4JKVA

Structure of the human smoothened 7tm receptor in complex with an antitumor agent
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
469
structure length
454
Chain Sequence
b'GTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562, Smoothened homolog
publication title Structure of the human smoothened receptor bound to an antitumour agent.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 186
structure length 454
sequence length 469
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01534 Frizzled Frizzled/Smoothened family membrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4jkvA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4jkvA02
1VGOA 5ITEA 4XXJA 4UHRA 4U9DA 4BUOA 2XL8A 1MGYA 3DDLA 1IW6A 3C63A 1PXSA 3PQRA 3QJQB 4G71B 1R84A 1QPUA 5AWZA 5B35A 4FA7B 2ZIYA 3ZTZA 2RH1A 2XLEA 1Q5IA 4JEBA 2XM4A 4MQSA 1UAZA 2XM0A 1S53A 5A8EA 3ZWIA 1H68A 2VT4A 2KSAA 4A4MA 2KSBA 1JAFA 4XT3A 1F88A 3QAKA 2YLDA 4G7RB 3HANA 2QLAA 2J4YA 3S8GB 3QVZA 1M0LA 1IW9A 3QAPA 1CGNA 4X32A 3EH4B 3COCA 3ZQYA 1MQVA 5FJGA 1CPQA 3M79A 4IAQA 5H2JA 3ODUA 3U8PA 1UCQA 1BRDA 1C8RA 1YZCA 1PY6A 3S3DB 4HWLA 1RCPA 5TGZA 3UZCA 2G87A 3PDSA 4AMIA 3P0GA 3DE8A 3VVKA 3M15A 3QW1A 3OE0A 1EHKB 3EH5B 5JJNA 5G28A 1QM8A 2R4RA 2XL6A 1XMEB 5G53A 3HNIA 2F93A 2Z73A 5B2NA 5H2OA 5EN0A 3QJUB 3HNKA 3AYMA 1R2NA 3UONA 2I1XA 3SN6R 3UTVA 5JRAA 4LDOA 4JR8A 4EIYA 5AZDA 2XLHA 1C3WA 5G54A 4KNFA 3NS0A 4CDYA 3NY8A 2QPDB 1JV7A 5JLIA 1NBBA 1JFPA 4G70B 4WGZA 4D4XA 4XT1A 2X72A 3UZAA 4LDLA 5H2MA 1YYXA 3L1MA 3C9LA 5B0WA 4DKLA 1L9HA 4ULVA 3NY9A 3QJTB 1FBKA 4FBZA 2HPYA 2YL3A 4FAAB 2XLOA 5AHZA 1YZAA 1TN5A 5F8UA 2YCYA 4PXKA 3ZQVA 5JJEA 4N6HA 1H2SA 4CJOA 1IXFA 1L0MA 5H2LA 1TN0A 3BVDB 5B6ZA 3PXOA 4BV0A 3S8FB 3VI0A 1E86A 1AP9A 2YCZA 3TOMA 3QJSB 3C62A 5ETZA 2F95A 4D4NA 1C8SA 1XJIA 4X1HA 4GBRA 5G2DA 3D4SA 4G7QB 3IQ5A 3OE8A 1E85A 2J9BA 2YDVA 3QBKA 5H2HA 4AMJA 5DHGA 4QIDA 4GYCA 4MD1A 2YLGA 3RFMA 4N4WA 1S8LA 5DYSA 1QQ3A 5B6WA 4GP5B 5G36A 4JKVA 1E84A 5B6YA 1E83A 3MBVA 2WJKA 1S8JA 5JJJA 1O0AA 4BEZA 1S51A 2WJLA 4GPOA 4JQ6A 3QW0A 3HAOA 4QI1A 3S3CB 1HZXA 3DQBA 4QRYA 5AX1A 5H2IA 1KG8A 2LNLA 2JAGA 1KGBA 3UTXA 2Y04A 1X0I1 5B6XA 3FOPA 3CAPA 4K5YA 5BR2A 2YKZA 2ZZLA 3HAQA 3VG9A 3HARA 3NYAA 2XLMA 3HNLA 2PEDA 2Z55A 5H2PA 4GP4B 4L6RA 1APCA 2XLDA 1JGJA 2I21A 1BM1A 4XTNA 2L6XA 3NMKA 4DJHA 3EMLA 3DE9A 1S05A 3VHZA 3S3BB 4IARA 3C9MA 5ITCA 1YYJA 4PXFA 2Y01A 5JVEA 3EH3B 2XLVA 2BC5A 3ZTMA 3NSBA 5J7AA 4CX9A 2YCWA 1KG9A 3QBIA 1LM3B 1QHJA 2QPEB 4EA3A 3IQ6A 5G2CA 1FBBA 5G2AA 5B34A 5JT4A 1M6TA 1X0K1 2YDOA 1F4ZA 3UG9A 3PBLA 3ZPQA 1XIOA 1P8IA 2YL7A 1CGOA 2YCXA 1F50A 4MQTA 1X0SA 4WGYA 5JP7A 4NC3A 3NMJA 2Y02A 3ZPRA 5A45A 3QJRB 4L35A 1A7VA 2EI4A 3AYNA 3UTYA 3KJ6A 1S52A 3CODA 2YL1A 3OAXA 3QBLA 3QJVB 3QDCA 4FPDA 3WQJA 1KMEA 4MBSA 1P8HA 3QBGA 2YL0A 1CPRA 2KSYA 5AGFA 2NTUA 4XTLA 5AHYA 4CDAA 1U19A 4CDVA 4ER9A 5H2NA 2R4SA 3ABWA 1CWQA 3OE6A 1QKPA 3X3BA 3TOLA 1Q5JA 4U9EA 4CIPA 3VW7A 5DHHA 3PWHA 5C1MA 4BEYA 256BA 1JV6A 4EJ4A 2Y00A 4J4QA 2BRDA 4WW3A 3RZEA 3NMIA 1GZMA 5JUAA 3REYA 2YLIA 3VGAA 1GQAA 5JSLA 5BR5A 2KS9A 1GU8A 1S54A 3A7KA 5AX0A 1QKOA 4G72B 4TL3A 4GRVA 2I20A 1LN6A 2XLWA 1M0MA 2J8WA 4HYXA 1VJMA 3HASA 2CCYA 3ZEVA 1EKYA 1M0KA 5H2KA 2JAFA 5LWEA 1P8UA 4LDEA 4JEAA 2AT9A 3V2WA 3OE9A 5KKHA 1E0PA 5B3IA 1PXRA 4DAJA 1DZEA 3UTWA 3T45A 2Y03A 4JE9A 4GP8B 1BRRA 1E12A 4XTOA 2M3GA 4Y9HA 3HAPA 4BWBA 4MD2A 3AM6A 3M4CA 5JS5A 3HNJA 1GUEA 3QVYA 2NTWA 4X31A 1BBHA 2ZFEA 2I35A 5A44A 4KLYA 4G7SB 4HYJA 4WAVA 4OV0A 4IB4A 4CJGA 1BRXA 4BVNA 3X3CA 5B6VA 3V2YA 4UG2A 4N4YB 3FOOA 1AT9A 3M4BA 3VRCA
chains in the Genus database with same CATH superfamily
1LVKA 1VK5A 4BUOA 5L0HA 1CGME 2R02A 5DVWA 4JTDB 3MLGA 2A0BA 2H7VC 4MTFA 1PXSA 3J06A 2G3VA 1OKKD 4BJ6A 4PFPA 3K1IA 1QPUA 2YVKA 3G50A 3CQZA 2XM4A 4GEHA 4Q5SF 1WWPA 1FFTC 3EFOA 1T6UA 4DVZA 1FR0A 2R7TA 2GFHA 4G0HA 1MNEA 1G5ZA 3B9QA 4DRJB 4JRZA 2QLAA 1FFHA 3NRHA 5A69A 4YL1A 4XEFA 3ZQYA 2AWYA 3DAFA 5F5FA 1HMDA 3EG9A 5H2JA 2EPKX 1UCQA 4LLCA 1PY6A 3UZCA 2G87A 4YT5A 3PDSA 1KU2A 5E3AA 3EZIA 5A6KA 3M15A 3QW1A 4N6CA 1EHKB 2A68F 4LERA 4GQHA 5G28A 1QM8A 3K6BA 1ZHWA 3BEHA 4G7HF 3WODF 2F93A 2H8AA 5B2NA 2W4BA 5EN0A 4CS8A 4ULWA 1NFNA 3LAYA 2E87A 2XLHA 2G62A 3NDBB 5G54A 3NS0A 3NY8A 2IXNA 1NBBA 1JFPA 4WGZA 5H2MA 3L1MA 4O6MA 2L9JA 3ZVRA 4FBZA 2VH3A 4U5HA 4FAAB 2YL3A 1QZXA 3ZDLA 1G4WR 5F8UA 5F28E 4N6HA 1H2SA 4E7SA 1Z7Qc 5B6ZA 3JRMO 4OD4A 3HLZA 4YK5A 3Q7LA 1AVOB 1VLSA 3TOMA 3TULA 3QJSB 4KI2A 3WG7C 3DM5A 1YAUO 2O9XA 3RQEA 2CYDA 1T9KA 3U2LA 1BR1A 3D4SA 4MVQA 5F5HA 3FXHA 2OKUA 3EGXB 1Z5ZA 3RQFA 5KYYA 4JC7A 4GYCA 4MW3A 4MD1A 3DMDA 1S8LA 5DYSA 1QQ3A 1YJGA 4GP5B 3G4XA 5COMA 1E84A 3SXZA 1MMNA 5EK0A 2QUPA 3EGDB 1O0AA 1M57C 4LDKA 2R7UA 3KKBA 3X1OA 3HAOA 4QRYA 4FESA 2KGOA 5IY5C 4CS9C 2P6VA 4W8KA 1RKEB 1D1BA 3W8IA 1X0I1 5E3CA 3RFYA 3RKOF 1B68A 3HAQA 4XLNF 1R4TA 2DGJA 3LUTB 4O6NA 2I21A 4U5CE 4JCZA 2L6XA 4YT8A 4DJHA 4WJ0A 3VHZA 3B0VC 1WATA 1RJ9B 3S3BB 3C9MA 2AU5A 4U5BE 3DI5A 2XLVA 3ITFA 2Y3BA 4CX9A 1WTYA 2KQ9A 2YCWA 1ZHZA 2GDCA 3IQTA 3NYJA 4EA3A 2HV7A 4E18A 1FBBA 3JT1A 4PFOA 4BJ1A 5B34A 2R7OA 3PCVA 2I8BA 3Q7GA 4MVOA 1X0K1 2YDOA 4JVSA 3PBLA 2YL7A 4MQTA 1X0SA 4WGYA 2JX0A 1T01A 3LS1A 2NUTA 2LK4A 3NMJA 3OWTA 2R7SA 3UTYA 3ZIBA 3CODA 3QBLA 1YLMA 3WQJA 1KMEA 3JZ0A 4C7OA 2LFFA 1P8HA 3QBGA 1TWAA 1DOWA 1FNTc 2KSYA 2XL4A 4XTLA 4CDAA 1U19A 4CDVA 5H2NA 3EQLF 1CWQA 2R7XA 1TQGA 1Q5JA 4NQFA 1M2VA 3VW7A 1NFOA 1JV6A 1BR4A 2XSEA 3S29A 2XS1A 2OJED 1H7IA 1GZMA 1LS4A 4I3MA 5B3SC 4G7OF 2Q3TA 1TWCA 2QY9A 2CDQA 3V7OA 2VCBA 4WABA 4HYXA 4XPXA 1VJMA 3K7DA 3HASA 3AQBA 3ZEVA 5DQTA 5L0IA 3U9JA 1OQCA 4OIRF 2JAFA 2C04A 2YRFA 3F47A 1PCXA 4CIHA 2J46A 2XRHA 2L7AA 3LNMB 4XPWA 4O79A 4IWBA 3H65A 3GM1A 3UTWA 2GA0A 4GP8B 3HJCA 2L6HA 1L3PA 2M3GA 5EGYA 4H54A 4BWBA 1TR2A 3M4CA 3T6BA 4X31A 4OIQF 3U9MA 4GYTA 5A44A 1ZHTA 4J30B 4YWQA 5AC4A 1OW8A 3S9OA 1D1CA 1L7CA 2GAQA 2WVNA 5B6VA 4FX5A 4IAOA 3M4BA 4JURI 4XXJA 4UHRA 1MGYA 3DDLA 2W45A 3C63A 2NUPB 3QJQB 3EHNA 5AWZA 4FA7B 2ZIYA 3ZTZA 2RH1A 1V54C 3MFNA 2PFDA 1HW2A 1LI5A 1H68A 4Z9IA 4Z9JA 2KSBA 4PR9A 2J0WA 1JAFA 3R7CA 1F88A 3QAKA 4MVZA 5A6JA 3EZHA 4JIOA 4U5GA 3FHDA 4G7RB 1A0BA 4DRIB 4CS9A 2J4YA 5A6BD 1LE4A 3QVZA 1M0LA 1IW9A 3QAPA 2OEVA 1RKCA 3JRTA 1FTSA 1MQVA 2Y39A 1IW7F 5FJGA 2M64A 1CPQA 3M79A 3I5QA 1ORJA 2X0CA 2ZXRA 1Q0GA 1OCZC 3S3DB 2RSEB 4HWLA 1RCPA 1LKXA 1QSPA 3P0GA 2QE9A 4PJJA 3VVKA 3OEOA 5JJNA 2LP4A 1HY5A 2R25A 3HNIA 2Z73A 1ZW3A 2Y3DA 5AC5A 2HSQA 5DQZA 5L0GA 1R2NA 5BUOA 3UONA 2I1XA 3UMIA 3SN6R 5JRAA 4LDOA 3PDMP 4MVUA 1C3WA 3L8IA 4CDYA 2QPDB 1YA7O 1VYIA 5HV9A 4XT1A 3UZAA 1YYXA 1L9HA 4KBLA 3NY9A 5DLJA 3U3FA 2XLOA 2WZGA 3W2VA 4ONSA 5H2LA 2EPMX 3S8FB 1J8YF 3AGUA 1AP9A 4KC9A 3L8JA 1R5ID 3M1CB 3AJMA 3DWWA 3GEHA 3C8ZA 2IXMA 5CI8A 1LS1A 4GBRA 1OXKA 3IQ5A 3OE8A 2NSFA 1NSGB 2R7RA 2J9BA 2P61A 4JJGA 4AMJA 1JPNA 2KNHA 4RBNA 2P7VA 2YLGA 3RFMA 4OIOF 4Q4ZF 3ZSUA 5G36A 1EI7A 1E83A 1A7DA 4AK9A 1T6QA 3MBVA 5E33A 3MX3A 3GM2A 1S8JA 1YVIA 4ANJA 4BEZA 3I5PA 4AX2A 1S51A 3U3BA 2WJLA 1U6HA 2H7BA 4GPOA 4JQ6A 2HUJA 1V74B 2EPOA 4QI1A 2J9WA 4AE4A 3S3CB 1HZXA 5L3QA 3DQBA 5CIVA 1BR2A 3W2WA 2LNLA 5KYUB 2JAGA 1TWHA 3SXKA 4HEAJ 5B6XA 3W8HA 2Y69C 3FOPA 3V5ZA 4K5YA 2NSGA 2YKZA 3GM3A 4YL3A 3HARA 1FMWA 2Z55A 5D91A 1Y4CA 2XLDA 4XTNA 3N2ZB 3VF0A 3NMKA 2Q9AA 3DE9A 3AGTA 3SXMA 3ZC4A 2J7PD 4J7YA 2Y01A 3EH3B 1HW1A 5J7AA 2LQGA 1OCRC 1ZHYA 3G4ZA 1SYQA 1GS9A 1LM3B 3EH1A 2R7VA 3RH3A 2PP4A 2FAPB 3IHUA 5G2CA 1XZQA 1MMDA 1M6TA 3U5SA 1N1CA 1F4ZA 3UG9A 3ZPQA 1XIOA 3T9OA 2IOQA 1F50A 3O39A 3SXYA 4BJ5C 1K04A 1O3UA 3K1HA 1K05A 1H6GA 2D4UA 4K0DA 2ZD9A 3KPHA 3NG1A 2Y02A 5A45A 3L34A 2EI4A 2Y3HA 1S52A 4MNDA 1JRAA 4Z9HA 4J32B 3V5YA 3QJVB 3POVA 3QDCA 2B0HA 4MVSA 1U0BB 2DYRC 1CPRA 1PD0A 4C3BA 2Z15A 5AGFA 1A7EA 5CI9A 5AHYA 1ZVZA 5E2QA 3FAJA 3CEXA 3EHMA 4YN0B 3N24A 3ABWA 1QKPA 3X3BA 4U9EA 1Z3IX 4BEYA 1OR3A 3JCUQ 4EJ4A 2PBEA 1NU9C 3RZEA 3NMIA 3C7JA 5FCLA 3LS0A 3REYA 3VGAA 1F1MA 1GQAA 2UUHA 1O87A 1XZPA 2KS9A 1GU8A 1PV3A 4G72B 4GRVA 5GPGB 2I20A 3IPMO 3PMRA 2J8WA 2Q7RA 5HSWA 4HFKB 3RVYA 2BL2A 2CCYA 3AOUA 2A69F 4F4BA 3Q6MA 1SF8A 1Q0FA 2IBFA 3H2VA 2V26A 2AT9A 1C03A 4CS7A 3V2WA 3CAXA 5KKHA 1E0PA 3WHNA 1A41A 4DAJA 3U8VA 4I1OB 1DZEA 3T45A 3NKDA 3MYIA 1Y6DA 4ZLCA 4XTOA 1NLXA 4K1OA 4P9FA 2Q9BA 4Y9HA 4PK4A 4IJJA 3QVYA 1M2OA 3GODA 2DI3A 2V3CC 2I35A 1VB5A 3EH2A 2JD3A 3C8GD 4KLYA 3DJUB 2H7OA 2YHSA 3JSZA 2KW3C 4WAVA 3NYLA 2AVKA 1BRXA 3GORA 4BVNA 1EA8A 4UG2A 1AT9A 3VRCA 5ITEA 4JJFA 4U9DA 2XL8A 1ZZPA 2WVQA 1IW6A 3SP1A 2KSFA 1VTMP 2W9YA 4KNVA 3PQRA 4BEMJ 1R84A 3I4UA 2YZSA 2XLEA 1Q5IA 5EHHA 2JPUA 4NTAA 3F46A 3JYYA 1C02A 3ZWIA 2KSAA 4A4MA 3A9CA 1ZYRF 3VM6A 4B6IA 1AUEA 4XT3A 2EINC 3HANA 4U5EE 3GANA 3S8GB 3LEOA 2D5RB 2ZPAA 3DJNB 1NU7D 1CGNA 3TQOA 3AG4C 4X32A 4NCQA 3RYLA 2ZXPA 3COCA 4IGGA 2IXOA 3GWNA 3CSKA 2PNOA 1O5HA 4IAQA 2OG2A 2ZXWC 1HE1A 2KYHA 1BRDA 1C8RA 1Q0KA 3EFOB 1FMVA 4AMIA 1HE9A 4E7ZA 3DE8A 5T3TA 3OE0A 1YDIA 3EH5B 4NTBA 1UG7A 3SNHA 3EPVA 1WASA 4O6YA 2XL6A 3LLIA 5G53A 2VC9A 5L0CA 3V5XA 5FZTA 3TK0A 4XLPF 3QJUB 1RMVA 3T4RA 4K7BA 4EBKA 4EIYA 5AZDA 4KNFA 4BJ5A 5JLIA 4D4XA 4JTCB 4LDLA 4R32A 3DAGA 5B0WA 4DKLA 4ULVA 5A6BA 3JYHA 2CNWA 4QI2A 3QJTB 2YEVA 5TJ5E 3S28A 5BQIA 2WVOA 5AHZA 2J45A 3EGXA 5T3WA 1TN5A 1TFKB 2YCYA 4PXKA 1NZEA 5JJEA 4UDVA 2CW0F 5COFA 1IXFA 1VYKA 3RVZA 3SYNA 1TN0A 3BVDB 4BV0A 4EWCA 1E86A 1WOLA 2NG1A 2Y3GA 2YCZA 4MVRA 5ETZA 3U0CA 3EGDA 2F95A 1MMGA 4D4NA 1C8SA 3UMHA 5G2DA 1Z63A 2OOCA 2L6FA 1LI7A 2G3KA 1E85A 3B29A 4RD9A 3QBKA 4A2NB 4M63A 5DHGA 4QIDA 2L81A 1VMAA 1RKEA 4PJLA 3UMKA 4MS2A 3VAYA 2Q9CA 2RD9A 4CSAC 1QKRA 1JR8A 2XXAB 4Q7CA 1LPEA 3LJBA 2WJKA 4I1MA 4PJMA 2M4EA 1JPJA 3Q6NA 3QW0A 4I44A 3K33A 1RJ9A 5H2IA 3ATPA 1KG8A 1KGBA 3UTXA 4PJNA 3CAPA 1TKNA 5BR2A 1XWJA 2PEDA 5H2PA 4GP4B 3RIPA 1OKKA 1VOMA 1JGJA 1BM1A 1ORSC 2NPUA 3E70C 3TJ5A 3EMLA 3C8GB 1QLEC 1S05A 1WGWA 1ZHXA 5ITCA 1YYJA 5JVEA 3ZTMA 3NSBA 4NTFA 3O10A 3N0TA 1RXQA 3QBIA 2LIGA 2QPEB 2OEXA 5DS4A 1H9TA 3LEVA 2HJ3A 2A6EF 1S7ZA 2W4MA 1W2WA 1P8IA 2WZFA 1CGOA 2YCXA 4E0IA 4EHPA 3US6A 5JP7A 4U5DE 4ZLDA 2CGEA 1I4ZA 3HTKC 4E0HA 3AYNA 2HJMA 3OAXA 4FPDA 4DXWA 2EPNA 4MBSA 2AWCA 2EIMC 2R03A 4A4AA 2A0UA 1J8MF 4ER9A 2R4SA 4MW8A 2NUTB 2XS8A 3OA1A 3OE6A 2J7PA 4JCHA 1H9GA 2J0XA 3EJNA 5C1MA 256BA 2MWQA 4WW3A 2QTVA 5JUAA 4XWJA 3IQCA 2YLIA 2B0JA 3ABMC 4C7OB 4JTAB 3QMKA 2IYLD 1S54A 4TL3A 2EIKC 1OXBA 2PX3A 4AL0A 3S27A 1M0MA 1ST6A 3KMIA 1EKYA 1M0KA 4KNWA 1C17M 5H2KA 5LWEA 1M2VB 1YARO 1G4US 4JEAA 3OE9A 4G7ZF 1U89A 4MTOA 1PXRA 2L6GA 3B71A 1PD1A 1OR2A 2FFHA 1BRRA 3ASNC 2PF4E 3AG3C 3ECSA 1JMWA 2KJGA 3RQGA 3HAPA 3SZRA 4U5FE 2NUPA 5JS5A 3HNJA 1LE2A 3JSEO 2ZFEA 4DVYP 3HKKA 3B0UX 2TMVP 4HYJA 4BJTA 3FDQA 2MYSA 3RW0A 4OV0A 4CJGA 4EBJA 2LCHA 3X3CA 2OQMA 5L0DA 4N4YB 5T1DB 3ABKC 1VGOA 1Z6AA 4LLEA 4AL1A 3UGOA 3WAQA 4CSAA 2XXAA 4G71B 4XTKA 1ORYA 1OW6A 5B35A 1SMYF 5DS5A 5KYNA 4JEBA 4MQSA 1UAZA 2XM0A 4DJ9A 1ZW2A 1S53A 1HMOA 5A8EA 2VT4A 2P0NA 2J9VA 5L0JA 4J7TA 2YLDA 1ZU4A 3GEIA 3DXJF 2WB7A 3EH4B 5KYWB 4QI0A 4CBEA 4C3DA 2VCCA 4P6IC 3NKEA 3ODUA 3U8PA 2FGYA 3C8GA 1YZCA 1D0YA 3E9VA 5TGZA 4W8PA 3H2UA 4DS7E 4DBRA 1YA9A 1K40A 2EPLX 2IXPA 1M56C 4OD5A 2HV6A 4OIPF 4RDAA 2R4RA 1XMEB 2R7WA 5H2OA 2R7QA 3DZAA 3HNKA 3AYMA 1G8XA 1GM5A 3B0PA 1JOGA 3UTVA 2I15A 4PACA 4JR8A 1ZU5A 3UGPA 2ASRA 3KL4A 4BG0A 1TWGA 1JV7A 1OW7A 4G70B 4MTGA 1NG1A 2X72A 3VYWA 3C9LA 3AG1C 4QDLA 4IRUA 1FBKA 2HPYA 3QTHA 4H4KC 2KC3A 1YZAA 4BEJA 3ZQVA 5KYXB 1T6IA 2YQYA 4CJOA 1L0MA 4X0RA 3T6GB 3PXOA 4MVMA 3VI0A 2BE5F 3DKAA 1LIHA 2WL8A 4XEVA 2YWAA 3C62A 2HMZA 3IEEA 3GEEA 2HZ8A 1XJIA 1OCOC 4X1HA 4G7QB 2VCAA 4YT2A 2YDVA 2PX0A 1OCCC 5H2HA 5A6AA 5KYUA 4BPMA 1D0ZA 4N4WA 2HFIA 1KNYA 5L3VA 4EBBA 3TD7A 2HMQA 1Q0MA 3K1IC 4BJ6C 5B6WA 5BQHA 4JKVA 2VB6A 5B6YA 3TJ6A 3K66A 1GGQA 5JJJA 2Q00A 2EIJC 1KTMA 1Q0DA 5AX1A 4YJWA 1SR2A 1I4YA 2OJQA 2Y04A 1I5NA 1Z23A 3LLKA 2ZZLA 2WZLA 2ZXOA 3VG9A 3AG2C 3NYAA 2XLMA 3HNLA 2A1DD 1MMAA 4L6RA 1V4AA 3DM9B 1APCA 1TFOB 4EKWA 3A11A 2C03A 3EG9B 2R9RB 3FMSA 1DOVA 2KK1A 4AE4B 3RF3A 4IARA 4YL0A 3W4YA 4PXFA 3SEOA 3PHF2 1SZIA 1VLTA 2BC5A 2DYSC 3FVYA 3NYMA 1T5OA 4DBQA 2ETSA 5K0IA 5L0FA 1KG9A 3R2PA 1QHJA 3IQ6A 5G2AA 3S90A 4NY3A 2R05A 4JZAA 4CS8C 3S84A 5JT4A 2VASA 3MYFA 1EQ1A 2MHRA 4FAPB 2A6HF 5DS6A 3ASOC 3UR3C 4FWVA 3ABLC 4P9TA 3U2MA 1E2XA 2LFDA 3AQCA 3QZCA 4NC3A 3ZPRA 5BQGA 4XPYA 3QJRB 5B1AC 1A7VA 4L35A 4HFFB 4MQ9F 3KJ6A 1QVXA 2Q4FA 3O6XA 4LDQA 4JW1A 2YL1A 3ZG1A 5KYWA 1D0XA 1V55C 2HKVA 3FAPB 2YL0A 3BRJA 1BZ4A 2NTUA 2HS5A 3S0XA 1WN0A 3T6JA 1IZMA 2DB4A 4XEKA 3TOLA 2CNWD 4C3EA 4CIPA 2EILC 3PWHA 5DHHA 2UUIA 3KYIA 2Y00A 4J4QA 2QNLA 2BRDA 2IM8A 1D1AA 4HE8D 2OU6A 5D92A 5KYYB 5JSLA 5BR5A 3CZ6A 2LSEA 3O55A 1UFBA 3A7KA 5AX0A 5COGA 1BDJB 1QKOA 3KYJA 1FAPB 1LN6A 2XLWA 4XQ1A 4G78A 2LD6A 1P8UA 4LDEA 4E17A 3X2QC 3L0IA 3JTLO 5B3IA 3GWLA 3KH2A 4DRHB 2HSBA 4N06A 4EUKB 2Y03A 4JE9A 2X51A 1E12A 5KYXA 3DD7A 4MD2A 3AM6A 2OCCC 2AP3A 3LESA 4DOZA 1GUEA 2J9UA 2NTWA 1BBHA 4LACB 4YT4A 2P1AA 4G7SB 1AEPA 2ICWG 3UNGC 3MBGA 4IB4A 4LDRA 2F22A 2GWWA 1MNDA 5B1BC 3V2YA 3FOOA 3C18A 4OINF 3LNRA 4O7GA
chains in the Genus database with same CATH topology
1VGOA 5ITEA 4XXJA 4UHRA 4U9DA 4BUOA 2XL8A 1MGYA 3DDLA 1IW6A 3C63A 1PXSA 3PQRA 3QJQB 4G71B 1R84A 1QPUA 5AWZA 5B35A 4FA7B 2ZIYA 3ZTZA 2RH1A 2XLEA 1Q5IA 4JEBA 2XM4A 4MQSA 1UAZA 2XM0A 1S53A 5A8EA 3ZWIA 1H68A 2VT4A 2KSAA 4A4MA 2KSBA 1JAFA 4XT3A 1F88A 3QAKA 2YLDA 4G7RB 3HANA 2QLAA 2J4YA 3S8GB 3QVZA 1M0LA 1IW9A 3QAPA 1CGNA 4X32A 3EH4B 3COCA 3ZQYA 1MQVA 5FJGA 1CPQA 3M79A 4IAQA 5H2JA 3ODUA 3U8PA 1UCQA 1BRDA 1C8RA 1YZCA 1PY6A 3S3DB 4HWLA 1RCPA 5TGZA 3UZCA 2G87A 3PDSA 4AMIA 3P0GA 3DE8A 3VVKA 3M15A 3QW1A 4DS7E 3OE0A 1EHKB 3EH5B 5JJNA 5G28A 1QM8A 2R4RA 2XL6A 1XMEB 5G53A 3HNIA 2F93A 2Z73A 5B2NA 5H2OA 5EN0A 3QJUB 3HNKA 3AYMA 1R2NA 3UONA 2I1XA 3SN6R 3UTVA 5JRAA 4LDOA 4JR8A 4EIYA 5AZDA 2XLHA 1C3WA 5G54A 4KNFA 3NS0A 4CDYA 3NY8A 2QPDB 1JV7A 5JLIA 1NBBA 1JFPA 4G70B 4WGZA 4D4XA 4XT1A 2X72A 3UZAA 4LDLA 5H2MA 1YYXA 3L1MA 3C9LA 5B0WA 4DKLA 1L9HA 4ULVA 3NY9A 3QJTB 1FBKA 4FBZA 2HPYA 2YL3A 4FAAB 2XLOA 5AHZA 1YZAA 1TN5A 5F8UA 2YCYA 4PXKA 3ZQVA 5JJEA 4N6HA 1H2SA 4CJOA 1IXFA 1L0MA 5H2LA 1TN0A 3BVDB 5B6ZA 3PXOA 4BV0A 3S8FB 3VI0A 1E86A 1AP9A 2YCZA 3TOMA 3QJSB 3C62A 5ETZA 2F95A 4D4NA 1C8SA 1XJIA 4X1HA 4GBRA 5G2DA 3D4SA 4G7QB 3IQ5A 3OE8A 1E85A 2J9BA 2YDVA 3QBKA 5H2HA 4AMJA 5DHGA 4QIDA 4GYCA 4MD1A 2YLGA 3RFMA 4N4WA 1S8LA 5DYSA 1QQ3A 5B6WA 4GP5B 5G36A 4JKVA 1E84A 5B6YA 1E83A 3MBVA 2WJKA 1S8JA 5JJJA 1O0AA 4BEZA 1S51A 2WJLA 4GPOA 4JQ6A 3QW0A 3HAOA 4QI1A 3S3CB 1HZXA 3DQBA 4QRYA 5AX1A 5H2IA 1KG8A 2LNLA 2JAGA 1KGBA 3UTXA 2Y04A 1X0I1 5B6XA 3FOPA 3CAPA 4K5YA 5BR2A 2YKZA 2ZZLA 3HAQA 3VG9A 3HARA 3NYAA 2XLMA 3HNLA 2PEDA 2Z55A 5H2PA 4GP4B 4L6RA 1APCA 2XLDA 1JGJA 2I21A 1BM1A 4XTNA 2L6XA 3NMKA 4DJHA 3EMLA 3DE9A 1S05A 3VHZA 3S3BB 4IARA 3C9MA 5ITCA 1YYJA 4PXFA 2Y01A 5JVEA 3EH3B 2XLVA 2BC5A 3ZTMA 3NSBA 5J7AA 4CX9A 2YCWA 1KG9A 3QBIA 1LM3B 1QHJA 2QPEB 4EA3A 3IQ6A 5G2CA 1FBBA 5G2AA 5B34A 5JT4A 1M6TA 1X0K1 2YDOA 1F4ZA 3UG9A 3PBLA 3ZPQA 1XIOA 1P8IA 2YL7A 1CGOA 2YCXA 1F50A 4MQTA 1X0SA 4WGYA 5JP7A 4NC3A 3NMJA 2Y02A 3ZPRA 5A45A 3QJRB 4L35A 1A7VA 2EI4A 3AYNA 3UTYA 3KJ6A 1S52A 3CODA 2YL1A 3OAXA 3QBLA 3QJVB 3QDCA 4FPDA 3WQJA 1KMEA 4MBSA 1P8HA 3QBGA 2YL0A 1CPRA 2KSYA 5AGFA 2NTUA 4XTLA 5AHYA 4CDAA 1U19A 4CDVA 4ER9A 5H2NA 2R4SA 3ABWA 1CWQA 3OE6A 1QKPA 3X3BA 3TOLA 1Q5JA 4U9EA 4CIPA 3VW7A 5DHHA 3PWHA 5C1MA 4BEYA 256BA 1JV6A 4EJ4A 2Y00A 4J4QA 2BRDA 4WW3A 3RZEA 3NMIA 1GZMA 5JUAA 3REYA 2YLIA 3VGAA 1GQAA 5JSLA 5BR5A 2KS9A 1GU8A 1S54A 3A7KA 5AX0A 1QKOA 4G72B 4TL3A 4GRVA 2I20A 1LN6A 2XLWA 1M0MA 2J8WA 4HYXA 1VJMA 3HASA 2CCYA 3ZEVA 1EKYA 1M0KA 5H2KA 2JAFA 5LWEA 1P8UA 4LDEA 4JEAA 2AT9A 3V2WA 3OE9A 5KKHA 1E0PA 5B3IA 1PXRA 4DAJA 1DZEA 3UTWA 3T45A 2Y03A 4JE9A 4GP8B 1BRRA 1E12A 4XTOA 2M3GA 4Y9HA 3HAPA 4BWBA 4MD2A 3AM6A 3M4CA 5JS5A 3HNJA 1GUEA 3QVYA 2NTWA 4X31A 1BBHA 2ZFEA 2I35A 5A44A 4KLYA 4G7SB 4HYJA 4WAVA 4OV0A 4IB4A 4CJGA 1BRXA 4BVNA 3X3CA 5B6VA 3V2YA 4UG2A 4N4YB 3FOOA 1AT9A 3M4BA 3VRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VGO A;  5ITE A;  4XXJ A;  4UHR A;  4U9D A;  4BUO A;  2XL8 A;  1MGY A;  3DDL A;  1IW6 A;  3C63 A;  1PXS A;  3PQR A;  3QJQ B;  4G71 B;  1R84 A;  1QPU A;  5AWZ A;  5B35 A;  4FA7 B;  2ZIY A;  3ZTZ A;  2RH1 A;  2XLE A;  1Q5I A;  4JEB A;  2XM4 A;  4MQS A;  1UAZ A;  2XM0 A;  1S53 A;  5A8E A;  3ZWI A;  1H68 A;  2VT4 A;  2KSA A;  4A4M A;  2KSB A;  1JAF A;  4XT3 A;  1F88 A;  3QAK A;  2YLD A;  4G7R B;  3HAN A;  2QLA A;  2J4Y A;  3S8G B;  3QVZ A;  1M0L A;  1IW9 A;  3QAP A;  1CGN A;  4X32 A;  3EH4 B;  3COC A;  3ZQY A;  1MQV A;  5FJG A;  1CPQ A;  3M79 A;  4IAQ A;  5H2J A;  3ODU A;  3U8P A;  1UCQ A;  1BRD A;  1C8R A;  1YZC A;  1PY6 A;  3S3D B;  4HWL A;  1RCP A;  5TGZ A;  3UZC A;  2G87 A;  3PDS A;  4AMI A;  3P0G A;  3DE8 A;  3VVK A;  3M15 A;  3QW1 A;  3OE0 A;  1EHK B;  3EH5 B;  5JJN A;  5G28 A;  1QM8 A;  2R4R A;  2XL6 A;  1XME B;  5G53 A;  3HNI A;  2F93 A;  2Z73 A;  5B2N A;  5H2O A;  5EN0 A;  3QJU B;  3HNK A;  3AYM A;  1R2N A;  3UON A;  2I1X A;  3SN6 R;  3UTV A;  5JRA A;  4LDO A;  4JR8 A;  4EIY A;  5AZD A;  2XLH A;  1C3W A;  5G54 A;  4KNF A;  3NS0 A;  4CDY A;  3NY8 A;  2QPD B;  1JV7 A;  5JLI A;  1NBB A;  1JFP A;  4G70 B;  4WGZ A;  4D4X A;  4XT1 A;  2X72 A;  3UZA A;  4LDL A;  5H2M A;  1YYX A;  3L1M A;  3C9L A;  5B0W A;  4DKL A;  1L9H A;  4ULV A;  3NY9 A;  3QJT B;  1FBK A;  4FBZ A;  2HPY A;  2YL3 A;  4FAA B;  2XLO A;  5AHZ A;  1YZA A;  1TN5 A;  5F8U A;  2YCY A;  4PXK A;  3ZQV A;  5JJE A;  4N6H A;  1H2S A;  4CJO A;  1IXF A;  1L0M A;  5H2L A;  1TN0 A;  3BVD B;  5B6Z A;  3PXO A;  4BV0 A;  3S8F B;  3VI0 A;  1E86 A;  1AP9 A;  2YCZ A;  3TOM A;  3QJS B;  3C62 A;  5ETZ A;  2F95 A;  4D4N A;  1C8S A;  1XJI A;  4X1H A;  4GBR A;  5G2D A;  3D4S A;  4G7Q B;  3IQ5 A;  3OE8 A;  1E85 A;  2J9B A;  2YDV A;  3QBK A;  5H2H A;  4AMJ A;  5DHG A;  4QID A;  4GYC A;  4MD1 A;  2YLG A;  3RFM A;  4N4W A;  1S8L A;  5DYS A;  1QQ3 A;  5B6W A;  4GP5 B;  5G36 A;  4JKV A;  1E84 A;  5B6Y A;  1E83 A;  3MBV A;  2WJK A;  1S8J A;  5JJJ A;  1O0A A;  4BEZ A;  1S51 A;  2WJL A;  4GPO A;  4JQ6 A;  3QW0 A;  3HAO A;  4QI1 A;  3S3C B;  1HZX A;  3DQB A;  4QRY A;  5AX1 A;  5H2I A;  1KG8 A;  2LNL A;  2JAG A;  1KGB A;  3UTX A;  2Y04 A;  1X0I 1;  5B6X A;  3FOP A;  3CAP A;  4K5Y A;  5BR2 A;  2YKZ A;  2ZZL A;  3HAQ A;  3VG9 A;  3HAR A;  3NYA A;  2XLM A;  3HNL A;  2PED A;  2Z55 A;  5H2P A;  4GP4 B;  4L6R A;  1APC A;  2XLD A;  1JGJ A;  2I21 A;  1BM1 A;  4XTN A;  2L6X A;  3NMK A;  4DJH A;  3EML A;  3DE9 A;  1S05 A;  3VHZ A;  3S3B B;  4IAR A;  3C9M A;  5ITC A;  1YYJ A;  4PXF A;  2Y01 A;  5JVE A;  3EH3 B;  2XLV A;  2BC5 A;  3ZTM A;  3NSB A;  5J7A A;  4CX9 A;  2YCW A;  1KG9 A;  3QBI A;  1LM3 B;  1QHJ A;  2QPE B;  4EA3 A;  3IQ6 A;  5G2C A;  1FBB A;  5G2A A;  5B34 A;  5JT4 A;  1M6T A;  1X0K 1;  2YDO A;  1F4Z A;  3UG9 A;  3PBL A;  3ZPQ A;  1XIO A;  1P8I A;  2YL7 A;  1CGO A;  2YCX A;  1F50 A;  4MQT A;  1X0S A;  4WGY A;  5JP7 A;  4NC3 A;  3NMJ A;  2Y02 A;  3ZPR A;  5A45 A;  3QJR B;  4L35 A;  1A7V A;  2EI4 A;  3AYN A;  3UTY A;  3KJ6 A;  1S52 A;  3COD A;  2YL1 A;  3OAX A;  3QBL A;  3QJV B;  3QDC A;  4FPD A;  3WQJ A;  1KME A;  4MBS A;  1P8H A;  3QBG A;  2YL0 A;  1CPR A;  2KSY A;  5AGF A;  2NTU A;  4XTL A;  5AHY A;  4CDA A;  1U19 A;  4CDV A;  4ER9 A;  5H2N A;  2R4S A;  3ABW A;  1CWQ A;  3OE6 A;  1QKP A;  3X3B A;  3TOL A;  1Q5J A;  4U9E A;  4CIP A;  3VW7 A;  5DHH A;  3PWH A;  5C1M A;  4BEY A;  256B A;  1JV6 A;  4EJ4 A;  2Y00 A;  4J4Q A;  2BRD A;  4WW3 A;  3RZE A;  3NMI A;  1GZM A;  5JUA A;  3REY A;  2YLI A;  3VGA A;  1GQA A;  5JSL A;  5BR5 A;  2KS9 A;  1GU8 A;  1S54 A;  3A7K A;  5AX0 A;  1QKO A;  4G72 B;  4TL3 A;  4GRV A;  2I20 A;  1LN6 A;  2XLW A;  1M0M A;  2J8W A;  4HYX A;  1VJM A;  3HAS A;  2CCY A;  3ZEV A;  1EKY A;  1M0K A;  5H2K A;  2JAF A;  5LWE A;  1P8U A;  4LDE A;  4JEA A;  2AT9 A;  3V2W A;  3OE9 A;  5KKH A;  1E0P A;  5B3I A;  1PXR A;  4DAJ A;  1DZE A;  3UTW A;  3T45 A;  2Y03 A;  4JE9 A;  4GP8 B;  1BRR A;  1E12 A;  4XTO A;  2M3G A;  4Y9H A;  3HAP A;  4BWB A;  4MD2 A;  3AM6 A;  3M4C A;  5JS5 A;  3HNJ A;  1GUE A;  3QVY A;  2NTW A;  4X31 A;  1BBH A;  2ZFE A;  2I35 A;  5A44 A;  4KLY A;  4G7S B;  4HYJ A;  4WAV A;  4OV0 A;  4IB4 A;  4CJG A;  1BRX A;  4BVN A;  3X3C A;  5B6V A;  3V2Y A;  4UG2 A;  4N4Y B;  3FOO A;  1AT9 A;  3M4B A;  3VRC A; 
#chains in the Genus database with same CATH topology
 1LVK A;  1VK5 A;  4BUO A;  5L0H A;  1CGM E;  2R02 A;  5DVW A;  4JTD B;  3MLG A;  2A0B A;  2H7V C;  4MTF A;  1PXS A;  3J06 A;  2G3V A;  1OKK D;  4BJ6 A;  4PFP A;  3K1I A;  1QPU A;  2YVK A;  3G50 A;  3CQZ A;  2XM4 A;  4GEH A;  4Q5S F;  1WWP A;  1FFT C;  3EFO A;  1T6U A;  4DVZ A;  1FR0 A;  2R7T A;  2GFH A;  4G0H A;  1MNE A;  1G5Z A;  3B9Q A;  4DRJ B;  4JRZ A;  2QLA A;  1FFH A;  3NRH A;  5A69 A;  4YL1 A;  4XEF A;  3ZQY A;  2AWY A;  3DAF A;  5F5F A;  1HMD A;  3EG9 A;  5H2J A;  2EPK X;  1UCQ A;  4LLC A;  1PY6 A;  3UZC A;  2G87 A;  4YT5 A;  3PDS A;  1KU2 A;  5E3A A;  3EZI A;  5A6K A;  3M15 A;  3QW1 A;  4N6C A;  1EHK B;  2A68 F;  4LER A;  4GQH A;  5G28 A;  1QM8 A;  3K6B A;  1ZHW A;  3BEH A;  4G7H F;  3WOD F;  2F93 A;  2H8A A;  5B2N A;  2W4B A;  5EN0 A;  4CS8 A;  4ULW A;  1NFN A;  3LAY A;  2E87 A;  2XLH A;  2G62 A;  3NDB B;  5G54 A;  3NS0 A;  3NY8 A;  2IXN A;  1NBB A;  1JFP A;  4WGZ A;  5H2M A;  3L1M A;  4O6M A;  2L9J A;  3ZVR A;  4FBZ A;  2VH3 A;  4U5H A;  4FAA B;  2YL3 A;  1QZX A;  3ZDL A;  1G4W R;  5F8U A;  5F28 E;  4N6H A;  1H2S A;  4E7S A;  1Z7Q c;  5B6Z A;  3JRM O;  4OD4 A;  3HLZ A;  4YK5 A;  3Q7L A;  1AVO B;  1VLS A;  3TOM A;  3TUL A;  3QJS B;  4KI2 A;  3WG7 C;  3DM5 A;  1YAU O;  2O9X A;  3RQE A;  2CYD A;  1T9K A;  3U2L A;  1BR1 A;  3D4S A;  4MVQ A;  5F5H A;  3FXH A;  2OKU A;  3EGX B;  1Z5Z A;  3RQF A;  5KYY A;  4JC7 A;  4GYC A;  4MW3 A;  4MD1 A;  3DMD A;  1S8L A;  5DYS A;  1QQ3 A;  1YJG A;  4GP5 B;  3G4X A;  5COM A;  1E84 A;  3SXZ A;  1MMN A;  5EK0 A;  2QUP A;  3EGD B;  1O0A A;  1M57 C;  4LDK A;  2R7U A;  3KKB A;  3X1O A;  3HAO A;  4QRY A;  4FES A;  2KGO A;  5IY5 C;  4CS9 C;  2P6V A;  4W8K A;  1RKE B;  1D1B A;  3W8I A;  1X0I 1;  5E3C A;  3RFY A;  3RKO F;  1B68 A;  3HAQ A;  4XLN F;  1R4T A;  2DGJ A;  3LUT B;  4O6N A;  2I21 A;  4U5C E;  4JCZ A;  2L6X A;  4YT8 A;  4DJH A;  4WJ0 A;  3VHZ A;  3B0V C;  1WAT A;  1RJ9 B;  3S3B B;  3C9M A;  2AU5 A;  4U5B E;  3DI5 A;  2XLV A;  3ITF A;  2Y3B A;  4CX9 A;  1WTY A;  2KQ9 A;  2YCW A;  1ZHZ A;  2GDC A;  3IQT A;  3NYJ A;  4EA3 A;  2HV7 A;  4E18 A;  1FBB A;  3JT1 A;  4PFO A;  4BJ1 A;  5B34 A;  2R7O A;  3PCV A;  2I8B A;  3Q7G A;  4MVO A;  1X0K 1;  2YDO A;  4JVS A;  3PBL A;  2YL7 A;  4MQT A;  1X0S A;  4WGY A;  2JX0 A;  1T01 A;  3LS1 A;  2NUT A;  2LK4 A;  3NMJ A;  3OWT A;  2R7S A;  3UTY A;  3ZIB A;  3COD A;  3QBL A;  1YLM A;  3WQJ A;  1KME A;  3JZ0 A;  4C7O A;  2LFF A;  1P8H A;  3QBG A;  1TWA A;  1DOW A;  1FNT c;  2KSY A;  2XL4 A;  4XTL A;  4CDA A;  1U19 A;  4CDV A;  5H2N A;  3EQL F;  1CWQ A;  2R7X A;  1TQG A;  1Q5J A;  4NQF A;  1M2V A;  3VW7 A;  1NFO A;  1JV6 A;  1BR4 A;  2XSE A;  3S29 A;  2XS1 A;  2OJE D;  1H7I A;  1GZM A;  1LS4 A;  4I3M A;  5B3S C;  4G7O F;  2Q3T A;  1TWC A;  2QY9 A;  2CDQ A;  3V7O A;  2VCB A;  4WAB A;  4HYX A;  4XPX A;  1VJM A;  3K7D A;  3HAS A;  3AQB A;  3ZEV A;  5DQT A;  5L0I A;  3U9J A;  1OQC A;  4OIR F;  2JAF A;  2C04 A;  2YRF A;  3F47 A;  1PCX A;  4CIH A;  2J46 A;  2XRH A;  2L7A A;  3LNM B;  4XPW A;  4O79 A;  4IWB A;  3H65 A;  3GM1 A;  3UTW A;  2GA0 A;  4GP8 B;  3HJC A;  2L6H A;  1L3P A;  2M3G A;  5EGY A;  4H54 A;  4BWB A;  1TR2 A;  3M4C A;  3T6B A;  4X31 A;  4OIQ F;  3U9M A;  4GYT A;  5A44 A;  1ZHT A;  4J30 B;  4YWQ A;  5AC4 A;  1OW8 A;  3S9O A;  1D1C A;  1L7C A;  2GAQ A;  2WVN A;  5B6V A;  4FX5 A;  4IAO A;  3M4B A;  4JUR I;  4XXJ A;  4UHR A;  1MGY A;  3DDL A;  2W45 A;  3C63 A;  2NUP B;  3QJQ B;  3EHN A;  5AWZ A;  4FA7 B;  2ZIY A;  3ZTZ A;  2RH1 A;  1V54 C;  3MFN A;  2PFD A;  1HW2 A;  1LI5 A;  1H68 A;  4Z9I A;  4Z9J A;  2KSB A;  4PR9 A;  2J0W A;  1JAF A;  3R7C A;  1F88 A;  3QAK A;  4MVZ A;  5A6J A;  3EZH A;  4JIO A;  4U5G A;  3FHD A;  4G7R B;  1A0B A;  4DRI B;  4CS9 A;  2J4Y A;  5A6B D;  1LE4 A;  3QVZ A;  1M0L A;  1IW9 A;  3QAP A;  2OEV A;  1RKC A;  3JRT A;  1FTS A;  1MQV A;  2Y39 A;  1IW7 F;  5FJG A;  2M64 A;  1CPQ A;  3M79 A;  3I5Q A;  1ORJ A;  2X0C A;  2ZXR A;  1Q0G A;  1OCZ C;  3S3D B;  2RSE B;  4HWL A;  1RCP A;  1LKX A;  1QSP A;  3P0G A;  2QE9 A;  4PJJ A;  3VVK A;  3OEO A;  5JJN A;  2LP4 A;  1HY5 A;  2R25 A;  3HNI A;  2Z73 A;  1ZW3 A;  2Y3D A;  5AC5 A;  2HSQ A;  5DQZ A;  5L0G A;  1R2N A;  5BUO A;  3UON A;  2I1X A;  3UMI A;  3SN6 R;  5JRA A;  4LDO A;  3PDM P;  4MVU A;  1C3W A;  3L8I A;  4CDY A;  2QPD B;  1YA7 O;  1VYI A;  5HV9 A;  4XT1 A;  3UZA A;  1YYX A;  1L9H A;  4KBL A;  3NY9 A;  5DLJ A;  3U3F A;  2XLO A;  2WZG A;  3W2V A;  4ONS A;  5H2L A;  2EPM X;  3S8F B;  1J8Y F;  3AGU A;  1AP9 A;  4KC9 A;  3L8J A;  1R5I D;  3M1C B;  3AJM A;  3DWW A;  3GEH A;  3C8Z A;  2IXM A;  5CI8 A;  1LS1 A;  4GBR A;  1OXK A;  3IQ5 A;  3OE8 A;  2NSF A;  1NSG B;  2R7R A;  2J9B A;  2P61 A;  4JJG A;  4AMJ A;  1JPN A;  2KNH A;  4RBN A;  2P7V A;  2YLG A;  3RFM A;  4OIO F;  4Q4Z F;  3ZSU A;  5G36 A;  1EI7 A;  1E83 A;  1A7D A;  4AK9 A;  1T6Q A;  3MBV A;  5E33 A;  3MX3 A;  3GM2 A;  1S8J A;  1YVI A;  4ANJ A;  4BEZ A;  3I5P A;  4AX2 A;  1S51 A;  3U3B A;  2WJL A;  1U6H A;  2H7B A;  4GPO A;  4JQ6 A;  2HUJ A;  1V74 B;  2EPO A;  4QI1 A;  2J9W A;  4AE4 A;  3S3C B;  1HZX A;  5L3Q A;  3DQB A;  5CIV A;  1BR2 A;  3W2W A;  2LNL A;  5KYU B;  2JAG A;  1TWH A;  3SXK A;  4HEA J;  5B6X A;  3W8H A;  2Y69 C;  3FOP A;  3V5Z A;  4K5Y A;  2NSG A;  2YKZ A;  3GM3 A;  4YL3 A;  3HAR A;  1FMW A;  2Z55 A;  5D91 A;  1Y4C A;  2XLD A;  4XTN A;  3N2Z B;  3VF0 A;  3NMK A;  2Q9A A;  3DE9 A;  3AGT A;  3SXM A;  3ZC4 A;  2J7P D;  4J7Y A;  2Y01 A;  3EH3 B;  1HW1 A;  5J7A A;  2LQG A;  1OCR C;  1ZHY A;  3G4Z A;  1SYQ A;  1GS9 A;  1LM3 B;  3EH1 A;  2R7V A;  3RH3 A;  2PP4 A;  2FAP B;  3IHU A;  5G2C A;  1XZQ A;  1MMD A;  1M6T A;  3U5S A;  1N1C A;  1F4Z A;  3UG9 A;  3ZPQ A;  1XIO A;  3T9O A;  2IOQ A;  1F50 A;  3O39 A;  3SXY A;  4BJ5 C;  1K04 A;  1O3U A;  3K1H A;  1K05 A;  1H6G A;  2D4U A;  4K0D A;  2ZD9 A;  3KPH A;  3NG1 A;  2Y02 A;  5A45 A;  3L34 A;  2EI4 A;  2Y3H A;  1S52 A;  4MND A;  1JRA A;  4Z9H A;  4J32 B;  3V5Y A;  3QJV B;  3POV A;  3QDC A;  2B0H A;  4MVS A;  1U0B B;  2DYR C;  1CPR A;  1PD0 A;  4C3B A;  2Z15 A;  5AGF A;  1A7E A;  5CI9 A;  5AHY A;  1ZVZ A;  5E2Q A;  3FAJ A;  3CEX A;  3EHM A;  4YN0 B;  3N24 A;  3ABW A;  1QKP A;  3X3B A;  4U9E A;  1Z3I X;  4BEY A;  1OR3 A;  3JCU Q;  4EJ4 A;  2PBE A;  1NU9 C;  3RZE A;  3NMI A;  3C7J A;  5FCL A;  3LS0 A;  3REY A;  3VGA A;  1F1M A;  1GQA A;  2UUH A;  1O87 A;  1XZP A;  2KS9 A;  1GU8 A;  1PV3 A;  4G72 B;  4GRV A;  5GPG B;  2I20 A;  3IPM O;  3PMR A;  2J8W A;  2Q7R A;  5HSW A;  4HFK B;  3RVY A;  2BL2 A;  2CCY A;  3AOU A;  2A69 F;  4F4B A;  3Q6M A;  1SF8 A;  1Q0F A;  2IBF A;  3H2V A;  2V26 A;  2AT9 A;  1C03 A;  4CS7 A;  3V2W A;  3CAX A;  5KKH A;  1E0P A;  3WHN A;  1A41 A;  4DAJ A;  3U8V A;  4I1O B;  1DZE A;  3T45 A;  3NKD A;  3MYI A;  1Y6D A;  4ZLC A;  4XTO A;  1NLX A;  4K1O A;  4P9F A;  2Q9B A;  4Y9H A;  4PK4 A;  4IJJ A;  3QVY A;  1M2O A;  3GOD A;  2DI3 A;  2V3C C;  2I35 A;  1VB5 A;  3EH2 A;  2JD3 A;  3C8G D;  4KLY A;  3DJU B;  2H7O A;  2YHS A;  3JSZ A;  2KW3 C;  4WAV A;  3NYL A;  2AVK A;  1BRX A;  3GOR A;  4BVN A;  1EA8 A;  4UG2 A;  1AT9 A;  3VRC A;  5ITE A;  4JJF A;  4U9D A;  2XL8 A;  1ZZP A;  2WVQ A;  1IW6 A;  3SP1 A;  2KSF A;  1VTM P;  2W9Y A;  4KNV A;  3PQR A;  4BEM J;  1R84 A;  3I4U A;  2YZS A;  2XLE A;  1Q5I A;  5EHH A;  2JPU A;  4NTA A;  3F46 A;  3JYY A;  1C02 A;  3ZWI A;  2KSA A;  4A4M A;  3A9C A;  1ZYR F;  3VM6 A;  4B6I A;  1AUE A;  4XT3 A;  2EIN C;  3HAN A;  4U5E E;  3GAN A;  3S8G B;  3LEO A;  2D5R B;  2ZPA A;  3DJN B;  1NU7 D;  1CGN A;  3TQO A;  3AG4 C;  4X32 A;  4NCQ A;  3RYL A;  2ZXP A;  3COC A;  4IGG A;  2IXO A;  3GWN A;  3CSK A;  2PNO A;  1O5H A;  4IAQ A;  2OG2 A;  2ZXW C;  1HE1 A;  2KYH A;  1BRD A;  1C8R A;  1Q0K A;  3EFO B;  1FMV A;  4AMI A;  1HE9 A;  4E7Z A;  3DE8 A;  5T3T A;  3OE0 A;  1YDI A;  3EH5 B;  4NTB A;  1UG7 A;  3SNH A;  3EPV A;  1WAS A;  4O6Y A;  2XL6 A;  3LLI A;  5G53 A;  2VC9 A;  5L0C A;  3V5X A;  5FZT A;  3TK0 A;  4XLP F;  3QJU B;  1RMV A;  3T4R A;  4K7B A;  4EBK A;  4EIY A;  5AZD A;  4KNF A;  4BJ5 A;  5JLI A;  4D4X A;  4JTC B;  4LDL A;  4R32 A;  3DAG A;  5B0W A;  4DKL A;  4ULV A;  5A6B A;  3JYH A;  2CNW A;  4QI2 A;  3QJT B;  2YEV A;  5TJ5 E;  3S28 A;  5BQI A;  2WVO A;  5AHZ A;  2J45 A;  3EGX A;  5T3W A;  1TN5 A;  1TFK B;  2YCY A;  4PXK A;  1NZE A;  5JJE A;  4UDV A;  2CW0 F;  5COF A;  1IXF A;  1VYK A;  3RVZ A;  3SYN A;  1TN0 A;  3BVD B;  4BV0 A;  4EWC A;  1E86 A;  1WOL A;  2NG1 A;  2Y3G A;  2YCZ A;  4MVR A;  5ETZ A;  3U0C A;  3EGD A;  2F95 A;  1MMG A;  4D4N A;  1C8S A;  3UMH A;  5G2D A;  1Z63 A;  2OOC A;  2L6F A;  1LI7 A;  2G3K A;  1E85 A;  3B29 A;  4RD9 A;  3QBK A;  4A2N B;  4M63 A;  5DHG A;  4QID A;  2L81 A;  1VMA A;  1RKE A;  4PJL A;  3UMK A;  4MS2 A;  3VAY A;  2Q9C A;  2RD9 A;  4CSA C;  1QKR A;  1JR8 A;  2XXA B;  4Q7C A;  1LPE A;  3LJB A;  2WJK A;  4I1M A;  4PJM A;  2M4E A;  1JPJ A;  3Q6N A;  3QW0 A;  4I44 A;  3K33 A;  1RJ9 A;  5H2I A;  3ATP A;  1KG8 A;  1KGB A;  3UTX A;  4PJN A;  3CAP A;  1TKN A;  5BR2 A;  1XWJ A;  2PED A;  5H2P A;  4GP4 B;  3RIP A;  1OKK A;  1VOM A;  1JGJ A;  1BM1 A;  1ORS C;  2NPU A;  3E70 C;  3TJ5 A;  3EML A;  3C8G B;  1QLE C;  1S05 A;  1WGW A;  1ZHX A;  5ITC A;  1YYJ A;  5JVE A;  3ZTM A;  3NSB A;  4NTF A;  3O10 A;  3N0T A;  1RXQ A;  3QBI A;  2LIG A;  2QPE B;  2OEX A;  5DS4 A;  1H9T A;  3LEV A;  2HJ3 A;  2A6E F;  1S7Z A;  2W4M A;  1W2W A;  1P8I A;  2WZF A;  1CGO A;  2YCX A;  4E0I A;  4EHP A;  3US6 A;  5JP7 A;  4U5D E;  4ZLD A;  2CGE A;  1I4Z A;  3HTK C;  4E0H A;  3AYN A;  2HJM A;  3OAX A;  4FPD A;  4DXW A;  2EPN A;  4MBS A;  2AWC A;  2EIM C;  2R03 A;  4A4A A;  2A0U A;  1J8M F;  4ER9 A;  2R4S A;  4MW8 A;  2NUT B;  2XS8 A;  3OA1 A;  3OE6 A;  2J7P A;  4JCH A;  1H9G A;  2J0X A;  3EJN A;  5C1M A;  256B A;  2MWQ A;  4WW3 A;  2QTV A;  5JUA A;  4XWJ A;  3IQC A;  2YLI A;  2B0J A;  3ABM C;  4C7O B;  4JTA B;  3QMK A;  2IYL D;  1S54 A;  4TL3 A;  2EIK C;  1OXB A;  2PX3 A;  4AL0 A;  3S27 A;  1M0M A;  1ST6 A;  3KMI A;  1EKY A;  1M0K A;  4KNW A;  1C17 M;  5H2K A;  5LWE A;  1M2V B;  1YAR O;  1G4U S;  4JEA A;  3OE9 A;  4G7Z F;  1U89 A;  4MTO A;  1PXR A;  2L6G A;  3B71 A;  1PD1 A;  1OR2 A;  2FFH A;  1BRR A;  3ASN C;  2PF4 E;  3AG3 C;  3ECS A;  1JMW A;  2KJG A;  3RQG A;  3HAP A;  3SZR A;  4U5F E;  2NUP A;  5JS5 A;  3HNJ A;  1LE2 A;  3JSE O;  2ZFE A;  4DVY P;  3HKK A;  3B0U X;  2TMV P;  4HYJ A;  4BJT A;  3FDQ A;  2MYS A;  3RW0 A;  4OV0 A;  4CJG A;  4EBJ A;  2LCH A;  3X3C A;  2OQM A;  5L0D A;  4N4Y B;  5T1D B;  3ABK C;  1VGO A;  1Z6A A;  4LLE A;  4AL1 A;  3UGO A;  3WAQ A;  4CSA A;  2XXA A;  4G71 B;  4XTK A;  1ORY A;  1OW6 A;  5B35 A;  1SMY F;  5DS5 A;  5KYN A;  4JEB A;  4MQS A;  1UAZ A;  2XM0 A;  4DJ9 A;  1ZW2 A;  1S53 A;  1HMO A;  5A8E A;  2VT4 A;  2P0N A;  2J9V A;  5L0J A;  4J7T A;  2YLD A;  1ZU4 A;  3GEI A;  3DXJ F;  2WB7 A;  3EH4 B;  5KYW B;  4QI0 A;  4CBE A;  4C3D A;  2VCC A;  4P6I C;  3NKE A;  3ODU A;  3U8P A;  2FGY A;  3C8G A;  1YZC A;  1D0Y A;  3E9V A;  5TGZ A;  4W8P A;  3H2U A;  4DS7 E;  4DBR A;  1YA9 A;  1K40 A;  2EPL X;  2IXP A;  1M56 C;  4OD5 A;  2HV6 A;  4OIP F;  4RDA A;  2R4R A;  1XME B;  2R7W A;  5H2O A;  2R7Q A;  3DZA A;  3HNK A;  3AYM A;  1G8X A;  1GM5 A;  3B0P A;  1JOG A;  3UTV A;  2I15 A;  4PAC A;  4JR8 A;  1ZU5 A;  3UGP A;  2ASR A;  3KL4 A;  4BG0 A;  1TWG A;  1JV7 A;  1OW7 A;  4G70 B;  4MTG A;  1NG1 A;  2X72 A;  3VYW A;  3C9L A;  3AG1 C;  4QDL A;  4IRU A;  1FBK A;  2HPY A;  3QTH A;  4H4K C;  2KC3 A;  1YZA A;  4BEJ A;  3ZQV A;  5KYX B;  1T6I A;  2YQY A;  4CJO A;  1L0M A;  4X0R A;  3T6G B;  3PXO A;  4MVM A;  3VI0 A;  2BE5 F;  3DKA A;  1LIH A;  2WL8 A;  4XEV A;  2YWA A;  3C62 A;  2HMZ A;  3IEE A;  3GEE A;  2HZ8 A;  1XJI A;  1OCO C;  4X1H A;  4G7Q B;  2VCA A;  4YT2 A;  2YDV A;  2PX0 A;  1OCC C;  5H2H A;  5A6A A;  5KYU A;  4BPM A;  1D0Z A;  4N4W A;  2HFI A;  1KNY A;  5L3V A;  4EBB A;  3TD7 A;  2HMQ A;  1Q0M A;  3K1I C;  4BJ6 C;  5B6W A;  5BQH A;  4JKV A;  2VB6 A;  5B6Y A;  3TJ6 A;  3K66 A;  1GGQ A;  5JJJ A;  2Q00 A;  2EIJ C;  1KTM A;  1Q0D A;  5AX1 A;  4YJW A;  1SR2 A;  1I4Y A;  2OJQ A;  2Y04 A;  1I5N A;  1Z23 A;  3LLK A;  2ZZL A;  2WZL A;  2ZXO A;  3VG9 A;  3AG2 C;  3NYA A;  2XLM A;  3HNL A;  2A1D D;  1MMA A;  4L6R A;  1V4A A;  3DM9 B;  1APC A;  1TFO B;  4EKW A;  3A11 A;  2C03 A;  3EG9 B;  2R9R B;  3FMS A;  1DOV A;  2KK1 A;  4AE4 B;  3RF3 A;  4IAR A;  4YL0 A;  3W4Y A;  4PXF A;  3SEO A;  3PHF 2;  1SZI A;  1VLT A;  2BC5 A;  2DYS C;  3FVY A;  3NYM A;  1T5O A;  4DBQ A;  2ETS A;  5K0I A;  5L0F A;  1KG9 A;  3R2P A;  1QHJ A;  3IQ6 A;  5G2A A;  3S90 A;  4NY3 A;  2R05 A;  4JZA A;  4CS8 C;  3S84 A;  5JT4 A;  2VAS A;  3MYF A;  1EQ1 A;  2MHR A;  4FAP B;  2A6H F;  5DS6 A;  3ASO C;  3UR3 C;  4FWV A;  3ABL C;  4P9T A;  3U2M A;  1E2X A;  2LFD A;  3AQC A;  3QZC A;  4NC3 A;  3ZPR A;  5BQG A;  4XPY A;  3QJR B;  5B1A C;  1A7V A;  4L35 A;  4HFF B;  4MQ9 F;  3KJ6 A;  1QVX A;  2Q4F A;  3O6X A;  4LDQ A;  4JW1 A;  2YL1 A;  3ZG1 A;  5KYW A;  1D0X A;  1V55 C;  2HKV A;  3FAP B;  2YL0 A;  3BRJ A;  1BZ4 A;  2NTU A;  2HS5 A;  3S0X A;  1WN0 A;  3T6J A;  1IZM A;  2DB4 A;  4XEK A;  3TOL A;  2CNW D;  4C3E A;  4CIP A;  2EIL C;  3PWH A;  5DHH A;  2UUI A;  3KYI A;  2Y00 A;  4J4Q A;  2QNL A;  2BRD A;  2IM8 A;  1D1A A;  4HE8 D;  2OU6 A;  5D92 A;  5KYY B;  5JSL A;  5BR5 A;  3CZ6 A;  2LSE A;  3O55 A;  1UFB A;  3A7K A;  5AX0 A;  5COG A;  1BDJ B;  1QKO A;  3KYJ A;  1FAP B;  1LN6 A;  2XLW A;  4XQ1 A;  4G78 A;  2LD6 A;  1P8U A;  4LDE A;  4E17 A;  3X2Q C;  3L0I A;  3JTL O;  5B3I A;  3GWL A;  3KH2 A;  4DRH B;  2HSB A;  4N06 A;  4EUK B;  2Y03 A;  4JE9 A;  2X51 A;  1E12 A;  5KYX A;  3DD7 A;  4MD2 A;  3AM6 A;  2OCC C;  2AP3 A;  3LES A;  4DOZ A;  1GUE A;  2J9U A;  2NTW A;  1BBH A;  4LAC B;  4YT4 A;  2P1A A;  4G7S B;  1AEP A;  2ICW G;  3UNG C;  3MBG A;  4IB4 A;  4LDR A;  2F22 A;  2GWW A;  1MND A;  5B1B C;  3V2Y A;  3FOO A;  3C18 A;  4OIN F;  3LNR A;  4O7G A; 
#chains in the Genus database with same CATH homology
 1VGO A;  5ITE A;  4XXJ A;  4UHR A;  4U9D A;  4BUO A;  2XL8 A;  1MGY A;  3DDL A;  1IW6 A;  3C63 A;  1PXS A;  3PQR A;  3QJQ B;  4G71 B;  1R84 A;  1QPU A;  5AWZ A;  5B35 A;  4FA7 B;  2ZIY A;  3ZTZ A;  2RH1 A;  2XLE A;  1Q5I A;  4JEB A;  2XM4 A;  4MQS A;  1UAZ A;  2XM0 A;  1S53 A;  5A8E A;  3ZWI A;  1H68 A;  2VT4 A;  2KSA A;  4A4M A;  2KSB A;  1JAF A;  4XT3 A;  1F88 A;  3QAK A;  2YLD A;  4G7R B;  3HAN A;  2QLA A;  2J4Y A;  3S8G B;  3QVZ A;  1M0L A;  1IW9 A;  3QAP A;  1CGN A;  4X32 A;  3EH4 B;  3COC A;  3ZQY A;  1MQV A;  5FJG A;  1CPQ A;  3M79 A;  4IAQ A;  5H2J A;  3ODU A;  3U8P A;  1UCQ A;  1BRD A;  1C8R A;  1YZC A;  1PY6 A;  3S3D B;  4HWL A;  1RCP A;  5TGZ A;  3UZC A;  2G87 A;  3PDS A;  4AMI A;  3P0G A;  3DE8 A;  3VVK A;  3M15 A;  3QW1 A;  4DS7 E;  3OE0 A;  1EHK B;  3EH5 B;  5JJN A;  5G28 A;  1QM8 A;  2R4R A;  2XL6 A;  1XME B;  5G53 A;  3HNI A;  2F93 A;  2Z73 A;  5B2N A;  5H2O A;  5EN0 A;  3QJU B;  3HNK A;  3AYM A;  1R2N A;  3UON A;  2I1X A;  3SN6 R;  3UTV A;  5JRA A;  4LDO A;  4JR8 A;  4EIY A;  5AZD A;  2XLH A;  1C3W A;  5G54 A;  4KNF A;  3NS0 A;  4CDY A;  3NY8 A;  2QPD B;  1JV7 A;  5JLI A;  1NBB A;  1JFP A;  4G70 B;  4WGZ A;  4D4X A;  4XT1 A;  2X72 A;  3UZA A;  4LDL A;  5H2M A;  1YYX A;  3L1M A;  3C9L A;  5B0W A;  4DKL A;  1L9H A;  4ULV A;  3NY9 A;  3QJT B;  1FBK A;  4FBZ A;  2HPY A;  2YL3 A;  4FAA B;  2XLO A;  5AHZ A;  1YZA A;  1TN5 A;  5F8U A;  2YCY A;  4PXK A;  3ZQV A;  5JJE A;  4N6H A;  1H2S A;  4CJO A;  1IXF A;  1L0M A;  5H2L A;  1TN0 A;  3BVD B;  5B6Z A;  3PXO A;  4BV0 A;  3S8F B;  3VI0 A;  1E86 A;  1AP9 A;  2YCZ A;  3TOM A;  3QJS B;  3C62 A;  5ETZ A;  2F95 A;  4D4N A;  1C8S A;  1XJI A;  4X1H A;  4GBR A;  5G2D A;  3D4S A;  4G7Q B;  3IQ5 A;  3OE8 A;  1E85 A;  2J9B A;  2YDV A;  3QBK A;  5H2H A;  4AMJ A;  5DHG A;  4QID A;  4GYC A;  4MD1 A;  2YLG A;  3RFM A;  4N4W A;  1S8L A;  5DYS A;  1QQ3 A;  5B6W A;  4GP5 B;  5G36 A;  4JKV A;  1E84 A;  5B6Y A;  1E83 A;  3MBV A;  2WJK A;  1S8J A;  5JJJ A;  1O0A A;  4BEZ A;  1S51 A;  2WJL A;  4GPO A;  4JQ6 A;  3QW0 A;  3HAO A;  4QI1 A;  3S3C B;  1HZX A;  3DQB A;  4QRY A;  5AX1 A;  5H2I A;  1KG8 A;  2LNL A;  2JAG A;  1KGB A;  3UTX A;  2Y04 A;  1X0I 1;  5B6X A;  3FOP A;  3CAP A;  4K5Y A;  5BR2 A;  2YKZ A;  2ZZL A;  3HAQ A;  3VG9 A;  3HAR A;  3NYA A;  2XLM A;  3HNL A;  2PED A;  2Z55 A;  5H2P A;  4GP4 B;  4L6R A;  1APC A;  2XLD A;  1JGJ A;  2I21 A;  1BM1 A;  4XTN A;  2L6X A;  3NMK A;  4DJH A;  3EML A;  3DE9 A;  1S05 A;  3VHZ A;  3S3B B;  4IAR A;  3C9M A;  5ITC A;  1YYJ A;  4PXF A;  2Y01 A;  5JVE A;  3EH3 B;  2XLV A;  2BC5 A;  3ZTM A;  3NSB A;  5J7A A;  4CX9 A;  2YCW A;  1KG9 A;  3QBI A;  1LM3 B;  1QHJ A;  2QPE B;  4EA3 A;  3IQ6 A;  5G2C A;  1FBB A;  5G2A A;  5B34 A;  5JT4 A;  1M6T A;  1X0K 1;  2YDO A;  1F4Z A;  3UG9 A;  3PBL A;  3ZPQ A;  1XIO A;  1P8I A;  2YL7 A;  1CGO A;  2YCX A;  1F50 A;  4MQT A;  1X0S A;  4WGY A;  5JP7 A;  4NC3 A;  3NMJ A;  2Y02 A;  3ZPR A;  5A45 A;  3QJR B;  4L35 A;  1A7V A;  2EI4 A;  3AYN A;  3UTY A;  3KJ6 A;  1S52 A;  3COD A;  2YL1 A;  3OAX A;  3QBL A;  3QJV B;  3QDC A;  4FPD A;  3WQJ A;  1KME A;  4MBS A;  1P8H A;  3QBG A;  2YL0 A;  1CPR A;  2KSY A;  5AGF A;  2NTU A;  4XTL A;  5AHY A;  4CDA A;  1U19 A;  4CDV A;  4ER9 A;  5H2N A;  2R4S A;  3ABW A;  1CWQ A;  3OE6 A;  1QKP A;  3X3B A;  3TOL A;  1Q5J A;  4U9E A;  4CIP A;  3VW7 A;  5DHH A;  3PWH A;  5C1M A;  4BEY A;  256B A;  1JV6 A;  4EJ4 A;  2Y00 A;  4J4Q A;  2BRD A;  4WW3 A;  3RZE A;  3NMI A;  1GZM A;  5JUA A;  3REY A;  2YLI A;  3VGA A;  1GQA A;  5JSL A;  5BR5 A;  2KS9 A;  1GU8 A;  1S54 A;  3A7K A;  5AX0 A;  1QKO A;  4G72 B;  4TL3 A;  4GRV A;  2I20 A;  1LN6 A;  2XLW A;  1M0M A;  2J8W A;  4HYX A;  1VJM A;  3HAS A;  2CCY A;  3ZEV A;  1EKY A;  1M0K A;  5H2K A;  2JAF A;  5LWE A;  1P8U A;  4LDE A;  4JEA A;  2AT9 A;  3V2W A;  3OE9 A;  5KKH A;  1E0P A;  5B3I A;  1PXR A;  4DAJ A;  1DZE A;  3UTW A;  3T45 A;  2Y03 A;  4JE9 A;  4GP8 B;  1BRR A;  1E12 A;  4XTO A;  2M3G A;  4Y9H A;  3HAP A;  4BWB A;  4MD2 A;  3AM6 A;  3M4C A;  5JS5 A;  3HNJ A;  1GUE A;  3QVY A;  2NTW A;  4X31 A;  1BBH A;  2ZFE A;  2I35 A;  5A44 A;  4KLY A;  4G7S B;  4HYJ A;  4WAV A;  4OV0 A;  4IB4 A;  4CJG A;  1BRX A;  4BVN A;  3X3C A;  5B6V A;  3V2Y A;  4UG2 A;  4N4Y B;  3FOO A;  1AT9 A;  3M4B A;  3VRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...