4JKGB

Open and closed forms of mixed t1789p+r1865a and r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
214
Chain Sequence
LFSNQIIWFVDDTNVYRVPIHKLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 66
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkgB02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkgB01
4JK7A 4JKCA 4JKFA 3SBTA 3SBGA 3E9PA 3E66A 4JKHA 4JKBA 4JKEA 3ENBA 4ILJA 3E9LA 3E9OA 4JKAA 4JK9A 4JKDA 4ILHA 4JK8A 4JKGA 4JKGB 4ILGB
chains in the Genus database with same CATH superfamily
3FZMA 2G8IA 1GOCA 1LWEA 4HVJA 4H5WA 2RQ1A 2GUPA 4M45A 3CJBA 5AQLA 2YJEA 3G71N 4B8CA 2NZTA 2B6AA 1SV5A 2IOCA 1QQCA 4OGEA 2JWLA 1J5EK 3NH0A 2ZJPL 4C8OA 3W3DA 1GOBA 1CZ9A 3M5RA 4KHPK 4DKWA 1B9FA 5HRPA 5EX5A 4JKCA 1RT6A 3CERA 3CQXA 1JLFA 4PKGA 3LP3A 3GL1A 5KI6A 3OYIA 3LPTA 4DSIA 4N5SA 4B1ZA 4E7IA 4B9LA 3WUHA 2QWPA 3HVTA 4M3XA 4YDUA 3ULEB 3MWTA 4FWRA 3VETA 3H6EA 3O4QA 3AU4A 1Z6RA 3LANA 1VAZA 4JKGA 4IJNA 4DU4A 3HJFA 4NCGA 5CE3A 5ADXA 3MECA 4DSEA 5AQGA 4JI0K 5BRHA 2DTUA 2A41A 3GG4A 3F9MA 4JRQA 2DY4A 1JKHA 4DQ8A 3L2RA 1YTUA 2FJ9A 1L3TA 3CCRN 1QSLA 3U4LA 2ZF5O 1QSYA 4M3RA 3AVBA 1BIUA 4CI6A 3AVFA 4ID5A 4LSNA 1KLMA 4IWVA 4ISEA 3LL3A 1JCGA 5FLXO 2HHVA 1HLUA 2P9KA 4GY2B 1BQMA 4IZ9A 3PV8A 4I2QA 2RN2A 1C0GA 1KVCA 2OTJN 5EOYA 3ATVA 1TUYA 5AFUH 3RR7A 3F2KA 1FXXA 3ZLJA 4M3WA 2HBMA 4BDYA 3ZSWA 4DS5A 1LWCA 3J8AA 3WXKA 3AVAA 4DV5K 3L0QA 4FLTA 4IFYA 1VRUA 2NNWA 4C23A 4CJ4A 4Y1CA 3RRHA 1YT3A 1OVQA 3M6GA 1U45A 1KBLA 1WBBA 3JXUA 3VTHA 1RBUA 1WAJA 3AAPA 2QXFA 5GAHP 1UA0A 5ADXH 3FLVA 3KLHA 2HVHA 4AF1A 2A5XA 4XIUA 3SLCA 1K9MO 2OCEA 4C1NI 5HBMA 3SV4A 1HNIA 1RTJA 3DYAA 5AQQA 1N6QA 1H1VA 3DXMB 4H5VA 4F2RA 3WQUA 5JLHA 2OPQA 4FJHA 3MWPA 5JLFA 4IDHA 1ZBFA 2YHAA 4GKJK 3DRPA 3O3GA 3THYA 2HHUA 2QTDA 1IBKK 2NRXA 3ZEUA 1WSJA 1VRTA 4M63C 4YHHK 2P9PA 2PFUA 3IAYA 4FJIA 2UXBK 4PL7A 1V4TA 1VSIA 3L2UA 4ELVA 1ATRA 4IBNA 3QMLA 5B8HA 2UXCK 1KFDA 3J80O 4OKEA 1LWFA 4FLWA 2E2PA 4BC3A 5GAEP 4DTJA 4LFCK 3P31A 1IKXA 4FVMA 3O9RA 4KFBA 3TTFA 5CZ1A 4F3TA 4LC9B 1YAGA 3FR0A 5CYMA 2QKBA 1S5JA 2P9UB 3KLFA 2AJQA 1TAQA 4E7LA 2V52B 3QBWA 1JL2A 3TI0A 3OYEA 2D0AA 3K58A 1IH7A 4I2PA 3VF2A 4PY5A 3TABA 4KAZA 3UB5A 4KHYA 2RKIA 2P5GA 1NWKA 2VYPA 1U2VB 5IJMA 4FWSA 3SAFA 1JLAA 5BR9A 4DV1K 5J2QA 1DTQA 3K9JA 4AH9A 3T19A 1L3SA 1L3VA 1NK5A 1NMDA 3VQBA 3DLLL 4DU1A 3CM5A 3F73A 3P38A 3FZFA 1SKSA 2CH5A 4HDOA 4M3UA 1NLVA 1NK7A 3FFKB 3NFAA 3VQ7A 1HYVA 3QEXA 1NGIA 3MAQA 1U4BA 2BE2A 4F7GA 1TK5A 3KZBA 1CLQA 3PO4A 4J2EA 1I94K 2BTFA 3LM2A 4DV2K 3HP9A 3L4QA 4CE9A 4IDKA 1M1KO 2ZPYA 4ZRKA 5FDLA 3QEPA 3KHYA 4MDAA 4KB0A 4LFAK 4H0XB 4PQUA 3TTDA 4BC2A 1XNQK 2Q3SA 4O0JA 4AHSA 3S3OA 4NY0A 1JLBA 3IMXA 3EKSA 1IV0A 2EMTA 4M41A 3DOLA 3H1QA 4OKKA 3JSMA 2D11A 4M3YA 4FW2A 2FSNA 4DFPA 1GC7A 4I9LA 5BREA 2KZZA 3M8QA 2P9NA 4MLHA 1QSSA 2HRJA 1S6PA 1D9DA 4C1NK 3WNHA 4BGBA 2IVPA 1MIXA 4JN4A 2FC0A 3FZHA 1ZBSA 3U3YA 1NK0A 2BDPA 2D5RA 4CF9A 2Z1JA 5FPEA 4W5NA 3SQ1A 3HPHA 4CJ5A 1WB9A 4OPAA 4IO9L 1QE1A 3VTIA 2ASMA 1S1UA 3DLHA 3LDOA 2CB8A 1RBVA 2QWMA 3BF1A 2VG7A 4LF9K 3ITHA 4H4MA 4CJQA 2BANA 1S1VA 4Y0WA 1IKVA 2QA4N 3MEEA 1F21A 4A2BA 1RGIA 4IOXA 4CBWA 4CVNE 4ELUA 1Q9XA 4DUZK 3R3LA 4IG0A 1TL3A 2YHYA 4ILJA 4LFBK 3OY9A 4FJ5A 1HNWK 2E2OA 2BH1A 3MX5A 3QDKA 5AFUA 4IXCA 4BRIA 2Q0RA 5AZIB 3HM9A 1YF5L 1IKYA 1CZAN 4O55A 1TV6A 2E4LA 2E1ZA 3EE8A 2QWOA 2F9TA 4AILC 2O4IA 3JYTA 4H5TA 4PUOA 3PIOL 1L3UA 2ZGZA 1XMOK 1QVGM 1OH5A 4RG8A 3H46O 4JI1K 2GBZA 2D0OA 5M1QA 3BINA 4CJTA 3OS0A 4JKAA 3ZYYX 4DG1A 3EYZA 3SAGA 2E6LA 4RW4A 4L8RB 1NK6A 4ZRJA 3CIPA 5AQNA 4LF8K 4FLYA 3WXIA 4KH5A 1UWBA 1NOYA 4CJRA 1YI2N 1GLDG 1EETA 1WOQA 1VQLN 4KHQA 3L2QA 4JEPA 4FK4A 4YOWA 4KTQA 4FJMA 3QLHA 4J2DA 4CHPA 3ZSYA 1EP4A 3ZSOA 4O8KA 2UUCK 1K8KA 2W6LA 3R6MA 4WFBL 1X9SA 3ENHA 3BDPA 1C0FA 3AO1A 3RR8A 1MDUB 3OTOK 2PAVA 4B9MA 4C8MA 3AA3A 4BDPA 4CFCA 3EZWA 4OKJA 1SS6A 4BQLA 1JLGA 2QXLA 3FP5A 1VQPN 2WC9A 1FW6A 3TSUA 1ASWA 5F2RA 4YL8A 4FO0A 1KAXA 2WTUA 3OYNA 1QZ5A 4H4OA 4N76A 2O8BB 1HUXA 4BRNA 1W97L 4A59A 3EO3A 4AM6A 3BP8A 2LBBA 3CFRA 3ULDA 4AHCA 4FK2A 1YIJN 3C6HA 3NF8A 3SUOA 3ZX2A 4BREA 5JVGL 4GKKK 5AQIA 3CCLN 5C0YA 1JCEA 2CGLA 1S3XA 3LZJA 4RW8A 4ID1A 1C1AA 1XHXA 4JI4K 4CGGA 1W0HA 3D45A 2IAJA 4F8RA 5E84A 1WUAA 4FM0A 1RT7A 4JI3K 4BR0A 2AP1A 3TTCA 4CJFA 3DRSA 3RRGA 1Q82O 1SGHA 3I0RA 4MDBA 3V1QA 5AQXA 1FKPA 3ZX0A 3ASMA 3MCAB 2P51A 4DR7K 1XC9A 4W5QA 2Z1GA 2X74A 1TKTA 3KJVA 3SMSA 5AZJA 5C12A 1T44A 1VSJA 3OYCA 1GLJO 3AO2A 5AQMA 1X3MA 1NKBA 1Z26A 4FWQA 3NH2A 4FZXC 1GG3A 5DM7L 1VBGA 2E2QA 1RTIA 4DTMA 3DWLA 3LDLA 1W7AA 5JS1A 4OPJA 3WNFA 4O0IA 5H1SQ 3QEVA 1TKDA 4DR2K 2P9IB 2DFHA 3DLBA 1HKGA 3O6WA 3CCSN 1T8EA 2VQEK 4BRMA 4DV6K 2ZE2A 1TL1A 2FF6A 4Z4EA 4FJLA 3VEVA 1BA0A 2QWQA 1SL1A 1NJWA 1U04A 3PIPL 3J7ZO 1EF1A 5I3UA 2FBVA 4DCHA 4BACA 3U6FA 2OPRA 4PKHA 3B6PA 1J53A 3IDHA 5BRFA 1NJIO 2G8KA 4FYDA 4J2BA 4CD3A 1LV5A 3D2EA 4DFKA 4BR5A 2IDOA 4K8ZA 4BG9A 3MK6A 4BRKA 1VHXA 3ZSVA 3MXIA 4JKFA 3P5JA 3ZEUB 1NGEA 2Q36A 1Z25A 5AQPA 4K42A 2G8HA 3OYBA 4AM7A 4DQIA 2P9PB 2NLXA 3THWA 4DF8A 4B1YB 3VF4A 5HOOA 1HKBA 4JKEA 5AQRA 5CY4A 2XY7A 3VQAA 1RT5A 4B9QA 3O9QA 2NRHA 3KWGA 1T6CA 4CIGA 4JI2K 4BQZA 1NNEA 1ITGA 3MN5A 4KI4A 3TR8A 3K5MA 5FPMA 1S1TA 4BG8A 5AQFA 4YOUA 4KTZA 1KC8O 5JVLA 2F4VK 1HNXK 3AVLA 4HDQA 3SYZA 4CHNA 2JWKA 3A5NC 1GLEG 1R0AA 1WAFA 3L2VA 3OBYA 2KFZA 4FWPA 3N4PA 5J2PA 1N34K 4LY7A 2BGGA 3ULEA 2RF2A 1TKXA 3CQ8A 2KFNA 3G9WA 1KAZA 1VQ9N 4TKNA 1VSHA 2O8CA 5LJWA 3O8MA 1ZBHA 2COPA 1QHTA 3K0SA 3BY5A 1E4GT 2QM1A 5KGWA 3DLKA 3VEWA 3MMVA 4DLEA 4DR6K 1XMQK 3V9WA 1DEJA 5A2QO 5GAGP 2PYLA 3KD5E 1ZXOA 1TYQB 4AHRA 2KHOA 4JKDA 3LALA 1QQNA 5AZIA 1X9WA 3HRGA 2AA4A 2UU9K 2PZSA 4JK7A 4DV4K 2YKNA 3DAWA 1MIZB 2VG5A 5AZJB 2CGKA 3S3NA 4FJKA 1YJWN 1TVRA 1WSIA 4BY9C 3FE1A 1YITN 4BROA 1IG8A 1HNZK 3AO3A 4A57A 4WQ4A 4PL8A 3L3VA 3ZSZA 3ZT2A 3L4IA 2HNDA 4CESA 3V9UA 1R59O 3JS6A 3CPEA 3CYMA 5AQTA 3BUZB 2ZJRL 4BR2A 3K9KA 1K6YA 4KREA 3CJ1A 1X1PA 3VOVA 3ATUA 2UUAK 1KQSM 5TKWA 1G99A 4CJLA 2P9NB 1GLFO 5C2FA 3J81O 4KH4A 3EY1A 3KK1A 3NHGA 3H45C 3UKUB 4CF2A 4CEAA 2OZSA 2ITGA 3WQTA 1REVA 4WFNL 1S9GA 4R79A 1IKWA 1EO1A 2GEMA 4FJ9A 3VQ9A 2R82A 4BC4A 3LWLA 4FWKA 4CJVA 3GBTA 3GOIA 5M1KA 3HTVA 3I8DA 1JLQA 4RW9A 4ISFA 3SAHA 4DMNA 5CYQA 4GNIA 4BRHA 3O9TA 1P8ZA 1RDWX 2HBJA 2BUPA 4MFBA 3UE5A 2XY5A 2VWKA 4NLBA 1WSEA 4YOTA 4CECA 1DKGD 3QNOA 1XI1A 4TSXA 4CEZA 1GOAA 5AQWA 1ASUA 3I55N 1GLCG 4E7HA 4CZJA 1D8YA 1VQ4N 3DLRA 2D0PA 4XH4A 2A1SA 1RDDA 5DK5A 1HNVA 2ZM6K 4KHWA 3T7ZA 5HRRA 4OJRA 4Z0UA 3D0PA 1NGDA 2YNFA 3K5LA 3LP1A 2FBTA 2FLOA 4BRGA 4CYEA 3D2FB 5AQUA 4PKIA 1VQ8N 3TAGA 3C6UA 4OPKA 5KPTA 1YTAA 3DM2A 4L3QA 3O4WA 1CZBA 1NGHA 2LSNA 1NMNA 2Q1NA 1YJNN 3QIOA 1VSLA 1GLBG 4B1UB 1RFQA 2A1RA 3EL2A 4JKGB 5AQZA 3CJAA 4WCEL 2W6KA 2ZD1A 4E89A 4CHYA 3R1XA 3MXJA 3AARA 3L8BA 4KI6A 3CM6A 5AQKA 2HE7A 1QS4A 4HTLA 2V51B 1X3NA 3DLGA 1EQYA 4O4GA 3CD6N 4JD2A 2RE2A 1I3AA 4CJWA 2DFEA 1RBRA 3QO9A 4QS7A 3AY9A 2DPNA 4WF9L 5K14A 2ASPA 3HPOA 4BR7A 3AO5A 2NRZA 5M1FA 5LL6Z 3THWB 1FK9A 1RDAA 3H3NO 3ZT0A 1YVUA 3O9SA 4LSLA 4B9UA 4CJ7A 2HF4A 3MEDA 3QNNA 4FL9A 1NU0A 3OYLA 2FDQA 1MWMA 3OYGA 3CFOA 2P9SA 3HK2A 2CQUA 5JVHL 3KK3A 5BPMA 5DM6L 4JI8K 4N56A 1KRPA 4DHYA 4LF7K 5EXWA 3O08A 3SBTA 3OS2A 2JLEA 4B1VA 3DI6A 2GELA 4CEDA 3IKMA 4B9NA 4DR4K 3SUPA 4H03B 4B9SA 5EU7A 4CZIA 1SKWA 4LH5A 1KVAA 3TAEA 3FFIA 3IFRA 1VSEA 2NRWA 1VK0A 3D2EB 1NM1A 1BO5O 3VPZA 2KQ2A 3AU5A 3HVRA 3WEEB 3TAPA 4ILGB 3VQEA 1YVNA 4NYFA 4RWTA 1ZBLA 4CJEA 2A42A 4OO1J 4CEOA 4V19S 4H0YB 2IVOA 3V6DA 4Q0BA 3C0BA 4FLZA 5GIOA 3SUQA 3U7DA 1W9HA 2HHHK 4I9QA 3HYFA 4F9OA 3RTVA 4JK9A 2E8AA 1Q9YA 3ID6A 4FLUA 2YNHA 1RT4A 1NI2A 3V9ZA 2E1YA 3LDQA 3T3FA 4H8KA 3B8AX 4CFDA 3UIQA 4CGHA 3VQQA 1NKEA 2KLAA 3NF7A 3D2FA 4EIAA 1K8AO 4LF5K 3ZSXA 3QFUA 3CETA 4CW7B 3NH1A 4RW6A 3ZT4A 3S3MA 3VQPA 5HRSA 2ABDA 3AVMA 4B9VA 1BISA 5D3GA 3NE6A 3QEIA 1RDCA 2EMSA 2G8VA 3J7YP 2J4RA 4YOVA 3DXKB 1DGKN 3JAMO 4CJUA 2HNYA 1X9MA 3CJ9A 3P4IA 3Q7CA 1D9FA 3LDPA 1LAWA 3HOTA 5FRMA 3K59A 3I8BA 3VMFB 3DRRA 3SV3A 3FLCO 5C10A 3PZDA 3CG7A 3C95A 3NCIA 2QEXN 1NK8A 4QS9A 3VQ6A 1BOTO 4BR4A 3TAQA 1BIZA 3VENA 4YNQA 4OX9K 4FJGA 3L3UA 3F9KA 1ZYQA 2G8FA 4U7BA 3P83D 3QFPA 4MQ3A 1N8RO 3VEZA 4CZGA 1WNSA 4NYNA 3AVKA 3FZLA 2ETJA 4FSVA 4FWLA 3A5OC 4Z4HA 4JKHA 3AVGA 2IC3A 3L6QA 3DXMA 1VQ6N 5C2DA 2O8EA 3G4SN 3P39A 4RCHA 1VBHA 3H08A 1LAVA 1BCMA 2F96A 1RBTA 4JHDA 4YOYA 3C6AA 3VN5A 5E41A 1TYQA 4DLGA 4B9TA 1DTTA 4FOIA 1VQKN 3X23A 1WSFA 3UKUA 2IS3A 4E0DA 3UKRA 3AVIA 1BGXT 2KW4A 2YJFA 5SZTA 4CEFA 2VCPA 4DTNA 3WXMB 4GV6A 2HVIA 4E19A 3PLAA 4CEEA 2OPSA 1SKRA 1BWFO 4W5OA 3E1YA 3HT3A 4IFEA 2ZJQL 3LDNA 3IRXA 3S9HA 1S1WA 4EAHD 2WFBA 2RHKA 3MXMA 1SQKA 4DTXA 4DV0K 4WQ4C 1ASVA 1Y64A 4CEQA 4DV7K 4CZMA 1GGOA 3EKUA 3NGIA 1NK9A 1IBMK 2XY6A 3SPZA 1D5AA 1S9EA 3K5OA 1VSFA 1KC7A 3M8SA 1NGJA 4OLBA 4IJAA 2Z1HA 1ATNA 1ACAA 4F2SA 4BRLA 2YKMA 1K8KB 3I33A 3OS1A 4E7KA 4IKFA 1JXEA 3V4IA 1XUPO 4BRPA 3MX2A 5HLFA 3WEEA 3SBGA 4BR9A 1BUPA 4CF0A 4KKOA 2E88A 4CZHA 1C0MA 4B3TK 2R7YA 2QKKA 2XRIA 5F0XA 3M8PA 4DQPA 1G15A 1E3MA 3HI0A 5EVZA 3QINA 1HB8A 4CJ3A 4ZHRA 1BL3A 1HKCA 3ZX3A 4ILHA 3VEXA 2XHBA 3O80A 2FF3B 4DWIA 2WUSA 2J0JA 4MLEA 1BHLA 3TWHA 1WBDA 2P5OA 4K41A 3ZCMA 1JL1A 4DTRA 2HHSA 3OYJA 5C42A 4JKBA 4KHSA 3WNGA 4JD2B 4DTPA 4W5RA 1YHQN 3ENBA 1C1BA 2W40A 2XO7A 5E26A 1NGCA 4I6MA 2E2NA 3ZETB 1EXQA 1S1XA 1JJ2M 2D0BA 3O9UA 2UXDK 5J2NA 2GUIA 4C8LA 2F9WA 1U2VA 1Y97A 3G6EN 3KK2A 4BDZA 2YVCA 5AQYA 3THYB 3E01A 2ZWHA 4YOXA 2HMPA 2O8EB 2Q0UA 3OJUA 1OVYA 4O44A 4I6MB 3QIPA 5C24A 2Q2RA 3CPWM 2V7YA 4HUGA 1XC3A 3SNNA 4HUEA 2OZMA 4ZTJA 2O8FA 1J19A 1K73O 2P9LB 4Z4IA 5BPLA 3OYFA 2HSTA 2KKZA 3KWIA 4NLCA 4A5AA 4BRDA 1VSMA 4CZKA 4HHTA 4JI5K 4B1XB 4FLXA 4GV3A 1RILA 4BGAA 1NGFA 3SQ0A 2YCHA 4FJNA 4CD1A 3V9XA 2F7TA 3NMUA 1RCHA 2ATQA 3FZKA 3KK7A 3MN7A 3KIOA 4BRQA 2NRVA 4CBUA 1NKCA 1EX4A 3CQYA 4FLVA 4O5FA 2P9UA 1B92A 3W0LA 1MU2A 1E5WA 5HROA 3SUNA 4LH4A 4XEIA 3OYAA 1KLNA 4FWNA 1UA1A 2KZMA 1W2BM 3QB0A 4DXAB 2F8SA 3HXMA 1RT2A 2WOMA 1P90A 4FVUA 1JLEA 5J2MA 1GLAG 4DSFA 1IJJA 2HMIA 4GW6A 4KV8A 3VGMA 4BE0A 4FW1A 3AVJA 5C25A 4K43A 3FGUA 1NGAA 1Y19B 4IOAL 3HP6A 1IO2A 2EHGA 3DXKA 3AO4A 3CCQN 3C7NA 3G0ZA 2HBKA 3UKRB 2Z1IA 3MEGA 3VGLA 4E1NA 4DU3A 4FCYA 3V9SA 3LZIA 2G8UA 2HHTA 4J2AA 5JICA 2VG6A 5GIPA 3LAMA 3A0IX 4I7FA 4CIEA 3WXJA 5HP1A 2FSKA 5HRNA 3ZDTA 1JXBA 3TSPA 1HRHA 1RBSA 1JDEA 4HCBA 1OH8A 1VQMN 4CHOA 4BE1A 4DR3K 3LAKA 3O4NA 3KLEA 1SL0A 4WE1A 3BZCA 4FM1A 1HJOA 3PY8A 5LJVA 4FJ8A 4QOZB 3A2FA 2UUBK 4DF4A 2D0CA 3AGRA 3PVLA 4W5TA 4X64K 4ELTA 3WNEA 1T6DA 3KTQA 1QHAA 4PWDA 2YHBA 2VGNA 1KCFA 1Z05A 3HZ6A 1TK8A 4GXBA 4CGJA 5J1EA 4IOCL 3SZ2A 1FJGK 1HQEA 4CEBA 4E1JA 2O8CB 1HYZA 2P1JA 4X62K 3KVGA 4H0PA 2UYTA 2OPPA 4BRCA 1OKJA 1UAXA 4EHTA 4P7IA 3ZT1A 2B4JA 1LW0A 2A40A 4CIFA 1QZ6A 3NF6A 5BN8A 4CK3A 1BG3A 2HF3A 4AHVA 1V4SA 4J8FA 2GWKA 2QWRA 3NDKA 1NJXA 5AQHA 3QEWA 3BZKA 5LMNK 1J6ZA 3O5BA 2WH5A 3HL8A 3NAEA 2O4GA 4IG3A 4KO0A 4JI7K 1X9JA 5FPDA 4KHNA 1HR0K 3B6OA 4F4KA 3R8EA 4DQSA 3KKSA 3CF5L 4NO7A 4H5RA 2QI2A 3VA0A 3ISNC 1N33K 2OA8A 2B5JA 3IVFA 4CHQA 2I7PA 5M1OA 3C65A 4HTUA 3OA9A 4ZTFA 2YX6A 3VEYA 1JCFA 4B1WB 3ZSRA 3ZT3A 1SL2A 2DIKA 4E1MA 4A61A 3TARA 1HB6A 4X65K 1D4XA 4OPHA 3T69A 1SZ2A 3E9OA 2HBLA 3DOKA 1HPMA 1N32K 3T1HK 4Z4GA 4PHTX 3D6RA 3LPUA 4CK2A 3MDQA 4BWJA 2OTLN 3DMJA 3OHRA 1NTIA 4M42A 5M1NA 3KLGA 4AHUA 5C15A 4OLAA 2YV0X 3OYKA 1QQOA 3HBTA 2IGIA 3SMPA 4JS5A 2HW3A 3CMAN 4N47A 1RT1A 1VQ5N 2NUBA 1ZBIA 3IG1A 3CCMN 3HM8A 1VQ7N 4N41A 1H4RA 4X66K 1EWRA 4DS4A 5AQJA 4K0KK 5TKYA 3LP0A 1B9DA 4JLHA 3V81A 3VEOA 2H3GX 1BI4B 1WSGA 4AHTA 4A2AA 4OGCA 4M7XA 3V1OA 4Z4CA 3PX6A 3MN9A 1NK4A 1YUWA 4JS4A 4QCLA 1MK7B 4DV3K 2IVNA 4WQ5A 4H0VB 4BE2A 1Q81O 3O3FA 4DTUA 3I0SA 3AGKA 1WLJA 3PSFA 4JHDB 5HL7L 4BVOA 3E9LA 3THXA 4H5NA 4CGFA 3CI5A 4OVLA 4CBXA 1VQON 2OYQA 3NGZA 1SUQA 1N36K 3TU5A 3M8RA 1TK0A 1C0UA 3TPQA 5IT9O 3A8YA 2KTQA 3A5LC 4EHUA 3OBWA 3EPYA 1NG9A 4JNEA 4K8XA 1HYSA 3ZSQA 3N4QA 1BA1A 5GADP 4LF6K 3RMBA 3HSTB 3K2PA 3RWUA 3P1GA 1RDUA 1WN7A 1CXQA 1TKZA 4RW7A 3ZETA 1ESVA 4JK8A 2E20A 4DB3A 1U47A 4B3OA 2QK9A 3Q7BA 2J0KA 4E7JA 3AV9A 4Y1DA 3R9PA 1U48A 4MO5A 3CXCM 5MLCQ 4EFHA 2P9KB 3KLIA 4JAXA 3E9PA 4EZ9A 2QW9A 1S72N 3NVKA 1ST7A 4O5BA 3VF6A 1CXUA 3J7AP 2FBYA 2Q31A 2YHWA 2VGMA 4KHUA 3CCJN 4KRFA 4U67L 3CC4N 3TSQA 1HJRA 1XNRK 2P9SB 1T3VA 4EP5A 2O8BA 1OH6A 4CK1A 1VQNN 4CZFA 3PO5A 1QQMA 2ASOA 4WQ5C 2XY8A 3VQ8A 5KQDA 3OJSA 4JV5K 4CGIA 2D10A 2X0SA 1NJYA 4FZYA 4DSLA 1C6VA 1XWLA 4KPYA 4B3RK 4UQGA 5JMVA 1BU6O 4DFMA 2PY5A 4IEIA 1TUUA 4FWOA 2A3ZA 3NBPA 1KXPA 3HPGA 5GINA 3VQCA 3SI6A 1J54A 3WT0A 4Z4FA 4FXDA 1LOTB 3G10A 1Q7YO 4NB4A 4DUYK 1XHZA 3MCPA 3ALYA 3E66A 3VESA 5KTQA 2O8DA 2YHXA 3LP2A 1NGBA 2GX9A 1HBKA 3U3GA 3EZ5A 1S6QA 3M3ZA 1N5YA 5KPRA 5DMRA 3I56N 5AQOA 5BR8K 3RSEB 4G9ZA 3AA4A 5CR4A 4Z94A 3QERA 1IBLK 3VQDA 1Q86O 3BF3A 3AVNA 2G8WA 3IS9A 4M7YA 3AVHA 3VGKA 3PUFA 4CHZA 3U8ZA 1GLLO 3G25A 1EKEA 4HCCA 3SQ2A 3THXB 4FPBA 4BRAA 4O8UA 3LWMA 3IUCA 4K25A 1XQSC 1LCUA 2VWJA 3TAFA 3HO1A 3O1WA 4KBOA 1Q18A 4NXNK 2GWJA 2I5JA 4CJKA 3VERA 2WBNA 3H3OB 4EKUA 5AR0A 1O13A 4DTOA 5KPZA 5FPNA 1RTDA 2NRTA 1C1CA 4NCBA 4EP4A 1S22A 2HNZA 4CFBA 4GVEA 5KRSA 1BDGA 3BGRA 2CGJA 3CCEN 3CCVN 1IG9A 1RDBA 4DSJA 2HB5A 2ZGYA 4FOEA 5M1PA 4A62A 3U8XA 3RVCA 4EZ6A 4XH1A 3OVNA 1NVLA 1ZC6A 5LMUK 4KB1A 1ATSA 4FM2A 3K5NA 4IFVA 1L5UA 1HPZA 3MN6A 2I1JA 1MA9B 2P9LA 5FROA 3NGYA 3AVCA 3ENOA 3HOSA 2EWSA 1J5OA 1SAZA 3PSIA 3CJCA 1NJZA 2E5LK 3V1RA 5AQVA 2I1KA 1A5WA 3SCXA 1O1WA 4B3MK 1Q8IA 1RTHA 5CHIA 3QESA 3VA3A 4PA1A 3WXLA 2D4WA 3C7NB 3RMAA 3KD1E 2FXUA 4YDUC 3QBXA 2V7ZA 4LF4K 2FSJA 1YXQA 4NXMK 1TGOA 4UY8O 2PBDA 1BCOA 3AA5X 3PX4A 1VSKA 4CZEA 4Q5VA 1LW2A 3ID8A 3EE9A 4YY3K 4JYAK 2JGUA 3CCUN 4FJXA 3CHWA 1MWKA 2AEHA 4M3ZA 5BN9A 3CJ7A 4GVMA 1HQUA 2HHXA 3WA0A 3LM9A 4H0OA 2ZQBA 2RPIA 2W41A 1KTQA 1U6ZA 1JLCA 4G1QA 2EX3A 1FKOA 4FWMA 3CFPA 2WONA 5CZ2A 3BEXA 3C6TA 5I42A 3U9DA 5JS2A 4CFAA 2O8DB 1TAUA 4BVPA 4YORA 4KH6A 3OYDA 3GE1A 1NBWA 4HUFA 4IO8A 4JI6K 4DR1K 4HWIA 1DLOA 3NVMA 3D7EO 1A5XA 1HMVA 1BI4A 4DQRA 2A6AA 1I39A 2X6NA 3TAMA 3C94A 2GTDA 4R5PA 2HHWA 2YNIA 2D2QA 4DFJA 3U9ZA 1J9AA 4H0TB 4CF1A 4B8AB 3K57A 1T05A 3H1VX 1YJ9N 1U49A 5FRNA 3SJHA 5BRDA 2CH6A 4MO4A 3QICA 2YNGA 4A5BA 1KVBA 5KGXA 2GV9A 4QAGA 2Q97A 1ZBUA 5KQ8A 3O3HA 3AAQA 3O1BA 4QS8A 4WFAL 3A5MC 4CF8A 1MK9B 3QETA 2W42A 4E3SA 3VQ5A 2PYJA 3SK3A 4M3TA 1EWQA 4CJSA 3EN9A 2X78A 1VSDA 4DR5K 3T1YK 2IIRA 2P9IA 3SPYA 4GMJB 4FPAA 3CC7N 3L2WA 2D1KA 4CCHA 1OH7A 1DT9A 4F3OA 1WSHA 4ISGA 1C0TA 2QWNA 3EEQA 5LY3A 5AJ3K 1KAYA 3CC2N 3VQ4A 1E4FT 1UOCA 3CMEN 1NOZA 2VWBA 3T1AA 3TANA 1T7PA 1KSPA 1BQNA 3DLEA 4FZZA 2DFFA 1KFSA 4AQYK 3QIJA 1NGGA 4ICLA 4FK0A 3SJJA 2Y1JA 2NRRA 5SWMA 4JRPA 5T7BA 4DTSA 4CGDA 5F1XA 3OYMA 5AQSA 3OYHA 1T03A 4BRFA 4BWMA 4FJ7A 4XH5A 2HHQA 2QWLA 4BC5A 5I9EB 2AL6A 5EY4A 3RSEA 3PX0A 5BPNA 4KTWA 4CZLA 2ITMA 2VQFK 3M1FA 2Y1IA 4C8NA 1DIKA 2OANA 2J0MA 2YI1A 2I7NA 4RTFD 4CJPA 3RMDA 4LD0A 4IEEA 1RT3A 2O8FB 3GDQA 5ELZA 4GV9A 1HX1A 4B08A 3RMCA 1KD1O 4YFUA 3AA2A 1ISNA 1ILYA 1A5VA 3OW2M 3NF9A 5IWAK 2HOEA 4DQQA 5KRTA 1GC6A 3SQ4A 4C8KA 3DJCA 1QTMA 2E6MA 4WYBA 2F8TA 1M90O 4ZRIA 4CERA 4B3SK 3KKRA 1QVFM 2FBXA 3HSCA 4NCAA 3F5TA 2X6SA 3THVA 4FJJA 3S41A 1RNHA 4DSKA 3LDSA
chains in the Genus database with same CATH topology
1NTIA 3FZMA 3ID6A 1QZ5A 5M1NA 5C15A 1NI2A 4H5WA 1QQOA 3HBTA 1HUXA 2E1YA 1W97L 3LDQA 4BRNA 2RQ1A 3B8AX 3EO3A 2GUPA 3SMPA 4A59A 4AM6A 3CMAN 3BP8A 3CJBA 1VQ5N 2KLAA 5AQLA 2YJEA 2LBBA 3G71N 3D2FA 4EIAA 1K8AO 2NZTA 1YIJN 3C6HA 3CCMN 3HM8A 3ZX2A 3QFUA 4BREA 5JVGL 3CETA 1VQ7N 1H4RA 2JWLA 5AQIA 3CCLN 5AQJA 2ZJPL 1JCEA 5C0YA 5TKYA 2CGLA 1S3XA 3W3DA 2ABDA 5JMVA 3M5RA 3VEOA 2H3GX 3NMUA 4DKWA 4A2AA 5EX5A 2EMSA 4JKCA 3CERA 4M7XA 2J4RA 3CQXA 3MN9A 1YUWA 4YOVA 3DXKB 1DGKN 1MK7B 4PKGA 2IVNA 4WQ5A 5E84A 1WUAA 3GL1A 4H0VB 1Q81O 3CJ9A 4BR0A 3P4IA 2AP1A 3TTCA 3Q7CA 3AGKA 4B1ZA 4JHDB 3WUHA 3LDPA 5HL7L 3HOTA 4BVOA 1SGHA 3E9LA 4H5NA 4IO9L 2QWPA 1Q82O 4MDBA 3CI5A 5AQXA 4YDUA 3ULEB 4CBXA 1VQON 3I8BA 3MCAB 3MWTA 4FWRA 3VETA 3VMFB 3ZX0A 3FLCO 3H6EA 3AU4A 1Z6RA 5C10A 1VAZA 4JKGA 4IJNA 3PZDA 3TU5A 3TPQA 2QEXN 5CE3A 3SMSA 5ADXA 4QS9A 5AZJA 5C12A 5AQGA 3A8YA 5BRHA 1T44A 3A5LC 1BOTO 1GLJO 3OBWA 5AQMA 1X3MA 4BR4A 4EHUA 2A41A 3EPYA 4FWQA 3GG4A 3F9MA 1GG3A 5DM7L 1VBGA 4JNEA 2E2QA 3VENA 4DQ8A 3N4QA 1BA1A 3DWLA 3LDLA 5GADP 2FJ9A 5H1SQ 1RDUA 2P9IB 3ZETA 1ESVA 4JK8A 3CCRN 2E20A 4DB3A 1HKGA 3O6WA 3U4LA 3CCSN 2ZF5O 4U7BA 3Q7BA 4BRMA 2J0KA 3QFPA 4CI6A 2FF6A 3R9PA 3VEZA 4CZGA 1N8RO 3VEVA 4MO5A 3CXCM 4IWVA 5MLCQ 4EFHA 2P9KB 4ISEA 3LL3A 4JAXA 3E9PA 1BA0A 2QWQA 2QW9A 3FZLA 1JCGA 4FSVA 1ST7A 4FWLA 3A5OC 1EF1A 3J7ZO 3PIPL 1S72N 3NVKA 4JKHA 2P9KA 1HLUA 3VF6A 4DCHA 1VQ6N 3L6QA 3DXMA 4PKHA 4GY2B 5C2DA 3IDHA 2Q31A 2YHWA 3G4SN 5BRFA 4IZ9A 1NJIO 3P39A 2VGMA 4RCHA 1VBHA 1C0GA 3CCJN 2OTJN 5EOYA 4U67L 3CC4N 3TSQA 4CD3A 4JHDA 2P9SB 1TUYA 3ATVA 3C6AA 3D2EA 1T3VA 5AFUH 3F2KA 4BR5A 1TYQA 4BG9A 3MK6A 2HBMA 4BRKA 4FOIA 1VQKN 3X23A 3J8AA 3UKUA 4JKFA 3WXKA 3UKRA 1VQNN 4CZFA 3ZEUB 1NGEA 2Q36A 3L0QA 5AQPA 2YJFA 1QQMA 2ASOA 4WQ5C 4K42A 2VCPA 4AM7A 3WXMB 5KQDA 4GV6A 3PLAA 2P9PB 2D10A 2NLXA 2NNWA 2X0SA 1BWFO 4C23A 4B1YB 3VF4A 5HOOA 1HKBA 4JKEA 3E1YA 4IFEA 2ZJQL 5AQRA 3LDNA 4B9QA 3M6GA 1BU6O 3O9QA 2NRHA 1KBLA 2WFBA 1TUUA 4IEIA 3KWGA 2RHKA 3JXUA 4FWOA 3VTHA 1T6CA 2A3ZA 1KXPA 4BQZA 1SQKA 4WQ4C 5GINA 3WT0A 3AAPA 1Y64A 1LOTB 3MN5A 5GAHP 4CZMA 1GGOA 3EKUA 5ADXH 1Q7YO 3FLVA 4NB4A 3MCPA 5FPMA 4AF1A 4BG8A 5AQFA 2A5XA 4YOUA 1KC8O 5JVLA 3E66A 3VESA 3SLCA 1K9MO 4HDQA 1KC7A 2YHXA 2JWKA 1NGJA 1GLEG 1NGBA 3A5NC 2GX9A 4IJAA 1HBKA 4C1NI 5AQQA 3OBYA 1ATNA 1H1VA 3DXMB 4FWPA 3N4PA 1ACAA 3M3ZA 4H5VA 5KPRA 3WQUA 3I56N 4BRLA 5JLHA 5AQOA 1K8KB 3I33A 3ULEA 3MWPA 3RSEB 5JLFA 4G9ZA 5CR4A 3G9WA 1KAZA 4Z94A 4TKNA 1VQ9N 4IDHA 5LJWA 1XUPO 3O8MA 4BRPA 2COPA 1Q86O 3BF3A 3MX2A 1E4GT 3WEEA 3SBGA 2QM1A 4BR9A 4M7YA 1BUPA 3VEWA 2QTDA 3VGKA 3MMVA 2NRXA 3U8ZA 1GLLO 2E88A 3G25A 3ZEUA 4CZHA 4FPBA 1DEJA 4BRAA 4O8UA 4M63C 3IUCA 5GAGP 4K25A 1XQSC 1LCUA 5F0XA 2P9PA 2PFUA 3O1WA 4KBOA 1ZXOA 3HI0A 1Q18A 1TYQB 5EVZA 2GWJA 4PL7A 1HB8A 1V4TA 2KHOA 1ATRA 3VERA 2WBNA 3H3OB 4EKUA 1HKCA 4JKDA 4ILHA 1O13A 3QMLA 5AR0A 3VEXA 3ZX3A 5B8HA 3O80A 5KPZA 1QQNA 2FF3B 5FPNA 3HRGA 2AA4A 2NRTA 5AZIA 4JK7A 2E2PA 2WUSA 2J0JA 4BC3A 5GAEP 1S22A 4MLEA 3DAWA 1MIZB 3P31A 4K41A 4GVEA 1BDGA 5AZJB 2CGJA 3CCEN 3CCVN 3O9RA 2CGKA 1YJWN 2ZGYA 4JKBA 4FOEA 5M1PA 3TTFA 4A62A 4LC9B 4JD2B 3RVCA 3U8XA 1YHQN 3FE1A 4XH1A 3ENBA 4BY9C 1NVLA 1YITN 1ZC6A 2W40A 1YAGA 3FR0A 5E26A 1ATSA 4BROA 1NGCA 4I6MA 2E2NA 1IG8A 2P9UB 3MN6A 3ZETB 2I1JA 1MA9B 2V52B 3QBWA 4A57A 1JJ2M 4WQ4A 4PL8A 2P9LA 3O9UA 3VF2A 3L4IA 3ENOA 3HOSA 2F9WA 1U2VA 2EWSA 1R59O 1SAZA 3UB5A 3JS6A 3G6EN 3CJCA 1NWKA 2VYPA 3CPEA 1U2VB 2YVCA 5AQYA 5IJMA 5AQVA 4FWSA 3SAFA 5BR9A 2I1KA 2ZWHA 4YOXA 5AQTA 3BUZB 2ZJRL 5CHIA 3K9JA 4BR2A 3K9KA 2HMPA 3WXLA 2D4WA 3C7NB 2Q0UA 1OVYA 2FXUA 3CJ1A 1NMDA 2V7ZA 3QBXA 4YDUC 3DLLL 3VOVA 2FSJA 3P38A 1YXQA 3ATUA 3FZFA 4I6MB 1KQSM 5TKWA 4UY8O 2Q2RA 2PBDA 2CH5A 4HDOA 2V7YA 3CPWM 1G99A 1XC3A 2P9NB 1GLFO 5C2FA 4KH4A 4CZEA 3H45C 3UKUB 1NLVA 3ID8A 1J19A 3FFKB 3EE9A 1K73O 3WQTA 2P9LB 5BPLA 3CCUN 2HSTA 2KKZA 3CHWA 3KWIA 4NLCA 1NGIA 4A5AA 4BRDA 1MWKA 2AEHA 4CZKA 4WFNL 5BN9A 3CJ7A 4B1XB 4R79A 4GV3A 4BGAA 1NGFA 1EO1A 2GEMA 2YCHA 4F7GA 4CD1A 2R82A 3WA0A 2F7TA 3KZBA 3LM9A 4H0OA 3KK7A 3FZKA 4BC4A 2W41A 3MN7A 1U6ZA 2BTFA 4FWKA 3LM2A 4BRQA 3L4QA 2NRVA 4CBUA 5M1KA 3GBTA 3GOIA 3HTVA 1M1KO 2ZPYA 4ZRKA 3CQYA 4FWMA 4O5FA 3SAHA 4ISFA 2P9UA 3W0LA 4GNIA 4BRHA 3KHYA 4MDAA 3O9TA 1P8ZA 1RDWX 2HBJA 3BEXA 1E5WA 2BUPA 4H0XB 3TTDA 3U9DA 4BC2A 3UE5A 4BVPA 4YORA 4NLBA 4XEIA 4YOTA 4KH6A 1DKGD 4NY0A 3IMXA 4FWNA 3EKSA 1W2BM 5AQWA 3GE1A 3QB0A 1NBWA 4DXAB 4IO8A 2EMTA 3I55N 3H1QA 1P90A 1GLCG 4HWIA 4CZJA 4FVUA 2D11A 1VQ4N 1GLAG 3NVMA 2D0PA 1IJJA 3D7EO 3VGMA 4XH4A 2FSNA 1GC7A 4K43A 3FGUA 1NGAA 5BREA 1Y19B 2A6AA 2P9NA 4MLHA 3T7ZA 2GTDA 4IOAL 1NGDA 2D2QA 2HRJA 3DXKA 3CCQN 3U9ZA 3C7NA 4H0TB 4C1NK 4BGBA 2HBKA 2IVPA 3UKRB 1MIXA 2FLOA 4BRGA 4JN4A 3VGLA 4CYEA 3D2FB 3FZHA 5AQUA 1ZBSA 4PKIA 3H1VX 1YJ9N 1VQ8N 5KPTA 5JICA 4L3QA 3O4WA 5GIPA 3A0IX 3SJHA 5FPEA 1NGHA 5BRDA 2CH6A 3WXJA 2FSKA 2Q1NA 4OPAA 4MO4A 3QICA 1GLBG 3ZDTA 2ASMA 1RFQA 3VTIA 4B1UB 3TSPA 3EL2A 4YOYA 4JKGB 4A5BA 3LDOA 2CB8A 3CJAA 5AQZA 2QWMA 4WCEL 3BF1A 1JDEA 1YJNN 2Q97A 1VQMN 3R1XA 5KQ8A 3AARA 3AAQA 4Y0WA 5AQKA 2QA4N 2HE7A 4HTLA 2V51B 1HJOA 1X3NA 3O1BA 1EQYA 1RGIA 3A5MC 4QS8A 4A2BA 4IOXA 4CBWA 5LJVA 4JD2A 4WFAL 1MK9B 3CD6N 2RE2A 3SK3A 3AGRA 3R3LA 3PVLA 3EN9A 2YHYA 4ILJA 2IIRA 4QS7A 1T6DA 3AY9A 1QHAA 2P9IA 2E2OA 4FPAA 3CC7N 2DPNA 2D1KA 2BH1A 2VGNA 3MX5A 3QDKA 5AFUA 1Z05A 4WF9L 3HZ6A 4IXCA 2ASPA 4BRIA 1DT9A 2Q0RA 5AZIB 4BR7A 1YF5L 4GXBA 4IOCL 5M1FA 2NRZA 1CZAN 4E1JA 4ISGA 2E1ZA 3KVGA 2QWNA 3EE8A 5LY3A 2QWOA 4H0PA 2UYTA 1KAYA 3H3NO 3CC2N 2F9TA 4BRCA 1OKJA 1E4FT 3O9SA 4H5TA 4P7IA 4EHTA 3CMEN 2VWBA 4CJ7A 2HF4A 3PIOL 2ZGZA 1QVGM 3H46O 4FL9A 2A40A 3QIJA 2FDQA 1NGGA 2D0OA 5M1QA 3BINA 1MWMA 4JKAA 3ZYYX 2P9SA 2CQUA 1QZ6A 2NRRA 3SAGA 5JVHL 5BN8A 5BPMA 5DM6L 4ZRJA 3CIPA 5AQNA 1BG3A 2HF3A 5F1XA 5AQSA 3WXIA 4KH5A 4DHYA 1V4SA 4J8FA 2GWKA 2QWRA 5EXWA 3O08A 3SBTA 5AQHA 4B1VA 1YI2N 1GLDG 1WOQA 4BRFA 1VQLN 2GELA 3IKMA 4XH5A 2QWLA 4JEPA 4BC5A 5I9EB 1J6ZA 4YOWA 2AL6A 2WH5A 3O5BA 4H03B 5EY4A 4EAHD 4CZIA 1X9JA 5FPDA 3RSEA 5BPNA 4O8KA 3R8EA 4CZLA 3IFRA 1K8KA 2ITMA 3CF5L 2NRWA 3D2EB 3M1FA 3R6MA 4WFBL 1DIKA 4NO7A 4H5RA 1NM1A 2OANA 2J0MA 1BO5O 2QI2A 1C0FA 2YI1A 3ENHA 3AU5A 3VPZA 1MDUB 2PAVA 3WEEB 3IVFA 2I7NA 4RTFD 2I7PA 5M1OA 4ILGB 3C65A 4IEEA 3OA9A 3GDQA 5ELZA 4GV9A 1YVNA 1HX1A 3EZWA 4RWTA 1KD1O 1SS6A 2YX6A 3VEYA 1JCFA 2A42A 4B1WB 4BQLA 4OO1J 1ISNA 1ILYA 2DIKA 3OW2M 2QXLA 2IVOA 2HOEA 3FP5A 4H0YB 3C0BA 5GIOA 1GC6A 4A61A 1HB6A 3U7DA 1VQPN 1D4XA 3DJCA 2WC9A 4WYBA 3TSUA 4OPHA 3T69A 4ZRIA 1SZ2A 1M90O 3E9OA 2HBLA 4F9OA 1HPMA 5F2RA 4YL8A 1QVFM 4FO0A 4JK9A 3HSCA 3F5TA 1KAXA 3S41A 3D6RA 4PHTX 3MDQA 2E8AA 2OTLN 3OHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK7 A;  4JKC A;  4JKF A;  3SBT A;  3SBG A;  3E9P A;  3E66 A;  4JKH A;  4JKB A;  4JKE A;  3ENB A;  4ILJ A;  3E9L A;  3E9O A;  4JKA A;  4JK9 A;  4JKD A;  4ILH A;  4JK8 A;  4JKG A;  4JKG B;  4ILG B; 
#chains in the Genus database with same CATH topology
 3FZM A;  2G8I A;  1GOC A;  1LWE A;  4HVJ A;  4H5W A;  2RQ1 A;  2GUP A;  4M45 A;  3CJB A;  5AQL A;  2YJE A;  3G71 N;  4B8C A;  2NZT A;  2B6A A;  1SV5 A;  2IOC A;  1QQC A;  4OGE A;  2JWL A;  1J5E K;  3NH0 A;  2ZJP L;  4C8O A;  3W3D A;  1GOB A;  1CZ9 A;  3M5R A;  4KHP K;  4DKW A;  1B9F A;  5HRP A;  5EX5 A;  4JKC A;  1RT6 A;  3CER A;  3CQX A;  1JLF A;  4PKG A;  3LP3 A;  3GL1 A;  5KI6 A;  3OYI A;  3LPT A;  4DSI A;  4N5S A;  4B1Z A;  4E7I A;  4B9L A;  3WUH A;  2QWP A;  3HVT A;  4M3X A;  4YDU A;  3ULE B;  3MWT A;  4FWR A;  3VET A;  3H6E A;  3O4Q A;  3AU4 A;  1Z6R A;  3LAN A;  1VAZ A;  4JKG A;  4IJN A;  4DU4 A;  3HJF A;  4NCG A;  5CE3 A;  5ADX A;  3MEC A;  4DSE A;  5AQG A;  4JI0 K;  5BRH A;  2DTU A;  2A41 A;  3GG4 A;  3F9M A;  4JRQ A;  2DY4 A;  1JKH A;  4DQ8 A;  3L2R A;  1YTU A;  2FJ9 A;  1L3T A;  3CCR N;  1QSL A;  3U4L A;  2ZF5 O;  1QSY A;  4M3R A;  3AVB A;  1BIU A;  4CI6 A;  3AVF A;  4ID5 A;  4LSN A;  1KLM A;  4IWV A;  4ISE A;  3LL3 A;  1JCG A;  5FLX O;  2HHV A;  1HLU A;  2P9K A;  4GY2 B;  1BQM A;  4IZ9 A;  3PV8 A;  4I2Q A;  2RN2 A;  1C0G A;  1KVC A;  2OTJ N;  5EOY A;  3ATV A;  1TUY A;  5AFU H;  3RR7 A;  3F2K A;  1FXX A;  3ZLJ A;  4M3W A;  2HBM A;  4BDY A;  3ZSW A;  4DS5 A;  1LWC A;  3J8A A;  3WXK A;  3AVA A;  4DV5 K;  3L0Q A;  4FLT A;  4IFY A;  1VRU A;  2NNW A;  4C23 A;  4CJ4 A;  4Y1C A;  3RRH A;  1YT3 A;  1OVQ A;  3M6G A;  1U45 A;  1KBL A;  1WBB A;  3JXU A;  3VTH A;  1RBU A;  1WAJ A;  3AAP A;  2QXF A;  5GAH P;  1UA0 A;  5ADX H;  3FLV A;  3KLH A;  2HVH A;  4AF1 A;  2A5X A;  4XIU A;  3SLC A;  1K9M O;  2OCE A;  4C1N I;  5HBM A;  3SV4 A;  1HNI A;  1RTJ A;  3DYA A;  5AQQ A;  1N6Q A;  1H1V A;  3DXM B;  4H5V A;  4F2R A;  3WQU A;  5JLH A;  2OPQ A;  4FJH A;  3MWP A;  5JLF A;  4IDH A;  1ZBF A;  2YHA A;  4GKJ K;  3DRP A;  3O3G A;  3THY A;  2HHU A;  2QTD A;  1IBK K;  2NRX A;  3ZEU A;  1WSJ A;  1VRT A;  4M63 C;  4YHH K;  2P9P A;  2PFU A;  3IAY A;  4FJI A;  2UXB K;  4PL7 A;  1V4T A;  1VSI A;  3L2U A;  4ELV A;  1ATR A;  4IBN A;  3QML A;  5B8H A;  2UXC K;  1KFD A;  3J80 O;  4OKE A;  1LWF A;  4FLW A;  2E2P A;  4BC3 A;  5GAE P;  4DTJ A;  4LFC K;  3P31 A;  1IKX A;  4FVM A;  3O9R A;  4KFB A;  3TTF A;  5CZ1 A;  4F3T A;  4LC9 B;  1YAG A;  3FR0 A;  5CYM A;  2QKB A;  1S5J A;  2P9U B;  3KLF A;  2AJQ A;  1TAQ A;  4E7L A;  2V52 B;  3QBW A;  1JL2 A;  3TI0 A;  3OYE A;  2D0A A;  3K58 A;  1IH7 A;  4I2P A;  3VF2 A;  4PY5 A;  3TAB A;  4KAZ A;  3UB5 A;  4KHY A;  2RKI A;  2P5G A;  1NWK A;  2VYP A;  1U2V B;  5IJM A;  4FWS A;  3SAF A;  1JLA A;  5BR9 A;  4DV1 K;  5J2Q A;  1DTQ A;  3K9J A;  4AH9 A;  3T19 A;  1L3S A;  1L3V A;  1NK5 A;  1NMD A;  3VQB A;  3DLL L;  4DU1 A;  3CM5 A;  3F73 A;  3P38 A;  3FZF A;  1SKS A;  2CH5 A;  4HDO A;  4M3U A;  1NLV A;  1NK7 A;  3FFK B;  3NFA A;  3VQ7 A;  1HYV A;  3QEX A;  1NGI A;  3MAQ A;  1U4B A;  2BE2 A;  4F7G A;  1TK5 A;  3KZB A;  1CLQ A;  3PO4 A;  4J2E A;  1I94 K;  2BTF A;  3LM2 A;  4DV2 K;  3HP9 A;  3L4Q A;  4CE9 A;  4IDK A;  1M1K O;  2ZPY A;  4ZRK A;  5FDL A;  3QEP A;  3KHY A;  4MDA A;  4KB0 A;  4LFA K;  4H0X B;  4PQU A;  3TTD A;  4BC2 A;  1XNQ K;  2Q3S A;  4O0J A;  4AHS A;  3S3O A;  4NY0 A;  1JLB A;  3IMX A;  3EKS A;  1IV0 A;  2EMT A;  4M41 A;  3DOL A;  3H1Q A;  4OKK A;  3JSM A;  2D11 A;  4M3Y A;  4FW2 A;  2FSN A;  4DFP A;  1GC7 A;  4I9L A;  5BRE A;  2KZZ A;  3M8Q A;  2P9N A;  4MLH A;  1QSS A;  2HRJ A;  1S6P A;  1D9D A;  4C1N K;  3WNH A;  4BGB A;  2IVP A;  1MIX A;  4JN4 A;  2FC0 A;  3FZH A;  1ZBS A;  3U3Y A;  1NK0 A;  2BDP A;  2D5R A;  4CF9 A;  2Z1J A;  5FPE A;  4W5N A;  3SQ1 A;  3HPH A;  4CJ5 A;  1WB9 A;  4OPA A;  4IO9 L;  1QE1 A;  3VTI A;  2ASM A;  1S1U A;  3DLH A;  3LDO A;  2CB8 A;  1RBV A;  2QWM A;  3BF1 A;  2VG7 A;  4LF9 K;  3ITH A;  4H4M A;  4CJQ A;  2BAN A;  1S1V A;  4Y0W A;  1IKV A;  2QA4 N;  3MEE A;  1F21 A;  4A2B A;  1RGI A;  4IOX A;  4CBW A;  4CVN E;  4ELU A;  1Q9X A;  4DUZ K;  3R3L A;  4IG0 A;  1TL3 A;  2YHY A;  4ILJ A;  4LFB K;  3OY9 A;  4FJ5 A;  1HNW K;  2E2O A;  2BH1 A;  3MX5 A;  3QDK A;  5AFU A;  4IXC A;  4BRI A;  2Q0R A;  5AZI B;  3HM9 A;  1YF5 L;  1IKY A;  1CZA N;  4O55 A;  1TV6 A;  2E4L A;  2E1Z A;  3EE8 A;  2QWO A;  2F9T A;  4AIL C;  2O4I A;  3JYT A;  4H5T A;  4PUO A;  3PIO L;  1L3U A;  2ZGZ A;  1XMO K;  1QVG M;  1OH5 A;  4RG8 A;  3H46 O;  4JI1 K;  2GBZ A;  2D0O A;  5M1Q A;  3BIN A;  4CJT A;  3OS0 A;  4JKA A;  3ZYY X;  4DG1 A;  3EYZ A;  3SAG A;  2E6L A;  4RW4 A;  4L8R B;  1NK6 A;  4ZRJ A;  3CIP A;  5AQN A;  4LF8 K;  4FLY A;  3WXI A;  4KH5 A;  1UWB A;  1NOY A;  4CJR A;  1YI2 N;  1GLD G;  1EET A;  1WOQ A;  1VQL N;  4KHQ A;  3L2Q A;  4JEP A;  4FK4 A;  4YOW A;  4KTQ A;  4FJM A;  3QLH A;  4J2D A;  4CHP A;  3ZSY A;  1EP4 A;  3ZSO A;  4O8K A;  2UUC K;  1K8K A;  2W6L A;  3R6M A;  4WFB L;  1X9S A;  3ENH A;  3BDP A;  1C0F A;  3AO1 A;  3RR8 A;  1MDU B;  3OTO K;  2PAV A;  4B9M A;  4C8M A;  3AA3 A;  4BDP A;  4CFC A;  3EZW A;  4OKJ A;  1SS6 A;  4BQL A;  1JLG A;  2QXL A;  3FP5 A;  1VQP N;  2WC9 A;  1FW6 A;  3TSU A;  1ASW A;  5F2R A;  4YL8 A;  4FO0 A;  1KAX A;  2WTU A;  3OYN A;  1QZ5 A;  4H4O A;  4N76 A;  2O8B B;  1HUX A;  4BRN A;  1W97 L;  4A59 A;  3EO3 A;  4AM6 A;  3BP8 A;  2LBB A;  3CFR A;  3ULD A;  4AHC A;  4FK2 A;  1YIJ N;  3C6H A;  3NF8 A;  3SUO A;  3ZX2 A;  4BRE A;  5JVG L;  4GKK K;  5AQI A;  3CCL N;  5C0Y A;  1JCE A;  2CGL A;  1S3X A;  3LZJ A;  4RW8 A;  4ID1 A;  1C1A A;  1XHX A;  4JI4 K;  4CGG A;  1W0H A;  3D45 A;  2IAJ A;  4F8R A;  5E84 A;  1WUA A;  4FM0 A;  1RT7 A;  4JI3 K;  4BR0 A;  2AP1 A;  3TTC A;  4CJF A;  3DRS A;  3RRG A;  1Q82 O;  1SGH A;  3I0R A;  4MDB A;  3V1Q A;  5AQX A;  1FKP A;  3ZX0 A;  3ASM A;  3MCA B;  2P51 A;  4DR7 K;  1XC9 A;  4W5Q A;  2Z1G A;  2X74 A;  1TKT A;  3KJV A;  3SMS A;  5AZJ A;  5C12 A;  1T44 A;  1VSJ A;  3OYC A;  1GLJ O;  3AO2 A;  5AQM A;  1X3M A;  1NKB A;  1Z26 A;  4FWQ A;  3NH2 A;  4FZX C;  1GG3 A;  5DM7 L;  1VBG A;  2E2Q A;  1RTI A;  4DTM A;  3DWL A;  3LDL A;  1W7A A;  5JS1 A;  4OPJ A;  3WNF A;  4O0I A;  5H1S Q;  3QEV A;  1TKD A;  4DR2 K;  2P9I B;  2DFH A;  3DLB A;  1HKG A;  3O6W A;  3CCS N;  1T8E A;  2VQE K;  4BRM A;  4DV6 K;  2ZE2 A;  1TL1 A;  2FF6 A;  4Z4E A;  4FJL A;  3VEV A;  1BA0 A;  2QWQ A;  1SL1 A;  1NJW A;  1U04 A;  3PIP L;  3J7Z O;  1EF1 A;  5I3U A;  2FBV A;  4DCH A;  4BAC A;  3U6F A;  2OPR A;  4PKH A;  3B6P A;  1J53 A;  3IDH A;  5BRF A;  1NJI O;  2G8K A;  4FYD A;  4J2B A;  4CD3 A;  1LV5 A;  3D2E A;  4DFK A;  4BR5 A;  2IDO A;  4K8Z A;  4BG9 A;  3MK6 A;  4BRK A;  1VHX A;  3ZSV A;  3MXI A;  4JKF A;  3P5J A;  3ZEU B;  1NGE A;  2Q36 A;  1Z25 A;  5AQP A;  4K42 A;  2G8H A;  3OYB A;  4AM7 A;  4DQI A;  2P9P B;  2NLX A;  3THW A;  4DF8 A;  4B1Y B;  3VF4 A;  5HOO A;  1HKB A;  4JKE A;  5AQR A;  5CY4 A;  2XY7 A;  3VQA A;  1RT5 A;  4B9Q A;  3O9Q A;  2NRH A;  3KWG A;  1T6C A;  4CIG A;  4JI2 K;  4BQZ A;  1NNE A;  1ITG A;  3MN5 A;  4KI4 A;  3TR8 A;  3K5M A;  5FPM A;  1S1T A;  4BG8 A;  5AQF A;  4YOU A;  4KTZ A;  1KC8 O;  5JVL A;  2F4V K;  1HNX K;  3AVL A;  4HDQ A;  3SYZ A;  4CHN A;  2JWK A;  3A5N C;  1GLE G;  1R0A A;  1WAF A;  3L2V A;  3OBY A;  2KFZ A;  4FWP A;  3N4P A;  5J2P A;  1N34 K;  4LY7 A;  2BGG A;  3ULE A;  2RF2 A;  1TKX A;  3CQ8 A;  2KFN A;  3G9W A;  1KAZ A;  1VQ9 N;  4TKN A;  1VSH A;  2O8C A;  5LJW A;  3O8M A;  1ZBH A;  2COP A;  1QHT A;  3K0S A;  3BY5 A;  1E4G T;  2QM1 A;  5KGW A;  3DLK A;  3VEW A;  3MMV A;  4DLE A;  4DR6 K;  1XMQ K;  3V9W A;  1DEJ A;  5A2Q O;  5GAG P;  2PYL A;  3KD5 E;  1ZXO A;  1TYQ B;  4AHR A;  2KHO A;  4JKD A;  3LAL A;  1QQN A;  5AZI A;  1X9W A;  3HRG A;  2AA4 A;  2UU9 K;  2PZS A;  4JK7 A;  4DV4 K;  2YKN A;  3DAW A;  1MIZ B;  2VG5 A;  5AZJ B;  2CGK A;  3S3N A;  4FJK A;  1YJW N;  1TVR A;  1WSI A;  4BY9 C;  3FE1 A;  1YIT N;  4BRO A;  1IG8 A;  1HNZ K;  3AO3 A;  4A57 A;  4WQ4 A;  4PL8 A;  3L3V A;  3ZSZ A;  3ZT2 A;  3L4I A;  2HND A;  4CES A;  3V9U A;  1R59 O;  3JS6 A;  3CPE A;  3CYM A;  5AQT A;  3BUZ B;  2ZJR L;  4BR2 A;  3K9K A;  1K6Y A;  4KRE A;  3CJ1 A;  1X1P A;  3VOV A;  3ATU A;  2UUA K;  1KQS M;  5TKW A;  1G99 A;  4CJL A;  2P9N B;  1GLF O;  5C2F A;  3J81 O;  4KH4 A;  3EY1 A;  3KK1 A;  3NHG A;  3H45 C;  3UKU B;  4CF2 A;  4CEA A;  2OZS A;  2ITG A;  3WQT A;  1REV A;  4WFN L;  1S9G A;  4R79 A;  1IKW A;  1EO1 A;  2GEM A;  4FJ9 A;  3VQ9 A;  2R82 A;  4BC4 A;  3LWL A;  4FWK A;  4CJV A;  3GBT A;  3GOI A;  5M1K A;  3HTV A;  3I8D A;  1JLQ A;  4RW9 A;  4ISF A;  3SAH A;  4DMN A;  5CYQ A;  4GNI A;  4BRH A;  3O9T A;  1P8Z A;  1RDW X;  2HBJ A;  2BUP A;  4MFB A;  3UE5 A;  2XY5 A;  2VWK A;  4NLB A;  1WSE A;  4YOT A;  4CEC A;  1DKG D;  3QNO A;  1XI1 A;  4TSX A;  4CEZ A;  1GOA A;  5AQW A;  1ASU A;  3I55 N;  1GLC G;  4E7H A;  4CZJ A;  1D8Y A;  1VQ4 N;  3DLR A;  2D0P A;  4XH4 A;  2A1S A;  1RDD A;  5DK5 A;  1HNV A;  2ZM6 K;  4KHW A;  3T7Z A;  5HRR A;  4OJR A;  4Z0U A;  3D0P A;  1NGD A;  2YNF A;  3K5L A;  3LP1 A;  2FBT A;  2FLO A;  4BRG A;  4CYE A;  3D2F B;  5AQU A;  4PKI A;  1VQ8 N;  3TAG A;  3C6U A;  4OPK A;  5KPT A;  1YTA A;  3DM2 A;  4L3Q A;  3O4W A;  1CZB A;  1NGH A;  2LSN A;  1NMN A;  2Q1N A;  1YJN N;  3QIO A;  1VSL A;  1GLB G;  4B1U B;  1RFQ A;  2A1R A;  3EL2 A;  4JKG B;  5AQZ A;  3CJA A;  4WCE L;  2W6K A;  2ZD1 A;  4E89 A;  4CHY A;  3R1X A;  3MXJ A;  3AAR A;  3L8B A;  4KI6 A;  3CM6 A;  5AQK A;  2HE7 A;  1QS4 A;  4HTL A;  2V51 B;  1X3N A;  3DLG A;  1EQY A;  4O4G A;  3CD6 N;  4JD2 A;  2RE2 A;  1I3A A;  4CJW A;  2DFE A;  1RBR A;  3QO9 A;  4QS7 A;  3AY9 A;  2DPN A;  4WF9 L;  5K14 A;  2ASP A;  3HPO A;  4BR7 A;  3AO5 A;  2NRZ A;  5M1F A;  5LL6 Z;  3THW B;  1FK9 A;  1RDA A;  3H3N O;  3ZT0 A;  1YVU A;  3O9S A;  4LSL A;  4B9U A;  4CJ7 A;  2HF4 A;  3MED A;  3QNN A;  4FL9 A;  1NU0 A;  3OYL A;  2FDQ A;  1MWM A;  3OYG A;  3CFO A;  2P9S A;  3HK2 A;  2CQU A;  5JVH L;  3KK3 A;  5BPM A;  5DM6 L;  4JI8 K;  4N56 A;  1KRP A;  4DHY A;  4LF7 K;  5EXW A;  3O08 A;  3SBT A;  3OS2 A;  2JLE A;  4B1V A;  3DI6 A;  2GEL A;  4CED A;  3IKM A;  4B9N A;  4DR4 K;  3SUP A;  4H03 B;  4B9S A;  5EU7 A;  4CZI A;  1SKW A;  4LH5 A;  1KVA A;  3TAE A;  3FFI A;  3IFR A;  1VSE A;  2NRW A;  1VK0 A;  3D2E B;  1NM1 A;  1BO5 O;  3VPZ A;  2KQ2 A;  3AU5 A;  3HVR A;  3WEE B;  3TAP A;  4ILG B;  3VQE A;  1YVN A;  4NYF A;  4RWT A;  1ZBL A;  4CJE A;  2A42 A;  4OO1 J;  4CEO A;  4V19 S;  4H0Y B;  2IVO A;  3V6D A;  4Q0B A;  3C0B A;  4FLZ A;  5GIO A;  3SUQ A;  3U7D A;  1W9H A;  2HHH K;  4I9Q A;  3HYF A;  4F9O A;  3RTV A;  4JK9 A;  2E8A A;  1Q9Y A;  3ID6 A;  4FLU A;  2YNH A;  1RT4 A;  1NI2 A;  3V9Z A;  2E1Y A;  3LDQ A;  3T3F A;  4H8K A;  3B8A X;  4CFD A;  3UIQ A;  4CGH A;  3VQQ A;  1NKE A;  2KLA A;  3NF7 A;  3D2F A;  4EIA A;  1K8A O;  4LF5 K;  3ZSX A;  3QFU A;  3CET A;  4CW7 B;  3NH1 A;  4RW6 A;  3ZT4 A;  3S3M A;  3VQP A;  5HRS A;  2ABD A;  3AVM A;  4B9V A;  1BIS A;  5D3G A;  3NE6 A;  3QEI A;  1RDC A;  2EMS A;  2G8V A;  3J7Y P;  2J4R A;  4YOV A;  3DXK B;  1DGK N;  3JAM O;  4CJU A;  2HNY A;  1X9M A;  3CJ9 A;  3P4I A;  3Q7C A;  1D9F A;  3LDP A;  1LAW A;  3HOT A;  5FRM A;  3K59 A;  3I8B A;  3VMF B;  3DRR A;  3SV3 A;  3FLC O;  5C10 A;  3PZD A;  3CG7 A;  3C95 A;  3NCI A;  2QEX N;  1NK8 A;  4QS9 A;  3VQ6 A;  1BOT O;  4BR4 A;  3TAQ A;  1BIZ A;  3VEN A;  4YNQ A;  4OX9 K;  4FJG A;  3L3U A;  3F9K A;  1ZYQ A;  2G8F A;  4U7B A;  3P83 D;  3QFP A;  4MQ3 A;  1N8R O;  3VEZ A;  4CZG A;  1WNS A;  4NYN A;  3AVK A;  3FZL A;  2ETJ A;  4FSV A;  4FWL A;  3A5O C;  4Z4H A;  4JKH A;  3AVG A;  2IC3 A;  3L6Q A;  3DXM A;  1VQ6 N;  5C2D A;  2O8E A;  3G4S N;  3P39 A;  4RCH A;  1VBH A;  3H08 A;  1LAV A;  1BCM A;  2F96 A;  1RBT A;  4JHD A;  4YOY A;  3C6A A;  3VN5 A;  5E41 A;  1TYQ A;  4DLG A;  4B9T A;  1DTT A;  4FOI A;  1VQK N;  3X23 A;  1WSF A;  3UKU A;  2IS3 A;  4E0D A;  3UKR A;  3AVI A;  1BGX T;  2KW4 A;  2YJF A;  5SZT A;  4CEF A;  2VCP A;  4DTN A;  3WXM B;  4GV6 A;  2HVI A;  4E19 A;  3PLA A;  4CEE A;  2OPS A;  1SKR A;  1BWF O;  4W5O A;  3E1Y A;  3HT3 A;  4IFE A;  2ZJQ L;  3LDN A;  3IRX A;  3S9H A;  1S1W A;  4EAH D;  2WFB A;  2RHK A;  3MXM A;  1SQK A;  4DTX A;  4DV0 K;  4WQ4 C;  1ASV A;  1Y64 A;  4CEQ A;  4DV7 K;  4CZM A;  1GGO A;  3EKU A;  3NGI A;  1NK9 A;  1IBM K;  2XY6 A;  3SPZ A;  1D5A A;  1S9E A;  3K5O A;  1VSF A;  1KC7 A;  3M8S A;  1NGJ A;  4OLB A;  4IJA A;  2Z1H A;  1ATN A;  1ACA A;  4F2S A;  4BRL A;  2YKM A;  1K8K B;  3I33 A;  3OS1 A;  4E7K A;  4IKF A;  1JXE A;  3V4I A;  1XUP O;  4BRP A;  3MX2 A;  5HLF A;  3WEE A;  3SBG A;  4BR9 A;  1BUP A;  4CF0 A;  4KKO A;  2E88 A;  4CZH A;  1C0M A;  4B3T K;  2R7Y A;  2QKK A;  2XRI A;  5F0X A;  3M8P A;  4DQP A;  1G15 A;  1E3M A;  3HI0 A;  5EVZ A;  3QIN A;  1HB8 A;  4CJ3 A;  4ZHR A;  1BL3 A;  1HKC A;  3ZX3 A;  4ILH A;  3VEX A;  2XHB A;  3O80 A;  2FF3 B;  4DWI A;  2WUS A;  2J0J A;  4MLE A;  1BHL A;  3TWH A;  1WBD A;  2P5O A;  4K41 A;  3ZCM A;  1JL1 A;  4DTR A;  2HHS A;  3OYJ A;  5C42 A;  4JKB A;  4KHS A;  3WNG A;  4JD2 B;  4DTP A;  4W5R A;  1YHQ N;  3ENB A;  1C1B A;  2W40 A;  2XO7 A;  5E26 A;  1NGC A;  4I6M A;  2E2N A;  3ZET B;  1EXQ A;  1S1X A;  1JJ2 M;  2D0B A;  3O9U A;  2UXD K;  5J2N A;  2GUI A;  4C8L A;  2F9W A;  1U2V A;  1Y97 A;  3G6E N;  3KK2 A;  4BDZ A;  2YVC A;  5AQY A;  3THY B;  3E01 A;  2ZWH A;  4YOX A;  2HMP A;  2O8E B;  2Q0U A;  3OJU A;  1OVY A;  4O44 A;  4I6M B;  3QIP A;  5C24 A;  2Q2R A;  3CPW M;  2V7Y A;  4HUG A;  1XC3 A;  3SNN A;  4HUE A;  2OZM A;  4ZTJ A;  2O8F A;  1J19 A;  1K73 O;  2P9L B;  4Z4I A;  5BPL A;  3OYF A;  2HST A;  2KKZ A;  3KWI A;  4NLC A;  4A5A A;  4BRD A;  1VSM A;  4CZK A;  4HHT A;  4JI5 K;  4B1X B;  4FLX A;  4GV3 A;  1RIL A;  4BGA A;  1NGF A;  3SQ0 A;  2YCH A;  4FJN A;  4CD1 A;  3V9X A;  2F7T A;  3NMU A;  1RCH A;  2ATQ A;  3FZK A;  3KK7 A;  3MN7 A;  3KIO A;  4BRQ A;  2NRV A;  4CBU A;  1NKC A;  1EX4 A;  3CQY A;  4FLV A;  4O5F A;  2P9U A;  1B92 A;  3W0L A;  1MU2 A;  1E5W A;  5HRO A;  3SUN A;  4LH4 A;  4XEI A;  3OYA A;  1KLN A;  4FWN A;  1UA1 A;  2KZM A;  1W2B M;  3QB0 A;  4DXA B;  2F8S A;  3HXM A;  1RT2 A;  2WOM A;  1P90 A;  4FVU A;  1JLE A;  5J2M A;  1GLA G;  4DSF A;  1IJJ A;  2HMI A;  4GW6 A;  4KV8 A;  3VGM A;  4BE0 A;  4FW1 A;  3AVJ A;  5C25 A;  4K43 A;  3FGU A;  1NGA A;  1Y19 B;  4IOA L;  3HP6 A;  1IO2 A;  2EHG A;  3DXK A;  3AO4 A;  3CCQ N;  3C7N A;  3G0Z A;  2HBK A;  3UKR B;  2Z1I A;  3MEG A;  3VGL A;  4E1N A;  4DU3 A;  4FCY A;  3V9S A;  3LZI A;  2G8U A;  2HHT A;  4J2A A;  5JIC A;  2VG6 A;  5GIP A;  3LAM A;  3A0I X;  4I7F A;  4CIE A;  3WXJ A;  5HP1 A;  2FSK A;  5HRN A;  3ZDT A;  1JXB A;  3TSP A;  1HRH A;  1RBS A;  1JDE A;  4HCB A;  1OH8 A;  1VQM N;  4CHO A;  4BE1 A;  4DR3 K;  3LAK A;  3O4N A;  3KLE A;  1SL0 A;  4WE1 A;  3BZC A;  4FM1 A;  1HJO A;  3PY8 A;  5LJV A;  4FJ8 A;  4QOZ B;  3A2F A;  2UUB K;  4DF4 A;  2D0C A;  3AGR A;  3PVL A;  4W5T A;  4X64 K;  4ELT A;  3WNE A;  1T6D A;  3KTQ A;  1QHA A;  4PWD A;  2YHB A;  2VGN A;  1KCF A;  1Z05 A;  3HZ6 A;  1TK8 A;  4GXB A;  4CGJ A;  5J1E A;  4IOC L;  3SZ2 A;  1FJG K;  1HQE A;  4CEB A;  4E1J A;  2O8C B;  1HYZ A;  2P1J A;  4X62 K;  3KVG A;  4H0P A;  2UYT A;  2OPP A;  4BRC A;  1OKJ A;  1UAX A;  4EHT A;  4P7I A;  3ZT1 A;  2B4J A;  1LW0 A;  2A40 A;  4CIF A;  1QZ6 A;  3NF6 A;  5BN8 A;  4CK3 A;  1BG3 A;  2HF3 A;  4AHV A;  1V4S A;  4J8F A;  2GWK A;  2QWR A;  3NDK A;  1NJX A;  5AQH A;  3QEW A;  3BZK A;  5LMN K;  1J6Z A;  3O5B A;  2WH5 A;  3HL8 A;  3NAE A;  2O4G A;  4IG3 A;  4KO0 A;  4JI7 K;  1X9J A;  5FPD A;  4KHN A;  1HR0 K;  3B6O A;  4F4K A;  3R8E A;  4DQS A;  3KKS A;  3CF5 L;  4NO7 A;  4H5R A;  2QI2 A;  3VA0 A;  3ISN C;  1N33 K;  2OA8 A;  2B5J A;  3IVF A;  4CHQ A;  2I7P A;  5M1O A;  3C65 A;  4HTU A;  3OA9 A;  4ZTF A;  2YX6 A;  3VEY A;  1JCF A;  4B1W B;  3ZSR A;  3ZT3 A;  1SL2 A;  2DIK A;  4E1M A;  4A61 A;  3TAR A;  1HB6 A;  4X65 K;  1D4X A;  4OPH A;  3T69 A;  1SZ2 A;  3E9O A;  2HBL A;  3DOK A;  1HPM A;  1N32 K;  3T1H K;  4Z4G A;  4PHT X;  3D6R A;  3LPU A;  4CK2 A;  3MDQ A;  4BWJ A;  2OTL N;  3DMJ A;  3OHR A;  1NTI A;  4M42 A;  5M1N A;  3KLG A;  4AHU A;  5C15 A;  4OLA A;  2YV0 X;  3OYK A;  1QQO A;  3HBT A;  2IGI A;  3SMP A;  4JS5 A;  2HW3 A;  3CMA N;  4N47 A;  1RT1 A;  1VQ5 N;  2NUB A;  1ZBI A;  3IG1 A;  3CCM N;  3HM8 A;  1VQ7 N;  4N41 A;  1H4R A;  4X66 K;  1EWR A;  4DS4 A;  5AQJ A;  4K0K K;  5TKY A;  3LP0 A;  1B9D A;  4JLH A;  3V81 A;  3VEO A;  2H3G X;  1BI4 B;  1WSG A;  4AHT A;  4A2A A;  4OGC A;  4M7X A;  3V1O A;  4Z4C A;  3PX6 A;  3MN9 A;  1NK4 A;  1YUW A;  4JS4 A;  4QCL A;  1MK7 B;  4DV3 K;  2IVN A;  4WQ5 A;  4H0V B;  4BE2 A;  1Q81 O;  3O3F A;  4DTU A;  3I0S A;  3AGK A;  1WLJ A;  3PSF A;  4JHD B;  5HL7 L;  4BVO A;  3E9L A;  3THX A;  4H5N A;  4CGF A;  3CI5 A;  4OVL A;  4CBX A;  1VQO N;  2OYQ A;  3NGZ A;  1SUQ A;  1N36 K;  3TU5 A;  3M8R A;  1TK0 A;  1C0U A;  3TPQ A;  5IT9 O;  3A8Y A;  2KTQ A;  3A5L C;  4EHU A;  3OBW A;  3EPY A;  1NG9 A;  4JNE A;  4K8X A;  1HYS A;  3ZSQ A;  3N4Q A;  1BA1 A;  5GAD P;  4LF6 K;  3RMB A;  3HST B;  3K2P A;  3RWU A;  3P1G A;  1RDU A;  1WN7 A;  1CXQ A;  1TKZ A;  4RW7 A;  3ZET A;  1ESV A;  4JK8 A;  2E20 A;  4DB3 A;  1U47 A;  4B3O A;  2QK9 A;  3Q7B A;  2J0K A;  4E7J A;  3AV9 A;  4Y1D A;  3R9P A;  1U48 A;  4MO5 A;  3CXC M;  5MLC Q;  4EFH A;  2P9K B;  3KLI A;  4JAX A;  3E9P A;  4EZ9 A;  2QW9 A;  1S72 N;  3NVK A;  1ST7 A;  4O5B A;  3VF6 A;  1CXU A;  3J7A P;  2FBY A;  2Q31 A;  2YHW A;  2VGM A;  4KHU A;  3CCJ N;  4KRF A;  4U67 L;  3CC4 N;  3TSQ A;  1HJR A;  1XNR K;  2P9S B;  1T3V A;  4EP5 A;  2O8B A;  1OH6 A;  4CK1 A;  1VQN N;  4CZF A;  3PO5 A;  1QQM A;  2ASO A;  4WQ5 C;  2XY8 A;  3VQ8 A;  5KQD A;  3OJS A;  4JV5 K;  4CGI A;  2D10 A;  2X0S A;  1NJY A;  4FZY A;  4DSL A;  1C6V A;  1XWL A;  4KPY A;  4B3R K;  4UQG A;  5JMV A;  1BU6 O;  4DFM A;  2PY5 A;  4IEI A;  1TUU A;  4FWO A;  2A3Z A;  3NBP A;  1KXP A;  3HPG A;  5GIN A;  3VQC A;  3SI6 A;  1J54 A;  3WT0 A;  4Z4F A;  4FXD A;  1LOT B;  3G10 A;  1Q7Y O;  4NB4 A;  4DUY K;  1XHZ A;  3MCP A;  3ALY A;  3E66 A;  3VES A;  5KTQ A;  2O8D A;  2YHX A;  3LP2 A;  1NGB A;  2GX9 A;  1HBK A;  3U3G A;  3EZ5 A;  1S6Q A;  3M3Z A;  1N5Y A;  5KPR A;  5DMR A;  3I56 N;  5AQO A;  5BR8 K;  3RSE B;  4G9Z A;  3AA4 A;  5CR4 A;  4Z94 A;  3QER A;  1IBL K;  3VQD A;  1Q86 O;  3BF3 A;  3AVN A;  2G8W A;  3IS9 A;  4M7Y A;  3AVH A;  3VGK A;  3PUF A;  4CHZ A;  3U8Z A;  1GLL O;  3G25 A;  1EKE A;  4HCC A;  3SQ2 A;  3THX B;  4FPB A;  4BRA A;  4O8U A;  3LWM A;  3IUC A;  4K25 A;  1XQS C;  1LCU A;  2VWJ A;  3TAF A;  3HO1 A;  3O1W A;  4KBO A;  1Q18 A;  4NXN K;  2GWJ A;  2I5J A;  4CJK A;  3VER A;  2WBN A;  3H3O B;  4EKU A;  5AR0 A;  1O13 A;  4DTO A;  5KPZ A;  5FPN A;  1RTD A;  2NRT A;  1C1C A;  4NCB A;  4EP4 A;  1S22 A;  2HNZ A;  4CFB A;  4GVE A;  5KRS A;  1BDG A;  3BGR A;  2CGJ A;  3CCE N;  3CCV N;  1IG9 A;  1RDB A;  4DSJ A;  2HB5 A;  2ZGY A;  4FOE A;  5M1P A;  4A62 A;  3U8X A;  3RVC A;  4EZ6 A;  4XH1 A;  3OVN A;  1NVL A;  1ZC6 A;  5LMU K;  4KB1 A;  1ATS A;  4FM2 A;  3K5N A;  4IFV A;  1L5U A;  1HPZ A;  3MN6 A;  2I1J A;  1MA9 B;  2P9L A;  5FRO A;  3NGY A;  3AVC A;  3ENO A;  3HOS A;  2EWS A;  1J5O A;  1SAZ A;  3PSI A;  3CJC A;  1NJZ A;  2E5L K;  3V1R A;  5AQV A;  2I1K A;  1A5W A;  3SCX A;  1O1W A;  4B3M K;  1Q8I A;  1RTH A;  5CHI A;  3QES A;  3VA3 A;  4PA1 A;  3WXL A;  2D4W A;  3C7N B;  3RMA A;  3KD1 E;  2FXU A;  4YDU C;  3QBX A;  2V7Z A;  4LF4 K;  2FSJ A;  1YXQ A;  4NXM K;  1TGO A;  4UY8 O;  2PBD A;  1BCO A;  3AA5 X;  3PX4 A;  1VSK A;  4CZE A;  4Q5V A;  1LW2 A;  3ID8 A;  3EE9 A;  4YY3 K;  4JYA K;  2JGU A;  3CCU N;  4FJX A;  3CHW A;  1MWK A;  2AEH A;  4M3Z A;  5BN9 A;  3CJ7 A;  4GVM A;  1HQU A;  2HHX A;  3WA0 A;  3LM9 A;  4H0O A;  2ZQB A;  2RPI A;  2W41 A;  1KTQ A;  1U6Z A;  1JLC A;  4G1Q A;  2EX3 A;  1FKO A;  4FWM A;  3CFP A;  2WON A;  5CZ2 A;  3BEX A;  3C6T A;  5I42 A;  3U9D A;  5JS2 A;  4CFA A;  2O8D B;  1TAU A;  4BVP A;  4YOR A;  4KH6 A;  3OYD A;  3GE1 A;  1NBW A;  4HUF A;  4IO8 A;  4JI6 K;  4DR1 K;  4HWI A;  1DLO A;  3NVM A;  3D7E O;  1A5X A;  1HMV A;  1BI4 A;  4DQR A;  2A6A A;  1I39 A;  2X6N A;  3TAM A;  3C94 A;  2GTD A;  4R5P A;  2HHW A;  2YNI A;  2D2Q A;  4DFJ A;  3U9Z A;  1J9A A;  4H0T B;  4CF1 A;  4B8A B;  3K57 A;  1T05 A;  3H1V X;  1YJ9 N;  1U49 A;  5FRN A;  3SJH A;  5BRD A;  2CH6 A;  4MO4 A;  3QIC A;  2YNG A;  4A5B A;  1KVB A;  5KGX A;  2GV9 A;  4QAG A;  2Q97 A;  1ZBU A;  5KQ8 A;  3O3H A;  3AAQ A;  3O1B A;  4QS8 A;  4WFA L;  3A5M C;  4CF8 A;  1MK9 B;  3QET A;  2W42 A;  4E3S A;  3VQ5 A;  2PYJ A;  3SK3 A;  4M3T A;  1EWQ A;  4CJS A;  3EN9 A;  2X78 A;  1VSD A;  4DR5 K;  3T1Y K;  2IIR A;  2P9I A;  3SPY A;  4GMJ B;  4FPA A;  3CC7 N;  3L2W A;  2D1K A;  4CCH A;  1OH7 A;  1DT9 A;  4F3O A;  1WSH A;  4ISG A;  1C0T A;  2QWN A;  3EEQ A;  5LY3 A;  5AJ3 K;  1KAY A;  3CC2 N;  3VQ4 A;  1E4F T;  1UOC A;  3CME N;  1NOZ A;  2VWB A;  3T1A A;  3TAN A;  1T7P A;  1KSP A;  1BQN A;  3DLE A;  4FZZ A;  2DFF A;  1KFS A;  4AQY K;  3QIJ A;  1NGG A;  4ICL A;  4FK0 A;  3SJJ A;  2Y1J A;  2NRR A;  5SWM A;  4JRP A;  5T7B A;  4DTS A;  4CGD A;  5F1X A;  3OYM A;  5AQS A;  3OYH A;  1T03 A;  4BRF A;  4BWM A;  4FJ7 A;  4XH5 A;  2HHQ A;  2QWL A;  4BC5 A;  5I9E B;  2AL6 A;  5EY4 A;  3RSE A;  3PX0 A;  5BPN A;  4KTW A;  4CZL A;  2ITM A;  2VQF K;  3M1F A;  2Y1I A;  4C8N A;  1DIK A;  2OAN A;  2J0M A;  2YI1 A;  2I7N A;  4RTF D;  4CJP A;  3RMD A;  4LD0 A;  4IEE A;  1RT3 A;  2O8F B;  3GDQ A;  5ELZ A;  4GV9 A;  1HX1 A;  4B08 A;  3RMC A;  1KD1 O;  4YFU A;  3AA2 A;  1ISN A;  1ILY A;  1A5V A;  3OW2 M;  3NF9 A;  5IWA K;  2HOE A;  4DQQ A;  5KRT A;  1GC6 A;  3SQ4 A;  4C8K A;  3DJC A;  1QTM A;  2E6M A;  4WYB A;  2F8T A;  1M90 O;  4ZRI A;  4CER A;  4B3S K;  3KKR A;  1QVF M;  2FBX A;  3HSC A;  4NCA A;  3F5T A;  2X6S A;  3THV A;  4FJJ A;  3S41 A;  1RNH A;  4DSK A;  3LDS A; 
#chains in the Genus database with same CATH homology
 1NTI A;  3FZM A;  3ID6 A;  1QZ5 A;  5M1N A;  5C15 A;  1NI2 A;  4H5W A;  1QQO A;  3HBT A;  1HUX A;  2E1Y A;  1W97 L;  3LDQ A;  4BRN A;  2RQ1 A;  3B8A X;  3EO3 A;  2GUP A;  3SMP A;  4A59 A;  4AM6 A;  3CMA N;  3BP8 A;  3CJB A;  1VQ5 N;  2KLA A;  5AQL A;  2YJE A;  2LBB A;  3G71 N;  3D2F A;  4EIA A;  1K8A O;  2NZT A;  1YIJ N;  3C6H A;  3CCM N;  3HM8 A;  3ZX2 A;  3QFU A;  4BRE A;  5JVG L;  3CET A;  1VQ7 N;  1H4R A;  2JWL A;  5AQI A;  3CCL N;  5AQJ A;  2ZJP L;  1JCE A;  5C0Y A;  5TKY A;  2CGL A;  1S3X A;  3W3D A;  2ABD A;  5JMV A;  3M5R A;  3VEO A;  2H3G X;  3NMU A;  4DKW A;  4A2A A;  5EX5 A;  2EMS A;  4JKC A;  3CER A;  4M7X A;  2J4R A;  3CQX A;  3MN9 A;  1YUW A;  4YOV A;  3DXK B;  1DGK N;  1MK7 B;  4PKG A;  2IVN A;  4WQ5 A;  5E84 A;  1WUA A;  3GL1 A;  4H0V B;  1Q81 O;  3CJ9 A;  4BR0 A;  3P4I A;  2AP1 A;  3TTC A;  3Q7C A;  3AGK A;  4B1Z A;  4JHD B;  3WUH A;  3LDP A;  5HL7 L;  3HOT A;  4BVO A;  1SGH A;  3E9L A;  4H5N A;  4IO9 L;  2QWP A;  1Q82 O;  4MDB A;  3CI5 A;  5AQX A;  4YDU A;  3ULE B;  4CBX A;  1VQO N;  3I8B A;  3MCA B;  3MWT A;  4FWR A;  3VET A;  3VMF B;  3ZX0 A;  3FLC O;  3H6E A;  3AU4 A;  1Z6R A;  5C10 A;  1VAZ A;  4JKG A;  4IJN A;  3PZD A;  3TU5 A;  3TPQ A;  2QEX N;  5CE3 A;  3SMS A;  5ADX A;  4QS9 A;  5AZJ A;  5C12 A;  5AQG A;  3A8Y A;  5BRH A;  1T44 A;  3A5L C;  1BOT O;  1GLJ O;  3OBW A;  5AQM A;  1X3M A;  4BR4 A;  4EHU A;  2A41 A;  3EPY A;  4FWQ A;  3GG4 A;  3F9M A;  1GG3 A;  5DM7 L;  1VBG A;  4JNE A;  2E2Q A;  3VEN A;  4DQ8 A;  3N4Q A;  1BA1 A;  3DWL A;  3LDL A;  5GAD P;  2FJ9 A;  5H1S Q;  1RDU A;  2P9I B;  3ZET A;  1ESV A;  4JK8 A;  3CCR N;  2E20 A;  4DB3 A;  1HKG A;  3O6W A;  3U4L A;  3CCS N;  2ZF5 O;  4U7B A;  3Q7B A;  4BRM A;  2J0K A;  3QFP A;  4CI6 A;  2FF6 A;  3R9P A;  3VEZ A;  4CZG A;  1N8R O;  3VEV A;  4MO5 A;  3CXC M;  4IWV A;  5MLC Q;  4EFH A;  2P9K B;  4ISE A;  3LL3 A;  4JAX A;  3E9P A;  1BA0 A;  2QWQ A;  2QW9 A;  3FZL A;  1JCG A;  4FSV A;  1ST7 A;  4FWL A;  3A5O C;  1EF1 A;  3J7Z O;  3PIP L;  1S72 N;  3NVK A;  4JKH A;  2P9K A;  1HLU A;  3VF6 A;  4DCH A;  1VQ6 N;  3L6Q A;  3DXM A;  4PKH A;  4GY2 B;  5C2D A;  3IDH A;  2Q31 A;  2YHW A;  3G4S N;  5BRF A;  4IZ9 A;  1NJI O;  3P39 A;  2VGM A;  4RCH A;  1VBH A;  1C0G A;  3CCJ N;  2OTJ N;  5EOY A;  4U67 L;  3CC4 N;  3TSQ A;  4CD3 A;  4JHD A;  2P9S B;  1TUY A;  3ATV A;  3C6A A;  3D2E A;  1T3V A;  5AFU H;  3F2K A;  4BR5 A;  1TYQ A;  4BG9 A;  3MK6 A;  2HBM A;  4BRK A;  4FOI A;  1VQK N;  3X23 A;  3J8A A;  3UKU A;  4JKF A;  3WXK A;  3UKR A;  1VQN N;  4CZF A;  3ZEU B;  1NGE A;  2Q36 A;  3L0Q A;  5AQP A;  2YJF A;  1QQM A;  2ASO A;  4WQ5 C;  4K42 A;  2VCP A;  4AM7 A;  3WXM B;  5KQD A;  4GV6 A;  3PLA A;  2P9P B;  2D10 A;  2NLX A;  2NNW A;  2X0S A;  1BWF O;  4C23 A;  4B1Y B;  3VF4 A;  5HOO A;  1HKB A;  4JKE A;  3E1Y A;  4IFE A;  2ZJQ L;  5AQR A;  3LDN A;  4B9Q A;  3M6G A;  1BU6 O;  3O9Q A;  2NRH A;  1KBL A;  2WFB A;  1TUU A;  4IEI A;  3KWG A;  2RHK A;  3JXU A;  4FWO A;  3VTH A;  1T6C A;  2A3Z A;  1KXP A;  4BQZ A;  1SQK A;  4WQ4 C;  5GIN A;  3WT0 A;  3AAP A;  1Y64 A;  1LOT B;  3MN5 A;  5GAH P;  4CZM A;  1GGO A;  3EKU A;  5ADX H;  1Q7Y O;  3FLV A;  4NB4 A;  3MCP A;  5FPM A;  4AF1 A;  4BG8 A;  5AQF A;  2A5X A;  4YOU A;  1KC8 O;  5JVL A;  3E66 A;  3VES A;  3SLC A;  1K9M O;  4HDQ A;  1KC7 A;  2YHX A;  2JWK A;  1NGJ A;  1GLE G;  1NGB A;  3A5N C;  2GX9 A;  4IJA A;  1HBK A;  4C1N I;  5AQQ A;  3OBY A;  1ATN A;  1H1V A;  3DXM B;  4FWP A;  3N4P A;  1ACA A;  3M3Z A;  4H5V A;  5KPR A;  3WQU A;  3I56 N;  4BRL A;  5JLH A;  5AQO A;  1K8K B;  3I33 A;  3ULE A;  3MWP A;  3RSE B;  5JLF A;  4G9Z A;  5CR4 A;  3G9W A;  1KAZ A;  4Z94 A;  4TKN A;  1VQ9 N;  4IDH A;  5LJW A;  1XUP O;  3O8M A;  4BRP A;  2COP A;  1Q86 O;  3BF3 A;  3MX2 A;  1E4G T;  3WEE A;  3SBG A;  2QM1 A;  4BR9 A;  4M7Y A;  1BUP A;  3VEW A;  2QTD A;  3VGK A;  3MMV A;  2NRX A;  3U8Z A;  1GLL O;  2E88 A;  3G25 A;  3ZEU A;  4CZH A;  4FPB A;  1DEJ A;  4BRA A;  4O8U A;  4M63 C;  3IUC A;  5GAG P;  4K25 A;  1XQS C;  1LCU A;  5F0X A;  2P9P A;  2PFU A;  3O1W A;  4KBO A;  1ZXO A;  3HI0 A;  1Q18 A;  1TYQ B;  5EVZ A;  2GWJ A;  4PL7 A;  1HB8 A;  1V4T A;  2KHO A;  1ATR A;  3VER A;  2WBN A;  3H3O B;  4EKU A;  1HKC A;  4JKD A;  4ILH A;  1O13 A;  3QML A;  5AR0 A;  3VEX A;  3ZX3 A;  5B8H A;  3O80 A;  5KPZ A;  1QQN A;  2FF3 B;  5FPN A;  3HRG A;  2AA4 A;  2NRT A;  5AZI A;  4JK7 A;  2E2P A;  2WUS A;  2J0J A;  4BC3 A;  5GAE P;  1S22 A;  4MLE A;  3DAW A;  1MIZ B;  3P31 A;  4K41 A;  4GVE A;  1BDG A;  5AZJ B;  2CGJ A;  3CCE N;  3CCV N;  3O9R A;  2CGK A;  1YJW N;  2ZGY A;  4JKB A;  4FOE A;  5M1P A;  3TTF A;  4A62 A;  4LC9 B;  4JD2 B;  3RVC A;  3U8X A;  1YHQ N;  3FE1 A;  4XH1 A;  3ENB A;  4BY9 C;  1NVL A;  1YIT N;  1ZC6 A;  2W40 A;  1YAG A;  3FR0 A;  5E26 A;  1ATS A;  4BRO A;  1NGC A;  4I6M A;  2E2N A;  1IG8 A;  2P9U B;  3MN6 A;  3ZET B;  2I1J A;  1MA9 B;  2V52 B;  3QBW A;  4A57 A;  1JJ2 M;  4WQ4 A;  4PL8 A;  2P9L A;  3O9U A;  3VF2 A;  3L4I A;  3ENO A;  3HOS A;  2F9W A;  1U2V A;  2EWS A;  1R59 O;  1SAZ A;  3UB5 A;  3JS6 A;  3G6E N;  3CJC A;  1NWK A;  2VYP A;  3CPE A;  1U2V B;  2YVC A;  5AQY A;  5IJM A;  5AQV A;  4FWS A;  3SAF A;  5BR9 A;  2I1K A;  2ZWH A;  4YOX A;  5AQT A;  3BUZ B;  2ZJR L;  5CHI A;  3K9J A;  4BR2 A;  3K9K A;  2HMP A;  3WXL A;  2D4W A;  3C7N B;  2Q0U A;  1OVY A;  2FXU A;  3CJ1 A;  1NMD A;  2V7Z A;  3QBX A;  4YDU C;  3DLL L;  3VOV A;  2FSJ A;  3P38 A;  1YXQ A;  3ATU A;  3FZF A;  4I6M B;  1KQS M;  5TKW A;  4UY8 O;  2Q2R A;  2PBD A;  2CH5 A;  4HDO A;  2V7Y A;  3CPW M;  1G99 A;  1XC3 A;  2P9N B;  1GLF O;  5C2F A;  4KH4 A;  4CZE A;  3H45 C;  3UKU B;  1NLV A;  3ID8 A;  1J19 A;  3FFK B;  3EE9 A;  1K73 O;  3WQT A;  2P9L B;  5BPL A;  3CCU N;  2HST A;  2KKZ A;  3CHW A;  3KWI A;  4NLC A;  1NGI A;  4A5A A;  4BRD A;  1MWK A;  2AEH A;  4CZK A;  4WFN L;  5BN9 A;  3CJ7 A;  4B1X B;  4R79 A;  4GV3 A;  4BGA A;  1NGF A;  1EO1 A;  2GEM A;  2YCH A;  4F7G A;  4CD1 A;  2R82 A;  3WA0 A;  2F7T A;  3KZB A;  3LM9 A;  4H0O A;  3KK7 A;  3FZK A;  4BC4 A;  2W41 A;  3MN7 A;  1U6Z A;  2BTF A;  4FWK A;  3LM2 A;  4BRQ A;  3L4Q A;  2NRV A;  4CBU A;  5M1K A;  3GBT A;  3GOI A;  3HTV A;  1M1K O;  2ZPY A;  4ZRK A;  3CQY A;  4FWM A;  4O5F A;  3SAH A;  4ISF A;  2P9U A;  3W0L A;  4GNI A;  4BRH A;  3KHY A;  4MDA A;  3O9T A;  1P8Z A;  1RDW X;  2HBJ A;  3BEX A;  1E5W A;  2BUP A;  4H0X B;  3TTD A;  3U9D A;  4BC2 A;  3UE5 A;  4BVP A;  4YOR A;  4NLB A;  4XEI A;  4YOT A;  4KH6 A;  1DKG D;  4NY0 A;  3IMX A;  4FWN A;  3EKS A;  1W2B M;  5AQW A;  3GE1 A;  3QB0 A;  1NBW A;  4DXA B;  4IO8 A;  2EMT A;  3I55 N;  3H1Q A;  1P90 A;  1GLC G;  4HWI A;  4CZJ A;  4FVU A;  2D11 A;  1VQ4 N;  1GLA G;  3NVM A;  2D0P A;  1IJJ A;  3D7E O;  3VGM A;  4XH4 A;  2FSN A;  1GC7 A;  4K43 A;  3FGU A;  1NGA A;  5BRE A;  1Y19 B;  2A6A A;  2P9N A;  4MLH A;  3T7Z A;  2GTD A;  4IOA L;  1NGD A;  2D2Q A;  2HRJ A;  3DXK A;  3CCQ N;  3U9Z A;  3C7N A;  4H0T B;  4C1N K;  4BGB A;  2HBK A;  2IVP A;  3UKR B;  1MIX A;  2FLO A;  4BRG A;  4JN4 A;  3VGL A;  4CYE A;  3D2F B;  3FZH A;  5AQU A;  1ZBS A;  4PKI A;  3H1V X;  1YJ9 N;  1VQ8 N;  5KPT A;  5JIC A;  4L3Q A;  3O4W A;  5GIP A;  3A0I X;  3SJH A;  5FPE A;  1NGH A;  5BRD A;  2CH6 A;  3WXJ A;  2FSK A;  2Q1N A;  4OPA A;  4MO4 A;  3QIC A;  1GLB G;  3ZDT A;  2ASM A;  1RFQ A;  3VTI A;  4B1U B;  3TSP A;  3EL2 A;  4YOY A;  4JKG B;  4A5B A;  3LDO A;  2CB8 A;  3CJA A;  5AQZ A;  2QWM A;  4WCE L;  3BF1 A;  1JDE A;  1YJN N;  2Q97 A;  1VQM N;  3R1X A;  5KQ8 A;  3AAR A;  3AAQ A;  4Y0W A;  5AQK A;  2QA4 N;  2HE7 A;  4HTL A;  2V51 B;  1HJO A;  1X3N A;  3O1B A;  1EQY A;  1RGI A;  3A5M C;  4QS8 A;  4A2B A;  4IOX A;  4CBW A;  5LJV A;  4JD2 A;  4WFA L;  1MK9 B;  3CD6 N;  2RE2 A;  3SK3 A;  3AGR A;  3R3L A;  3PVL A;  3EN9 A;  2YHY A;  4ILJ A;  2IIR A;  4QS7 A;  1T6D A;  3AY9 A;  1QHA A;  2P9I A;  2E2O A;  4FPA A;  3CC7 N;  2DPN A;  2D1K A;  2BH1 A;  2VGN A;  3MX5 A;  3QDK A;  5AFU A;  1Z05 A;  4WF9 L;  3HZ6 A;  4IXC A;  2ASP A;  4BRI A;  1DT9 A;  2Q0R A;  5AZI B;  4BR7 A;  1YF5 L;  4GXB A;  4IOC L;  5M1F A;  2NRZ A;  1CZA N;  4E1J A;  4ISG A;  2E1Z A;  3KVG A;  2QWN A;  3EE8 A;  5LY3 A;  2QWO A;  4H0P A;  2UYT A;  1KAY A;  3H3N O;  3CC2 N;  2F9T A;  4BRC A;  1OKJ A;  1E4F T;  3O9S A;  4H5T A;  4P7I A;  4EHT A;  3CME N;  2VWB A;  4CJ7 A;  2HF4 A;  3PIO L;  2ZGZ A;  1QVG M;  3H46 O;  4FL9 A;  2A40 A;  3QIJ A;  2FDQ A;  1NGG A;  2D0O A;  5M1Q A;  3BIN A;  1MWM A;  4JKA A;  3ZYY X;  2P9S A;  2CQU A;  1QZ6 A;  2NRR A;  3SAG A;  5JVH L;  5BN8 A;  5BPM A;  5DM6 L;  4ZRJ A;  3CIP A;  5AQN A;  1BG3 A;  2HF3 A;  5F1X A;  5AQS A;  3WXI A;  4KH5 A;  4DHY A;  1V4S A;  4J8F A;  2GWK A;  2QWR A;  5EXW A;  3O08 A;  3SBT A;  5AQH A;  4B1V A;  1YI2 N;  1GLD G;  1WOQ A;  4BRF A;  1VQL N;  2GEL A;  3IKM A;  4XH5 A;  2QWL A;  4JEP A;  4BC5 A;  5I9E B;  1J6Z A;  4YOW A;  2AL6 A;  2WH5 A;  3O5B A;  4H03 B;  5EY4 A;  4EAH D;  4CZI A;  1X9J A;  5FPD A;  3RSE A;  5BPN A;  4O8K A;  3R8E A;  4CZL A;  3IFR A;  1K8K A;  2ITM A;  3CF5 L;  2NRW A;  3D2E B;  3M1F A;  3R6M A;  4WFB L;  1DIK A;  4NO7 A;  4H5R A;  1NM1 A;  2OAN A;  2J0M A;  1BO5 O;  2QI2 A;  1C0F A;  2YI1 A;  3ENH A;  3AU5 A;  3VPZ A;  1MDU B;  2PAV A;  3WEE B;  3IVF A;  2I7N A;  4RTF D;  2I7P A;  5M1O A;  4ILG B;  3C65 A;  4IEE A;  3OA9 A;  3GDQ A;  5ELZ A;  4GV9 A;  1YVN A;  1HX1 A;  3EZW A;  4RWT A;  1KD1 O;  1SS6 A;  2YX6 A;  3VEY A;  1JCF A;  2A42 A;  4B1W B;  4BQL A;  4OO1 J;  1ISN A;  1ILY A;  2DIK A;  3OW2 M;  2QXL A;  2IVO A;  2HOE A;  3FP5 A;  4H0Y B;  3C0B A;  5GIO A;  1GC6 A;  4A61 A;  1HB6 A;  3U7D A;  1VQP N;  1D4X A;  3DJC A;  2WC9 A;  4WYB A;  3TSU A;  4OPH A;  3T69 A;  4ZRI A;  1SZ2 A;  1M90 O;  3E9O A;  2HBL A;  4F9O A;  1HPM A;  5F2R A;  4YL8 A;  1QVF M;  4FO0 A;  4JK9 A;  3HSC A;  3F5T A;  1KAX A;  3S41 A;  3D6R A;  4PHT X;  3MDQ A;  2E8A A;  2OTL N;  3OHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...