3LP3A 3GDQA 3AVAA 3NH0A 3PZDA 4H4MA 3KHYA 3VF2A 2Q2RA 3IVFA 4FJIA 3SPZA 4ISFA 2EX3A 4PHTX 5JMVA 1TL1A 4BE1A 3CYMA 5FPEA 3C65A 5KRSA 3KIOA 4B9NA 5AQSA 4CEAA 4CK3A 3DOLA 3CXCM 2AEHA 3KWGA 2W40A 2WBNA 3MMVA 4E89A 5KGXA 1QVFM 2NRWA 1U49A 3RVCA 1T44A 4FWMA 5AR0A 3U8XA 4CZGA 4DV7K 1XHZA 4DQIA 1T6CA 2VQFK 4EIAA 1FW6A 4IO9L 1JLQA 2X74A 3VQDA 3TSQA 4NYFA 3L2QA 2NRXA 1S6PA 2P9IB 2X6SA 3A5OC 2O4GA 4BVPA 4BG8A 3QBXA 1SV5A 2E1YA 4JK9A 3MEDA 3UKUB 4H0YB 2F4VK 2IOCA 4I6MA 5EVZA 2RPIA 4B8AB 3HVTA 2QWMA 1HB8A 2LSNA 3S3NA 1U48A 3D7EO 2GWJA 3QNNA 4GNIA 2ETJA 1VQPN 4WQ4A 3THWA 3OVNA 2P5OA 2E2NA 3HJFA 3E1YA 2IIRA 1RDUA 3OYCA 2ZGYA 4JKFA 2QW9A 2D11A 3K5MA 1EF1A 3A2FA 3KD5E 5AQGA 2FBVA 2QWNA 1TK5A 5HLFA 5C0YA 2ZPYA 3R3LA 2UXDK 5AQRA 1A5WA 2P5GA 4CJWA 4OGEA 2PYJA 1BO5O 3NCIA 3TU5A 4CZIA 1NGJA 4B1VA 3KK1A 1OH5A 4FJLA 4JS5A 3SUPA 4BC5A 4M7YA 2GX9A 3TAGA 4YY3K 1Z05A 1NMNA 4LH4A 4MQ3A 4CHZA 4B9LA 4C23A 3BEXA 3BP8A 2UXCK 5GIPA 2CH5A 4RG8A 4JKEA 1ASVA 3WT0A 4ISEA 2YHYA 3J8AA 5BRDA 2KZMA 3ATUA 4JKDA 3V81A 5AQFA 5FROA 2ATQA 2A40A 3LAKA 3WXKA 4H5RA 2UXBK 4JKBA 3R1XA 1VQ8N 2WTUA 2D0CA 2CH6A 3OYGA 5C2FA 1TYQA 3CERA 4UY8O 2OA8A 1JLEA 2HNDA 1BU6O 3S3MA 3O9RA 4PKHA 2P9LB 4I6MB 3OHRA 5LMNK 4OKKA 3R9PA 3OS1A 3PSFA 3RMCA 3QBWA 3ZT3A 2HNZA 3N4QA 2FJ9A 2VWKA 3QFPA 1VQKN 2QKBA 2VCPA 4DKWA 3L8BA 3CFRA 4H8KA 4HDQA 4EAHD 3ZSYA 3CCQN 2QXFA 1RDBA 3DRPA 1L5UA 1HBKA 2D0OA 2HMPA 4JI6K 1EP4A 4H4OA 1YJWN 3A0IX 1LW0A 1JCEA 1YVNA 3OTOK 3H1VX 4WFAL 1DTTA 4WQ5A 3UE5A 4B9TA 4J2DA 3M8PA 4JS4A 3BUZB 1KFDA 2CGJA 3NF9A 3KLFA 1BHLA 2A5XA 1VSLA 4Z4FA 5AQQA 2VG6A 4CEFA 4ZTJA 4JV5K 5M1FA 3E66A 3SJHA 1CZBA 3DXKB 1SUQA 3O9UA 5LJWA 2HHSA 1QE1A 4CIFA 1Q81O 2FDQA 2P9PA 4J8FA 3E01A 2O8FA 4C8MA 1YT3A 2KW4A 4KFBA 2E2PA 5KRTA 3K2PA 1EX4A 2UYTA 1BWFO 3OYBA 3ZSWA 1VSDA 4E7LA 3GBTA 2UU9K 5AQKA 4CK1A 4CJSA 4W5TA 3HOSA 4AHVA 1K8KB 4JK7A 2E2QA 4FW1A 4M3ZA 2P9IA 4FWNA 2HHUA 1J5OA 4AHRA 4B9VA 1TAQA 1N36K 1CZAN 4E3SA 1QSSA 4ZRKA 2F96A 3O9TA 5J2MA 2F8TA 1VSHA 2VG5A 1GOBA 2RKIA 2YCHA 5LL6Z 2ZJPL 3HP6A 3VEOA 4BR0A 5CE3A 4I9LA 1TUUA 2OYQA 3SAGA 3LZJA 3CC4N 4B3SK 2O8FB 1LOTB 4NYNA 2XO7A 5KGWA 1X9SA 1VSIA 3ZSXA 4O8UA 4IOCL 3UIQA 2YHBA 4IDHA 1ST7A 4AQYK 1WSHA 3F9KA 1RT2A 5CYMA 5M1PA 1KXPA 3L3VA 4HHTA 2PFUA 3NFAA 4FJMA 1NJXA 4NCBA 5JS2A 1HX1A 5SWMA 3AA4A 1TL3A 3AA2A 4AHTA 1NGCA 4IDKA 1EETA 4CYEA 4CZFA 3DI6A 2E8AA 4MLHA 1SL2A 3LALA 4LSLA 4R5PA 1VBGA 4M7XA 5GAEP 1LAWA 2YI1A 2ZD1A 1C0GA 1WUAA 3ALYA 3ZSVA 1N6QA 4JHDB 3WXJA 1RTDA 4IZ9A 2DTUA 1DKGD 3VEVA 1NJIO 4EFHA 4NLBA 1DEJA 3VGMA 1NGIA 3P4IA 4KB1A 5J1EA 4J2AA 2WC9A 1VQ4N 4IBNA 1BGXT 2I1JA 3ULDA 5ELZA 4DR1K 4BR2A 5IT9O 1S22A 4G9ZA 1BOTO 3AO5A 4DR5K 5TKYA 3CCVN 3ULEA 4I2PA 1K8KA 2A1SA 5F1XA 1U04A 2HHWA 4HTUA 3MN6A 1EWQA 1WSGA 1XHXA 1Z6RA 1UA1A 2FF3B 1IJJA 4FVMA 4DR7K 4CIGA 1F21A 3ZX2A 1TYQB 3VQAA 2A6AA 1MU2A 1HNWK 1NU0A 1HNVA 1QQMA 3B6PA 4IG0A 4Y0WA 3ENBA 3EE8A 3PO4A 4I2QA 4FYDA 3PVLA 4CHOA 4U7BA 2FBYA 2RF2A 1TKTA 3KKRA 4EHTA 5KTQA 3LL3A 4N41A 3G4SN 5FRMA 4E7KA 4RW4A 1S1WA 4RW8A 1IKVA 1IO2A 5FDLA 3AVCA 4CERA 1S1VA 3PIPL 1MIZB 1H1VA 1GLAG 3SK3A 3TR8A 2YVCA 4EP5A 1R59O 3M8QA 2W42A 4DB3A 3SMSA 1Q8IA 4B1ZA 4CW7B 4B9MA 3FP5A 1SL0A 1E4FT 1ASWA 4M3TA 1NK5A 1CZ9A 2UUAK 1JCFA 4FLVA 1NGFA 1M1KO 1NMDA 1KSPA 3DLGA 3MN5A 4EHUA 1MWMA 3BGRA 3SMPA 4TSXA 2P51A 3QDKA 1WSIA 3NGZA 4E1JA 2I1KA 4JI2K 1ATSA 3S9HA 3QEIA 2YNHA 2O8DA 4F3TA 2A1RA 1SKRA 1N32K 4KH4A 2RQ1A 4DTXA 2NZTA 1S5JA 1YUWA 1O13A 4PKGA 5SZTA 3CQ8A 3C6AA 3FZMA 4WQ5C 3LAMA 4CFDA 5F0XA 1XUPO 5JVGL 1ZBSA 4AHSA 4CZMA 1S1TA 1E4GT 2W41A 1JLGA 4LF5K 1HYVA 3H08A 4DUZK 4RW6A 3ZEUA 4LFCK 2OZMA 3QERA 1BDGA 2HBLA 2P9NA 4LD0A 5AFUA 3TARA 4F7GA 4K8ZA 3T69A 4WFNL 1IH7A 3VQ7A 3FFIA 1BUPA 2YJEA 4B8CA 4GV9A 3AAQA 4KO0A 3WEEB 1D8YA 3HPGA 3K9KA 2QXLA 5BPMA 4DV1K 2R7YA 3IFRA 3OYKA 1CLQA 5KPRA 4H5WA 3CJ1A 5JVLA 1DGKN 3C7NA 4BDPA 4CF2A 1WN7A 5C42A 3I8BA 4BR7A 2O8BA 3S3OA 3DXMA 3M8SA 3HP9A 2HHQA 4CF1A 2YHAA 3DRSA 2HHVA 5AQXA 3K57A 4DWIA 3O9SA 3QFUA 4OLAA 4Z4HA 4PUOA 3CMEN 4CFCA 2BUPA 3V4IA 3GL1A 3JAMO 1ITGA 4LF7K 1Y19B 1N34K 1OH7A 4GMJB 5AZIB 4OPAA 5E26A 4JYAK 1NGEA 3T1AA 3I8DA 3FE1A 4CJVA 1RTHA 1BA0A 4KHPK 4CEEA 1VSMA 3CI5A 4YOVA 1VQON 2RE2A 4CECA 1L3SA 3FR0A 4FL9A 4YDUC 2VQEK 4H0TB 2PY5A 2G8IA 3KWIA 3WXMB 4CF9A 4DV2K 2J4RA 1NJWA 2HE7A 4BWJA 4BR5A 1HNXK 1YAGA 4BC4A 5EU7A 3SQ1A 3CIPA 1U45A 2VYPA 4BROA 3F9MA 1QVGM 1VQ5N 4QOZB 3ENHA 4CZEA 3OA9A 4DQPA 3FZLA 1VHXA 1X3NA 5DMRA 3QESA 4JI8K 4FJ7A 2PBDA 4K42A 4CGDA 3MAQA 2CGLA 1QZ6A 4H03B 3OYMA 1TVRA 1ZBUA 3TWHA 3TANA 3X23A 3D2EA 3TSPA 3ZT0A 1RBVA 2V51B 1YJ9N 1EWRA 3VTIA 4JAXA 1S1UA 1Y97A 4H0VB 1TGOA 3RMBA 1JJ2M 3O80A 3M5RA 1Z26A 5HRPA 3VQ9A 1ILYA 4CFAA 2X0SA 3KLEA 2HRJA 3SUNA 3TAEA 1HKBA 3PUFA 4PWDA 3VQ4A 2BGGA 3IKMA 3WNGA 4CBWA 2FXUA 4F4KA 4XH5A 1ACAA 4RW9A 4JKAA 3V1RA 4BRHA 3QLHA 4B3TK 1DIKA 3ZT2A 4Z4GA 4FJGA 4H5TA 1JXEA 2HF4A 3KK7A 3ZT1A 4BY9C 4ELUA 1ZBHA 4CZKA 3BF3A 3LDSA 3RR7A 4H0OA 1EO1A 4YORA 4C8OA 3RSEB 5BN9A 4Z4EA 1RDAA 1EQYA 2FF6A 1JLBA 4DQSA 4FM1A 1NLVA 1RFQA 1RTIA 1VQ6N 3HT3A 3SBGA 3WQUA 4GW6A 1HLUA 2D0BA 3GOIA 4YOTA 4CESA 2FLOA 1J19A 3L6QA 4BRIA 3CJAA 3O1BA 3AO3A 2D10A 3VMFB 1TK0A 4FW2A 2D1KA 4OPJA 2YNFA 3ZETB 3L2RA 1BA1A 4JEPA 4DTMA 5KQ8A 4KRFA 4DLEA 1QSYA 3QICA 2BTFA 2Z1IA 4GKJK 3AVIA 1W0HA 4F2RA 4DSJA 4OX9K 3Q7CA 1NK0A 4M3YA 1MDUB 4ISGA 5KPZA 4BG9A 1N33K 4CJUA 4IO8A 1NGHA 1S1XA 3QEVA 4Q0BA 3D6RA 4W5NA 2E5LK 3WUHA 3H3NO 4QS8A 4KTWA 3FLCO 3U4LA 3U9ZA 4KI4A 1JCGA 1G99A 1OVQA 1X9JA 3C95A 1GGOA 2RN2A 3MK6A 3SQ2A 1J5EK 1IBLK 2ASMA 1RT3A 1LV5A 1A5VA 1NBWA 4PKIA 3K59A 4QS9A 2YV0X 3NF8A 2QWRA 1LWEA 4DU3A 1KVCA 4CHQA 1L3UA 4DU1A 2E88A 4M41A 1KAXA 1X1PA 3LWLA 3WXLA 4JD2B 2YJFA 3VA3A 4DR3K 1YJNN 3VESA 3CM5A 3MX5A 5BRHA 1UOCA 2IVPA 3MEEA 5K14A 1BQNA 4CGGA 1HQUA 3KJVA 1T05A 3HVRA 1K9MO 2DFHA 4C8NA 1KC8O 1ZBFA 4DTUA 1NKBA 3VQEA 3K58A 4BR9A 3EL2A 3MXIA 4MLEA 1XQSC 2D4WA 3I56N 5EY4A 3VENA 1U4BA 1HYSA 5J2NA 4MO5A 3OJSA 1BI4A 4BRQA 3TAFA 5CZ2A 2ZWHA 4KPYA 1I39A 1R0AA 3K5OA 3AU4A 1J6ZA 3MDQA 4CHNA 3RRGA 1BIUA 3TAQA 1SZ2A 4X64K 4JLHA 2GV9A 2OPQA 5AQYA 5KQDA 2IVNA 1L3TA 4TKNA 1TUYA 1JLAA 1T3VA 3U3GA 4YOUA 3MX2A 4LFBK 1C0UA 1RCHA 4FWSA 3H45C 2HHHK 2Q36A 1JXBA 1RILA 3D0PA 2V52B 4M45A 4HTLA 1VQMN 4PY5A 1C1CA 4FWQA 2ZQBA 3CFPA 2GUPA 3MXJA 4IFYA 3RRHA 3QO9A 1SKSA 2KQ2A 1C0FA 2X78A 3ZSZA 3KLIA 2I5JA 2YHXA 4H0PA 3CCUN 3SV4A 4FJ5A 1TAUA 4ID5A 4GKKK 4CJKA 4NCGA 1NI2A 4DF4A 2EHGA 4A62A 4CJFA 1KBLA 3BDPA 1HPZA 4C1NI 4BGBA 1GLJO 4AH9A 2FSNA 3RSEA 4WE1A 4O8KA 4HDOA 3QETA 4BRDA 4O5BA 3SAHA 4JI4K 1DT9A 2YX6A 2Q31A 4YOXA 3PV8A 4FWPA 3JYTA 4FWKA 4M3UA 3A8YA 4DR6K 3O9QA 3ZEUB 2NRTA 1T6DA 4JKGA 4P7IA 2Q3SA 1D4XA 1UAXA 4BE2A 5HOOA 3AARA 3T19A 4WQ4C 3WA0A 1ATNA 4KH5A 4DHYA 4R79A 2WFBA 1WAJA 1LCUA 1ZBLA 3CC7N 1GC6A 3VA0A 3THYA 5DK5A 4CEZA 3CQXA 2P9PB 2NRVA 3U6FA 2HHTA 3IDHA 4CGFA 4FK2A 3THWB 2FBXA 2VGNA 3H1QA 5M1QA 3OYAA 1JDEA 1GLBG 4BRKA 4DFJA 4KHNA 4IWVA 2DFFA 4JI5K 3SI6A 1FXXA 1QQCA 3L4IA 1ZYQA 2HOEA 2AA4A 1HQEA 1VSKA 3HSCA 3DJCA 5AQWA 4QS7A 4CVNE 5HBMA 4FSVA 1FKOA 4BRLA 1KVAA 3N4PA 3WQTA 3EZ5A 4KV8A 2HHXA 4KHQA 4HVJA 2E4LA 1KTQA 3CD6N 3T3FA 4IFEA 2P9KA 3OYIA 2VWJA 3AGKA 3DLEA 4MO4A 3VPZA 3OYHA 4XEIA 1ISNA 4LF4K 3BF1A 1HYZA 4IJNA 5FRNA 2QWLA 5AQJA 4M3WA 3LDPA 4EKUA 5KI6A 1HMVA 4OKEA 5AZJB 4AF1A 2E1ZA 4JHDA 4GY2B 4DS4A 1O1WA 5I9EB 1WOQA 1IV0A 5GINA 3O4QA 3J7YP 2IS3A 1MK7B 4FOEA 3E9OA 1N5YA 2YKMA 3ZT4A 3HK2A 3DLBA 1TKZA 3CPWM 3OW2M 3CCJN 5TKWA 2O8EB 5AQMA 5EXWA 4NB4A 2CQUA 4G1QA 1T7PA 3AVGA 1Y64A 3OBYA 3SAFA 2F9TA 2NNWA 1NGBA 4A2AA 3SNNA 1MWKA 3HPHA 1V4SA 3CJCA 5AQLA 1C1AA 4IKFA 4DG1A 4B1UB 2QI2A 5GADP 2AP1A 5EX5A 3IS9A 3SBTA 3TABA 1XMOK 2GTDA 4DSLA 2DPNA 3LWMA 3K5NA 3M3ZA 4FJKA 4OPHA 2Q0RA 2G8HA 1VRUA 1XNRK 4W5RA 4AM6A 4FZZA 5BR9A 1I3AA 3G6EN 2FSJA 1VQ9N 4NLCA 2E6MA 4X65K 2WONA 3T7ZA 1OKJA 1TKXA 3AO2A 3CG7A 3LP2A 4EZ9A 4DSFA 1HR0K 4CZLA 5KPTA 4DLGA 3D2FA 3OYEA 2Z1HA 3AU5A 5FPNA 3R8EA 3TI0A 3FFKB 4JD2A 2Z1GA 3KLHA 1Z25A 1S72N 1QS4A 3VQCA 1SQKA 1GLLO 4BR4A 1C0MA 1C1BA 5JLFA 3R6MA 4CJ3A 4CE9A 3O5BA 3ZX0A 3VQ8A 2ZJRL 4N5SA 1IBKK 1KC7A 1B9FA 2PAVA 3QMLA 1M90O 2QWOA 5M1OA 4BRMA 2WOMA 3HZ6A 3ZCMA 3AAPA 3B6OA 3V1QA 3VTHA 5IJMA 1YIJN 1XMQK 1NWKA 4ICLA 5AQOA 3PLAA 2KFZA 4JI1K 4DR2K 1X9MA 4FPAA 1ASUA 2A42A 4M42A 1W2BM 3OYLA 2GEMA 1NK9A 1BIZA 1A5XA 5AQTA 4CI6A 1MA9B 2E2OA 3EEQA 1LAVA 3VQ6A 4CJEA 1XI1A 5AZIA 4FZYA 1HJRA 3IMXA 1X3MA 4BC2A 4OPKA 2CGKA 4HUEA 3C0BA 1NK7A 4DSKA 3DLLL 2PYLA 3OYDA 1RDWX 3VN5A 4N76A 4V19S 2BDPA 2KFNA 3AVNA 5AQHA 1VQNN 5J2PA 3THYB 4LY7A 1HKGA 4CCHA 2A41A 4X62K 4FOIA 4Q5VA 1YVUA 2P1JA 3H46O 2F9WA 3C6HA 1HB6A 2QTDA 4K41A 4FLTA 4ZTFA 3D2FB 2E6LA 3TTCA 4CEBA 4NXNK 5ADXH 1IKWA 4J2BA 2ITMA 3WNEA 3MEGA 3SZ2A 1OH6A 3TTDA 5FLXO 3VETA 3EY1A 3O3GA 2Z1JA 4CJTA 5I3UA 5DM7L 2AL6A 1WBDA 1YTUA 4QCLA 4BACA 1IKXA 4FZXC 3THXB 3DAWA 3CCRN 3EZWA 1QHAA 3PX0A 3DLRA 1NNEA 4FLUA 4KREA 1XWLA 2YKNA 3JSMA 4LF8K 2VG7A 3AVHA 3LP0A 2BH1A 3P1GA 2NUBA 2RHKA 4BRGA 4CJPA 1NOZA 3QIOA 1W7AA 5LJVA 3AO1A 2XY7A 3D45A 1VK0A 3HL8A 2O8EA 3C94A 3SV3A 3EKSA 5DM6L 2I7PA 2O8DB 3CCMN 4IEEA 2P9SA 1Q9XA 3LPTA 5F2RA 3M1FA 3CJBA 3MWTA 1VRTA 4JK8A 2HNYA 1QQNA 4B9SA 4BQLA 3KK3A 3S41A 3LDOA 1ATRA 3WEEA 4GV3A 3HTVA 1DLOA 3LDLA 3DMJA 3HI0A 4KTQA 4IJAA 1YITN 4CJ5A 2COPA 3V1OA 1Q9YA 2D2QA 3VQPA 3H3OB 3GG4A 1NKCA 3UB5A 1H4RA 2P9NB 4CJRA 4ZRIA 3CC2N 3BY5A 1UWBA 1LW2A 4CJ4A 2Y1JA 3EE9A 4CIEA 3U7DA 1HJOA 4BVOA 1VSJA 3HXMA 3V9WA 1NTIA 4KAZA 4NXMK 1BCMA 2JLEA 4BDYA 4FCYA 3VEZA 2OZSA 3V6DA 3EPYA 4UQGA 3G9WA 5FPDA 4X66K 1OH8A 4LSNA 5GAHP 2NRHA 2WH5A 5GIOA 2HMIA 3FZFA 3EN9A 4N56A 4B08A 1GLDG 5IWAK 3F73A 3OJUA 5HP1A 3RWUA 2HVHA 1GLEG 3QNOA 5T7BA 1RT7A 4I7FA 4CD3A 3VGLA 3LM2A 3KTQA 2GWKA 2O8CB 3DXMB 1NK6A 3DLKA 3MECA 2XRIA 3KKSA 4DMNA 1NK8A 1FJGK 5JICA 4IOAL 1KLNA 3CM6A 3ULEB 4E0DA 1QQOA 1NJYA 4LC9B 1S3XA 3MXMA 1K6YA 3RTVA 3VQQA 4FJHA 2Y1IA 4GXBA 1RNHA 1NJZA 3ZX3A 5BPNA 2ABDA 2HBJA 4OO1J 3F5TA 3KVGA 1BQMA 3NH2A 3ZDTA 4CD1A 2P9UB 4ZHRA 4AHCA 5C25A 3O4WA 4DQRA 4F9OA 3ZETA 3TAPA 2G8VA 1K8AO 1RTJA 4MFBA 1W9HA 3TPQA 3LDNA 5AQPA 3J81O 4CEOA 3AVLA 1UA0A 4H0XB 2ZF5O 3AVBA 4A57A 4KBOA 1JLCA 4A5BA 2DFEA 5FPMA 5GAGP 3SUQA 3KD1E 1ESVA 1HNZK 2FSKA 3DWLA 3FGUA 3NDKA 3ASMA 4BRCA 5EOYA 4OKJA 4PL8A 2OTLN 1HKCA 3AVJA 4A5AA 3OS2A 2AJQA 4YDUA 1JKHA 4MDBA 4YOWA 3O4NA 4L8RB 3CPEA 3WNFA 3NAEA 3SJJA 4EP4A 2R82A 3P39A 5AQVA 5C2DA 2IDOA 3ATVA 2BANA 3I55N 1SKWA 4GVEA 5AQZA 5BR8K 2GBZA 4GVMA 4FLYA 2A3ZA 3C6UA 1KCFA 3UKUA 1DTQA 3MWPA 1Q86O 3VEWA 4W5QA 5H1SQ 3KZBA 4HWIA 4AHUA 3LZIA 1GLCG 4Y1DA 1J53A 4HUFA 2HSTA 4YFUA 1MK9B 4JNEA 3MN7A 4DV6K 3CJ7A 2JWKA 4C8KA 4RWTA 2G8UA 4CZHA 4OJRA 3OBWA 4WF9L 5E84A 2J0MA 3TTFA 4FLWA 1NKEA 3A5MC 2XHBA 1C6VA 5J2QA 1BL3A 1WSEA 4JI7K 3QEWA 4FJJA 4DUYK 1S9GA 2I7NA 2V7ZA 4PL7A 4FM0A 2ASOA 3HYFA 4IXCA 5B8HA 3RR8A 5JVHL 1NK4A 4RTFD 4E7IA 3CCEN 1SAZA 4KI6A 3DYAA 3AVFA 5AFUH 3V9SA 2D0AA 2X6NA 5I42A 2HF3A 3CCLN 1YI2N 4O4GA 2UUBK 3O8MA 4DV3K 2G8WA 3JS6A 1OVYA 1JL1A 3G71N 1RBRA 3A5LC 1RT4A 3H6EA 4YOYA 5CR4A 1KRPA 1XNQK 2KHOA 3IG1A 4DTNA 4I9QA 4BWMA 3KLGA 3ZSRA 4C1NK 3IAYA 4B9UA 3B8AX 4O0IA
chains in the Genus database with same CATH topology
1YXQA 4A2AA 1BUPA 3C65A 2YJEA 1MWKA 3EO3A 3AAQA 4GV9A 3A5NC 4A59A 1V4SA 5AQSA 3CJCA 5AQLA 3WEEB 1MIXA 3K9KA 5BPMA 2QXLA 4B1UB 5MLCQ 2QI2A 2AEHA 4CBXA 3KWGA 1KAYA 3IFRA 3J7ZO 3CXCM 2W40A 5GADP 2AP1A 2WBNA 3MMVA 5M1NA 1QVFM 2NRWA 5KPRA 4BRPA 4H5WA 3CJ1A 5EX5A 3SBTA 5JVLA 1DGKN 1T44A 3O08A 3C7NA 4JKCA 4FWMA 3RVCA 3UKRA 2QEXN 2GTDA 5AR0A 3U8XA 4CZGA 3I8BA 4BR7A 2DPNA 3DXMA 1T6CA 3M3ZA 1ZXOA 4BC3A 4EIAA 4OPHA 2Q0RA 3QB0A 3CMAN 4IO9L 4ILHA 4AM6A 5AQXA 5BR9A 3TSQA 3G6EN 3O9SA 2FSJA 3QFUA 1RGIA 4BQZA 3CMEN 1VQ9N 4NLCA 2BUPA 2NRXA 2P9IB 3GL1A 3A5OC 1NGGA 3T7ZA 4BVPA 1OKJA 2Q97A 3AGRA 4BG8A 3QBXA 1Y19B 2E1YA 3PIOL 4JK9A 3UKUB 4CZLA 4ZRJA 4KH6A 5KPTA 3D2FA 4H0YB 3DXKA 5AZIB 3AU5A 4M63C 4OPAA 5E26A 5FPNA 1NGEA 4I6MA 1W97L 5EVZA 3FE1A 2IVOA 3R8EA 1HUXA 1BA0A 3U9DA 3FFKB 4JD2A 1S72N 2QWMA 2WUSA 4YL8A 1SQKA 1HB8A 1GLLO 5AQUA 4GV6A 3CI5A 2VGMA 4YOVA 2RE2A 1VQON 3D7EO 2GWJA 4BR4A 4GNIA 3CETA 3FR0A 4FL9A 4YDUC 4H0TB 3CF5L 2VWBA 3KWIA 3ID6A 3WXMB 1QZ5A 3R6MA 5JLFA 2J4RA 4FO0A 2HE7A 4WQ4A 3HM8A 1VQPN 2E2NA 2P9UA 3LDQA 3O5BA 3E1YA 2IIRA 1RDUA 3ZX0A 1YAGA 3Q7BA 4BR5A 4BRAA 2ZGYA 4JKFA 2QW9A 4BC4A 2HBMA 3AY9A 2ZJRL 3CIPA 2D11A 3NVKA 4O5FA 1EF1A 5AQGA 2VYPA 3L0QA 1KC7A 2QWNA 3FZHA 4BROA 3F9MA 2PAVA 3QMLA 1QVGM 1N8RO 1M90O 3ENHA 1VQ5N 4CZEA 3OA9A 2QWOA 4DXAB 3IUCA 5M1OA 3FZLA 3VF6A 2ZPYA 1E5WA 1X3NA 3HZ6A 3R3LA 4BRMA 5AQRA 4U67L 5C0YA 2PBDA 3AAPA 4K42A 1VQ7N 1BO5O 2CGLA 1QZ6A 3O6WA 4H03B 3VTHA 5IJMA 3TU5A 1YIJN 3X23A 3D2EA 4CZIA 1IG8A 1NWKA 3TSPA 1NGJA 4B1VA 2V51B 4NY0A 5AQOA 3PLAA 4MDAA 3VTIA 1YJ9N 4JAXA 4BC5A 5C12A 4M7YA 4H0VB 2GX9A 4L3QA 4FPAA 3BINA 5M1KA 1JJ2M 3O80A 3M5RA 1Z05A 2A42A 3HOTA 3VOVA 1W2BM 4BGAA 2GEMA 1ILYA 4C23A 2X0SA 3BEXA 2HRJA 3BP8A 5GIPA 5AQTA 4CI6A 1MA9B 2CH5A 2P9SB 1HKBA 4JKEA 2E2OA 3WT0A 4ISEA 2YHYA 3J8AA 3IKMA 5BRDA 4CBWA 3ATUA 3GE1A 2FXUA 2GELA 4JKDA 4XH5A 1ACAA 5AZIA 4JKHA 3IMXA 4BC2A 1P90A 1X3MA 1KD1O 2CGKA 3C0BA 1NVLA 5AQFA 4JKAA 3NMUA 2A40A 2HBKA 1HPMA 4BRHA 3DLLL 3WXKA 1DIKA 1RDWX 4H5RA 4JKBA 3R1XA 1VQ8N 5AQHA 4H5TA 1VQNN 2CH6A 2HF4A 3KK7A 3W3DA 4BY9C 5C2FA 1TYQA 3CERA 3BF3A 4CZKA 1HKGA 4UY8O 2A41A 4H0OA 4WYBA 4YORA 1EO1A 4FOIA 1BU6O 3RSEB 3O9RA 5C10A 4PKHA 3H46O 2F9WA 2P9LB 3C6HA 3OHRA 2D0PA 1HB6A 4I6MB 5BN9A 2QTDA 1K73O 3R9PA 5BN8A 4K41A 3D2FB 1EQYA 3TTCA 3QBWA 2FF6A 5ADXH 3N4QA 2FJ9A 2ITMA 2EMTA 2JWLA 4DCHA 3CCSN 3QFPA 1NLVA 1VQKN 1RFQA 3TTDA 1VQ6N 4B9QA 3VETA 2VCPA 4DKWA 3SBGA 4HDQA 3WQUA 4EAHD 3CCQN 1HLUA 3CJ9A 4YOTA 3GOIA 5DM7L 3VF4A 2AL6A 2F7TA 3K9JA 2FLOA 1HBKA 1J19A 2D0OA 2HMPA 3DAWA 3L6QA 4BRIA 3CJAA 3CCRN 3EZWA 3O1BA 4XH1A 1QHAA 2P9LA 2J0KA 1YJWN 3UKRB 2D10A 3A0IX 3VMFB 2D1KA 3E9PA 1JCEA 5BRFA 1YHQN 1YVNA 3WXIA 3H1VX 4WFAL 3ZETB 4WQ5A 3UE5A 1BA1A 1ZC6A 4JEPA 5KQ8A 2BH1A 3QIJA 2RHKA 3FZKA 3QICA 4BRGA 2BTFA 2QWQA 3BUZB 2CGJA 3O1WA 5LJVA 3JXUA 3M6GA 2A5XA 3SLCA 5AQQA 2ZJQL 3Q7CA 1MDUB 3EKSA 4ISGA 5DM6L 2I7PA 5KPZA 5M1FA 4BG9A 3E66A 3SJHA 4IO8A 1NGHA 3CCMN 4IEEA 2P9SA 3DXKB 2QA4N 5F2RA 3NVMA 3D6RA 3O9UA 3P38A 5LJWA 4AM7A 4CZJA 4FVUA 3M1FA 3G25A 1Q81O 1Q18A 3CJBA 3MWTA 4K43A 3WUHA 3H3NO 4QS8A 2FDQA 5CHIA 2P9PA 4JK8A 3FLCO 1QQNA 4J8FA 3U4LA 4XH4A 3U9ZA 4BQLA 1JCGA 2LBBA 1G99A 3S41A 3LDOA 1ATRA 1X9JA 3WEEA 1GGOA 4GV3A 3HTVA 3LDLA 3HI0A 4IJAA 1YITN 2E2PA 2YHWA 2COPA 3MK6A 4FWRA 2D2QA 3H3OB 2UYTA 3GG4A 1BWFO 3UB5A 1H4RA 2P9NB 2ASMA 5BPLA 3GBTA 5AQKA 4ZRIA 1NBWA 4PKIA 3VEYA 3HOSA 3CC2N 1K8KB 1GC7A 4JK7A 2E2QA 4QS9A 4FWLA 3MN9A 2P9IA 4FWNA 3EE9A 2QWRA 3U7DA 1HJOA 4BVOA 1SGHA 1NTIA 2E88A 1KAXA 1CZAN 3VEZA 3WXLA 4JD2B 2YJFA 2CB8A 4ZRKA 1Q82O 1YJNN 3VESA 3O9TA 2NRRA 3MX5A 4A61A 3EPYA 5BRHA 3U8ZA 3TSUA 2NRZA 2YCHA 3G9WA 2IVPA 3ENOA 5FPDA 4WFBL 2ZJPL 1VBHA 3VEOA 4BR0A 5CE3A 1TUUA 1VAZA 5GAHP 3SAGA 1NGAA 2NRHA 3ZYYX 5AQIA 2WH5A 2E20A 1NGDA 4A2BA 5C15A 3CC4N 1KQSM 1LOTB 4WCEL 1K9MO 1KC8O 5GIOA 4H5VA 3FZFA 5BREA 3EN9A 4O8UA 4IOCL 4IDHA 1ST7A 1GLDG 5AZJA 4BR9A 3EL2A 1GLEG 5M1PA 1KXPA 4MLEA 3L4QA 2ASPA 1XQSC 2PFUA 1YF5L 2D4WA 4CD3A 3VGLA 3I56N 3LM2A 5EY4A 2GWKA 3VENA 3ID8A 4MO5A 1HX1A 3DXMB 4BRQA 4K25A 1NGCA 2ZWHA 2NLXA 4BRNA 4CYEA 4BREA 3AU4A 4CZFA 5JICA 2E8AA 4MLHA 4IOAL 1J6ZA 1VBGA 3MDQA 4M7XA 5GAEP 2KKZA 2YI1A 1SZ2A 3ULEB 3VERA 1C0GA 1WUAA 4B1YB 2V7YA 5KQDA 5AQYA 4JHDB 2IVNA 4CJ7A 3WXJA 4IZ9A 4TKNA 1DKGD 1QQOA 1TUYA 1T3VA 3VEVA 4YOUA 1NJIO 4LC9B 3MX2A 4EFHA 4NLBA 1S3XA 1DEJA 4FWSA 4IEIA 4JN4A 3VGMA 4Z94A 3H45C 1NGIA 2Q36A 3P4IA 4H5NA 2WC9A 2V52B 4GXBA 3CHWA 1VQ4N 4HTLA 1VQMN 1NM1A 3ZX3A 1U2VB 2I1JA 4FWQA 2GUPA 4FWOA 5BPNA 2ABDA 5ELZA 2OTJN 2HBJA 4BR2A 4OO1J 3FLVA 3F5TA 1S22A 3KVGA 3ZDTA 2Q0UA 2P9UB 4CD1A 4G9ZA 1C0FA 3O4WA 4H0PA 3ZETA 2YHXA 4F9OA 1BOTO 3C7NB 3CCUN 1K8AO 5TKYA 3CCVN 3ULEA 4JKGB 1NI2A 1K8KA 3TPQA 5F1XA 3LDNA 4A62A 5AQPA 3MN6A 5ADXA 1V4TA 2EMSA 5HL7L 1KBLA 4H0XB 1Z6RA 1VQLN 2EWSA 2ZF5O 4A57A 4KBOA 4C1NI 4BGBA 4A5BA 1GLJO 2FF3B 2FSNA 5FPMA 4B1WB 1KAZA 3RSEA 5GAGP 4RCHA 1ESVA 4O8KA 4HDOA 2FSKA 3DWLA 3VGKA 1IJJA 3MCAB 3F2KA 3FGUA 3W0LA 4BRDA 3SAHA 3ZX2A 4BRCA 1DT9A 1TYQB 2YX6A 2Q31A 3LM9A 5EOYA 4FWPA 4PL8A 4FWKA 4YOXA 3A8YA 2OTLN 1XC3A 3VEXA 4BRFA 1GG3A 2A6AA 3O9QA 3ZEUB 2NRTA 1QQMA 1T6DA 1HKCA 4A5AA 4JKGA 4FPBA 4YDUA 4P7IA 4MDBA 1D4XA 4Y0WA 4YOWA 5HOOA 3AARA 4B1XB 3CPEA 3ENBA 4WQ4C 3WA0A 1ATNA 4KH5A 4DHYA 4R79A 3EE8A 2R82A 2WFBA 3P39A 3PVLA 1LCUA 3MCPA 4U7BA 1SS6A 5AQVA 5C2DA 4EHTA 3ATVA 3LL3A 1GC6A 2QM1A 3CC7N 3I55N 3CQXA 1P8ZA 3G4SN 2P9PB 4GVEA 5AQZA 2NRVA 2J0JA 3IDHA 3PIPL 1MIZB 1H1VA 2A3ZA 1Q7YO 3UKUA 1GLAG 2DIKA 3I33A 3MWPA 2VGNA 3H1QA 5M1QA 4NO7A 3SK3A 1Q86O 2YVCA 1JDEA 1BG3A 1GLBG 4BRKA 1R59O 5AQNA 3VEWA 4DB3A 3D2EB 3SMSA 3KZBA 5H1SQ 4HWIA 4IWVA 4B1ZA 3CQYA 1U6ZA 1U2VA 3FP5A 3L4IA 1GLCG 2HOEA 1E4FT 3EKUA 2HSTA 2AA4A 1MK9B 4JNEA 2H3GX 3MN7A 3HBTA 3P31A 1JCFA 1NGFA 3CJ7A 1M1KO 1NMDA 2JWKA 3HSCA 3DJCA 4DQ8A 5AQWA 4RWTA 4QS7A 3MN5A 5JLHA 4CZHA 4FSVA 1MWMA 4EHUA 4IOXA 2P9KB 3OBWA 2Q1NA 4WF9L 3SMPA 4BRLA 5E84A 3QDKA 1GLFO 2J0MA 3N4PA 3TTFA 3WQTA 4ILGB 5LY3A 4E1JA 2I1KA 3A5MC 3CD6N 1ATSA 2P9KA 4IFEA 4CBUA 3E9LA 3AGKA 4MO4A 3VPZA 2I7NA 4ILJA 2V7ZA 4XEIA 1ISNA 4PL7A 3BF1A 2ASOA 2OANA 4IXCA 5B8HA 4IJNA 4KH4A 2RQ1A 5JVHL 4RTFD 2NZTA 2QWLA 5AQJA 3CCEN 1SAZA 1YUWA 3LDPA 4EKUA 1O13A 4PKGA 2ZGZA 2KLAA 5AFUH 3C6AA 3FZMA 4WQ5C 5F0XA 1XUPO 5JVGL 5AZJB 4AF1A 2E1ZA 4JHDA 1ZBSA 2HF3A 4GY2B 3HRGA 3CCLN 5I9EB 1WOQA 4CZMA 5GINA 1YI2N 1E4GT 2W41A 3O8MA 2QWPA 1MK7B 4FOEA 3E9OA 3JS6A 1OVYA 3ZEUA 3G71N 3A5LC 3GDQA 3CPWM 3H6EA 4YOYA 5CR4A 3PZDA 3KHYA 3OW2M 3VF2A 2Q2RA 3IVFA 3CCJN 5TKWA 5AQMA 2KHOA 4NB4A 5EXWA 2CQUA 2P9NA 1BDGA 2HBLA 4ISFA 4PHTX 5AFUA 1Y64A 3OBYA 3SAFA 5JMVA 4F7GA 4C1NK 2F9TA 3T69A 4WFNL 2NNWA 1NGBA 3B8AX 5FPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKH A;  3E9P A;  4JKA A;  4JK7 A;  4JKB A;  4ILG B;  4JKG B;  4JK9 A;  3E9O A;  4JKG A;  3SBT A;  3SBG A;  4JK8 A;  4JKF A;  4JKC A;  3E9L A;  3ENB A;  4ILJ A;  4JKE A;  4ILH A;  4JKD A;  3E66 A; 
#chains in the Genus database with same CATH topology
 1YXQ A;  3EO3 A;  1X9W A;  3A5N C;  4A59 A;  1MIX A;  3BZK A;  5MLC Q;  4DFK A;  1QHT A;  4CBX A;  3J7Z O;  1KAY A;  3T1H K;  3PSI A;  2KZZ A;  5M1N A;  1LWF A;  2ITG A;  3C6T A;  4BRP A;  3O08 A;  3UKR A;  1L3V A;  4JKC A;  3M8R A;  2QEX N;  1CXU A;  3HO1 A;  1WSF A;  1ZXO A;  3QIN A;  4BC3 A;  1VSF A;  1JLF A;  3QB0 A;  4KKO A;  3CMA N;  4ILH A;  2O8B B;  1JL2 A;  2O8C A;  3SUO A;  1RGI A;  4BQZ A;  2XY5 A;  4YNQ A;  1NGG A;  2Q97 A;  3AGR A;  4DFP A;  3PIO L;  4ZRJ A;  3AVK A;  3L3U A;  3I0S A;  4KH6 A;  3DXK A;  4ELT A;  1U47 A;  4QAG A;  4M63 C;  1W97 L;  2IVO A;  1HUX A;  1KVB A;  3U9D A;  4DS5 A;  4YHH K;  3PX6 A;  2WUS A;  4YL8 A;  5AQU A;  4GV6 A;  2VGM A;  4DV4 K;  2JGU A;  1D9F A;  3LP1 A;  3CET A;  3OS0 A;  4K0K K;  3CF5 L;  2VWB A;  3ID6 A;  1QZ5 A;  4FO0 A;  1IKY A;  3HM8 A;  2P9U A;  3LDQ A;  1ZBI A;  3Q7B A;  3LAN A;  4BRA A;  2HBM A;  3V9Z A;  3AY9 A;  4Y1C A;  2ZM6 K;  3V9X A;  3NVK A;  4O5F A;  2IC3 A;  1RBS A;  3HST B;  3G0Z A;  3L0Q A;  4HUG A;  4PQU A;  3FZH A;  1N8R O;  1HRH A;  4E1N A;  4DXA B;  3IUC A;  4O0J A;  3VF6 A;  1E5W A;  4U67 L;  4DTJ A;  2YNI A;  4DV5 K;  1VQ7 N;  3SQ0 A;  4E7J A;  3O6W A;  3L2V A;  2BE2 A;  3L2W A;  2QKK A;  1IG8 A;  3RMA A;  4NY0 A;  4MDA A;  1RT6 A;  2FC0 A;  5C12 A;  1QSL A;  4KTZ A;  4L3Q A;  3BIN A;  5M1K A;  2HB5 A;  3HOT A;  3VOV A;  4BGA A;  4M3X A;  5C24 A;  4B3M K;  4EZ6 A;  2P9S B;  4CEQ A;  4KHU A;  3G10 A;  4ELV A;  3K5L A;  3GE1 A;  4NCA A;  1GOC A;  2GEL A;  5HRN A;  4JKH A;  1S6Q A;  1P90 A;  1KD1 O;  4J2E A;  1NVL A;  1BIS A;  2HBK A;  3O3F A;  1HPM A;  2PZS A;  4DSE A;  2FBT A;  3W3D A;  1RBU A;  4DSI A;  4WYB A;  5C10 A;  3NGY A;  5AJ3 K;  4BDZ A;  1K73 O;  2D0P A;  1BI4 B;  5BN8 A;  4FJ8 A;  3AV9 A;  2EMT A;  2W6L A;  2JWL A;  4CJL A;  4DCH A;  3CCS N;  4CGI A;  4Z0U A;  2OCE A;  4B9Q A;  3SQ4 A;  3CJ9 A;  1NOY A;  3VF4 A;  2F7T A;  5HRR A;  3K9J A;  1XC9 A;  1J54 A;  3LPU A;  1RDC A;  2ZE2 A;  4XH1 A;  2P9L A;  5CY4 A;  2J0K A;  3TAM A;  3UKR B;  4CED A;  2DY4 A;  3E9P A;  5BRF A;  1YHQ N;  3NF6 A;  1TKD A;  3WXI A;  3OYN A;  3J80 O;  1ZC6 A;  4E1M A;  3QIJ A;  3FZK A;  3AA5 X;  1HNI A;  1VSE A;  2QWQ A;  3O1W A;  3JXU A;  3M6G A;  4IG3 A;  1QTM A;  3SLC A;  2ZJQ L;  5A2Q O;  3ISN C;  1RDD A;  4CHP A;  4DU4 A;  4LF6 K;  4JI3 K;  4FLZ A;  3QIP A;  4CFB A;  1KLM A;  3P5J A;  2QA4 N;  4Z4I A;  3HM9 A;  1BCO A;  3NVM A;  3P38 A;  4AM7 A;  4CZJ A;  4FVU A;  2G8K A;  3G25 A;  1Q18 A;  4K43 A;  5CHI A;  4HCC A;  4XH4 A;  4E7H A;  2LBB A;  4JRQ A;  4JRP A;  4F3O A;  1TK8 A;  3AO4 A;  4FJX A;  2F8S A;  2YHW A;  2KTQ A;  4FWR A;  3NBP A;  1WBB A;  3AA3 A;  5BPL A;  1FK9 A;  3VEY A;  3KK2 A;  1GC7 A;  4FWL A;  3MN9 A;  4LH5 A;  4F2S A;  4LF9 K;  3OYJ A;  1SGH A;  1WLJ A;  1YTA A;  3V9U A;  3NGI A;  2O4I A;  1WSJ A;  1WNS A;  2B4J A;  2CB8 A;  1Q82 O;  2XY8 A;  1IBM K;  2NRR A;  3DM2 A;  4A61 A;  4W5O A;  3U8Z A;  3TSU A;  2NRZ A;  3HPO A;  4ID1 A;  4WFB L;  3ENO A;  3O3H A;  1VBH A;  4RW7 A;  1VAZ A;  5HRO A;  1NGA A;  1KQS M;  3ZYY X;  5AQI A;  2E20 A;  1NGD A;  4A2B A;  5C15 A;  4F8R A;  1T03 A;  4WCE L;  1B92 A;  1J9A A;  2UUC K;  4OLB A;  1T8E A;  5JS1 A;  5CYQ A;  4H5V A;  1RT1 A;  5BRE A;  1RT5 A;  4FK4 A;  4IFV A;  4Z4C A;  5AZJ A;  3BZC A;  4LFA K;  3L4Q A;  1TV6 A;  2ASP A;  1YF5 L;  1REV A;  4KHY A;  3PY8 A;  3WNH A;  3ID8 A;  1NG9 A;  4DV0 K;  4AIL C;  4K25 A;  2G8F A;  3DLH A;  3ZSO A;  2NLX A;  4BRN A;  4BRE A;  2HW3 A;  3T1Y K;  4DTR A;  4CGH A;  4M3R A;  1B9D A;  2KKZ A;  3VER A;  1D9D A;  4B1Y B;  2V7Y A;  4CJ7 A;  3P83 D;  4FXD A;  2QK9 A;  4IEI A;  4JN4 A;  4Z94 A;  2GUI A;  3U3Y A;  2YNG A;  2XY6 A;  4H5N A;  3EYZ A;  4FLX A;  3CHW A;  2HVI A;  3J7A P;  3RMD A;  1NM1 A;  1U2V B;  2OPS A;  4FWO A;  1I94 K;  3ZSQ A;  2OTJ N;  3FLV A;  4O44 A;  4CF8 A;  2Q0U A;  3C7N B;  1G15 A;  4K8X A;  3ITH A;  3VQB A;  3SCX A;  4JKG B;  4FM2 A;  3DOK A;  3L2U A;  1WAF A;  4FJN A;  5ADX A;  1V4T A;  2EMS A;  5HL7 L;  3THV A;  4KB0 A;  1VQL N;  2EWS A;  5CZ1 A;  3THX A;  5LMU K;  4KHW A;  4B1W B;  1KAZ A;  4RCH A;  3QEP A;  3NE6 A;  4OVL A;  3VGK A;  3MCA B;  3ZLJ A;  3F2K A;  3W0L A;  4CGJ A;  2IAJ A;  3LM9 A;  4DF8 A;  3OYF A;  1IG9 A;  1XC3 A;  3VEX A;  4BRF A;  1GG3 A;  1KFS A;  4FPB A;  4DFM A;  4B1X B;  4DTS A;  4HCB A;  1LWC A;  4E19 A;  4PA1 A;  3VQ5 A;  4B3O A;  3MCP A;  4BE0 A;  1SS6 A;  4DR4 K;  4DTO A;  1SL1 A;  3OY9 A;  2QM1 A;  1EKE A;  4FK0 A;  2OPP A;  1P8Z A;  4FJ9 A;  2B6A A;  2J0J A;  5HRS A;  1GOA A;  1Q7Y O;  2DIK A;  3I33 A;  4JI0 K;  4B3R K;  4NO7 A;  1BG3 A;  1WB9 A;  1C0T A;  5AQN A;  3D2E B;  4N47 A;  3CFO A;  4CHY A;  3CQY A;  1U6Z A;  1U2V A;  3EKU A;  1FKP A;  4CF0 A;  4DQQ A;  2H3G X;  3HBT A;  3P31 A;  4CK2 A;  5E41 A;  1RBT A;  4DQ8 A;  5JLH A;  3SYZ A;  4IOX A;  2P9K B;  2B5J A;  2Q1N A;  4DTP A;  3NHG A;  1GLF O;  3DRR A;  4C8L A;  1D5A A;  4ILG B;  5LY3 A;  2OPR A;  5D3G A;  3SPY A;  4CBU A;  1S9E A;  1EXQ A;  3E9L A;  4XIU A;  4ILJ A;  2OAN A;  3NH1 A;  1E3M A;  4OGC A;  4CJQ A;  2ZGZ A;  2KLA A;  3QEX A;  2IGI A;  3PO5 A;  4O55 A;  3NMU A;  3NF7 A;  3HRG A;  4KHS A;  1CXQ A;  3I0R A;  3K0S A;  2W6K A;  3IRX A;  3AVM A;  3PX4 A;  2QWP A;  2D5R A;  3LP3 A;  3GDQ A;  3AVA A;  3NH0 A;  3PZD A;  4H4M A;  3KHY A;  3VF2 A;  2Q2R A;  3IVF A;  4FJI A;  3SPZ A;  4ISF A;  2EX3 A;  4PHT X;  5JMV A;  1TL1 A;  4BE1 A;  3CYM A;  5FPE A;  3C65 A;  5KRS A;  3KIO A;  4B9N A;  5AQS A;  4CEA A;  4CK3 A;  3DOL A;  3CXC M;  2AEH A;  3KWG A;  2W40 A;  2WBN A;  3MMV A;  4E89 A;  5KGX A;  1QVF M;  2NRW A;  1U49 A;  3RVC A;  1T44 A;  4FWM A;  5AR0 A;  3U8X A;  4CZG A;  4DV7 K;  1XHZ A;  4DQI A;  1T6C A;  2VQF K;  4EIA A;  1FW6 A;  4IO9 L;  1JLQ A;  2X74 A;  3VQD A;  3TSQ A;  4NYF A;  3L2Q A;  2NRX A;  1S6P A;  2P9I B;  2X6S A;  3A5O C;  2O4G A;  4BVP A;  4BG8 A;  3QBX A;  1SV5 A;  2E1Y A;  4JK9 A;  3MED A;  3UKU B;  4H0Y B;  2F4V K;  2IOC A;  4I6M A;  5EVZ A;  2RPI A;  4B8A B;  3HVT A;  2QWM A;  1HB8 A;  2LSN A;  3S3N A;  1U48 A;  3D7E O;  2GWJ A;  3QNN A;  4GNI A;  2ETJ A;  1VQP N;  4WQ4 A;  3THW A;  3OVN A;  2P5O A;  2E2N A;  3HJF A;  3E1Y A;  2IIR A;  1RDU A;  3OYC A;  2ZGY A;  4JKF A;  2QW9 A;  2D11 A;  3K5M A;  1EF1 A;  3A2F A;  3KD5 E;  5AQG A;  2FBV A;  2QWN A;  1TK5 A;  5HLF A;  5C0Y A;  2ZPY A;  3R3L A;  2UXD K;  5AQR A;  1A5W A;  2P5G A;  4CJW A;  4OGE A;  2PYJ A;  1BO5 O;  3NCI A;  3TU5 A;  4CZI A;  1NGJ A;  4B1V A;  3KK1 A;  1OH5 A;  4FJL A;  4JS5 A;  3SUP A;  4BC5 A;  4M7Y A;  2GX9 A;  3TAG A;  4YY3 K;  1Z05 A;  1NMN A;  4LH4 A;  4MQ3 A;  4CHZ A;  4B9L A;  4C23 A;  3BEX A;  3BP8 A;  2UXC K;  5GIP A;  2CH5 A;  4RG8 A;  4JKE A;  1ASV A;  3WT0 A;  4ISE A;  2YHY A;  3J8A A;  5BRD A;  2KZM A;  3ATU A;  4JKD A;  3V81 A;  5AQF A;  5FRO A;  2ATQ A;  2A40 A;  3LAK A;  3WXK A;  4H5R A;  2UXB K;  4JKB A;  3R1X A;  1VQ8 N;  2WTU A;  2D0C A;  2CH6 A;  3OYG A;  5C2F A;  1TYQ A;  3CER A;  4UY8 O;  2OA8 A;  1JLE A;  2HND A;  1BU6 O;  3S3M A;  3O9R A;  4PKH A;  2P9L B;  4I6M B;  3OHR A;  5LMN K;  4OKK A;  3R9P A;  3OS1 A;  3PSF A;  3RMC A;  3QBW A;  3ZT3 A;  2HNZ A;  3N4Q A;  2FJ9 A;  2VWK A;  3QFP A;  1VQK N;  2QKB A;  2VCP A;  4DKW A;  3L8B A;  3CFR A;  4H8K A;  4HDQ A;  4EAH D;  3ZSY A;  3CCQ N;  2QXF A;  1RDB A;  3DRP A;  1L5U A;  1HBK A;  2D0O A;  2HMP A;  4JI6 K;  1EP4 A;  4H4O A;  1YJW N;  3A0I X;  1LW0 A;  1JCE A;  1YVN A;  3OTO K;  3H1V X;  4WFA L;  1DTT A;  4WQ5 A;  3UE5 A;  4B9T A;  4J2D A;  3M8P A;  4JS4 A;  3BUZ B;  1KFD A;  2CGJ A;  3NF9 A;  3KLF A;  1BHL A;  2A5X A;  1VSL A;  4Z4F A;  5AQQ A;  2VG6 A;  4CEF A;  4ZTJ A;  4JV5 K;  5M1F A;  3E66 A;  3SJH A;  1CZB A;  3DXK B;  1SUQ A;  3O9U A;  5LJW A;  2HHS A;  1QE1 A;  4CIF A;  1Q81 O;  2FDQ A;  2P9P A;  4J8F A;  3E01 A;  2O8F A;  4C8M A;  1YT3 A;  2KW4 A;  4KFB A;  2E2P A;  5KRT A;  3K2P A;  1EX4 A;  2UYT A;  1BWF O;  3OYB A;  3ZSW A;  1VSD A;  4E7L A;  3GBT A;  2UU9 K;  5AQK A;  4CK1 A;  4CJS A;  4W5T A;  3HOS A;  4AHV A;  1K8K B;  4JK7 A;  2E2Q A;  4FW1 A;  4M3Z A;  2P9I A;  4FWN A;  2HHU A;  1J5O A;  4AHR A;  4B9V A;  1TAQ A;  1N36 K;  1CZA N;  4E3S A;  1QSS A;  4ZRK A;  2F96 A;  3O9T A;  5J2M A;  2F8T A;  1VSH A;  2VG5 A;  1GOB A;  2RKI A;  2YCH A;  5LL6 Z;  2ZJP L;  3HP6 A;  3VEO A;  4BR0 A;  5CE3 A;  4I9L A;  1TUU A;  2OYQ A;  3SAG A;  3LZJ A;  3CC4 N;  4B3S K;  2O8F B;  1LOT B;  4NYN A;  2XO7 A;  5KGW A;  1X9S A;  1VSI A;  3ZSX A;  4O8U A;  4IOC L;  3UIQ A;  2YHB A;  4IDH A;  1ST7 A;  4AQY K;  1WSH A;  3F9K A;  1RT2 A;  5CYM A;  5M1P A;  1KXP A;  3L3V A;  4HHT A;  2PFU A;  3NFA A;  4FJM A;  1NJX A;  4NCB A;  5JS2 A;  1HX1 A;  5SWM A;  3AA4 A;  1TL3 A;  3AA2 A;  4AHT A;  1NGC A;  4IDK A;  1EET A;  4CYE A;  4CZF A;  3DI6 A;  2E8A A;  4MLH A;  1SL2 A;  3LAL A;  4LSL A;  4R5P A;  1VBG A;  4M7X A;  5GAE P;  1LAW A;  2YI1 A;  2ZD1 A;  1C0G A;  1WUA A;  3ALY A;  3ZSV A;  1N6Q A;  4JHD B;  3WXJ A;  1RTD A;  4IZ9 A;  2DTU A;  1DKG D;  3VEV A;  1NJI O;  4EFH A;  4NLB A;  1DEJ A;  3VGM A;  1NGI A;  3P4I A;  4KB1 A;  5J1E A;  4J2A A;  2WC9 A;  1VQ4 N;  4IBN A;  1BGX T;  2I1J A;  3ULD A;  5ELZ A;  4DR1 K;  4BR2 A;  5IT9 O;  1S22 A;  4G9Z A;  1BOT O;  3AO5 A;  4DR5 K;  5TKY A;  3CCV N;  3ULE A;  4I2P A;  1K8K A;  2A1S A;  5F1X A;  1U04 A;  2HHW A;  4HTU A;  3MN6 A;  1EWQ A;  1WSG A;  1XHX A;  1Z6R A;  1UA1 A;  2FF3 B;  1IJJ A;  4FVM A;  4DR7 K;  4CIG A;  1F21 A;  3ZX2 A;  1TYQ B;  3VQA A;  2A6A A;  1MU2 A;  1HNW K;  1NU0 A;  1HNV A;  1QQM A;  3B6P A;  4IG0 A;  4Y0W A;  3ENB A;  3EE8 A;  3PO4 A;  4I2Q A;  4FYD A;  3PVL A;  4CHO A;  4U7B A;  2FBY A;  2RF2 A;  1TKT A;  3KKR A;  4EHT A;  5KTQ A;  3LL3 A;  4N41 A;  3G4S N;  5FRM A;  4E7K A;  4RW4 A;  1S1W A;  4RW8 A;  1IKV A;  1IO2 A;  5FDL A;  3AVC A;  4CER A;  1S1V A;  3PIP L;  1MIZ B;  1H1V A;  1GLA G;  3SK3 A;  3TR8 A;  2YVC A;  4EP5 A;  1R59 O;  3M8Q A;  2W42 A;  4DB3 A;  3SMS A;  1Q8I A;  4B1Z A;  4CW7 B;  4B9M A;  3FP5 A;  1SL0 A;  1E4F T;  1ASW A;  4M3T A;  1NK5 A;  1CZ9 A;  2UUA K;  1JCF A;  4FLV A;  1NGF A;  1M1K O;  1NMD A;  1KSP A;  3DLG A;  3MN5 A;  4EHU A;  1MWM A;  3BGR A;  3SMP A;  4TSX A;  2P51 A;  3QDK A;  1WSI A;  3NGZ A;  4E1J A;  2I1K A;  4JI2 K;  1ATS A;  3S9H A;  3QEI A;  2YNH A;  2O8D A;  4F3T A;  2A1R A;  1SKR A;  1N32 K;  4KH4 A;  2RQ1 A;  4DTX A;  2NZT A;  1S5J A;  1YUW A;  1O13 A;  4PKG A;  5SZT A;  3CQ8 A;  3C6A A;  3FZM A;  4WQ5 C;  3LAM A;  4CFD A;  5F0X A;  1XUP O;  5JVG L;  1ZBS A;  4AHS A;  4CZM A;  1S1T A;  1E4G T;  2W41 A;  1JLG A;  4LF5 K;  1HYV A;  3H08 A;  4DUZ K;  4RW6 A;  3ZEU A;  4LFC K;  2OZM A;  3QER A;  1BDG A;  2HBL A;  2P9N A;  4LD0 A;  5AFU A;  3TAR A;  4F7G A;  4K8Z A;  3T69 A;  4WFN L;  1IH7 A;  3VQ7 A;  3FFI A;  1BUP A;  2YJE A;  4B8C A;  4GV9 A;  3AAQ A;  4KO0 A;  3WEE B;  1D8Y A;  3HPG A;  3K9K A;  2QXL A;  5BPM A;  4DV1 K;  2R7Y A;  3IFR A;  3OYK A;  1CLQ A;  5KPR A;  4H5W A;  3CJ1 A;  5JVL A;  1DGK N;  3C7N A;  4BDP A;  4CF2 A;  1WN7 A;  5C42 A;  3I8B A;  4BR7 A;  2O8B A;  3S3O A;  3DXM A;  3M8S A;  3HP9 A;  2HHQ A;  4CF1 A;  2YHA A;  3DRS A;  2HHV A;  5AQX A;  3K57 A;  4DWI A;  3O9S A;  3QFU A;  4OLA A;  4Z4H A;  4PUO A;  3CME N;  4CFC A;  2BUP A;  3V4I A;  3GL1 A;  3JAM O;  1ITG A;  4LF7 K;  1Y19 B;  1N34 K;  1OH7 A;  4GMJ B;  5AZI B;  4OPA A;  5E26 A;  4JYA K;  1NGE A;  3T1A A;  3I8D A;  3FE1 A;  4CJV A;  1RTH A;  1BA0 A;  4KHP K;  4CEE A;  1VSM A;  3CI5 A;  4YOV A;  1VQO N;  2RE2 A;  4CEC A;  1L3S A;  3FR0 A;  4FL9 A;  4YDU C;  2VQE K;  4H0T B;  2PY5 A;  2G8I A;  3KWI A;  3WXM B;  4CF9 A;  4DV2 K;  2J4R A;  1NJW A;  2HE7 A;  4BWJ A;  4BR5 A;  1HNX K;  1YAG A;  4BC4 A;  5EU7 A;  3SQ1 A;  3CIP A;  1U45 A;  2VYP A;  4BRO A;  3F9M A;  1QVG M;  1VQ5 N;  4QOZ B;  3ENH A;  4CZE A;  3OA9 A;  4DQP A;  3FZL A;  1VHX A;  1X3N A;  5DMR A;  3QES A;  4JI8 K;  4FJ7 A;  2PBD A;  4K42 A;  4CGD A;  3MAQ A;  2CGL A;  1QZ6 A;  4H03 B;  3OYM A;  1TVR A;  1ZBU A;  3TWH A;  3TAN A;  3X23 A;  3D2E A;  3TSP A;  3ZT0 A;  1RBV A;  2V51 B;  1YJ9 N;  1EWR A;  3VTI A;  4JAX A;  1S1U A;  1Y97 A;  4H0V B;  1TGO A;  3RMB A;  1JJ2 M;  3O80 A;  3M5R A;  1Z26 A;  5HRP A;  3VQ9 A;  1ILY A;  4CFA A;  2X0S A;  3KLE A;  2HRJ A;  3SUN A;  3TAE A;  1HKB A;  3PUF A;  4PWD A;  3VQ4 A;  2BGG A;  3IKM A;  3WNG A;  4CBW A;  2FXU A;  4F4K A;  4XH5 A;  1ACA A;  4RW9 A;  4JKA A;  3V1R A;  4BRH A;  3QLH A;  4B3T K;  1DIK A;  3ZT2 A;  4Z4G A;  4FJG A;  4H5T A;  1JXE A;  2HF4 A;  3KK7 A;  3ZT1 A;  4BY9 C;  4ELU A;  1ZBH A;  4CZK A;  3BF3 A;  3LDS A;  3RR7 A;  4H0O A;  1EO1 A;  4YOR A;  4C8O A;  3RSE B;  5BN9 A;  4Z4E A;  1RDA A;  1EQY A;  2FF6 A;  1JLB A;  4DQS A;  4FM1 A;  1NLV A;  1RFQ A;  1RTI A;  1VQ6 N;  3HT3 A;  3SBG A;  3WQU A;  4GW6 A;  1HLU A;  2D0B A;  3GOI A;  4YOT A;  4CES A;  2FLO A;  1J19 A;  3L6Q A;  4BRI A;  3CJA A;  3O1B A;  3AO3 A;  2D10 A;  3VMF B;  1TK0 A;  4FW2 A;  2D1K A;  4OPJ A;  2YNF A;  3ZET B;  3L2R A;  1BA1 A;  4JEP A;  4DTM A;  5KQ8 A;  4KRF A;  4DLE A;  1QSY A;  3QIC A;  2BTF A;  2Z1I A;  4GKJ K;  3AVI A;  1W0H A;  4F2R A;  4DSJ A;  4OX9 K;  3Q7C A;  1NK0 A;  4M3Y A;  1MDU B;  4ISG A;  5KPZ A;  4BG9 A;  1N33 K;  4CJU A;  4IO8 A;  1NGH A;  1S1X A;  3QEV A;  4Q0B A;  3D6R A;  4W5N A;  2E5L K;  3WUH A;  3H3N O;  4QS8 A;  4KTW A;  3FLC O;  3U4L A;  3U9Z A;  4KI4 A;  1JCG A;  1G99 A;  1OVQ A;  1X9J A;  3C95 A;  1GGO A;  2RN2 A;  3MK6 A;  3SQ2 A;  1J5E K;  1IBL K;  2ASM A;  1RT3 A;  1LV5 A;  1A5V A;  1NBW A;  4PKI A;  3K59 A;  4QS9 A;  2YV0 X;  3NF8 A;  2QWR A;  1LWE A;  4DU3 A;  1KVC A;  4CHQ A;  1L3U A;  4DU1 A;  2E88 A;  4M41 A;  1KAX A;  1X1P A;  3LWL A;  3WXL A;  4JD2 B;  2YJF A;  3VA3 A;  4DR3 K;  1YJN N;  3VES A;  3CM5 A;  3MX5 A;  5BRH A;  1UOC A;  2IVP A;  3MEE A;  5K14 A;  1BQN A;  4CGG A;  1HQU A;  3KJV A;  1T05 A;  3HVR A;  1K9M O;  2DFH A;  4C8N A;  1KC8 O;  1ZBF A;  4DTU A;  1NKB A;  3VQE A;  3K58 A;  4BR9 A;  3EL2 A;  3MXI A;  4MLE A;  1XQS C;  2D4W A;  3I56 N;  5EY4 A;  3VEN A;  1U4B A;  1HYS A;  5J2N A;  4MO5 A;  3OJS A;  1BI4 A;  4BRQ A;  3TAF A;  5CZ2 A;  2ZWH A;  4KPY A;  1I39 A;  1R0A A;  3K5O A;  3AU4 A;  1J6Z A;  3MDQ A;  4CHN A;  3RRG A;  1BIU A;  3TAQ A;  1SZ2 A;  4X64 K;  4JLH A;  2GV9 A;  2OPQ A;  5AQY A;  5KQD A;  2IVN A;  1L3T A;  4TKN A;  1TUY A;  1JLA A;  1T3V A;  3U3G A;  4YOU A;  3MX2 A;  4LFB K;  1C0U A;  1RCH A;  4FWS A;  3H45 C;  2HHH K;  2Q36 A;  1JXB A;  1RIL A;  3D0P A;  2V52 B;  4M45 A;  4HTL A;  1VQM N;  4PY5 A;  1C1C A;  4FWQ A;  2ZQB A;  3CFP A;  2GUP A;  3MXJ A;  4IFY A;  3RRH A;  3QO9 A;  1SKS A;  2KQ2 A;  1C0F A;  2X78 A;  3ZSZ A;  3KLI A;  2I5J A;  2YHX A;  4H0P A;  3CCU N;  3SV4 A;  4FJ5 A;  1TAU A;  4ID5 A;  4GKK K;  4CJK A;  4NCG A;  1NI2 A;  4DF4 A;  2EHG A;  4A62 A;  4CJF A;  1KBL A;  3BDP A;  1HPZ A;  4C1N I;  4BGB A;  1GLJ O;  4AH9 A;  2FSN A;  3RSE A;  4WE1 A;  4O8K A;  4HDO A;  3QET A;  4BRD A;  4O5B A;  3SAH A;  4JI4 K;  1DT9 A;  2YX6 A;  2Q31 A;  4YOX A;  3PV8 A;  4FWP A;  3JYT A;  4FWK A;  4M3U A;  3A8Y A;  4DR6 K;  3O9Q A;  3ZEU B;  2NRT A;  1T6D A;  4JKG A;  4P7I A;  2Q3S A;  1D4X A;  1UAX A;  4BE2 A;  5HOO A;  3AAR A;  3T19 A;  4WQ4 C;  3WA0 A;  1ATN A;  4KH5 A;  4DHY A;  4R79 A;  2WFB A;  1WAJ A;  1LCU A;  1ZBL A;  3CC7 N;  1GC6 A;  3VA0 A;  3THY A;  5DK5 A;  4CEZ A;  3CQX A;  2P9P B;  2NRV A;  3U6F A;  2HHT A;  3IDH A;  4CGF A;  4FK2 A;  3THW B;  2FBX A;  2VGN A;  3H1Q A;  5M1Q A;  3OYA A;  1JDE A;  1GLB G;  4BRK A;  4DFJ A;  4KHN A;  4IWV A;  2DFF A;  4JI5 K;  3SI6 A;  1FXX A;  1QQC A;  3L4I A;  1ZYQ A;  2HOE A;  2AA4 A;  1HQE A;  1VSK A;  3HSC A;  3DJC A;  5AQW A;  4QS7 A;  4CVN E;  5HBM A;  4FSV A;  1FKO A;  4BRL A;  1KVA A;  3N4P A;  3WQT A;  3EZ5 A;  4KV8 A;  2HHX A;  4KHQ A;  4HVJ A;  2E4L A;  1KTQ A;  3CD6 N;  3T3F A;  4IFE A;  2P9K A;  3OYI A;  2VWJ A;  3AGK A;  3DLE A;  4MO4 A;  3VPZ A;  3OYH A;  4XEI A;  1ISN A;  4LF4 K;  3BF1 A;  1HYZ A;  4IJN A;  5FRN A;  2QWL A;  5AQJ A;  4M3W A;  3LDP A;  4EKU A;  5KI6 A;  1HMV A;  4OKE A;  5AZJ B;  4AF1 A;  2E1Z A;  4JHD A;  4GY2 B;  4DS4 A;  1O1W A;  5I9E B;  1WOQ A;  1IV0 A;  5GIN A;  3O4Q A;  3J7Y P;  2IS3 A;  1MK7 B;  4FOE A;  3E9O A;  1N5Y A;  2YKM A;  3ZT4 A;  3HK2 A;  3DLB A;  1TKZ A;  3CPW M;  3OW2 M;  3CCJ N;  5TKW A;  2O8E B;  5AQM A;  5EXW A;  4NB4 A;  2CQU A;  4G1Q A;  1T7P A;  3AVG A;  1Y64 A;  3OBY A;  3SAF A;  2F9T A;  2NNW A;  1NGB A;  4A2A A;  3SNN A;  1MWK A;  3HPH A;  1V4S A;  3CJC A;  5AQL A;  1C1A A;  4IKF A;  4DG1 A;  4B1U B;  2QI2 A;  5GAD P;  2AP1 A;  5EX5 A;  3IS9 A;  3SBT A;  3TAB A;  1XMO K;  2GTD A;  4DSL A;  2DPN A;  3LWM A;  3K5N A;  3M3Z A;  4FJK A;  4OPH A;  2Q0R A;  2G8H A;  1VRU A;  1XNR K;  4W5R A;  4AM6 A;  4FZZ A;  5BR9 A;  1I3A A;  3G6E N;  2FSJ A;  1VQ9 N;  4NLC A;  2E6M A;  4X65 K;  2WON A;  3T7Z A;  1OKJ A;  1TKX A;  3AO2 A;  3CG7 A;  3LP2 A;  4EZ9 A;  4DSF A;  1HR0 K;  4CZL A;  5KPT A;  4DLG A;  3D2F A;  3OYE A;  2Z1H A;  3AU5 A;  5FPN A;  3R8E A;  3TI0 A;  3FFK B;  4JD2 A;  2Z1G A;  3KLH A;  1Z25 A;  1S72 N;  1QS4 A;  3VQC A;  1SQK A;  1GLL O;  4BR4 A;  1C0M A;  1C1B A;  5JLF A;  3R6M A;  4CJ3 A;  4CE9 A;  3O5B A;  3ZX0 A;  3VQ8 A;  2ZJR L;  4N5S A;  1IBK K;  1KC7 A;  1B9F A;  2PAV A;  3QML A;  1M90 O;  2QWO A;  5M1O A;  4BRM A;  2WOM A;  3HZ6 A;  3ZCM A;  3AAP A;  3B6O A;  3V1Q A;  3VTH A;  5IJM A;  1YIJ N;  1XMQ K;  1NWK A;  4ICL A;  5AQO A;  3PLA A;  2KFZ A;  4JI1 K;  4DR2 K;  1X9M A;  4FPA A;  1ASU A;  2A42 A;  4M42 A;  1W2B M;  3OYL A;  2GEM A;  1NK9 A;  1BIZ A;  1A5X A;  5AQT A;  4CI6 A;  1MA9 B;  2E2O A;  3EEQ A;  1LAV A;  3VQ6 A;  4CJE A;  1XI1 A;  5AZI A;  4FZY A;  1HJR A;  3IMX A;  1X3M A;  4BC2 A;  4OPK A;  2CGK A;  4HUE A;  3C0B A;  1NK7 A;  4DSK A;  3DLL L;  2PYL A;  3OYD A;  1RDW X;  3VN5 A;  4N76 A;  4V19 S;  2BDP A;  2KFN A;  3AVN A;  5AQH A;  1VQN N;  5J2P A;  3THY B;  4LY7 A;  1HKG A;  4CCH A;  2A41 A;  4X62 K;  4FOI A;  4Q5V A;  1YVU A;  2P1J A;  3H46 O;  2F9W A;  3C6H A;  1HB6 A;  2QTD A;  4K41 A;  4FLT A;  4ZTF A;  3D2F B;  2E6L A;  3TTC A;  4CEB A;  4NXN K;  5ADX H;  1IKW A;  4J2B A;  2ITM A;  3WNE A;  3MEG A;  3SZ2 A;  1OH6 A;  3TTD A;  5FLX O;  3VET A;  3EY1 A;  3O3G A;  2Z1J A;  4CJT A;  5I3U A;  5DM7 L;  2AL6 A;  1WBD A;  1YTU A;  4QCL A;  4BAC A;  1IKX A;  4FZX C;  3THX B;  3DAW A;  3CCR N;  3EZW A;  1QHA A;  3PX0 A;  3DLR A;  1NNE A;  4FLU A;  4KRE A;  1XWL A;  2YKN A;  3JSM A;  4LF8 K;  2VG7 A;  3AVH A;  3LP0 A;  2BH1 A;  3P1G A;  2NUB A;  2RHK A;  4BRG A;  4CJP A;  1NOZ A;  3QIO A;  1W7A A;  5LJV A;  3AO1 A;  2XY7 A;  3D45 A;  1VK0 A;  3HL8 A;  2O8E A;  3C94 A;  3SV3 A;  3EKS A;  5DM6 L;  2I7P A;  2O8D B;  3CCM N;  4IEE A;  2P9S A;  1Q9X A;  3LPT A;  5F2R A;  3M1F A;  3CJB A;  3MWT A;  1VRT A;  4JK8 A;  2HNY A;  1QQN A;  4B9S A;  4BQL A;  3KK3 A;  3S41 A;  3LDO A;  1ATR A;  3WEE A;  4GV3 A;  3HTV A;  1DLO A;  3LDL A;  3DMJ A;  3HI0 A;  4KTQ A;  4IJA A;  1YIT N;  4CJ5 A;  2COP A;  3V1O A;  1Q9Y A;  2D2Q A;  3VQP A;  3H3O B;  3GG4 A;  1NKC A;  3UB5 A;  1H4R A;  2P9N B;  4CJR A;  4ZRI A;  3CC2 N;  3BY5 A;  1UWB A;  1LW2 A;  4CJ4 A;  2Y1J A;  3EE9 A;  4CIE A;  3U7D A;  1HJO A;  4BVO A;  1VSJ A;  3HXM A;  3V9W A;  1NTI A;  4KAZ A;  4NXM K;  1BCM A;  2JLE A;  4BDY A;  4FCY A;  3VEZ A;  2OZS A;  3V6D A;  3EPY A;  4UQG A;  3G9W A;  5FPD A;  4X66 K;  1OH8 A;  4LSN A;  5GAH P;  2NRH A;  2WH5 A;  5GIO A;  2HMI A;  3FZF A;  3EN9 A;  4N56 A;  4B08 A;  1GLD G;  5IWA K;  3F73 A;  3OJU A;  5HP1 A;  3RWU A;  2HVH A;  1GLE G;  3QNO A;  5T7B A;  1RT7 A;  4I7F A;  4CD3 A;  3VGL A;  3LM2 A;  3KTQ A;  2GWK A;  2O8C B;  3DXM B;  1NK6 A;  3DLK A;  3MEC A;  2XRI A;  3KKS A;  4DMN A;  1NK8 A;  1FJG K;  5JIC A;  4IOA L;  1KLN A;  3CM6 A;  3ULE B;  4E0D A;  1QQO A;  1NJY A;  4LC9 B;  1S3X A;  3MXM A;  1K6Y A;  3RTV A;  3VQQ A;  4FJH A;  2Y1I A;  4GXB A;  1RNH A;  1NJZ A;  3ZX3 A;  5BPN A;  2ABD A;  2HBJ A;  4OO1 J;  3F5T A;  3KVG A;  1BQM A;  3NH2 A;  3ZDT A;  4CD1 A;  2P9U B;  4ZHR A;  4AHC A;  5C25 A;  3O4W A;  4DQR A;  4F9O A;  3ZET A;  3TAP A;  2G8V A;  1K8A O;  1RTJ A;  4MFB A;  1W9H A;  3TPQ A;  3LDN A;  5AQP A;  3J81 O;  4CEO A;  3AVL A;  1UA0 A;  4H0X B;  2ZF5 O;  3AVB A;  4A57 A;  4KBO A;  1JLC A;  4A5B A;  2DFE A;  5FPM A;  5GAG P;  3SUQ A;  3KD1 E;  1ESV A;  1HNZ K;  2FSK A;  3DWL A;  3FGU A;  3NDK A;  3ASM A;  4BRC A;  5EOY A;  4OKJ A;  4PL8 A;  2OTL N;  1HKC A;  3AVJ A;  4A5A A;  3OS2 A;  2AJQ A;  4YDU A;  1JKH A;  4MDB A;  4YOW A;  3O4N A;  4L8R B;  3CPE A;  3WNF A;  3NAE A;  3SJJ A;  4EP4 A;  2R82 A;  3P39 A;  5AQV A;  5C2D A;  2IDO A;  3ATV A;  2BAN A;  3I55 N;  1SKW A;  4GVE A;  5AQZ A;  5BR8 K;  2GBZ A;  4GVM A;  4FLY A;  2A3Z A;  3C6U A;  1KCF A;  3UKU A;  1DTQ A;  3MWP A;  1Q86 O;  3VEW A;  4W5Q A;  5H1S Q;  3KZB A;  4HWI A;  4AHU A;  3LZI A;  1GLC G;  4Y1D A;  1J53 A;  4HUF A;  2HST A;  4YFU A;  1MK9 B;  4JNE A;  3MN7 A;  4DV6 K;  3CJ7 A;  2JWK A;  4C8K A;  4RWT A;  2G8U A;  4CZH A;  4OJR A;  3OBW A;  4WF9 L;  5E84 A;  2J0M A;  3TTF A;  4FLW A;  1NKE A;  3A5M C;  2XHB A;  1C6V A;  5J2Q A;  1BL3 A;  1WSE A;  4JI7 K;  3QEW A;  4FJJ A;  4DUY K;  1S9G A;  2I7N A;  2V7Z A;  4PL7 A;  4FM0 A;  2ASO A;  3HYF A;  4IXC A;  5B8H A;  3RR8 A;  5JVH L;  1NK4 A;  4RTF D;  4E7I A;  3CCE N;  1SAZ A;  4KI6 A;  3DYA A;  3AVF A;  5AFU H;  3V9S A;  2D0A A;  2X6N A;  5I42 A;  2HF3 A;  3CCL N;  1YI2 N;  4O4G A;  2UUB K;  3O8M A;  4DV3 K;  2G8W A;  3JS6 A;  1OVY A;  1JL1 A;  3G71 N;  1RBR A;  3A5L C;  1RT4 A;  3H6E A;  4YOY A;  5CR4 A;  1KRP A;  1XNQ K;  2KHO A;  3IG1 A;  4DTN A;  4I9Q A;  4BWM A;  3KLG A;  3ZSR A;  4C1N K;  3IAY A;  4B9U A;  3B8A X;  4O0I A; 
#chains in the Genus database with same CATH homology
 1YXQ A;  4A2A A;  1BUP A;  3C65 A;  2YJE A;  1MWK A;  3EO3 A;  3AAQ A;  4GV9 A;  3A5N C;  4A59 A;  1V4S A;  5AQS A;  3CJC A;  5AQL A;  3WEE B;  1MIX A;  3K9K A;  5BPM A;  2QXL A;  4B1U B;  5MLC Q;  2QI2 A;  2AEH A;  4CBX A;  3KWG A;  1KAY A;  3IFR A;  3J7Z O;  3CXC M;  2W40 A;  5GAD P;  2AP1 A;  2WBN A;  3MMV A;  5M1N A;  1QVF M;  2NRW A;  5KPR A;  4BRP A;  4H5W A;  3CJ1 A;  5EX5 A;  3SBT A;  5JVL A;  1DGK N;  1T44 A;  3O08 A;  3C7N A;  4JKC A;  4FWM A;  3RVC A;  3UKR A;  2QEX N;  2GTD A;  5AR0 A;  3U8X A;  4CZG A;  3I8B A;  4BR7 A;  2DPN A;  3DXM A;  1T6C A;  3M3Z A;  1ZXO A;  4BC3 A;  4EIA A;  4OPH A;  2Q0R A;  3QB0 A;  3CMA N;  4IO9 L;  4ILH A;  4AM6 A;  5AQX A;  5BR9 A;  3TSQ A;  3G6E N;  3O9S A;  2FSJ A;  3QFU A;  1RGI A;  4BQZ A;  3CME N;  1VQ9 N;  4NLC A;  2BUP A;  2NRX A;  2P9I B;  3GL1 A;  3A5O C;  1NGG A;  3T7Z A;  4BVP A;  1OKJ A;  2Q97 A;  3AGR A;  4BG8 A;  3QBX A;  1Y19 B;  2E1Y A;  3PIO L;  4JK9 A;  3UKU B;  4CZL A;  4ZRJ A;  4KH6 A;  5KPT A;  3D2F A;  4H0Y B;  3DXK A;  5AZI B;  3AU5 A;  4M63 C;  4OPA A;  5E26 A;  5FPN A;  1NGE A;  4I6M A;  1W97 L;  5EVZ A;  3FE1 A;  2IVO A;  3R8E A;  1HUX A;  1BA0 A;  3U9D A;  3FFK B;  4JD2 A;  1S72 N;  2QWM A;  2WUS A;  4YL8 A;  1SQK A;  1HB8 A;  1GLL O;  5AQU A;  4GV6 A;  3CI5 A;  2VGM A;  4YOV A;  2RE2 A;  1VQO N;  3D7E O;  2GWJ A;  4BR4 A;  4GNI A;  3CET A;  3FR0 A;  4FL9 A;  4YDU C;  4H0T B;  3CF5 L;  2VWB A;  3KWI A;  3ID6 A;  3WXM B;  1QZ5 A;  3R6M A;  5JLF A;  2J4R A;  4FO0 A;  2HE7 A;  4WQ4 A;  3HM8 A;  1VQP N;  2E2N A;  2P9U A;  3LDQ A;  3O5B A;  3E1Y A;  2IIR A;  1RDU A;  3ZX0 A;  1YAG A;  3Q7B A;  4BR5 A;  4BRA A;  2ZGY A;  4JKF A;  2QW9 A;  4BC4 A;  2HBM A;  3AY9 A;  2ZJR L;  3CIP A;  2D11 A;  3NVK A;  4O5F A;  1EF1 A;  5AQG A;  2VYP A;  3L0Q A;  1KC7 A;  2QWN A;  3FZH A;  4BRO A;  3F9M A;  2PAV A;  3QML A;  1QVG M;  1N8R O;  1M90 O;  3ENH A;  1VQ5 N;  4CZE A;  3OA9 A;  2QWO A;  4DXA B;  3IUC A;  5M1O A;  3FZL A;  3VF6 A;  2ZPY A;  1E5W A;  1X3N A;  3HZ6 A;  3R3L A;  4BRM A;  5AQR A;  4U67 L;  5C0Y A;  2PBD A;  3AAP A;  4K42 A;  1VQ7 N;  1BO5 O;  2CGL A;  1QZ6 A;  3O6W A;  4H03 B;  3VTH A;  5IJM A;  3TU5 A;  1YIJ N;  3X23 A;  3D2E A;  4CZI A;  1IG8 A;  1NWK A;  3TSP A;  1NGJ A;  4B1V A;  2V51 B;  4NY0 A;  5AQO A;  3PLA A;  4MDA A;  3VTI A;  1YJ9 N;  4JAX A;  4BC5 A;  5C12 A;  4M7Y A;  4H0V B;  2GX9 A;  4L3Q A;  4FPA A;  3BIN A;  5M1K A;  1JJ2 M;  3O80 A;  3M5R A;  1Z05 A;  2A42 A;  3HOT A;  3VOV A;  1W2B M;  4BGA A;  2GEM A;  1ILY A;  4C23 A;  2X0S A;  3BEX A;  2HRJ A;  3BP8 A;  5GIP A;  5AQT A;  4CI6 A;  1MA9 B;  2CH5 A;  2P9S B;  1HKB A;  4JKE A;  2E2O A;  3WT0 A;  4ISE A;  2YHY A;  3J8A A;  3IKM A;  5BRD A;  4CBW A;  3ATU A;  3GE1 A;  2FXU A;  2GEL A;  4JKD A;  4XH5 A;  1ACA A;  5AZI A;  4JKH A;  3IMX A;  4BC2 A;  1P90 A;  1X3M A;  1KD1 O;  2CGK A;  3C0B A;  1NVL A;  5AQF A;  4JKA A;  3NMU A;  2A40 A;  2HBK A;  1HPM A;  4BRH A;  3DLL L;  3WXK A;  1DIK A;  1RDW X;  4H5R A;  4JKB A;  3R1X A;  1VQ8 N;  5AQH A;  4H5T A;  1VQN N;  2CH6 A;  2HF4 A;  3KK7 A;  3W3D A;  4BY9 C;  5C2F A;  1TYQ A;  3CER A;  3BF3 A;  4CZK A;  1HKG A;  4UY8 O;  2A41 A;  4H0O A;  4WYB A;  4YOR A;  1EO1 A;  4FOI A;  1BU6 O;  3RSE B;  3O9R A;  5C10 A;  4PKH A;  3H46 O;  2F9W A;  2P9L B;  3C6H A;  3OHR A;  2D0P A;  1HB6 A;  4I6M B;  5BN9 A;  2QTD A;  1K73 O;  3R9P A;  5BN8 A;  4K41 A;  3D2F B;  1EQY A;  3TTC A;  3QBW A;  2FF6 A;  5ADX H;  3N4Q A;  2FJ9 A;  2ITM A;  2EMT A;  2JWL A;  4DCH A;  3CCS N;  3QFP A;  1NLV A;  1VQK N;  1RFQ A;  3TTD A;  1VQ6 N;  4B9Q A;  3VET A;  2VCP A;  4DKW A;  3SBG A;  4HDQ A;  3WQU A;  4EAH D;  3CCQ N;  1HLU A;  3CJ9 A;  4YOT A;  3GOI A;  5DM7 L;  3VF4 A;  2AL6 A;  2F7T A;  3K9J A;  2FLO A;  1HBK A;  1J19 A;  2D0O A;  2HMP A;  3DAW A;  3L6Q A;  4BRI A;  3CJA A;  3CCR N;  3EZW A;  3O1B A;  4XH1 A;  1QHA A;  2P9L A;  2J0K A;  1YJW N;  3UKR B;  2D10 A;  3A0I X;  3VMF B;  2D1K A;  3E9P A;  1JCE A;  5BRF A;  1YHQ N;  1YVN A;  3WXI A;  3H1V X;  4WFA L;  3ZET B;  4WQ5 A;  3UE5 A;  1BA1 A;  1ZC6 A;  4JEP A;  5KQ8 A;  2BH1 A;  3QIJ A;  2RHK A;  3FZK A;  3QIC A;  4BRG A;  2BTF A;  2QWQ A;  3BUZ B;  2CGJ A;  3O1W A;  5LJV A;  3JXU A;  3M6G A;  2A5X A;  3SLC A;  5AQQ A;  2ZJQ L;  3Q7C A;  1MDU B;  3EKS A;  4ISG A;  5DM6 L;  2I7P A;  5KPZ A;  5M1F A;  4BG9 A;  3E66 A;  3SJH A;  4IO8 A;  1NGH A;  3CCM N;  4IEE A;  2P9S A;  3DXK B;  2QA4 N;  5F2R A;  3NVM A;  3D6R A;  3O9U A;  3P38 A;  5LJW A;  4AM7 A;  4CZJ A;  4FVU A;  3M1F A;  3G25 A;  1Q81 O;  1Q18 A;  3CJB A;  3MWT A;  4K43 A;  3WUH A;  3H3N O;  4QS8 A;  2FDQ A;  5CHI A;  2P9P A;  4JK8 A;  3FLC O;  1QQN A;  4J8F A;  3U4L A;  4XH4 A;  3U9Z A;  4BQL A;  1JCG A;  2LBB A;  1G99 A;  3S41 A;  3LDO A;  1ATR A;  1X9J A;  3WEE A;  1GGO A;  4GV3 A;  3HTV A;  3LDL A;  3HI0 A;  4IJA A;  1YIT N;  2E2P A;  2YHW A;  2COP A;  3MK6 A;  4FWR A;  2D2Q A;  3H3O B;  2UYT A;  3GG4 A;  1BWF O;  3UB5 A;  1H4R A;  2P9N B;  2ASM A;  5BPL A;  3GBT A;  5AQK A;  4ZRI A;  1NBW A;  4PKI A;  3VEY A;  3HOS A;  3CC2 N;  1K8K B;  1GC7 A;  4JK7 A;  2E2Q A;  4QS9 A;  4FWL A;  3MN9 A;  2P9I A;  4FWN A;  3EE9 A;  2QWR A;  3U7D A;  1HJO A;  4BVO A;  1SGH A;  1NTI A;  2E88 A;  1KAX A;  1CZA N;  3VEZ A;  3WXL A;  4JD2 B;  2YJF A;  2CB8 A;  4ZRK A;  1Q82 O;  1YJN N;  3VES A;  3O9T A;  2NRR A;  3MX5 A;  4A61 A;  3EPY A;  5BRH A;  3U8Z A;  3TSU A;  2NRZ A;  2YCH A;  3G9W A;  2IVP A;  3ENO A;  5FPD A;  4WFB L;  2ZJP L;  1VBH A;  3VEO A;  4BR0 A;  5CE3 A;  1TUU A;  1VAZ A;  5GAH P;  3SAG A;  1NGA A;  2NRH A;  3ZYY X;  5AQI A;  2WH5 A;  2E20 A;  1NGD A;  4A2B A;  5C15 A;  3CC4 N;  1KQS M;  1LOT B;  4WCE L;  1K9M O;  1KC8 O;  5GIO A;  4H5V A;  3FZF A;  5BRE A;  3EN9 A;  4O8U A;  4IOC L;  4IDH A;  1ST7 A;  1GLD G;  5AZJ A;  4BR9 A;  3EL2 A;  1GLE G;  5M1P A;  1KXP A;  4MLE A;  3L4Q A;  2ASP A;  1XQS C;  2PFU A;  1YF5 L;  2D4W A;  4CD3 A;  3VGL A;  3I56 N;  3LM2 A;  5EY4 A;  2GWK A;  3VEN A;  3ID8 A;  4MO5 A;  1HX1 A;  3DXM B;  4BRQ A;  4K25 A;  1NGC A;  2ZWH A;  2NLX A;  4BRN A;  4CYE A;  4BRE A;  3AU4 A;  4CZF A;  5JIC A;  2E8A A;  4MLH A;  4IOA L;  1J6Z A;  1VBG A;  3MDQ A;  4M7X A;  5GAE P;  2KKZ A;  2YI1 A;  1SZ2 A;  3ULE B;  3VER A;  1C0G A;  1WUA A;  4B1Y B;  2V7Y A;  5KQD A;  5AQY A;  4JHD B;  2IVN A;  4CJ7 A;  3WXJ A;  4IZ9 A;  4TKN A;  1DKG D;  1QQO A;  1TUY A;  1T3V A;  3VEV A;  4YOU A;  1NJI O;  4LC9 B;  3MX2 A;  4EFH A;  4NLB A;  1S3X A;  1DEJ A;  4FWS A;  4IEI A;  4JN4 A;  3VGM A;  4Z94 A;  3H45 C;  1NGI A;  2Q36 A;  3P4I A;  4H5N A;  2WC9 A;  2V52 B;  4GXB A;  3CHW A;  1VQ4 N;  4HTL A;  1VQM N;  1NM1 A;  3ZX3 A;  1U2V B;  2I1J A;  4FWQ A;  2GUP A;  4FWO A;  5BPN A;  2ABD A;  5ELZ A;  2OTJ N;  2HBJ A;  4BR2 A;  4OO1 J;  3FLV A;  3F5T A;  1S22 A;  3KVG A;  3ZDT A;  2Q0U A;  2P9U B;  4CD1 A;  4G9Z A;  1C0F A;  3O4W A;  4H0P A;  3ZET A;  2YHX A;  4F9O A;  1BOT O;  3C7N B;  3CCU N;  1K8A O;  5TKY A;  3CCV N;  3ULE A;  4JKG B;  1NI2 A;  1K8K A;  3TPQ A;  5F1X A;  3LDN A;  4A62 A;  5AQP A;  3MN6 A;  5ADX A;  1V4T A;  2EMS A;  5HL7 L;  1KBL A;  4H0X B;  1Z6R A;  1VQL N;  2EWS A;  2ZF5 O;  4A57 A;  4KBO A;  4C1N I;  4BGB A;  4A5B A;  1GLJ O;  2FF3 B;  2FSN A;  5FPM A;  4B1W B;  1KAZ A;  3RSE A;  5GAG P;  4RCH A;  1ESV A;  4O8K A;  4HDO A;  2FSK A;  3DWL A;  3VGK A;  1IJJ A;  3MCA B;  3F2K A;  3FGU A;  3W0L A;  4BRD A;  3SAH A;  3ZX2 A;  4BRC A;  1DT9 A;  1TYQ B;  2YX6 A;  2Q31 A;  3LM9 A;  5EOY A;  4FWP A;  4PL8 A;  4FWK A;  4YOX A;  3A8Y A;  2OTL N;  1XC3 A;  3VEX A;  4BRF A;  1GG3 A;  2A6A A;  3O9Q A;  3ZEU B;  2NRT A;  1QQM A;  1T6D A;  1HKC A;  4A5A A;  4JKG A;  4FPB A;  4YDU A;  4P7I A;  4MDB A;  1D4X A;  4Y0W A;  4YOW A;  5HOO A;  3AAR A;  4B1X B;  3CPE A;  3ENB A;  4WQ4 C;  3WA0 A;  1ATN A;  4KH5 A;  4DHY A;  4R79 A;  3EE8 A;  2R82 A;  2WFB A;  3P39 A;  3PVL A;  1LCU A;  3MCP A;  4U7B A;  1SS6 A;  5AQV A;  5C2D A;  4EHT A;  3ATV A;  3LL3 A;  1GC6 A;  2QM1 A;  3CC7 N;  3I55 N;  3CQX A;  1P8Z A;  3G4S N;  2P9P B;  4GVE A;  5AQZ A;  2NRV A;  2J0J A;  3IDH A;  3PIP L;  1MIZ B;  1H1V A;  2A3Z A;  1Q7Y O;  3UKU A;  1GLA G;  2DIK A;  3I33 A;  3MWP A;  2VGN A;  3H1Q A;  5M1Q A;  4NO7 A;  3SK3 A;  1Q86 O;  2YVC A;  1JDE A;  1BG3 A;  1GLB G;  4BRK A;  1R59 O;  5AQN A;  3VEW A;  4DB3 A;  3D2E B;  3SMS A;  3KZB A;  5H1S Q;  4HWI A;  4IWV A;  4B1Z A;  3CQY A;  1U6Z A;  1U2V A;  3FP5 A;  3L4I A;  1GLC G;  2HOE A;  1E4F T;  3EKU A;  2HST A;  2AA4 A;  1MK9 B;  4JNE A;  2H3G X;  3MN7 A;  3HBT A;  3P31 A;  1JCF A;  1NGF A;  3CJ7 A;  1M1K O;  1NMD A;  2JWK A;  3HSC A;  3DJC A;  4DQ8 A;  5AQW A;  4RWT A;  4QS7 A;  3MN5 A;  5JLH A;  4CZH A;  4FSV A;  1MWM A;  4EHU A;  4IOX A;  2P9K B;  3OBW A;  2Q1N A;  4WF9 L;  3SMP A;  4BRL A;  5E84 A;  3QDK A;  1GLF O;  2J0M A;  3N4P A;  3TTF A;  3WQT A;  4ILG B;  5LY3 A;  4E1J A;  2I1K A;  3A5M C;  3CD6 N;  1ATS A;  2P9K A;  4IFE A;  4CBU A;  3E9L A;  3AGK A;  4MO4 A;  3VPZ A;  2I7N A;  4ILJ A;  2V7Z A;  4XEI A;  1ISN A;  4PL7 A;  3BF1 A;  2ASO A;  2OAN A;  4IXC A;  5B8H A;  4IJN A;  4KH4 A;  2RQ1 A;  5JVH L;  4RTF D;  2NZT A;  2QWL A;  5AQJ A;  3CCE N;  1SAZ A;  1YUW A;  3LDP A;  4EKU A;  1O13 A;  4PKG A;  2ZGZ A;  2KLA A;  5AFU H;  3C6A A;  3FZM A;  4WQ5 C;  5F0X A;  1XUP O;  5JVG L;  5AZJ B;  4AF1 A;  2E1Z A;  4JHD A;  1ZBS A;  2HF3 A;  4GY2 B;  3HRG A;  3CCL N;  5I9E B;  1WOQ A;  4CZM A;  5GIN A;  1YI2 N;  1E4G T;  2W41 A;  3O8M A;  2QWP A;  1MK7 B;  4FOE A;  3E9O A;  3JS6 A;  1OVY A;  3ZEU A;  3G71 N;  3A5L C;  3GDQ A;  3CPW M;  3H6E A;  4YOY A;  5CR4 A;  3PZD A;  3KHY A;  3OW2 M;  3VF2 A;  2Q2R A;  3IVF A;  3CCJ N;  5TKW A;  5AQM A;  2KHO A;  4NB4 A;  5EXW A;  2CQU A;  2P9N A;  1BDG A;  2HBL A;  4ISF A;  4PHT X;  5AFU A;  1Y64 A;  3OBY A;  3SAF A;  5JMV A;  4F7G A;  4C1N K;  2F9T A;  3T69 A;  4WFN L;  2NNW A;  1NGB A;  3B8A X;  5FPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...