4JKGB

Open and closed forms of mixed t1789p+r1865a and r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
214
Chain Sequence
b'LFSNQIIWFVDDTNVYRVPIHKLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
molecule tags Rna binding protein
source organism Homo sapiens
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
total genus 66
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkgB02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkgB01
3E66A 4JK8A 4JKGA 4JK7A 4ILJA 3E9LA 4ILHA 4ILGB 4JK9A 4JKAA 4JKCA 4JKFA 4JKBA 3E9PA 3E9OA 4JKGB 3SBGA 4JKHA 3ENBA 3SBTA 4JKEA 4JKDA
chains in the Genus database with same CATH superfamily
3WNHA 3AARA 3DXMA 1NKBA 4FM0A 1TK8A 3FFKB 3L2WA 3ZT1A 3VEXA 4CEFA 3SLCA 3SZ2A 1ITGA 4EZ6A 1B9FA 3D2FA 1ZBUA 4FWOA 1UWBA 3J80O 4LF7K 2JWLA 4FJGA 3DXMB 3VTHA 1VQ8N 2P9IB 3WEEB 1ISNA 2KZMA 1JXEA 4RW9A 4CEBA 1TUYA 3K5MA 2KFNA 1WLJA 5CY4A 5KQDA 2A3ZA 1M1KO 4PWDA 2P9UA 1MA9B 4KTZA 2D1KA 3MEGA 3KKSA 3LPTA 2EMTA 4E7HA 3OBYA 3OYKA 4JI7K 1O13A 2NUBA 4CBWA 4BE1A 4KI6A 3HJFA 1S22A 1C0GA 1XUPO 2ZE2A 2GWJA 2OZSA 2PYLA 1TGOA 2EX3A 2YJFA 4I6MB 1NGHA 4RG8A 4B9VA 3H1VX 5C42A 3ATVA 4N56A 1QSYA 4DU4A 2W41A 3AVHA 4CFDA 1Q86O 1KLNA 2UUBK 3LDQA 3OBWA 3BP8A 3DRRA 3CYMA 1NGJA 3ID8A 4JI2K 1VQ9N 4CZLA 4BRCA 4YL8A 1BQNA 3G71N 1S1WA 2P9PA 3QDKA 3OYAA 2F8SA 5FLXO 4KHPK 4WFBL 3DOLA 1YVUA 1UA1A 4W5RA 1WBDA 4W5QA 1NJWA 3MMVA 3FP5A 3O4WA 1VBGA 2YI1A 1TK0A 1MDUB 5M1KA 1VQ7N 3ENOA 1QQOA 4FJ8A 2E20A 3W0LA 4GVEA 1E4FT 3VEYA 3SV3A 2D5RA 4E7IA 4HUEA 2XY5A 4A61A 1GLLO 1HUXA 3CCUN 3OYBA 3NMUA 4B8CA 1BO5O 4Q5VA 3CD6N 2RN2A 4IEEA 4O55A 3ZSOA 5FRMA 4GV3A 1Y64A 3E1YA 3R1XA 1J19A 4FYDA 5FPDA 2HHQA 1G99A 3J7ZO 4K8ZA 2GEMA 3SQ2A 2Z1JA 3CJBA 3BDPA 4FJIA 4CD1A 5AQOA 2O8BA 3SBGA 1NK0A 3AO1A 5GINA 3P31A 3UKRA 2HHHK 3M3ZA 3M8RA 1YHQN 2FBXA 2O8CA 3THWA 4C8NA 1EF1A 1TVRA 3R9PA 5BREA 4JI8K 1WUAA 2DTUA 2E2NA 1IKXA 4C8KA 5F2RA 5AQXA 3KK1A 4B3OA 4F4KA 3FFIA 2FLOA 1WSFA 4NYNA 2JLEA 3PLAA 3V1RA 3S3NA 1NI2A 2IAJA 1IV0A 1FK9A 4CHOA 2X78A 5M1OA 1JLAA 4CHQA 4X64K 4BR4A 4YY3K 3TR8A 4M3TA 1KLMA 3QIOA 2QWQA 3U3GA 1CXUA 3KD5E 4BQZA 1T8EA 3TU5A 1W2BM 3KK7A 1QSLA 5BN8A 2WUSA 1WAFA 4Z94A 1VSDA 4FJLA 3D6RA 3ZETA 2VWBA 2BANA 3HT3A 3R6MA 2O8EB 3HSTB 2OANA 5LJVA 5KQ8A 1HPZA 4DR1K 2HNYA 4OKKA 1MIZB 1VRTA 1YTAA 2AL6A 4RCHA 1U49A 4DSEA 5C2DA 4NXNK 4FLYA 2HHUA 2Z1HA 1NM1A 3SQ1A 2J4RA 2VG6A 5HRNA 4E7KA 2AJQA 4JI3K 5AQKA 1QZ6A 3TTFA 3O08A 3X23A 2W42A 3PV8A 4OLBA 1NGDA 4DTSA 4FW2A 3HI0A 3HM8A 4FWNA 3IVFA 1C1CA 4K8XA 3TWHA 4OPAA 1RDCA 1ESVA 1J5OA 3H46O 1LWCA 3CXCM 4X66K 3THXB 1S6QA 4IEIA 4CZEA 1Q8IA 4IZ9A 3CJ1A 1JLFA 4Y1DA 5AJ3K 2O8DA 2P9LA 3MEDA 3BINA 3KWIA 3KKRA 3OS0A 5AFUH 4PQUA 2Y1IA 3ZEUA 2CH5A 5AQMA 5FDLA 2FSNA 1S1VA 5GAGP 4E7LA 1YF5L 1SKWA 4HTLA 3U9DA 5I42A 3U3YA 4KI4A 3KZBA 2D2QA 2BDPA 3FLVA 1RDBA 4JRPA 1UAXA 3Q7BA 1U45A 4CJ5A 4CGGA 3CMAN 3DLEA 2XY6A 4FWPA 1Q9YA 1DEJA 5CZ1A 3C7NB 2ZQBA 4J8FA 4BRNA 3ULDA 1HYZA 1LAWA 1I94K 4DTXA 4FPAA 1BIZA 4LD0A 4HVJA 3PX0A 5KRSA 5C15A 4LF6K 5C10A 2PFUA 2FDQA 4R5PA 4MFBA 2HNZA 4BE2A 3IDHA 3JS6A 2OPSA 2FBYA 2OPPA 3UIQA 2CGLA 4X65K 1X9MA 3SQ4A 4HHTA 3C65A 5AFUA 4FJXA 3TANA 1IBLK 1N6QA 4BY9C 1FJGK 5AQLA 4DR2K 3NBPA 2F96A 1TL3A 4DTJA 5LL6Z 4PUOA 4OGEA 3LP1A 1JJ2M 4L8RB 2RKIA 4O8KA 3KD1E 3GL1A 3CM6A 4BVOA 2G8UA 4KRFA 1Z05A 1HQUA 1JCGA 4CYEA 2CGKA 4W5OA 4TSXA 4B08A 2Q97A 3ATUA 4E1MA 1RT5A 2R7YA 3WT0A 3O3FA 1J6ZA 1OH8A 4B8AB 2A1RA 2YHBA 3FR0A 2I1JA 3WQTA 2HBJA 3OTOK 4E1JA 1W0HA 3U7DA 3CETA 1XHXA 4CCHA 3PZDA 4DQPA 4DLGA 4DSFA 3VA0A 4OVLA 1WSJA 3BZCA 4CBXA 1GGOA 2QKKA 2YVCA 2WH5A 3ZCMA 5GAHP 4DSLA 2QWRA 3GG4A 4AF1A 2RQ1A 4H5RA 3HK2A 3D2FB 1NTIA 3VQCA 4RW4A 2DPNA 1K8KB 3AVMA 4N5SA 3A0IX 3KVGA 4O5FA 3CCJN 4FJMA 3G6EN 2HHWA 3I8BA 3VQPA 4GV6A 1O1WA 1C1BA 1I39A 1LCUA 4FJHA 3Q7CA 4AHTA 3ISNC 5K14A 4BG9A 4DR7K 1B92A 1VSIA 3HZ6A 3HPGA 2A41A 1R59O 5GIOA 1WSGA 1NG9A 4FK4A 2UXBK 4ELVA 3TSPA 3VQAA 2HHVA 4FZXC 4Y1CA 3WXIA 3EZ5A 1N33K 2ZGYA 2P5GA 1A5XA 2NRVA 1NGFA 4FPBA 3H3OB 3VESA 4QCLA 4BREA 1SV5A 2F4VK 4JD2B 5AQVA 4KHSA 1ST7A 4FM2A 1JXBA 4CJ4A 3TABA 3C7NA 3NH0A 5FPEA 1DTQA 1P90A 4K41A 3L0QA 4BROA 1KBLA 2D0AA 3BZKA 4FLXA 2ZPYA 5J2MA 5EU7A 4BRHA 2PZSA 3E9OA 3SAHA 4ZHRA 2KQ2A 1VRUA 1D8YA 4FWKA 5AQPA 3HXMA 4DQSA 4JK8A 4BRQA 1YTUA 4U7BA 3SQ0A 3HBTA 4CFCA 2PAVA 1GLCG 2O8FB 2YV0X 2PYJA 3NVKA 3VQ8A 5AQIA 3MXMA 3BEXA 3IFRA 1ATNA 2OA8A 1Z25A 4DV3K 4HCCA 2KZZA 1JLGA 3FGUA 4A59A 2YHWA 5AQTA 2XRIA 2IVNA 2BGGA 2IOCA 1LW2A 2WTUA 4IFVA 4DS5A 4O0JA 5KTQA 1L3SA 1NMNA 1RDAA 3UB5A 2CB8A 3PIPL 4KAZA 3RMAA 3E9LA 1IKYA 3AVNA 3AVJA 3R8EA 1RDWX 1VSJA 3CERA 5AQHA 4DKWA 4BG8A 3F5TA 1QZ5A 4RW8A 4HDOA 1HJRA 2O8CB 2FBTA 2Q3SA 1S72N 4CJ7A 1D9DA 2A40A 4NCAA 3MAQA 3VF4A 1DTTA 4J2BA 1Y97A 3QEWA 4YOXA 1IKWA 1IG8A 4DUZK 1VSHA 1XNQK 1ASWA 1VSKA 1JKHA 5J2QA 4LF4K 4LSNA 1REVA 4L3QA 1GLJO 4RW6A 4JI6K 3HVRA 3V9XA 3O1BA 2VGNA 1K8KA 1NK5A 4JKBA 4KO0A 2UYTA 3NVMA 2ITMA 1ZC6A 1HKBA 3SUQA 1XMOK 1MIXA 2HVIA 4DTMA 3MDQA 3L4QA 4W5NA 1SUQA 1JL1A 4IXCA 3V9WA 3LZJA 3KIOA 4YDUC 3M1FA 4IJAA 3JXUA 2DY4A 5M1PA 2IIRA 3VEZA 3KLEA 4FK2A 1T03A 3CPEA 4KBOA 1HBKA 2IS3A 2G8FA 5GADP 5ADXH 5AQUA 4BC2A 1NGBA 4I2PA 3VQEA 4LFAK 5FRNA 3NF7A 3F9KA 2W40A 4H0VB 3PIOL 3D2EB 3CQYA 3CC4N 4ILHA 4A5AA 1EKEA 3HP6A 4DFJA 3C6TA 4ZRJA 5E41A 3J7AP 3AA4A 4DLEA 3MN5A 3WXMB 1ZBFA 2AP1A 3L6QA 3MX5A 4DFPA 4O44A 4Z0UA 4C8OA 4CESA 3EY1A 1BI4A 4BGAA 1C1AA 2XO7A 4P7IA 3UKUA 1CZBA 3ULEB 5TKWA 3CQXA 4ZRKA 3DRSA 4V19S 4OJRA 3HTVA 3RWUA 3DI6A 4KH4A 3AAQA 3LM2A 5AQSA 3AO2A 3ITHA 1NLVA 5KGWA 2Q2RA 1H1VA 2QI2A 4NXMK 4OPKA 4BDYA 3HM9A 2WC9A 3DLHA 4CJSA 1NJZA 1JL2A 4F8RA 4X62K 3O4QA 3N4QA 2OYQA 3CJCA 5BN9A 5A2QO 5SZTA 4DQRA 4AHUA 3OYDA 1QE1A 2YNIA 1J53A 4JHDB 4CJRA 4DTOA 1HJOA 4PKHA 3V4IA 3VQDA 4CW7B 2W6KA 4JYAK 1YUWA 1M90O 4KPYA 3QICA 2YX6A 1ILYA 4DV4K 4M41A 3KTQA 4BRKA 4NYFA 4PL7A 2X74A 1SL2A 2NRHA 5BPMA 3T1HK 4B3MK 1T7PA 3DJCA 4A5BA 3SNNA 1EX4A 3ALYA 2EHGA 4JEPA 4CZIA 4FVUA 3VTIA 4CZFA 4N47A 2QTDA 2OPRA 4B1YB 4JK9A 4JKAA 2HBMA 4RWTA 2E1YA 3U4LA 3EZWA 4M3ZA 1DLOA 3TTDA 4NY0A 4YOUA 5J2PA 4NO7A 4H0PA 4CIFA 4WE1A 4B9LA 4FWRA 4I9LA 4FWMA 1TL1A 1JLBA 1KTQA 3S41A 1U2VB 4WFAL 3VEVA 4CHYA 4CZMA 1VQLN 3TPQA 4CEAA 3K59A 3O8MA 4WQ5C 3HOTA 5C12A 1JLEA 4BR0A 2VQEK 1YITN 2J0JA 5JVLA 2D0CA 4FM1A 4KHQA 2Q0RA 1D4XA 3QMLA 4BQLA 5AQWA 1RBVA 1TV6A 2YCHA 1S6PA 2Z1IA 3QLHA 5BPNA 4E89A 4JKDA 3LM9A 2UU9K 4GVMA 4A57A 4BC5A 4FLZA 3DLRA 3AV9A 4DV2K 1NJXA 1S1UA 1NOZA 4H03B 4B1VA 3KLIA 3BGRA 3P5JA 3CC7N 4HUGA 1RT2A 1T6DA 4CJLA 5I9EB 3OY9A 4Z4IA 1RT7A 3QESA 1EP4A 1HMVA 3VQ4A 1Q82O 3BF1A 4M63C 4OKEA 3HOSA 3QEXA 4CGHA 2D11A 3OYNA 1WSHA 3IG1A 1C0MA 2YJEA 4CEQA 3FZMA 3SCXA 3O3GA 2LBBA 4JK7A 1SGHA 2P9IA 3FZHA 5AR0A 4H5WA 3V9ZA 3SAGA 4CJQA 1BWFO 4CK1A 3V1OA 1VQKN 4HDQA 1TUUA 5I3UA 2DFHA 2CH6A 3M5RA 3VOVA 1QQNA 2D0BA 2D10A 3GBTA 1BG3A 2P9KB 1RTJA 3WA0A 1Q18A 1WOQA 3G25A 3WNEA 3NGYA 3RMBA 2G8HA 4PA1A 1NK7A 3ID6A 4KFBA 4J2AA 2HHTA 4MDBA 3VEOA 5KRTA 2DFFA 4FWQA 1J9AA 2D0OA 5EOYA 3ULEA 4DB3A 1NGGA 3QIJA 4CJKA 3DAWA 1ZXOA 3BUZB 3EPYA 4GMJB 4B9MA 4OKJA 1FKPA 2HF4A 1NGIA 2YNHA 4DTNA 5LMUK 3MCAB 5FPMA 3CFOA 1YVNA 4GNIA 1BDGA 5BRHA 1KFDA 1Y19B 4F3TA 3K9JA 3ZDTA 3A5MC 3VQ9A 4JRQA 1OH5A 5AZJA 3OJSA 2OCEA 1Q9XA 1JDEA 1X3NA 1GOCA 1U48A 1NGAA 1RBSA 5BR8K 1KXPA 3VQ6A 5HRPA 3RMCA 2I7PA 1D9FA 4XIUA 4FZZA 4PHTX 2HHXA 1X1PA 4A2AA 4JKGB 4DR3K 1IBKK 1NWKA 1L3TA 3O1WA 3NGZA 3VA3A 3CPWM 5AZIA 1NGEA 4EP4A 4OX9K 4FJ7A 4KH5A 4AH9A 3V81A 4YHHK 5HL7L 4DF4A 1BU6O 3VQ7A 4JAXA 5KPZA 4IO8A 4K0KK 4YNQA 3JYTA 4M7XA 1HX1A 4FWLA 4UY8O 4BDZA 2ASOA 4E19A 2XHBA 4JKFA 1HLUA 3FZKA 4EZ9A 1TKXA 1MK7B 1CZ9A 4CD3A 3L2VA 1ZBLA 1EQYA 4FK0A 4IFYA 1TKZA 3TAMA 5CHIA 3TAEA 2I5JA 4FJJA 1C0UA 3O80A 3LDPA 3UKRB 5FROA 4M3UA 3VF6A 4J2DA 2QWNA 1HNXK 2HB5A 3AVCA 5HBMA 2COPA 3VQBA 3CCLN 2PY5A 1LV5A 1XC3A 4QS8A 4FJ9A 4E7JA 1XI1A 2YKMA 1YI2N 4C1NK 3SPYA 5MLCQ 4CJTA 2F8TA 2CQUA 2KFZA 4KHWA 2HRJA 3NHGA 1BOTO 2P1JA 4DTRA 3WXJA 1N36K 4YOWA 4DXAB 3SJJA 2E88A 4JV5K 4GKJK 3OYMA 3EN9A 2HNDA 4JI0K 3K9KA 1GC6A 1MWMA 3QNOA 4BRGA 4B1XB 1X9SA 1C0FA 4FZYA 4CI6A 3THWB 1HB8A 4WQ4C 4H5NA 1RT6A 4XH5A 1X9WA 2YNGA 2YKNA 3KLGA 2EWSA 4WQ5A 3G0ZA 2FSJA 3C94A 3OYHA 3M8QA 2DIKA 3VMFB 2NRTA 3ZYYX 3THYB 2O8EA 3I0RA 4JI5K 5HOOA 1KAXA 4CBUA 1OH7A 1B9DA 1ZYQA 5IT9O 2X6SA 1XQSC 2NZTA 3E9PA 1S1XA 2WFBA 4O8UA 2OTJN 4OPJA 4CGFA 1E3MA 4CF9A 4QS7A 3GDQA 3F73A 4Z4FA 2HBKA 4CFBA 3ZSRA 4CIEA 4AHRA 1HNZK 3CCEN 1CZAN 2AA4A 3ZETB 2E2OA 4EKUA 3ZX3A 3UKUB 1G15A 3G10A 2HBLA 3KWGA 3AGRA 3T1AA 1JCFA 3O3HA 3QFUA 3LPUA 3IS9A 1YJNN 4J2EA 4H4MA 4LH4A 2GTDA 1VQ5N 2KLAA 1J54A 2QM1A 3NFAA 1SZ2A 5F0XA 3LDSA 3SK3A 2KW4A 1LOTB 3PX4A 3QFPA 4M3WA 4CF2A 3ZEUB 3ZLJA 4M3XA 2G8VA 1EETA 2V7YA 3C0BA 5AQJA 2OTLN 3MXIA 1VSFA 5HRSA 1BUPA 4BVPA 3CI5A 1NKEA 4F2SA 3H08A 3UE5A 2J0KA 3F2KA 4DQQA 2HHSA 3OYLA 1IO2A 3AVIA 1XWLA 5DMRA 4DQIA 2P51A 3MWPA 3PSFA 2P9PB 3MN6A 3CJ9A 2HVHA 5CYQA 2ZF5O 3CF5L 2O8FA 5AQRA 2VGMA 3VN5A 4CEOA 2GBZA 1XHZA 5TKYA 4YFUA 5AQQA 4DWIA 4Y0WA 1HNIA 5M1NA 2IC3A 1HYVA 1NJIO 3OVNA 3QBWA 3RR8A 4E1NA 3CMEN 2UUCK 4KB0A 3THVA 2QA4N 1N8RO 4JI1K 3P4IA 4DV5K 3S3OA 1UOCA 1OH6A 3I33A 3J8AA 2NNWA 4DTPA 3HPHA 4CE9A 1U2VA 1R0AA 4WF9L 3DM2A 5HRRA 1YXQA 2GV9A 3DRPA 5EVZA 3CG7A 1NKCA 3SBTA 4KH6A 3SYZA 1KC7A 1KSPA 3BF3A 1Z26A 3WNGA 3SUNA 1KRPA 3QETA 1WB9A 4IDKA 3NF8A 4R79A 3K5NA 5ADXA 5HLFA 1YT3A 3N4PA 1QSSA 3THYA 4OGCA 4OLAA 1KD1O 5LJWA 1TYQA 1XC9A 1NGCA 1ACAA 4CZGA 4I9QA 4GKKK 1BA1A 1FW6A 4I2QA 4Z4EA 3SV4A 4FO0A 3BY5A 4YDUA 1NMDA 2OZMA 2VQFK 3WNFA 4IG0A 1KVAA 5IWAK 4OPHA 1QVFM 1LWFA 1TKTA 3SMSA 1GLAG 3HO1A 1VSEA 3LDLA 3K57A 4B1ZA 4YOVA 4FSVA 3VENA 4DV0K 4OO1J 2RHKA 1MU2A 1YAGA 4DU1A 3NDKA 3VQ5A 4LFCK 1BIUA 1ASUA 3A5OC 4JI4K 4DHYA 1GLEG 4IFEA 4ISFA 3RRHA 4ILGB 4BRAA 3QERA 1NK9A 1QHTA 3KHYA 1UA0A 3H6EA 4IG3A 3W3DA 4AM6A 1RBUA 5M1FA 3AVLA 1L3UA 4M3YA 2E8AA 3LZIA 1J5EK 2IDOA 2FF6A 4BGBA 2YHAA 4CZKA 3KK3A 4HTUA 3I0SA 3WXLA 3CCMN 2WONA 4NCGA 2P9LB 1HB6A 4B9UA 3LALA 4H8KA 5ELZA 1U4BA 3QEIA 3LL3A 2VG5A 2CGJA 3AO4A 3ZT0A 3D7EO 4O5BA 4FJKA 4JNEA 3AU4A 1VAZA 4K25A 2XY8A 3T69A 3EO3A 3T19A 4CHNA 4PY5A 4XEIA 3H1QA 2NRRA 1NK6A 2D4WA 1JLQA 4H5TA 1S3XA 2BH1A 4CK2A 1NOYA 3DYAA 3MX2A 3VGLA 3B8AX 3WUHA 3MCPA 1IKVA 4CEEA 1TKDA 4YOYA 1TK5A 3VGKA 4I7FA 2O8DB 4CF1A 1KQSM 4H0TB 4HWIA 1S5JA 3P1GA 4DR6K 3AO3A 2GELA 2VWJA 4LH5A 4E0DA 4JLHA 5T7BA 4B1WB 4FL9A 1VBHA 1VQ6N 1BISA 2ZD1A 3AA3A 3CHWA 3RTVA 3AA2A 1MK9B 4DR5K 3MECA 4BRMA 2ASPA 3LWMA 4LF9K 1W7AA 4CGDA 4A2BA 1IG9A 3ZSWA 2YHYA 4C23A 2PBDA 4KHNA 4BR2A 1RGIA 3SJHA 1DGKN 4CJWA 3PX6A 5HP1A 4B1UB 4M42A 4DCHA 3LDNA 3T7ZA 3SMPA 2RF2A 1U04A 1A5VA 2F9WA 3NF9A 5JICA 4FXDA 1VQMN 1RCHA 3HSCA 4DV6K 4WFNL 3L2QA 3O9UA 2ZGZA 4H4OA 3MXJA 1N32K 1HR0K 1K8AO 4JS5A 1JCEA 2NLXA 1BQMA 5DK5A 3V1QA 3QIPA 4KHUA 1BGXT 3L3VA 2HE7A 2X6NA 1KFSA 4M45A 3MN7A 4KB1A 1ATRA 2FXUA 3HVTA 3QNNA 5FPNA 3IUCA 4IDHA 3KLHA 3DXKA 4JKEA 2FSKA 1NU0A 3HRGA 2BTFA 4ZTJA 5C25A 3TAGA 3GOIA 1RT1A 3AVBA 1GG3A 1BCOA 4CZHA 2WBNA 4CFAA 1VQON 1NJYA 4AHCA 2RPIA 2J0MA 3OYFA 4BWMA 1L5UA 1RTIA 3WXKA 2E2QA 1BA0A 1E4GT 4IWVA 2QXFA 3HPOA 2ETJA 2ZJRL 2IVPA 4LFBK 3VERA 3C95A 4CK3A 2FF3B 3RVCA 4ELTA 4EFHA 4G1QA 4MLHA 1DKGD 3K5OA 2G8KA 1QVGM 4BR9A 3ENHA 4BRLA 5GAEP 2GUIA 3EE8A 1HKGA 1IH7A 1QQMA 4JKCA 3PSIA 4GW6A 3JSMA 2R82A 5F1XA 5BPLA 1X9JA 4DS4A 4BR5A 2W6LA 4DFMA 4EP5A 4B3SK 1SL0A 3L3UA 5C0YA 1RT3A 2ZJPL 1U6ZA 4FLWA 2O4GA 3LANA 3EE9A 3H45C 4B3TK 4FVMA 3WQUA 2E4LA 1WN7A 2Z1GA 3ZX2A 4BRFA 4DQ8A 3M6GA 5CE3A 2P9KA 3C6UA 4RW7A 4M3RA 3CJAA 3J7YP 1ATSA 5AQYA 4CJPA 3TSUA 1F21A 4I6MA 4CZJA 3D2EA 2Q36A 3AVGA 1A5WA 4DSKA 2XY7A 5GIPA 3I56N 5LY3A 5KPTA 4HCBA 1BCMA 3T1YK 1JLCA 1GOAA 4CERA 4WYBA 5AQZA 3ZT4A 3QEPA 4CGIA 4YOTA 1SQKA 3FE1A 1CXQA 4CHPA 2O4IA 2QWMA 3PO4A 4BDPA 4JD2A 4M7YA 3B6PA 4QS9A 1W97L 3A5NC 2Q0UA 1TAQA 4IOAL 2HMPA 1OKJA 3O4NA 4DF8A 2Y1JA 1DT9A 1FKOA 4JKGA 1V4SA 2GUPA 2QWOA 3PVLA 3NE6A 3OYJA 4B9TA 3HP9A 5SWMA 5AZIB 4Z4GA 3G9WA 3V9UA 4DV1K 5JVHL 1NK8A 5D3GA 1DIKA 1EXQA 4GV9A 5CR4A 1S9EA 4H5VA 5CYMA 4DG1A 2QWLA 3ZT3A 3TARA 4DUYK 4B3RK 1X3MA 3CQ8A 1U47A 3A5LC 4BC3A 1HYSA 1EWQA 3P38A 4F3OA 3NH2A 1VQ4N 4MO4A 3MK6A 4K42A 1EO1A 3D45A 3SUOA 4HUFA 3IRXA 1OVQA 2P9NB 3CIPA 3D0PA 4G9ZA 2FJ9A 2E1ZA 2E6MA 2RE2A 4CF8A 3CFRA 3U8ZA 4JS4A 3M8SA 2FBVA 4KV8A 3IMXA 4CVNE 1LWEA 4A62A 1TYQB 1WSEA 2P9NA 3MEEA 4Z4HA 1GLFO 3J81O 4H0OA 4DMNA 1N34K 3ZT2A 1C0TA 5IJMA 3SAFA 3VGMA 4C8LA 3DXKB 3M8PA 3B6OA 1T3VA 3PUFA 1CLQA 3V9SA 1ASVA 1RTHA 2AEHA 5CZ2A 1SKSA 1TAUA 4O4GA 1VHXA 2E6LA 1OVYA 5C24A 1YJWN 3MN9A 1RDDA 5EX5A 3SI6A 3AVFA 3C6HA 2F7TA 3LAKA 4NB4A 3SPZA 1GOBA 3OW2M 3AA5X 3EYZA 4AHVA 5HROA 3NCIA 4EHTA 4F7GA 5AQFA 4IO9L 3S9HA 5JS2A 2ZM6K 3ENBA 1GLBG 2V52B 1K6YA 1D5AA 2A1SA 3O9SA 4CECA 3AVKA 4ICLA 2NRWA 4O0IA 4H0XB 2Q31A 3EKUA 5BRFA 3G4SN 2DFEA 2NRXA 1H4RA 4BWJA 1VSMA 3R3LA 1BHLA 4DU3A 4FLVA 3CCQN 2KKZA 2ZWHA 1VK0A 1HNWK 3JAMO 3TAFA 1T6CA 1QQCA 3P83D 2QWPA 4CF0A 1SKRA 2HF3A 4UQGA 1Z6RA 4FJ5A 2YHXA 2KTQA 5BRDA 2A5XA 4WCEL 2ABDA 4DV7K 5EY4A 1RDUA 4JHDA 1RFQA 1NVLA 3OYCA 5JS1A 1RTDA 2BE2A 3CCVN 1Q7YO 4K43A 4MQ3A 4AM7A 3AGKA 5LMNK 3O9RA 3DLBA 2IVOA 3A8YA 3E66A 1KVBA 4KKOA 5KGXA 2ZJQL 2G8IA 3AU5A 1K73O 1GLDG 4CHZA 3ZSVA 3IKMA 2P9SA 4DR4K 1I3AA 4N41A 2QW9A 2YNFA 4LF8K 4CEDA 3LP3A 3CFPA 3QEVA 4EHUA 4BC4A 4LC9B 3OYGA 1RNHA 2GX9A 1HRHA 3LAMA 1KAYA 2P9SB 4H0YB 5AZJB 4Q0BA 2UUAK 1C6VA 2G8WA 1NNEA 2WOMA 1SAZA 3TAQA 4PKGA 4AHSA 5H1SQ 3QO9A 3L2RA 1RT4A 3HYFA 4F9OA 4DFKA 4LY7A 3K2PA 3LP0A 5E26A 2B5JA 3GE1A 4KREA 3DMJA 1QHAA 4ISGA 3C6AA 4AILC 3OYEA 4ZRIA 3O5BA 4XH4A 2NRZA 3KK2A 1T44A 5JLFA 3OS2A 4LF5K 4DTUA 2V7ZA 5JVGL 1EWRA 3U8XA 3O6WA 4FOIA 2JGUA 3RSEB 3TSQA 4AQYK 4Z4CA 3P39A 1QTMA 2QEXN 4JKHA 2UXDK 1N5YA 1L3VA 2HSTA 4IOXA 1LAVA 1GC7A 3U9ZA 3TAPA 4C1NI 3OHRA 1HKCA 2JWKA 4CJUA 3RSEA 4BR7A 4CIGA 3RRGA 3L2UA 2A6AA 4CJFA 3KJVA 4BACA 2QK9A 2IGIA 3FZFA 3ZSZA 1YIJN 4CGJA 3K58A 2Q1NA 3AO5A 3ASMA 4CEZA 2F9TA 2E2PA 5J2NA 3RMDA 4TKNA 2P5OA 5JLHA 1ZBSA 4IOCL 4NLBA 4B9NA 3AVAA 4XH1A 1ZBHA 2OPQA 2QKBA 3FZLA 1HNVA 2EMSA 2V51B 1RBTA 3PY8A 4B9SA 3OA9A 2P9UB 3LP2A 1IBMK 2VYPA 3DLLL 3T3FA 5EXWA 4QOZB 3MWTA 4ELUA 3O9QA 3CM5A 3CCSN 2VWKA 1W9HA 4ISEA 2BUPA 3KLFA 5DM6L 3O9TA 1SL1A 2B6AA 4ID1A 4RTFD 3L8BA 3NF6A 4N76A 1BI4B 1HPMA 3CJ7A 4BRDA 1VQNN 3WEEA 2I1KA 1IJJA 1S9GA 5AQNA 1MWKA 1YJ9N 3DWLA 1NK4A 1LW0A 3EL2A 3DOKA 5C2FA 3S3MA 3PO5A 2H3GX 3THXA 5J1EA 2HOEA 2KHOA 5KI6A 3DLGA 3VETA 4IJNA 4BRPA 1VSLA 2HMIA 4E3SA 3RR7A 3ZSQA 3OJUA 3U6FA 3LWLA 4KTQA 3L4IA 2ASMA 2HW3A 4FLUA 3ZSXA 1KC8O 2D0PA 4JN4A 5JMVA 3E01A 4DSIA 4CJ3A 1WAJA 2E5LK 3AAPA 4F2RA 4BRIA 3TI0A 5AQGA 2ATQA 3FLCO 2I7NA 4LSLA 3I8DA 1Q81O 4PL8A 3HL8A 3QB0A 4ZTFA 4FJNA 4MDAA 2GWKA 3VEWA 4NCBA 3I55N 2B4JA 3EEQA 3CC2N 3VPZA 3LDOA 4IBNA 4NLCA 4IKFA 1KCFA 4C8MA 3EKSA 1XMQK 4CJVA 3ZSYA 4DSJA 3CCRN 2VCPA 2FC0A 3H3NO 1E5WA 3QBXA 1XNRK 1V4TA 3SUPA 4EIAA 2X0SA 2ITGA 4W5TA 3V6DA 4FOEA 1KVCA 1WSIA 1P8ZA 2QXLA 4MLEA 4ILJA 4U67L 2O8BB 4KTWA 4QAGA 1SS6A 4YORA 5M1QA 4GY2B 5BR9A 1S1TA 3DLKA 5KPRA 4B9QA 3NAEA 5DM7L 1WBBA 1T05A 1WNSA 2LSNA 1KAZA 4FWSA 3NH1A 1QS4A 2A42A 3IAYA 5E84A 4FCYA 4EAHD 3K0SA 3OS1A 3K5LA 3F9MA 3VF2A 1ZBIA 4ID5A 1RBRA 1K9MO 2UXCK 4CJEA 4WQ4A 3ZX0A 3A2FA 4GXBA 5B8HA 3VQQA 3NGIA 3QINA 4KHYA 4PKIA 3AY9A 1NBWA 4MO5A 4FW1A 1BL3A 4FLTA 1FXXA 1RILA 3TTCA 1HQEA 1VQPN 2VG7A 4BE0A 3OYIA
chains in the Genus database with same CATH topology
4JK8A 1DT9A 3AARA 4BRQA 4JKGA 3VMFB 2NRTA 3DXMA 3ZYYX 1V4SA 3HBTA 4U7BA 2GUPA 2PAVA 2QWOA 3PVLA 1GLCG 3FFKB 5AZIB 5HOOA 1KAXA 3G9WA 4CBUA 3VEXA 5JVHL 3SLCA 3NVKA 5AQIA 3BEXA 3IFRA 1ATNA 3D2FA 4FWOA 1DIKA 4GV9A 3FGUA 5CR4A 4A59A 4H5VA 1XQSC 2NZTA 2JWLA 2YHWA 3E9PA 5AQTA 2IVNA 2QWLA 3DXMB 3VTHA 1VQ8N 2P9IB 2WFBA 1ISNA 4O8UA 3WEEB 2OTJN 1TUYA 1X3MA 4QS7A 3GDQA 3UB5A 3A5LC 2CB8A 5KQDA 2A3ZA 4BC3A 3PIPL 1M1KO 2P9UA 2HBKA 1MA9B 3E9LA 3CCEN 2D1KA 3R8EA 1CZAN 3P38A 1RDWX 2AA4A 3ZETB 3CERA 1VQ4N 2E2OA 2EMTA 5AQHA 4MO4A 4DKWA 4EKUA 3ZX3A 4BG8A 3MK6A 3F5TA 1QZ5A 4K42A 3UKUB 3OBYA 1EO1A 1O13A 2HBLA 3KWGA 3AGRA 4CBWA 1JCFA 4HDOA 2P9NB 3CIPA 3QFUA 1S22A 1C0GA 1YJNN 1S72N 1XUPO 4CJ7A 2GWJA 2A40A 4G9ZA 2FJ9A 2E1ZA 2RE2A 3VF4A 3U8ZA 4YOXA 2GTDA 1VQ5N 1IG8A 2KLAA 2QM1A 2YJFA 3IMXA 4I6MB 1SZ2A 5F0XA 1NGHA 3H1VX 3ATVA 1TYQB 1GLJO 4L3QA 2P9NA 4A62A 3SK3A 1LOTB 1GLFO 3QFPA 2W41A 1Q86O 3ZEUB 3LDQA 3O1BA 3OBWA 4H0OA 3BP8A 2VGNA 1K8KA 5IJMA 3SAFA 3VGMA 4JKBA 1NGJA 3ID8A 2V7YA 3C0BA 3DXKB 5AQJA 2OTLN 1VQ9N 4CZLA 4BRCA 4YL8A 1T3VA 3G71N 2P9PA 2UYTA 3QDKA 3NVMA 1BUPA 4BVPA 3CI5A 1ZC6A 1HKBA 2ITMA 4WFBL 1MIXA 2AEHA 3UE5A 2J0KA 3F2KA 3MDQA 3L4QA 4IXCA 1OVYA 3MMVA 3M1FA 4YDUC 3FP5A 3O4WA 4IJAA 1VBGA 3JXUA 2YI1A 3MWPA 1YJWN 2P9PB 3MN6A 3MN9A 5EX5A 5M1PA 2IIRA 3CJ9A 3VEZA 1MDUB 5M1KA 3C6HA 2ZF5O 2F7TA 4NB4A 1VQ7N 3CPEA 3ENOA 3CF5L 1QQOA 2E20A 4KBOA 3W0LA 1HBKA 4GVEA 3OW2M 1E4FT 5AQRA 2VGMA 3VEYA 5GADP 4EHTA 4F7GA 5AQFA 5AQUA 5ADXH 4IO9L 4BC2A 1NGBA 5TKYA 5AQQA 4A61A 1GLLO 4Y0WA 3ENBA 1GLBG 1HUXA 2V52B 3CCUN 5M1NA 3NMUA 3O9SA 2W40A 1NJIO 1BO5O 4H0VB 3QBWA 3PIOL 3CMEN 2NRWA 3CD6N 4H0XB 2Q31A 3D2EB 3EKUA 3CQYA 4IEEA 5BRFA 3G4SN 3CC4N 4ILHA 2QA4N 1N8RO 4GV3A 4A5AA 2NRXA 1H4RA 3P4IA 1Y64A 3E1YA 4ZRJA 1J19A 3R1XA 3R3LA 5FPDA 1G99A 3MN5A 3WXMB 2AP1A 3J7ZO 3I33A 2KKZA 2ZWHA 3J8AA 2GEMA 2NNWA 3L6QA 3MX5A 3CCQN 3CJBA 1U2VA 4BGAA 4CD1A 5AQOA 4WF9L 3SBGA 4P7IA 1T6CA 1YXQA 3UKUA 5EVZA 2QWPA 5GINA 3ULEB 3P31A 3UKRA 5TKWA 3SBTA 2HF3A 3CQXA 4ZRKA 1Z6RA 3M3ZA 1YHQN 2YHXA 4KH6A 1KC7A 1EF1A 3HTVA 3BF3A 3R9PA 5BREA 4KH4A 5BRDA 2A5XA 1WUAA 3AAQA 4WCEL 2ABDA 3LM2A 5AQSA 2E2NA 1NLVA 5EY4A 5F2RA 4R79A 2Q2RA 1H1VA 5ADXA 2QI2A 5AQXA 1RDUA 3N4PA 2WC9A 4JHDA 1RFQA 1NVLA 1KD1O 5LJWA 2FLOA 1TYQA 1NGCA 1ACAA 3N4QA 3CCVN 3PLAA 1Q7YO 4CZGA 3CJCA 5BN9A 1NI2A 4K43A 1BA1A 5M1OA 3AGKA 4AM7A 3O9RA 4BR4A 4FO0A 2IVOA 3A8YA 4YDUA 1NMDA 3E66A 4JHDB 1HJOA 4PKHA 2ZJQL 2QWQA 3AU5A 4OPHA 1GLDG 1K73O 3IKMA 2P9SA 1YUWA 4BQZA 1M90O 3QICA 1QVFM 3SMSA 1GLAG 2YX6A 3TU5A 1W2BM 1ILYA 3KK7A 2QW9A 4BRKA 4PL7A 5BN8A 2WUSA 3LDLA 4Z94A 3D6RA 3ZETA 2VWBA 4B1ZA 4EHUA 4YOVA 4BC4A 4FSVA 3R6MA 4LC9B 3VENA 2NRHA 4OO1J 2GX9A 2RHKA 1YAGA 2OANA 5LJVA 5KQ8A 5BPMA 1KAYA 2P9SB 4H0YB 3DJCA 5AZJB 4A5BA 3A5OC 1MIZB 1GLEG 4JEPA 4DHYA 4CZIA 4IFEA 4ISFA 4FVUA 3VTIA 4CZFA 2QTDA 2AL6A 4RCHA 4ILGB 5C2DA 4B1YB 4BRAA 4JK9A 1NM1A 4JKAA 2J4RA 2HBMA 4RWTA 1SAZA 2E1YA 4PKGA 5H1SQ 3U4LA 3EZWA 3KHYA 1QZ6A 5AQKA 3TTFA 3O08A 3X23A 3H6EA 3TTDA 4NY0A 4YOUA 4F9OA 4NO7A 4H0PA 1NGDA 3W3DA 4AM6A 5M1FA 2E8AA 5E26A 4FWRA 4FWMA 3GE1A 3HI0A 3HM8A 2FF6A 4FWNA 3IVFA 1QHAA 4BGBA 4CZKA 4ISGA 3S41A 3C6AA 3WXLA 1U2VB 4WFAL 4OPAA 3CCMN 4ZRIA 3VEVA 3O5BA 4XH4A 1ESVA 2NRZA 2P9LB 1HB6A 4CZMA 1VQLN 1T44A 3H46O 3TPQA 5JLFA 3CXCM 5ELZA 3LL3A 2V7ZA 3O8MA 4WQ5C 5JVGL 3HOTA 3U8XA 4IEIA 4CZEA 2CGJA 5C12A 3O6WA 4IZ9A 3CJ1A 4BR0A 1YITN 3D7EO 4JNEA 3AU4A 1VAZA 4K25A 3T69A 3EO3A 2J0JA 5JVLA 4FOIA 3RSEB 3TSQA 2P9LA 4XEIA 3BINA 2Q0RA 1D4XA 3KWIA 3P39A 3QMLA 3H1QA 2QEXN 2NRRA 5AFUH 4JKHA 5AQWA 4BQLA 2YCHA 2D4WA 4H5TA 1S3XA 2BH1A 5BPNA 3ZEUA 4JKDA 2CH5A 2HSTA 3LM9A 4IOXA 5AQMA 3MX2A 3U9ZA 1GC7A 4A57A 2FSNA 4BC5A 4C1NI 3VGLA 1YF5L 3B8AX 3WUHA 4HTLA 3MCPA 3U9DA 5GAGP 3KZBA 2D2QA 3OHRA 4YOYA 3VGKA 1HKCA 2JWKA 4H03B 3RSEA 4B1VA 3CC7N 3FLVA 4BR7A 1KQSM 1T6DA 3Q7BA 2A6AA 4H0TB 3CMAN 4HWIA 5I9EB 3FZFA 4FWPA 2GELA 1DEJA 1YIJN 1Q82O 3C7NB 4B1WB 4FL9A 4J8FA 3BF1A 2Q1NA 4BRNA 4M63C 1VBHA 1VQ6N 2F9TA 3HOSA 2E2PA 2D11A 4FPAA 2YJEA 3CHWA 4TKNA 3FZMA 5JLHA 1MK9B 1ZBSA 4IOCL 4NLBA 4BRMA 2ASPA 5C15A 2LBBA 4JK7A 4XH1A 1SGHA 2P9IA 3FZHA 5AR0A 5C10A 2PFUA 2FDQA 3FZLA 4H5WA 4A2BA 2EMSA 2V51B 3SAGA 2YHYA 4C23A 2PBDA 4BR2A 3IDHA 3OA9A 2P9UB 1BWFO 1RGIA 3SJHA 3JS6A 1DGKN 1VQKN 4HDQA 1TUUA 2VYPA 3DLLL 5EXWA 3MWTA 2CH6A 3M5RA 4B1UB 4DCHA 2CGLA 3LDNA 3T7ZA 3SMPA 3O9QA 3VOVA 1QQNA 2D10A 3GBTA 2F9WA 5JICA 3C65A 3CCSN 5AFUA 1BG3A 4ISEA 2BUPA 5DM6L 1VQMN 3HSCA 3O9TA 2P9KB 4RTFD 4BY9C 3WA0A 4WFNL 1Q18A 1WOQA 3G25A 5AQLA 3O9UA 2ZGZA 3ID6A 1HPMA 1K8AO 1JCEA 2NLXA 1JJ2M 3CJ7A 4BRDA 1VQNN 3WEEA 4MDBA 3VEOA 2I1KA 1IJJA 4O8KA 3GL1A 5AQNA 2HE7A 1MWKA 4FWQA 3DWLA 3ULEA 2D0OA 5EOYA 4DB3A 1YJ9N 1NGGA 4BVOA 3QIJA 3DAWA 1ZXOA 3BUZB 3EL2A 3EPYA 5C2FA 3MN7A 1Z05A 1ATRA 2H3GX 1JCGA 4CYEA 2CGKA 2FXUA 2HF4A 2HOEA 1NGIA 2KHOA 5FPNA 3IUCA 4IDHA 3VETA 4IJNA 2Q97A 3DXKA 4JKEA 3ATUA 3MCAB 5FPMA 2FSKA 1YVNA 4GNIA 3WT0A 1J6ZA 4BRPA 1BDGA 3HRGA 3FR0A 2I1JA 3WQTA 2BTFA 5BRHA 2HBJA 1Y19B 3L4IA 3K9JA 2ASMA 3ZDTA 3A5MC 3GOIA 4E1JA 3U7DA 5AZJA 1KC8O 2D0PA 1JDEA 1X3NA 1GG3A 3CETA 4JN4A 4CZHA 2WBNA 1NGAA 3PZDA 5JMVA 1VQON 1KXPA 2J0MA 2I7PA 3WXKA 4PHTX 3AAPA 2E2QA 1BA0A 4JKGB 1E4GT 4IWVA 4A2AA 5AQGA 4BRIA 4CBXA 1NWKA 1GGOA 3O1WA 3FLCO 2YVCA 2WH5A 2I7NA 2IVPA 5AZIA 5GAHP 3CPWM 3VERA 2ZJRL 1NGEA 2QWRA 3GG4A 4PL8A 4AF1A 1Q81O 3QB0A 2RQ1A 4H5RA 4KH5A 5HL7L 3D2FB 1NTIA 1BU6O 2FF3B 3RVCA 2DPNA 1K8KB 4JAXA 5KPZA 4MDAA 4EFHA 4IO8A 4MLHA 2GWKA 1DKGD 3A0IX 3VEWA 3KVGA 4O5FA 1QVGM 4BR9A 3ENHA 3I55N 4BRLA 5GAEP 3CCJN 3G6EN 3CC2N 3I8BA 4M7XA 3EE8A 1HKGA 3VPZA 1HX1A 1QQMA 4FWLA 4GV6A 3LDOA 4NLCA 4UY8O 2ASOA 4JKCA 4JKFA 3EKSA 1HLUA 3FZKA 2R82A 1LCUA 5F1XA 5BPLA 1X9JA 3CCRN 3Q7CA 4BR5A 1MK7B 2VCPA 3H3NO 4CD3A 1E5WA 3QBXA 4BG9A 5C0YA 1V4TA 4EIAA 2ZJPL 1U6ZA 1EQYA 2X0SA 3HZ6A 2A41A 1R59O 4FOEA 5GIOA 3EE9A 3H45C 1P8ZA 2QXLA 4MLEA 4ILJA 4U67L 3WQUA 3TSPA 5CHIA 1SS6A 4YORA 5M1QA 3O80A 3ZX2A 3LDPA 3UKRB 4BRFA 4DQ8A 3VF6A 2QWNA 3M6GA 5CE3A 2P9KA 4GY2B 5BR9A 3CJAA 3CCLN 2COPA 1ATSA 3WXIA 4B9QA 5AQYA 5KPRA 2ZGYA 1XC3A 5DM7L 4QS8A 2NRVA 3TSUA 1NGFA 4FPBA 3H3OB 3VESA 4I6MA 4CZJA 1KAZA 3D2EA 4FWSA 4BREA 1YI2N 4JD2B 2Q36A 5AQVA 4C1NK 5MLCQ 1ST7A 2A42A 5GIPA 5E84A 3I56N 2CQUA 5LY3A 4EAHD 5KPTA 2HRJA 3F9MA 3VF2A 1BOTO 3C7NA 5FPEA 4WYBA 5AQZA 1P90A 3WXJA 1K9MO 4K41A 4WQ4A 4YOTA 4YOWA 1SQKA 3FE1A 4DXAB 3ZX0A 2E88A 4GXBA 5B8HA 3L0QA 2QWMA 4BROA 3EN9A 4JD2A 3K9KA 1GC6A 1KBLA 1MWMA 4BRGA 4B1XB 4PKIA 2ZPYA 3AY9A 1NBWA 4M7YA 1C0FA 4BRHA 4CI6A 4MO5A 4QS9A 1HB8A 3E9OA 4WQ4C 1W97L 3A5NC 3SAHA 2Q0UA 4H5NA 4XH5A 4IOAL 2HMPA 1OKJA 3TTCA 4FWKA 2EWSA 4WQ5A 5AQPA 1VQPN 2FSJA 2DIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E66 A;  4JK8 A;  4JKG A;  4JK7 A;  4ILJ A;  3E9L A;  4ILH A;  4ILG B;  4JK9 A;  4JKA A;  4JKC A;  4JKF A;  4JKB A;  3E9P A;  3E9O A;  4JKG B;  3SBG A;  4JKH A;  3ENB A;  3SBT A;  4JKE A;  4JKD A; 
#chains in the Genus database with same CATH topology
 3WNH A;  3AAR A;  3DXM A;  1NKB A;  4FM0 A;  1TK8 A;  3FFK B;  3L2W A;  3ZT1 A;  3VEX A;  4CEF A;  3SLC A;  3SZ2 A;  1ITG A;  4EZ6 A;  1B9F A;  3D2F A;  1ZBU A;  4FWO A;  1UWB A;  3J80 O;  4LF7 K;  2JWL A;  4FJG A;  3DXM B;  3VTH A;  1VQ8 N;  2P9I B;  3WEE B;  1ISN A;  2KZM A;  1JXE A;  4RW9 A;  4CEB A;  1TUY A;  3K5M A;  2KFN A;  1WLJ A;  5CY4 A;  5KQD A;  2A3Z A;  1M1K O;  4PWD A;  2P9U A;  1MA9 B;  4KTZ A;  2D1K A;  3MEG A;  3KKS A;  3LPT A;  2EMT A;  4E7H A;  3OBY A;  3OYK A;  4JI7 K;  1O13 A;  2NUB A;  4CBW A;  4BE1 A;  4KI6 A;  3HJF A;  1S22 A;  1C0G A;  1XUP O;  2ZE2 A;  2GWJ A;  2OZS A;  2PYL A;  1TGO A;  2EX3 A;  2YJF A;  4I6M B;  1NGH A;  4RG8 A;  4B9V A;  3H1V X;  5C42 A;  3ATV A;  4N56 A;  1QSY A;  4DU4 A;  2W41 A;  3AVH A;  4CFD A;  1Q86 O;  1KLN A;  2UUB K;  3LDQ A;  3OBW A;  3BP8 A;  3DRR A;  3CYM A;  1NGJ A;  3ID8 A;  4JI2 K;  1VQ9 N;  4CZL A;  4BRC A;  4YL8 A;  1BQN A;  3G71 N;  1S1W A;  2P9P A;  3QDK A;  3OYA A;  2F8S A;  5FLX O;  4KHP K;  4WFB L;  3DOL A;  1YVU A;  1UA1 A;  4W5R A;  1WBD A;  4W5Q A;  1NJW A;  3MMV A;  3FP5 A;  3O4W A;  1VBG A;  2YI1 A;  1TK0 A;  1MDU B;  5M1K A;  1VQ7 N;  3ENO A;  1QQO A;  4FJ8 A;  2E20 A;  3W0L A;  4GVE A;  1E4F T;  3VEY A;  3SV3 A;  2D5R A;  4E7I A;  4HUE A;  2XY5 A;  4A61 A;  1GLL O;  1HUX A;  3CCU N;  3OYB A;  3NMU A;  4B8C A;  1BO5 O;  4Q5V A;  3CD6 N;  2RN2 A;  4IEE A;  4O55 A;  3ZSO A;  5FRM A;  4GV3 A;  1Y64 A;  3E1Y A;  3R1X A;  1J19 A;  4FYD A;  5FPD A;  2HHQ A;  1G99 A;  3J7Z O;  4K8Z A;  2GEM A;  3SQ2 A;  2Z1J A;  3CJB A;  3BDP A;  4FJI A;  4CD1 A;  5AQO A;  2O8B A;  3SBG A;  1NK0 A;  3AO1 A;  5GIN A;  3P31 A;  3UKR A;  2HHH K;  3M3Z A;  3M8R A;  1YHQ N;  2FBX A;  2O8C A;  3THW A;  4C8N A;  1EF1 A;  1TVR A;  3R9P A;  5BRE A;  4JI8 K;  1WUA A;  2DTU A;  2E2N A;  1IKX A;  4C8K A;  5F2R A;  5AQX A;  3KK1 A;  4B3O A;  4F4K A;  3FFI A;  2FLO A;  1WSF A;  4NYN A;  2JLE A;  3PLA A;  3V1R A;  3S3N A;  1NI2 A;  2IAJ A;  1IV0 A;  1FK9 A;  4CHO A;  2X78 A;  5M1O A;  1JLA A;  4CHQ A;  4X64 K;  4BR4 A;  4YY3 K;  3TR8 A;  4M3T A;  1KLM A;  3QIO A;  2QWQ A;  3U3G A;  1CXU A;  3KD5 E;  4BQZ A;  1T8E A;  3TU5 A;  1W2B M;  3KK7 A;  1QSL A;  5BN8 A;  2WUS A;  1WAF A;  4Z94 A;  1VSD A;  4FJL A;  3D6R A;  3ZET A;  2VWB A;  2BAN A;  3HT3 A;  3R6M A;  2O8E B;  3HST B;  2OAN A;  5LJV A;  5KQ8 A;  1HPZ A;  4DR1 K;  2HNY A;  4OKK A;  1MIZ B;  1VRT A;  1YTA A;  2AL6 A;  4RCH A;  1U49 A;  4DSE A;  5C2D A;  4NXN K;  4FLY A;  2HHU A;  2Z1H A;  1NM1 A;  3SQ1 A;  2J4R A;  2VG6 A;  5HRN A;  4E7K A;  2AJQ A;  4JI3 K;  5AQK A;  1QZ6 A;  3TTF A;  3O08 A;  3X23 A;  2W42 A;  3PV8 A;  4OLB A;  1NGD A;  4DTS A;  4FW2 A;  3HI0 A;  3HM8 A;  4FWN A;  3IVF A;  1C1C A;  4K8X A;  3TWH A;  4OPA A;  1RDC A;  1ESV A;  1J5O A;  3H46 O;  1LWC A;  3CXC M;  4X66 K;  3THX B;  1S6Q A;  4IEI A;  4CZE A;  1Q8I A;  4IZ9 A;  3CJ1 A;  1JLF A;  4Y1D A;  5AJ3 K;  2O8D A;  2P9L A;  3MED A;  3BIN A;  3KWI A;  3KKR A;  3OS0 A;  5AFU H;  4PQU A;  2Y1I A;  3ZEU A;  2CH5 A;  5AQM A;  5FDL A;  2FSN A;  1S1V A;  5GAG P;  4E7L A;  1YF5 L;  1SKW A;  4HTL A;  3U9D A;  5I42 A;  3U3Y A;  4KI4 A;  3KZB A;  2D2Q A;  2BDP A;  3FLV A;  1RDB A;  4JRP A;  1UAX A;  3Q7B A;  1U45 A;  4CJ5 A;  4CGG A;  3CMA N;  3DLE A;  2XY6 A;  4FWP A;  1Q9Y A;  1DEJ A;  5CZ1 A;  3C7N B;  2ZQB A;  4J8F A;  4BRN A;  3ULD A;  1HYZ A;  1LAW A;  1I94 K;  4DTX A;  4FPA A;  1BIZ A;  4LD0 A;  4HVJ A;  3PX0 A;  5KRS A;  5C15 A;  4LF6 K;  5C10 A;  2PFU A;  2FDQ A;  4R5P A;  4MFB A;  2HNZ A;  4BE2 A;  3IDH A;  3JS6 A;  2OPS A;  2FBY A;  2OPP A;  3UIQ A;  2CGL A;  4X65 K;  1X9M A;  3SQ4 A;  4HHT A;  3C65 A;  5AFU A;  4FJX A;  3TAN A;  1IBL K;  1N6Q A;  4BY9 C;  1FJG K;  5AQL A;  4DR2 K;  3NBP A;  2F96 A;  1TL3 A;  4DTJ A;  5LL6 Z;  4PUO A;  4OGE A;  3LP1 A;  1JJ2 M;  4L8R B;  2RKI A;  4O8K A;  3KD1 E;  3GL1 A;  3CM6 A;  4BVO A;  2G8U A;  4KRF A;  1Z05 A;  1HQU A;  1JCG A;  4CYE A;  2CGK A;  4W5O A;  4TSX A;  4B08 A;  2Q97 A;  3ATU A;  4E1M A;  1RT5 A;  2R7Y A;  3WT0 A;  3O3F A;  1J6Z A;  1OH8 A;  4B8A B;  2A1R A;  2YHB A;  3FR0 A;  2I1J A;  3WQT A;  2HBJ A;  3OTO K;  4E1J A;  1W0H A;  3U7D A;  3CET A;  1XHX A;  4CCH A;  3PZD A;  4DQP A;  4DLG A;  4DSF A;  3VA0 A;  4OVL A;  1WSJ A;  3BZC A;  4CBX A;  1GGO A;  2QKK A;  2YVC A;  2WH5 A;  3ZCM A;  5GAH P;  4DSL A;  2QWR A;  3GG4 A;  4AF1 A;  2RQ1 A;  4H5R A;  3HK2 A;  3D2F B;  1NTI A;  3VQC A;  4RW4 A;  2DPN A;  1K8K B;  3AVM A;  4N5S A;  3A0I X;  3KVG A;  4O5F A;  3CCJ N;  4FJM A;  3G6E N;  2HHW A;  3I8B A;  3VQP A;  4GV6 A;  1O1W A;  1C1B A;  1I39 A;  1LCU A;  4FJH A;  3Q7C A;  4AHT A;  3ISN C;  5K14 A;  4BG9 A;  4DR7 K;  1B92 A;  1VSI A;  3HZ6 A;  3HPG A;  2A41 A;  1R59 O;  5GIO A;  1WSG A;  1NG9 A;  4FK4 A;  2UXB K;  4ELV A;  3TSP A;  3VQA A;  2HHV A;  4FZX C;  4Y1C A;  3WXI A;  3EZ5 A;  1N33 K;  2ZGY A;  2P5G A;  1A5X A;  2NRV A;  1NGF A;  4FPB A;  3H3O B;  3VES A;  4QCL A;  4BRE A;  1SV5 A;  2F4V K;  4JD2 B;  5AQV A;  4KHS A;  1ST7 A;  4FM2 A;  1JXB A;  4CJ4 A;  3TAB A;  3C7N A;  3NH0 A;  5FPE A;  1DTQ A;  1P90 A;  4K41 A;  3L0Q A;  4BRO A;  1KBL A;  2D0A A;  3BZK A;  4FLX A;  2ZPY A;  5J2M A;  5EU7 A;  4BRH A;  2PZS A;  3E9O A;  3SAH A;  4ZHR A;  2KQ2 A;  1VRU A;  1D8Y A;  4FWK A;  5AQP A;  3HXM A;  4DQS A;  4JK8 A;  4BRQ A;  1YTU A;  4U7B A;  3SQ0 A;  3HBT A;  4CFC A;  2PAV A;  1GLC G;  2O8F B;  2YV0 X;  2PYJ A;  3NVK A;  3VQ8 A;  5AQI A;  3MXM A;  3BEX A;  3IFR A;  1ATN A;  2OA8 A;  1Z25 A;  4DV3 K;  4HCC A;  2KZZ A;  1JLG A;  3FGU A;  4A59 A;  2YHW A;  5AQT A;  2XRI A;  2IVN A;  2BGG A;  2IOC A;  1LW2 A;  2WTU A;  4IFV A;  4DS5 A;  4O0J A;  5KTQ A;  1L3S A;  1NMN A;  1RDA A;  3UB5 A;  2CB8 A;  3PIP L;  4KAZ A;  3RMA A;  3E9L A;  1IKY A;  3AVN A;  3AVJ A;  3R8E A;  1RDW X;  1VSJ A;  3CER A;  5AQH A;  4DKW A;  4BG8 A;  3F5T A;  1QZ5 A;  4RW8 A;  4HDO A;  1HJR A;  2O8C B;  2FBT A;  2Q3S A;  1S72 N;  4CJ7 A;  1D9D A;  2A40 A;  4NCA A;  3MAQ A;  3VF4 A;  1DTT A;  4J2B A;  1Y97 A;  3QEW A;  4YOX A;  1IKW A;  1IG8 A;  4DUZ K;  1VSH A;  1XNQ K;  1ASW A;  1VSK A;  1JKH A;  5J2Q A;  4LF4 K;  4LSN A;  1REV A;  4L3Q A;  1GLJ O;  4RW6 A;  4JI6 K;  3HVR A;  3V9X A;  3O1B A;  2VGN A;  1K8K A;  1NK5 A;  4JKB A;  4KO0 A;  2UYT A;  3NVM A;  2ITM A;  1ZC6 A;  1HKB A;  3SUQ A;  1XMO K;  1MIX A;  2HVI A;  4DTM A;  3MDQ A;  3L4Q A;  4W5N A;  1SUQ A;  1JL1 A;  4IXC A;  3V9W A;  3LZJ A;  3KIO A;  4YDU C;  3M1F A;  4IJA A;  3JXU A;  2DY4 A;  5M1P A;  2IIR A;  3VEZ A;  3KLE A;  4FK2 A;  1T03 A;  3CPE A;  4KBO A;  1HBK A;  2IS3 A;  2G8F A;  5GAD P;  5ADX H;  5AQU A;  4BC2 A;  1NGB A;  4I2P A;  3VQE A;  4LFA K;  5FRN A;  3NF7 A;  3F9K A;  2W40 A;  4H0V B;  3PIO L;  3D2E B;  3CQY A;  3CC4 N;  4ILH A;  4A5A A;  1EKE A;  3HP6 A;  4DFJ A;  3C6T A;  4ZRJ A;  5E41 A;  3J7A P;  3AA4 A;  4DLE A;  3MN5 A;  3WXM B;  1ZBF A;  2AP1 A;  3L6Q A;  3MX5 A;  4DFP A;  4O44 A;  4Z0U A;  4C8O A;  4CES A;  3EY1 A;  1BI4 A;  4BGA A;  1C1A A;  2XO7 A;  4P7I A;  3UKU A;  1CZB A;  3ULE B;  5TKW A;  3CQX A;  4ZRK A;  3DRS A;  4V19 S;  4OJR A;  3HTV A;  3RWU A;  3DI6 A;  4KH4 A;  3AAQ A;  3LM2 A;  5AQS A;  3AO2 A;  3ITH A;  1NLV A;  5KGW A;  2Q2R A;  1H1V A;  2QI2 A;  4NXM K;  4OPK A;  4BDY A;  3HM9 A;  2WC9 A;  3DLH A;  4CJS A;  1NJZ A;  1JL2 A;  4F8R A;  4X62 K;  3O4Q A;  3N4Q A;  2OYQ A;  3CJC A;  5BN9 A;  5A2Q O;  5SZT A;  4DQR A;  4AHU A;  3OYD A;  1QE1 A;  2YNI A;  1J53 A;  4JHD B;  4CJR A;  4DTO A;  1HJO A;  4PKH A;  3V4I A;  3VQD A;  4CW7 B;  2W6K A;  4JYA K;  1YUW A;  1M90 O;  4KPY A;  3QIC A;  2YX6 A;  1ILY A;  4DV4 K;  4M41 A;  3KTQ A;  4BRK A;  4NYF A;  4PL7 A;  2X74 A;  1SL2 A;  2NRH A;  5BPM A;  3T1H K;  4B3M K;  1T7P A;  3DJC A;  4A5B A;  3SNN A;  1EX4 A;  3ALY A;  2EHG A;  4JEP A;  4CZI A;  4FVU A;  3VTI A;  4CZF A;  4N47 A;  2QTD A;  2OPR A;  4B1Y B;  4JK9 A;  4JKA A;  2HBM A;  4RWT A;  2E1Y A;  3U4L A;  3EZW A;  4M3Z A;  1DLO A;  3TTD A;  4NY0 A;  4YOU A;  5J2P A;  4NO7 A;  4H0P A;  4CIF A;  4WE1 A;  4B9L A;  4FWR A;  4I9L A;  4FWM A;  1TL1 A;  1JLB A;  1KTQ A;  3S41 A;  1U2V B;  4WFA L;  3VEV A;  4CHY A;  4CZM A;  1VQL N;  3TPQ A;  4CEA A;  3K59 A;  3O8M A;  4WQ5 C;  3HOT A;  5C12 A;  1JLE A;  4BR0 A;  2VQE K;  1YIT N;  2J0J A;  5JVL A;  2D0C A;  4FM1 A;  4KHQ A;  2Q0R A;  1D4X A;  3QML A;  4BQL A;  5AQW A;  1RBV A;  1TV6 A;  2YCH A;  1S6P A;  2Z1I A;  3QLH A;  5BPN A;  4E89 A;  4JKD A;  3LM9 A;  2UU9 K;  4GVM A;  4A57 A;  4BC5 A;  4FLZ A;  3DLR A;  3AV9 A;  4DV2 K;  1NJX A;  1S1U A;  1NOZ A;  4H03 B;  4B1V A;  3KLI A;  3BGR A;  3P5J A;  3CC7 N;  4HUG A;  1RT2 A;  1T6D A;  4CJL A;  5I9E B;  3OY9 A;  4Z4I A;  1RT7 A;  3QES A;  1EP4 A;  1HMV A;  3VQ4 A;  1Q82 O;  3BF1 A;  4M63 C;  4OKE A;  3HOS A;  3QEX A;  4CGH A;  2D11 A;  3OYN A;  1WSH A;  3IG1 A;  1C0M A;  2YJE A;  4CEQ A;  3FZM A;  3SCX A;  3O3G A;  2LBB A;  4JK7 A;  1SGH A;  2P9I A;  3FZH A;  5AR0 A;  4H5W A;  3V9Z A;  3SAG A;  4CJQ A;  1BWF O;  4CK1 A;  3V1O A;  1VQK N;  4HDQ A;  1TUU A;  5I3U A;  2DFH A;  2CH6 A;  3M5R A;  3VOV A;  1QQN A;  2D0B A;  2D10 A;  3GBT A;  1BG3 A;  2P9K B;  1RTJ A;  3WA0 A;  1Q18 A;  1WOQ A;  3G25 A;  3WNE A;  3NGY A;  3RMB A;  2G8H A;  4PA1 A;  1NK7 A;  3ID6 A;  4KFB A;  4J2A A;  2HHT A;  4MDB A;  3VEO A;  5KRT A;  2DFF A;  4FWQ A;  1J9A A;  2D0O A;  5EOY A;  3ULE A;  4DB3 A;  1NGG A;  3QIJ A;  4CJK A;  3DAW A;  1ZXO A;  3BUZ B;  3EPY A;  4GMJ B;  4B9M A;  4OKJ A;  1FKP A;  2HF4 A;  1NGI A;  2YNH A;  4DTN A;  5LMU K;  3MCA B;  5FPM A;  3CFO A;  1YVN A;  4GNI A;  1BDG A;  5BRH A;  1KFD A;  1Y19 B;  4F3T A;  3K9J A;  3ZDT A;  3A5M C;  3VQ9 A;  4JRQ A;  1OH5 A;  5AZJ A;  3OJS A;  2OCE A;  1Q9X A;  1JDE A;  1X3N A;  1GOC A;  1U48 A;  1NGA A;  1RBS A;  5BR8 K;  1KXP A;  3VQ6 A;  5HRP A;  3RMC A;  2I7P A;  1D9F A;  4XIU A;  4FZZ A;  4PHT X;  2HHX A;  1X1P A;  4A2A A;  4JKG B;  4DR3 K;  1IBK K;  1NWK A;  1L3T A;  3O1W A;  3NGZ A;  3VA3 A;  3CPW M;  5AZI A;  1NGE A;  4EP4 A;  4OX9 K;  4FJ7 A;  4KH5 A;  4AH9 A;  3V81 A;  4YHH K;  5HL7 L;  4DF4 A;  1BU6 O;  3VQ7 A;  4JAX A;  5KPZ A;  4IO8 A;  4K0K K;  4YNQ A;  3JYT A;  4M7X A;  1HX1 A;  4FWL A;  4UY8 O;  4BDZ A;  2ASO A;  4E19 A;  2XHB A;  4JKF A;  1HLU A;  3FZK A;  4EZ9 A;  1TKX A;  1MK7 B;  1CZ9 A;  4CD3 A;  3L2V A;  1ZBL A;  1EQY A;  4FK0 A;  4IFY A;  1TKZ A;  3TAM A;  5CHI A;  3TAE A;  2I5J A;  4FJJ A;  1C0U A;  3O80 A;  3LDP A;  3UKR B;  5FRO A;  4M3U A;  3VF6 A;  4J2D A;  2QWN A;  1HNX K;  2HB5 A;  3AVC A;  5HBM A;  2COP A;  3VQB A;  3CCL N;  2PY5 A;  1LV5 A;  1XC3 A;  4QS8 A;  4FJ9 A;  4E7J A;  1XI1 A;  2YKM A;  1YI2 N;  4C1N K;  3SPY A;  5MLC Q;  4CJT A;  2F8T A;  2CQU A;  2KFZ A;  4KHW A;  2HRJ A;  3NHG A;  1BOT O;  2P1J A;  4DTR A;  3WXJ A;  1N36 K;  4YOW A;  4DXA B;  3SJJ A;  2E88 A;  4JV5 K;  4GKJ K;  3OYM A;  3EN9 A;  2HND A;  4JI0 K;  3K9K A;  1GC6 A;  1MWM A;  3QNO A;  4BRG A;  4B1X B;  1X9S A;  1C0F A;  4FZY A;  4CI6 A;  3THW B;  1HB8 A;  4WQ4 C;  4H5N A;  1RT6 A;  4XH5 A;  1X9W A;  2YNG A;  2YKN A;  3KLG A;  2EWS A;  4WQ5 A;  3G0Z A;  2FSJ A;  3C94 A;  3OYH A;  3M8Q A;  2DIK A;  3VMF B;  2NRT A;  3ZYY X;  3THY B;  2O8E A;  3I0R A;  4JI5 K;  5HOO A;  1KAX A;  4CBU A;  1OH7 A;  1B9D A;  1ZYQ A;  5IT9 O;  2X6S A;  1XQS C;  2NZT A;  3E9P A;  1S1X A;  2WFB A;  4O8U A;  2OTJ N;  4OPJ A;  4CGF A;  1E3M A;  4CF9 A;  4QS7 A;  3GDQ A;  3F73 A;  4Z4F A;  2HBK A;  4CFB A;  3ZSR A;  4CIE A;  4AHR A;  1HNZ K;  3CCE N;  1CZA N;  2AA4 A;  3ZET B;  2E2O A;  4EKU A;  3ZX3 A;  3UKU B;  1G15 A;  3G10 A;  2HBL A;  3KWG A;  3AGR A;  3T1A A;  1JCF A;  3O3H A;  3QFU A;  3LPU A;  3IS9 A;  1YJN N;  4J2E A;  4H4M A;  4LH4 A;  2GTD A;  1VQ5 N;  2KLA A;  1J54 A;  2QM1 A;  3NFA A;  1SZ2 A;  5F0X A;  3LDS A;  3SK3 A;  2KW4 A;  1LOT B;  3PX4 A;  3QFP A;  4M3W A;  4CF2 A;  3ZEU B;  3ZLJ A;  4M3X A;  2G8V A;  1EET A;  2V7Y A;  3C0B A;  5AQJ A;  2OTL N;  3MXI A;  1VSF A;  5HRS A;  1BUP A;  4BVP A;  3CI5 A;  1NKE A;  4F2S A;  3H08 A;  3UE5 A;  2J0K A;  3F2K A;  4DQQ A;  2HHS A;  3OYL A;  1IO2 A;  3AVI A;  1XWL A;  5DMR A;  4DQI A;  2P51 A;  3MWP A;  3PSF A;  2P9P B;  3MN6 A;  3CJ9 A;  2HVH A;  5CYQ A;  2ZF5 O;  3CF5 L;  2O8F A;  5AQR A;  2VGM A;  3VN5 A;  4CEO A;  2GBZ A;  1XHZ A;  5TKY A;  4YFU A;  5AQQ A;  4DWI A;  4Y0W A;  1HNI A;  5M1N A;  2IC3 A;  1HYV A;  1NJI O;  3OVN A;  3QBW A;  3RR8 A;  4E1N A;  3CME N;  2UUC K;  4KB0 A;  3THV A;  2QA4 N;  1N8R O;  4JI1 K;  3P4I A;  4DV5 K;  3S3O A;  1UOC A;  1OH6 A;  3I33 A;  3J8A A;  2NNW A;  4DTP A;  3HPH A;  4CE9 A;  1U2V A;  1R0A A;  4WF9 L;  3DM2 A;  5HRR A;  1YXQ A;  2GV9 A;  3DRP A;  5EVZ A;  3CG7 A;  1NKC A;  3SBT A;  4KH6 A;  3SYZ A;  1KC7 A;  1KSP A;  3BF3 A;  1Z26 A;  3WNG A;  3SUN A;  1KRP A;  3QET A;  1WB9 A;  4IDK A;  3NF8 A;  4R79 A;  3K5N A;  5ADX A;  5HLF A;  1YT3 A;  3N4P A;  1QSS A;  3THY A;  4OGC A;  4OLA A;  1KD1 O;  5LJW A;  1TYQ A;  1XC9 A;  1NGC A;  1ACA A;  4CZG A;  4I9Q A;  4GKK K;  1BA1 A;  1FW6 A;  4I2Q A;  4Z4E A;  3SV4 A;  4FO0 A;  3BY5 A;  4YDU A;  1NMD A;  2OZM A;  2VQF K;  3WNF A;  4IG0 A;  1KVA A;  5IWA K;  4OPH A;  1QVF M;  1LWF A;  1TKT A;  3SMS A;  1GLA G;  3HO1 A;  1VSE A;  3LDL A;  3K57 A;  4B1Z A;  4YOV A;  4FSV A;  3VEN A;  4DV0 K;  4OO1 J;  2RHK A;  1MU2 A;  1YAG A;  4DU1 A;  3NDK A;  3VQ5 A;  4LFC K;  1BIU A;  1ASU A;  3A5O C;  4JI4 K;  4DHY A;  1GLE G;  4IFE A;  4ISF A;  3RRH A;  4ILG B;  4BRA A;  3QER A;  1NK9 A;  1QHT A;  3KHY A;  1UA0 A;  3H6E A;  4IG3 A;  3W3D A;  4AM6 A;  1RBU A;  5M1F A;  3AVL A;  1L3U A;  4M3Y A;  2E8A A;  3LZI A;  1J5E K;  2IDO A;  2FF6 A;  4BGB A;  2YHA A;  4CZK A;  3KK3 A;  4HTU A;  3I0S A;  3WXL A;  3CCM N;  2WON A;  4NCG A;  2P9L B;  1HB6 A;  4B9U A;  3LAL A;  4H8K A;  5ELZ A;  1U4B A;  3QEI A;  3LL3 A;  2VG5 A;  2CGJ A;  3AO4 A;  3ZT0 A;  3D7E O;  4O5B A;  4FJK A;  4JNE A;  3AU4 A;  1VAZ A;  4K25 A;  2XY8 A;  3T69 A;  3EO3 A;  3T19 A;  4CHN A;  4PY5 A;  4XEI A;  3H1Q A;  2NRR A;  1NK6 A;  2D4W A;  1JLQ A;  4H5T A;  1S3X A;  2BH1 A;  4CK2 A;  1NOY A;  3DYA A;  3MX2 A;  3VGL A;  3B8A X;  3WUH A;  3MCP A;  1IKV A;  4CEE A;  1TKD A;  4YOY A;  1TK5 A;  3VGK A;  4I7F A;  2O8D B;  4CF1 A;  1KQS M;  4H0T B;  4HWI A;  1S5J A;  3P1G A;  4DR6 K;  3AO3 A;  2GEL A;  2VWJ A;  4LH5 A;  4E0D A;  4JLH A;  5T7B A;  4B1W B;  4FL9 A;  1VBH A;  1VQ6 N;  1BIS A;  2ZD1 A;  3AA3 A;  3CHW A;  3RTV A;  3AA2 A;  1MK9 B;  4DR5 K;  3MEC A;  4BRM A;  2ASP A;  3LWM A;  4LF9 K;  1W7A A;  4CGD A;  4A2B A;  1IG9 A;  3ZSW A;  2YHY A;  4C23 A;  2PBD A;  4KHN A;  4BR2 A;  1RGI A;  3SJH A;  1DGK N;  4CJW A;  3PX6 A;  5HP1 A;  4B1U B;  4M42 A;  4DCH A;  3LDN A;  3T7Z A;  3SMP A;  2RF2 A;  1U04 A;  1A5V A;  2F9W A;  3NF9 A;  5JIC A;  4FXD A;  1VQM N;  1RCH A;  3HSC A;  4DV6 K;  4WFN L;  3L2Q A;  3O9U A;  2ZGZ A;  4H4O A;  3MXJ A;  1N32 K;  1HR0 K;  1K8A O;  4JS5 A;  1JCE A;  2NLX A;  1BQM A;  5DK5 A;  3V1Q A;  3QIP A;  4KHU A;  1BGX T;  3L3V A;  2HE7 A;  2X6N A;  1KFS A;  4M45 A;  3MN7 A;  4KB1 A;  1ATR A;  2FXU A;  3HVT A;  3QNN A;  5FPN A;  3IUC A;  4IDH A;  3KLH A;  3DXK A;  4JKE A;  2FSK A;  1NU0 A;  3HRG A;  2BTF A;  4ZTJ A;  5C25 A;  3TAG A;  3GOI A;  1RT1 A;  3AVB A;  1GG3 A;  1BCO A;  4CZH A;  2WBN A;  4CFA A;  1VQO N;  1NJY A;  4AHC A;  2RPI A;  2J0M A;  3OYF A;  4BWM A;  1L5U A;  1RTI A;  3WXK A;  2E2Q A;  1BA0 A;  1E4G T;  4IWV A;  2QXF A;  3HPO A;  2ETJ A;  2ZJR L;  2IVP A;  4LFB K;  3VER A;  3C95 A;  4CK3 A;  2FF3 B;  3RVC A;  4ELT A;  4EFH A;  4G1Q A;  4MLH A;  1DKG D;  3K5O A;  2G8K A;  1QVG M;  4BR9 A;  3ENH A;  4BRL A;  5GAE P;  2GUI A;  3EE8 A;  1HKG A;  1IH7 A;  1QQM A;  4JKC A;  3PSI A;  4GW6 A;  3JSM A;  2R82 A;  5F1X A;  5BPL A;  1X9J A;  4DS4 A;  4BR5 A;  2W6L A;  4DFM A;  4EP5 A;  4B3S K;  1SL0 A;  3L3U A;  5C0Y A;  1RT3 A;  2ZJP L;  1U6Z A;  4FLW A;  2O4G A;  3LAN A;  3EE9 A;  3H45 C;  4B3T K;  4FVM A;  3WQU A;  2E4L A;  1WN7 A;  2Z1G A;  3ZX2 A;  4BRF A;  4DQ8 A;  3M6G A;  5CE3 A;  2P9K A;  3C6U A;  4RW7 A;  4M3R A;  3CJA A;  3J7Y P;  1ATS A;  5AQY A;  4CJP A;  3TSU A;  1F21 A;  4I6M A;  4CZJ A;  3D2E A;  2Q36 A;  3AVG A;  1A5W A;  4DSK A;  2XY7 A;  5GIP A;  3I56 N;  5LY3 A;  5KPT A;  4HCB A;  1BCM A;  3T1Y K;  1JLC A;  1GOA A;  4CER A;  4WYB A;  5AQZ A;  3ZT4 A;  3QEP A;  4CGI A;  4YOT A;  1SQK A;  3FE1 A;  1CXQ A;  4CHP A;  2O4I A;  2QWM A;  3PO4 A;  4BDP A;  4JD2 A;  4M7Y A;  3B6P A;  4QS9 A;  1W97 L;  3A5N C;  2Q0U A;  1TAQ A;  4IOA L;  2HMP A;  1OKJ A;  3O4N A;  4DF8 A;  2Y1J A;  1DT9 A;  1FKO A;  4JKG A;  1V4S A;  2GUP A;  2QWO A;  3PVL A;  3NE6 A;  3OYJ A;  4B9T A;  3HP9 A;  5SWM A;  5AZI B;  4Z4G A;  3G9W A;  3V9U A;  4DV1 K;  5JVH L;  1NK8 A;  5D3G A;  1DIK A;  1EXQ A;  4GV9 A;  5CR4 A;  1S9E A;  4H5V A;  5CYM A;  4DG1 A;  2QWL A;  3ZT3 A;  3TAR A;  4DUY K;  4B3R K;  1X3M A;  3CQ8 A;  1U47 A;  3A5L C;  4BC3 A;  1HYS A;  1EWQ A;  3P38 A;  4F3O A;  3NH2 A;  1VQ4 N;  4MO4 A;  3MK6 A;  4K42 A;  1EO1 A;  3D45 A;  3SUO A;  4HUF A;  3IRX A;  1OVQ A;  2P9N B;  3CIP A;  3D0P A;  4G9Z A;  2FJ9 A;  2E1Z A;  2E6M A;  2RE2 A;  4CF8 A;  3CFR A;  3U8Z A;  4JS4 A;  3M8S A;  2FBV A;  4KV8 A;  3IMX A;  4CVN E;  1LWE A;  4A62 A;  1TYQ B;  1WSE A;  2P9N A;  3MEE A;  4Z4H A;  1GLF O;  3J81 O;  4H0O A;  4DMN A;  1N34 K;  3ZT2 A;  1C0T A;  5IJM A;  3SAF A;  3VGM A;  4C8L A;  3DXK B;  3M8P A;  3B6O A;  1T3V A;  3PUF A;  1CLQ A;  3V9S A;  1ASV A;  1RTH A;  2AEH A;  5CZ2 A;  1SKS A;  1TAU A;  4O4G A;  1VHX A;  2E6L A;  1OVY A;  5C24 A;  1YJW N;  3MN9 A;  1RDD A;  5EX5 A;  3SI6 A;  3AVF A;  3C6H A;  2F7T A;  3LAK A;  4NB4 A;  3SPZ A;  1GOB A;  3OW2 M;  3AA5 X;  3EYZ A;  4AHV A;  5HRO A;  3NCI A;  4EHT A;  4F7G A;  5AQF A;  4IO9 L;  3S9H A;  5JS2 A;  2ZM6 K;  3ENB A;  1GLB G;  2V52 B;  1K6Y A;  1D5A A;  2A1S A;  3O9S A;  4CEC A;  3AVK A;  4ICL A;  2NRW A;  4O0I A;  4H0X B;  2Q31 A;  3EKU A;  5BRF A;  3G4S N;  2DFE A;  2NRX A;  1H4R A;  4BWJ A;  1VSM A;  3R3L A;  1BHL A;  4DU3 A;  4FLV A;  3CCQ N;  2KKZ A;  2ZWH A;  1VK0 A;  1HNW K;  3JAM O;  3TAF A;  1T6C A;  1QQC A;  3P83 D;  2QWP A;  4CF0 A;  1SKR A;  2HF3 A;  4UQG A;  1Z6R A;  4FJ5 A;  2YHX A;  2KTQ A;  5BRD A;  2A5X A;  4WCE L;  2ABD A;  4DV7 K;  5EY4 A;  1RDU A;  4JHD A;  1RFQ A;  1NVL A;  3OYC A;  5JS1 A;  1RTD A;  2BE2 A;  3CCV N;  1Q7Y O;  4K43 A;  4MQ3 A;  4AM7 A;  3AGK A;  5LMN K;  3O9R A;  3DLB A;  2IVO A;  3A8Y A;  3E66 A;  1KVB A;  4KKO A;  5KGX A;  2ZJQ L;  2G8I A;  3AU5 A;  1K73 O;  1GLD G;  4CHZ A;  3ZSV A;  3IKM A;  2P9S A;  4DR4 K;  1I3A A;  4N41 A;  2QW9 A;  2YNF A;  4LF8 K;  4CED A;  3LP3 A;  3CFP A;  3QEV A;  4EHU A;  4BC4 A;  4LC9 B;  3OYG A;  1RNH A;  2GX9 A;  1HRH A;  3LAM A;  1KAY A;  2P9S B;  4H0Y B;  5AZJ B;  4Q0B A;  2UUA K;  1C6V A;  2G8W A;  1NNE A;  2WOM A;  1SAZ A;  3TAQ A;  4PKG A;  4AHS A;  5H1S Q;  3QO9 A;  3L2R A;  1RT4 A;  3HYF A;  4F9O A;  4DFK A;  4LY7 A;  3K2P A;  3LP0 A;  5E26 A;  2B5J A;  3GE1 A;  4KRE A;  3DMJ A;  1QHA A;  4ISG A;  3C6A A;  4AIL C;  3OYE A;  4ZRI A;  3O5B A;  4XH4 A;  2NRZ A;  3KK2 A;  1T44 A;  5JLF A;  3OS2 A;  4LF5 K;  4DTU A;  2V7Z A;  5JVG L;  1EWR A;  3U8X A;  3O6W A;  4FOI A;  2JGU A;  3RSE B;  3TSQ A;  4AQY K;  4Z4C A;  3P39 A;  1QTM A;  2QEX N;  4JKH A;  2UXD K;  1N5Y A;  1L3V A;  2HST A;  4IOX A;  1LAV A;  1GC7 A;  3U9Z A;  3TAP A;  4C1N I;  3OHR A;  1HKC A;  2JWK A;  4CJU A;  3RSE A;  4BR7 A;  4CIG A;  3RRG A;  3L2U A;  2A6A A;  4CJF A;  3KJV A;  4BAC A;  2QK9 A;  2IGI A;  3FZF A;  3ZSZ A;  1YIJ N;  4CGJ A;  3K58 A;  2Q1N A;  3AO5 A;  3ASM A;  4CEZ A;  2F9T A;  2E2P A;  5J2N A;  3RMD A;  4TKN A;  2P5O A;  5JLH A;  1ZBS A;  4IOC L;  4NLB A;  4B9N A;  3AVA A;  4XH1 A;  1ZBH A;  2OPQ A;  2QKB A;  3FZL A;  1HNV A;  2EMS A;  2V51 B;  1RBT A;  3PY8 A;  4B9S A;  3OA9 A;  2P9U B;  3LP2 A;  1IBM K;  2VYP A;  3DLL L;  3T3F A;  5EXW A;  4QOZ B;  3MWT A;  4ELU A;  3O9Q A;  3CM5 A;  3CCS N;  2VWK A;  1W9H A;  4ISE A;  2BUP A;  3KLF A;  5DM6 L;  3O9T A;  1SL1 A;  2B6A A;  4ID1 A;  4RTF D;  3L8B A;  3NF6 A;  4N76 A;  1BI4 B;  1HPM A;  3CJ7 A;  4BRD A;  1VQN N;  3WEE A;  2I1K A;  1IJJ A;  1S9G A;  5AQN A;  1MWK A;  1YJ9 N;  3DWL A;  1NK4 A;  1LW0 A;  3EL2 A;  3DOK A;  5C2F A;  3S3M A;  3PO5 A;  2H3G X;  3THX A;  5J1E A;  2HOE A;  2KHO A;  5KI6 A;  3DLG A;  3VET A;  4IJN A;  4BRP A;  1VSL A;  2HMI A;  4E3S A;  3RR7 A;  3ZSQ A;  3OJU A;  3U6F A;  3LWL A;  4KTQ A;  3L4I A;  2ASM A;  2HW3 A;  4FLU A;  3ZSX A;  1KC8 O;  2D0P A;  4JN4 A;  5JMV A;  3E01 A;  4DSI A;  4CJ3 A;  1WAJ A;  2E5L K;  3AAP A;  4F2R A;  4BRI A;  3TI0 A;  5AQG A;  2ATQ A;  3FLC O;  2I7N A;  4LSL A;  3I8D A;  1Q81 O;  4PL8 A;  3HL8 A;  3QB0 A;  4ZTF A;  4FJN A;  4MDA A;  2GWK A;  3VEW A;  4NCB A;  3I55 N;  2B4J A;  3EEQ A;  3CC2 N;  3VPZ A;  3LDO A;  4IBN A;  4NLC A;  4IKF A;  1KCF A;  4C8M A;  3EKS A;  1XMQ K;  4CJV A;  3ZSY A;  4DSJ A;  3CCR N;  2VCP A;  2FC0 A;  3H3N O;  1E5W A;  3QBX A;  1XNR K;  1V4T A;  3SUP A;  4EIA A;  2X0S A;  2ITG A;  4W5T A;  3V6D A;  4FOE A;  1KVC A;  1WSI A;  1P8Z A;  2QXL A;  4MLE A;  4ILJ A;  4U67 L;  2O8B B;  4KTW A;  4QAG A;  1SS6 A;  4YOR A;  5M1Q A;  4GY2 B;  5BR9 A;  1S1T A;  3DLK A;  5KPR A;  4B9Q A;  3NAE A;  5DM7 L;  1WBB A;  1T05 A;  1WNS A;  2LSN A;  1KAZ A;  4FWS A;  3NH1 A;  1QS4 A;  2A42 A;  3IAY A;  5E84 A;  4FCY A;  4EAH D;  3K0S A;  3OS1 A;  3K5L A;  3F9M A;  3VF2 A;  1ZBI A;  4ID5 A;  1RBR A;  1K9M O;  2UXC K;  4CJE A;  4WQ4 A;  3ZX0 A;  3A2F A;  4GXB A;  5B8H A;  3VQQ A;  3NGI A;  3QIN A;  4KHY A;  4PKI A;  3AY9 A;  1NBW A;  4MO5 A;  4FW1 A;  1BL3 A;  4FLT A;  1FXX A;  1RIL A;  3TTC A;  1HQE A;  1VQP N;  2VG7 A;  4BE0 A;  3OYI A; 
#chains in the Genus database with same CATH homology
 4JK8 A;  1DT9 A;  3AAR A;  4BRQ A;  4JKG A;  3VMF B;  2NRT A;  3DXM A;  3ZYY X;  1V4S A;  3HBT A;  4U7B A;  2GUP A;  2PAV A;  2QWO A;  3PVL A;  1GLC G;  3FFK B;  5AZI B;  5HOO A;  1KAX A;  3G9W A;  4CBU A;  3VEX A;  5JVH L;  3SLC A;  3NVK A;  5AQI A;  3BEX A;  3IFR A;  1ATN A;  3D2F A;  4FWO A;  1DIK A;  4GV9 A;  3FGU A;  5CR4 A;  4A59 A;  4H5V A;  1XQS C;  2NZT A;  2JWL A;  2YHW A;  3E9P A;  5AQT A;  2IVN A;  2QWL A;  3DXM B;  3VTH A;  1VQ8 N;  2P9I B;  2WFB A;  1ISN A;  4O8U A;  3WEE B;  2OTJ N;  1TUY A;  1X3M A;  4QS7 A;  3GDQ A;  3UB5 A;  3A5L C;  2CB8 A;  5KQD A;  2A3Z A;  4BC3 A;  3PIP L;  1M1K O;  2P9U A;  2HBK A;  1MA9 B;  3E9L A;  3CCE N;  2D1K A;  3R8E A;  1CZA N;  3P38 A;  1RDW X;  2AA4 A;  3ZET B;  3CER A;  1VQ4 N;  2E2O A;  2EMT A;  5AQH A;  4MO4 A;  4DKW A;  4EKU A;  3ZX3 A;  4BG8 A;  3MK6 A;  3F5T A;  1QZ5 A;  4K42 A;  3UKU B;  3OBY A;  1EO1 A;  1O13 A;  2HBL A;  3KWG A;  3AGR A;  4CBW A;  1JCF A;  4HDO A;  2P9N B;  3CIP A;  3QFU A;  1S22 A;  1C0G A;  1YJN N;  1S72 N;  1XUP O;  4CJ7 A;  2GWJ A;  2A40 A;  4G9Z A;  2FJ9 A;  2E1Z A;  2RE2 A;  3VF4 A;  3U8Z A;  4YOX A;  2GTD A;  1VQ5 N;  1IG8 A;  2KLA A;  2QM1 A;  2YJF A;  3IMX A;  4I6M B;  1SZ2 A;  5F0X A;  1NGH A;  3H1V X;  3ATV A;  1TYQ B;  1GLJ O;  4L3Q A;  2P9N A;  4A62 A;  3SK3 A;  1LOT B;  1GLF O;  3QFP A;  2W41 A;  1Q86 O;  3ZEU B;  3LDQ A;  3O1B A;  3OBW A;  4H0O A;  3BP8 A;  2VGN A;  1K8K A;  5IJM A;  3SAF A;  3VGM A;  4JKB A;  1NGJ A;  3ID8 A;  2V7Y A;  3C0B A;  3DXK B;  5AQJ A;  2OTL N;  1VQ9 N;  4CZL A;  4BRC A;  4YL8 A;  1T3V A;  3G71 N;  2P9P A;  2UYT A;  3QDK A;  3NVM A;  1BUP A;  4BVP A;  3CI5 A;  1ZC6 A;  1HKB A;  2ITM A;  4WFB L;  1MIX A;  2AEH A;  3UE5 A;  2J0K A;  3F2K A;  3MDQ A;  3L4Q A;  4IXC A;  1OVY A;  3MMV A;  3M1F A;  4YDU C;  3FP5 A;  3O4W A;  4IJA A;  1VBG A;  3JXU A;  2YI1 A;  3MWP A;  1YJW N;  2P9P B;  3MN6 A;  3MN9 A;  5EX5 A;  5M1P A;  2IIR A;  3CJ9 A;  3VEZ A;  1MDU B;  5M1K A;  3C6H A;  2ZF5 O;  2F7T A;  4NB4 A;  1VQ7 N;  3CPE A;  3ENO A;  3CF5 L;  1QQO A;  2E20 A;  4KBO A;  3W0L A;  1HBK A;  4GVE A;  3OW2 M;  1E4F T;  5AQR A;  2VGM A;  3VEY A;  5GAD P;  4EHT A;  4F7G A;  5AQF A;  5AQU A;  5ADX H;  4IO9 L;  4BC2 A;  1NGB A;  5TKY A;  5AQQ A;  4A61 A;  1GLL O;  4Y0W A;  3ENB A;  1GLB G;  1HUX A;  2V52 B;  3CCU N;  5M1N A;  3NMU A;  3O9S A;  2W40 A;  1NJI O;  1BO5 O;  4H0V B;  3QBW A;  3PIO L;  3CME N;  2NRW A;  3CD6 N;  4H0X B;  2Q31 A;  3D2E B;  3EKU A;  3CQY A;  4IEE A;  5BRF A;  3G4S N;  3CC4 N;  4ILH A;  2QA4 N;  1N8R O;  4GV3 A;  4A5A A;  2NRX A;  1H4R A;  3P4I A;  1Y64 A;  3E1Y A;  4ZRJ A;  1J19 A;  3R1X A;  3R3L A;  5FPD A;  1G99 A;  3MN5 A;  3WXM B;  2AP1 A;  3J7Z O;  3I33 A;  2KKZ A;  2ZWH A;  3J8A A;  2GEM A;  2NNW A;  3L6Q A;  3MX5 A;  3CCQ N;  3CJB A;  1U2V A;  4BGA A;  4CD1 A;  5AQO A;  4WF9 L;  3SBG A;  4P7I A;  1T6C A;  1YXQ A;  3UKU A;  5EVZ A;  2QWP A;  5GIN A;  3ULE B;  3P31 A;  3UKR A;  5TKW A;  3SBT A;  2HF3 A;  3CQX A;  4ZRK A;  1Z6R A;  3M3Z A;  1YHQ N;  2YHX A;  4KH6 A;  1KC7 A;  1EF1 A;  3HTV A;  3BF3 A;  3R9P A;  5BRE A;  4KH4 A;  5BRD A;  2A5X A;  1WUA A;  3AAQ A;  4WCE L;  2ABD A;  3LM2 A;  5AQS A;  2E2N A;  1NLV A;  5EY4 A;  5F2R A;  4R79 A;  2Q2R A;  1H1V A;  5ADX A;  2QI2 A;  5AQX A;  1RDU A;  3N4P A;  2WC9 A;  4JHD A;  1RFQ A;  1NVL A;  1KD1 O;  5LJW A;  2FLO A;  1TYQ A;  1NGC A;  1ACA A;  3N4Q A;  3CCV N;  3PLA A;  1Q7Y O;  4CZG A;  3CJC A;  5BN9 A;  1NI2 A;  4K43 A;  1BA1 A;  5M1O A;  3AGK A;  4AM7 A;  3O9R A;  4BR4 A;  4FO0 A;  2IVO A;  3A8Y A;  4YDU A;  1NMD A;  3E66 A;  4JHD B;  1HJO A;  4PKH A;  2ZJQ L;  2QWQ A;  3AU5 A;  4OPH A;  1GLD G;  1K73 O;  3IKM A;  2P9S A;  1YUW A;  4BQZ A;  1M90 O;  3QIC A;  1QVF M;  3SMS A;  1GLA G;  2YX6 A;  3TU5 A;  1W2B M;  1ILY A;  3KK7 A;  2QW9 A;  4BRK A;  4PL7 A;  5BN8 A;  2WUS A;  3LDL A;  4Z94 A;  3D6R A;  3ZET A;  2VWB A;  4B1Z A;  4EHU A;  4YOV A;  4BC4 A;  4FSV A;  3R6M A;  4LC9 B;  3VEN A;  2NRH A;  4OO1 J;  2GX9 A;  2RHK A;  1YAG A;  2OAN A;  5LJV A;  5KQ8 A;  5BPM A;  1KAY A;  2P9S B;  4H0Y B;  3DJC A;  5AZJ B;  4A5B A;  3A5O C;  1MIZ B;  1GLE G;  4JEP A;  4DHY A;  4CZI A;  4IFE A;  4ISF A;  4FVU A;  3VTI A;  4CZF A;  2QTD A;  2AL6 A;  4RCH A;  4ILG B;  5C2D A;  4B1Y B;  4BRA A;  4JK9 A;  1NM1 A;  4JKA A;  2J4R A;  2HBM A;  4RWT A;  1SAZ A;  2E1Y A;  4PKG A;  5H1S Q;  3U4L A;  3EZW A;  3KHY A;  1QZ6 A;  5AQK A;  3TTF A;  3O08 A;  3X23 A;  3H6E A;  3TTD A;  4NY0 A;  4YOU A;  4F9O A;  4NO7 A;  4H0P A;  1NGD A;  3W3D A;  4AM6 A;  5M1F A;  2E8A A;  5E26 A;  4FWR A;  4FWM A;  3GE1 A;  3HI0 A;  3HM8 A;  2FF6 A;  4FWN A;  3IVF A;  1QHA A;  4BGB A;  4CZK A;  4ISG A;  3S41 A;  3C6A A;  3WXL A;  1U2V B;  4WFA L;  4OPA A;  3CCM N;  4ZRI A;  3VEV A;  3O5B A;  4XH4 A;  1ESV A;  2NRZ A;  2P9L B;  1HB6 A;  4CZM A;  1VQL N;  1T44 A;  3H46 O;  3TPQ A;  5JLF A;  3CXC M;  5ELZ A;  3LL3 A;  2V7Z A;  3O8M A;  4WQ5 C;  5JVG L;  3HOT A;  3U8X A;  4IEI A;  4CZE A;  2CGJ A;  5C12 A;  3O6W A;  4IZ9 A;  3CJ1 A;  4BR0 A;  1YIT N;  3D7E O;  4JNE A;  3AU4 A;  1VAZ A;  4K25 A;  3T69 A;  3EO3 A;  2J0J A;  5JVL A;  4FOI A;  3RSE B;  3TSQ A;  2P9L A;  4XEI A;  3BIN A;  2Q0R A;  1D4X A;  3KWI A;  3P39 A;  3QML A;  3H1Q A;  2QEX N;  2NRR A;  5AFU H;  4JKH A;  5AQW A;  4BQL A;  2YCH A;  2D4W A;  4H5T A;  1S3X A;  2BH1 A;  5BPN A;  3ZEU A;  4JKD A;  2CH5 A;  2HST A;  3LM9 A;  4IOX A;  5AQM A;  3MX2 A;  3U9Z A;  1GC7 A;  4A57 A;  2FSN A;  4BC5 A;  4C1N I;  3VGL A;  1YF5 L;  3B8A X;  3WUH A;  4HTL A;  3MCP A;  3U9D A;  5GAG P;  3KZB A;  2D2Q A;  3OHR A;  4YOY A;  3VGK A;  1HKC A;  2JWK A;  4H03 B;  3RSE A;  4B1V A;  3CC7 N;  3FLV A;  4BR7 A;  1KQS M;  1T6D A;  3Q7B A;  2A6A A;  4H0T B;  3CMA N;  4HWI A;  5I9E B;  3FZF A;  4FWP A;  2GEL A;  1DEJ A;  1YIJ N;  1Q82 O;  3C7N B;  4B1W B;  4FL9 A;  4J8F A;  3BF1 A;  2Q1N A;  4BRN A;  4M63 C;  1VBH A;  1VQ6 N;  2F9T A;  3HOS A;  2E2P A;  2D11 A;  4FPA A;  2YJE A;  3CHW A;  4TKN A;  3FZM A;  5JLH A;  1MK9 B;  1ZBS A;  4IOC L;  4NLB A;  4BRM A;  2ASP A;  5C15 A;  2LBB A;  4JK7 A;  4XH1 A;  1SGH A;  2P9I A;  3FZH A;  5AR0 A;  5C10 A;  2PFU A;  2FDQ A;  3FZL A;  4H5W A;  4A2B A;  2EMS A;  2V51 B;  3SAG A;  2YHY A;  4C23 A;  2PBD A;  4BR2 A;  3IDH A;  3OA9 A;  2P9U B;  1BWF O;  1RGI A;  3SJH A;  3JS6 A;  1DGK N;  1VQK N;  4HDQ A;  1TUU A;  2VYP A;  3DLL L;  5EXW A;  3MWT A;  2CH6 A;  3M5R A;  4B1U B;  4DCH A;  2CGL A;  3LDN A;  3T7Z A;  3SMP A;  3O9Q A;  3VOV A;  1QQN A;  2D10 A;  3GBT A;  2F9W A;  5JIC A;  3C65 A;  3CCS N;  5AFU A;  1BG3 A;  4ISE A;  2BUP A;  5DM6 L;  1VQM N;  3HSC A;  3O9T A;  2P9K B;  4RTF D;  4BY9 C;  3WA0 A;  4WFN L;  1Q18 A;  1WOQ A;  3G25 A;  5AQL A;  3O9U A;  2ZGZ A;  3ID6 A;  1HPM A;  1K8A O;  1JCE A;  2NLX A;  1JJ2 M;  3CJ7 A;  4BRD A;  1VQN N;  3WEE A;  4MDB A;  3VEO A;  2I1K A;  1IJJ A;  4O8K A;  3GL1 A;  5AQN A;  2HE7 A;  1MWK A;  4FWQ A;  3DWL A;  3ULE A;  2D0O A;  5EOY A;  4DB3 A;  1YJ9 N;  1NGG A;  4BVO A;  3QIJ A;  3DAW A;  1ZXO A;  3BUZ B;  3EL2 A;  3EPY A;  5C2F A;  3MN7 A;  1Z05 A;  1ATR A;  2H3G X;  1JCG A;  4CYE A;  2CGK A;  2FXU A;  2HF4 A;  2HOE A;  1NGI A;  2KHO A;  5FPN A;  3IUC A;  4IDH A;  3VET A;  4IJN A;  2Q97 A;  3DXK A;  4JKE A;  3ATU A;  3MCA B;  5FPM A;  2FSK A;  1YVN A;  4GNI A;  3WT0 A;  1J6Z A;  4BRP A;  1BDG A;  3HRG A;  3FR0 A;  2I1J A;  3WQT A;  2BTF A;  5BRH A;  2HBJ A;  1Y19 B;  3L4I A;  3K9J A;  2ASM A;  3ZDT A;  3A5M C;  3GOI A;  4E1J A;  3U7D A;  5AZJ A;  1KC8 O;  2D0P A;  1JDE A;  1X3N A;  1GG3 A;  3CET A;  4JN4 A;  4CZH A;  2WBN A;  1NGA A;  3PZD A;  5JMV A;  1VQO N;  1KXP A;  2J0M A;  2I7P A;  3WXK A;  4PHT X;  3AAP A;  2E2Q A;  1BA0 A;  4JKG B;  1E4G T;  4IWV A;  4A2A A;  5AQG A;  4BRI A;  4CBX A;  1NWK A;  1GGO A;  3O1W A;  3FLC O;  2YVC A;  2WH5 A;  2I7N A;  2IVP A;  5AZI A;  5GAH P;  3CPW M;  3VER A;  2ZJR L;  1NGE A;  2QWR A;  3GG4 A;  4PL8 A;  4AF1 A;  1Q81 O;  3QB0 A;  2RQ1 A;  4H5R A;  4KH5 A;  5HL7 L;  3D2F B;  1NTI A;  1BU6 O;  2FF3 B;  3RVC A;  2DPN A;  1K8K B;  4JAX A;  5KPZ A;  4MDA A;  4EFH A;  4IO8 A;  4MLH A;  2GWK A;  1DKG D;  3A0I X;  3VEW A;  3KVG A;  4O5F A;  1QVG M;  4BR9 A;  3ENH A;  3I55 N;  4BRL A;  5GAE P;  3CCJ N;  3G6E N;  3CC2 N;  3I8B A;  4M7X A;  3EE8 A;  1HKG A;  3VPZ A;  1HX1 A;  1QQM A;  4FWL A;  4GV6 A;  3LDO A;  4NLC A;  4UY8 O;  2ASO A;  4JKC A;  4JKF A;  3EKS A;  1HLU A;  3FZK A;  2R82 A;  1LCU A;  5F1X A;  5BPL A;  1X9J A;  3CCR N;  3Q7C A;  4BR5 A;  1MK7 B;  2VCP A;  3H3N O;  4CD3 A;  1E5W A;  3QBX A;  4BG9 A;  5C0Y A;  1V4T A;  4EIA A;  2ZJP L;  1U6Z A;  1EQY A;  2X0S A;  3HZ6 A;  2A41 A;  1R59 O;  4FOE A;  5GIO A;  3EE9 A;  3H45 C;  1P8Z A;  2QXL A;  4MLE A;  4ILJ A;  4U67 L;  3WQU A;  3TSP A;  5CHI A;  1SS6 A;  4YOR A;  5M1Q A;  3O80 A;  3ZX2 A;  3LDP A;  3UKR B;  4BRF A;  4DQ8 A;  3VF6 A;  2QWN A;  3M6G A;  5CE3 A;  2P9K A;  4GY2 B;  5BR9 A;  3CJA A;  3CCL N;  2COP A;  1ATS A;  3WXI A;  4B9Q A;  5AQY A;  5KPR A;  2ZGY A;  1XC3 A;  5DM7 L;  4QS8 A;  2NRV A;  3TSU A;  1NGF A;  4FPB A;  3H3O B;  3VES A;  4I6M A;  4CZJ A;  1KAZ A;  3D2E A;  4FWS A;  4BRE A;  1YI2 N;  4JD2 B;  2Q36 A;  5AQV A;  4C1N K;  5MLC Q;  1ST7 A;  2A42 A;  5GIP A;  5E84 A;  3I56 N;  2CQU A;  5LY3 A;  4EAH D;  5KPT A;  2HRJ A;  3F9M A;  3VF2 A;  1BOT O;  3C7N A;  5FPE A;  4WYB A;  5AQZ A;  1P90 A;  3WXJ A;  1K9M O;  4K41 A;  4WQ4 A;  4YOT A;  4YOW A;  1SQK A;  3FE1 A;  4DXA B;  3ZX0 A;  2E88 A;  4GXB A;  5B8H A;  3L0Q A;  2QWM A;  4BRO A;  3EN9 A;  4JD2 A;  3K9K A;  1GC6 A;  1KBL A;  1MWM A;  4BRG A;  4B1X B;  4PKI A;  2ZPY A;  3AY9 A;  1NBW A;  4M7Y A;  1C0F A;  4BRH A;  4CI6 A;  4MO5 A;  4QS9 A;  1HB8 A;  3E9O A;  4WQ4 C;  1W97 L;  3A5N C;  3SAH A;  2Q0U A;  4H5N A;  4XH5 A;  4IOA L;  2HMP A;  1OKJ A;  3TTC A;  4FWK A;  2EWS A;  4WQ5 A;  5AQP A;  1VQP N;  2FSJ A;  2DIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...