4JKVA

Structure of the human smoothened 7tm receptor in complex with an antitumor agent
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
469
structure length
454
Chain Sequence
GTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562, Smoothened homolog
publication title Structure of the human smoothened receptor bound to an antitumour agent.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 186
structure length 454
sequence length 469
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01534 Frizzled Frizzled/Smoothened family membrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4jkvA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4jkvA02
3QW1A 1R2NA 3UZAA 1KGBA 3ZEVA 3QW0A 3REYA 5DYSA 4XTLA 3OE0A 4JKVA 2R4SA 3UTXA 4X32A 1KG8A 4QI1A 2Z55A 3X3BA 2Y01A 3HNLA 1QHJA 4EIYA 5A45A 2YLIA 2YDVA 5JUAA 4WW3A 3VG9A 4BEZA 3ZQVA 4PXKA 5AX1A 3QAKA 4BVNA 2J4YA 1Q5JA 1MGYA 3V2YA 5B6XA 4K5YA 4MD2A 3TOLA 1GQAA 3QJSB 3NMKA 3QVZA 1X0I1 3ODUA 3QAPA 3AYNA 3P0GA 4QIDA 2NTUA 1S53A 3QBKA 4N4WA 4N6HA 4EA3A 4D4XA 1APCA 1C8SA 1X0SA 3ZQYA 5AGFA 2YDOA 3HNIA 3NY8A 2KSAA 5JSLA 3QJRB 4A4MA 1NBBA 4G7RB 1YZAA 5KKHA 4CJOA 5AHYA 5G28A 4JR8A 2Y02A 1F50A 5JJNA 2YCWA 3S3DB 1GZMA 4LDEA 4BWBA 3QJUB 1IXFA 1S8LA 3S8FB 1M0KA 3U8PA 1PY6A 2G87A 1L0MA 2HPYA 2JAFA 2YL1A 1M6TA 4LDLA 3DE8A 1QKPA 3OE6A 2PEDA 2XLEA 4EJ4A 4IARA 4WGZA 5AHZA 4CDVA 4XT1A 5A44A 5JT4A 4X31A 2LNLA 1E83A 2XM4A 3VVKA 1E84A 4UG2A 1GUEA 4BEYA 3S3BB 4AMIA 4FA7B 2KSBA 1YZCA 3QBGA 5H2HA 1O0AA 1JV7A 3X3CA 4G71B 4OV0A 4X1HA 3DDLA 2YCYA 3IQ6A 3HANA 4NC3A 2Y00A 1F4ZA 2XLOA 5JJEA 4MQTA 4U9EA 5H2KA 5ETZA 2BC5A 3UONA 4GP4B 5JRAA 4FAAB 2WJLA 3V2WA 1BRDA 3QVYA 1M0LA 1S54A 4N4YB 2F95A 1F88A 1E85A 5F8UA 4CX9A 2JAGA 3ZPQA 5A8EA 4JEBA 2I35A 2XM0A 1UCQA 4KNFA 1FBKA 1KG9A 2XLHA 4JE9A 3CODA 5H2NA 4UHRA 1FBBA 4ER9A 3ZWIA 1GU8A 3SN6R 5G53A 5LWEA 2CCYA 3MBVA 4CDYA 3ZTZA 3NYAA 5JJJA 4GP8B 5EN0A 1S05A 2ZFEA 3ZTMA 2VT4A 3HNKA 3VHZA 2X72A 5ITEA 4WGYA 2KS9A 1Q5IA 2J8WA 4IAQA 1VGOA 3L1MA 3PXOA 4GBRA 3EH4B 4FBZA 1XMEB 5B0WA 5H2MA 1E86A 5BR2A 4CIPA 4FPDA 3KJ6A 3AM6A 1CPQA 5B2NA 2XL6A 5B6YA 3FOOA 1RCPA 1XIOA 3C9LA 2RH1A 2XLWA 1S52A 4MD1A 4TL3A 3DQBA 3BVDB 4KLYA 2ZZLA 3QBIA 4AMJA 2YL3A 3RZEA 4WAVA 1U19A 5G2DA 1LM3B 2AT9A 3C63A 1YYXA 5TGZA 3NY9A 5JLIA 1QPUA 5H2LA 3A7KA 3IQ5A 3NMJA 1JAFA 3QJTB 1JFPA 5AWZA 1A7VA 2YLGA 1CGOA 1IW6A 1QM8A 3UTYA 4GP5B 5AX0A 3NMIA 1LN6A 1E12A 2YKZA 4HYJA 2YLDA 4JEAA 2XLMA 3QJQB 4PXFA 4Y9HA 5DHGA 4MQSA 4GRVA 3HNJA 2WJKA 3C9MA 3WQJA 1C3WA 2Y03A 1S51A 3D4SA 3OE8A 1YYJA 3PQRA 3QBLA 3PWHA 1H68A 2QLAA 2I21A 4LDOA 1IW9A 5B35A 5BR5A 1PXSA 5H2JA 2XL8A 5H2IA 5C1MA 4ULVA 3UTVA 4QRYA 3HAOA 3QJVB 2YCXA 1EHKB 2Y04A 2EI4A 1BBHA 3HAPA 1HZXA 3HARA 3AYMA 5G36A 3VI0A 1AP9A 5JS5A 3OAXA 2KSYA 4G7QB 5DHHA 2YL0A 5B34A 2L6XA 4L6RA 1X0K1 1XJIA 4BV0A 1CGNA 2R4RA 4BUOA 5B6ZA 5H2OA 2I20A 3PBLA 3S8GB 3EH3B 1PXRA 1P8HA 4G7SB 4IB4A 3CAPA 4J4QA 3COCA 3M79A 1C8RA 5ITCA 4GYCA 3UG9A 5AZDA 1BRXA 2YCZA 2F93A 1H2SA 5J7AA 3RFMA 1EKYA 1BM1A 4CDAA 1KMEA 256BA 1L9HA 2BRDA 3PDSA 3EH5B 3QDCA 4G70B 3UZCA 1QKOA 1TN0A 4CJGA 4XT3A 3OE9A 1QQ3A 1P8UA 5B6WA 2Z73A 4G72B 4DJHA 1CPRA 3C62A 4U9DA 3VGAA 3ZPRA 5JP7A 3NSBA 2J9BA 2XLVA 5B6VA 2QPEB 3M4CA 1AT9A 3M4BA 4XTOA 5H2PA 5G2AA 1R84A 1JV6A 3EMLA 2I1XA 3VRCA 1CWQA 5JVEA 3TOMA 1BRRA 3S3CB 4DAJA 1JGJA 4HYXA 1M0MA 2XLDA 4D4NA 5G2CA 1DZEA 4DKLA 4JQ6A 1MQVA 4GPOA 2M3GA 4HWLA 1VJMA 2NTWA 4MBSA 3UTWA 3HASA 3VW7A 3M15A 3ABWA 2QPDB 2ZIYA 4L35A 1UAZA 3FOPA 1P8IA 1S8JA 4XXJA 1TN5A 2YL7A 4XTNA 1E0PA 3T45A 3HAQA 3NS0A 5B3IA 5G54A 5FJGA 3DE9A
chains in the Genus database with same CATH superfamily
2G62A 3LLKA 1M57C 3FVYA 1SMYF 2XSEA 4JKVA 2R4SA 2B0HA 1YLMA 4U5FE 3UTXA 3CAXA 1ZHXA 4H4KC 4FESA 3X3BA 2Y39A 3N0TA 5EGYA 2YLIA 5BQGA 5AC5A 1Q0KA 4E17A 3ZQVA 3QAKA 4J7TA 2J4YA 1NLXA 2HZ8A 3TOLA 4JJGA 1GQAA 4MVZA 3ODUA 1MMGA 1TWAA 4AK9A 1BZ4A 3SYNA 1S53A 2R7XA 2EPKX 3C8GA 4P9TA 4EA3A 4H54A 1APCA 3S29A 3JT1A 1UG7A 3Q7GA 3G4ZA 2QY9A 1OW6A 4G7RB 4PJNA 4CJOA 1T6UA 2YZSA 2CNWD 1Y6DA 4CS8C 2AWYA 3ABMC 3UMIA 4XEFA 4PACA 5A6JA 3S3DB 1YAUO 1OCCC 1IXFA 3S8FB 5L0FA 5F5FA 1PY6A 2JAFA 3KMIA 4LDLA 5T3TA 4GQHA 5HV9A 5AHZA 1QKRA 3DMDA 4QI2A 4X31A 3VVKA 2Q00A 2R9RB 2LSEA 1LKXA 2NUTB 3S3BB 4AMIA 4FA7B 2LQGA 3OEOA 2KSBA 2J45A 1O3UA 5DQZA 4U5HA 1O0AA 2AP3A 1GS9A 2J7PA 4OIPF 3X3CA 4JZAA 3GM3A 2ZXRA 2R7QA 2QUPA 1EI7A 4X1HA 3SEOA 3IQ6A 2A69F 4O6NA 4NC3A 4BJTA 4YT2A 4U9EA 3AG2C 2W9YA 2YVKA 3U3BA 3W2WA 5A6BA 5JRAA 3L8JA 2WJLA 3V2WA 2KYHA 3QVYA 5B1BC 4AL0A 2LD6A 2MHRA 3RKOF 4N4YB 2GA0A 4XPYA 3A9CA 3ZPQA 2I35A 1TFKB 4YL1A 4DBQA 3RFYA 1HY5A 4UHRA 1FBBA 1RKEB 2CCYA 4CDYA 4RD9A 1LIHA 1MMAA 2VT4A 2J8WA 2VB6A 2L6FA 1WTYA 4JJFA 4X0RA 2A68F 3ECSA 4YT5A 2DI3A 5B0WA 5H2MA 4CIPA 2CDQA 3KJ6A 4UDVA 3SXMA 2KJGA 4PK4A 1OKKD 4JW1A 4BJ5C 4MD1A 3ABLC 2RSEB 4TL3A 3DQBA 3BVDB 4AL1A 1HW2A 2TMVP 1JPJA 4AE4B 4CSAA 4ANJA 4P6IC 5G2DA 1OR3A 3HKKA 1YYXA 1LS4A 1J8MF 4CIHA 2X0CA 1JAFA 3QJTB 4GEHA 1ORYA 4MS2A 3HLZA 1QM8A 1Z6AA 3DD7A 1L3PA 1C17M 1SYQA 3JSEO 3T6GB 2YLDA 3DXJF 1ZU5A 4IWBA 3QJQB 1LE2A 5L3VA 4Y9HA 3TULA 3JRMO 2R03A 4JTDB 2YHSA 2IXPA 2XS8A 1GM5A 4XWJA 4YWQA 3D4SA 4LLCA 2Q7RA 4K0DA 3H2VA 1HW1A 4XEKA 3QBLA 5DS6A 1BR2A 4MVUA 2QLAA 3UNGC 1JOGA 2WVQA 5B35A 4CBEA 4EBBA 3UGPA 4ULVA 5T1DB 1RKCA 3UTVA 2VH3A 4QRYA 3QJVB 2YCXA 2EI4A 2PFDA 3AYMA 3HJCA 2R02A 5G36A 3VI0A 2HKVA 3OAXA 4O6MA 5CI8A 3K66A 2OU6A 4W8KA 5B34A 2L6XA 4YT4A 3I4UA 4U5EE 1XJIA 1CGNA 2R4RA 4BUOA 2I20A 3PBLA 1D0XA 2HV7A 4OIOF 4IB4A 3POVA 4EBJA 1Q0MA 3CAPA 3JRTA 4Z9HA 2H7VC 2HJMA 5ITCA 3F47A 4O7GA 1H2SA 3IQTA 3RFMA 3B9QA 2BRDA 2NUTA 4I1MA 5L0JA 2VCBA 2P7VA 4J32B 1VMAA 2J9VA 1TN0A 4XT3A 3EJNA 1P8UA 2WZFA 2Z73A 4DJHA 1E2XA 2QE9A 3MBGA 1ORSC 1ZYRF 5D91A 3KKBA 5GPGB 3ZPRA 5JP7A 2EIKC 2FFHA 4C3DA 3NSBA 4JTCB 4YK5A 3M4CA 1ZW2A 4PR9A 4G7ZF 2PNOA 4JVSA 4WJ0A 2H7BA 1H9GA 1CWQA 5JVEA 1BRRA 2CGEA 4HYXA 1RXQA 2Y3BA 4N06A 4JQ6A 3LUTB 1LS1A 1TWHA 2QPDB 4L35A 1RKEA 1Z23A 4XTNA 5L0DA 2QTVA 5BQHA 3RVYA 3DE9A 2Q9BA 3GM1A 1VK5A 3K6BA 3WODF 2M64A 4A4AA 1H7IA 1PV3A 1K40A 3LEOA 1KG8A 4QI1A 4JRZA 2UUIA 2Y01A 3LNMB 3HNLA 5TJ5E 1VB5A 3TK0A 4WW3A 3VG9A 1HMDA 3W4YA 4BVNA 1WWPA 3SXZA 1Q5JA 3V2YA 5FZTA 5B6XA 3TJ5A 2HJ3A 2IXMA 2NPUA 3NMKA 3QVZA 4AE4A 3QAPA 3EGDB 1NG1A 2WVNA 4QIDA 5CIVA 4C3EA 3QTHA 3DAFA 4PFOA 2GFHA 2P61A 4I1OB 3LS1A 3PDMP 2DB4A 1X0SA 3H65A 4IRUA 4BG0A 4E18A 3NY8A 2KSAA 5JSLA 4EUKB 4A4MA 1A0BA 3G4XA 2WZGA 1YA7O 5L0HA 4OINF 5AHYA 4Z9IA 4JR8A 2Y02A 2CNWA 4LDEA 1A41A 3X1OA 2GDCA 4E7ZA 4EHPA 2X51A 3N2ZB 1NU7D 2G87A 2YQYA 2YL1A 4YL3A 2IYLD 2XLEA 5A44A 1SR2A 2CYDA 2LNLA 3K1HA 5KYXB 1T9KA 1VTMP 2H8AA 4UG2A 4O6YA 3EG9B 3V5ZA 4ZLCA 5K0IA 2XXAB 1YZCA 1JV7A 2FAPB 3DM9B 2M4EA 1V54C 1V74B 4JC7A 2OOCA 1OCZC 3T6BA 3BRJA 3ZDLA 4EBKA 5H2KA 1DOWA 1JR8A 5ETZA 4YT8A 4GP4B 1HE9A 3E70C 2WB7A 1S54A 1BRDA 1ZU4A 1E85A 5F8UA 4CS9C 2XL4A 3B29A 1I4YA 5A8EA 4JEBA 1FFHA 3UGOA 2XM0A 3GEIA 5KYUB 1KG9A 1OXBA 4JE9A 3CODA 5H2NA 3K1IC 1QLEC 3DAGA 2W45A 4ER9A 1G5ZA 1GU8A 2V3CC 5LWEA 2YWAA 4XTKA 4HE8D 4EWCA 4DBRA 3ZTZA 2NG1A 3KPHA 4KNWA 1S05A 2ZFEA 3HNKA 2JPUA 4JIOA 2EIJC 2HSQA 4J7YA 4XLNF 1ORJA 4KI2A 5ITEA 2HS5A 4BJ5A 1D0ZA 3S84A 2QNLA 4Q4ZF 3FDQA 3U2LA 3PXOA 2Y3DA 2IBFA 3X2QC 2R05A 2NUPB 4E7SA 3EH4B 2FGYA 1OR2A 5HSWA 3FOOA 1BDJB 1FTSA 1XIOA 3C9LA 3B0UX 2XLWA 3JZ0A 2R25A 2OG2A 2ZZLA 3QBIA 4XQ1A 5CI9A 2KK1A 2BE5F 1IW7F 2OJED 1M2VA 3RZEA 4FAPB 1U19A 3S27A 1J8YF 3C63A 3AGUA 3LESA 1H6GA 1LI7A 1PD0A 1QPUA 5H2LA 5F5HA 1YVIA 2D4UA 4DRJB 4XEVA 2I8BA 5AC4A 5DVWA 1A7VA 3NRHA 4MVQA 2DGJA 1ST6A 2J0XA 2P1AA 3NMIA 4Q7CA 2R7WA 1E12A 2YKZA 4HYJA 1I4ZA 1G4WR 2KC3A 4PXFA 3BEHA 3HNJA 2WJKA 1C3WA 4HEAJ 2Y03A 1ZHYA 1Z5ZA 2MWQA 3OE8A 1DOVA 3EGDA 3TJ6A 3PWHA 5DS5A 1YJGA 4LDOA 3EH1A 5BR5A 5H2JA 2UUHA 3DJNB 3KH2A 3MYFA 1BBHA 3HAPA 1AP9A 3LNRA 3EGXA 3O6XA 4WABA 4L6RA 1ZW3A 1V55C 2ZPAA 5B6ZA 5H2OA 3AG3C 3S8GB 1P8HA 2ICWG 3C8GD 4J4QA 1KNYA 3K7DA 2OJQA 3A11A 4DOZA 3JCUQ 3L34A 5KYXA 5AZDA 4OIRF 1AVOB 1BM1A 4CDAA 4MVMA 3EG9A 1K04A 4XPXA 3T6JA 2D5RB 4HFKB 2XXAA 3PDSA 3EH5B 3ATPA 3QDCA 1ZVZA 3I5QA 5E3CA 1QKOA 2H7OA 4CJGA 2ASRA 3OE9A 1QQ3A 1SZIA 4BPMA 5B6WA 3U9JA 1CPRA 3RIPA 3KL4A 3QMKA 3GWNA 2J9UA 2XLVA 4YN0B 2A6HF 1AT9A 4NY3A 4E0IA 3M4BA 1HMOA 4XTOA 5G2AA 1JV6A 1KU2A 3EMLA 2G3KA 3O39A 3VRCA 3TOMA 5COMA 5E33A 2XLDA 1DZEA 3UMHA 4I44A 5KYUA 1MQVA 2M3GA 2NTWA 3HASA 2J7PD 5L0IA 1EA8A 2W4MA 1C02A 3FOPA 1P8IA 2IOQA 1TN5A 2R7OA 2YL7A 4PFPA 3T45A 2WL8A 5B3IA 3ASOC 1Q0DA 2LK4A 2EINC 5FJGA 3K33A 4XLPF 3QW1A 2AVKA 2OKUA 3UZAA 3QW0A 5A6BD 3REYA 3EZHA 1MNEA 4BEJA 3OE0A 1BR1A 4X32A 3EZIA 5COFA 3GEHA 2Z55A 3H2UA 3RYLA 5JUAA 1VYKA 5AX1A 3EHNA 2L6HA 3LS0A 1MGYA 2LIGA 4LDRA 2E87A 3AYNA 4MNDA 2NTUA 4XPWA 1FMWA 3SXYA 4N4WA 2IM8A 4PJLA 2GAQA 3ZQYA 4B6IA 5AGFA 3HNIA 2A0BA 4DVYP 3QJRB 1MMDA 4OIQF 1NBBA 5KKHA 2R7VA 3CSKA 3US6A 1FAPB 5JJNA 2YCWA 5E2QA 1GZMA 4ONSA 1VLTA 1ZHZA 3L8IA 1M0KA 3U8PA 1L0MA 1Z63A 1D1BA 2YEVA 3DE8A 1QKPA 1TKNA 4IARA 4WGZA 4CDVA 4NCQA 4Z9JA 4BJ6A 3SXKA 3TD7A 2XM4A 3RVZA 2PP4A 1E84A 1G8XA 3JYYA 4KNVA 3CZ6A 2HMQA 1I5NA 4E0HA 2ZXPA 4N6CA 2Q9CA 1NSGB 2LCHA 3U9MA 2Q4FA 1EQ1A 3W8IA 4G71B 4OV0A 3EHMA 3AG4C 4CS9A 2YCYA 1QVXA 3HANA 3ZVRA 3MYIA 1HE1A 3K1IA 3UONA 4FAAB 2L81A 1M0LA 3MFNA 2F95A 4RBNA 2PX3A 3RH3A 4CX9A 2VC9A 3NYLA 1FBKA 4C3BA 3S90A 3FAJA 3ABKC 3WHNA 4IGGA 1YARO 2ETSA 3ZWIA 3ITFA 3VYWA 3RQEA 3U8VA 3NYAA 4U5BE 4KBLA 5B1AC 4GP8B 4CS8A 2J46A 2HV6A 2X72A 5DQTA 4BEMJ 3MLGA 1KTMA 4JCHA 4WGYA 1Q5IA 5L0GA 1VYIA 4FX5A 3L1MA 5A6KA 3OWTA 2MYSA 1XMEB 3DI5A 4JTAB 4Q5SF 3AOUA 1E86A 5BR2A 2KW3C 4FPDA 3AM6A 5B2NA 2XL6A 3NG1A 1PD1A 2RH1A 3RQFA 1LE4A 4KLYA 4AMJA 3L0IA 2OQMA 1OCOC 1TR2A 4DJ9A 1OW7A 3NY9A 1RMVA 3V7OA 3A7KA 2GWWA 3AQCA 4FWVA 1O87A 3LLIA 2WVOA 5AWZA 1CGOA 1LI5A 2A6EF 3S28A 1IW6A 2A0UA 4U5GA 4GP5B 5AX0A 1SF8A 3FAPB 2WZLA 4I3MA 1OQCA 5DHGA 4MQSA 3V5YA 4GRVA 4DS7E 3C9MA 1UFBA 1NU9C 5BQIA 1H9TA 3PCVA 2L9JA 1S51A 1YYJA 4EKWA 1PCXA 1FNTc 3PQRA 3E9VA 3EFOB 2I21A 2YRFA 3EH2A 2Q9AA 3DWWA 3AQBA 3KYIA 5C1MA 4A2NB 3T4RA 3JSZA 1OCRC 1T6QA 3KYJA 2R7SA 5T3WA 3MX3A 1EHKB 2Y04A 3IHUA 1RJ9B 3DM5A 1HZXA 3PMRA 2HUJA 2KSYA 4G7QB 5DHHA 2KNHA 3M1CB 4ZLDA 2EPMX 5D92A 5KYYB 1JPNA 1Q0FA 1D0YA 1F1MA 3EH3B 3R2PA 1PXRA 5A6AA 3B71A 3UMKA 4K1OA 2L6GA 5B3SC 2IXNA 1XZQA 1C8RA 2OEXA 4GYCA 3UG9A 4DRHB 2YCZA 4U5DE 1EKYA 256BA 2NSGA 3GANA 4W8PA 4MVOA 1QZXA 2CW0F 1WASA 4G70B 1OKKA 3VAYA 3NKEA 3CEXA 3CQZA 1WGWA 1CGME 3VF0A 3EPVA 3TQOA 2V26A 3U5SA 4G72B 3C62A 4U9DA 4KC9A 1YDIA 2HMZA 4CS7A 1NFOA 5B6VA 3ZG1A 4JCZA 2QPEB 2DYRC 5H2PA 2I1XA 1YA9A 3Q6MA 4AX2A 4DAJA 1Q0GA 5KYWB 3GODA 4D4NA 5G2CA 3SP1A 4R32A 2EILC 1VJMA 4DXWA 1GGQA 3IPMO 2ZIYA 1UAZA 2IXOA 3LAYA 1S8JA 2JX0A 3AGTA 3HAQA 3G50A 2J0WA 3NYJA 5L0CA 2HSBA 5G54A 4G78A 1ZHWA 1A7DA 2I15A 1R2NA 1KGBA 3ZEVA 2RD9A 5DYSA 4XTLA 2R7RA 4K7BA 3R7CA 2EPLX 4DVZA 4P9FA 2JD3A 1QHJA 4EIYA 5A45A 1NFNA 2YDVA 4BEZA 4PXKA 1VLSA 4OD4A 3O10A 2VCAA 4K5YA 4MD2A 3RW0A 4MTFA 1MNDA 3GORA 1X0I1 4PJJA 3U2MA 3QJSB 3OA1A 5IY5C 3P0GA 1B68A 2EPNA 3QBKA 2L7AA 4N6HA 4D4XA 1C8SA 1TQGA 2YDOA 2F22A 1U0BB 3HTKC 2Y69C 2P0NA 1YZAA 3DKAA 2ZXOA 5G28A 3GEEA 1F50A 4BWBA 3QJUB 4PJMA 5KYNA 1S8LA 3U3FA 2OCCC 2O9XA 4IAOA 4LLEA 2HPYA 3FMSA 3AJMA 4JURI 3Q6NA 1M6TA 4J30B 3OE6A 1ZZPA 2Q3TA 2PEDA 1L7CA 1MMNA 3Q7LA 4EJ4A 3ZSUA 4XT1A 3EFOA 5JT4A 1E83A 1BR4A 2VASA 1W2WA 5DLJA 1GUEA 2EIMC 4BJ1A 3ZIBA 4BEYA 3V5XA 3QBGA 1U6HA 5H2HA 1RJ9A 2G3VA 4F4BA 1D1CA 4LERA 3DDLA 4LDQA 4NTFA 3B0PA 4ULWA 2Y00A 1F4ZA 2XLOA 5JJEA 4MQTA 5KYYA 3PHF2 1V4AA 2BC5A 3F46A 1OXKA 4HFFB 1VOMA 3GWLA 2NUPA 3IEEA 5BUOA 4C7OB 1F88A 5E3AA 1WN0A 2JAGA 2C03A 4QDLA 1UCQA 2NSFA 4KNFA 2XLHA 3C7JA 1R4TA 1XZPA 1M56C 3SN6R 5G53A 1LVKA 3MBVA 2Y3GA 2PX0A 5FCLA 4RDAA 5JJJA 5F28E 5EN0A 4MTOA 1M2OA 3ZTMA 3VHZA 2XS1A 2J9WA 1AEPA 2KS9A 1G4US 3DZAA 4IAQA 1VGOA 1NZEA 4GBRA 3LEVA 5EK0A 3RF3A 3O55A 4FBZA 2ZXWC 3RQGA 5KYWA 1Z7Qc 3S0XA 1CPQA 2W4BA 5B6YA 3ZC4A 1RCPA 4G7HF 2LFDA 3S9OA 4LDKA 1S52A 3WAQA 3C8ZA 1Z3IX 3UR3C 2B0JA 5EHHA 2YL3A 4WAVA 2R7TA 1LM3B 2AT9A 1WOLA 2A1DD 4G7OF 3C8GB 5TGZA 1JRAA 3B0VC 5JLIA 4MTGA 4MQ9F 3N24A 4IJJA 1K05A 1XWJA 3IQ5A 3NMJA 3QZCA 4G0HA 4CSAC 1JFPA 2OEVA 2YLGA 3FHDA 4MW8A 1N1CA 3UTYA 1A7EA 1ZHTA 1LN6A 2AU5A 5L3QA 4JEAA 2XLMA 2BL2A 1T5OA 1C03A 4MVSA 3WQJA 3W2VA 2P6VA 2EPOA 2Z15A 1M2VB 1AUEA 1H68A 1IZMA 1IW9A 2XRHA 1S7ZA 2ZD9A 3AG1C 1PXSA 1T6IA 2XL8A 2LP4A 4NTAA 5H2IA 4YJWA 1FFTC 3HAOA 1OW8A 1T01A 3HARA 3SZRA 4NQFA 5JS5A 3NYMA 3U0CA 3IQCA 2C04A 2YL0A 4DRIB 1X0K1 1WATA 4BV0A 1FMVA 4G7SB 1Y4CA 4U5CE 2AWCA 3COCA 3M79A 4OD5A 4NTBA 1BRXA 2F93A 5J7AA 1KMEA 1L9HA 1JMWA 4QI0A 3ASNC 1U89A 4YL0A 2PF4E 3JYHA 3UZCA 1O5HA 3NKDA 3JTLO 1TWGA 3VGAA 3EGXB 3SNHA 5COGA 4MVRA 2PBEA 3WG7C 3J06A 2J9BA 3W8HA 1LPEA 2R7UA 5DS4A 2KGOA 3LJBA 3GM2A 1TWCA 1R84A 3VM6A 2KQ9A 2HFIA 3C18A 3T9OA 3S3CB 1R5ID 1JGJA 4C7OA 1M0MA 4DKLA 3I5PA 3EQLF 3FXHA 4GPOA 1D1AA 4M63A 2Y3HA 4HWLA 4LACB 3DJUB 4MBSA 3UTWA 3VW7A 1QSPA 5A69A 3NDBB 3M15A 3ABWA 1TFOB 4MW3A 2KSFA 4XXJA 2VCCA 4BJ6C 2DYSC 1E0PA 3NS0A 4GYTA 4O79A 1FR0A 2LFFA
chains in the Genus database with same CATH topology
3QW1A 1R2NA 3UZAA 1KGBA 3ZEVA 3QW0A 3REYA 5DYSA 4XTLA 3OE0A 4JKVA 2R4SA 3UTXA 4X32A 1KG8A 4QI1A 2Z55A 3X3BA 2Y01A 3HNLA 1QHJA 4EIYA 5A45A 2YLIA 2YDVA 5JUAA 4WW3A 3VG9A 4BEZA 3ZQVA 4PXKA 5AX1A 3QAKA 4BVNA 2J4YA 1Q5JA 1MGYA 3V2YA 5B6XA 4K5YA 4MD2A 3TOLA 1GQAA 3QJSB 3NMKA 3QVZA 1X0I1 3ODUA 3QAPA 3AYNA 3P0GA 4QIDA 2NTUA 1S53A 3QBKA 4N4WA 4N6HA 4EA3A 4D4XA 1APCA 1C8SA 1X0SA 3ZQYA 5AGFA 2YDOA 3HNIA 3NY8A 2KSAA 5JSLA 3QJRB 4A4MA 1NBBA 4G7RB 1YZAA 5KKHA 4CJOA 5AHYA 5G28A 4JR8A 2Y02A 1F50A 5JJNA 2YCWA 3S3DB 1GZMA 4LDEA 4BWBA 3QJUB 1IXFA 1S8LA 3S8FB 1M0KA 3U8PA 1PY6A 2G87A 1L0MA 2HPYA 2JAFA 2YL1A 1M6TA 4LDLA 3DE8A 1QKPA 3OE6A 2PEDA 2XLEA 4EJ4A 4IARA 4WGZA 5AHZA 4CDVA 4XT1A 5A44A 5JT4A 4X31A 2LNLA 1E83A 2XM4A 3VVKA 1E84A 4UG2A 1GUEA 4BEYA 3S3BB 4AMIA 4FA7B 2KSBA 1YZCA 3QBGA 5H2HA 1O0AA 1JV7A 3X3CA 4G71B 4OV0A 4X1HA 3DDLA 2YCYA 3IQ6A 3HANA 4NC3A 2Y00A 1F4ZA 2XLOA 5JJEA 4MQTA 4U9EA 5H2KA 5ETZA 2BC5A 3UONA 4GP4B 5JRAA 4FAAB 2WJLA 3V2WA 1BRDA 3QVYA 1M0LA 1S54A 4N4YB 2F95A 1F88A 1E85A 5F8UA 4CX9A 2JAGA 3ZPQA 5A8EA 4JEBA 2I35A 2XM0A 1UCQA 4KNFA 1FBKA 1KG9A 2XLHA 4JE9A 3CODA 5H2NA 4UHRA 1FBBA 4ER9A 3ZWIA 1GU8A 3SN6R 5G53A 5LWEA 2CCYA 3MBVA 4CDYA 3ZTZA 3NYAA 5JJJA 4GP8B 5EN0A 1S05A 2ZFEA 3ZTMA 2VT4A 3HNKA 3VHZA 2X72A 5ITEA 4WGYA 2KS9A 1Q5IA 2J8WA 4IAQA 1VGOA 3L1MA 3PXOA 4GBRA 3EH4B 4FBZA 1XMEB 5B0WA 5H2MA 1E86A 5BR2A 4CIPA 4FPDA 3KJ6A 3AM6A 1CPQA 5B2NA 2XL6A 5B6YA 3FOOA 1RCPA 1XIOA 3C9LA 2RH1A 2XLWA 1S52A 4MD1A 4TL3A 3DQBA 3BVDB 4KLYA 2ZZLA 3QBIA 4AMJA 2YL3A 3RZEA 4WAVA 1U19A 5G2DA 1LM3B 2AT9A 3C63A 1YYXA 5TGZA 3NY9A 5JLIA 1QPUA 5H2LA 3A7KA 3IQ5A 3NMJA 1JAFA 3QJTB 1JFPA 5AWZA 1A7VA 2YLGA 1CGOA 1IW6A 1QM8A 3UTYA 4GP5B 5AX0A 3NMIA 1LN6A 1E12A 2YKZA 4HYJA 2YLDA 4JEAA 2XLMA 3QJQB 4PXFA 4Y9HA 5DHGA 4MQSA 4GRVA 4DS7E 3HNJA 2WJKA 3C9MA 3WQJA 1C3WA 2Y03A 1S51A 3D4SA 3OE8A 1YYJA 3PQRA 3QBLA 3PWHA 1H68A 2QLAA 2I21A 4LDOA 1IW9A 5B35A 5BR5A 1PXSA 5H2JA 2XL8A 5H2IA 5C1MA 4ULVA 3UTVA 4QRYA 3HAOA 3QJVB 2YCXA 1EHKB 2Y04A 2EI4A 1BBHA 3HAPA 1HZXA 3HARA 3AYMA 5G36A 3VI0A 1AP9A 5JS5A 3OAXA 2KSYA 4G7QB 5DHHA 2YL0A 5B34A 2L6XA 4L6RA 1X0K1 1XJIA 4BV0A 1CGNA 2R4RA 4BUOA 5B6ZA 5H2OA 2I20A 3PBLA 3S8GB 3EH3B 1PXRA 1P8HA 4G7SB 4IB4A 3CAPA 4J4QA 3COCA 3M79A 1C8RA 5ITCA 4GYCA 3UG9A 5AZDA 1BRXA 2YCZA 2F93A 1H2SA 5J7AA 3RFMA 1EKYA 1BM1A 4CDAA 1KMEA 256BA 1L9HA 2BRDA 3PDSA 3EH5B 3QDCA 4G70B 3UZCA 1QKOA 1TN0A 4CJGA 4XT3A 3OE9A 1QQ3A 1P8UA 5B6WA 2Z73A 4G72B 4DJHA 1CPRA 3C62A 4U9DA 3VGAA 3ZPRA 5JP7A 3NSBA 2J9BA 2XLVA 5B6VA 2QPEB 3M4CA 1AT9A 3M4BA 4XTOA 5H2PA 5G2AA 1R84A 1JV6A 3EMLA 2I1XA 3VRCA 1CWQA 5JVEA 3TOMA 1BRRA 3S3CB 4DAJA 1JGJA 4HYXA 1M0MA 2XLDA 4D4NA 5G2CA 1DZEA 4DKLA 4JQ6A 1MQVA 4GPOA 2M3GA 4HWLA 1VJMA 2NTWA 4MBSA 3UTWA 3HASA 3VW7A 3M15A 3ABWA 2QPDB 2ZIYA 4L35A 1UAZA 3FOPA 1P8IA 1S8JA 4XXJA 1TN5A 2YL7A 4XTNA 1E0PA 3T45A 3HAQA 3NS0A 5B3IA 5G54A 5FJGA 3DE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QW1 A;  1R2N A;  3UZA A;  1KGB A;  3ZEV A;  3QW0 A;  3REY A;  5DYS A;  4XTL A;  3OE0 A;  4JKV A;  2R4S A;  3UTX A;  4X32 A;  1KG8 A;  4QI1 A;  2Z55 A;  3X3B A;  2Y01 A;  3HNL A;  1QHJ A;  4EIY A;  5A45 A;  2YLI A;  2YDV A;  5JUA A;  4WW3 A;  3VG9 A;  4BEZ A;  3ZQV A;  4PXK A;  5AX1 A;  3QAK A;  4BVN A;  2J4Y A;  1Q5J A;  1MGY A;  3V2Y A;  5B6X A;  4K5Y A;  4MD2 A;  3TOL A;  1GQA A;  3QJS B;  3NMK A;  3QVZ A;  1X0I 1;  3ODU A;  3QAP A;  3AYN A;  3P0G A;  4QID A;  2NTU A;  1S53 A;  3QBK A;  4N4W A;  4N6H A;  4EA3 A;  4D4X A;  1APC A;  1C8S A;  1X0S A;  3ZQY A;  5AGF A;  2YDO A;  3HNI A;  3NY8 A;  2KSA A;  5JSL A;  3QJR B;  4A4M A;  1NBB A;  4G7R B;  1YZA A;  5KKH A;  4CJO A;  5AHY A;  5G28 A;  4JR8 A;  2Y02 A;  1F50 A;  5JJN A;  2YCW A;  3S3D B;  1GZM A;  4LDE A;  4BWB A;  3QJU B;  1IXF A;  1S8L A;  3S8F B;  1M0K A;  3U8P A;  1PY6 A;  2G87 A;  1L0M A;  2HPY A;  2JAF A;  2YL1 A;  1M6T A;  4LDL A;  3DE8 A;  1QKP A;  3OE6 A;  2PED A;  2XLE A;  4EJ4 A;  4IAR A;  4WGZ A;  5AHZ A;  4CDV A;  4XT1 A;  5A44 A;  5JT4 A;  4X31 A;  2LNL A;  1E83 A;  2XM4 A;  3VVK A;  1E84 A;  4UG2 A;  1GUE A;  4BEY A;  3S3B B;  4AMI A;  4FA7 B;  2KSB A;  1YZC A;  3QBG A;  5H2H A;  1O0A A;  1JV7 A;  3X3C A;  4G71 B;  4OV0 A;  4X1H A;  3DDL A;  2YCY A;  3IQ6 A;  3HAN A;  4NC3 A;  2Y00 A;  1F4Z A;  2XLO A;  5JJE A;  4MQT A;  4U9E A;  5H2K A;  5ETZ A;  2BC5 A;  3UON A;  4GP4 B;  5JRA A;  4FAA B;  2WJL A;  3V2W A;  1BRD A;  3QVY A;  1M0L A;  1S54 A;  4N4Y B;  2F95 A;  1F88 A;  1E85 A;  5F8U A;  4CX9 A;  2JAG A;  3ZPQ A;  5A8E A;  4JEB A;  2I35 A;  2XM0 A;  1UCQ A;  4KNF A;  1FBK A;  1KG9 A;  2XLH A;  4JE9 A;  3COD A;  5H2N A;  4UHR A;  1FBB A;  4ER9 A;  3ZWI A;  1GU8 A;  3SN6 R;  5G53 A;  5LWE A;  2CCY A;  3MBV A;  4CDY A;  3ZTZ A;  3NYA A;  5JJJ A;  4GP8 B;  5EN0 A;  1S05 A;  2ZFE A;  3ZTM A;  2VT4 A;  3HNK A;  3VHZ A;  2X72 A;  5ITE A;  4WGY A;  2KS9 A;  1Q5I A;  2J8W A;  4IAQ A;  1VGO A;  3L1M A;  3PXO A;  4GBR A;  3EH4 B;  4FBZ A;  1XME B;  5B0W A;  5H2M A;  1E86 A;  5BR2 A;  4CIP A;  4FPD A;  3KJ6 A;  3AM6 A;  1CPQ A;  5B2N A;  2XL6 A;  5B6Y A;  3FOO A;  1RCP A;  1XIO A;  3C9L A;  2RH1 A;  2XLW A;  1S52 A;  4MD1 A;  4TL3 A;  3DQB A;  3BVD B;  4KLY A;  2ZZL A;  3QBI A;  4AMJ A;  2YL3 A;  3RZE A;  4WAV A;  1U19 A;  5G2D A;  1LM3 B;  2AT9 A;  3C63 A;  1YYX A;  5TGZ A;  3NY9 A;  5JLI A;  1QPU A;  5H2L A;  3A7K A;  3IQ5 A;  3NMJ A;  1JAF A;  3QJT B;  1JFP A;  5AWZ A;  1A7V A;  2YLG A;  1CGO A;  1IW6 A;  1QM8 A;  3UTY A;  4GP5 B;  5AX0 A;  3NMI A;  1LN6 A;  1E12 A;  2YKZ A;  4HYJ A;  2YLD A;  4JEA A;  2XLM A;  3QJQ B;  4PXF A;  4Y9H A;  5DHG A;  4MQS A;  4GRV A;  3HNJ A;  2WJK A;  3C9M A;  3WQJ A;  1C3W A;  2Y03 A;  1S51 A;  3D4S A;  3OE8 A;  1YYJ A;  3PQR A;  3QBL A;  3PWH A;  1H68 A;  2QLA A;  2I21 A;  4LDO A;  1IW9 A;  5B35 A;  5BR5 A;  1PXS A;  5H2J A;  2XL8 A;  5H2I A;  5C1M A;  4ULV A;  3UTV A;  4QRY A;  3HAO A;  3QJV B;  2YCX A;  1EHK B;  2Y04 A;  2EI4 A;  1BBH A;  3HAP A;  1HZX A;  3HAR A;  3AYM A;  5G36 A;  3VI0 A;  1AP9 A;  5JS5 A;  3OAX A;  2KSY A;  4G7Q B;  5DHH A;  2YL0 A;  5B34 A;  2L6X A;  4L6R A;  1X0K 1;  1XJI A;  4BV0 A;  1CGN A;  2R4R A;  4BUO A;  5B6Z A;  5H2O A;  2I20 A;  3PBL A;  3S8G B;  3EH3 B;  1PXR A;  1P8H A;  4G7S B;  4IB4 A;  3CAP A;  4J4Q A;  3COC A;  3M79 A;  1C8R A;  5ITC A;  4GYC A;  3UG9 A;  5AZD A;  1BRX A;  2YCZ A;  2F93 A;  1H2S A;  5J7A A;  3RFM A;  1EKY A;  1BM1 A;  4CDA A;  1KME A;  256B A;  1L9H A;  2BRD A;  3PDS A;  3EH5 B;  3QDC A;  4G70 B;  3UZC A;  1QKO A;  1TN0 A;  4CJG A;  4XT3 A;  3OE9 A;  1QQ3 A;  1P8U A;  5B6W A;  2Z73 A;  4G72 B;  4DJH A;  1CPR A;  3C62 A;  4U9D A;  3VGA A;  3ZPR A;  5JP7 A;  3NSB A;  2J9B A;  2XLV A;  5B6V A;  2QPE B;  3M4C A;  1AT9 A;  3M4B A;  4XTO A;  5H2P A;  5G2A A;  1R84 A;  1JV6 A;  3EML A;  2I1X A;  3VRC A;  1CWQ A;  5JVE A;  3TOM A;  1BRR A;  3S3C B;  4DAJ A;  1JGJ A;  4HYX A;  1M0M A;  2XLD A;  4D4N A;  5G2C A;  1DZE A;  4DKL A;  4JQ6 A;  1MQV A;  4GPO A;  2M3G A;  4HWL A;  1VJM A;  2NTW A;  4MBS A;  3UTW A;  3HAS A;  3VW7 A;  3M15 A;  3ABW A;  2QPD B;  2ZIY A;  4L35 A;  1UAZ A;  3FOP A;  1P8I A;  1S8J A;  4XXJ A;  1TN5 A;  2YL7 A;  4XTN A;  1E0P A;  3T45 A;  3HAQ A;  3NS0 A;  5B3I A;  5G54 A;  5FJG A;  3DE9 A; 
#chains in the Genus database with same CATH topology
 2G62 A;  3LLK A;  1M57 C;  3FVY A;  1SMY F;  2XSE A;  4JKV A;  2R4S A;  2B0H A;  1YLM A;  4U5F E;  3UTX A;  3CAX A;  1ZHX A;  4H4K C;  4FES A;  3X3B A;  2Y39 A;  3N0T A;  5EGY A;  2YLI A;  5BQG A;  5AC5 A;  1Q0K A;  4E17 A;  3ZQV A;  3QAK A;  4J7T A;  2J4Y A;  1NLX A;  2HZ8 A;  3TOL A;  4JJG A;  1GQA A;  4MVZ A;  3ODU A;  1MMG A;  1TWA A;  4AK9 A;  1BZ4 A;  3SYN A;  1S53 A;  2R7X A;  2EPK X;  3C8G A;  4P9T A;  4EA3 A;  4H54 A;  1APC A;  3S29 A;  3JT1 A;  1UG7 A;  3Q7G A;  3G4Z A;  2QY9 A;  1OW6 A;  4G7R B;  4PJN A;  4CJO A;  1T6U A;  2YZS A;  2CNW D;  1Y6D A;  4CS8 C;  2AWY A;  3ABM C;  3UMI A;  4XEF A;  4PAC A;  5A6J A;  3S3D B;  1YAU O;  1OCC C;  1IXF A;  3S8F B;  5L0F A;  5F5F A;  1PY6 A;  2JAF A;  3KMI A;  4LDL A;  5T3T A;  4GQH A;  5HV9 A;  5AHZ A;  1QKR A;  3DMD A;  4QI2 A;  4X31 A;  3VVK A;  2Q00 A;  2R9R B;  2LSE A;  1LKX A;  2NUT B;  3S3B B;  4AMI A;  4FA7 B;  2LQG A;  3OEO A;  2KSB A;  2J45 A;  1O3U A;  5DQZ A;  4U5H A;  1O0A A;  2AP3 A;  1GS9 A;  2J7P A;  4OIP F;  3X3C A;  4JZA A;  3GM3 A;  2ZXR A;  2R7Q A;  2QUP A;  1EI7 A;  4X1H A;  3SEO A;  3IQ6 A;  2A69 F;  4O6N A;  4NC3 A;  4BJT A;  4YT2 A;  4U9E A;  3AG2 C;  2W9Y A;  2YVK A;  3U3B A;  3W2W A;  5A6B A;  5JRA A;  3L8J A;  2WJL A;  3V2W A;  2KYH A;  3QVY A;  5B1B C;  4AL0 A;  2LD6 A;  2MHR A;  3RKO F;  4N4Y B;  2GA0 A;  4XPY A;  3A9C A;  3ZPQ A;  2I35 A;  1TFK B;  4YL1 A;  4DBQ A;  3RFY A;  1HY5 A;  4UHR A;  1FBB A;  1RKE B;  2CCY A;  4CDY A;  4RD9 A;  1LIH A;  1MMA A;  2VT4 A;  2J8W A;  2VB6 A;  2L6F A;  1WTY A;  4JJF A;  4X0R A;  2A68 F;  3ECS A;  4YT5 A;  2DI3 A;  5B0W A;  5H2M A;  4CIP A;  2CDQ A;  3KJ6 A;  4UDV A;  3SXM A;  2KJG A;  4PK4 A;  1OKK D;  4JW1 A;  4BJ5 C;  4MD1 A;  3ABL C;  2RSE B;  4TL3 A;  3DQB A;  3BVD B;  4AL1 A;  1HW2 A;  2TMV P;  1JPJ A;  4AE4 B;  4CSA A;  4ANJ A;  4P6I C;  5G2D A;  1OR3 A;  3HKK A;  1YYX A;  1LS4 A;  1J8M F;  4CIH A;  2X0C A;  1JAF A;  3QJT B;  4GEH A;  1ORY A;  4MS2 A;  3HLZ A;  1QM8 A;  1Z6A A;  3DD7 A;  1L3P A;  1C17 M;  1SYQ A;  3JSE O;  3T6G B;  2YLD A;  3DXJ F;  1ZU5 A;  4IWB A;  3QJQ B;  1LE2 A;  5L3V A;  4Y9H A;  3TUL A;  3JRM O;  2R03 A;  4JTD B;  2YHS A;  2IXP A;  2XS8 A;  1GM5 A;  4XWJ A;  4YWQ A;  3D4S A;  4LLC A;  2Q7R A;  4K0D A;  3H2V A;  1HW1 A;  4XEK A;  3QBL A;  5DS6 A;  1BR2 A;  4MVU A;  2QLA A;  3UNG C;  1JOG A;  2WVQ A;  5B35 A;  4CBE A;  4EBB A;  3UGP A;  4ULV A;  5T1D B;  1RKC A;  3UTV A;  2VH3 A;  4QRY A;  3QJV B;  2YCX A;  2EI4 A;  2PFD A;  3AYM A;  3HJC A;  2R02 A;  5G36 A;  3VI0 A;  2HKV A;  3OAX A;  4O6M A;  5CI8 A;  3K66 A;  2OU6 A;  4W8K A;  5B34 A;  2L6X A;  4YT4 A;  3I4U A;  4U5E E;  1XJI A;  1CGN A;  2R4R A;  4BUO A;  2I20 A;  3PBL A;  1D0X A;  2HV7 A;  4OIO F;  4IB4 A;  3POV A;  4EBJ A;  1Q0M A;  3CAP A;  3JRT A;  4Z9H A;  2H7V C;  2HJM A;  5ITC A;  3F47 A;  4O7G A;  1H2S A;  3IQT A;  3RFM A;  3B9Q A;  2BRD A;  2NUT A;  4I1M A;  5L0J A;  2VCB A;  2P7V A;  4J32 B;  1VMA A;  2J9V A;  1TN0 A;  4XT3 A;  3EJN A;  1P8U A;  2WZF A;  2Z73 A;  4DJH A;  1E2X A;  2QE9 A;  3MBG A;  1ORS C;  1ZYR F;  5D91 A;  3KKB A;  5GPG B;  3ZPR A;  5JP7 A;  2EIK C;  2FFH A;  4C3D A;  3NSB A;  4JTC B;  4YK5 A;  3M4C A;  1ZW2 A;  4PR9 A;  4G7Z F;  2PNO A;  4JVS A;  4WJ0 A;  2H7B A;  1H9G A;  1CWQ A;  5JVE A;  1BRR A;  2CGE A;  4HYX A;  1RXQ A;  2Y3B A;  4N06 A;  4JQ6 A;  3LUT B;  1LS1 A;  1TWH A;  2QPD B;  4L35 A;  1RKE A;  1Z23 A;  4XTN A;  5L0D A;  2QTV A;  5BQH A;  3RVY A;  3DE9 A;  2Q9B A;  3GM1 A;  1VK5 A;  3K6B A;  3WOD F;  2M64 A;  4A4A A;  1H7I A;  1PV3 A;  1K40 A;  3LEO A;  1KG8 A;  4QI1 A;  4JRZ A;  2UUI A;  2Y01 A;  3LNM B;  3HNL A;  5TJ5 E;  1VB5 A;  3TK0 A;  4WW3 A;  3VG9 A;  1HMD A;  3W4Y A;  4BVN A;  1WWP A;  3SXZ A;  1Q5J A;  3V2Y A;  5FZT A;  5B6X A;  3TJ5 A;  2HJ3 A;  2IXM A;  2NPU A;  3NMK A;  3QVZ A;  4AE4 A;  3QAP A;  3EGD B;  1NG1 A;  2WVN A;  4QID A;  5CIV A;  4C3E A;  3QTH A;  3DAF A;  4PFO A;  2GFH A;  2P61 A;  4I1O B;  3LS1 A;  3PDM P;  2DB4 A;  1X0S A;  3H65 A;  4IRU A;  4BG0 A;  4E18 A;  3NY8 A;  2KSA A;  5JSL A;  4EUK B;  4A4M A;  1A0B A;  3G4X A;  2WZG A;  1YA7 O;  5L0H A;  4OIN F;  5AHY A;  4Z9I A;  4JR8 A;  2Y02 A;  2CNW A;  4LDE A;  1A41 A;  3X1O A;  2GDC A;  4E7Z A;  4EHP A;  2X51 A;  3N2Z B;  1NU7 D;  2G87 A;  2YQY A;  2YL1 A;  4YL3 A;  2IYL D;  2XLE A;  5A44 A;  1SR2 A;  2CYD A;  2LNL A;  3K1H A;  5KYX B;  1T9K A;  1VTM P;  2H8A A;  4UG2 A;  4O6Y A;  3EG9 B;  3V5Z A;  4ZLC A;  5K0I A;  2XXA B;  1YZC A;  1JV7 A;  2FAP B;  3DM9 B;  2M4E A;  1V54 C;  1V74 B;  4JC7 A;  2OOC A;  1OCZ C;  3T6B A;  3BRJ A;  3ZDL A;  4EBK A;  5H2K A;  1DOW A;  1JR8 A;  5ETZ A;  4YT8 A;  4GP4 B;  1HE9 A;  3E70 C;  2WB7 A;  1S54 A;  1BRD A;  1ZU4 A;  1E85 A;  5F8U A;  4CS9 C;  2XL4 A;  3B29 A;  1I4Y A;  5A8E A;  4JEB A;  1FFH A;  3UGO A;  2XM0 A;  3GEI A;  5KYU B;  1KG9 A;  1OXB A;  4JE9 A;  3COD A;  5H2N A;  3K1I C;  1QLE C;  3DAG A;  2W45 A;  4ER9 A;  1G5Z A;  1GU8 A;  2V3C C;  5LWE A;  2YWA A;  4XTK A;  4HE8 D;  4EWC A;  4DBR A;  3ZTZ A;  2NG1 A;  3KPH A;  4KNW A;  1S05 A;  2ZFE A;  3HNK A;  2JPU A;  4JIO A;  2EIJ C;  2HSQ A;  4J7Y A;  4XLN F;  1ORJ A;  4KI2 A;  5ITE A;  2HS5 A;  4BJ5 A;  1D0Z A;  3S84 A;  2QNL A;  4Q4Z F;  3FDQ A;  3U2L A;  3PXO A;  2Y3D A;  2IBF A;  3X2Q C;  2R05 A;  2NUP B;  4E7S A;  3EH4 B;  2FGY A;  1OR2 A;  5HSW A;  3FOO A;  1BDJ B;  1FTS A;  1XIO A;  3C9L A;  3B0U X;  2XLW A;  3JZ0 A;  2R25 A;  2OG2 A;  2ZZL A;  3QBI A;  4XQ1 A;  5CI9 A;  2KK1 A;  2BE5 F;  1IW7 F;  2OJE D;  1M2V A;  3RZE A;  4FAP B;  1U19 A;  3S27 A;  1J8Y F;  3C63 A;  3AGU A;  3LES A;  1H6G A;  1LI7 A;  1PD0 A;  1QPU A;  5H2L A;  5F5H A;  1YVI A;  2D4U A;  4DRJ B;  4XEV A;  2I8B A;  5AC4 A;  5DVW A;  1A7V A;  3NRH A;  4MVQ A;  2DGJ A;  1ST6 A;  2J0X A;  2P1A A;  3NMI A;  4Q7C A;  2R7W A;  1E12 A;  2YKZ A;  4HYJ A;  1I4Z A;  1G4W R;  2KC3 A;  4PXF A;  3BEH A;  3HNJ A;  2WJK A;  1C3W A;  4HEA J;  2Y03 A;  1ZHY A;  1Z5Z A;  2MWQ A;  3OE8 A;  1DOV A;  3EGD A;  3TJ6 A;  3PWH A;  5DS5 A;  1YJG A;  4LDO A;  3EH1 A;  5BR5 A;  5H2J A;  2UUH A;  3DJN B;  3KH2 A;  3MYF A;  1BBH A;  3HAP A;  1AP9 A;  3LNR A;  3EGX A;  3O6X A;  4WAB A;  4L6R A;  1ZW3 A;  1V55 C;  2ZPA A;  5B6Z A;  5H2O A;  3AG3 C;  3S8G B;  1P8H A;  2ICW G;  3C8G D;  4J4Q A;  1KNY A;  3K7D A;  2OJQ A;  3A11 A;  4DOZ A;  3JCU Q;  3L34 A;  5KYX A;  5AZD A;  4OIR F;  1AVO B;  1BM1 A;  4CDA A;  4MVM A;  3EG9 A;  1K04 A;  4XPX A;  3T6J A;  2D5R B;  4HFK B;  2XXA A;  3PDS A;  3EH5 B;  3ATP A;  3QDC A;  1ZVZ A;  3I5Q A;  5E3C A;  1QKO A;  2H7O A;  4CJG A;  2ASR A;  3OE9 A;  1QQ3 A;  1SZI A;  4BPM A;  5B6W A;  3U9J A;  1CPR A;  3RIP A;  3KL4 A;  3QMK A;  3GWN A;  2J9U A;  2XLV A;  4YN0 B;  2A6H F;  1AT9 A;  4NY3 A;  4E0I A;  3M4B A;  1HMO A;  4XTO A;  5G2A A;  1JV6 A;  1KU2 A;  3EML A;  2G3K A;  3O39 A;  3VRC A;  3TOM A;  5COM A;  5E33 A;  2XLD A;  1DZE A;  3UMH A;  4I44 A;  5KYU A;  1MQV A;  2M3G A;  2NTW A;  3HAS A;  2J7P D;  5L0I A;  1EA8 A;  2W4M A;  1C02 A;  3FOP A;  1P8I A;  2IOQ A;  1TN5 A;  2R7O A;  2YL7 A;  4PFP A;  3T45 A;  2WL8 A;  5B3I A;  3ASO C;  1Q0D A;  2LK4 A;  2EIN C;  5FJG A;  3K33 A;  4XLP F;  3QW1 A;  2AVK A;  2OKU A;  3UZA A;  3QW0 A;  5A6B D;  3REY A;  3EZH A;  1MNE A;  4BEJ A;  3OE0 A;  1BR1 A;  4X32 A;  3EZI A;  5COF A;  3GEH A;  2Z55 A;  3H2U A;  3RYL A;  5JUA A;  1VYK A;  5AX1 A;  3EHN A;  2L6H A;  3LS0 A;  1MGY A;  2LIG A;  4LDR A;  2E87 A;  3AYN A;  4MND A;  2NTU A;  4XPW A;  1FMW A;  3SXY A;  4N4W A;  2IM8 A;  4PJL A;  2GAQ A;  3ZQY A;  4B6I A;  5AGF A;  3HNI A;  2A0B A;  4DVY P;  3QJR B;  1MMD A;  4OIQ F;  1NBB A;  5KKH A;  2R7V A;  3CSK A;  3US6 A;  1FAP B;  5JJN A;  2YCW A;  5E2Q A;  1GZM A;  4ONS A;  1VLT A;  1ZHZ A;  3L8I A;  1M0K A;  3U8P A;  1L0M A;  1Z63 A;  1D1B A;  2YEV A;  3DE8 A;  1QKP A;  1TKN A;  4IAR A;  4WGZ A;  4CDV A;  4NCQ A;  4Z9J A;  4BJ6 A;  3SXK A;  3TD7 A;  2XM4 A;  3RVZ A;  2PP4 A;  1E84 A;  1G8X A;  3JYY A;  4KNV A;  3CZ6 A;  2HMQ A;  1I5N A;  4E0H A;  2ZXP A;  4N6C A;  2Q9C A;  1NSG B;  2LCH A;  3U9M A;  2Q4F A;  1EQ1 A;  3W8I A;  4G71 B;  4OV0 A;  3EHM A;  3AG4 C;  4CS9 A;  2YCY A;  1QVX A;  3HAN A;  3ZVR A;  3MYI A;  1HE1 A;  3K1I A;  3UON A;  4FAA B;  2L81 A;  1M0L A;  3MFN A;  2F95 A;  4RBN A;  2PX3 A;  3RH3 A;  4CX9 A;  2VC9 A;  3NYL A;  1FBK A;  4C3B A;  3S90 A;  3FAJ A;  3ABK C;  3WHN A;  4IGG A;  1YAR O;  2ETS A;  3ZWI A;  3ITF A;  3VYW A;  3RQE A;  3U8V A;  3NYA A;  4U5B E;  4KBL A;  5B1A C;  4GP8 B;  4CS8 A;  2J46 A;  2HV6 A;  2X72 A;  5DQT A;  4BEM J;  3MLG A;  1KTM A;  4JCH A;  4WGY A;  1Q5I A;  5L0G A;  1VYI A;  4FX5 A;  3L1M A;  5A6K A;  3OWT A;  2MYS A;  1XME B;  3DI5 A;  4JTA B;  4Q5S F;  3AOU A;  1E86 A;  5BR2 A;  2KW3 C;  4FPD A;  3AM6 A;  5B2N A;  2XL6 A;  3NG1 A;  1PD1 A;  2RH1 A;  3RQF A;  1LE4 A;  4KLY A;  4AMJ A;  3L0I A;  2OQM A;  1OCO C;  1TR2 A;  4DJ9 A;  1OW7 A;  3NY9 A;  1RMV A;  3V7O A;  3A7K A;  2GWW A;  3AQC A;  4FWV A;  1O87 A;  3LLI A;  2WVO A;  5AWZ A;  1CGO A;  1LI5 A;  2A6E F;  3S28 A;  1IW6 A;  2A0U A;  4U5G A;  4GP5 B;  5AX0 A;  1SF8 A;  3FAP B;  2WZL A;  4I3M A;  1OQC A;  5DHG A;  4MQS A;  3V5Y A;  4GRV A;  4DS7 E;  3C9M A;  1UFB A;  1NU9 C;  5BQI A;  1H9T A;  3PCV A;  2L9J A;  1S51 A;  1YYJ A;  4EKW A;  1PCX A;  1FNT c;  3PQR A;  3E9V A;  3EFO B;  2I21 A;  2YRF A;  3EH2 A;  2Q9A A;  3DWW A;  3AQB A;  3KYI A;  5C1M A;  4A2N B;  3T4R A;  3JSZ A;  1OCR C;  1T6Q A;  3KYJ A;  2R7S A;  5T3W A;  3MX3 A;  1EHK B;  2Y04 A;  3IHU A;  1RJ9 B;  3DM5 A;  1HZX A;  3PMR A;  2HUJ A;  2KSY A;  4G7Q B;  5DHH A;  2KNH A;  3M1C B;  4ZLD A;  2EPM X;  5D92 A;  5KYY B;  1JPN A;  1Q0F A;  1D0Y A;  1F1M A;  3EH3 B;  3R2P A;  1PXR A;  5A6A A;  3B71 A;  3UMK A;  4K1O A;  2L6G A;  5B3S C;  2IXN A;  1XZQ A;  1C8R A;  2OEX A;  4GYC A;  3UG9 A;  4DRH B;  2YCZ A;  4U5D E;  1EKY A;  256B A;  2NSG A;  3GAN A;  4W8P A;  4MVO A;  1QZX A;  2CW0 F;  1WAS A;  4G70 B;  1OKK A;  3VAY A;  3NKE A;  3CEX A;  3CQZ A;  1WGW A;  1CGM E;  3VF0 A;  3EPV A;  3TQO A;  2V26 A;  3U5S A;  4G72 B;  3C62 A;  4U9D A;  4KC9 A;  1YDI A;  2HMZ A;  4CS7 A;  1NFO A;  5B6V A;  3ZG1 A;  4JCZ A;  2QPE B;  2DYR C;  5H2P A;  2I1X A;  1YA9 A;  3Q6M A;  4AX2 A;  4DAJ A;  1Q0G A;  5KYW B;  3GOD A;  4D4N A;  5G2C A;  3SP1 A;  4R32 A;  2EIL C;  1VJM A;  4DXW A;  1GGQ A;  3IPM O;  2ZIY A;  1UAZ A;  2IXO A;  3LAY A;  1S8J A;  2JX0 A;  3AGT A;  3HAQ A;  3G50 A;  2J0W A;  3NYJ A;  5L0C A;  2HSB A;  5G54 A;  4G78 A;  1ZHW A;  1A7D A;  2I15 A;  1R2N A;  1KGB A;  3ZEV A;  2RD9 A;  5DYS A;  4XTL A;  2R7R A;  4K7B A;  3R7C A;  2EPL X;  4DVZ A;  4P9F A;  2JD3 A;  1QHJ A;  4EIY A;  5A45 A;  1NFN A;  2YDV A;  4BEZ A;  4PXK A;  1VLS A;  4OD4 A;  3O10 A;  2VCA A;  4K5Y A;  4MD2 A;  3RW0 A;  4MTF A;  1MND A;  3GOR A;  1X0I 1;  4PJJ A;  3U2M A;  3QJS B;  3OA1 A;  5IY5 C;  3P0G A;  1B68 A;  2EPN A;  3QBK A;  2L7A A;  4N6H A;  4D4X A;  1C8S A;  1TQG A;  2YDO A;  2F22 A;  1U0B B;  3HTK C;  2Y69 C;  2P0N A;  1YZA A;  3DKA A;  2ZXO A;  5G28 A;  3GEE A;  1F50 A;  4BWB A;  3QJU B;  4PJM A;  5KYN A;  1S8L A;  3U3F A;  2OCC C;  2O9X A;  4IAO A;  4LLE A;  2HPY A;  3FMS A;  3AJM A;  4JUR I;  3Q6N A;  1M6T A;  4J30 B;  3OE6 A;  1ZZP A;  2Q3T A;  2PED A;  1L7C A;  1MMN A;  3Q7L A;  4EJ4 A;  3ZSU A;  4XT1 A;  3EFO A;  5JT4 A;  1E83 A;  1BR4 A;  2VAS A;  1W2W A;  5DLJ A;  1GUE A;  2EIM C;  4BJ1 A;  3ZIB A;  4BEY A;  3V5X A;  3QBG A;  1U6H A;  5H2H A;  1RJ9 A;  2G3V A;  4F4B A;  1D1C A;  4LER A;  3DDL A;  4LDQ A;  4NTF A;  3B0P A;  4ULW A;  2Y00 A;  1F4Z A;  2XLO A;  5JJE A;  4MQT A;  5KYY A;  3PHF 2;  1V4A A;  2BC5 A;  3F46 A;  1OXK A;  4HFF B;  1VOM A;  3GWL A;  2NUP A;  3IEE A;  5BUO A;  4C7O B;  1F88 A;  5E3A A;  1WN0 A;  2JAG A;  2C03 A;  4QDL A;  1UCQ A;  2NSF A;  4KNF A;  2XLH A;  3C7J A;  1R4T A;  1XZP A;  1M56 C;  3SN6 R;  5G53 A;  1LVK A;  3MBV A;  2Y3G A;  2PX0 A;  5FCL A;  4RDA A;  5JJJ A;  5F28 E;  5EN0 A;  4MTO A;  1M2O A;  3ZTM A;  3VHZ A;  2XS1 A;  2J9W A;  1AEP A;  2KS9 A;  1G4U S;  3DZA A;  4IAQ A;  1VGO A;  1NZE A;  4GBR A;  3LEV A;  5EK0 A;  3RF3 A;  3O55 A;  4FBZ A;  2ZXW C;  3RQG A;  5KYW A;  1Z7Q c;  3S0X A;  1CPQ A;  2W4B A;  5B6Y A;  3ZC4 A;  1RCP A;  4G7H F;  2LFD A;  3S9O A;  4LDK A;  1S52 A;  3WAQ A;  3C8Z A;  1Z3I X;  3UR3 C;  2B0J A;  5EHH A;  2YL3 A;  4WAV A;  2R7T A;  1LM3 B;  2AT9 A;  1WOL A;  2A1D D;  4G7O F;  3C8G B;  5TGZ A;  1JRA A;  3B0V C;  5JLI A;  4MTG A;  4MQ9 F;  3N24 A;  4IJJ A;  1K05 A;  1XWJ A;  3IQ5 A;  3NMJ A;  3QZC A;  4G0H A;  4CSA C;  1JFP A;  2OEV A;  2YLG A;  3FHD A;  4MW8 A;  1N1C A;  3UTY A;  1A7E A;  1ZHT A;  1LN6 A;  2AU5 A;  5L3Q A;  4JEA A;  2XLM A;  2BL2 A;  1T5O A;  1C03 A;  4MVS A;  3WQJ A;  3W2V A;  2P6V A;  2EPO A;  2Z15 A;  1M2V B;  1AUE A;  1H68 A;  1IZM A;  1IW9 A;  2XRH A;  1S7Z A;  2ZD9 A;  3AG1 C;  1PXS A;  1T6I A;  2XL8 A;  2LP4 A;  4NTA A;  5H2I A;  4YJW A;  1FFT C;  3HAO A;  1OW8 A;  1T01 A;  3HAR A;  3SZR A;  4NQF A;  5JS5 A;  3NYM A;  3U0C A;  3IQC A;  2C04 A;  2YL0 A;  4DRI B;  1X0K 1;  1WAT A;  4BV0 A;  1FMV A;  4G7S B;  1Y4C A;  4U5C E;  2AWC A;  3COC A;  3M79 A;  4OD5 A;  4NTB A;  1BRX A;  2F93 A;  5J7A A;  1KME A;  1L9H A;  1JMW A;  4QI0 A;  3ASN C;  1U89 A;  4YL0 A;  2PF4 E;  3JYH A;  3UZC A;  1O5H A;  3NKD A;  3JTL O;  1TWG A;  3VGA A;  3EGX B;  3SNH A;  5COG A;  4MVR A;  2PBE A;  3WG7 C;  3J06 A;  2J9B A;  3W8H A;  1LPE A;  2R7U A;  5DS4 A;  2KGO A;  3LJB A;  3GM2 A;  1TWC A;  1R84 A;  3VM6 A;  2KQ9 A;  2HFI A;  3C18 A;  3T9O A;  3S3C B;  1R5I D;  1JGJ A;  4C7O A;  1M0M A;  4DKL A;  3I5P A;  3EQL F;  3FXH A;  4GPO A;  1D1A A;  4M63 A;  2Y3H A;  4HWL A;  4LAC B;  3DJU B;  4MBS A;  3UTW A;  3VW7 A;  1QSP A;  5A69 A;  3NDB B;  3M15 A;  3ABW A;  1TFO B;  4MW3 A;  2KSF A;  4XXJ A;  2VCC A;  4BJ6 C;  2DYS C;  1E0P A;  3NS0 A;  4GYT A;  4O79 A;  1FR0 A;  2LFF A; 
#chains in the Genus database with same CATH homology
 3QW1 A;  1R2N A;  3UZA A;  1KGB A;  3ZEV A;  3QW0 A;  3REY A;  5DYS A;  4XTL A;  3OE0 A;  4JKV A;  2R4S A;  3UTX A;  4X32 A;  1KG8 A;  4QI1 A;  2Z55 A;  3X3B A;  2Y01 A;  3HNL A;  1QHJ A;  4EIY A;  5A45 A;  2YLI A;  2YDV A;  5JUA A;  4WW3 A;  3VG9 A;  4BEZ A;  3ZQV A;  4PXK A;  5AX1 A;  3QAK A;  4BVN A;  2J4Y A;  1Q5J A;  1MGY A;  3V2Y A;  5B6X A;  4K5Y A;  4MD2 A;  3TOL A;  1GQA A;  3QJS B;  3NMK A;  3QVZ A;  1X0I 1;  3ODU A;  3QAP A;  3AYN A;  3P0G A;  4QID A;  2NTU A;  1S53 A;  3QBK A;  4N4W A;  4N6H A;  4EA3 A;  4D4X A;  1APC A;  1C8S A;  1X0S A;  3ZQY A;  5AGF A;  2YDO A;  3HNI A;  3NY8 A;  2KSA A;  5JSL A;  3QJR B;  4A4M A;  1NBB A;  4G7R B;  1YZA A;  5KKH A;  4CJO A;  5AHY A;  5G28 A;  4JR8 A;  2Y02 A;  1F50 A;  5JJN A;  2YCW A;  3S3D B;  1GZM A;  4LDE A;  4BWB A;  3QJU B;  1IXF A;  1S8L A;  3S8F B;  1M0K A;  3U8P A;  1PY6 A;  2G87 A;  1L0M A;  2HPY A;  2JAF A;  2YL1 A;  1M6T A;  4LDL A;  3DE8 A;  1QKP A;  3OE6 A;  2PED A;  2XLE A;  4EJ4 A;  4IAR A;  4WGZ A;  5AHZ A;  4CDV A;  4XT1 A;  5A44 A;  5JT4 A;  4X31 A;  2LNL A;  1E83 A;  2XM4 A;  3VVK A;  1E84 A;  4UG2 A;  1GUE A;  4BEY A;  3S3B B;  4AMI A;  4FA7 B;  2KSB A;  1YZC A;  3QBG A;  5H2H A;  1O0A A;  1JV7 A;  3X3C A;  4G71 B;  4OV0 A;  4X1H A;  3DDL A;  2YCY A;  3IQ6 A;  3HAN A;  4NC3 A;  2Y00 A;  1F4Z A;  2XLO A;  5JJE A;  4MQT A;  4U9E A;  5H2K A;  5ETZ A;  2BC5 A;  3UON A;  4GP4 B;  5JRA A;  4FAA B;  2WJL A;  3V2W A;  1BRD A;  3QVY A;  1M0L A;  1S54 A;  4N4Y B;  2F95 A;  1F88 A;  1E85 A;  5F8U A;  4CX9 A;  2JAG A;  3ZPQ A;  5A8E A;  4JEB A;  2I35 A;  2XM0 A;  1UCQ A;  4KNF A;  1FBK A;  1KG9 A;  2XLH A;  4JE9 A;  3COD A;  5H2N A;  4UHR A;  1FBB A;  4ER9 A;  3ZWI A;  1GU8 A;  3SN6 R;  5G53 A;  5LWE A;  2CCY A;  3MBV A;  4CDY A;  3ZTZ A;  3NYA A;  5JJJ A;  4GP8 B;  5EN0 A;  1S05 A;  2ZFE A;  3ZTM A;  2VT4 A;  3HNK A;  3VHZ A;  2X72 A;  5ITE A;  4WGY A;  2KS9 A;  1Q5I A;  2J8W A;  4IAQ A;  1VGO A;  3L1M A;  3PXO A;  4GBR A;  3EH4 B;  4FBZ A;  1XME B;  5B0W A;  5H2M A;  1E86 A;  5BR2 A;  4CIP A;  4FPD A;  3KJ6 A;  3AM6 A;  1CPQ A;  5B2N A;  2XL6 A;  5B6Y A;  3FOO A;  1RCP A;  1XIO A;  3C9L A;  2RH1 A;  2XLW A;  1S52 A;  4MD1 A;  4TL3 A;  3DQB A;  3BVD B;  4KLY A;  2ZZL A;  3QBI A;  4AMJ A;  2YL3 A;  3RZE A;  4WAV A;  1U19 A;  5G2D A;  1LM3 B;  2AT9 A;  3C63 A;  1YYX A;  5TGZ A;  3NY9 A;  5JLI A;  1QPU A;  5H2L A;  3A7K A;  3IQ5 A;  3NMJ A;  1JAF A;  3QJT B;  1JFP A;  5AWZ A;  1A7V A;  2YLG A;  1CGO A;  1IW6 A;  1QM8 A;  3UTY A;  4GP5 B;  5AX0 A;  3NMI A;  1LN6 A;  1E12 A;  2YKZ A;  4HYJ A;  2YLD A;  4JEA A;  2XLM A;  3QJQ B;  4PXF A;  4Y9H A;  5DHG A;  4MQS A;  4GRV A;  4DS7 E;  3HNJ A;  2WJK A;  3C9M A;  3WQJ A;  1C3W A;  2Y03 A;  1S51 A;  3D4S A;  3OE8 A;  1YYJ A;  3PQR A;  3QBL A;  3PWH A;  1H68 A;  2QLA A;  2I21 A;  4LDO A;  1IW9 A;  5B35 A;  5BR5 A;  1PXS A;  5H2J A;  2XL8 A;  5H2I A;  5C1M A;  4ULV A;  3UTV A;  4QRY A;  3HAO A;  3QJV B;  2YCX A;  1EHK B;  2Y04 A;  2EI4 A;  1BBH A;  3HAP A;  1HZX A;  3HAR A;  3AYM A;  5G36 A;  3VI0 A;  1AP9 A;  5JS5 A;  3OAX A;  2KSY A;  4G7Q B;  5DHH A;  2YL0 A;  5B34 A;  2L6X A;  4L6R A;  1X0K 1;  1XJI A;  4BV0 A;  1CGN A;  2R4R A;  4BUO A;  5B6Z A;  5H2O A;  2I20 A;  3PBL A;  3S8G B;  3EH3 B;  1PXR A;  1P8H A;  4G7S B;  4IB4 A;  3CAP A;  4J4Q A;  3COC A;  3M79 A;  1C8R A;  5ITC A;  4GYC A;  3UG9 A;  5AZD A;  1BRX A;  2YCZ A;  2F93 A;  1H2S A;  5J7A A;  3RFM A;  1EKY A;  1BM1 A;  4CDA A;  1KME A;  256B A;  1L9H A;  2BRD A;  3PDS A;  3EH5 B;  3QDC A;  4G70 B;  3UZC A;  1QKO A;  1TN0 A;  4CJG A;  4XT3 A;  3OE9 A;  1QQ3 A;  1P8U A;  5B6W A;  2Z73 A;  4G72 B;  4DJH A;  1CPR A;  3C62 A;  4U9D A;  3VGA A;  3ZPR A;  5JP7 A;  3NSB A;  2J9B A;  2XLV A;  5B6V A;  2QPE B;  3M4C A;  1AT9 A;  3M4B A;  4XTO A;  5H2P A;  5G2A A;  1R84 A;  1JV6 A;  3EML A;  2I1X A;  3VRC A;  1CWQ A;  5JVE A;  3TOM A;  1BRR A;  3S3C B;  4DAJ A;  1JGJ A;  4HYX A;  1M0M A;  2XLD A;  4D4N A;  5G2C A;  1DZE A;  4DKL A;  4JQ6 A;  1MQV A;  4GPO A;  2M3G A;  4HWL A;  1VJM A;  2NTW A;  4MBS A;  3UTW A;  3HAS A;  3VW7 A;  3M15 A;  3ABW A;  2QPD B;  2ZIY A;  4L35 A;  1UAZ A;  3FOP A;  1P8I A;  1S8J A;  4XXJ A;  1TN5 A;  2YL7 A;  4XTN A;  1E0P A;  3T45 A;  3HAQ A;  3NS0 A;  5B3I A;  5G54 A;  5FJG A;  3DE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...