4JKGB

Open and closed forms of mixed t1789p+r1865a and r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
214
Chain Sequence
b'LFSNQIIWFVDDTNVYRVPIHKLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 66
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkgB02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkgB01
3E66A 4JKGA 4JK9A 4JKHA 4JKAA 4ILGB 4JKEA 4JKDA 3E9PA 4JK8A 3E9OA 4JK7A 3E9LA 3SBGA 4JKCA 4JKGB 3ENBA 4ILHA 4JKBA 4JKFA 4ILJA 3SBTA
chains in the Genus database with same CATH superfamily
2NRRA 2ITMA 3VF6A 4CW7B 4MDAA 3EE9A 4JAXA 1QQMA 3OW2M 1IO2A 2E1YA 3HI0A 3VPZA 3HPOA 3F9MA 4E7KA 1QE1A 3OYCA 4AM6A 4DR4K 3NBPA 2QKKA 1BU6O 1NGBA 5BR9A 3BINA 1ZXOA 2HOEA 3CG7A 3SJHA 2ZM6K 3CCEN 2E6LA 3C6AA 1WBDA 3LDNA 3K5NA 2OZSA 2CGLA 3V9UA 1U45A 2Q31A 3TU5A 3KK3A 4DR7K 3MEEA 5CHIA 2EWSA 2BTFA 1ISNA 3M8PA 3QMLA 1S1WA 2YNIA 1QSYA 4N5SA 4LY7A 1JLEA 4YOYA 2YVCA 4CZKA 4AHRA 2ZJPL 4Q5VA 3VERA 2ABDA 4ILHA 3CCUN 1TKTA 4KH6A 3NDKA 3CCJN 3KLFA 3QB0A 1KD1O 1P8ZA 1NJZA 2D2QA 3E1YA 4AHUA 3AVNA 3CQYA 4CZHA 3SQ2A 4EZ9A 4AHVA 4IOCL 2ZD1A 3OS1A 2D10A 3V81A 2A3ZA 4DU1A 1EQYA 4DU4A 1WOQA 3QFPA 3QBWA 1REVA 2HBLA 4O8KA 4WFNL 4DQPA 2WTUA 2O8FA 1NOZA 4TKNA 2BUPA 1G15A 4OJRA 4CHOA 1Z26A 1NK6A 5EOYA 3AO2A 4M3XA 1EO1A 1P90A 5SZTA 5D3GA 1WN7A 1ZBIA 4LC9B 4LFCK 5KQDA 1X9JA 3V6DA 3TSQA 3H3OB 4FM2A 1DLOA 2Q0RA 4CYEA 3DAWA 4DR1K 1NGFA 3HZ6A 4CZJA 4B1VA 4GV3A 3SAFA 4CEFA 4RW7A 3PX6A 4FJNA 3C95A 2AA4A 2ZQBA 1JXEA 4CJQA 1RTHA 2I1KA 2FLOA 3HO1A 4CFCA 3THYA 2DFFA 3LAKA 4HUFA 3V9WA 1DIKA 1NGGA 1TKZA 4DSKA 1Y97A 4BE1A 4DTPA 1IH7A 4CE9A 4FVUA 4FPAA 3THWB 2YJFA 3ZSRA 1BIZA 4ID1A 5KRSA 3RTVA 1RBTA 2GUIA 3IS9A 1GC6A 1Z6RA 3CCSN 4CZLA 1FKPA 4YOTA 1B9FA 3HJFA 1NGEA 4BE0A 4JI2K 5HRNA 1XNQK 1C1AA 5CYMA 2BANA 3TTDA 2V51B 2HNYA 3PX0A 4AF1A 4DKWA 1TKDA 1J53A 1LWCA 3QESA 1VQPN 1ATNA 1G99A 4L3QA 4W5RA 2ITGA 1BCOA 4FWLA 2GX9A 2D5RA 3NCIA 1WSFA 3O3HA 4JHDB 2OPSA 1IKVA 2P5OA 3C0BA 3LDOA 4E7LA 3WNHA 3J8AA 2DY4A 3DMJA 5AQXA 4M7YA 4M7XA 4FJ7A 2E20A 3IDHA 2RQ1A 2CB8A 3HYFA 1VQ8N 4CJFA 4BDYA 1NGCA 4DR6K 4OVLA 4DF4A 3CYMA 4RCHA 5ADXH 2QWNA 3M8RA 4FJ8A 4OLBA 3ZT2A 3LDPA 2NUBA 4IBNA 3RWUA 4AH9A 3AAQA 2XY7A 4NCBA 2A41A 2A1SA 1NG9A 3D2EB 1J5OA 3VF4A 3L3UA 4MFBA 3ENOA 3U7DA 1TK8A 4BRNA 3AVKA 2OANA 4JN4A 3GL1A 2HVHA 4DWIA 5BRFA 4BACA 3CCMN 2RKIA 3NHGA 4BRCA 1YVUA 1M1KO 1H4RA 3DLKA 3LWLA 5FROA 4JKAA 2WBNA 3IMXA 3DLBA 2P9UA 1HX1A 3ZEUB 1GLEG 4KB0A 3MN6A 5ADXA 4K8XA 2IAJA 5I9EB 4CZMA 3AVBA 1HB6A 4JI0K 3D6RA 4KBOA 1A5VA 4KHQA 2D11A 1KFSA 3VGMA 3L6QA 3X23A 3H1VX 4BG8A 3P38A 1U47A 3K5OA 4B9MA 3TI0A 4CCHA 3KD5E 4ILGB 3TWHA 2YHAA 5AQJA 2FBXA 3AA4A 3J7ZO 3PX4A 4CJUA 1K8KB 4IXCA 1W2BM 4CHZA 3MK6A 3LALA 2HHVA 5JLFA 3WXLA 2UXCK 3NH0A 2COPA 2QI2A 4LH5A 3DWLA 3V1RA 3CD6N 3I0RA 4IDKA 1U48A 4R79A 4CEAA 4JKDA 5KGXA 1V4TA 4GMJB 1OKJA 5C15A 2J0JA 1S6PA 2O8BB 2GWKA 3ITHA 2E2NA 4AILC 1NKBA 1ZC6A 4LH4A 1YTAA 2IVPA 1QSSA 3T19A 4FJJA 3UIQA 3ASMA 4BR5A 3ZSVA 2DTUA 4X64K 2Z1IA 1NK0A 4BWJA 2HHXA 4DU3A 2HBJA 4PA1A 1WB9A 5ELZA 3BUZB 3ATVA 3QLHA 1VQ6N 3H6EA 4XH4A 3THWA 3CETA 3WEEB 4DFKA 1GLCG 2VG6A 1QQCA 1K9MO 5GAGP 3CQXA 3ZSYA 3LDQA 2UU9K 4E7IA 1ZYQA 3RRGA 1VRTA 4RWTA 3NH2A 1YJNN 4GV9A 1JL1A 5M1KA 3SQ1A 4BRAA 4QOZB 2P1JA 4IEEA 4QS8A 2A6AA 3D2FB 1MIZB 3MECA 2Q1NA 1LV5A 4W5NA 2P9IB 3BF1A 4GVMA 4IZ9A 4HTLA 4ZRJA 3PY8A 1E4GT 4JI1K 4JNEA 3LM9A 1JCEA 1QTMA 3QEXA 1NGDA 1VHXA 5FPEA 4JHDA 4CVNE 1VSIA 1FW6A 1TV6A 3OS2A 1S5JA 4H5WA 4IG3A 3ZT3A 1HUXA 4BRHA 1T6DA 4NXMK 1LW0A 1JLGA 4A2BA 1A5WA 3ZLJA 3B6PA 2XY8A 1C0UA 4BR0A 2HHWA 4CK2A 2ZE2A 2GELA 2Z1JA 4TSXA 1J5EK 2YNFA 3TPQA 2P51A 3U8XA 1T3VA 4N56A 3I8DA 1VQNN 1Y64A 4YOVA 1T7PA 2QWQA 4CIFA 4FLYA 4DFJA 4K25A 1HPMA 4BR9A 3EPYA 1KAXA 5BN8A 5BREA 1ATRA 1VSDA 3HVTA 3OBYA 3WT0A 1IV0A 4IOAL 1TUYA 4B9VA 2P9KB 4CGGA 1YVNA 1HR0K 4IJAA 3A5OC 4U67L 4CJSA 3CIPA 3GG4A 5LY3A 4JK7A 1CZ9A 3VTHA 3SNNA 4FOEA 4DQSA 4KKOA 1YIJN 3T7ZA 3CJ1A 5C25A 3OHRA 4I2QA 3O1WA 2Y1JA 4WQ5C 3TTCA 4WFBL 2IS3A 3ZEUA 1RDAA 4UQGA 4CJ5A 3OYBA 1XUPO 4CD3A 2UUBK 4Z4EA 3A0IX 2AP1A 2FBTA 3CJ7A 4IWVA 1KLNA 2JLEA 1JDEA 1KC7A 2F96A 3KLGA 3I55N 1BA1A 1NK4A 4XEIA 5I3UA 2BDPA 5AQWA 3AO4A 3NGZA 3N4PA 4FJMA 3U3GA 4CEOA 3TABA 4KTZA 1XC9A 4RW8A 5JVLA 4GXBA 1LCUA 4BY9C 3MXIA 1F21A 1VQLN 4J2AA 1JLCA 1VQKN 3AO3A 3QEWA 3DLRA 1K8KA 5FPNA 2OZMA 4Z0UA 3CMAN 4F4KA 4YOUA 1RDBA 4KHNA 4DQRA 4DMNA 4DS4A 2D0PA 4DQQA 2ATQA 1YJ9N 3DLEA 3NF8A 4A62A 3FE1A 3IVFA 3CI5A 4C8KA 2DFEA 3KK1A 4JI5K 1DTQA 2O8BA 2J4RA 1T44A 3CPEA 4BRPA 4BWMA 1HYSA 1N5YA 1VQ9N 5AZJB 1TGOA 4BVPA 3J7YP 3TANA 1HLUA 1S1UA 3J80O 5JVGL 3J81O 4DTSA 2YKMA 4B9SA 5FPDA 3CCLN 3GBTA 2J0MA 4CHNA 4Z4FA 3M8SA 5BRDA 1BWFO 2QXLA 1YF5L 2A5XA 2YX6A 3R1XA 2ETJA 3BZKA 5AQKA 4BR4A 4DR3K 5J2MA 3ZYYX 4FWMA 2CGKA 2A1RA 4DSFA 2HMIA 5FRMA 3CJAA 4MLEA 4M3RA 1NU0A 3VA3A 3DLHA 4LF9K 2P9IA 1NK5A 1FXXA 1L3SA 3OYAA 1YI2N 4B9NA 1W7AA 4IFEA 1H1VA 3SQ0A 4FJ9A 1NTIA 5HROA 4M45A 3THYB 1D8YA 2F9WA 2OPPA 3CCVN 2QTDA 5DM7L 2RN2A 3W0LA 2O8EB 4AHCA 1D9DA 2D0BA 3QERA 2VWBA 3U9DA 3VQDA 1Q18A 2E2PA 4FWRA 2OYQA 1W9HA 2BGGA 2VWJA 4DTNA 3NF9A 4B3MK 1QVGM 4PUOA 1Q9XA 4DR5K 1KBLA 4EIAA 1DKGD 2E8AA 3WXJA 3HP9A 1XMQK 4NB4A 1KC8O 1RDUA 1BL3A 3C65A 2E4LA 1YITN 1VSJA 1MDUB 4E1MA 3J7AP 3ID8A 4E1JA 2KLAA 4CEEA 5FRNA 2D4WA 4H0OA 3O5BA 5HRPA 1HKCA 4WQ5A 2P9KA 2RHKA 1NJIO 4JKBA 4IEIA 4LF6K 5GIPA 3OYIA 4NCAA 2ASOA 3QNNA 3NGYA 4HDQA 3S41A 2KW4A 2V52B 3WQUA 5AQRA 3LP1A 4K42A 3CJ9A 1SGHA 5DMRA 4CF2A 1J6ZA 2QWMA 1VSMA 3WNEA 4KHWA 2E6MA 4FZYA 4CJ3A 1IBKK 3PSFA 5JICA 4E3SA 1NMDA 1L3VA 3IUCA 3OYNA 1SL0A 3AVHA 4CJPA 4PKHA 5C10A 2IDOA 4PL8A 3CFPA 5T7BA 3VEOA 1CXUA 3A5MC 2HHQA 1CLQA 1OVQA 1RCHA 3DRPA 3JS6A 3R6MA 1S22A 3QIOA 4NCGA 4JKEA 2I7PA 3EKUA 1SL2A 4F8RA 1OVYA 4OPHA 1VQMN 1EWRA 3EN9A 1BO5O 2H3GX 2ZGYA 4GNIA 2QK9A 2G8FA 2Z1GA 4KI6A 3QO9A 2A42A 4ISEA 1TAUA 1I39A 2P9UB 2F7TA 5KRTA 4JK9A 3WA0A 3EYZA 4Z4IA 3MX5A 2P5GA 1KFDA 4W5TA 4WQ4A 1VAZA 2J0KA 4BRLA 1UA1A 1HPZA 3P1GA 1E3MA 3OYGA 3VQPA 2EMSA 3AY9A 1DGKN 4CD1A 3AGKA 3L3VA 4KRFA 2V7ZA 4BC2A 3SPYA 1Z05A 3C7NB 3KKSA 1ZBSA 3VF2A 2IIRA 1WAJA 4MO5A 5AZJA 1HNXK 3UKRA 2WH5A 3RMBA 4CBUA 3FP5A 4CZFA 5HRSA 3F73A 2OTJN 3E9OA 3H3NO 4CJRA 3VQ9A 1SUQA 1U2VA 2CH6A 2G8VA 2WOMA 4CF9A 3EZ5A 1KAZA 4CK3A 3CCQN 1QHTA 1Z25A 4MO4A 4FYDA 1YUWA 5H1SQ 4ZTJA 1ZBUA 4DUZK 4HVJA 1S72N 2B5JA 1QVFM 4IG0A 3ZX3A 4C1NK 3HPGA 5CZ2A 4V19S 1L3TA 3C6UA 1NOYA 2X6SA 4FM1A 1V4SA 2O8EA 1GLBG 1QHAA 1HYVA 4YY3K 3AGRA 3BEXA 1RILA 4HHTA 1S9EA 1TAQA 1GLDG 2W41A 3FZHA 1EX4A 4I9LA 1S6QA 2HF4A 3TSPA 3HPHA 2UYTA 4HTUA 4JLHA 3TAPA 3TAGA 3I0SA 3MMVA 3V4IA 2ZGZA 5JVHL 3V9XA 2YHBA 1J54A 1N8RO 2NRWA 2HHHK 3QINA 4OPJA 2HVIA 3F5TA 1CZBA 2F9TA 3GE1A 5EX5A 4CEQA 4H5RA 4LSLA 3KLHA 1TYQB 3NH1A 4BQLA 5LJVA 3SV3A 1HMVA 3KTQA 3TAEA 3A5NC 4CESA 3L4IA 4QS7A 3KK2A 1RDWX 4NY0A 2HF3A 4G1QA 1QQOA 5FLXO 3G10A 4O0JA 1VSEA 3R3LA 2YHWA 1NM1A 4FLZA 2BH1A 3OYKA 3KK7A 2HSTA 4ISFA 3AVFA 1N33K 4FPBA 5FDLA 3MN7A 1SKRA 1S3XA 5AQIA 4Q0BA 1VK0A 3CC4N 3L2RA 3HXMA 1Q8IA 1XC3A 4H5TA 3C94A 1RDDA 3ZETA 4B8AB 4KFBA 1KQSM 1HRHA 3K9KA 3D45A 4DSEA 1TK5A 3VGKA 1BISA 3G9WA 3UE5A 4B3RK 2NRXA 1WNSA 4HDOA 4Z94A 3G6EN 4LF5K 4CGFA 1EKEA 3DLLL 1VBHA 5HOOA 2W6LA 3HBTA 5M1FA 3QNOA 3RR7A 2O8CA 3VQ7A 4K0KK 4FJXA 2GBZA 1QZ6A 3P31A 1U6ZA 3DXKB 4F7GA 1W0HA 5DK5A 4RW4A 3SBTA 1LOTB 1R59O 2WFBA 4JI8K 3PIOL 4BRMA 4BC4A 5AFUH 4PHTX 3K5LA 1VRUA 1KSPA 2QEXN 3C7NA 2E2OA 4R5PA 4Z4GA 1RFQA 3L4QA 3O9QA 4YHHK 2W42A 4DV6K 4BG9A 1NMNA 4DQ8A 3RMAA 5JLHA 2X74A 2HB5A 1MK7B 4DSJA 1JCGA 4KB1A 5AQTA 5SWMA 4CHQA 5HL7L 5J2PA 3T69A 5E26A 3SPZA 1VSLA 4CF8A 3KWIA 2NRVA 4J2DA 2D1KA 1VQON 5I42A 4FM0A 1NNEA 1YJWN 1K6YA 2DPNA 5AFUA 1OH5A 5HP1A 5LMUK 1N36K 4A5BA 3VQQA 4B3OA 3MCPA 3K0SA 1OH8A 3AARA 1XWLA 4JI3K 4BRFA 4EAHD 4GKKK 1HNWK 1WUAA 2HHUA 4K41A 4FZXC 1IBLK 2FF3B 3AO1A 3JAMO 4E7JA 3EL2A 2QA4N 2B6AA 4H4OA 5KTQA 3HT3A 2ZJRL 3VQ6A 3MDQA 3PUFA 1BGXT 4YOXA 3NF6A 5AQHA 4WCEL 3O9RA 1T6CA 1RGIA 1JLFA 3Q7BA 3THVA 4A5AA 1I3AA 1LW2A 2LBBA 4DR2K 1XHXA 1TYQA 3CFRA 4JV5K 3KKRA 3CC7N 4X65K 3DOLA 1CXQA 3HM8A 1RNHA 4FXDA 2O8DB 3T1HK 3BP8A 3MWTA 5C2DA 5DM6L 1X9SA 4CHYA 2G8IA 3O3GA 4GV6A 3O9TA 1C1CA 4OPKA 2IOCA 2HBKA 4F2SA 4Z4CA 1NGJA 2QWRA 3NFAA 4YORA 3VQEA 1NI2A 3HM9A 4M3UA 4KAZA 4CEBA 1GC7A 5EXWA 4ZRKA 2E1ZA 4O4GA 5AQNA 3QICA 3SUNA 4DV2K 1DT9A 1MU2A 5J2QA 2DIKA 1HKBA 3C6HA 4LFAK 4M3YA 3SLCA 2JWKA 2JGUA 4CFBA 1WSGA 1WSHA 3O4WA 4YNQA 4GKJK 3ZSWA 1T8EA 1NK9A 1EWQA 3VEXA 3ALYA 2PY5A 3CERA 2RE2A 3KJVA 1LWFA 4JKGB 3AVLA 3CC2N 4MDBA 4DV0K 2QKBA 4CERA 4DV3K 1BHLA 4ZRIA 1RBSA 3CHWA 3SYZA 4NXNK 2KHOA 3GDQA 4DFPA 2UXBK 3DXKA 4C1NI 2IVNA 3MN5A 2LSNA 3P5JA 4A61A 1BG3A 3EKSA 3VGLA 1ZBFA 2V7YA 3U3YA 4RW9A 3O08A 3CMEN 3WXIA 5JS2A 3DXMB 5B8HA 3IRXA 1E5WA 3DRRA 4E1NA 4JYAK 3OA9A 2B4JA 4C23A 2HMPA 4DHYA 3A2FA 1ZBHA 4HCCA 4FWNA 5M1QA 2OA8A 1GOBA 2YJEA 3KLEA 2HHTA 4FWPA 2YCHA 3VESA 4ELTA 1EP4A 3G25A 4E19A 1BDGA 4DTJA 4FJKA 4FJIA 5M1PA 2YNHA 3VN5A 4FLXA 4DTRA 1BOTO 4EHTA 1NWKA 4JS4A 3QFUA 1C0TA 1ACAA 4W5QA 3CJBA 4FLWA 4DF8A 2CGJA 2P9NB 1RDCA 3AVAA 1TUUA 3K2PA 1HJRA 1C0MA 1ZBLA 2PBDA 1C1BA 5BR8K 1BUPA 3NVMA 4A57A 3FZFA 4WQ4C 3QEPA 4H0YB 1W97L 4B08A 2UUAK 4WE1A 4FL9A 3UKRB 3D7EO 4JI6K 1B9DA 4AQYK 3ZX0A 3MWPA 3AVMA 3FLVA 3L2WA 1DEJA 3DLGA 4PWDA 1YTUA 2KKZA 5CE3A 2W40A 3PZDA 4DCHA 1U2VB 1ESVA 4JI4K 3CCRN 4FWSA 3K5MA 5AR0A 4C8MA 2VGMA 2NNWA 3MXMA 4WF9L 4JRQA 2FDQA 4FLVA 4NYNA 1HYZA 1L5UA 4FJ5A 3EY1A 3VENA 3H08A 3EZWA 4CEDA 1VSKA 4BQZA 4YDUA 3WUHA 5AQGA 5CYQA 3VEVA 3NGIA 1GLJO 1HBKA 5AQMA 1JCFA 4CJLA 4B8CA 4GW6A 1NKEA 4BGAA 4CIGA 3VTIA 3ENHA 2O8DA 1YXQA 5BPMA 1JJ2M 3BDPA 5AQFA 3W3DA 1JLBA 4I7FA 4BVOA 2QWLA 4IFVA 3OYHA 4FW1A 3QDKA 3K58A 2DFHA 3HRGA 4BC3A 4BRDA 4M42A 3LDLA 5C12A 3PIPL 1FK9A 3RMCA 2KFNA 4FW2A 2F8TA 1LAWA 4CZEA 4PKIA 3O4NA 3T3FA 5C42A 4AHTA 3E01A 2R82A 3HOTA 4CJTA 4KREA 5M1NA 4N76A 1NLVA 2GV9A 1BCMA 1NGHA 1D5AA 3T1YK 4CJ4A 2Q97A 4DFMA 4CGJA 4B9UA 4H0VB 2XHBA 4KTQA 3OVNA 3LZIA 4JKGA 3ZDTA 4E89A 3L8BA 2O4GA 4CK1A 4CZGA 4DLGA 2UUCK 3WQTA 4CHPA 4CEZA 1GOAA 1KLMA 4I6MB 1T03A 3MCAB 4O44A 3VEYA 5A2QO 2G8HA 4N41A 4B9QA 3SZ2A 2VCPA 2KZMA 3O8MA 4H0XB 3LANA 4OPAA 3DXMA 5E84A 3UKUB 4KPYA 1ILYA 1M90O 3M1FA 4JS5A 4FK2A 1S1VA 3LAMA 1RT1A 3H1QA 2NRZA 2QXFA 2ZPYA 3ZETB 5AZIA 1NJYA 3G0ZA 5BRHA 4CECA 3ZX2A 4F2RA 3N4QA 3CF5L 2PAVA 4LF4K 4KHUA 4H0PA 4BR2A 4QCLA 4FZZA 5AQQA 1NKCA 3CFOA 5TKWA 1Q86O 3VOVA 4O8UA 4U7BA 1N32K 5CY4A 1J19A 2G8WA 2ZF5O 1MA9B 1KAYA 2GWJA 3C6TA 3FZLA 2KTQA 2O8CB 3K9JA 4DUYK 2VG5A 2P9NA 5AQPA 3CM6A 3AVJA 2F4VK 5IT9O 2Y1IA 3QETA 4YOWA 1XHZA 3OYLA 5LMNK 3VQBA 2Q2RA 3HVRA 2ZJQL 3ENBA 4F3OA 1VSFA 4FO0A 2NRTA 4GY2B 4FSVA 3B8AX 5HRRA 1RTJA 5KGWA 1RT7A 1RBUA 5TKYA 4F9OA 1J9AA 3QEVA 4C8NA 3TR8A 3I8BA 2D0AA 1NGAA 2P9SA 4KO0A 2FBYA 3H46O 4IFYA 4EP4A 2KZZA 5J2NA 1Y19B 1EF1A 1RBVA 4O5FA 5AQOA 5E41A 1BIUA 3V1OA 4OLAA 4JD2B 3S9HA 1MWKA 2GTDA 3RRHA 4RTFD 3AO5A 1B92A 1KXPA 4B1UB 3E66A 3L2QA 2EHGA 3DM2A 4BDPA 2FXUA 4CJVA 4KI4A 2YHXA 4DXAB 3AU5A 1ASVA 4CF1A 1FKOA 1VBGA 1TK0A 3PV8A 5GAEP 1C0GA 2YHYA 3DOKA 3THXA 1ASWA 4M63C 4W5OA 4EZ6A 3R8EA 2VG7A 3G4SN 3KD1E 3CPWM 1WSJA 1YT3A 1UOCA 3BGRA 4BREA 3B6OA 4K8ZA 5J1EA 2I7NA 4XH1A 3I56N 5F2RA 4CJWA 5EU7A 2HW3A 4FLTA 3E9LA 3MAQA 3ZSXA 3VA0A 4M3WA 3JYTA 2Q36A 4Y0WA 4N47A 3LDSA 1BQNA 1TL1A 4RG8A 4BRGA 2P9PB 2VYPA 3RVCA 2XRIA 3SQ4A 3ZSOA 2EMTA 1D4XA 4BRIA 3U6FA 4M3TA 4YFUA 1GLLO 2QW9A 2G8KA 4FWKA 4A2AA 4BDZA 3O9SA 3K57A 3AVGA 5KPRA 5LL6Z 2HNDA 4FVMA 4H5NA 4OGCA 4JK8A 4B1WB 3V9SA 1R0AA 1K8AO 2HRJA 3HSTB 2ZWHA 3LWMA 2X78A 3OTOK 4H5VA 3ULDA 4CJKA 4IO8A 3HL8A 1C6VA 1HQUA 4I6MA 4A59A 2BE2A 3AA5X 4BR7A 4LF7K 3FZKA 2ASPA 2GEMA 4KHSA 3PSIA 5JMVA 4IKFA 3UKUA 4DLEA 3AA2A 1QS4A 1X3NA 3E9PA 1YAGA 5KI6A 1OH6A 1TKXA 3RR8A 4B3TK 4CJ7A 4PL7A 2OCEA 3SV4A 1BI4B 4JKFA 3SUQA 3FR0A 4FK4A 3HOSA 3LP3A 1LWEA 3SMSA 4E7HA 3S3NA 4FJLA 4KHPK 4XH5A 1CZAN 5MLCQ 1S1XA 3RMDA 4LFBK 3U4LA 4B1YB 1SKSA 2G8UA 4JI7K 1NBWA 4B1XB 4QAGA 4EHUA 4NYFA 1NGIA 3ZT1A 4GVEA 3T1AA 1XI1A 4C8OA 3TAQA 4ICLA 2OPRA 3NVKA 1KVCA 4CGDA 3DYAA 2E88A 5AQYA 3PO5A 3LZJA 2QM1A 2R7YA 3FFKB 3L2VA 3OYDA 1A5XA 4P7IA 3KIOA 3QIPA 2WC9A 2OTLN 3V1QA 3WNGA 1IJJA 4KH5A 4O5BA 2I5JA 3ID6A 4DV4K 1U04A 2O4IA 1SS6A 4FJHA 1E4FT 2IGIA 2VWKA 4M41A 3P39A 1LAVA 3MEGA 3VQ4A 2P9LB 4JD2A 5AQVA 3IG1A 4LSNA 3A8YA 4PY5A 3KHYA 1KTQA 2XY6A 4KH4A 2HBMA 5F0XA 1KRPA 4CGIA 3ULEB 4CI6A 1Q81O 3SBGA 3QIJA 5FPMA 4K43A 4DSLA 1GLFO 2JWLA 3GOIA 1ATSA 3U8ZA 1X1PA 3OYFA 1IG8A 4FWOA 3RSEB 4PQUA 4PKGA 4CGHA 1SZ2A 3TAFA 1U4BA 3KWGA 2FBVA 5C2FA 3EO3A 5C24A 3WXKA 5GINA 2WONA 3OJSA 3O9UA 4IO9L 5GAHP 3ISNC 4DV1K 4DQIA 2KQ2A 1RT5A 5AQZA 5F1XA 3MN9A 3O6WA 5KPTA 4F3TA 3FFIA 1T05A 4H0TB 3L2UA 1JXBA 1HQEA 1ST7A 3ZT4A 2D0CA 3PLAA 4LD0A 1HNVA 4EFHA 2YNGA 1GG3A 2P9PA 3ZSQA 1IKWA 4FCYA 2XY5A 5BPLA 5CR4A 1C0FA 4FK0A 1RT6A 4KTWA 1HNIA 1IKYA 3SK3A 1TL3A 4OX9K 2HNZA 3IKMA 4B9LA 3LPUA 3BF3A 4NLCA 1O13A 4JKCA 2W6KA 3CQ8A 2Q0UA 4Y1CA 3FZMA 3CXCM 2VQEK 4DB3A 4QS9A 1TVRA 4FWQA 5LJWA 1BQMA 4FJGA 4CIEA 3M8QA 5CZ1A 4Z4HA 1UWBA 3VEZA 4YDUC 3CM5A 3LL3A 4BE2A 3PO4A 1NK7A 3SI6A 3UB5A 4AM7A 1UAXA 4ISGA 1WLJA 4HWIA 4OKKA 3ZT0A 3O1BA 2GUPA 3SAGA 3G71N 1EETA 4OO1J 1X9WA 4XIUA 1NJWA 2CH5A 3VQ8A 1Q82O 1SL1A 2ASMA 4B1ZA 3AVIA 3S3OA 3AV9A 5AQLA 4C8LA 1BI4A 2VQFK 3SJJA 3HSCA 1YHQN 1HJOA 2QWPA 3H45C 3M6GA 3NAEA 1RTIA 3ZSZA 3CJCA 4Y1DA 1Q9YA 3FLCO 3VQAA 4X66K 3OYJA 4ZHRA 4H8KA 3JXUA 4ELUA 1ASUA 1HKGA 3VEWA 3LPTA 3WNFA 4DG1A 4FLUA 1RTDA 3SUPA 4J2BA 3BY5A 2PFUA 2E2QA 2RPIA 3TSUA 4J8FA 3D2EA 3LM2A 5EVZA 5C0YA 2D0OA 4NO7A 1SAZA 4ELVA 4B9TA 4L8RB 4KHYA 3HK2A 4DV7K 2FSJA 4OKEA 1JLQA 5BN9A 3R9PA 3SAHA 1XNRK 2WUSA 3SUOA 4RW6A 1VQ7N 1VQ5N 2X6NA 3Q7CA 2PYJA 4EP5A 1ITGA 4MQ3A 5AZIB 5HLFA 3QEIA 4IJNA 4AHSA 4G9ZA 4BRQA 2OPQA 4I9QA 4H03B 3MEDA 4DTMA 5KPZA 3U9ZA 3DI6A 4CBWA 2VGNA 2YKNA 1Q7YO 2EX3A 2CQUA 3KLIA 5IJMA 3AVCA 4O0IA 3M5RA 2NLXA 2RF2A 1OH7A 4IOXA 1JL2A 1RBRA 3BZCA 1RT4A 1KCFA 3VQ5A 2FJ9A 2UXDK 3LP2A 3NMUA 4ID5A 2P9LA 2AL6A 3O4QA 1SKWA 1IG9A 3TAMA 2FSKA 2PZSA 3DRSA 3KZBA 4CFDA 1NVLA 5JS1A 3ULEA 1WSIA 1IKXA 1XQSC 3HTVA 3P4IA 1HNZK 4DSIA 4CF0A 1BA0A 2AEHA 1JKHA 1EXQA 2F8SA 3RSEA 3KVGA 4DS5A 3AAPA 1MK9B 4BGBA 1GGOA 3EE8A 2IC3A 2A40A 4CFAA 3OYMA 2YI1A 1VSHA 1WSEA 3D0PA 1SV5A 5AJ3K 1K73O 2P9SB 4H4MA 4OGEA 4JEPA 3ZCMA 2FC0A 3F2KA 1RT3A 3SCXA 3QBXA 5M1OA 4M3ZA 4OKJA 3OBWA 2PYLA 3S3MA 3L0QA 1D9FA 2E5LK 3ATUA 3VMFB 1WAFA 5KQ8A 2O8FB 1HB8A 3LP0A 3O3FA 1DTTA 3WEEA 1VQ4N 4CBXA 1MWMA 4FOIA 3TTFA 3TARA 3FGUA 2HHSA 4YL8A 4E0DA 3THXB 4J2EA 3AA3A 4JKHA 3IFRA 1SQKA 1WBBA 2NZTA 2AJQA 3D2FA 4UY8O 4NLBA 1KVBA 3SMPA 4DTOA 1KVAA 1N34K 5IWAK 3A5LC 2YV0X 4HUGA 1S1TA 2NRHA 3NF7A 4BRKA 4CJEA 4ILJA 5K14A 1QQNA 1FJGK 3M3ZA 1MIXA 4HCBA 1GLAG 4BC5A 3O80A 4WYBA 5BPNA 5AQUA 2FSNA 3WXMB 4WFAL 3OJUA 4DTXA 1X3MA 4HUEA 3K59A 4LF8K 1NK8A 4MLHA 4B3SK 5HBMA 4KV8A 3OYEA 2FF6A 3F9KA 1N6QA 5AQSA 4ZTFA 4DTUA 1X9MA 5EY4A 1U49A 4O55A 4JRPA 1XMOK 2IVOA 5GIOA 4DV5K 3AU4A 3NE6A 1RT2A 1S9GA 3DJCA 1UA0A 2Q3SA 3I33A 2I1JA 4CZIA 5GADP 3JSMA 2XO7A 4EKUA 3IAYA 1NJXA 3OY9A 2HE7A 1I94K 2KFZA 4X62K 3MX2A 3EEQA 3HP6A 1JLAA 1L3UA 3P83D 3VETA 3OS0A 4IDHA 1IBMK 1O1WA 2Z1HA 4BROA 1QSLA 3VQCA 1QZ5A 2QWOA 4I2PA 3PVLA 3V9ZA 3MXJA 2X0SA 1GOCA
chains in the Genus database with same CATH topology
2NRRA 2ITMA 3VF6A 2EMTA 3AARA 1VQLN 1D4XA 4MDAA 4BRIA 3EE9A 1VQKN 4JAXA 1GLLO 1QQMA 2QW9A 3OW2M 4FWKA 4A2AA 1K8KA 5FPNA 3O9SA 4BRFA 4EAHD 2E1YA 3HI0A 3VPZA 5KPRA 3CMAN 1WUAA 4YOUA 4H5NA 4K41A 3F9MA 4JK8A 4B1WB 1K8AO 4AM6A 2HRJA 2FF3B 1BU6O 2ZWHA 2D0PA 1NGBA 5BR9A 3EL2A 2QA4N 3BINA 4H5VA 1ZXOA 1YJ9N 2HOEA 3SJHA 2ZJRL 3MDQA 4IO8A 3CCEN 4A62A 4A59A 3C6AA 4I6MA 3FE1A 4YOXA 5AQHA 3LDNA 4BR7A 4WCEL 3IVFA 3CI5A 3O9RA 1T6CA 1RGIA 2CGLA 3FZKA 2ASPA 2Q31A 3TU5A 2GEMA 5CHIA 2EWSA 2BTFA 3Q7BA 2J4RA 5JMVA 1T44A 3CPEA 3UKUA 1ISNA 4A5AA 1X3NA 3QMLA 4BRPA 3E9PA 1YAGA 1VQ9N 4YOYA 2YVCA 2LBBA 4CJ7A 5AZJB 4CZKA 4BVPA 4PL7A 1HLUA 2ZJPL 5JVGL 3VERA 2ABDA 1TYQA 4ILHA 5FPDA 3CCUN 3CC7N 4JKFA 3CCLN 3GBTA 2J0MA 4KH6A 3HM8A 3FR0A 5BRDA 3HOSA 3CCJN 1BWFO 3BP8A 3MWTA 2QXLA 1YF5L 2A5XA 2YX6A 3QB0A 3R1XA 5AQKA 3SMSA 1P8ZA 4BR4A 5DM6L 1KD1O 2D2QA 3E1YA 3ZYYX 4GV6A 3O9TA 3CQYA 4XH5A 4FWMA 2CGKA 1CZAN 4CZHA 2HBKA 5MLCQ 3U4LA 4B1YB 1NGJA 2QWRA 1NBWA 4B1XB 3CJAA 4IOCL 4YORA 1NI2A 4MLEA 1NGIA 4EHUA 4GVEA 2D10A 1GC7A 5EXWA 4ZRKA 2A3ZA 1EQYA 2E1ZA 1WOQA 5AQNA 2P9IA 3QICA 3QFPA 3QBWA 3NVKA 1DT9A 2DIKA 1HKBA 2E88A 1YI2N 3C6HA 5AQYA 2HBLA 4O8KA 4IFEA 3SLCA 4WFNL 1H1VA 2QM1A 1NTIA 3FFKB 2JWKA 2F9WA 4TKNA 2BUPA 3CCVN 2QTDA 3O4WA 5EOYA 4P7IA 5DM7L 3W0LA 1EO1A 1P90A 3VEXA 2WC9A 2RE2A 3CERA 4LC9B 2OTLN 2VWBA 3U9DA 5KQDA 1Q18A 4JKGB 1IJJA 4KH5A 3CC2N 3ID6A 2E2PA 4FWRA 1X9JA 4MDBA 1SS6A 1E4FT 3TSQA 1QVGM 3H3OB 3CHWA 4ZRIA 2Q0RA 4CYEA 1KBLA 2KHOA 3GDQA 4EIAA 3DAWA 1DKGD 2E8AA 3DXKA 2IVNA 4C1NI 3MN5A 1NGFA 3WXJA 3HZ6A 3P39A 4A61A 1BG3A 3EKSA 4NB4A 3VGLA 4B1VA 4CZJA 1KC8O 3SAFA 4GV3A 1RDUA 2V7YA 3C65A 2P9LB 4JD2A 5AQVA 1YITN 3O08A 3A8YA 3KHYA 3CMEN 3WXIA 3DXMB 1MDUB 2AA4A 1E5WA 4KH4A 5B8HA 2HBMA 5F0XA 3OA9A 4C23A 3ID8A 2HMPA 3ULEB 4DHYA 4E1JA 4CI6A 2I1KA 2FLOA 2KLAA 1Q81O 2D4WA 3SBGA 4FWNA 4H0OA 5M1QA 3O5BA 3QIJA 1HKCA 1DIKA 2P9KA 2RHKA 2YJEA 4JKBA 4IEIA 4WQ5A 4K43A 4FWPA 1NGGA 5FPMA 2YCHA 3VESA 5GIPA 1GLFO 2JWLA 2ASOA 3GOIA 4FVUA 4FPAA 4HDQA 2YJFA 3G25A 1ATSA 3S41A 3U8ZA 2V52B 1BDGA 1IG8A 3WQUA 4FWOA 3RSEB 5AQRA 5M1PA 4PKGA 4K42A 3CJ9A 1GC6A 1SZ2A 1Z6RA 3CCSN 3KWGA 1SGHA 5C2FA 4CZLA 3EO3A 1J6ZA 4YOTA 1NGEA 2QWMA 3WXKA 5GINA 1BOTO 3O9UA 4EHTA 4IO9L 1NWKA 5GAHP 3QFUA 1ACAA 3CJBA 5AQZA 3TTDA 5F1XA 5JICA 3MN9A 1NMDA 2CGJA 2P9NB 2V51B 3O6WA 5KPTA 3IUCA 4AF1A 4H0TB 4DKWA 1VQPN 1ST7A 1TUUA 4PKHA 1ATNA 1G99A 4L3QA 4PL8A 5C10A 3PLAA 4EFHA 3VEOA 4FWLA 2GX9A 3A5MC 1GG3A 2P9PA 2PBDA 3JS6A 3R6MA 4JHDB 1S22A 5BPLA 4JKEA 2I7PA 3EKUA 5CR4A 3C0BA 1BUPA 1C0FA 1OVYA 3LDOA 4OPHA 3NVMA 4A57A 3FZFA 3SK3A 3J8AA 4WQ4C 3EN9A 1BO5O 3IKMA 1VQMN 3BF3A 4NLCA 5AQXA 2H3GX 2ZGYA 4GNIA 4M7YA 4H0YB 4M7XA 1O13A 4JKCA 2E20A 1W97L 2Q0UA 3IDHA 2RQ1A 3FZMA 4FL9A 3UKRB 2CB8A 3CXCM 4DB3A 2A42A 3D7EO 4ISEA 4QS9A 3ZX0A 1VQ8N 4FWQA 3MWPA 5LJWA 1NGCA 3FLVA 2P9UB 1DEJA 2F7TA 2KKZA 5CE3A 4JK9A 2W40A 3PZDA 3WA0A 4RCHA 2QWNA 5ADXH 3MX5A 4DCHA 1U2VB 1ESVA 1VAZA 4WQ4A 3VEZA 2J0KA 4BRLA 3CCRN 4YDUC 3LL3A 4FWSA 3LDPA 1YHQN 5AR0A 1VQ6N 2VGMA 3UB5A 3AAQA 4AM7A 2A41A 2EMSA 3AY9A 1DGKN 4HWIA 4ISGA 4CD1A 5C2DA 2NNWA 3O1BA 3AGKA 4WF9L 2FDQA 2V7ZA 3D2EB 2GUPA 3VF4A 4BC2A 3SAGA 1Z05A 3G71N 3C7NB 3ENOA 3U7DA 4OO1J 1ZBSA 4BRNA 2OANA 2CH5A 3VF2A 4JN4A 1Q82O 3VENA 3GL1A 2ASMA 3EZWA 4B1ZA 2IIRA 5BRFA 3CCMN 4MO5A 5AZJA 4BQZA 4YDUA 3WUHA 5AQLA 5AQGA 3UKRA 2WH5A 3VEVA 1GLJO 4BRCA 4CBUA 1M1KO 1H4RA 1HBKA 3FP5A 1JCFA 1HJOA 2QWPA 3HSCA 5AQMA 3H45C 4CZFA 4BGAA 4JKAA 2WBNA 3M6GA 3VTIA 2OTJN 3IMXA 3ENHA 2P9UA 3CJCA 1HX1A 3ZEUB 1GLEG 3E9OA 3H3NO 1YXQA 5BPMA 3FLCO 3ZX2A 3MN6A 5ADXA 1JJ2M 1U2VA 2CH6A 5I9EB 4CZMA 3JXUA 5AQFA 3W3DA 1KAZA 3CCQN 1HB6A 1HKGA 3VEWA 4BVOA 3D6RA 4KBOA 4MO4A 2QWLA 2D11A 1YUWA 5H1SQ 3VGMA 3L6QA 3QDKA 3X23A 2PFUA 2E2QA 3H1VX 3HRGA 4J8FA 3TSUA 3D2EA 3LM2A 3P38A 5EVZA 4BG8A 4BC3A 4BRDA 3LDLA 5C12A 2D0OA 3PIPL 1S72N 5C0YA 4NO7A 1QVFM 1SAZA 4ILGB 4CZEA 4PKIA 3ZX3A 2FSJA 4C1NK 5AQJA 5BN9A 3R9PA 3SAHA 2R82A 3HOTA 2WUSA 3J7ZO 1VQ7N 1VQ5N 3Q7CA 5M1NA 1K8KB 4IXCA 1W2BM 1NLVA 1V4SA 5AZIB 1GLBG 1NGHA 1QHAA 4IJNA 3MK6A 4G9ZA 3AGRA 4BRQA 4H03B 3BEXA 2Q97A 4H0VB 5JLFA 3WXLA 4JKGA 2COPA 2QI2A 3ZDTA 5KPZA 3U9ZA 3DWLA 4CBWA 4CZGA 2VGNA 1GLDG 2W41A 3FZHA 1Q7YO 3WQTA 2CQUA 3CD6N 5IJMA 2HF4A 3TSPA 4R79A 2NLXA 3M5RA 4IOXA 4JKDA 2UYTA 4I6MB 1V4TA 3MCAB 3VEYA 3MMVA 2FJ9A 2ZGZA 4B9QA 5JVHL 3NMUA 1OKJA 2VCPA 2J0JA 2AL6A 2P9LA 5C15A 1N8RO 3O8MA 2NRWA 2FSKA 2GWKA 4H0XB 2E2NA 4OPAA 3DXMA 3KZBA 5E84A 1ZC6A 3F5TA 3UKUB 1ILYA 2IVPA 1NVLA 2F9TA 3GE1A 1M90O 5EX5A 4BR5A 3ULEA 4H5RA 3M1FA 3RVCA 3H1QA 2NRZA 2HBJA 5ELZA 1XQSC 1TYQB 3BUZB 3ATVA 3HTVA 3P4IA 2ZPYA 3ZETB 5AZIA 1BA0A 4BQLA 5LJVA 3A5NC 5BRHA 2AEHA 3H6EA 3L4IA 3CETA 1RDWX 4QS7A 4XH4A 1GLCG 3N4QA 4NY0A 3WEEB 2PAVA 3CF5L 2HF3A 4H0PA 1K9MO 3RSEA 4BR2A 3KVGA 5AQQA 5GAGP 1QQOA 3CQXA 3AAPA 1MK9B 4BGBA 1GGOA 3EE8A 3LDQA 5TKWA 2A40A 1Q86O 2YI1A 3VOVA 4O8UA 4U7BA 4RWTA 1YJNN 3R3LA 4GV9A 5M1KA 2YHWA 1NM1A 1J19A 2BH1A 1K73O 3KK7A 4BRAA 2ZF5O 1MA9B 1KAYA 2GWJA 2HSTA 2P9SB 3FZLA 4IEEA 4ISFA 4QS8A 2A6AA 3K9JA 4FPBA 3D2FB 4JEPA 3MN7A 1MIZB 3F2KA 2P9NA 5AQPA 1S3XA 2Q1NA 2P9IB 3BF1A 3QBXA 4IZ9A 5AQIA 4HTLA 5M1OA 4YOWA 4ZRJA 1E4GT 3CC4N 2Q2RA 3OBWA 4JNEA 3LM9A 1XC3A 4H5TA 2ZJQL 3L0QA 3ZETA 3ENBA 1JCEA 3ATUA 3VMFB 1NGDA 5FPEA 5KQ8A 1HB8A 4JHDA 1KQSM 3WEEA 3K9KA 4FO0A 4CBXA 1MWMA 1VQ4N 4FOIA 3TTFA 2NRTA 3VGKA 4GY2B 4FSVA 3B8AX 4H5WA 3FGUA 4YL8A 1HUXA 3G9WA 4BRHA 3UE5A 1T6DA 2NRXA 4HDOA 5TKYA 4Z94A 4F9OA 3G6EN 4A2BA 4JKHA 3I8BA 3IFRA 3DLLL 1NGAA 1VBHA 1SQKA 4BR0A 5HOOA 3HBTA 5M1FA 2P9SA 2NZTA 2GELA 3H46O 1QZ6A 3D2FA 3P31A 3TPQA 4UY8O 3U8XA 4NLBA 1U6ZA 1T3VA 3DXKB 3SMPA 1Y19B 1EF1A 1VQNN 4F7GA 1Y64A 4O5FA 5AQOA 4YOVA 3A5LC 2QWQA 4K25A 1HPMA 4JD2B 4BRKA 2NRHA 4BR9A 3EPYA 1MWKA 2GTDA 4ILJA 1KAXA 3SBTA 1LOTB 5BN8A 5BREA 1ATRA 1R59O 2WFBA 1QQNA 4RTFD 3M3ZA 1MIXA 1KXPA 4B1UB 3PIOL 1GLAG 4BC5A 3E66A 3O80A 4BRMA 4WYBA 3OBYA 5AFUH 3WT0A 5AQUA 4BC4A 4PHTX 5BPNA 2FSNA 3WXMB 4WFAL 2QEXN 2FXUA 4IOAL 1TUYA 2YHXA 1X3MA 4DXAB 3C7NA 2E2OA 2P9KB 1YVNA 3AU5A 4IJAA 1RFQA 3A5OC 4MLHA 3L4QA 1VBGA 3CIPA 3O9QA 4U67L 3GG4A 5LY3A 5GAEP 4JK7A 1C0GA 2YHYA 3VTHA 4FOEA 4BG9A 2FF6A 4DQ8A 4M63C 5JLHA 1YIJN 1NJIO 1MK7B 3CJ1A 5AQSA 3T7ZA 3OHRA 5EY4A 3R8EA 1JCGA 5AQTA 3G4SN 3O1WA 2IVOA 5HL7L 5GIOA 3AU4A 4WQ5C 3T69A 3DJCA 3TTCA 3ZEUA 4WFBL 3CPWM 5E26A 3I33A 4CZIA 2I1JA 5GADP 4EKUA 3KWIA 4BREA 1XUPO 2HE7A 4CD3A 3A0IX 2NRVA 2AP1A 2I7NA 3CJ7A 4XH1A 3I56N 4IWVA 1JDEA 1KC7A 2D1KA 1VQON 3MX2A 5F2RA 3I55N 1BA1A 4XEIA 3VETA 5AQWA 1YJWN 3E9LA 4IDHA 2DPNA 5AFUA 3N4PA 2Q36A 4Y0WA 4BROA 4A5BA 5JVLA 1QZ5A 2QWOA 4GXBA 3PVLA 1LCUA 4BRGA 2P9PB 4BY9C 2VYPA 3MCPA 2X0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E66 A;  4JKG A;  4JK9 A;  4JKH A;  4JKA A;  4ILG B;  4JKE A;  4JKD A;  3E9P A;  4JK8 A;  3E9O A;  4JK7 A;  3E9L A;  3SBG A;  4JKC A;  4JKG B;  3ENB A;  4ILH A;  4JKB A;  4JKF A;  4ILJ A;  3SBT A; 
#chains in the Genus database with same CATH topology
 2NRR A;  2ITM A;  3VF6 A;  4CW7 B;  4MDA A;  3EE9 A;  4JAX A;  1QQM A;  3OW2 M;  1IO2 A;  2E1Y A;  3HI0 A;  3VPZ A;  3HPO A;  3F9M A;  4E7K A;  1QE1 A;  3OYC A;  4AM6 A;  4DR4 K;  3NBP A;  2QKK A;  1BU6 O;  1NGB A;  5BR9 A;  3BIN A;  1ZXO A;  2HOE A;  3CG7 A;  3SJH A;  2ZM6 K;  3CCE N;  2E6L A;  3C6A A;  1WBD A;  3LDN A;  3K5N A;  2OZS A;  2CGL A;  3V9U A;  1U45 A;  2Q31 A;  3TU5 A;  3KK3 A;  4DR7 K;  3MEE A;  5CHI A;  2EWS A;  2BTF A;  1ISN A;  3M8P A;  3QML A;  1S1W A;  2YNI A;  1QSY A;  4N5S A;  4LY7 A;  1JLE A;  4YOY A;  2YVC A;  4CZK A;  4AHR A;  2ZJP L;  4Q5V A;  3VER A;  2ABD A;  4ILH A;  3CCU N;  1TKT A;  4KH6 A;  3NDK A;  3CCJ N;  3KLF A;  3QB0 A;  1KD1 O;  1P8Z A;  1NJZ A;  2D2Q A;  3E1Y A;  4AHU A;  3AVN A;  3CQY A;  4CZH A;  3SQ2 A;  4EZ9 A;  4AHV A;  4IOC L;  2ZD1 A;  3OS1 A;  2D10 A;  3V81 A;  2A3Z A;  4DU1 A;  1EQY A;  4DU4 A;  1WOQ A;  3QFP A;  3QBW A;  1REV A;  2HBL A;  4O8K A;  4WFN L;  4DQP A;  2WTU A;  2O8F A;  1NOZ A;  4TKN A;  2BUP A;  1G15 A;  4OJR A;  4CHO A;  1Z26 A;  1NK6 A;  5EOY A;  3AO2 A;  4M3X A;  1EO1 A;  1P90 A;  5SZT A;  5D3G A;  1WN7 A;  1ZBI A;  4LC9 B;  4LFC K;  5KQD A;  1X9J A;  3V6D A;  3TSQ A;  3H3O B;  4FM2 A;  1DLO A;  2Q0R A;  4CYE A;  3DAW A;  4DR1 K;  1NGF A;  3HZ6 A;  4CZJ A;  4B1V A;  4GV3 A;  3SAF A;  4CEF A;  4RW7 A;  3PX6 A;  4FJN A;  3C95 A;  2AA4 A;  2ZQB A;  1JXE A;  4CJQ A;  1RTH A;  2I1K A;  2FLO A;  3HO1 A;  4CFC A;  3THY A;  2DFF A;  3LAK A;  4HUF A;  3V9W A;  1DIK A;  1NGG A;  1TKZ A;  4DSK A;  1Y97 A;  4BE1 A;  4DTP A;  1IH7 A;  4CE9 A;  4FVU A;  4FPA A;  3THW B;  2YJF A;  3ZSR A;  1BIZ A;  4ID1 A;  5KRS A;  3RTV A;  1RBT A;  2GUI A;  3IS9 A;  1GC6 A;  1Z6R A;  3CCS N;  4CZL A;  1FKP A;  4YOT A;  1B9F A;  3HJF A;  1NGE A;  4BE0 A;  4JI2 K;  5HRN A;  1XNQ K;  1C1A A;  5CYM A;  2BAN A;  3TTD A;  2V51 B;  2HNY A;  3PX0 A;  4AF1 A;  4DKW A;  1TKD A;  1J53 A;  1LWC A;  3QES A;  1VQP N;  1ATN A;  1G99 A;  4L3Q A;  4W5R A;  2ITG A;  1BCO A;  4FWL A;  2GX9 A;  2D5R A;  3NCI A;  1WSF A;  3O3H A;  4JHD B;  2OPS A;  1IKV A;  2P5O A;  3C0B A;  3LDO A;  4E7L A;  3WNH A;  3J8A A;  2DY4 A;  3DMJ A;  5AQX A;  4M7Y A;  4M7X A;  4FJ7 A;  2E20 A;  3IDH A;  2RQ1 A;  2CB8 A;  3HYF A;  1VQ8 N;  4CJF A;  4BDY A;  1NGC A;  4DR6 K;  4OVL A;  4DF4 A;  3CYM A;  4RCH A;  5ADX H;  2QWN A;  3M8R A;  4FJ8 A;  4OLB A;  3ZT2 A;  3LDP A;  2NUB A;  4IBN A;  3RWU A;  4AH9 A;  3AAQ A;  2XY7 A;  4NCB A;  2A41 A;  2A1S A;  1NG9 A;  3D2E B;  1J5O A;  3VF4 A;  3L3U A;  4MFB A;  3ENO A;  3U7D A;  1TK8 A;  4BRN A;  3AVK A;  2OAN A;  4JN4 A;  3GL1 A;  2HVH A;  4DWI A;  5BRF A;  4BAC A;  3CCM N;  2RKI A;  3NHG A;  4BRC A;  1YVU A;  1M1K O;  1H4R A;  3DLK A;  3LWL A;  5FRO A;  4JKA A;  2WBN A;  3IMX A;  3DLB A;  2P9U A;  1HX1 A;  3ZEU B;  1GLE G;  4KB0 A;  3MN6 A;  5ADX A;  4K8X A;  2IAJ A;  5I9E B;  4CZM A;  3AVB A;  1HB6 A;  4JI0 K;  3D6R A;  4KBO A;  1A5V A;  4KHQ A;  2D11 A;  1KFS A;  3VGM A;  3L6Q A;  3X23 A;  3H1V X;  4BG8 A;  3P38 A;  1U47 A;  3K5O A;  4B9M A;  3TI0 A;  4CCH A;  3KD5 E;  4ILG B;  3TWH A;  2YHA A;  5AQJ A;  2FBX A;  3AA4 A;  3J7Z O;  3PX4 A;  4CJU A;  1K8K B;  4IXC A;  1W2B M;  4CHZ A;  3MK6 A;  3LAL A;  2HHV A;  5JLF A;  3WXL A;  2UXC K;  3NH0 A;  2COP A;  2QI2 A;  4LH5 A;  3DWL A;  3V1R A;  3CD6 N;  3I0R A;  4IDK A;  1U48 A;  4R79 A;  4CEA A;  4JKD A;  5KGX A;  1V4T A;  4GMJ B;  1OKJ A;  5C15 A;  2J0J A;  1S6P A;  2O8B B;  2GWK A;  3ITH A;  2E2N A;  4AIL C;  1NKB A;  1ZC6 A;  4LH4 A;  1YTA A;  2IVP A;  1QSS A;  3T19 A;  4FJJ A;  3UIQ A;  3ASM A;  4BR5 A;  3ZSV A;  2DTU A;  4X64 K;  2Z1I A;  1NK0 A;  4BWJ A;  2HHX A;  4DU3 A;  2HBJ A;  4PA1 A;  1WB9 A;  5ELZ A;  3BUZ B;  3ATV A;  3QLH A;  1VQ6 N;  3H6E A;  4XH4 A;  3THW A;  3CET A;  3WEE B;  4DFK A;  1GLC G;  2VG6 A;  1QQC A;  1K9M O;  5GAG P;  3CQX A;  3ZSY A;  3LDQ A;  2UU9 K;  4E7I A;  1ZYQ A;  3RRG A;  1VRT A;  4RWT A;  3NH2 A;  1YJN N;  4GV9 A;  1JL1 A;  5M1K A;  3SQ1 A;  4BRA A;  4QOZ B;  2P1J A;  4IEE A;  4QS8 A;  2A6A A;  3D2F B;  1MIZ B;  3MEC A;  2Q1N A;  1LV5 A;  4W5N A;  2P9I B;  3BF1 A;  4GVM A;  4IZ9 A;  4HTL A;  4ZRJ A;  3PY8 A;  1E4G T;  4JI1 K;  4JNE A;  3LM9 A;  1JCE A;  1QTM A;  3QEX A;  1NGD A;  1VHX A;  5FPE A;  4JHD A;  4CVN E;  1VSI A;  1FW6 A;  1TV6 A;  3OS2 A;  1S5J A;  4H5W A;  4IG3 A;  3ZT3 A;  1HUX A;  4BRH A;  1T6D A;  4NXM K;  1LW0 A;  1JLG A;  4A2B A;  1A5W A;  3ZLJ A;  3B6P A;  2XY8 A;  1C0U A;  4BR0 A;  2HHW A;  4CK2 A;  2ZE2 A;  2GEL A;  2Z1J A;  4TSX A;  1J5E K;  2YNF A;  3TPQ A;  2P51 A;  3U8X A;  1T3V A;  4N56 A;  3I8D A;  1VQN N;  1Y64 A;  4YOV A;  1T7P A;  2QWQ A;  4CIF A;  4FLY A;  4DFJ A;  4K25 A;  1HPM A;  4BR9 A;  3EPY A;  1KAX A;  5BN8 A;  5BRE A;  1ATR A;  1VSD A;  3HVT A;  3OBY A;  3WT0 A;  1IV0 A;  4IOA L;  1TUY A;  4B9V A;  2P9K B;  4CGG A;  1YVN A;  1HR0 K;  4IJA A;  3A5O C;  4U67 L;  4CJS A;  3CIP A;  3GG4 A;  5LY3 A;  4JK7 A;  1CZ9 A;  3VTH A;  3SNN A;  4FOE A;  4DQS A;  4KKO A;  1YIJ N;  3T7Z A;  3CJ1 A;  5C25 A;  3OHR A;  4I2Q A;  3O1W A;  2Y1J A;  4WQ5 C;  3TTC A;  4WFB L;  2IS3 A;  3ZEU A;  1RDA A;  4UQG A;  4CJ5 A;  3OYB A;  1XUP O;  4CD3 A;  2UUB K;  4Z4E A;  3A0I X;  2AP1 A;  2FBT A;  3CJ7 A;  4IWV A;  1KLN A;  2JLE A;  1JDE A;  1KC7 A;  2F96 A;  3KLG A;  3I55 N;  1BA1 A;  1NK4 A;  4XEI A;  5I3U A;  2BDP A;  5AQW A;  3AO4 A;  3NGZ A;  3N4P A;  4FJM A;  3U3G A;  4CEO A;  3TAB A;  4KTZ A;  1XC9 A;  4RW8 A;  5JVL A;  4GXB A;  1LCU A;  4BY9 C;  3MXI A;  1F21 A;  1VQL N;  4J2A A;  1JLC A;  1VQK N;  3AO3 A;  3QEW A;  3DLR A;  1K8K A;  5FPN A;  2OZM A;  4Z0U A;  3CMA N;  4F4K A;  4YOU A;  1RDB A;  4KHN A;  4DQR A;  4DMN A;  4DS4 A;  2D0P A;  4DQQ A;  2ATQ A;  1YJ9 N;  3DLE A;  3NF8 A;  4A62 A;  3FE1 A;  3IVF A;  3CI5 A;  4C8K A;  2DFE A;  3KK1 A;  4JI5 K;  1DTQ A;  2O8B A;  2J4R A;  1T44 A;  3CPE A;  4BRP A;  4BWM A;  1HYS A;  1N5Y A;  1VQ9 N;  5AZJ B;  1TGO A;  4BVP A;  3J7Y P;  3TAN A;  1HLU A;  1S1U A;  3J80 O;  5JVG L;  3J81 O;  4DTS A;  2YKM A;  4B9S A;  5FPD A;  3CCL N;  3GBT A;  2J0M A;  4CHN A;  4Z4F A;  3M8S A;  5BRD A;  1BWF O;  2QXL A;  1YF5 L;  2A5X A;  2YX6 A;  3R1X A;  2ETJ A;  3BZK A;  5AQK A;  4BR4 A;  4DR3 K;  5J2M A;  3ZYY X;  4FWM A;  2CGK A;  2A1R A;  4DSF A;  2HMI A;  5FRM A;  3CJA A;  4MLE A;  4M3R A;  1NU0 A;  3VA3 A;  3DLH A;  4LF9 K;  2P9I A;  1NK5 A;  1FXX A;  1L3S A;  3OYA A;  1YI2 N;  4B9N A;  1W7A A;  4IFE A;  1H1V A;  3SQ0 A;  4FJ9 A;  1NTI A;  5HRO A;  4M45 A;  3THY B;  1D8Y A;  2F9W A;  2OPP A;  3CCV N;  2QTD A;  5DM7 L;  2RN2 A;  3W0L A;  2O8E B;  4AHC A;  1D9D A;  2D0B A;  3QER A;  2VWB A;  3U9D A;  3VQD A;  1Q18 A;  2E2P A;  4FWR A;  2OYQ A;  1W9H A;  2BGG A;  2VWJ A;  4DTN A;  3NF9 A;  4B3M K;  1QVG M;  4PUO A;  1Q9X A;  4DR5 K;  1KBL A;  4EIA A;  1DKG D;  2E8A A;  3WXJ A;  3HP9 A;  1XMQ K;  4NB4 A;  1KC8 O;  1RDU A;  1BL3 A;  3C65 A;  2E4L A;  1YIT N;  1VSJ A;  1MDU B;  4E1M A;  3J7A P;  3ID8 A;  4E1J A;  2KLA A;  4CEE A;  5FRN A;  2D4W A;  4H0O A;  3O5B A;  5HRP A;  1HKC A;  4WQ5 A;  2P9K A;  2RHK A;  1NJI O;  4JKB A;  4IEI A;  4LF6 K;  5GIP A;  3OYI A;  4NCA A;  2ASO A;  3QNN A;  3NGY A;  4HDQ A;  3S41 A;  2KW4 A;  2V52 B;  3WQU A;  5AQR A;  3LP1 A;  4K42 A;  3CJ9 A;  1SGH A;  5DMR A;  4CF2 A;  1J6Z A;  2QWM A;  1VSM A;  3WNE A;  4KHW A;  2E6M A;  4FZY A;  4CJ3 A;  1IBK K;  3PSF A;  5JIC A;  4E3S A;  1NMD A;  1L3V A;  3IUC A;  3OYN A;  1SL0 A;  3AVH A;  4CJP A;  4PKH A;  5C10 A;  2IDO A;  4PL8 A;  3CFP A;  5T7B A;  3VEO A;  1CXU A;  3A5M C;  2HHQ A;  1CLQ A;  1OVQ A;  1RCH A;  3DRP A;  3JS6 A;  3R6M A;  1S22 A;  3QIO A;  4NCG A;  4JKE A;  2I7P A;  3EKU A;  1SL2 A;  4F8R A;  1OVY A;  4OPH A;  1VQM N;  1EWR A;  3EN9 A;  1BO5 O;  2H3G X;  2ZGY A;  4GNI A;  2QK9 A;  2G8F A;  2Z1G A;  4KI6 A;  3QO9 A;  2A42 A;  4ISE A;  1TAU A;  1I39 A;  2P9U B;  2F7T A;  5KRT A;  4JK9 A;  3WA0 A;  3EYZ A;  4Z4I A;  3MX5 A;  2P5G A;  1KFD A;  4W5T A;  4WQ4 A;  1VAZ A;  2J0K A;  4BRL A;  1UA1 A;  1HPZ A;  3P1G A;  1E3M A;  3OYG A;  3VQP A;  2EMS A;  3AY9 A;  1DGK N;  4CD1 A;  3AGK A;  3L3V A;  4KRF A;  2V7Z A;  4BC2 A;  3SPY A;  1Z05 A;  3C7N B;  3KKS A;  1ZBS A;  3VF2 A;  2IIR A;  1WAJ A;  4MO5 A;  5AZJ A;  1HNX K;  3UKR A;  2WH5 A;  3RMB A;  4CBU A;  3FP5 A;  4CZF A;  5HRS A;  3F73 A;  2OTJ N;  3E9O A;  3H3N O;  4CJR A;  3VQ9 A;  1SUQ A;  1U2V A;  2CH6 A;  2G8V A;  2WOM A;  4CF9 A;  3EZ5 A;  1KAZ A;  4CK3 A;  3CCQ N;  1QHT A;  1Z25 A;  4MO4 A;  4FYD A;  1YUW A;  5H1S Q;  4ZTJ A;  1ZBU A;  4DUZ K;  4HVJ A;  1S72 N;  2B5J A;  1QVF M;  4IG0 A;  3ZX3 A;  4C1N K;  3HPG A;  5CZ2 A;  4V19 S;  1L3T A;  3C6U A;  1NOY A;  2X6S A;  4FM1 A;  1V4S A;  2O8E A;  1GLB G;  1QHA A;  1HYV A;  4YY3 K;  3AGR A;  3BEX A;  1RIL A;  4HHT A;  1S9E A;  1TAQ A;  1GLD G;  2W41 A;  3FZH A;  1EX4 A;  4I9L A;  1S6Q A;  2HF4 A;  3TSP A;  3HPH A;  2UYT A;  4HTU A;  4JLH A;  3TAP A;  3TAG A;  3I0S A;  3MMV A;  3V4I A;  2ZGZ A;  5JVH L;  3V9X A;  2YHB A;  1J54 A;  1N8R O;  2NRW A;  2HHH K;  3QIN A;  4OPJ A;  2HVI A;  3F5T A;  1CZB A;  2F9T A;  3GE1 A;  5EX5 A;  4CEQ A;  4H5R A;  4LSL A;  3KLH A;  1TYQ B;  3NH1 A;  4BQL A;  5LJV A;  3SV3 A;  1HMV A;  3KTQ A;  3TAE A;  3A5N C;  4CES A;  3L4I A;  4QS7 A;  3KK2 A;  1RDW X;  4NY0 A;  2HF3 A;  4G1Q A;  1QQO A;  5FLX O;  3G10 A;  4O0J A;  1VSE A;  3R3L A;  2YHW A;  1NM1 A;  4FLZ A;  2BH1 A;  3OYK A;  3KK7 A;  2HST A;  4ISF A;  3AVF A;  1N33 K;  4FPB A;  5FDL A;  3MN7 A;  1SKR A;  1S3X A;  5AQI A;  4Q0B A;  1VK0 A;  3CC4 N;  3L2R A;  3HXM A;  1Q8I A;  1XC3 A;  4H5T A;  3C94 A;  1RDD A;  3ZET A;  4B8A B;  4KFB A;  1KQS M;  1HRH A;  3K9K A;  3D45 A;  4DSE A;  1TK5 A;  3VGK A;  1BIS A;  3G9W A;  3UE5 A;  4B3R K;  2NRX A;  1WNS A;  4HDO A;  4Z94 A;  3G6E N;  4LF5 K;  4CGF A;  1EKE A;  3DLL L;  1VBH A;  5HOO A;  2W6L A;  3HBT A;  5M1F A;  3QNO A;  3RR7 A;  2O8C A;  3VQ7 A;  4K0K K;  4FJX A;  2GBZ A;  1QZ6 A;  3P31 A;  1U6Z A;  3DXK B;  4F7G A;  1W0H A;  5DK5 A;  4RW4 A;  3SBT A;  1LOT B;  1R59 O;  2WFB A;  4JI8 K;  3PIO L;  4BRM A;  4BC4 A;  5AFU H;  4PHT X;  3K5L A;  1VRU A;  1KSP A;  2QEX N;  3C7N A;  2E2O A;  4R5P A;  4Z4G A;  1RFQ A;  3L4Q A;  3O9Q A;  4YHH K;  2W42 A;  4DV6 K;  4BG9 A;  1NMN A;  4DQ8 A;  3RMA A;  5JLH A;  2X74 A;  2HB5 A;  1MK7 B;  4DSJ A;  1JCG A;  4KB1 A;  5AQT A;  5SWM A;  4CHQ A;  5HL7 L;  5J2P A;  3T69 A;  5E26 A;  3SPZ A;  1VSL A;  4CF8 A;  3KWI A;  2NRV A;  4J2D A;  2D1K A;  1VQO N;  5I42 A;  4FM0 A;  1NNE A;  1YJW N;  1K6Y A;  2DPN A;  5AFU A;  1OH5 A;  5HP1 A;  5LMU K;  1N36 K;  4A5B A;  3VQQ A;  4B3O A;  3MCP A;  3K0S A;  1OH8 A;  3AAR A;  1XWL A;  4JI3 K;  4BRF A;  4EAH D;  4GKK K;  1HNW K;  1WUA A;  2HHU A;  4K41 A;  4FZX C;  1IBL K;  2FF3 B;  3AO1 A;  3JAM O;  4E7J A;  3EL2 A;  2QA4 N;  2B6A A;  4H4O A;  5KTQ A;  3HT3 A;  2ZJR L;  3VQ6 A;  3MDQ A;  3PUF A;  1BGX T;  4YOX A;  3NF6 A;  5AQH A;  4WCE L;  3O9R A;  1T6C A;  1RGI A;  1JLF A;  3Q7B A;  3THV A;  4A5A A;  1I3A A;  1LW2 A;  2LBB A;  4DR2 K;  1XHX A;  1TYQ A;  3CFR A;  4JV5 K;  3KKR A;  3CC7 N;  4X65 K;  3DOL A;  1CXQ A;  3HM8 A;  1RNH A;  4FXD A;  2O8D B;  3T1H K;  3BP8 A;  3MWT A;  5C2D A;  5DM6 L;  1X9S A;  4CHY A;  2G8I A;  3O3G A;  4GV6 A;  3O9T A;  1C1C A;  4OPK A;  2IOC A;  2HBK A;  4F2S A;  4Z4C A;  1NGJ A;  2QWR A;  3NFA A;  4YOR A;  3VQE A;  1NI2 A;  3HM9 A;  4M3U A;  4KAZ A;  4CEB A;  1GC7 A;  5EXW A;  4ZRK A;  2E1Z A;  4O4G A;  5AQN A;  3QIC A;  3SUN A;  4DV2 K;  1DT9 A;  1MU2 A;  5J2Q A;  2DIK A;  1HKB A;  3C6H A;  4LFA K;  4M3Y A;  3SLC A;  2JWK A;  2JGU A;  4CFB A;  1WSG A;  1WSH A;  3O4W A;  4YNQ A;  4GKJ K;  3ZSW A;  1T8E A;  1NK9 A;  1EWQ A;  3VEX A;  3ALY A;  2PY5 A;  3CER A;  2RE2 A;  3KJV A;  1LWF A;  4JKG B;  3AVL A;  3CC2 N;  4MDB A;  4DV0 K;  2QKB A;  4CER A;  4DV3 K;  1BHL A;  4ZRI A;  1RBS A;  3CHW A;  3SYZ A;  4NXN K;  2KHO A;  3GDQ A;  4DFP A;  2UXB K;  3DXK A;  4C1N I;  2IVN A;  3MN5 A;  2LSN A;  3P5J A;  4A61 A;  1BG3 A;  3EKS A;  3VGL A;  1ZBF A;  2V7Y A;  3U3Y A;  4RW9 A;  3O08 A;  3CME N;  3WXI A;  5JS2 A;  3DXM B;  5B8H A;  3IRX A;  1E5W A;  3DRR A;  4E1N A;  4JYA K;  3OA9 A;  2B4J A;  4C23 A;  2HMP A;  4DHY A;  3A2F A;  1ZBH A;  4HCC A;  4FWN A;  5M1Q A;  2OA8 A;  1GOB A;  2YJE A;  3KLE A;  2HHT A;  4FWP A;  2YCH A;  3VES A;  4ELT A;  1EP4 A;  3G25 A;  4E19 A;  1BDG A;  4DTJ A;  4FJK A;  4FJI A;  5M1P A;  2YNH A;  3VN5 A;  4FLX A;  4DTR A;  1BOT O;  4EHT A;  1NWK A;  4JS4 A;  3QFU A;  1C0T A;  1ACA A;  4W5Q A;  3CJB A;  4FLW A;  4DF8 A;  2CGJ A;  2P9N B;  1RDC A;  3AVA A;  1TUU A;  3K2P A;  1HJR A;  1C0M A;  1ZBL A;  2PBD A;  1C1B A;  5BR8 K;  1BUP A;  3NVM A;  4A57 A;  3FZF A;  4WQ4 C;  3QEP A;  4H0Y B;  1W97 L;  4B08 A;  2UUA K;  4WE1 A;  4FL9 A;  3UKR B;  3D7E O;  4JI6 K;  1B9D A;  4AQY K;  3ZX0 A;  3MWP A;  3AVM A;  3FLV A;  3L2W A;  1DEJ A;  3DLG A;  4PWD A;  1YTU A;  2KKZ A;  5CE3 A;  2W40 A;  3PZD A;  4DCH A;  1U2V B;  1ESV A;  4JI4 K;  3CCR N;  4FWS A;  3K5M A;  5AR0 A;  4C8M A;  2VGM A;  2NNW A;  3MXM A;  4WF9 L;  4JRQ A;  2FDQ A;  4FLV A;  4NYN A;  1HYZ A;  1L5U A;  4FJ5 A;  3EY1 A;  3VEN A;  3H08 A;  3EZW A;  4CED A;  1VSK A;  4BQZ A;  4YDU A;  3WUH A;  5AQG A;  5CYQ A;  3VEV A;  3NGI A;  1GLJ O;  1HBK A;  5AQM A;  1JCF A;  4CJL A;  4B8C A;  4GW6 A;  1NKE A;  4BGA A;  4CIG A;  3VTI A;  3ENH A;  2O8D A;  1YXQ A;  5BPM A;  1JJ2 M;  3BDP A;  5AQF A;  3W3D A;  1JLB A;  4I7F A;  4BVO A;  2QWL A;  4IFV A;  3OYH A;  4FW1 A;  3QDK A;  3K58 A;  2DFH A;  3HRG A;  4BC3 A;  4BRD A;  4M42 A;  3LDL A;  5C12 A;  3PIP L;  1FK9 A;  3RMC A;  2KFN A;  4FW2 A;  2F8T A;  1LAW A;  4CZE A;  4PKI A;  3O4N A;  3T3F A;  5C42 A;  4AHT A;  3E01 A;  2R82 A;  3HOT A;  4CJT A;  4KRE A;  5M1N A;  4N76 A;  1NLV A;  2GV9 A;  1BCM A;  1NGH A;  1D5A A;  3T1Y K;  4CJ4 A;  2Q97 A;  4DFM A;  4CGJ A;  4B9U A;  4H0V B;  2XHB A;  4KTQ A;  3OVN A;  3LZI A;  4JKG A;  3ZDT A;  4E89 A;  3L8B A;  2O4G A;  4CK1 A;  4CZG A;  4DLG A;  2UUC K;  3WQT A;  4CHP A;  4CEZ A;  1GOA A;  1KLM A;  4I6M B;  1T03 A;  3MCA B;  4O44 A;  3VEY A;  5A2Q O;  2G8H A;  4N41 A;  4B9Q A;  3SZ2 A;  2VCP A;  2KZM A;  3O8M A;  4H0X B;  3LAN A;  4OPA A;  3DXM A;  5E84 A;  3UKU B;  4KPY A;  1ILY A;  1M90 O;  3M1F A;  4JS5 A;  4FK2 A;  1S1V A;  3LAM A;  1RT1 A;  3H1Q A;  2NRZ A;  2QXF A;  2ZPY A;  3ZET B;  5AZI A;  1NJY A;  3G0Z A;  5BRH A;  4CEC A;  3ZX2 A;  4F2R A;  3N4Q A;  3CF5 L;  2PAV A;  4LF4 K;  4KHU A;  4H0P A;  4BR2 A;  4QCL A;  4FZZ A;  5AQQ A;  1NKC A;  3CFO A;  5TKW A;  1Q86 O;  3VOV A;  4O8U A;  4U7B A;  1N32 K;  5CY4 A;  1J19 A;  2G8W A;  2ZF5 O;  1MA9 B;  1KAY A;  2GWJ A;  3C6T A;  3FZL A;  2KTQ A;  2O8C B;  3K9J A;  4DUY K;  2VG5 A;  2P9N A;  5AQP A;  3CM6 A;  3AVJ A;  2F4V K;  5IT9 O;  2Y1I A;  3QET A;  4YOW A;  1XHZ A;  3OYL A;  5LMN K;  3VQB A;  2Q2R A;  3HVR A;  2ZJQ L;  3ENB A;  4F3O A;  1VSF A;  4FO0 A;  2NRT A;  4GY2 B;  4FSV A;  3B8A X;  5HRR A;  1RTJ A;  5KGW A;  1RT7 A;  1RBU A;  5TKY A;  4F9O A;  1J9A A;  3QEV A;  4C8N A;  3TR8 A;  3I8B A;  2D0A A;  1NGA A;  2P9S A;  4KO0 A;  2FBY A;  3H46 O;  4IFY A;  4EP4 A;  2KZZ A;  5J2N A;  1Y19 B;  1EF1 A;  1RBV A;  4O5F A;  5AQO A;  5E41 A;  1BIU A;  3V1O A;  4OLA A;  4JD2 B;  3S9H A;  1MWK A;  2GTD A;  3RRH A;  4RTF D;  3AO5 A;  1B92 A;  1KXP A;  4B1U B;  3E66 A;  3L2Q A;  2EHG A;  3DM2 A;  4BDP A;  2FXU A;  4CJV A;  4KI4 A;  2YHX A;  4DXA B;  3AU5 A;  1ASV A;  4CF1 A;  1FKO A;  1VBG A;  1TK0 A;  3PV8 A;  5GAE P;  1C0G A;  2YHY A;  3DOK A;  3THX A;  1ASW A;  4M63 C;  4W5O A;  4EZ6 A;  3R8E A;  2VG7 A;  3G4S N;  3KD1 E;  3CPW M;  1WSJ A;  1YT3 A;  1UOC A;  3BGR A;  4BRE A;  3B6O A;  4K8Z A;  5J1E A;  2I7N A;  4XH1 A;  3I56 N;  5F2R A;  4CJW A;  5EU7 A;  2HW3 A;  4FLT A;  3E9L A;  3MAQ A;  3ZSX A;  3VA0 A;  4M3W A;  3JYT A;  2Q36 A;  4Y0W A;  4N47 A;  3LDS A;  1BQN A;  1TL1 A;  4RG8 A;  4BRG A;  2P9P B;  2VYP A;  3RVC A;  2XRI A;  3SQ4 A;  3ZSO A;  2EMT A;  1D4X A;  4BRI A;  3U6F A;  4M3T A;  4YFU A;  1GLL O;  2QW9 A;  2G8K A;  4FWK A;  4A2A A;  4BDZ A;  3O9S A;  3K57 A;  3AVG A;  5KPR A;  5LL6 Z;  2HND A;  4FVM A;  4H5N A;  4OGC A;  4JK8 A;  4B1W B;  3V9S A;  1R0A A;  1K8A O;  2HRJ A;  3HST B;  2ZWH A;  3LWM A;  2X78 A;  3OTO K;  4H5V A;  3ULD A;  4CJK A;  4IO8 A;  3HL8 A;  1C6V A;  1HQU A;  4I6M A;  4A59 A;  2BE2 A;  3AA5 X;  4BR7 A;  4LF7 K;  3FZK A;  2ASP A;  2GEM A;  4KHS A;  3PSI A;  5JMV A;  4IKF A;  3UKU A;  4DLE A;  3AA2 A;  1QS4 A;  1X3N A;  3E9P A;  1YAG A;  5KI6 A;  1OH6 A;  1TKX A;  3RR8 A;  4B3T K;  4CJ7 A;  4PL7 A;  2OCE A;  3SV4 A;  1BI4 B;  4JKF A;  3SUQ A;  3FR0 A;  4FK4 A;  3HOS A;  3LP3 A;  1LWE A;  3SMS A;  4E7H A;  3S3N A;  4FJL A;  4KHP K;  4XH5 A;  1CZA N;  5MLC Q;  1S1X A;  3RMD A;  4LFB K;  3U4L A;  4B1Y B;  1SKS A;  2G8U A;  4JI7 K;  1NBW A;  4B1X B;  4QAG A;  4EHU A;  4NYF A;  1NGI A;  3ZT1 A;  4GVE A;  3T1A A;  1XI1 A;  4C8O A;  3TAQ A;  4ICL A;  2OPR A;  3NVK A;  1KVC A;  4CGD A;  3DYA A;  2E88 A;  5AQY A;  3PO5 A;  3LZJ A;  2QM1 A;  2R7Y A;  3FFK B;  3L2V A;  3OYD A;  1A5X A;  4P7I A;  3KIO A;  3QIP A;  2WC9 A;  2OTL N;  3V1Q A;  3WNG A;  1IJJ A;  4KH5 A;  4O5B A;  2I5J A;  3ID6 A;  4DV4 K;  1U04 A;  2O4I A;  1SS6 A;  4FJH A;  1E4F T;  2IGI A;  2VWK A;  4M41 A;  3P39 A;  1LAV A;  3MEG A;  3VQ4 A;  2P9L B;  4JD2 A;  5AQV A;  3IG1 A;  4LSN A;  3A8Y A;  4PY5 A;  3KHY A;  1KTQ A;  2XY6 A;  4KH4 A;  2HBM A;  5F0X A;  1KRP A;  4CGI A;  3ULE B;  4CI6 A;  1Q81 O;  3SBG A;  3QIJ A;  5FPM A;  4K43 A;  4DSL A;  1GLF O;  2JWL A;  3GOI A;  1ATS A;  3U8Z A;  1X1P A;  3OYF A;  1IG8 A;  4FWO A;  3RSE B;  4PQU A;  4PKG A;  4CGH A;  1SZ2 A;  3TAF A;  1U4B A;  3KWG A;  2FBV A;  5C2F A;  3EO3 A;  5C24 A;  3WXK A;  5GIN A;  2WON A;  3OJS A;  3O9U A;  4IO9 L;  5GAH P;  3ISN C;  4DV1 K;  4DQI A;  2KQ2 A;  1RT5 A;  5AQZ A;  5F1X A;  3MN9 A;  3O6W A;  5KPT A;  4F3T A;  3FFI A;  1T05 A;  4H0T B;  3L2U A;  1JXB A;  1HQE A;  1ST7 A;  3ZT4 A;  2D0C A;  3PLA A;  4LD0 A;  1HNV A;  4EFH A;  2YNG A;  1GG3 A;  2P9P A;  3ZSQ A;  1IKW A;  4FCY A;  2XY5 A;  5BPL A;  5CR4 A;  1C0F A;  4FK0 A;  1RT6 A;  4KTW A;  1HNI A;  1IKY A;  3SK3 A;  1TL3 A;  4OX9 K;  2HNZ A;  3IKM A;  4B9L A;  3LPU A;  3BF3 A;  4NLC A;  1O13 A;  4JKC A;  2W6K A;  3CQ8 A;  2Q0U A;  4Y1C A;  3FZM A;  3CXC M;  2VQE K;  4DB3 A;  4QS9 A;  1TVR A;  4FWQ A;  5LJW A;  1BQM A;  4FJG A;  4CIE A;  3M8Q A;  5CZ1 A;  4Z4H A;  1UWB A;  3VEZ A;  4YDU C;  3CM5 A;  3LL3 A;  4BE2 A;  3PO4 A;  1NK7 A;  3SI6 A;  3UB5 A;  4AM7 A;  1UAX A;  4ISG A;  1WLJ A;  4HWI A;  4OKK A;  3ZT0 A;  3O1B A;  2GUP A;  3SAG A;  3G71 N;  1EET A;  4OO1 J;  1X9W A;  4XIU A;  1NJW A;  2CH5 A;  3VQ8 A;  1Q82 O;  1SL1 A;  2ASM A;  4B1Z A;  3AVI A;  3S3O A;  3AV9 A;  5AQL A;  4C8L A;  1BI4 A;  2VQF K;  3SJJ A;  3HSC A;  1YHQ N;  1HJO A;  2QWP A;  3H45 C;  3M6G A;  3NAE A;  1RTI A;  3ZSZ A;  3CJC A;  4Y1D A;  1Q9Y A;  3FLC O;  3VQA A;  4X66 K;  3OYJ A;  4ZHR A;  4H8K A;  3JXU A;  4ELU A;  1ASU A;  1HKG A;  3VEW A;  3LPT A;  3WNF A;  4DG1 A;  4FLU A;  1RTD A;  3SUP A;  4J2B A;  3BY5 A;  2PFU A;  2E2Q A;  2RPI A;  3TSU A;  4J8F A;  3D2E A;  3LM2 A;  5EVZ A;  5C0Y A;  2D0O A;  4NO7 A;  1SAZ A;  4ELV A;  4B9T A;  4L8R B;  4KHY A;  3HK2 A;  4DV7 K;  2FSJ A;  4OKE A;  1JLQ A;  5BN9 A;  3R9P A;  3SAH A;  1XNR K;  2WUS A;  3SUO A;  4RW6 A;  1VQ7 N;  1VQ5 N;  2X6N A;  3Q7C A;  2PYJ A;  4EP5 A;  1ITG A;  4MQ3 A;  5AZI B;  5HLF A;  3QEI A;  4IJN A;  4AHS A;  4G9Z A;  4BRQ A;  2OPQ A;  4I9Q A;  4H03 B;  3MED A;  4DTM A;  5KPZ A;  3U9Z A;  3DI6 A;  4CBW A;  2VGN A;  2YKN A;  1Q7Y O;  2EX3 A;  2CQU A;  3KLI A;  5IJM A;  3AVC A;  4O0I A;  3M5R A;  2NLX A;  2RF2 A;  1OH7 A;  4IOX A;  1JL2 A;  1RBR A;  3BZC A;  1RT4 A;  1KCF A;  3VQ5 A;  2FJ9 A;  2UXD K;  3LP2 A;  3NMU A;  4ID5 A;  2P9L A;  2AL6 A;  3O4Q A;  1SKW A;  1IG9 A;  3TAM A;  2FSK A;  2PZS A;  3DRS A;  3KZB A;  4CFD A;  1NVL A;  5JS1 A;  3ULE A;  1WSI A;  1IKX A;  1XQS C;  3HTV A;  3P4I A;  1HNZ K;  4DSI A;  4CF0 A;  1BA0 A;  2AEH A;  1JKH A;  1EXQ A;  2F8S A;  3RSE A;  3KVG A;  4DS5 A;  3AAP A;  1MK9 B;  4BGB A;  1GGO A;  3EE8 A;  2IC3 A;  2A40 A;  4CFA A;  3OYM A;  2YI1 A;  1VSH A;  1WSE A;  3D0P A;  1SV5 A;  5AJ3 K;  1K73 O;  2P9S B;  4H4M A;  4OGE A;  4JEP A;  3ZCM A;  2FC0 A;  3F2K A;  1RT3 A;  3SCX A;  3QBX A;  5M1O A;  4M3Z A;  4OKJ A;  3OBW A;  2PYL A;  3S3M A;  3L0Q A;  1D9F A;  2E5L K;  3ATU A;  3VMF B;  1WAF A;  5KQ8 A;  2O8F B;  1HB8 A;  3LP0 A;  3O3F A;  1DTT A;  3WEE A;  1VQ4 N;  4CBX A;  1MWM A;  4FOI A;  3TTF A;  3TAR A;  3FGU A;  2HHS A;  4YL8 A;  4E0D A;  3THX B;  4J2E A;  3AA3 A;  4JKH A;  3IFR A;  1SQK A;  1WBB A;  2NZT A;  2AJQ A;  3D2F A;  4UY8 O;  4NLB A;  1KVB A;  3SMP A;  4DTO A;  1KVA A;  1N34 K;  5IWA K;  3A5L C;  2YV0 X;  4HUG A;  1S1T A;  2NRH A;  3NF7 A;  4BRK A;  4CJE A;  4ILJ A;  5K14 A;  1QQN A;  1FJG K;  3M3Z A;  1MIX A;  4HCB A;  1GLA G;  4BC5 A;  3O80 A;  4WYB A;  5BPN A;  5AQU A;  2FSN A;  3WXM B;  4WFA L;  3OJU A;  4DTX A;  1X3M A;  4HUE A;  3K59 A;  4LF8 K;  1NK8 A;  4MLH A;  4B3S K;  5HBM A;  4KV8 A;  3OYE A;  2FF6 A;  3F9K A;  1N6Q A;  5AQS A;  4ZTF A;  4DTU A;  1X9M A;  5EY4 A;  1U49 A;  4O55 A;  4JRP A;  1XMO K;  2IVO A;  5GIO A;  4DV5 K;  3AU4 A;  3NE6 A;  1RT2 A;  1S9G A;  3DJC A;  1UA0 A;  2Q3S A;  3I33 A;  2I1J A;  4CZI A;  5GAD P;  3JSM A;  2XO7 A;  4EKU A;  3IAY A;  1NJX A;  3OY9 A;  2HE7 A;  1I94 K;  2KFZ A;  4X62 K;  3MX2 A;  3EEQ A;  3HP6 A;  1JLA A;  1L3U A;  3P83 D;  3VET A;  3OS0 A;  4IDH A;  1IBM K;  1O1W A;  2Z1H A;  4BRO A;  1QSL A;  3VQC A;  1QZ5 A;  2QWO A;  4I2P A;  3PVL A;  3V9Z A;  3MXJ A;  2X0S A;  1GOC A; 
#chains in the Genus database with same CATH homology
 2NRR A;  2ITM A;  3VF6 A;  2EMT A;  3AAR A;  1VQL N;  1D4X A;  4MDA A;  4BRI A;  3EE9 A;  1VQK N;  4JAX A;  1GLL O;  1QQM A;  2QW9 A;  3OW2 M;  4FWK A;  4A2A A;  1K8K A;  5FPN A;  3O9S A;  4BRF A;  4EAH D;  2E1Y A;  3HI0 A;  3VPZ A;  5KPR A;  3CMA N;  1WUA A;  4YOU A;  4H5N A;  4K41 A;  3F9M A;  4JK8 A;  4B1W B;  1K8A O;  4AM6 A;  2HRJ A;  2FF3 B;  1BU6 O;  2ZWH A;  2D0P A;  1NGB A;  5BR9 A;  3EL2 A;  2QA4 N;  3BIN A;  4H5V A;  1ZXO A;  1YJ9 N;  2HOE A;  3SJH A;  2ZJR L;  3MDQ A;  4IO8 A;  3CCE N;  4A62 A;  4A59 A;  3C6A A;  4I6M A;  3FE1 A;  4YOX A;  5AQH A;  3LDN A;  4BR7 A;  4WCE L;  3IVF A;  3CI5 A;  3O9R A;  1T6C A;  1RGI A;  2CGL A;  3FZK A;  2ASP A;  2Q31 A;  3TU5 A;  2GEM A;  5CHI A;  2EWS A;  2BTF A;  3Q7B A;  2J4R A;  5JMV A;  1T44 A;  3CPE A;  3UKU A;  1ISN A;  4A5A A;  1X3N A;  3QML A;  4BRP A;  3E9P A;  1YAG A;  1VQ9 N;  4YOY A;  2YVC A;  2LBB A;  4CJ7 A;  5AZJ B;  4CZK A;  4BVP A;  4PL7 A;  1HLU A;  2ZJP L;  5JVG L;  3VER A;  2ABD A;  1TYQ A;  4ILH A;  5FPD A;  3CCU N;  3CC7 N;  4JKF A;  3CCL N;  3GBT A;  2J0M A;  4KH6 A;  3HM8 A;  3FR0 A;  5BRD A;  3HOS A;  3CCJ N;  1BWF O;  3BP8 A;  3MWT A;  2QXL A;  1YF5 L;  2A5X A;  2YX6 A;  3QB0 A;  3R1X A;  5AQK A;  3SMS A;  1P8Z A;  4BR4 A;  5DM6 L;  1KD1 O;  2D2Q A;  3E1Y A;  3ZYY X;  4GV6 A;  3O9T A;  3CQY A;  4XH5 A;  4FWM A;  2CGK A;  1CZA N;  4CZH A;  2HBK A;  5MLC Q;  3U4L A;  4B1Y B;  1NGJ A;  2QWR A;  1NBW A;  4B1X B;  3CJA A;  4IOC L;  4YOR A;  1NI2 A;  4MLE A;  1NGI A;  4EHU A;  4GVE A;  2D10 A;  1GC7 A;  5EXW A;  4ZRK A;  2A3Z A;  1EQY A;  2E1Z A;  1WOQ A;  5AQN A;  2P9I A;  3QIC A;  3QFP A;  3QBW A;  3NVK A;  1DT9 A;  2DIK A;  1HKB A;  2E88 A;  1YI2 N;  3C6H A;  5AQY A;  2HBL A;  4O8K A;  4IFE A;  3SLC A;  4WFN L;  1H1V A;  2QM1 A;  1NTI A;  3FFK B;  2JWK A;  2F9W A;  4TKN A;  2BUP A;  3CCV N;  2QTD A;  3O4W A;  5EOY A;  4P7I A;  5DM7 L;  3W0L A;  1EO1 A;  1P90 A;  3VEX A;  2WC9 A;  2RE2 A;  3CER A;  4LC9 B;  2OTL N;  2VWB A;  3U9D A;  5KQD A;  1Q18 A;  4JKG B;  1IJJ A;  4KH5 A;  3CC2 N;  3ID6 A;  2E2P A;  4FWR A;  1X9J A;  4MDB A;  1SS6 A;  1E4F T;  3TSQ A;  1QVG M;  3H3O B;  3CHW A;  4ZRI A;  2Q0R A;  4CYE A;  1KBL A;  2KHO A;  3GDQ A;  4EIA A;  3DAW A;  1DKG D;  2E8A A;  3DXK A;  2IVN A;  4C1N I;  3MN5 A;  1NGF A;  3WXJ A;  3HZ6 A;  3P39 A;  4A61 A;  1BG3 A;  3EKS A;  4NB4 A;  3VGL A;  4B1V A;  4CZJ A;  1KC8 O;  3SAF A;  4GV3 A;  1RDU A;  2V7Y A;  3C65 A;  2P9L B;  4JD2 A;  5AQV A;  1YIT N;  3O08 A;  3A8Y A;  3KHY A;  3CME N;  3WXI A;  3DXM B;  1MDU B;  2AA4 A;  1E5W A;  4KH4 A;  5B8H A;  2HBM A;  5F0X A;  3OA9 A;  4C23 A;  3ID8 A;  2HMP A;  3ULE B;  4DHY A;  4E1J A;  4CI6 A;  2I1K A;  2FLO A;  2KLA A;  1Q81 O;  2D4W A;  3SBG A;  4FWN A;  4H0O A;  5M1Q A;  3O5B A;  3QIJ A;  1HKC A;  1DIK A;  2P9K A;  2RHK A;  2YJE A;  4JKB A;  4IEI A;  4WQ5 A;  4K43 A;  4FWP A;  1NGG A;  5FPM A;  2YCH A;  3VES A;  5GIP A;  1GLF O;  2JWL A;  2ASO A;  3GOI A;  4FVU A;  4FPA A;  4HDQ A;  2YJF A;  3G25 A;  1ATS A;  3S41 A;  3U8Z A;  2V52 B;  1BDG A;  1IG8 A;  3WQU A;  4FWO A;  3RSE B;  5AQR A;  5M1P A;  4PKG A;  4K42 A;  3CJ9 A;  1GC6 A;  1SZ2 A;  1Z6R A;  3CCS N;  3KWG A;  1SGH A;  5C2F A;  4CZL A;  3EO3 A;  1J6Z A;  4YOT A;  1NGE A;  2QWM A;  3WXK A;  5GIN A;  1BOT O;  3O9U A;  4EHT A;  4IO9 L;  1NWK A;  5GAH P;  3QFU A;  1ACA A;  3CJB A;  5AQZ A;  3TTD A;  5F1X A;  5JIC A;  3MN9 A;  1NMD A;  2CGJ A;  2P9N B;  2V51 B;  3O6W A;  5KPT A;  3IUC A;  4AF1 A;  4H0T B;  4DKW A;  1VQP N;  1ST7 A;  1TUU A;  4PKH A;  1ATN A;  1G99 A;  4L3Q A;  4PL8 A;  5C10 A;  3PLA A;  4EFH A;  3VEO A;  4FWL A;  2GX9 A;  3A5M C;  1GG3 A;  2P9P A;  2PBD A;  3JS6 A;  3R6M A;  4JHD B;  1S22 A;  5BPL A;  4JKE A;  2I7P A;  3EKU A;  5CR4 A;  3C0B A;  1BUP A;  1C0F A;  1OVY A;  3LDO A;  4OPH A;  3NVM A;  4A57 A;  3FZF A;  3SK3 A;  3J8A A;  4WQ4 C;  3EN9 A;  1BO5 O;  3IKM A;  1VQM N;  3BF3 A;  4NLC A;  5AQX A;  2H3G X;  2ZGY A;  4GNI A;  4M7Y A;  4H0Y B;  4M7X A;  1O13 A;  4JKC A;  2E20 A;  1W97 L;  2Q0U A;  3IDH A;  2RQ1 A;  3FZM A;  4FL9 A;  3UKR B;  2CB8 A;  3CXC M;  4DB3 A;  2A42 A;  3D7E O;  4ISE A;  4QS9 A;  3ZX0 A;  1VQ8 N;  4FWQ A;  3MWP A;  5LJW A;  1NGC A;  3FLV A;  2P9U B;  1DEJ A;  2F7T A;  2KKZ A;  5CE3 A;  4JK9 A;  2W40 A;  3PZD A;  3WA0 A;  4RCH A;  2QWN A;  5ADX H;  3MX5 A;  4DCH A;  1U2V B;  1ESV A;  1VAZ A;  4WQ4 A;  3VEZ A;  2J0K A;  4BRL A;  3CCR N;  4YDU C;  3LL3 A;  4FWS A;  3LDP A;  1YHQ N;  5AR0 A;  1VQ6 N;  2VGM A;  3UB5 A;  3AAQ A;  4AM7 A;  2A41 A;  2EMS A;  3AY9 A;  1DGK N;  4HWI A;  4ISG A;  4CD1 A;  5C2D A;  2NNW A;  3O1B A;  3AGK A;  4WF9 L;  2FDQ A;  2V7Z A;  3D2E B;  2GUP A;  3VF4 A;  4BC2 A;  3SAG A;  1Z05 A;  3G71 N;  3C7N B;  3ENO A;  3U7D A;  4OO1 J;  1ZBS A;  4BRN A;  2OAN A;  2CH5 A;  3VF2 A;  4JN4 A;  1Q82 O;  3VEN A;  3GL1 A;  2ASM A;  3EZW A;  4B1Z A;  2IIR A;  5BRF A;  3CCM N;  4MO5 A;  5AZJ A;  4BQZ A;  4YDU A;  3WUH A;  5AQL A;  5AQG A;  3UKR A;  2WH5 A;  3VEV A;  1GLJ O;  4BRC A;  4CBU A;  1M1K O;  1H4R A;  1HBK A;  3FP5 A;  1JCF A;  1HJO A;  2QWP A;  3HSC A;  5AQM A;  3H45 C;  4CZF A;  4BGA A;  4JKA A;  2WBN A;  3M6G A;  3VTI A;  2OTJ N;  3IMX A;  3ENH A;  2P9U A;  3CJC A;  1HX1 A;  3ZEU B;  1GLE G;  3E9O A;  3H3N O;  1YXQ A;  5BPM A;  3FLC O;  3ZX2 A;  3MN6 A;  5ADX A;  1JJ2 M;  1U2V A;  2CH6 A;  5I9E B;  4CZM A;  3JXU A;  5AQF A;  3W3D A;  1KAZ A;  3CCQ N;  1HB6 A;  1HKG A;  3VEW A;  4BVO A;  3D6R A;  4KBO A;  4MO4 A;  2QWL A;  2D11 A;  1YUW A;  5H1S Q;  3VGM A;  3L6Q A;  3QDK A;  3X23 A;  2PFU A;  2E2Q A;  3H1V X;  3HRG A;  4J8F A;  3TSU A;  3D2E A;  3LM2 A;  3P38 A;  5EVZ A;  4BG8 A;  4BC3 A;  4BRD A;  3LDL A;  5C12 A;  2D0O A;  3PIP L;  1S72 N;  5C0Y A;  4NO7 A;  1QVF M;  1SAZ A;  4ILG B;  4CZE A;  4PKI A;  3ZX3 A;  2FSJ A;  4C1N K;  5AQJ A;  5BN9 A;  3R9P A;  3SAH A;  2R82 A;  3HOT A;  2WUS A;  3J7Z O;  1VQ7 N;  1VQ5 N;  3Q7C A;  5M1N A;  1K8K B;  4IXC A;  1W2B M;  1NLV A;  1V4S A;  5AZI B;  1GLB G;  1NGH A;  1QHA A;  4IJN A;  3MK6 A;  4G9Z A;  3AGR A;  4BRQ A;  4H03 B;  3BEX A;  2Q97 A;  4H0V B;  5JLF A;  3WXL A;  4JKG A;  2COP A;  2QI2 A;  3ZDT A;  5KPZ A;  3U9Z A;  3DWL A;  4CBW A;  4CZG A;  2VGN A;  1GLD G;  2W41 A;  3FZH A;  1Q7Y O;  3WQT A;  2CQU A;  3CD6 N;  5IJM A;  2HF4 A;  3TSP A;  4R79 A;  2NLX A;  3M5R A;  4IOX A;  4JKD A;  2UYT A;  4I6M B;  1V4T A;  3MCA B;  3VEY A;  3MMV A;  2FJ9 A;  2ZGZ A;  4B9Q A;  5JVH L;  3NMU A;  1OKJ A;  2VCP A;  2J0J A;  2AL6 A;  2P9L A;  5C15 A;  1N8R O;  3O8M A;  2NRW A;  2FSK A;  2GWK A;  4H0X B;  2E2N A;  4OPA A;  3DXM A;  3KZB A;  5E84 A;  1ZC6 A;  3F5T A;  3UKU B;  1ILY A;  2IVP A;  1NVL A;  2F9T A;  3GE1 A;  1M90 O;  5EX5 A;  4BR5 A;  3ULE A;  4H5R A;  3M1F A;  3RVC A;  3H1Q A;  2NRZ A;  2HBJ A;  5ELZ A;  1XQS C;  1TYQ B;  3BUZ B;  3ATV A;  3HTV A;  3P4I A;  2ZPY A;  3ZET B;  5AZI A;  1BA0 A;  4BQL A;  5LJV A;  3A5N C;  5BRH A;  2AEH A;  3H6E A;  3L4I A;  3CET A;  1RDW X;  4QS7 A;  4XH4 A;  1GLC G;  3N4Q A;  4NY0 A;  3WEE B;  2PAV A;  3CF5 L;  2HF3 A;  4H0P A;  1K9M O;  3RSE A;  4BR2 A;  3KVG A;  5AQQ A;  5GAG P;  1QQO A;  3CQX A;  3AAP A;  1MK9 B;  4BGB A;  1GGO A;  3EE8 A;  3LDQ A;  5TKW A;  2A40 A;  1Q86 O;  2YI1 A;  3VOV A;  4O8U A;  4U7B A;  4RWT A;  1YJN N;  3R3L A;  4GV9 A;  5M1K A;  2YHW A;  1NM1 A;  1J19 A;  2BH1 A;  1K73 O;  3KK7 A;  4BRA A;  2ZF5 O;  1MA9 B;  1KAY A;  2GWJ A;  2HST A;  2P9S B;  3FZL A;  4IEE A;  4ISF A;  4QS8 A;  2A6A A;  3K9J A;  4FPB A;  3D2F B;  4JEP A;  3MN7 A;  1MIZ B;  3F2K A;  2P9N A;  5AQP A;  1S3X A;  2Q1N A;  2P9I B;  3BF1 A;  3QBX A;  4IZ9 A;  5AQI A;  4HTL A;  5M1O A;  4YOW A;  4ZRJ A;  1E4G T;  3CC4 N;  2Q2R A;  3OBW A;  4JNE A;  3LM9 A;  1XC3 A;  4H5T A;  2ZJQ L;  3L0Q A;  3ZET A;  3ENB A;  1JCE A;  3ATU A;  3VMF B;  1NGD A;  5FPE A;  5KQ8 A;  1HB8 A;  4JHD A;  1KQS M;  3WEE A;  3K9K A;  4FO0 A;  4CBX A;  1MWM A;  1VQ4 N;  4FOI A;  3TTF A;  2NRT A;  3VGK A;  4GY2 B;  4FSV A;  3B8A X;  4H5W A;  3FGU A;  4YL8 A;  1HUX A;  3G9W A;  4BRH A;  3UE5 A;  1T6D A;  2NRX A;  4HDO A;  5TKY A;  4Z94 A;  4F9O A;  3G6E N;  4A2B A;  4JKH A;  3I8B A;  3IFR A;  3DLL L;  1NGA A;  1VBH A;  1SQK A;  4BR0 A;  5HOO A;  3HBT A;  5M1F A;  2P9S A;  2NZT A;  2GEL A;  3H46 O;  1QZ6 A;  3D2F A;  3P31 A;  3TPQ A;  4UY8 O;  3U8X A;  4NLB A;  1U6Z A;  1T3V A;  3DXK B;  3SMP A;  1Y19 B;  1EF1 A;  1VQN N;  4F7G A;  1Y64 A;  4O5F A;  5AQO A;  4YOV A;  3A5L C;  2QWQ A;  4K25 A;  1HPM A;  4JD2 B;  4BRK A;  2NRH A;  4BR9 A;  3EPY A;  1MWK A;  2GTD A;  4ILJ A;  1KAX A;  3SBT A;  1LOT B;  5BN8 A;  5BRE A;  1ATR A;  1R59 O;  2WFB A;  1QQN A;  4RTF D;  3M3Z A;  1MIX A;  1KXP A;  4B1U B;  3PIO L;  1GLA G;  4BC5 A;  3E66 A;  3O80 A;  4BRM A;  4WYB A;  3OBY A;  5AFU H;  3WT0 A;  5AQU A;  4BC4 A;  4PHT X;  5BPN A;  2FSN A;  3WXM B;  4WFA L;  2QEX N;  2FXU A;  4IOA L;  1TUY A;  2YHX A;  1X3M A;  4DXA B;  3C7N A;  2E2O A;  2P9K B;  1YVN A;  3AU5 A;  4IJA A;  1RFQ A;  3A5O C;  4MLH A;  3L4Q A;  1VBG A;  3CIP A;  3O9Q A;  4U67 L;  3GG4 A;  5LY3 A;  5GAE P;  4JK7 A;  1C0G A;  2YHY A;  3VTH A;  4FOE A;  4BG9 A;  2FF6 A;  4DQ8 A;  4M63 C;  5JLH A;  1YIJ N;  1NJI O;  1MK7 B;  3CJ1 A;  5AQS A;  3T7Z A;  3OHR A;  5EY4 A;  3R8E A;  1JCG A;  5AQT A;  3G4S N;  3O1W A;  2IVO A;  5HL7 L;  5GIO A;  3AU4 A;  4WQ5 C;  3T69 A;  3DJC A;  3TTC A;  3ZEU A;  4WFB L;  3CPW M;  5E26 A;  3I33 A;  4CZI A;  2I1J A;  5GAD P;  4EKU A;  3KWI A;  4BRE A;  1XUP O;  2HE7 A;  4CD3 A;  3A0I X;  2NRV A;  2AP1 A;  2I7N A;  3CJ7 A;  4XH1 A;  3I56 N;  4IWV A;  1JDE A;  1KC7 A;  2D1K A;  1VQO N;  3MX2 A;  5F2R A;  3I55 N;  1BA1 A;  4XEI A;  3VET A;  5AQW A;  1YJW N;  3E9L A;  4IDH A;  2DPN A;  5AFU A;  3N4P A;  2Q36 A;  4Y0W A;  4BRO A;  4A5B A;  5JVL A;  1QZ5 A;  2QWO A;  4GXB A;  3PVL A;  1LCU A;  4BRG A;  2P9P B;  4BY9 C;  2VYP A;  3MCP A;  2X0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...