4JKVA

Structure of the human smoothened 7tm receptor in complex with an antitumor agent
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
469
structure length
454
Chain Sequence
GTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human smoothened receptor bound to an antitumour agent.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Soluble cytochrome b562, Smoothened homolog
total genus 186
structure length 454
sequence length 469
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01534 Frizzled Frizzled/Smoothened family membrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4jkvA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4jkvA02
2R4RA 4X31A 5JJJA 1UAZA 1FBKA 1JV6A 5H2LA 1LM3B 3ODUA 3QJRB 3UTVA 5EN0A 2YLIA 1GU8A 3UTWA 3ZWIA 4CJOA 4UG2A 2J4YA 3T45A 5G28A 3D4SA 5G53A 5B6WA 5AZDA 3HNIA 1HZXA 2YKZA 4KNFA 4MQTA 4Y9HA 2LNLA 1E86A 3S8FB 5G36A 4JEAA 3HANA 4U9EA 1EKYA 1X0K1 3AYMA 1Q5JA 4XTNA 1M0KA 1QM8A 2XLWA 1FBBA 4G71B 3OE6A 4HWLA 3QJVB 1R84A 4CDYA 4JEBA 1H68A 4L35A 1CGNA 4JE9A 4IAQA 4WW3A 2XLVA 2YCWA 4GBRA 1M0LA 3EMLA 5B6VA 3HNKA 4LDLA 3UZAA 1S53A 5TGZA 3HASA 4L6RA 4G7QB 3EH5B 2BC5A 3NMKA 2ZZLA 3VHZA 4JR8A 4G7RB 3OAXA 4N4WA 4CX9A 4QIDA 3M15A 3TOMA 5FJGA 3M79A 1YZAA 2F95A 1CPRA 3UTYA 3QBIA 1KG8A 2AT9A 1L0MA 1JAFA 1S8JA 3ABWA 3DDLA 4TL3A 5JRAA 3DE9A 3NY9A 3QJSB 1MQVA 3AYNA 3NYAA 3WQJA 1IW6A 1YYXA 4CJGA 2M3GA 3NMJA 1KGBA 5B6YA 5H2OA 1PY6A 5BR2A 3CODA 3QJQB 5B35A 1TN5A 2QPEB 3VGAA 1JFPA 2J9BA 1LN6A 4N6HA 3OE0A 1KG9A 1S51A 3EH4B 2BRDA 4MD2A 4DAJA 1E0PA 1NBBA 1BBHA 3ZQVA 3IQ6A 1U19A 3UTXA 2YCYA 1S8LA 1GZMA 1E85A 1YYJA 2L6XA 3PXOA 3HNJA 3NY8A 3ZPQA 1S54A 2Y03A 4PXFA 1CGOA 3QJUB 1A7VA 2XLDA 1QPUA 5JUAA 3S3DB 1VJMA 2YL0A 4GPOA 4FBZA 5A44A 1RCPA 4G72B 4MBSA 5AHZA 5BR5A 1EHKB 1VGOA 4UHRA 2NTUA 3QDCA 3S3CB 4MD1A 1GUEA 1PXSA 2Y02A 2YL3A 2PEDA 3NSBA 1AT9A 3MBVA 1E83A 1AP9A 4XT3A 3QJTB 2QLAA 5B6ZA 4NC3A 4U9DA 5DHHA 4GRVA 2Y00A 3RZEA 3S8GB 2Y04A 5AX0A 2XL8A 4G70B 1QQ3A 2XLEA 5KKHA 2EI4A 1XMEB 2XLMA 3C9LA 3M4CA 5ITCA 3PBLA 3QW1A 4X32A 1C8SA 1P8IA 5H2MA 2KSYA 1IW9A 3RFMA 5H2HA 5H2NA 2R4SA 1R2NA 4WAVA 5G54A 3UONA 4D4XA 3ZEVA 5G2CA 2XLOA 5JP7A 3TOLA 2YLGA 4XXJA 2YCZA 3HAQA 5JS5A 3UG9A 4IB4A 3COCA 3SN6R 4EIYA 2I21A 1E12A 1M0MA 5B3IA 2WJKA 4IARA 2I35A 3V2YA 4BEYA 1F50A 3C62A 3C9MA 2Z55A 3NS0A 3QAKA 3HARA 3OE8A 4JKVA 5JLIA 4DJHA 4BWBA 1DZEA 2HPYA 3REYA 3QW0A 5H2PA 1P8UA 5B6XA 4D4NA 1YZCA 1Q5IA 4QI1A 1TN0A 1E84A 2JAFA 5AWZA 1F4ZA 4BVNA 4A4MA 3U8PA 4XTOA 4X1HA 5JT4A 1S05A 1BRXA 5JJEA 4ER9A 4KLYA 4CDVA 1H2SA 2Z73A 1BM1A 2YLDA 1C3WA 1O0AA 2KS9A 3X3BA 2XM0A 4CDAA 2YCXA 3OE9A 3QBLA 5ETZA 3VI0A 2YL7A 3PQRA 4GP8B 1QKOA 3QVZA 1KMEA 5F8UA 4AMJA 3HAPA 3FOOA 3VW7A 3QVYA 1GQAA 1JV7A 4EA3A 5B2NA 4XTLA 4CIPA 3PDSA 4FAAB 3C63A 1JGJA 5AGFA 1UCQA 4HYJA 4GP5B 4BV0A 1L9HA 2YDVA 4GYCA 5A45A 4MQSA 5B0WA 3QBGA 1QHJA 4XT1A 3IQ5A 2I1XA 3KJ6A 4WGZA 3S3BB 1M6TA 1QKPA 4DKLA 3DQBA 2XM4A 3EH3B 4PXKA 2J8WA 2I20A 3BVDB 1MGYA 4AMIA 3DE8A 5ITEA 2YL1A 3QBKA 1XIOA 3FOPA 2F93A 256BA 3ZQYA 1X0I1 2ZIYA 3X3CA 5A8EA 3HAOA 5H2JA 1X0SA 4OV0A 4LDOA 4FA7B 2XL6A 5H2KA 5LWEA 3UZCA 2KSAA 4ULVA 5JSLA 1P8HA 5H2IA 2ZFEA 3M4BA 2Y01A 5B34A 1F88A 5G2DA 4EJ4A 3VVKA 1PXRA 1IXFA 3P0GA 2YDOA 2CCYA 5G2AA 4BUOA 1CPQA 4FPDA 3NMIA 5AHYA 2NTWA 1BRDA 5DHGA 2RH1A 4LDEA 4N4YB 3VRCA 2X72A 4BEZA 5JVEA 4K5YA 4GP4B 4WGYA 1APCA 4G7SB 5J7AA 5JJNA 3V2WA 2WJLA 2XLHA 3CAPA 4J4QA 3AM6A 3VG9A 4JQ6A 3ZTZA 1C8RA 5AX1A 2VT4A 3ZPRA 2QPDB 2G87A 1CWQA 5DYSA 3QAPA 5C1MA 2KSBA 3PWHA 4QRYA 3HNLA 1BRRA 3L1MA 4HYXA 2JAGA 1XJIA 3A7KA 1S52A 3ZTMA
chains in the Genus database with same CATH superfamily
4X31A 1HY5A 4WJ0A 1FBKA 4JCZA 1V4AA 1GS9A 4IWBA 3V5XA 3EG9A 4DS7E 3VAYA 2BE5F 3SXMA 3T45A 3D4SA 2PX0A 2YKZA 4Y9HA 2LNLA 5A69A 4EBBA 4NTAA 4U9EA 2AP3A 3HLZA 2ZD9A 4JTAB 3L34A 1FBBA 3OE6A 4HWLA 3QJVB 3TJ5A 3JCUQ 2XLVA 1M0LA 2YZSA 5TJ5E 1DOWA 2DI3A 5D91A 3MBGA 1FFHA 1S53A 4PJNA 3EH5B 3NMKA 2ZZLA 4JR8A 4G7RB 1ZU4A 4N4WA 2MHRA 2CNWD 3M15A 3FMSA 4IAOA 3TOMA 3DXJF 1GM5A 2NSGA 3B0UX 3WHNA 3T9OA 4QI0A 3B29A 1JAFA 4A4AA 4TL3A 5KYXA 4YL0A 4JJFA 4IGGA 1YYXA 4CJGA 2VCCA 3NKEA 3SP1A 2M3GA 2L9JA 4ZLCA 1BR2A 1NFNA 2GFHA 5BR2A 3CODA 2YVKA 4B6IA 3QJQB 5B35A 3Q7LA 3VGAA 1JFPA 3S0XA 2WZGA 2BRDA 1TFKB 3DJUB 4DAJA 3LS1A 1I4YA 3ZQVA 1YA9A 1U19A 3UTXA 2LD6A 3TJ6A 3UGPA 2G62A 4XPXA 2Y03A 1CGOA 3T4RA 3ZG1A 1XWJA 1QPUA 4CSAA 1Q0KA 3ZVRA 4I3MA 3IQTA 1VJMA 2VC9A 5A44A 4FBZA 3MYFA 1RCPA 4MBSA 1VGOA 3S3CB 2Y02A 3LLKA 2PEDA 3NSBA 3MBVA 1MNEA 1AP9A 3RKOF 5DS4A 4XLNF 3CEXA 3QJTB 1VYKA 4GYTA 5B6ZA 3AQBA 2HV7A 3DMDA 1DOVA 3S8GB 2Y04A 2L81A 5AX0A 4G70B 2XLEA 1KTMA 2HJMA 3PBLA 3KL4A 3U0CA 1R5ID 1C8SA 1O3UA 1VMAA 5H2HA 1WATA 4FAPB 1LS1A 2YCZA 4NTBA 1NZEA 3U9MA 4IB4A 3COCA 1TWGA 1LE2A 4EIYA 1E12A 1M0MA 4N6CA 5B3IA 4IARA 1A7EA 3V2YA 3DWWA 5E2QA 3C62A 2Z55A 3NS0A 3B0PA 1G4US 1K04A 4DJHA 2J46A 1DZEA 2J9UA 4EUKB 4U5HA 2L7AA 4D4NA 4BJ5A 1Q5IA 4Z9JA 4BJ6C 2FAPB 4BVNA 3S28A 3U8PA 4XTOA 4LERA 5BQGA 5JT4A 3GEEA 2NUPA 1AEPA 4ER9A 2IXPA 1BM1A 2YLDA 4G78A 1C3WA 1XZQA 1OR3A 2XM0A 5AC5A 3U8VA 5E3CA 3OE9A 2HSBA 2L6FA 5ETZA 1PCXA 4JZAA 3VI0A 1G4WR 1JMWA 1LS4A 2QNLA 2YL7A 1QKOA 2HV6A 5T3TA 4AMJA 2DYRC 2KYHA 3HAPA 4U5EE 1GQAA 1XZPA 2IOQA 4YWQA 5B2NA 4FAAB 2GA0A 3EQLF 1JRAA 4PJMA 3VYWA 4MTGA 2R7QA 1HW1A 3K1IC 4I1MA 3JRTA 3RQFA 5A45A 1ORSC 3UNGC 3ZDLA 3IQ5A 3KJ6A 4XEKA 2Y3DA 3V5ZA 3VM6A 1FMWA 4W8PA 4Z9IA 4BEJA 1QSPA 3GEIA 2ICWG 3QBKA 4Q7CA 1JPNA 2F93A 5A8EA 1T9KA 5H2JA 4K1OA 4LLCA 4HE8D 1X0SA 4J32B 4P9TA 4LDOA 2J9VA 5H2KA 2KSAA 3M4BA 2Y01A 5B34A 5T1DB 2IM8A 5A6JA 1ZHZA 3VVKA 1MMGA 5L0GA 1UG7A 2YDOA 3EGDB 2GWWA 3GM1A 2Q00A 2I15A 4BUOA 1CPQA 4JVSA 2NTWA 1H9GA 3AGUA 2WVOA 4LDEA 1Q0GA 4KNVA 5GPGB 4BEZA 1G5ZA 1GGQA 4G7SB 5JJNA 1OXBA 5FCLA 4NY3A 3O10A 3U2LA 3KMIA 2XLHA 3CAPA 2ASRA 1V54C 3AM6A 2GAQA 2QE9A 4MVQA 4XEVA 5F5FA 5EHHA 1C8RA 3ZPRA 1RJ9A 1UFBA 3GODA 3AJMA 5DYSA 3ZSUA 2ZXOA 1KU2A 1KNYA 5C1MA 3PWHA 4KC9A 3L1MA 4JW1A 2IYLD 1NSGB 1T6UA 2EIJC 4OIOF 2HKVA 3PMRA 1JV6A 5H2LA 2XSEA 3U5SA 3ODUA 1U0BB 5DQTA 1TQGA 5EN0A 5F5HA 1Z5ZA 2KGOA 3PDMP 2ETSA 5L3VA 2J4YA 3FDQA 5G53A 1E86A 1Z6AA 2G3KA 2UUHA 3HANA 4MW8A 1X0K1 2DYSC 1Q5JA 3EPVA 1LKXA 1QM8A 2B0HA 3U2MA 4G71B 1R84A 2AWYA 4JEBA 1H68A 5A6AA 4JE9A 4WW3A 3C18A 4GBRA 4O79A 5KYWA 3EMLA 4O6YA 1D0YA 3IQCA 5L0FA 2LP4A 3G4XA 3Q6MA 3T6BA 2OKUA 2AU5A 5FJGA 3AGTA 1CPRA 4G7OF 4DVYP 5E3AA 3CQZA 2J9WA 4MVOA 3S29A 1ZHXA 2R7XA 1J8MF 3NY9A 4U5BE 3QJSB 4XPWA 1Q0MA 2B0JA 4OIPF 3NMJA 1ORJA 4C3BA 5H2OA 1D0XA 5DVWA 3KYIA 3B71A 2F22A 3LUTB 3DM5A 4AL0A 1ZZPA 5D92A 2J9BA 4N6HA 3L8JA 5CI9A 3L8IA 4MD2A 2R7RA 1RKEB 2HZ8A 4LDKA 4YT4A 3LLIA 1BBHA 3IQ6A 3EHNA 2L6XA 1YYJA 3R2PA 3NY8A 3ZPQA 2R7VA 3GWLA 2C03A 3I5QA 4HEAJ 2Q7RA 4JTCB 4QDLA 4LDRA 1FAPB 2VASA 3KPHA 1B68A 4BJ1A 2LIGA 3KKBA 1FMVA 2EIMC 3I5PA 2NUTA 1PXSA 2YL3A 5FZTA 3G4ZA 2M64A 3SXYA 2Q3TA 2QLAA 2CGEA 1T6QA 4NC3A 2VCBA 1EI7A 1HMDA 2LFDA 1Y4CA 2Y00A 2R9RB 3W4YA 4RDAA 3RZEA 4IRUA 2L6HA 3T6GB 1FR0A 2EI4A 1XMEB 3C9LA 3M4CA 4XPYA 3QW1A 1IW9A 3W8HA 4AE4A 3RYLA 2V26A 3S27A 3GORA 1NLXA 5H2NA 2R4SA 5G2CA 1YLMA 2YLGA 4XXJA 3NYJA 3HAQA 1ZHWA 1Q0DA 4XEFA 4Z9HA 1ORYA 4U5DE 2P61A 2W4MA 1QVXA 2GDCA 4XLPF 4GEHA 1F50A 1SYQA 3C9MA 4DRHB 3Q6NA 4FX5A 2XRHA 4LACB 2J0XA 2HPYA 3QW0A 5DQZA 4E18A 1P8UA 1YZCA 3HTKC 5AWZA 2PX3A 4X1HA 2A6HF 1BRXA 2WZFA 3GM2A 4KLYA 3K1IA 1I5NA 3NYMA 1G8XA 1HE9A 5B1BC 5CIVA 3C8GB 2CW0F 2JD3A 2YWAA 4GP8B 1OCZC 5F8UA 1SR2A 3FOOA 3JSZA 2Q9AA 4OIQF 4CIPA 1M57C 3PDSA 4YJWA 5A6BD 1VOMA 4HYJA 4GP5B 1L9HA 2I8BA 2HFIA 4GYCA 2P7VA 4YL1A 2J0WA 4G7ZF 4XT1A 3S3BB 4DKLA 3DQBA 2I20A 1H9TA 3CAXA 4AMIA 1HE1A 4JJGA 3W8IA 5BQHA 3POVA 2OQMA 3ZQYA 1NG1A 1X0I1 3S9OA 2ZIYA 3X3CA 3DAFA 5K0IA 3LJBA 1A7DA 4E7ZA 4FA7B 2NG1A 2XL6A 3UZCA 3X1OA 2H8AA 3B9QA 5H2IA 4NQFA 4PFPA 2OOCA 1T5OA 1H6GA 3A11A 1IXFA 2PF4E 3P0GA 1O87A 1VK5A 2P6VA 5G2AA 3M1CB 1M2VB 4C7OA 3NMIA 5AHYA 5DHGA 5F28E 2KNHA 2V3CC 1Z23A 1A41A 3VRCA 2X72A 5JVEA 4K5YA 1APCA 3CZ6A 5J7AA 3WG7C 4C3EA 3JT1A 2WJLA 3B0VC 4JC7A 2HSQA 1TFOB 4AX2A 1IZMA 2R7TA 4I44A 3RW0A 1CWQA 3UR3C 2KSBA 4YL3A 1BRRA 2X0CA 2EPOA 4BJTA 4DRJB 4MNDA 3A7KA 2O9XA 2OG2A 3C8GA 3ZTMA 2R4RA 5JJJA 1UAZA 1L3PA 4P6IC 3QJRB 3AG1C 1OW7A 3UTVA 2Y69C 3V5YA 2HMZA 3UTWA 3EZIA 1LPEA 3ZWIA 2WL8A 5G28A 3RVYA 2Y39A 3EFOA 5B6WA 4KNFA 4MVSA 4XTKA 1FNTc 1JOGA 4O6MA 5G36A 4JEAA 4CBEA 2KJGA 3EGXB 3AYMA 4MVUA 3RQGA 1M0KA 2R7OA 1LIHA 3EFOB 5B1AC 1QLEC 1TKNA 2W4BA 3HNKA 4PR9A 3AG2C 4RBNA 3RFYA 2D4UA 5TGZA 4L6RA 2EPLX 1Z63A 3VHZA 2VCAA 4QIDA 3MX3A 1LI5A 4FWVA 4O7GA 4P9FA 3M79A 1SF8A 1YZAA 4CS9A 4AK9A 3UTYA 3QBIA 1KG8A 4E0IA 4AL1A 4MTFA 4MVZA 1S8JA 3ABWA 2FGYA 1Z3IX 3ABMC 2NUPB 5JRAA 1BDJB 3DE9A 2YEVA 1E2XA 3C8ZA 2CDQA 5A6KA 1V74B 2VB6A 1D1BA 2ZXWC 3CSKA 3W2WA 1PY6A 3I4UA 5AC4A 3EHMA 2X51A 4K0DA 1TN5A 3UGOA 2QPEB 1LI7A 4MQ9F 4FESA 3K6BA 3JRMO 3EH4B 1WGWA 1R4TA 1KG9A 3IEEA 1S51A 3LEVA 2P1AA 1E0PA 1NBBA 3C8GD 2YCYA 1S8LA 1GZMA 1OCCC 3RIPA 2WVNA 1TR2A 1S54A 3QJUB 2H7OA 1A7VA 2OJED 2XLDA 3SNHA 3PHF2 2H7VC 4F4BA 2AWCA 5COGA 3K66A 5JUAA 3S3DB 4Q4ZF 2YL0A 2A1DD 3C7JA 3K1HA 5EGYA 4JIOA 1C03A 4BJ5C 1Z7Qc 5L3QA 3LESA 1EHKB 2PNOA 2NTUA 2J7PA 3O55A 1GUEA 4MD1A 3LNMB 3TK0A 2QUPA 2IXMA 3ECSA 1E83A 1WWPA 3BEHA 4GRVA 4A2NB 3ABLC 3X2QC 4G0HA 1OR2A 4YT2A 1QQ3A 1QKRA 3TQOA 3ZC4A 2ZPAA 5ITCA 1D0ZA 2Y3BA 4NTFA 4X32A 3EG9B 2KK1A 1OXKA 1P8IA 5H2MA 3RFMA 4U5CE 1R2NA 3ZEVA 3UONA 4XQ1A 3TOLA 2W9YA 1ZYRF 5JS5A 2Q9CA 1ZVZA 2TMVP 4YN0B 2JPUA 4J7TA 4BJ6A 1ZU5A 4BEYA 2R03A 5L0HA 3SYNA 3OE8A 5JLIA 4G7HF 2YQYA 3MFNA 2A6EF 2XS8A 3REYA 5H2PA 4ONSA 5B6XA 3U9JA 3FVYA 4XWJA 4KI2A 1TN0A 2JAFA 2EPMX 1F4ZA 4YK5A 1MMAA 4C7OB 5JJEA 5L0IA 5KYUB 5B3SC 2ZXRA 2KS9A 4I1OB 5E33A 2UUIA 4OIRF 3X3BA 4CDAA 1Y6DA 3QBLA 2QY9A 1RMVA 4BEMJ 2XXAB 3TULA 3QVZA 3DI5A 1ZW2A 5HV9A 1S7ZA 3AQCA 1MMDA 1T01A 2OEVA 3QVYA 3L0IA 3A9CA 1JV7A 1O5HA 4EA3A 4MW3A 3C63A 2C04A 1UCQA 1U6HA 3SEOA 4PJLA 4BG0A 4BV0A 3AOUA 1BZ4A 2LK4A 2A69F 4MQSA 3QBGA 4DBQA 1L7CA 5COMA 4OD4A 2YRFA 2I1XA 5HSWA 2W45A 1M6TA 2M4EA 1K05A 2XM4A 3EH3B 2J8WA 1F1MA 3S84A 3BVDB 1MGYA 2Q9BA 4DBRA 1OCRC 4N06A 2YL1A 3W2VA 3ZIBA 3JSEO 3SXZA 1XIOA 2WB7A 5BQIA 3QTHA 1IW7F 3QZCA 3OWTA 3U3BA 4ANJA 2Z15A 2FFHA 3ASOC 2KQ9A 1D1AA 4ULVA 5JSLA 3DD7A 1J8YF 5G2DA 4EJ4A 5KYXB 1A0BA 2EIKC 1OKKD 3BRJA 2EINC 1BR1A 1LE4A 1OQCA 4E17A 3G50A 3FXHA 4FPDA 2NSFA 4WABA 4OINF 2EILC 3HKKA 2HMQA 4N4YB 4GP4B 4YT8A 4WGYA 3Q7GA 1ST6A 2XXAA 3V2WA 5COFA 2CYDA 4J4QA 4CS9C 3VG9A 3IPMO 3K7DA 4JQ6A 2XS1A 3EH2A 3WAQA 3IHUA 1YARO 3ZTZA 1SMYF 1PV3A 4ZLDA 1C17M 4KNWA 3DJNB 1VYIA 2KC3A 3GM3A 3HNLA 4HYXA 4PFOA 2KSFA 1XJIA 4ULWA 2Y3HA 1S52A 5A6BA 3UMIA 2AVKA 1RKEA 1LM3B 2PBEA 4MVMA 1WOLA 4CS8A 3SZRA 2YLIA 1GU8A 2J45A 4DRIB 5L0DA 4U5FE 1RXQA 4CJOA 4UG2A 2JX0A 2HJ3A 2OJQA 1NFOA 2PP4A 5AZDA 3HNIA 1HZXA 3O6XA 4MQTA 3AG3C 3J06A 3S8FB 4CS8C 4PJJA 3DZAA 1EKYA 3LS0A 4XTNA 2XLWA 3U3FA 1YAUO 4W8KA 1H7IA 2R05A 4CDYA 4L35A 1CGNA 4DXWA 4IAQA 2YCWA 2VH3A 5IY5C 5B6VA 4LDLA 3JTLO 3UZAA 2DGJA 3V7OA 4AE4B 1K40A 3O39A 3HASA 4OD5A 4LLEA 4G7QB 1YVIA 2BC5A 3HJCA 3OAXA 3ITFA 4CX9A 2LFFA 3VF0A 4EWCA 4H4KC 3ABKC 4E0HA 1NU9C 3H2VA 2F95A 1HW2A 2R7UA 1ZW3A 3MYIA 3H65A 2AT9A 2L6GA 3S90A 1D1CA 1RJ9B 3DM9B 3N0TA 1L0MA 1OKKA 3DDLA 5KYNA 2OU6A 3F47A 1MQVA 3AYNA 3NYAA 3WQJA 3RH3A 1IW6A 1QZXA 2IXOA 2CNWA 1MNDA 1T6IA 3GANA 1KGBA 3EZHA 2E87A 4GQHA 5B6YA 2EPKX 4CS7A 1VLSA 2MYSA 3TD7A 3LAYA 1U89A 1ZHYA 3JZ0A 1FFTC 3RVZA 1LN6A 3OE0A 2QTVA 3NKDA 3H2UA 4JURI 4IJJA 4PK4A 2LCHA 1C02A 1OW8A 5CI8A 2R7WA 1HMOA 1E85A 3PXOA 3HNJA 1YA7O 4PXFA 2BL2A 3FHDA 2WVQA 4PACA 4LDQA 4JRZA 4RD9A 1TWCA 4MVRA 1OCOC 1CGME 4GPOA 2NUTB 2DB4A 1WN0A 1OW6A 2KW3C 4G72B 5AHZA 5BR5A 4UHRA 3QDCA 2IXNA 4C3DA 1WTYA 4QI2A 1AT9A 3JYYA 4XT3A 1N1CA 4HFFB 1I4ZA 4U9DA 5DHHA 4K7BA 1LVKA 3NDBB 4EKWA 2RSEB 3US6A 2A68F 1TWHA 2XL8A 3GWNA 5KKHA 3EJNA 1M2VA 2XLMA 1FTSA 1VTMP 2PFDA 2KSYA 2YHSA 2NPUA 5G54A 4WAVA 4D4XA 2XLOA 5JP7A 1V55C 2LQGA 4EHPA 3UG9A 1YDIA 2A0BA 2MWQA 1MMNA 3SN6R 5KYYA 2I21A 3PCVA 2WJKA 2I35A 1RKCA 1SZIA 3KH2A 3QAKA 3N24A 5KYWB 3HARA 3R7CA 4JKVA 2G3VA 1AVOB 2R7SA 4BWBA 1M56C 3OEOA 4MTOA 2P0NA 2LSEA 2WZLA 1BR4A 1EQ1A 4QI1A 5DS6A 5DLJA 1E84A 3FAJA 4DVZA 4A4MA 2R02A 5BUOA 3E70C 3RQEA 2XL4A 1S05A 4CDVA 5T3WA 1H2SA 1TWAA 2Z73A 1O0AA 1PD0A 4X0RA 4KBLA 2EPNA 2OEXA 2YCXA 1ZHTA 3GEHA 3FAPB 3PQRA 1KMEA 2OCCC 1VB5A 3EGXA 3VW7A 4JTDB 2J7PD 4U5GA 3NYLA 2ZXPA 4CIHA 3UMKA 1W2WA 4XTLA 4DOZA 1PD1A 5EK0A 3EGDA 1JGJA 5AGFA 3QMKA 3DAGA 3EH1A 3NG1A 2YDVA 5B0WA 4JCHA 3UMHA 1VLTA 3LNRA 3ATPA 3ASNC 4MS2A 2R25A 1QHJA 4Q5SF 1JR8A 4WGZA 1QKPA 3RF3A 3LEOA 3SXKA 4PXKA 1WASA 3DE8A 3KYJA 5DS5A 1Q0FA 5ITEA 4HFKB 1EA8A 2IBFA 2HS5A 3WODF 5KYYB 5KYUA 3DKAA 4NCQA 3FOPA 4H54A 256BA 1NU7D 1AUEA 4M63A 3HAOA 2RD9A 3MLGA 3AG4C 4OV0A 5LWEA 5L0CA 2H7BA 1P8HA 4J30B 4EBKA 2ZFEA 1F88A 3NRHA 2A0UA 1PXRA 3JYHA 2CCYA 4E7SA 1BRDA 2D5RB 4J7YA 2RH1A 3T6JA 4EBJA 3OA1A 4BPMA 1M2OA 1YJGA 2Y3GA 2Q4FA 4DJ9A 3F46A 2HUJA 3E9VA 5L0JA 5AX1A 2VT4A 3K33A 2QPDB 2G87A 3N2ZB 4R32A 4UDVA 3QAPA 1JPJA 4QRYA 4YT5A 2JAGA 4CSAC 4O6NA
chains in the Genus database with same CATH topology
2R4RA 4X31A 5JJJA 1UAZA 1FBKA 1JV6A 5H2LA 1LM3B 3ODUA 3QJRB 3UTVA 4DS7E 5EN0A 2YLIA 1GU8A 3UTWA 3ZWIA 4CJOA 4UG2A 2J4YA 3T45A 5G28A 3D4SA 5G53A 5B6WA 5AZDA 3HNIA 1HZXA 2YKZA 4KNFA 4MQTA 4Y9HA 2LNLA 1E86A 3S8FB 5G36A 4JEAA 3HANA 4U9EA 1EKYA 1X0K1 3AYMA 1Q5JA 4XTNA 1M0KA 1QM8A 2XLWA 1FBBA 4G71B 3OE6A 4HWLA 3QJVB 1R84A 4CDYA 4JEBA 1H68A 4L35A 1CGNA 4JE9A 4IAQA 4WW3A 2XLVA 2YCWA 4GBRA 1M0LA 3EMLA 5B6VA 3HNKA 4LDLA 3UZAA 1S53A 5TGZA 3HASA 4L6RA 4G7QB 3EH5B 2BC5A 3NMKA 2ZZLA 3VHZA 4JR8A 4G7RB 3OAXA 4N4WA 4CX9A 4QIDA 3M15A 3TOMA 5FJGA 3M79A 1YZAA 2F95A 1CPRA 3UTYA 3QBIA 1KG8A 2AT9A 1L0MA 1JAFA 1S8JA 3ABWA 3DDLA 4TL3A 5JRAA 3DE9A 3NY9A 3QJSB 1MQVA 3AYNA 3NYAA 3WQJA 1IW6A 1YYXA 4CJGA 2M3GA 3NMJA 1KGBA 5B6YA 5H2OA 1PY6A 5BR2A 3CODA 3QJQB 5B35A 1TN5A 2QPEB 3VGAA 1JFPA 2J9BA 1LN6A 4N6HA 3OE0A 1KG9A 1S51A 3EH4B 2BRDA 4MD2A 4DAJA 1E0PA 1NBBA 1BBHA 3ZQVA 3IQ6A 1U19A 3UTXA 2YCYA 1S8LA 1GZMA 1E85A 1YYJA 2L6XA 3PXOA 3HNJA 3NY8A 3ZPQA 1S54A 2Y03A 4PXFA 1CGOA 3QJUB 1A7VA 2XLDA 1QPUA 5JUAA 3S3DB 1VJMA 2YL0A 4GPOA 4FBZA 5A44A 1RCPA 4G72B 4MBSA 5AHZA 5BR5A 1EHKB 1VGOA 4UHRA 2NTUA 3QDCA 3S3CB 4MD1A 1GUEA 1PXSA 2Y02A 2YL3A 2PEDA 3NSBA 1AT9A 3MBVA 1E83A 1AP9A 4XT3A 3QJTB 2QLAA 5B6ZA 4NC3A 4U9DA 5DHHA 4GRVA 2Y00A 3RZEA 3S8GB 2Y04A 5AX0A 2XL8A 4G70B 1QQ3A 2XLEA 5KKHA 2EI4A 1XMEB 2XLMA 3C9LA 3M4CA 5ITCA 3PBLA 3QW1A 4X32A 1C8SA 1P8IA 5H2MA 2KSYA 1IW9A 3RFMA 5H2HA 5H2NA 2R4SA 1R2NA 4WAVA 5G54A 3UONA 4D4XA 3ZEVA 5G2CA 2XLOA 5JP7A 3TOLA 2YLGA 4XXJA 2YCZA 3HAQA 5JS5A 3UG9A 4IB4A 3COCA 3SN6R 4EIYA 2I21A 1E12A 1M0MA 5B3IA 2WJKA 4IARA 2I35A 3V2YA 4BEYA 1F50A 3C62A 3C9MA 2Z55A 3NS0A 3QAKA 3HARA 3OE8A 4JKVA 5JLIA 4DJHA 4BWBA 1DZEA 2HPYA 3REYA 3QW0A 5H2PA 1P8UA 5B6XA 4D4NA 1YZCA 1Q5IA 4QI1A 1TN0A 1E84A 2JAFA 5AWZA 1F4ZA 4BVNA 4A4MA 3U8PA 4XTOA 4X1HA 5JT4A 1S05A 1BRXA 5JJEA 4ER9A 4KLYA 4CDVA 1H2SA 2Z73A 1BM1A 2YLDA 1C3WA 1O0AA 2KS9A 3X3BA 2XM0A 4CDAA 2YCXA 3OE9A 3QBLA 5ETZA 3VI0A 2YL7A 3PQRA 4GP8B 1QKOA 3QVZA 1KMEA 5F8UA 4AMJA 3HAPA 3FOOA 3VW7A 3QVYA 1GQAA 1JV7A 4EA3A 5B2NA 4XTLA 4CIPA 3PDSA 4FAAB 3C63A 1JGJA 5AGFA 1UCQA 4HYJA 4GP5B 4BV0A 1L9HA 2YDVA 4GYCA 5A45A 4MQSA 5B0WA 3QBGA 1QHJA 4XT1A 3IQ5A 2I1XA 3KJ6A 4WGZA 3S3BB 1M6TA 1QKPA 4DKLA 3DQBA 2XM4A 3EH3B 4PXKA 2J8WA 2I20A 3BVDB 1MGYA 4AMIA 3DE8A 5ITEA 2YL1A 3QBKA 1XIOA 3FOPA 2F93A 256BA 3ZQYA 1X0I1 2ZIYA 3X3CA 5A8EA 3HAOA 5H2JA 1X0SA 4OV0A 4LDOA 4FA7B 2XL6A 5H2KA 5LWEA 3UZCA 2KSAA 4ULVA 5JSLA 1P8HA 5H2IA 2ZFEA 3M4BA 2Y01A 5B34A 1F88A 5G2DA 4EJ4A 3VVKA 1PXRA 1IXFA 3P0GA 2YDOA 2CCYA 5G2AA 4BUOA 1CPQA 4FPDA 3NMIA 5AHYA 2NTWA 1BRDA 5DHGA 2RH1A 4LDEA 4N4YB 3VRCA 2X72A 4BEZA 5JVEA 4K5YA 4GP4B 4WGYA 1APCA 4G7SB 5J7AA 5JJNA 3V2WA 2WJLA 2XLHA 3CAPA 4J4QA 3AM6A 3VG9A 4JQ6A 3ZTZA 1C8RA 5AX1A 2VT4A 3ZPRA 2QPDB 2G87A 1CWQA 5DYSA 3QAPA 5C1MA 2KSBA 3PWHA 4QRYA 3HNLA 1BRRA 3L1MA 4HYXA 2JAGA 1XJIA 3A7KA 1S52A 3ZTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4R A;  4X31 A;  5JJJ A;  1UAZ A;  1FBK A;  1JV6 A;  5H2L A;  1LM3 B;  3ODU A;  3QJR B;  3UTV A;  5EN0 A;  2YLI A;  1GU8 A;  3UTW A;  3ZWI A;  4CJO A;  4UG2 A;  2J4Y A;  3T45 A;  5G28 A;  3D4S A;  5G53 A;  5B6W A;  5AZD A;  3HNI A;  1HZX A;  2YKZ A;  4KNF A;  4MQT A;  4Y9H A;  2LNL A;  1E86 A;  3S8F B;  5G36 A;  4JEA A;  3HAN A;  4U9E A;  1EKY A;  1X0K 1;  3AYM A;  1Q5J A;  4XTN A;  1M0K A;  1QM8 A;  2XLW A;  1FBB A;  4G71 B;  3OE6 A;  4HWL A;  3QJV B;  1R84 A;  4CDY A;  4JEB A;  1H68 A;  4L35 A;  1CGN A;  4JE9 A;  4IAQ A;  4WW3 A;  2XLV A;  2YCW A;  4GBR A;  1M0L A;  3EML A;  5B6V A;  3HNK A;  4LDL A;  3UZA A;  1S53 A;  5TGZ A;  3HAS A;  4L6R A;  4G7Q B;  3EH5 B;  2BC5 A;  3NMK A;  2ZZL A;  3VHZ A;  4JR8 A;  4G7R B;  3OAX A;  4N4W A;  4CX9 A;  4QID A;  3M15 A;  3TOM A;  5FJG A;  3M79 A;  1YZA A;  2F95 A;  1CPR A;  3UTY A;  3QBI A;  1KG8 A;  2AT9 A;  1L0M A;  1JAF A;  1S8J A;  3ABW A;  3DDL A;  4TL3 A;  5JRA A;  3DE9 A;  3NY9 A;  3QJS B;  1MQV A;  3AYN A;  3NYA A;  3WQJ A;  1IW6 A;  1YYX A;  4CJG A;  2M3G A;  3NMJ A;  1KGB A;  5B6Y A;  5H2O A;  1PY6 A;  5BR2 A;  3COD A;  3QJQ B;  5B35 A;  1TN5 A;  2QPE B;  3VGA A;  1JFP A;  2J9B A;  1LN6 A;  4N6H A;  3OE0 A;  1KG9 A;  1S51 A;  3EH4 B;  2BRD A;  4MD2 A;  4DAJ A;  1E0P A;  1NBB A;  1BBH A;  3ZQV A;  3IQ6 A;  1U19 A;  3UTX A;  2YCY A;  1S8L A;  1GZM A;  1E85 A;  1YYJ A;  2L6X A;  3PXO A;  3HNJ A;  3NY8 A;  3ZPQ A;  1S54 A;  2Y03 A;  4PXF A;  1CGO A;  3QJU B;  1A7V A;  2XLD A;  1QPU A;  5JUA A;  3S3D B;  1VJM A;  2YL0 A;  4GPO A;  4FBZ A;  5A44 A;  1RCP A;  4G72 B;  4MBS A;  5AHZ A;  5BR5 A;  1EHK B;  1VGO A;  4UHR A;  2NTU A;  3QDC A;  3S3C B;  4MD1 A;  1GUE A;  1PXS A;  2Y02 A;  2YL3 A;  2PED A;  3NSB A;  1AT9 A;  3MBV A;  1E83 A;  1AP9 A;  4XT3 A;  3QJT B;  2QLA A;  5B6Z A;  4NC3 A;  4U9D A;  5DHH A;  4GRV A;  2Y00 A;  3RZE A;  3S8G B;  2Y04 A;  5AX0 A;  2XL8 A;  4G70 B;  1QQ3 A;  2XLE A;  5KKH A;  2EI4 A;  1XME B;  2XLM A;  3C9L A;  3M4C A;  5ITC A;  3PBL A;  3QW1 A;  4X32 A;  1C8S A;  1P8I A;  5H2M A;  2KSY A;  1IW9 A;  3RFM A;  5H2H A;  5H2N A;  2R4S A;  1R2N A;  4WAV A;  5G54 A;  3UON A;  4D4X A;  3ZEV A;  5G2C A;  2XLO A;  5JP7 A;  3TOL A;  2YLG A;  4XXJ A;  2YCZ A;  3HAQ A;  5JS5 A;  3UG9 A;  4IB4 A;  3COC A;  3SN6 R;  4EIY A;  2I21 A;  1E12 A;  1M0M A;  5B3I A;  2WJK A;  4IAR A;  2I35 A;  3V2Y A;  4BEY A;  1F50 A;  3C62 A;  3C9M A;  2Z55 A;  3NS0 A;  3QAK A;  3HAR A;  3OE8 A;  4JKV A;  5JLI A;  4DJH A;  4BWB A;  1DZE A;  2HPY A;  3REY A;  3QW0 A;  5H2P A;  1P8U A;  5B6X A;  4D4N A;  1YZC A;  1Q5I A;  4QI1 A;  1TN0 A;  1E84 A;  2JAF A;  5AWZ A;  1F4Z A;  4BVN A;  4A4M A;  3U8P A;  4XTO A;  4X1H A;  5JT4 A;  1S05 A;  1BRX A;  5JJE A;  4ER9 A;  4KLY A;  4CDV A;  1H2S A;  2Z73 A;  1BM1 A;  2YLD A;  1C3W A;  1O0A A;  2KS9 A;  3X3B A;  2XM0 A;  4CDA A;  2YCX A;  3OE9 A;  3QBL A;  5ETZ A;  3VI0 A;  2YL7 A;  3PQR A;  4GP8 B;  1QKO A;  3QVZ A;  1KME A;  5F8U A;  4AMJ A;  3HAP A;  3FOO A;  3VW7 A;  3QVY A;  1GQA A;  1JV7 A;  4EA3 A;  5B2N A;  4XTL A;  4CIP A;  3PDS A;  4FAA B;  3C63 A;  1JGJ A;  5AGF A;  1UCQ A;  4HYJ A;  4GP5 B;  4BV0 A;  1L9H A;  2YDV A;  4GYC A;  5A45 A;  4MQS A;  5B0W A;  3QBG A;  1QHJ A;  4XT1 A;  3IQ5 A;  2I1X A;  3KJ6 A;  4WGZ A;  3S3B B;  1M6T A;  1QKP A;  4DKL A;  3DQB A;  2XM4 A;  3EH3 B;  4PXK A;  2J8W A;  2I20 A;  3BVD B;  1MGY A;  4AMI A;  3DE8 A;  5ITE A;  2YL1 A;  3QBK A;  1XIO A;  3FOP A;  2F93 A;  256B A;  3ZQY A;  1X0I 1;  2ZIY A;  3X3C A;  5A8E A;  3HAO A;  5H2J A;  1X0S A;  4OV0 A;  4LDO A;  4FA7 B;  2XL6 A;  5H2K A;  5LWE A;  3UZC A;  2KSA A;  4ULV A;  5JSL A;  1P8H A;  5H2I A;  2ZFE A;  3M4B A;  2Y01 A;  5B34 A;  1F88 A;  5G2D A;  4EJ4 A;  3VVK A;  1PXR A;  1IXF A;  3P0G A;  2YDO A;  2CCY A;  5G2A A;  4BUO A;  1CPQ A;  4FPD A;  3NMI A;  5AHY A;  2NTW A;  1BRD A;  5DHG A;  2RH1 A;  4LDE A;  4N4Y B;  3VRC A;  2X72 A;  4BEZ A;  5JVE A;  4K5Y A;  4GP4 B;  4WGY A;  1APC A;  4G7S B;  5J7A A;  5JJN A;  3V2W A;  2WJL A;  2XLH A;  3CAP A;  4J4Q A;  3AM6 A;  3VG9 A;  4JQ6 A;  3ZTZ A;  1C8R A;  5AX1 A;  2VT4 A;  3ZPR A;  2QPD B;  2G87 A;  1CWQ A;  5DYS A;  3QAP A;  5C1M A;  2KSB A;  3PWH A;  4QRY A;  3HNL A;  1BRR A;  3L1M A;  4HYX A;  2JAG A;  1XJI A;  3A7K A;  1S52 A;  3ZTM A; 
#chains in the Genus database with same CATH topology
 4X31 A;  1HY5 A;  4WJ0 A;  1FBK A;  4JCZ A;  1V4A A;  1GS9 A;  4IWB A;  3V5X A;  3EG9 A;  4DS7 E;  3VAY A;  2BE5 F;  3SXM A;  3T45 A;  3D4S A;  2PX0 A;  2YKZ A;  4Y9H A;  2LNL A;  5A69 A;  4EBB A;  4NTA A;  4U9E A;  2AP3 A;  3HLZ A;  2ZD9 A;  4JTA B;  3L34 A;  1FBB A;  3OE6 A;  4HWL A;  3QJV B;  3TJ5 A;  3JCU Q;  2XLV A;  1M0L A;  2YZS A;  5TJ5 E;  1DOW A;  2DI3 A;  5D91 A;  3MBG A;  1FFH A;  1S53 A;  4PJN A;  3EH5 B;  3NMK A;  2ZZL A;  4JR8 A;  4G7R B;  1ZU4 A;  4N4W A;  2MHR A;  2CNW D;  3M15 A;  3FMS A;  4IAO A;  3TOM A;  3DXJ F;  1GM5 A;  2NSG A;  3B0U X;  3WHN A;  3T9O A;  4QI0 A;  3B29 A;  1JAF A;  4A4A A;  4TL3 A;  5KYX A;  4YL0 A;  4JJF A;  4IGG A;  1YYX A;  4CJG A;  2VCC A;  3NKE A;  3SP1 A;  2M3G A;  2L9J A;  4ZLC A;  1BR2 A;  1NFN A;  2GFH A;  5BR2 A;  3COD A;  2YVK A;  4B6I A;  3QJQ B;  5B35 A;  3Q7L A;  3VGA A;  1JFP A;  3S0X A;  2WZG A;  2BRD A;  1TFK B;  3DJU B;  4DAJ A;  3LS1 A;  1I4Y A;  3ZQV A;  1YA9 A;  1U19 A;  3UTX A;  2LD6 A;  3TJ6 A;  3UGP A;  2G62 A;  4XPX A;  2Y03 A;  1CGO A;  3T4R A;  3ZG1 A;  1XWJ A;  1QPU A;  4CSA A;  1Q0K A;  3ZVR A;  4I3M A;  3IQT A;  1VJM A;  2VC9 A;  5A44 A;  4FBZ A;  3MYF A;  1RCP A;  4MBS A;  1VGO A;  3S3C B;  2Y02 A;  3LLK A;  2PED A;  3NSB A;  3MBV A;  1MNE A;  1AP9 A;  3RKO F;  5DS4 A;  4XLN F;  3CEX A;  3QJT B;  1VYK A;  4GYT A;  5B6Z A;  3AQB A;  2HV7 A;  3DMD A;  1DOV A;  3S8G B;  2Y04 A;  2L81 A;  5AX0 A;  4G70 B;  2XLE A;  1KTM A;  2HJM A;  3PBL A;  3KL4 A;  3U0C A;  1R5I D;  1C8S A;  1O3U A;  1VMA A;  5H2H A;  1WAT A;  4FAP B;  1LS1 A;  2YCZ A;  4NTB A;  1NZE A;  3U9M A;  4IB4 A;  3COC A;  1TWG A;  1LE2 A;  4EIY A;  1E12 A;  1M0M A;  4N6C A;  5B3I A;  4IAR A;  1A7E A;  3V2Y A;  3DWW A;  5E2Q A;  3C62 A;  2Z55 A;  3NS0 A;  3B0P A;  1G4U S;  1K04 A;  4DJH A;  2J46 A;  1DZE A;  2J9U A;  4EUK B;  4U5H A;  2L7A A;  4D4N A;  4BJ5 A;  1Q5I A;  4Z9J A;  4BJ6 C;  2FAP B;  4BVN A;  3S28 A;  3U8P A;  4XTO A;  4LER A;  5BQG A;  5JT4 A;  3GEE A;  2NUP A;  1AEP A;  4ER9 A;  2IXP A;  1BM1 A;  2YLD A;  4G78 A;  1C3W A;  1XZQ A;  1OR3 A;  2XM0 A;  5AC5 A;  3U8V A;  5E3C A;  3OE9 A;  2HSB A;  2L6F A;  5ETZ A;  1PCX A;  4JZA A;  3VI0 A;  1G4W R;  1JMW A;  1LS4 A;  2QNL A;  2YL7 A;  1QKO A;  2HV6 A;  5T3T A;  4AMJ A;  2DYR C;  2KYH A;  3HAP A;  4U5E E;  1GQA A;  1XZP A;  2IOQ A;  4YWQ A;  5B2N A;  4FAA B;  2GA0 A;  3EQL F;  1JRA A;  4PJM A;  3VYW A;  4MTG A;  2R7Q A;  1HW1 A;  3K1I C;  4I1M A;  3JRT A;  3RQF A;  5A45 A;  1ORS C;  3UNG C;  3ZDL A;  3IQ5 A;  3KJ6 A;  4XEK A;  2Y3D A;  3V5Z A;  3VM6 A;  1FMW A;  4W8P A;  4Z9I A;  4BEJ A;  1QSP A;  3GEI A;  2ICW G;  3QBK A;  4Q7C A;  1JPN A;  2F93 A;  5A8E A;  1T9K A;  5H2J A;  4K1O A;  4LLC A;  4HE8 D;  1X0S A;  4J32 B;  4P9T A;  4LDO A;  2J9V A;  5H2K A;  2KSA A;  3M4B A;  2Y01 A;  5B34 A;  5T1D B;  2IM8 A;  5A6J A;  1ZHZ A;  3VVK A;  1MMG A;  5L0G A;  1UG7 A;  2YDO A;  3EGD B;  2GWW A;  3GM1 A;  2Q00 A;  2I15 A;  4BUO A;  1CPQ A;  4JVS A;  2NTW A;  1H9G A;  3AGU A;  2WVO A;  4LDE A;  1Q0G A;  4KNV A;  5GPG B;  4BEZ A;  1G5Z A;  1GGQ A;  4G7S B;  5JJN A;  1OXB A;  5FCL A;  4NY3 A;  3O10 A;  3U2L A;  3KMI A;  2XLH A;  3CAP A;  2ASR A;  1V54 C;  3AM6 A;  2GAQ A;  2QE9 A;  4MVQ A;  4XEV A;  5F5F A;  5EHH A;  1C8R A;  3ZPR A;  1RJ9 A;  1UFB A;  3GOD A;  3AJM A;  5DYS A;  3ZSU A;  2ZXO A;  1KU2 A;  1KNY A;  5C1M A;  3PWH A;  4KC9 A;  3L1M A;  4JW1 A;  2IYL D;  1NSG B;  1T6U A;  2EIJ C;  4OIO F;  2HKV A;  3PMR A;  1JV6 A;  5H2L A;  2XSE A;  3U5S A;  3ODU A;  1U0B B;  5DQT A;  1TQG A;  5EN0 A;  5F5H A;  1Z5Z A;  2KGO A;  3PDM P;  2ETS A;  5L3V A;  2J4Y A;  3FDQ A;  5G53 A;  1E86 A;  1Z6A A;  2G3K A;  2UUH A;  3HAN A;  4MW8 A;  1X0K 1;  2DYS C;  1Q5J A;  3EPV A;  1LKX A;  1QM8 A;  2B0H A;  3U2M A;  4G71 B;  1R84 A;  2AWY A;  4JEB A;  1H68 A;  5A6A A;  4JE9 A;  4WW3 A;  3C18 A;  4GBR A;  4O79 A;  5KYW A;  3EML A;  4O6Y A;  1D0Y A;  3IQC A;  5L0F A;  2LP4 A;  3G4X A;  3Q6M A;  3T6B A;  2OKU A;  2AU5 A;  5FJG A;  3AGT A;  1CPR A;  4G7O F;  4DVY P;  5E3A A;  3CQZ A;  2J9W A;  4MVO A;  3S29 A;  1ZHX A;  2R7X A;  1J8M F;  3NY9 A;  4U5B E;  3QJS B;  4XPW A;  1Q0M A;  2B0J A;  4OIP F;  3NMJ A;  1ORJ A;  4C3B A;  5H2O A;  1D0X A;  5DVW A;  3KYI A;  3B71 A;  2F22 A;  3LUT B;  3DM5 A;  4AL0 A;  1ZZP A;  5D92 A;  2J9B A;  4N6H A;  3L8J A;  5CI9 A;  3L8I A;  4MD2 A;  2R7R A;  1RKE B;  2HZ8 A;  4LDK A;  4YT4 A;  3LLI A;  1BBH A;  3IQ6 A;  3EHN A;  2L6X A;  1YYJ A;  3R2P A;  3NY8 A;  3ZPQ A;  2R7V A;  3GWL A;  2C03 A;  3I5Q A;  4HEA J;  2Q7R A;  4JTC B;  4QDL A;  4LDR A;  1FAP B;  2VAS A;  3KPH A;  1B68 A;  4BJ1 A;  2LIG A;  3KKB A;  1FMV A;  2EIM C;  3I5P A;  2NUT A;  1PXS A;  2YL3 A;  5FZT A;  3G4Z A;  2M64 A;  3SXY A;  2Q3T A;  2QLA A;  2CGE A;  1T6Q A;  4NC3 A;  2VCB A;  1EI7 A;  1HMD A;  2LFD A;  1Y4C A;  2Y00 A;  2R9R B;  3W4Y A;  4RDA A;  3RZE A;  4IRU A;  2L6H A;  3T6G B;  1FR0 A;  2EI4 A;  1XME B;  3C9L A;  3M4C A;  4XPY A;  3QW1 A;  1IW9 A;  3W8H A;  4AE4 A;  3RYL A;  2V26 A;  3S27 A;  3GOR A;  1NLX A;  5H2N A;  2R4S A;  5G2C A;  1YLM A;  2YLG A;  4XXJ A;  3NYJ A;  3HAQ A;  1ZHW A;  1Q0D A;  4XEF A;  4Z9H A;  1ORY A;  4U5D E;  2P61 A;  2W4M A;  1QVX A;  2GDC A;  4XLP F;  4GEH A;  1F50 A;  1SYQ A;  3C9M A;  4DRH B;  3Q6N A;  4FX5 A;  2XRH A;  4LAC B;  2J0X A;  2HPY A;  3QW0 A;  5DQZ A;  4E18 A;  1P8U A;  1YZC A;  3HTK C;  5AWZ A;  2PX3 A;  4X1H A;  2A6H F;  1BRX A;  2WZF A;  3GM2 A;  4KLY A;  3K1I A;  1I5N A;  3NYM A;  1G8X A;  1HE9 A;  5B1B C;  5CIV A;  3C8G B;  2CW0 F;  2JD3 A;  2YWA A;  4GP8 B;  1OCZ C;  5F8U A;  1SR2 A;  3FOO A;  3JSZ A;  2Q9A A;  4OIQ F;  4CIP A;  1M57 C;  3PDS A;  4YJW A;  5A6B D;  1VOM A;  4HYJ A;  4GP5 B;  1L9H A;  2I8B A;  2HFI A;  4GYC A;  2P7V A;  4YL1 A;  2J0W A;  4G7Z F;  4XT1 A;  3S3B B;  4DKL A;  3DQB A;  2I20 A;  1H9T A;  3CAX A;  4AMI A;  1HE1 A;  4JJG A;  3W8I A;  5BQH A;  3POV A;  2OQM A;  3ZQY A;  1NG1 A;  1X0I 1;  3S9O A;  2ZIY A;  3X3C A;  3DAF A;  5K0I A;  3LJB A;  1A7D A;  4E7Z A;  4FA7 B;  2NG1 A;  2XL6 A;  3UZC A;  3X1O A;  2H8A A;  3B9Q A;  5H2I A;  4NQF A;  4PFP A;  2OOC A;  1T5O A;  1H6G A;  3A11 A;  1IXF A;  2PF4 E;  3P0G A;  1O87 A;  1VK5 A;  2P6V A;  5G2A A;  3M1C B;  1M2V B;  4C7O A;  3NMI A;  5AHY A;  5DHG A;  5F28 E;  2KNH A;  2V3C C;  1Z23 A;  1A41 A;  3VRC A;  2X72 A;  5JVE A;  4K5Y A;  1APC A;  3CZ6 A;  5J7A A;  3WG7 C;  4C3E A;  3JT1 A;  2WJL A;  3B0V C;  4JC7 A;  2HSQ A;  1TFO B;  4AX2 A;  1IZM A;  2R7T A;  4I44 A;  3RW0 A;  1CWQ A;  3UR3 C;  2KSB A;  4YL3 A;  1BRR A;  2X0C A;  2EPO A;  4BJT A;  4DRJ B;  4MND A;  3A7K A;  2O9X A;  2OG2 A;  3C8G A;  3ZTM A;  2R4R A;  5JJJ A;  1UAZ A;  1L3P A;  4P6I C;  3QJR B;  3AG1 C;  1OW7 A;  3UTV A;  2Y69 C;  3V5Y A;  2HMZ A;  3UTW A;  3EZI A;  1LPE A;  3ZWI A;  2WL8 A;  5G28 A;  3RVY A;  2Y39 A;  3EFO A;  5B6W A;  4KNF A;  4MVS A;  4XTK A;  1FNT c;  1JOG A;  4O6M A;  5G36 A;  4JEA A;  4CBE A;  2KJG A;  3EGX B;  3AYM A;  4MVU A;  3RQG A;  1M0K A;  2R7O A;  1LIH A;  3EFO B;  5B1A C;  1QLE C;  1TKN A;  2W4B A;  3HNK A;  4PR9 A;  3AG2 C;  4RBN A;  3RFY A;  2D4U A;  5TGZ A;  4L6R A;  2EPL X;  1Z63 A;  3VHZ A;  2VCA A;  4QID A;  3MX3 A;  1LI5 A;  4FWV A;  4O7G A;  4P9F A;  3M79 A;  1SF8 A;  1YZA A;  4CS9 A;  4AK9 A;  3UTY A;  3QBI A;  1KG8 A;  4E0I A;  4AL1 A;  4MTF A;  4MVZ A;  1S8J A;  3ABW A;  2FGY A;  1Z3I X;  3ABM C;  2NUP B;  5JRA A;  1BDJ B;  3DE9 A;  2YEV A;  1E2X A;  3C8Z A;  2CDQ A;  5A6K A;  1V74 B;  2VB6 A;  1D1B A;  2ZXW C;  3CSK A;  3W2W A;  1PY6 A;  3I4U A;  5AC4 A;  3EHM A;  2X51 A;  4K0D A;  1TN5 A;  3UGO A;  2QPE B;  1LI7 A;  4MQ9 F;  4FES A;  3K6B A;  3JRM O;  3EH4 B;  1WGW A;  1R4T A;  1KG9 A;  3IEE A;  1S51 A;  3LEV A;  2P1A A;  1E0P A;  1NBB A;  3C8G D;  2YCY A;  1S8L A;  1GZM A;  1OCC C;  3RIP A;  2WVN A;  1TR2 A;  1S54 A;  3QJU B;  2H7O A;  1A7V A;  2OJE D;  2XLD A;  3SNH A;  3PHF 2;  2H7V C;  4F4B A;  2AWC A;  5COG A;  3K66 A;  5JUA A;  3S3D B;  4Q4Z F;  2YL0 A;  2A1D D;  3C7J A;  3K1H A;  5EGY A;  4JIO A;  1C03 A;  4BJ5 C;  1Z7Q c;  5L3Q A;  3LES A;  1EHK B;  2PNO A;  2NTU A;  2J7P A;  3O55 A;  1GUE A;  4MD1 A;  3LNM B;  3TK0 A;  2QUP A;  2IXM A;  3ECS A;  1E83 A;  1WWP A;  3BEH A;  4GRV A;  4A2N B;  3ABL C;  3X2Q C;  4G0H A;  1OR2 A;  4YT2 A;  1QQ3 A;  1QKR A;  3TQO A;  3ZC4 A;  2ZPA A;  5ITC A;  1D0Z A;  2Y3B A;  4NTF A;  4X32 A;  3EG9 B;  2KK1 A;  1OXK A;  1P8I A;  5H2M A;  3RFM A;  4U5C E;  1R2N A;  3ZEV A;  3UON A;  4XQ1 A;  3TOL A;  2W9Y A;  1ZYR F;  5JS5 A;  2Q9C A;  1ZVZ A;  2TMV P;  4YN0 B;  2JPU A;  4J7T A;  4BJ6 A;  1ZU5 A;  4BEY A;  2R03 A;  5L0H A;  3SYN A;  3OE8 A;  5JLI A;  4G7H F;  2YQY A;  3MFN A;  2A6E F;  2XS8 A;  3REY A;  5H2P A;  4ONS A;  5B6X A;  3U9J A;  3FVY A;  4XWJ A;  4KI2 A;  1TN0 A;  2JAF A;  2EPM X;  1F4Z A;  4YK5 A;  1MMA A;  4C7O B;  5JJE A;  5L0I A;  5KYU B;  5B3S C;  2ZXR A;  2KS9 A;  4I1O B;  5E33 A;  2UUI A;  4OIR F;  3X3B A;  4CDA A;  1Y6D A;  3QBL A;  2QY9 A;  1RMV A;  4BEM J;  2XXA B;  3TUL A;  3QVZ A;  3DI5 A;  1ZW2 A;  5HV9 A;  1S7Z A;  3AQC A;  1MMD A;  1T01 A;  2OEV A;  3QVY A;  3L0I A;  3A9C A;  1JV7 A;  1O5H A;  4EA3 A;  4MW3 A;  3C63 A;  2C04 A;  1UCQ A;  1U6H A;  3SEO A;  4PJL A;  4BG0 A;  4BV0 A;  3AOU A;  1BZ4 A;  2LK4 A;  2A69 F;  4MQS A;  3QBG A;  4DBQ A;  1L7C A;  5COM A;  4OD4 A;  2YRF A;  2I1X A;  5HSW A;  2W45 A;  1M6T A;  2M4E A;  1K05 A;  2XM4 A;  3EH3 B;  2J8W A;  1F1M A;  3S84 A;  3BVD B;  1MGY A;  2Q9B A;  4DBR A;  1OCR C;  4N06 A;  2YL1 A;  3W2V A;  3ZIB A;  3JSE O;  3SXZ A;  1XIO A;  2WB7 A;  5BQI A;  3QTH A;  1IW7 F;  3QZC A;  3OWT A;  3U3B A;  4ANJ A;  2Z15 A;  2FFH A;  3ASO C;  2KQ9 A;  1D1A A;  4ULV A;  5JSL A;  3DD7 A;  1J8Y F;  5G2D A;  4EJ4 A;  5KYX B;  1A0B A;  2EIK C;  1OKK D;  3BRJ A;  2EIN C;  1BR1 A;  1LE4 A;  1OQC A;  4E17 A;  3G50 A;  3FXH A;  4FPD A;  2NSF A;  4WAB A;  4OIN F;  2EIL C;  3HKK A;  2HMQ A;  4N4Y B;  4GP4 B;  4YT8 A;  4WGY A;  3Q7G A;  1ST6 A;  2XXA A;  3V2W A;  5COF A;  2CYD A;  4J4Q A;  4CS9 C;  3VG9 A;  3IPM O;  3K7D A;  4JQ6 A;  2XS1 A;  3EH2 A;  3WAQ A;  3IHU A;  1YAR O;  3ZTZ A;  1SMY F;  1PV3 A;  4ZLD A;  1C17 M;  4KNW A;  3DJN B;  1VYI A;  2KC3 A;  3GM3 A;  3HNL A;  4HYX A;  4PFO A;  2KSF A;  1XJI A;  4ULW A;  2Y3H A;  1S52 A;  5A6B A;  3UMI A;  2AVK A;  1RKE A;  1LM3 B;  2PBE A;  4MVM A;  1WOL A;  4CS8 A;  3SZR A;  2YLI A;  1GU8 A;  2J45 A;  4DRI B;  5L0D A;  4U5F E;  1RXQ A;  4CJO A;  4UG2 A;  2JX0 A;  2HJ3 A;  2OJQ A;  1NFO A;  2PP4 A;  5AZD A;  3HNI A;  1HZX A;  3O6X A;  4MQT A;  3AG3 C;  3J06 A;  3S8F B;  4CS8 C;  4PJJ A;  3DZA A;  1EKY A;  3LS0 A;  4XTN A;  2XLW A;  3U3F A;  1YAU O;  4W8K A;  1H7I A;  2R05 A;  4CDY A;  4L35 A;  1CGN A;  4DXW A;  4IAQ A;  2YCW A;  2VH3 A;  5IY5 C;  5B6V A;  4LDL A;  3JTL O;  3UZA A;  2DGJ A;  3V7O A;  4AE4 B;  1K40 A;  3O39 A;  3HAS A;  4OD5 A;  4LLE A;  4G7Q B;  1YVI A;  2BC5 A;  3HJC A;  3OAX A;  3ITF A;  4CX9 A;  2LFF A;  3VF0 A;  4EWC A;  4H4K C;  3ABK C;  4E0H A;  1NU9 C;  3H2V A;  2F95 A;  1HW2 A;  2R7U A;  1ZW3 A;  3MYI A;  3H65 A;  2AT9 A;  2L6G A;  3S90 A;  1D1C A;  1RJ9 B;  3DM9 B;  3N0T A;  1L0M A;  1OKK A;  3DDL A;  5KYN A;  2OU6 A;  3F47 A;  1MQV A;  3AYN A;  3NYA A;  3WQJ A;  3RH3 A;  1IW6 A;  1QZX A;  2IXO A;  2CNW A;  1MND A;  1T6I A;  3GAN A;  1KGB A;  3EZH A;  2E87 A;  4GQH A;  5B6Y A;  2EPK X;  4CS7 A;  1VLS A;  2MYS A;  3TD7 A;  3LAY A;  1U89 A;  1ZHY A;  3JZ0 A;  1FFT C;  3RVZ A;  1LN6 A;  3OE0 A;  2QTV A;  3NKD A;  3H2U A;  4JUR I;  4IJJ A;  4PK4 A;  2LCH A;  1C02 A;  1OW8 A;  5CI8 A;  2R7W A;  1HMO A;  1E85 A;  3PXO A;  3HNJ A;  1YA7 O;  4PXF A;  2BL2 A;  3FHD A;  2WVQ A;  4PAC A;  4LDQ A;  4JRZ A;  4RD9 A;  1TWC A;  4MVR A;  1OCO C;  1CGM E;  4GPO A;  2NUT B;  2DB4 A;  1WN0 A;  1OW6 A;  2KW3 C;  4G72 B;  5AHZ A;  5BR5 A;  4UHR A;  3QDC A;  2IXN A;  4C3D A;  1WTY A;  4QI2 A;  1AT9 A;  3JYY A;  4XT3 A;  1N1C A;  4HFF B;  1I4Z A;  4U9D A;  5DHH A;  4K7B A;  1LVK A;  3NDB B;  4EKW A;  2RSE B;  3US6 A;  2A68 F;  1TWH A;  2XL8 A;  3GWN A;  5KKH A;  3EJN A;  1M2V A;  2XLM A;  1FTS A;  1VTM P;  2PFD A;  2KSY A;  2YHS A;  2NPU A;  5G54 A;  4WAV A;  4D4X A;  2XLO A;  5JP7 A;  1V55 C;  2LQG A;  4EHP A;  3UG9 A;  1YDI A;  2A0B A;  2MWQ A;  1MMN A;  3SN6 R;  5KYY A;  2I21 A;  3PCV A;  2WJK A;  2I35 A;  1RKC A;  1SZI A;  3KH2 A;  3QAK A;  3N24 A;  5KYW B;  3HAR A;  3R7C A;  4JKV A;  2G3V A;  1AVO B;  2R7S A;  4BWB A;  1M56 C;  3OEO A;  4MTO A;  2P0N A;  2LSE A;  2WZL A;  1BR4 A;  1EQ1 A;  4QI1 A;  5DS6 A;  5DLJ A;  1E84 A;  3FAJ A;  4DVZ A;  4A4M A;  2R02 A;  5BUO A;  3E70 C;  3RQE A;  2XL4 A;  1S05 A;  4CDV A;  5T3W A;  1H2S A;  1TWA A;  2Z73 A;  1O0A A;  1PD0 A;  4X0R A;  4KBL A;  2EPN A;  2OEX A;  2YCX A;  1ZHT A;  3GEH A;  3FAP B;  3PQR A;  1KME A;  2OCC C;  1VB5 A;  3EGX A;  3VW7 A;  4JTD B;  2J7P D;  4U5G A;  3NYL A;  2ZXP A;  4CIH A;  3UMK A;  1W2W A;  4XTL A;  4DOZ A;  1PD1 A;  5EK0 A;  3EGD A;  1JGJ A;  5AGF A;  3QMK A;  3DAG A;  3EH1 A;  3NG1 A;  2YDV A;  5B0W A;  4JCH A;  3UMH A;  1VLT A;  3LNR A;  3ATP A;  3ASN C;  4MS2 A;  2R25 A;  1QHJ A;  4Q5S F;  1JR8 A;  4WGZ A;  1QKP A;  3RF3 A;  3LEO A;  3SXK A;  4PXK A;  1WAS A;  3DE8 A;  3KYJ A;  5DS5 A;  1Q0F A;  5ITE A;  4HFK B;  1EA8 A;  2IBF A;  2HS5 A;  3WOD F;  5KYY B;  5KYU A;  3DKA A;  4NCQ A;  3FOP A;  4H54 A;  256B A;  1NU7 D;  1AUE A;  4M63 A;  3HAO A;  2RD9 A;  3MLG A;  3AG4 C;  4OV0 A;  5LWE A;  5L0C A;  2H7B A;  1P8H A;  4J30 B;  4EBK A;  2ZFE A;  1F88 A;  3NRH A;  2A0U A;  1PXR A;  3JYH A;  2CCY A;  4E7S A;  1BRD A;  2D5R B;  4J7Y A;  2RH1 A;  3T6J A;  4EBJ A;  3OA1 A;  4BPM A;  1M2O A;  1YJG A;  2Y3G A;  2Q4F A;  4DJ9 A;  3F46 A;  2HUJ A;  3E9V A;  5L0J A;  5AX1 A;  2VT4 A;  3K33 A;  2QPD B;  2G87 A;  3N2Z B;  4R32 A;  4UDV A;  3QAP A;  1JPJ A;  4QRY A;  4YT5 A;  2JAG A;  4CSA C;  4O6N A; 
#chains in the Genus database with same CATH homology
 2R4R A;  4X31 A;  5JJJ A;  1UAZ A;  1FBK A;  1JV6 A;  5H2L A;  1LM3 B;  3ODU A;  3QJR B;  3UTV A;  4DS7 E;  5EN0 A;  2YLI A;  1GU8 A;  3UTW A;  3ZWI A;  4CJO A;  4UG2 A;  2J4Y A;  3T45 A;  5G28 A;  3D4S A;  5G53 A;  5B6W A;  5AZD A;  3HNI A;  1HZX A;  2YKZ A;  4KNF A;  4MQT A;  4Y9H A;  2LNL A;  1E86 A;  3S8F B;  5G36 A;  4JEA A;  3HAN A;  4U9E A;  1EKY A;  1X0K 1;  3AYM A;  1Q5J A;  4XTN A;  1M0K A;  1QM8 A;  2XLW A;  1FBB A;  4G71 B;  3OE6 A;  4HWL A;  3QJV B;  1R84 A;  4CDY A;  4JEB A;  1H68 A;  4L35 A;  1CGN A;  4JE9 A;  4IAQ A;  4WW3 A;  2XLV A;  2YCW A;  4GBR A;  1M0L A;  3EML A;  5B6V A;  3HNK A;  4LDL A;  3UZA A;  1S53 A;  5TGZ A;  3HAS A;  4L6R A;  4G7Q B;  3EH5 B;  2BC5 A;  3NMK A;  2ZZL A;  3VHZ A;  4JR8 A;  4G7R B;  3OAX A;  4N4W A;  4CX9 A;  4QID A;  3M15 A;  3TOM A;  5FJG A;  3M79 A;  1YZA A;  2F95 A;  1CPR A;  3UTY A;  3QBI A;  1KG8 A;  2AT9 A;  1L0M A;  1JAF A;  1S8J A;  3ABW A;  3DDL A;  4TL3 A;  5JRA A;  3DE9 A;  3NY9 A;  3QJS B;  1MQV A;  3AYN A;  3NYA A;  3WQJ A;  1IW6 A;  1YYX A;  4CJG A;  2M3G A;  3NMJ A;  1KGB A;  5B6Y A;  5H2O A;  1PY6 A;  5BR2 A;  3COD A;  3QJQ B;  5B35 A;  1TN5 A;  2QPE B;  3VGA A;  1JFP A;  2J9B A;  1LN6 A;  4N6H A;  3OE0 A;  1KG9 A;  1S51 A;  3EH4 B;  2BRD A;  4MD2 A;  4DAJ A;  1E0P A;  1NBB A;  1BBH A;  3ZQV A;  3IQ6 A;  1U19 A;  3UTX A;  2YCY A;  1S8L A;  1GZM A;  1E85 A;  1YYJ A;  2L6X A;  3PXO A;  3HNJ A;  3NY8 A;  3ZPQ A;  1S54 A;  2Y03 A;  4PXF A;  1CGO A;  3QJU B;  1A7V A;  2XLD A;  1QPU A;  5JUA A;  3S3D B;  1VJM A;  2YL0 A;  4GPO A;  4FBZ A;  5A44 A;  1RCP A;  4G72 B;  4MBS A;  5AHZ A;  5BR5 A;  1EHK B;  1VGO A;  4UHR A;  2NTU A;  3QDC A;  3S3C B;  4MD1 A;  1GUE A;  1PXS A;  2Y02 A;  2YL3 A;  2PED A;  3NSB A;  1AT9 A;  3MBV A;  1E83 A;  1AP9 A;  4XT3 A;  3QJT B;  2QLA A;  5B6Z A;  4NC3 A;  4U9D A;  5DHH A;  4GRV A;  2Y00 A;  3RZE A;  3S8G B;  2Y04 A;  5AX0 A;  2XL8 A;  4G70 B;  1QQ3 A;  2XLE A;  5KKH A;  2EI4 A;  1XME B;  2XLM A;  3C9L A;  3M4C A;  5ITC A;  3PBL A;  3QW1 A;  4X32 A;  1C8S A;  1P8I A;  5H2M A;  2KSY A;  1IW9 A;  3RFM A;  5H2H A;  5H2N A;  2R4S A;  1R2N A;  4WAV A;  5G54 A;  3UON A;  4D4X A;  3ZEV A;  5G2C A;  2XLO A;  5JP7 A;  3TOL A;  2YLG A;  4XXJ A;  2YCZ A;  3HAQ A;  5JS5 A;  3UG9 A;  4IB4 A;  3COC A;  3SN6 R;  4EIY A;  2I21 A;  1E12 A;  1M0M A;  5B3I A;  2WJK A;  4IAR A;  2I35 A;  3V2Y A;  4BEY A;  1F50 A;  3C62 A;  3C9M A;  2Z55 A;  3NS0 A;  3QAK A;  3HAR A;  3OE8 A;  4JKV A;  5JLI A;  4DJH A;  4BWB A;  1DZE A;  2HPY A;  3REY A;  3QW0 A;  5H2P A;  1P8U A;  5B6X A;  4D4N A;  1YZC A;  1Q5I A;  4QI1 A;  1TN0 A;  1E84 A;  2JAF A;  5AWZ A;  1F4Z A;  4BVN A;  4A4M A;  3U8P A;  4XTO A;  4X1H A;  5JT4 A;  1S05 A;  1BRX A;  5JJE A;  4ER9 A;  4KLY A;  4CDV A;  1H2S A;  2Z73 A;  1BM1 A;  2YLD A;  1C3W A;  1O0A A;  2KS9 A;  3X3B A;  2XM0 A;  4CDA A;  2YCX A;  3OE9 A;  3QBL A;  5ETZ A;  3VI0 A;  2YL7 A;  3PQR A;  4GP8 B;  1QKO A;  3QVZ A;  1KME A;  5F8U A;  4AMJ A;  3HAP A;  3FOO A;  3VW7 A;  3QVY A;  1GQA A;  1JV7 A;  4EA3 A;  5B2N A;  4XTL A;  4CIP A;  3PDS A;  4FAA B;  3C63 A;  1JGJ A;  5AGF A;  1UCQ A;  4HYJ A;  4GP5 B;  4BV0 A;  1L9H A;  2YDV A;  4GYC A;  5A45 A;  4MQS A;  5B0W A;  3QBG A;  1QHJ A;  4XT1 A;  3IQ5 A;  2I1X A;  3KJ6 A;  4WGZ A;  3S3B B;  1M6T A;  1QKP A;  4DKL A;  3DQB A;  2XM4 A;  3EH3 B;  4PXK A;  2J8W A;  2I20 A;  3BVD B;  1MGY A;  4AMI A;  3DE8 A;  5ITE A;  2YL1 A;  3QBK A;  1XIO A;  3FOP A;  2F93 A;  256B A;  3ZQY A;  1X0I 1;  2ZIY A;  3X3C A;  5A8E A;  3HAO A;  5H2J A;  1X0S A;  4OV0 A;  4LDO A;  4FA7 B;  2XL6 A;  5H2K A;  5LWE A;  3UZC A;  2KSA A;  4ULV A;  5JSL A;  1P8H A;  5H2I A;  2ZFE A;  3M4B A;  2Y01 A;  5B34 A;  1F88 A;  5G2D A;  4EJ4 A;  3VVK A;  1PXR A;  1IXF A;  3P0G A;  2YDO A;  2CCY A;  5G2A A;  4BUO A;  1CPQ A;  4FPD A;  3NMI A;  5AHY A;  2NTW A;  1BRD A;  5DHG A;  2RH1 A;  4LDE A;  4N4Y B;  3VRC A;  2X72 A;  4BEZ A;  5JVE A;  4K5Y A;  4GP4 B;  4WGY A;  1APC A;  4G7S B;  5J7A A;  5JJN A;  3V2W A;  2WJL A;  2XLH A;  3CAP A;  4J4Q A;  3AM6 A;  3VG9 A;  4JQ6 A;  3ZTZ A;  1C8R A;  5AX1 A;  2VT4 A;  3ZPR A;  2QPD B;  2G87 A;  1CWQ A;  5DYS A;  3QAP A;  5C1M A;  2KSB A;  3PWH A;  4QRY A;  3HNL A;  1BRR A;  3L1M A;  4HYX A;  2JAG A;  1XJI A;  3A7K A;  1S52 A;  3ZTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...