4JKVA

Structure of the human smoothened 7tm receptor in complex with an antitumor agent
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
469
structure length
454
Chain Sequence
GTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562, Smoothened homolog
publication title Structure of the human smoothened receptor bound to an antitumour agent.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 186
structure length 454
sequence length 469
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01534 Frizzled Frizzled/Smoothened family membrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4jkvA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4jkvA02
1F4ZA 3C9LA 4BEZA 3REYA 1QKPA 1R84A 4N6HA 5G36A 2ZFEA 5J7AA 2JAFA 2R4SA 4Y9HA 1BRRA 1UAZA 3C63A 3U8PA 4BWBA 4CDYA 2YCXA 2M3GA 1F50A 2YDVA 2XLHA 2XLVA 5C1MA 4GP5B 1NBBA 5JVEA 2HPYA 3D4SA 2XLEA 3OE9A 5ITEA 5JLIA 1O0AA 3NMJA 3QJVB 4G72B 2Z73A 3S3DB 3V2WA 1E84A 1AP9A 2YLIA 5B3IA 3RZEA 3A7KA 1APCA 1GU8A 4UHRA 3HNKA 2XLWA 4G70B 3UTWA 2AT9A 2KSAA 3AYNA 2XLDA 2XM0A 4D4XA 1RCPA 1L0MA 3P0GA 1E85A 1E86A 3QAPA 3TOLA 5ETZA 3QBIA 3HAPA 2Z55A 1L9HA 3QVZA 3C62A 1S54A 3ZTMA 5AWZA 4GBRA 4MQSA 2BC5A 2YLGA 1C8RA 1S51A 2XLOA 5JJEA 4IB4A 5JUAA 4X1HA 5G2CA 5JRAA 1CPQA 4NC3A 3HAQA 5A44A 3DE9A 2YCZA 256BA 2QLAA 1H68A 4FAAB 3VRCA 5AZDA 3C9MA 1LN6A 2YCWA 3EH4B 1Q5IA 4ULVA 3L1MA 4XT1A 3HASA 1KMEA 3OE6A 2Y02A 3NSBA 5BR2A 5ITCA 4L6RA 1S8JA 1GUEA 5B6YA 4G7QB 3ABWA 1CWQA 1KG8A 2R4RA 4MBSA 4WGZA 4G7SB 4WW3A 2I21A 4MQTA 1AT9A 5JJJA 3RFMA 2QPDB 5G2DA 2I1XA 4X31A 4XXJA 1YYJA 1P8HA 3QBKA 2XL8A 4XTLA 4XTNA 4PXKA 2YL3A 3EMLA 5G2AA 4UG2A 3VW7A 1QQ3A 5JSLA 4CX9A 3PBLA 5H2KA 3NY8A 2NTUA 2YL0A 5B2NA 4JEAA 1KGBA 5JS5A 1IW6A 3QW1A 2I35A 3MBVA 2YLDA 1X0SA 1PY6A 5DHHA 3HARA 4HWLA 3SN6R 4CDAA 1MGYA 3QDCA 3VVKA 3DE8A 5H2PA 3KJ6A 4U9EA 5H2OA 1C8SA 4JQ6A 5A8EA 3QJTB 1H2SA 3ZQVA 4D4NA 3OAXA 1IW9A 3UONA 2VT4A 3QBLA 4JKVA 5FJGA 4CIPA 1KG9A 1JAFA 3PWHA 4X32A 4CJGA 3DQBA 5H2HA 2XL6A 5A45A 1P8IA 3M4CA 3ZTZA 2LNLA 1BM1A 1QM8A 1VJMA 4KNFA 3UTXA 1C3WA 3IQ6A 2KSBA 3NMKA 4MD2A 2XM4A 1XIOA 3EH5B 2ZIYA 3OE0A 4FA7B 5F8UA 3HNLA 1YYXA 1IXFA 4QIDA 1JV6A 4G71B 4BUOA 3ZPQA 3UZCA 2F93A 4N4WA 2Y01A 1F88A 3OE8A 5G53A 1FBBA 4GPOA 4JE9A 2YL1A 5B6VA 1U19A 1LM3B 1CPRA 2CCYA 1GZMA 4EA3A 3NYAA 1FBKA 4MD1A 5TGZA 1EKYA 3EH3B 1YZCA 2J8WA 2EI4A 1DZEA 2F95A 3UG9A 1JGJA 2KS9A 2Y04A 5H2IA 4CDVA 5AHYA 4DJHA 4HYJA 3ZPRA 1XMEB 3HANA 2NTWA 2WJKA 2Y03A 4HYXA 5AX0A 1BBHA 4AMIA 2YKZA 5DYSA 1Q5JA 2L6XA 4N4YB 1JV7A 3BVDB 3M4BA 1PXRA 1M0KA 3UTYA 1M0LA 2YDOA 4XT3A 5B6ZA 3VGAA 3QBGA 4CJOA 2PEDA 3M79A 4K5YA 4L35A 4AMJA 3PXOA 3ZEVA 1XJIA 3S3CB 1P8UA 5EN0A 3QJSB 3DDLA 1A7VA 1QPUA 3HAOA 5BR5A 4WGYA 3HNJA 2QPEB 3M15A 5JT4A 5B0WA 1HZXA 4PXFA 1R2NA 3UZAA 1M6TA 2YL7A 2J9BA 1VGOA 5DHGA 3QAKA 4LDEA 1X0K1 1S52A 3TOMA 1YZAA 2BRDA 5H2MA 4QI1A 3S3BB 5LWEA 5H2NA 1UCQA 3VI0A 4DKLA 2YCYA 5B6XA 3QJQB 2ZZLA 5AX1A 1TN5A 4KLYA 4G7RB 4BEYA 3ZQYA 4OV0A 4JR8A 2XLMA 1S8LA 3HNIA 2G87A 3QVYA 5AHZA 3UTVA 3ODUA 4EIYA 3CAPA 3T45A 1GQAA 5G28A 5B35A 3FOOA 4GP4B 3CODA 1X0I1 4IARA 5H2LA 3S8GB 1E83A 1CGOA 4JEBA 3VHZA 3QJRB 3VG9A 4DAJA 5AGFA 4QRYA 1S53A 3X3BA 1BRDA 3NS0A 1QKOA 4GRVA 4WAVA 3WQJA 4TL3A 4EJ4A 1BRXA 4IAQA 5JP7A 2WJLA 4A4MA 1E12A 4FBZA 4ER9A 5KKHA 1JFPA 4GYCA 3X3CA 4GP8B 1E0PA 2Y00A 5JJNA 3NMIA 3FOPA 5B34A 1QHJA 4LDLA 1PXSA 4J4QA 3COCA 1TN0A 3S8FB 4U9DA 3AYMA 2KSYA 2RH1A 5H2JA 2JAGA 2J4YA 3PDSA 3V2YA 2I20A 4XTOA 1S05A 3QW0A 1M0MA 3AM6A 4LDOA 4BV0A 3NY9A 3ZWIA 3QJUB 1CGNA 4FPDA 2X72A 3PQRA 1EHKB 5B6WA 4BVNA 1MQVA 3IQ5A 5G54A
chains in the Genus database with same CATH superfamily
5BQIA 2YZSA 1F4ZA 3CSKA 5L0DA 1WWPA 3Q7GA 3REYA 2DGJA 4A2NB 1TQGA 4YN0B 4HFFB 3US6A 1FMWA 1ST6A 2JPUA 4CS8A 5L3VA 4Y9HA 3C63A 3U8PA 3ABMC 2R7QA 1T6IA 4CDYA 2YCXA 2XLHA 2Z15A 5E3AA 2Y69C 3OE9A 1QKRA 3C8GA 2Z73A 3S3DB 3V2WA 1E84A 3EFOB 2YLIA 1AP9A 3RZEA 1U6HA 3HNKA 3LAYA 3UTWA 2PNOA 1SMYF 2KSAA 4KBLA 3AYNA 2XM0A 1G4WR 3PCVA 1RCPA 4O6YA 4OIOF 4FAPB 4GQHA 4U5BE 2Z55A 3JSEO 3K66A 3ZTMA 1Z63A 1S51A 2XLOA 4Q7CA 5A6AA 5JUAA 5G2CA 5JRAA 3DE9A 5TJ5E 2Q7RA 1LN6A 2YCWA 3W4YA 3EH4B 4ULVA 3L1MA 5CI9A 3HASA 2YQYA 2A0UA 2D5RB 4CS9A 5COFA 3OE6A 2Y02A 5ITCA 3ATPA 3KH2A 4PJJA 3DJNB 5KYWB 1S8JA 1GUEA 4J32B 3ABWA 2GDCA 2VCBA 2NSFA 4WGZA 2A68F 4H4KC 4G7SB 4MQTA 3SXKA 1AT9A 2ZPAA 2DYRC 1OW7A 4EHPA 3RFMA 4XPYA 3K6BA 4DOZA 1P8HA 5BQGA 3QBKA 4Q5SF 1OW6A 2NUTB 4OD5A 1D0ZA 2YL3A 4XEVA 3V5XA 1H7IA 1YA7O 4U5HA 5G2AA 3UMHA 5JSLA 3RQGA 5B3SC 2LSEA 1MNEA 5E2QA 3UGOA 3NY8A 2YL0A 4JEAA 3I5QA 3C8GD 2W45A 5JS5A 3G4ZA 3T6GB 1VLTA 1S7ZA 1D1AA 1NU7D 5DHHA 3A11A 2FFHA 1GS9A 1Q0GA 2J0WA 4C7OB 1XZPA 1MMAA 1H9GA 3L8IA 3GANA 4C7OA 2VB6A 2WL8A 4YJWA 3H2VA 3CEXA 4JQ6A 5A8EA 4ANJA 4D4NA 4EBKA 1IW9A 5D92A 2VT4A 2BE5F 3QBLA 4JKVA 1J8YF 1JAFA 3PWHA 2JD3A 3DAFA 5A45A 1JPJA 1Y6DA 3ZTZA 3N0TA 2AVKA 2OJQA 4KNFA 1C17M 1R5ID 3VM6A 4YL3A 2I15A 4N6CA 4F4BA 3K1HA 3RQEA 3HNLA 1TWCA 1A7DA 3A9CA 1H9TA 3SYNA 2JX0A 5KYNA 2F93A 2XS8A 5AC5A 4MVZA 2Y01A 3NYMA 1HY5A 1TR2A 1EA8A 3KKBA 4YT8A 1K04A 1C03A 3GEEA 1HW1A 4JURI 1EQ1A 1JPNA 4JC7A 2YL1A 1LM3B 1CPRA 2I8BA 1GZMA 2ASRA 1AEPA 4OINF 3NYAA 1FBKA 5L3QA 1HMOA 4MQ9F 1SYQA 4DBRA 1KU2A 2XSEA 1YZCA 3C8ZA 4JW1A 3ABKC 1VYKA 1ZYRF 4J7TA 2KGOA 1DZEA 1JGJA 3B0VC 5AHYA 4DJHA 4HYJA 4XPXA 2QE9A 4UDVA 4BJ5A 2OG2A 2DB4A 4AX2A 4MVRA 1OW8A 2B0JA 3EHMA 1YLMA 1O87A 2Y3GA 3UGPA 1VYIA 2AU5A 2L6XA 1JV7A 3VYWA 3JRTA 1IZMA 4JRZA 3VGAA 3QBGA 4CJOA 3CZ6A 4K5YA 3M79A 1T6QA 1P8UA 3HJCA 4JZAA 2WZGA 4XPWA 1N1CA 4HFKB 5JT4A 2H7VC 1VTMP 2EPNA 2QUPA 1V54C 3I4UA 4AK9A 1VGOA 3U8VA 2OKUA 3KYJA 3QAKA 3EG9A 4ULWA 4A4AA 2EIJC 1YZAA 5H2MA 2WVOA 2Q4FA 3VI0A 2H7BA 3NYJA 3QJQB 1RKEA 5BUOA 5AX1A 2J45A 3ZQYA 4EBBA 3T4RA 1G5ZA 5AHZA 4MW8A 4HEAJ 1X0I1 3K1IC 3JZ0A 1ZHYA 2HMQA 4U5CE 3QJRB 3VG9A 4IWBA 3ASNC 1S53A 1LE2A 3U2MA 1SZIA 3WQJA 3GODA 4LLCA 4EJ4A 1H6GA 2AP3A 1BRXA 5A69A 2LD6A 3MYFA 1RXQA 5F28E 1JFPA 1NFNA 5JJNA 3FOPA 5B34A 4LDLA 4ZLDA 1ZHTA 3JYYA 3COCA 2UUHA 1A0BA 1TN0A 3S8FB 3G4XA 4BG0A 3S0XA 3AYMA 4K7BA 1O5HA 5H2JA 4C3BA 3S90A 2J4YA 3PDSA 3ZSUA 1NZEA 2I20A 1S05A 3DKAA 2WVQA 1Z5ZA 4BV0A 3ZWIA 2TMVP 4MW3A 1WOLA 2DYSC 2KNHA 1OCZC 1QKPA 4N6HA 3RFYA 2Q00A 5G36A 2JAFA 2BL2A 1UAZA 1GGQA 4BWBA 3LJBA 2M3GA 1F50A 2YDVA 3EQLF 4GP5B 3DXJF 5JVEA 1G4US 2OJED 3DM5A 5DS5A 3D4SA 2D4UA 1RJ9A 2J7PA 5ITEA 1R4TA 4G78A 1O0AA 1PCXA 3NMJA 3WODF 5BQHA 3U3BA 1LS4A 1WASA 2P1AA 4QI0A 1K05A 4CBEA 2XL4A 3LNMB 1GU8A 2XLWA 2VASA 3ZIBA 2R03A 3L0IA 4D4XA 4U5FE 3T6BA 3AGUA 3DJUB 1E85A 1JRAA 1E86A 3QAPA 4E18A 5ETZA 4NQFA 4KI2A 1UG7A 3TK0A 3TULA 2R05A 4QI2A 5AWZA 4MQSA 2BC5A 2L6FA 3B0PA 3ASOC 5JJEA 4IB4A 2PP4A 4JJGA 4NC3A 4W8PA 2R7XA 4FAAB 4XEFA 4YT5A 1LIHA 5AZDA 1GM5A 5CIVA 3EH1A 1Q5IA 2MHRA 1Y4CA 3KPHA 5BR2A 3NKDA 5COMA 5A6BA 4E17A 5L0CA 4EUKB 1CWQA 4IGGA 2R4RA 2PX0A 3TQOA 2I21A 5G2DA 5K0IA 5HSWA 2XL8A 1K40A 4G7ZF 4K0DA 1PV3A 4XTNA 4PXKA 3EMLA 2R7OA 4NY3A 3AQCA 4UG2A 2M64A 3BRJA 4FX5A 3VW7A 1QQ3A 2G3VA 3EGDB 4BJ1A 2KK1A 3QMKA 4MVQA 4XLPF 3EGDA 3GM2A 2HV6A 4G0HA 3QW1A 3MBVA 1D1BA 4DVZA 1X0SA 1PY6A 4O6NA 3HARA 4HWLA 3KYIA 2ICWG 2C04A 5DQTA 2Y3DA 3S84A 2ZXWC 4U9EA 3KJ6A 5H2OA 3M1CB 4X0RA 3EFOA 3OAXA 1L7CA 1XZQA 4MVUA 3U0CA 1TWHA 5L0FA 3UONA 1IW7F 4O7GA 2IXOA 4CIPA 1KG9A 4X32A 5H2HA 1P8IA 4DRHB 1TKNA 1U89A 3B9QA 3UTXA 3H2UA 3AG3C 1QZXA 1Z23A 2KSFA 2A69F 4PACA 4MD2A 2Q9CA 3HLZA 3RVYA 1TWGA 3EH5B 1FFTC 4BJ6C 2Q9BA 3EH2A 1WATA 1T9KA 1YYXA 3W2WA 1QVXA 3FAJA 3O6XA 3LS0A 4G71B 1Q0DA 3UZCA 4GYTA 4N4WA 1Z7Qc 5A6BD 4EWCA 4XEKA 2EIKC 3OE8A 5CI8A 1V4AA 1V55C 4PJMA 3AQBA 4JE9A 3GWNA 2G62A 4MD1A 5B1AC 3K33A 5TGZA 1U0BB 3DI5A 5KYWA 2R9RB 3UG9A 2YWAA 5H2IA 1W2WA 1BR4A 4I1MA 1YARO 4CDVA 5DS6A 4XLNF 4MTFA 1OXBA 5E3CA 3ZPRA 4U5EE 3SXZA 2HJ3A 1KNYA 2NUTA 1OR3A 3PHF2 2WJKA 3L34A 2Y03A 4P9TA 2V26A 4HYXA 5AX0A 1JMWA 3ABLC 5DYSA 4DRIB 1Q5JA 2X0CA 3BVDB 3M4BA 2YDOA 1ZU5A 4XT3A 3E70C 2Y3HA 4AMJA 4M63A 1T01A 4R32A 2KC3A 3DDLA 3HAOA 3SZRA 5BR5A 2EPKX 3NDBB 1BZ4A 3BEHA 4IRUA 5B0WA 1HZXA 3OEOA 1M6TA 4LERA 2J9BA 2Y39A 4LDEA 4E0HA 1FFHA 3V7OA 1S52A 4LDKA 2BRDA 1OR2A 2HFIA 3S3BB 5LWEA 2YCYA 3FHDA 5IY5C 2KJGA 4CSAC 3GORA 5KYUB 1BR2A 2R25A 4BEYA 3TJ6A 4NCQA 2A6EF 1MMDA 3R2PA 4LACB 3UTVA 4YL0A 3ODUA 3GM1A 4EIYA 3T45A 3WHNA 3CODA 4MNDA 3T9OA 3ZDLA 1TWAA 4YT4A 4FESA 4DBQA 3C18A 3F47A 5AGFA 3R7CA 4JVSA 2IM8A 2XXAB 3O39A 4DRJB 5AC4A 5FCLA 3FVYA 2PBEA 4J7YA 2A1DD 5JP7A 4EKWA 2ZXRA 4ER9A 2P0NA 3U9MA 1LPEA 4YT2A 2LIGA 1LVKA 2LFDA 3RYLA 2GA0A 2V3CC 2RH1A 4KC9A 1I5NA 1TFKB 3HKKA 2RD9A 4ONSA 4XTOA 4U5DE 2EINC 4LDOA 1Q0KA 4AL0A 1CGNA 5B6WA 4BVNA 3IQ5A 4W8KA 5G54A 2J9VA 1OCOC 4KNVA 4BEZA 4CS8C 4CIHA 5J7AA 5COGA 2R4SA 2PX3A 2YRFA 3AG2C 3LEOA 1D0YA 4IAOA 5C1MA 3TD7A 1NBBA 1FMVA 2XLEA 5JLIA 2EPMX 3QJVB 4G72B 3NKEA 2R7WA 1LS1A 4YL1A 3A7KA 2H7OA 1T6UA 1ZHZA 1TFOB 1L0MA 3RF3A 3P0GA 5FZTA 1DOWA 5B1BC 3QBIA 3Q6MA 3HAPA 1L9HA 2LK4A 1F1MA 3EZHA 2KQ9A 3C62A 2RSEB 3DM9B 3ECSA 2NSGA 2YLGA 4BEJA 2HZ8A 4BJ6A 5A44A 2QLAA 1BDJB 2WZLA 2HKVA 2R7RA 4I3MA 4G7OF 1J8MF 1KMEA 4YK5A 4G7QB 2A6HF 1UFBA 4WW3A 1YJGA 5JJJA 1AUEA 3EGXB 2J46A 4NTAA 4X31A 4XXJA 1YYJA 2ETSA 4XTLA 2OEVA 3K7DA 3GEIA 4YWQA 4Z9IA 1YAUO 1VLSA 3S29A 3RW0A 5D91A 3GEHA 5T1DB 3SXYA 3Q6NA 3RH3A 4AE4B 4XWJA 1IW6A 3U5SA 3NYLA 4E7SA 5DVWA 2I35A 2OOCA 2YLDA 2KYHA 2QNLA 1MGYA 4LDRA 1M2VB 1NLXA 1PD0A 4CS7A 3UNGC 1H2SA 3ZQVA 3LNRA 1KTMA 3DD7A 4E7ZA 2WZFA 4O6MA 4U5GA 5FJGA 1ZU4A 4CJGA 5GPGB 3DQBA 2XL6A 3M4CA 1BM1A 2YHSA 1VJMA 1B68A 1C3WA 2IXPA 3IQ6A 2KSBA 2IXNA 3LESA 4HE8D 2ZIYA 4FA7B 5F8UA 3UMIA 3NRHA 4QIDA 3C7JA 1SF8A 3MLGA 1V74B 3W8IA 1ZZPA 3X2QC 1FBBA 3F46A 4MVOA 2CCYA 3ITFA 5A6KA 2NUPB 2NUPA 2EI4A 3I5PA 2KS9A 1Q0MA 2Y04A 1ZHWA 3JYHA 4MS2A 1BBHA 5HV9A 2YKZA 4N4YB 3H65A 1PXRA 1M0KA 4Z9JA 2J7PD 5B6ZA 3UTYA 2R7UA 1Z3IX 2PEDA 3SP1A 4OD4A 3JCUQ 1XJIA 3O10A 3QJSB 3N24A 2QPEB 1EI7A 1MMGA 5L0JA 3B29A 4P6IC 4PXFA 4E0IA 2WVNA 2R7TA 1X0K1 4NTBA 3TOMA 2P6VA 4PJLA 3C8GB 2GWWA 2DI3A 2OQMA 5DS4A 5H2NA 4DKLA 2LP4A 2J0XA 2ZZLA 4KLYA 3OA1A 2J9UA 2G87A 4DXWA 3QVYA 4O79A 1OXKA 2QY9A 2W4BA 4ZLCA 1GQAA 1XWJA 4G7HF 4I44A 4GP4B 2C03A 3EZIA 3POVA 5H2LA 3FMSA 3AGTA 4JCZA 3RIPA 3CAXA 3S9OA 3VHZA 3EPVA 1OQCA 2GFHA 2EPLX 3K1IA 1QSPA 4C3EA 3FAPB 1BRDA 3NS0A 5F5HA 3LLKA 4WAVA 2QTVA 3CQZA 5EGYA 3IEEA 4IAQA 1OCRC 4RD9A 1ZW2A 3KMIA 1RMVA 4A4MA 1E12A 4FBZA 5KKHA 1FTSA 3B0UX 1BR1A 4GYCA 3SEOA 3S28A 2Y00A 3NMIA 1E2XA 1PXSA 4MTGA 1D0XA 2M4EA 4U9DA 1LI5A 3LUTB 4WABA 1VK5A 2L6HA 3MFNA 3V2YA 2ZD9A 4P9FA 4MVSA 2F22A 3QW0A 1NFOA 3AG4C 4OIRF 1M0MA 3AM6A 3NY9A 3PQRA 2Q9AA 1OKKA 1MQVA 3AOUA 4RBNA 3C9LA 3MBGA 1R84A 1SR2A 2ZFEA 1LE4A 1O3UA 1BRRA 2WB7A 1VMAA 4OIQF 2XLVA 3EHNA 5DLJA 2FGYA 3N2ZB 2HPYA 2OEXA 3VF0A 2P7VA 2A0BA 3PMRA 1OCCC 5B3IA 1APCA 4IJJA 4UHRA 1M2OA 5KYUA 4G70B 3FDQA 1LI7A 4BPMA 2AT9A 2VH3A 3ZG1A 2UUIA 2XLDA 4XTKA 1I4ZA 1I4YA 1ORYA 2X51A 4PK4A 3TOLA 5E33A 4JTAB 1ORJA 2R02A 5EK0A 3QVZA 4K1OA 4LLEA 2L81A 3SNHA 1S54A 4GBRA 1C8RA 4H54A 1M57C 1ZVZA 2XXAA 4AL1A 4X1HA 2OU6A 3JTLO 2L9JA 1VOMA 1CPQA 3HAQA 1JOGA 2YCZA 2E87A 256BA 2HSBA 1H68A 3L8JA 4JTCB 3VRCA 3C9MA 4C3DA 2LQGA 1MMNA 3AJMA 4XT1A 1ZW3A 1AVOB 3JSZA 2HS5A 3LLIA 3NSBA 3RQFA 1DOVA 4Q4ZF 1PD1A 4L6RA 2CGEA 2CNWA 5B6YA 3GM3A 1KG8A 4MBSA 2J9WA 1OKKD 2YVKA 4PJNA 2QPDB 3IQTA 2I1XA 1L3PA 2GAQA 1WGWA 1Z6AA 3ZVRA 1ORSC 2L6GA 4N06A 2G3KA 4JIOA 3S27A 5EHHA 5A6JA 2FAPB 4I1OB 4CX9A 3KL4A 2W4MA 3PBLA 3PDMP 4LDQA 2R7SA 4OIPF 5H2KA 4PFPA 2NTUA 5L0IA 1YDIA 1NU9C 5B2NA 1KGBA 3VAYA 4NTFA 3SN6R 3DMDA 4CDAA 3QDCA 3DZAA 3VVKA 2L7AA 3RKOF 2ZXPA 2CYDA 3HTKC 3DE8A 5H2PA 3EG9B 4QDLA 1C8SA 3QJTB 1LKXA 1VB5A 5L0GA 2KW3C 2Q3TA 3U3FA 3UR3C 1JR8A 1RKEB 3U2LA 3V5ZA 2LNLA 2EILC 3E9VA 1QM8A 3UMKA 1G8XA 3NMKA 4XQ1A 1HE1A 2VCAA 2O9XA 1D1CA 4WJ0A 2XM4A 1XIOA 1RKCA 2VC9A 3ZC4A 3OE0A 2Y3BA 3X1OA 4J30B 2MWQA 2IOQA 1IXFA 5T3WA 1JV6A 1M56C 1HMDA 3LS1A 5T3TA 4BUOA 3ZPQA 2PFDA 2AWYA 2LFFA 3TJ5A 2CNWD 3WG7C 5F5FA 2B0HA 4CS9C 1F88A 3RVZA 5G53A 4GPOA 2CDQA 5B6VA 1U19A 4EA3A 3OWTA 1YVIA 1T5OA 3MYIA 1EKYA 3EH3B 3V5YA 2J8WA 3W8HA 1YA9A 2F95A 3EGXA 2H8AA 3T6JA 4JCHA 2VCCA 5KYXB 1XMEB 3HANA 1FNTc 5KYXA 2NTWA 4DS7E 1WN0A 4AMIA 1NG1A 4BEMJ 3IQCA 2CW0F 3O55A 1M0LA 4AE4A 1FR0A 4L35A 3PXOA 3IHUA 3ZEVA 3S3CB 4GEHA 5EN0A 2EIMC 1A7VA 1QPUA 3EJNA 2IBFA 4WGYA 3HNJA 1HE9A 2IYLD 3NG1A 3M15A 3JT1A 3B71A 1CGME 1FAPB 1R2NA 3UZAA 1M2VA 2YL7A 3MX3A 3W2VA 1Q0FA 5DHGA 3WAQA 2R7VA 2IXMA 1QLEC 2P61A 4PR9A 4MTOA 5KYYB 1RJ9B 5KYYA 4QI1A 1UCQA 5B6XA 2MYSA 2HJMA 1TN5A 4G7RB 4Z9HA 2HSQA 3J06A 4OV0A 4JR8A 2XLMA 1S8LA 1C02A 3HNIA 2AWCA 4CSAA 2XS1A 3IPMO 5DQZA 3CAPA 4JTDB 4EBJA 5G28A 5B35A 3FOOA 2HUJA 4IARA 3S8GB 1E83A 1CGOA 1WTYA 2YEVA 4JEBA 2EPOA 2ZXOA 3U9JA 4DAJA 4QRYA 3FXHA 4FWVA 2OCCC 3X3BA 1QKOA 3QZCA 4GRVA 5L0HA 4B6IA 4TL3A 4BJTA 3GWLA 3DAGA 2WJLA 3DWWA 3JRMO 3X3CA 4GP8B 4PFOA 1E0PA 2HMZA 1HW2A 4BJ5C 1QHJA 4RDAA 1MNDA 4J4QA 1NSGB 3G50A 3LEVA 1A7EA 2KSYA 4JJFA 2JAGA 2XRHA 4DVYP 4KNWA 2NG1A 3Q7LA 3QTHA 2LCHA 4DJ9A 2PF4E 2W9YA 1A41A 3QJUB 4FPDA 1ZHXA 2X72A 3AG1C 2HV7A 1EHKB 3SXMA 2NPUA 4MVMA
chains in the Genus database with same CATH topology
1F4ZA 3C9LA 4BEZA 3REYA 1QKPA 1R84A 4N6HA 5G36A 2ZFEA 5J7AA 2JAFA 2R4SA 4Y9HA 1BRRA 1UAZA 3C63A 3U8PA 4BWBA 4CDYA 2YCXA 2M3GA 1F50A 2YDVA 2XLHA 2XLVA 5C1MA 4GP5B 1NBBA 5JVEA 2HPYA 3D4SA 2XLEA 3OE9A 5ITEA 5JLIA 1O0AA 3NMJA 3QJVB 4G72B 2Z73A 3S3DB 3V2WA 1E84A 1AP9A 2YLIA 5B3IA 3RZEA 3A7KA 1APCA 1GU8A 4UHRA 3HNKA 2XLWA 4G70B 3UTWA 2AT9A 2KSAA 3AYNA 2XLDA 2XM0A 4D4XA 1RCPA 1L0MA 3P0GA 1E85A 1E86A 3QAPA 3TOLA 5ETZA 3QBIA 3HAPA 2Z55A 1L9HA 3QVZA 3C62A 1S54A 3ZTMA 5AWZA 4GBRA 4MQSA 2BC5A 2YLGA 1C8RA 1S51A 2XLOA 5JJEA 4IB4A 5JUAA 4X1HA 5G2CA 5JRAA 1CPQA 4NC3A 3HAQA 5A44A 3DE9A 2YCZA 256BA 2QLAA 1H68A 4FAAB 3VRCA 5AZDA 3C9MA 1LN6A 2YCWA 3EH4B 1Q5IA 4ULVA 3L1MA 4XT1A 3HASA 1KMEA 3OE6A 2Y02A 3NSBA 5BR2A 5ITCA 4L6RA 1S8JA 1GUEA 5B6YA 4G7QB 3ABWA 1CWQA 1KG8A 2R4RA 4MBSA 4WGZA 4G7SB 4WW3A 2I21A 4MQTA 1AT9A 5JJJA 3RFMA 2QPDB 5G2DA 2I1XA 4X31A 4XXJA 1YYJA 1P8HA 3QBKA 2XL8A 4XTLA 4XTNA 4PXKA 2YL3A 3EMLA 5G2AA 4UG2A 3VW7A 1QQ3A 5JSLA 4CX9A 3PBLA 5H2KA 3NY8A 2NTUA 2YL0A 5B2NA 4JEAA 1KGBA 5JS5A 1IW6A 3QW1A 2I35A 3MBVA 2YLDA 1X0SA 1PY6A 5DHHA 3HARA 4HWLA 3SN6R 4CDAA 1MGYA 3QDCA 3VVKA 3DE8A 5H2PA 3KJ6A 4U9EA 5H2OA 1C8SA 4JQ6A 5A8EA 3QJTB 1H2SA 3ZQVA 4D4NA 3OAXA 1IW9A 3UONA 2VT4A 3QBLA 4JKVA 5FJGA 4CIPA 1KG9A 1JAFA 3PWHA 4X32A 4CJGA 3DQBA 5H2HA 2XL6A 5A45A 1P8IA 3M4CA 3ZTZA 2LNLA 1BM1A 1QM8A 1VJMA 4KNFA 3UTXA 1C3WA 3IQ6A 2KSBA 3NMKA 4MD2A 2XM4A 1XIOA 3EH5B 2ZIYA 3OE0A 4FA7B 5F8UA 3HNLA 1YYXA 1IXFA 4QIDA 1JV6A 4G71B 4BUOA 3ZPQA 3UZCA 2F93A 4N4WA 2Y01A 1F88A 3OE8A 5G53A 1FBBA 4GPOA 4JE9A 2YL1A 5B6VA 1U19A 1LM3B 1CPRA 2CCYA 1GZMA 4EA3A 3NYAA 1FBKA 4MD1A 5TGZA 1EKYA 3EH3B 1YZCA 2J8WA 2EI4A 1DZEA 2F95A 3UG9A 1JGJA 2KS9A 2Y04A 5H2IA 4CDVA 5AHYA 4DJHA 4HYJA 3ZPRA 1XMEB 3HANA 2NTWA 4DS7E 2WJKA 2Y03A 4HYXA 5AX0A 1BBHA 4AMIA 2YKZA 5DYSA 1Q5JA 2L6XA 4N4YB 1JV7A 3BVDB 3M4BA 1PXRA 1M0KA 3UTYA 1M0LA 2YDOA 4XT3A 5B6ZA 3VGAA 3QBGA 4CJOA 2PEDA 3M79A 4K5YA 4L35A 4AMJA 3PXOA 3ZEVA 1XJIA 3S3CB 1P8UA 5EN0A 3QJSB 3DDLA 1A7VA 1QPUA 3HAOA 5BR5A 4WGYA 3HNJA 2QPEB 3M15A 5JT4A 5B0WA 1HZXA 4PXFA 1R2NA 3UZAA 1M6TA 2YL7A 2J9BA 1VGOA 5DHGA 3QAKA 4LDEA 1X0K1 1S52A 3TOMA 1YZAA 2BRDA 5H2MA 4QI1A 3S3BB 5LWEA 5H2NA 1UCQA 3VI0A 4DKLA 2YCYA 5B6XA 3QJQB 2ZZLA 5AX1A 1TN5A 4KLYA 4G7RB 4BEYA 3ZQYA 4OV0A 4JR8A 2XLMA 1S8LA 3HNIA 2G87A 3QVYA 5AHZA 3UTVA 3ODUA 4EIYA 3CAPA 3T45A 1GQAA 5G28A 5B35A 3FOOA 4GP4B 3CODA 1X0I1 4IARA 5H2LA 3S8GB 1E83A 1CGOA 4JEBA 3VHZA 3QJRB 3VG9A 4DAJA 5AGFA 4QRYA 1S53A 3X3BA 1BRDA 3NS0A 1QKOA 4GRVA 4WAVA 3WQJA 4TL3A 4EJ4A 1BRXA 4IAQA 5JP7A 2WJLA 4A4MA 1E12A 4FBZA 4ER9A 5KKHA 1JFPA 4GYCA 3X3CA 4GP8B 1E0PA 2Y00A 5JJNA 3NMIA 3FOPA 5B34A 1QHJA 4LDLA 1PXSA 4J4QA 3COCA 1TN0A 3S8FB 4U9DA 3AYMA 2KSYA 2RH1A 5H2JA 2JAGA 2J4YA 3PDSA 3V2YA 2I20A 4XTOA 1S05A 3QW0A 1M0MA 3AM6A 4LDOA 4BV0A 3NY9A 3ZWIA 3QJUB 1CGNA 4FPDA 2X72A 3PQRA 1EHKB 5B6WA 4BVNA 1MQVA 3IQ5A 5G54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4Z A;  3C9L A;  4BEZ A;  3REY A;  1QKP A;  1R84 A;  4N6H A;  5G36 A;  2ZFE A;  5J7A A;  2JAF A;  2R4S A;  4Y9H A;  1BRR A;  1UAZ A;  3C63 A;  3U8P A;  4BWB A;  4CDY A;  2YCX A;  2M3G A;  1F50 A;  2YDV A;  2XLH A;  2XLV A;  5C1M A;  4GP5 B;  1NBB A;  5JVE A;  2HPY A;  3D4S A;  2XLE A;  3OE9 A;  5ITE A;  5JLI A;  1O0A A;  3NMJ A;  3QJV B;  4G72 B;  2Z73 A;  3S3D B;  3V2W A;  1E84 A;  1AP9 A;  2YLI A;  5B3I A;  3RZE A;  3A7K A;  1APC A;  1GU8 A;  4UHR A;  3HNK A;  2XLW A;  4G70 B;  3UTW A;  2AT9 A;  2KSA A;  3AYN A;  2XLD A;  2XM0 A;  4D4X A;  1RCP A;  1L0M A;  3P0G A;  1E85 A;  1E86 A;  3QAP A;  3TOL A;  5ETZ A;  3QBI A;  3HAP A;  2Z55 A;  1L9H A;  3QVZ A;  3C62 A;  1S54 A;  3ZTM A;  5AWZ A;  4GBR A;  4MQS A;  2BC5 A;  2YLG A;  1C8R A;  1S51 A;  2XLO A;  5JJE A;  4IB4 A;  5JUA A;  4X1H A;  5G2C A;  5JRA A;  1CPQ A;  4NC3 A;  3HAQ A;  5A44 A;  3DE9 A;  2YCZ A;  256B A;  2QLA A;  1H68 A;  4FAA B;  3VRC A;  5AZD A;  3C9M A;  1LN6 A;  2YCW A;  3EH4 B;  1Q5I A;  4ULV A;  3L1M A;  4XT1 A;  3HAS A;  1KME A;  3OE6 A;  2Y02 A;  3NSB A;  5BR2 A;  5ITC A;  4L6R A;  1S8J A;  1GUE A;  5B6Y A;  4G7Q B;  3ABW A;  1CWQ A;  1KG8 A;  2R4R A;  4MBS A;  4WGZ A;  4G7S B;  4WW3 A;  2I21 A;  4MQT A;  1AT9 A;  5JJJ A;  3RFM A;  2QPD B;  5G2D A;  2I1X A;  4X31 A;  4XXJ A;  1YYJ A;  1P8H A;  3QBK A;  2XL8 A;  4XTL A;  4XTN A;  4PXK A;  2YL3 A;  3EML A;  5G2A A;  4UG2 A;  3VW7 A;  1QQ3 A;  5JSL A;  4CX9 A;  3PBL A;  5H2K A;  3NY8 A;  2NTU A;  2YL0 A;  5B2N A;  4JEA A;  1KGB A;  5JS5 A;  1IW6 A;  3QW1 A;  2I35 A;  3MBV A;  2YLD A;  1X0S A;  1PY6 A;  5DHH A;  3HAR A;  4HWL A;  3SN6 R;  4CDA A;  1MGY A;  3QDC A;  3VVK A;  3DE8 A;  5H2P A;  3KJ6 A;  4U9E A;  5H2O A;  1C8S A;  4JQ6 A;  5A8E A;  3QJT B;  1H2S A;  3ZQV A;  4D4N A;  3OAX A;  1IW9 A;  3UON A;  2VT4 A;  3QBL A;  4JKV A;  5FJG A;  4CIP A;  1KG9 A;  1JAF A;  3PWH A;  4X32 A;  4CJG A;  3DQB A;  5H2H A;  2XL6 A;  5A45 A;  1P8I A;  3M4C A;  3ZTZ A;  2LNL A;  1BM1 A;  1QM8 A;  1VJM A;  4KNF A;  3UTX A;  1C3W A;  3IQ6 A;  2KSB A;  3NMK A;  4MD2 A;  2XM4 A;  1XIO A;  3EH5 B;  2ZIY A;  3OE0 A;  4FA7 B;  5F8U A;  3HNL A;  1YYX A;  1IXF A;  4QID A;  1JV6 A;  4G71 B;  4BUO A;  3ZPQ A;  3UZC A;  2F93 A;  4N4W A;  2Y01 A;  1F88 A;  3OE8 A;  5G53 A;  1FBB A;  4GPO A;  4JE9 A;  2YL1 A;  5B6V A;  1U19 A;  1LM3 B;  1CPR A;  2CCY A;  1GZM A;  4EA3 A;  3NYA A;  1FBK A;  4MD1 A;  5TGZ A;  1EKY A;  3EH3 B;  1YZC A;  2J8W A;  2EI4 A;  1DZE A;  2F95 A;  3UG9 A;  1JGJ A;  2KS9 A;  2Y04 A;  5H2I A;  4CDV A;  5AHY A;  4DJH A;  4HYJ A;  3ZPR A;  1XME B;  3HAN A;  2NTW A;  2WJK A;  2Y03 A;  4HYX A;  5AX0 A;  1BBH A;  4AMI A;  2YKZ A;  5DYS A;  1Q5J A;  2L6X A;  4N4Y B;  1JV7 A;  3BVD B;  3M4B A;  1PXR A;  1M0K A;  3UTY A;  1M0L A;  2YDO A;  4XT3 A;  5B6Z A;  3VGA A;  3QBG A;  4CJO A;  2PED A;  3M79 A;  4K5Y A;  4L35 A;  4AMJ A;  3PXO A;  3ZEV A;  1XJI A;  3S3C B;  1P8U A;  5EN0 A;  3QJS B;  3DDL A;  1A7V A;  1QPU A;  3HAO A;  5BR5 A;  4WGY A;  3HNJ A;  2QPE B;  3M15 A;  5JT4 A;  5B0W A;  1HZX A;  4PXF A;  1R2N A;  3UZA A;  1M6T A;  2YL7 A;  2J9B A;  1VGO A;  5DHG A;  3QAK A;  4LDE A;  1X0K 1;  1S52 A;  3TOM A;  1YZA A;  2BRD A;  5H2M A;  4QI1 A;  3S3B B;  5LWE A;  5H2N A;  1UCQ A;  3VI0 A;  4DKL A;  2YCY A;  5B6X A;  3QJQ B;  2ZZL A;  5AX1 A;  1TN5 A;  4KLY A;  4G7R B;  4BEY A;  3ZQY A;  4OV0 A;  4JR8 A;  2XLM A;  1S8L A;  3HNI A;  2G87 A;  3QVY A;  5AHZ A;  3UTV A;  3ODU A;  4EIY A;  3CAP A;  3T45 A;  1GQA A;  5G28 A;  5B35 A;  3FOO A;  4GP4 B;  3COD A;  1X0I 1;  4IAR A;  5H2L A;  3S8G B;  1E83 A;  1CGO A;  4JEB A;  3VHZ A;  3QJR B;  3VG9 A;  4DAJ A;  5AGF A;  4QRY A;  1S53 A;  3X3B A;  1BRD A;  3NS0 A;  1QKO A;  4GRV A;  4WAV A;  3WQJ A;  4TL3 A;  4EJ4 A;  1BRX A;  4IAQ A;  5JP7 A;  2WJL A;  4A4M A;  1E12 A;  4FBZ A;  4ER9 A;  5KKH A;  1JFP A;  4GYC A;  3X3C A;  4GP8 B;  1E0P A;  2Y00 A;  5JJN A;  3NMI A;  3FOP A;  5B34 A;  1QHJ A;  4LDL A;  1PXS A;  4J4Q A;  3COC A;  1TN0 A;  3S8F B;  4U9D A;  3AYM A;  2KSY A;  2RH1 A;  5H2J A;  2JAG A;  2J4Y A;  3PDS A;  3V2Y A;  2I20 A;  4XTO A;  1S05 A;  3QW0 A;  1M0M A;  3AM6 A;  4LDO A;  4BV0 A;  3NY9 A;  3ZWI A;  3QJU B;  1CGN A;  4FPD A;  2X72 A;  3PQR A;  1EHK B;  5B6W A;  4BVN A;  1MQV A;  3IQ5 A;  5G54 A; 
#chains in the Genus database with same CATH topology
 5BQI A;  2YZS A;  1F4Z A;  3CSK A;  5L0D A;  1WWP A;  3Q7G A;  3REY A;  2DGJ A;  4A2N B;  1TQG A;  4YN0 B;  4HFF B;  3US6 A;  1FMW A;  1ST6 A;  2JPU A;  4CS8 A;  5L3V A;  4Y9H A;  3C63 A;  3U8P A;  3ABM C;  2R7Q A;  1T6I A;  4CDY A;  2YCX A;  2XLH A;  2Z15 A;  5E3A A;  2Y69 C;  3OE9 A;  1QKR A;  3C8G A;  2Z73 A;  3S3D B;  3V2W A;  1E84 A;  3EFO B;  2YLI A;  1AP9 A;  3RZE A;  1U6H A;  3HNK A;  3LAY A;  3UTW A;  2PNO A;  1SMY F;  2KSA A;  4KBL A;  3AYN A;  2XM0 A;  1G4W R;  3PCV A;  1RCP A;  4O6Y A;  4OIO F;  4FAP B;  4GQH A;  4U5B E;  2Z55 A;  3JSE O;  3K66 A;  3ZTM A;  1Z63 A;  1S51 A;  2XLO A;  4Q7C A;  5A6A A;  5JUA A;  5G2C A;  5JRA A;  3DE9 A;  5TJ5 E;  2Q7R A;  1LN6 A;  2YCW A;  3W4Y A;  3EH4 B;  4ULV A;  3L1M A;  5CI9 A;  3HAS A;  2YQY A;  2A0U A;  2D5R B;  4CS9 A;  5COF A;  3OE6 A;  2Y02 A;  5ITC A;  3ATP A;  3KH2 A;  4PJJ A;  3DJN B;  5KYW B;  1S8J A;  1GUE A;  4J32 B;  3ABW A;  2GDC A;  2VCB A;  2NSF A;  4WGZ A;  2A68 F;  4H4K C;  4G7S B;  4MQT A;  3SXK A;  1AT9 A;  2ZPA A;  2DYR C;  1OW7 A;  4EHP A;  3RFM A;  4XPY A;  3K6B A;  4DOZ A;  1P8H A;  5BQG A;  3QBK A;  4Q5S F;  1OW6 A;  2NUT B;  4OD5 A;  1D0Z A;  2YL3 A;  4XEV A;  3V5X A;  1H7I A;  1YA7 O;  4U5H A;  5G2A A;  3UMH A;  5JSL A;  3RQG A;  5B3S C;  2LSE A;  1MNE A;  5E2Q A;  3UGO A;  3NY8 A;  2YL0 A;  4JEA A;  3I5Q A;  3C8G D;  2W45 A;  5JS5 A;  3G4Z A;  3T6G B;  1VLT A;  1S7Z A;  1D1A A;  1NU7 D;  5DHH A;  3A11 A;  2FFH A;  1GS9 A;  1Q0G A;  2J0W A;  4C7O B;  1XZP A;  1MMA A;  1H9G A;  3L8I A;  3GAN A;  4C7O A;  2VB6 A;  2WL8 A;  4YJW A;  3H2V A;  3CEX A;  4JQ6 A;  5A8E A;  4ANJ A;  4D4N A;  4EBK A;  1IW9 A;  5D92 A;  2VT4 A;  2BE5 F;  3QBL A;  4JKV A;  1J8Y F;  1JAF A;  3PWH A;  2JD3 A;  3DAF A;  5A45 A;  1JPJ A;  1Y6D A;  3ZTZ A;  3N0T A;  2AVK A;  2OJQ A;  4KNF A;  1C17 M;  1R5I D;  3VM6 A;  4YL3 A;  2I15 A;  4N6C A;  4F4B A;  3K1H A;  3RQE A;  3HNL A;  1TWC A;  1A7D A;  3A9C A;  1H9T A;  3SYN A;  2JX0 A;  5KYN A;  2F93 A;  2XS8 A;  5AC5 A;  4MVZ A;  2Y01 A;  3NYM A;  1HY5 A;  1TR2 A;  1EA8 A;  3KKB A;  4YT8 A;  1K04 A;  1C03 A;  3GEE A;  1HW1 A;  4JUR I;  1EQ1 A;  1JPN A;  4JC7 A;  2YL1 A;  1LM3 B;  1CPR A;  2I8B A;  1GZM A;  2ASR A;  1AEP A;  4OIN F;  3NYA A;  1FBK A;  5L3Q A;  1HMO A;  4MQ9 F;  1SYQ A;  4DBR A;  1KU2 A;  2XSE A;  1YZC A;  3C8Z A;  4JW1 A;  3ABK C;  1VYK A;  1ZYR F;  4J7T A;  2KGO A;  1DZE A;  1JGJ A;  3B0V C;  5AHY A;  4DJH A;  4HYJ A;  4XPX A;  2QE9 A;  4UDV A;  4BJ5 A;  2OG2 A;  2DB4 A;  4AX2 A;  4MVR A;  1OW8 A;  2B0J A;  3EHM A;  1YLM A;  1O87 A;  2Y3G A;  3UGP A;  1VYI A;  2AU5 A;  2L6X A;  1JV7 A;  3VYW A;  3JRT A;  1IZM A;  4JRZ A;  3VGA A;  3QBG A;  4CJO A;  3CZ6 A;  4K5Y A;  3M79 A;  1T6Q A;  1P8U A;  3HJC A;  4JZA A;  2WZG A;  4XPW A;  1N1C A;  4HFK B;  5JT4 A;  2H7V C;  1VTM P;  2EPN A;  2QUP A;  1V54 C;  3I4U A;  4AK9 A;  1VGO A;  3U8V A;  2OKU A;  3KYJ A;  3QAK A;  3EG9 A;  4ULW A;  4A4A A;  2EIJ C;  1YZA A;  5H2M A;  2WVO A;  2Q4F A;  3VI0 A;  2H7B A;  3NYJ A;  3QJQ B;  1RKE A;  5BUO A;  5AX1 A;  2J45 A;  3ZQY A;  4EBB A;  3T4R A;  1G5Z A;  5AHZ A;  4MW8 A;  4HEA J;  1X0I 1;  3K1I C;  3JZ0 A;  1ZHY A;  2HMQ A;  4U5C E;  3QJR B;  3VG9 A;  4IWB A;  3ASN C;  1S53 A;  1LE2 A;  3U2M A;  1SZI A;  3WQJ A;  3GOD A;  4LLC A;  4EJ4 A;  1H6G A;  2AP3 A;  1BRX A;  5A69 A;  2LD6 A;  3MYF A;  1RXQ A;  5F28 E;  1JFP A;  1NFN A;  5JJN A;  3FOP A;  5B34 A;  4LDL A;  4ZLD A;  1ZHT A;  3JYY A;  3COC A;  2UUH A;  1A0B A;  1TN0 A;  3S8F B;  3G4X A;  4BG0 A;  3S0X A;  3AYM A;  4K7B A;  1O5H A;  5H2J A;  4C3B A;  3S90 A;  2J4Y A;  3PDS A;  3ZSU A;  1NZE A;  2I20 A;  1S05 A;  3DKA A;  2WVQ A;  1Z5Z A;  4BV0 A;  3ZWI A;  2TMV P;  4MW3 A;  1WOL A;  2DYS C;  2KNH A;  1OCZ C;  1QKP A;  4N6H A;  3RFY A;  2Q00 A;  5G36 A;  2JAF A;  2BL2 A;  1UAZ A;  1GGQ A;  4BWB A;  3LJB A;  2M3G A;  1F50 A;  2YDV A;  3EQL F;  4GP5 B;  3DXJ F;  5JVE A;  1G4U S;  2OJE D;  3DM5 A;  5DS5 A;  3D4S A;  2D4U A;  1RJ9 A;  2J7P A;  5ITE A;  1R4T A;  4G78 A;  1O0A A;  1PCX A;  3NMJ A;  3WOD F;  5BQH A;  3U3B A;  1LS4 A;  1WAS A;  2P1A A;  4QI0 A;  1K05 A;  4CBE A;  2XL4 A;  3LNM B;  1GU8 A;  2XLW A;  2VAS A;  3ZIB A;  2R03 A;  3L0I A;  4D4X A;  4U5F E;  3T6B A;  3AGU A;  3DJU B;  1E85 A;  1JRA A;  1E86 A;  3QAP A;  4E18 A;  5ETZ A;  4NQF A;  4KI2 A;  1UG7 A;  3TK0 A;  3TUL A;  2R05 A;  4QI2 A;  5AWZ A;  4MQS A;  2BC5 A;  2L6F A;  3B0P A;  3ASO C;  5JJE A;  4IB4 A;  2PP4 A;  4JJG A;  4NC3 A;  4W8P A;  2R7X A;  4FAA B;  4XEF A;  4YT5 A;  1LIH A;  5AZD A;  1GM5 A;  5CIV A;  3EH1 A;  1Q5I A;  2MHR A;  1Y4C A;  3KPH A;  5BR2 A;  3NKD A;  5COM A;  5A6B A;  4E17 A;  5L0C A;  4EUK B;  1CWQ A;  4IGG A;  2R4R A;  2PX0 A;  3TQO A;  2I21 A;  5G2D A;  5K0I A;  5HSW A;  2XL8 A;  1K40 A;  4G7Z F;  4K0D A;  1PV3 A;  4XTN A;  4PXK A;  3EML A;  2R7O A;  4NY3 A;  3AQC A;  4UG2 A;  2M64 A;  3BRJ A;  4FX5 A;  3VW7 A;  1QQ3 A;  2G3V A;  3EGD B;  4BJ1 A;  2KK1 A;  3QMK A;  4MVQ A;  4XLP F;  3EGD A;  3GM2 A;  2HV6 A;  4G0H A;  3QW1 A;  3MBV A;  1D1B A;  4DVZ A;  1X0S A;  1PY6 A;  4O6N A;  3HAR A;  4HWL A;  3KYI A;  2ICW G;  2C04 A;  5DQT A;  2Y3D A;  3S84 A;  2ZXW C;  4U9E A;  3KJ6 A;  5H2O A;  3M1C B;  4X0R A;  3EFO A;  3OAX A;  1L7C A;  1XZQ A;  4MVU A;  3U0C A;  1TWH A;  5L0F A;  3UON A;  1IW7 F;  4O7G A;  2IXO A;  4CIP A;  1KG9 A;  4X32 A;  5H2H A;  1P8I A;  4DRH B;  1TKN A;  1U89 A;  3B9Q A;  3UTX A;  3H2U A;  3AG3 C;  1QZX A;  1Z23 A;  2KSF A;  2A69 F;  4PAC A;  4MD2 A;  2Q9C A;  3HLZ A;  3RVY A;  1TWG A;  3EH5 B;  1FFT C;  4BJ6 C;  2Q9B A;  3EH2 A;  1WAT A;  1T9K A;  1YYX A;  3W2W A;  1QVX A;  3FAJ A;  3O6X A;  3LS0 A;  4G71 B;  1Q0D A;  3UZC A;  4GYT A;  4N4W A;  1Z7Q c;  5A6B D;  4EWC A;  4XEK A;  2EIK C;  3OE8 A;  5CI8 A;  1V4A A;  1V55 C;  4PJM A;  3AQB A;  4JE9 A;  3GWN A;  2G62 A;  4MD1 A;  5B1A C;  3K33 A;  5TGZ A;  1U0B B;  3DI5 A;  5KYW A;  2R9R B;  3UG9 A;  2YWA A;  5H2I A;  1W2W A;  1BR4 A;  4I1M A;  1YAR O;  4CDV A;  5DS6 A;  4XLN F;  4MTF A;  1OXB A;  5E3C A;  3ZPR A;  4U5E E;  3SXZ A;  2HJ3 A;  1KNY A;  2NUT A;  1OR3 A;  3PHF 2;  2WJK A;  3L34 A;  2Y03 A;  4P9T A;  2V26 A;  4HYX A;  5AX0 A;  1JMW A;  3ABL C;  5DYS A;  4DRI B;  1Q5J A;  2X0C A;  3BVD B;  3M4B A;  2YDO A;  1ZU5 A;  4XT3 A;  3E70 C;  2Y3H A;  4AMJ A;  4M63 A;  1T01 A;  4R32 A;  2KC3 A;  3DDL A;  3HAO A;  3SZR A;  5BR5 A;  2EPK X;  3NDB B;  1BZ4 A;  3BEH A;  4IRU A;  5B0W A;  1HZX A;  3OEO A;  1M6T A;  4LER A;  2J9B A;  2Y39 A;  4LDE A;  4E0H A;  1FFH A;  3V7O A;  1S52 A;  4LDK A;  2BRD A;  1OR2 A;  2HFI A;  3S3B B;  5LWE A;  2YCY A;  3FHD A;  5IY5 C;  2KJG A;  4CSA C;  3GOR A;  5KYU B;  1BR2 A;  2R25 A;  4BEY A;  3TJ6 A;  4NCQ A;  2A6E F;  1MMD A;  3R2P A;  4LAC B;  3UTV A;  4YL0 A;  3ODU A;  3GM1 A;  4EIY A;  3T45 A;  3WHN A;  3COD A;  4MND A;  3T9O A;  3ZDL A;  1TWA A;  4YT4 A;  4FES A;  4DBQ A;  3C18 A;  3F47 A;  5AGF A;  3R7C A;  4JVS A;  2IM8 A;  2XXA B;  3O39 A;  4DRJ B;  5AC4 A;  5FCL A;  3FVY A;  2PBE A;  4J7Y A;  2A1D D;  5JP7 A;  4EKW A;  2ZXR A;  4ER9 A;  2P0N A;  3U9M A;  1LPE A;  4YT2 A;  2LIG A;  1LVK A;  2LFD A;  3RYL A;  2GA0 A;  2V3C C;  2RH1 A;  4KC9 A;  1I5N A;  1TFK B;  3HKK A;  2RD9 A;  4ONS A;  4XTO A;  4U5D E;  2EIN C;  4LDO A;  1Q0K A;  4AL0 A;  1CGN A;  5B6W A;  4BVN A;  3IQ5 A;  4W8K A;  5G54 A;  2J9V A;  1OCO C;  4KNV A;  4BEZ A;  4CS8 C;  4CIH A;  5J7A A;  5COG A;  2R4S A;  2PX3 A;  2YRF A;  3AG2 C;  3LEO A;  1D0Y A;  4IAO A;  5C1M A;  3TD7 A;  1NBB A;  1FMV A;  2XLE A;  5JLI A;  2EPM X;  3QJV B;  4G72 B;  3NKE A;  2R7W A;  1LS1 A;  4YL1 A;  3A7K A;  2H7O A;  1T6U A;  1ZHZ A;  1TFO B;  1L0M A;  3RF3 A;  3P0G A;  5FZT A;  1DOW A;  5B1B C;  3QBI A;  3Q6M A;  3HAP A;  1L9H A;  2LK4 A;  1F1M A;  3EZH A;  2KQ9 A;  3C62 A;  2RSE B;  3DM9 B;  3ECS A;  2NSG A;  2YLG A;  4BEJ A;  2HZ8 A;  4BJ6 A;  5A44 A;  2QLA A;  1BDJ B;  2WZL A;  2HKV A;  2R7R A;  4I3M A;  4G7O F;  1J8M F;  1KME A;  4YK5 A;  4G7Q B;  2A6H F;  1UFB A;  4WW3 A;  1YJG A;  5JJJ A;  1AUE A;  3EGX B;  2J46 A;  4NTA A;  4X31 A;  4XXJ A;  1YYJ A;  2ETS A;  4XTL A;  2OEV A;  3K7D A;  3GEI A;  4YWQ A;  4Z9I A;  1YAU O;  1VLS A;  3S29 A;  3RW0 A;  5D91 A;  3GEH A;  5T1D B;  3SXY A;  3Q6N A;  3RH3 A;  4AE4 B;  4XWJ A;  1IW6 A;  3U5S A;  3NYL A;  4E7S A;  5DVW A;  2I35 A;  2OOC A;  2YLD A;  2KYH A;  2QNL A;  1MGY A;  4LDR A;  1M2V B;  1NLX A;  1PD0 A;  4CS7 A;  3UNG C;  1H2S A;  3ZQV A;  3LNR A;  1KTM A;  3DD7 A;  4E7Z A;  2WZF A;  4O6M A;  4U5G A;  5FJG A;  1ZU4 A;  4CJG A;  5GPG B;  3DQB A;  2XL6 A;  3M4C A;  1BM1 A;  2YHS A;  1VJM A;  1B68 A;  1C3W A;  2IXP A;  3IQ6 A;  2KSB A;  2IXN A;  3LES A;  4HE8 D;  2ZIY A;  4FA7 B;  5F8U A;  3UMI A;  3NRH A;  4QID A;  3C7J A;  1SF8 A;  3MLG A;  1V74 B;  3W8I A;  1ZZP A;  3X2Q C;  1FBB A;  3F46 A;  4MVO A;  2CCY A;  3ITF A;  5A6K A;  2NUP B;  2NUP A;  2EI4 A;  3I5P A;  2KS9 A;  1Q0M A;  2Y04 A;  1ZHW A;  3JYH A;  4MS2 A;  1BBH A;  5HV9 A;  2YKZ A;  4N4Y B;  3H65 A;  1PXR A;  1M0K A;  4Z9J A;  2J7P D;  5B6Z A;  3UTY A;  2R7U A;  1Z3I X;  2PED A;  3SP1 A;  4OD4 A;  3JCU Q;  1XJI A;  3O10 A;  3QJS B;  3N24 A;  2QPE B;  1EI7 A;  1MMG A;  5L0J A;  3B29 A;  4P6I C;  4PXF A;  4E0I A;  2WVN A;  2R7T A;  1X0K 1;  4NTB A;  3TOM A;  2P6V A;  4PJL A;  3C8G B;  2GWW A;  2DI3 A;  2OQM A;  5DS4 A;  5H2N A;  4DKL A;  2LP4 A;  2J0X A;  2ZZL A;  4KLY A;  3OA1 A;  2J9U A;  2G87 A;  4DXW A;  3QVY A;  4O79 A;  1OXK A;  2QY9 A;  2W4B A;  4ZLC A;  1GQA A;  1XWJ A;  4G7H F;  4I44 A;  4GP4 B;  2C03 A;  3EZI A;  3POV A;  5H2L A;  3FMS A;  3AGT A;  4JCZ A;  3RIP A;  3CAX A;  3S9O A;  3VHZ A;  3EPV A;  1OQC A;  2GFH A;  2EPL X;  3K1I A;  1QSP A;  4C3E A;  3FAP B;  1BRD A;  3NS0 A;  5F5H A;  3LLK A;  4WAV A;  2QTV A;  3CQZ A;  5EGY A;  3IEE A;  4IAQ A;  1OCR C;  4RD9 A;  1ZW2 A;  3KMI A;  1RMV A;  4A4M A;  1E12 A;  4FBZ A;  5KKH A;  1FTS A;  3B0U X;  1BR1 A;  4GYC A;  3SEO A;  3S28 A;  2Y00 A;  3NMI A;  1E2X A;  1PXS A;  4MTG A;  1D0X A;  2M4E A;  4U9D A;  1LI5 A;  3LUT B;  4WAB A;  1VK5 A;  2L6H A;  3MFN A;  3V2Y A;  2ZD9 A;  4P9F A;  4MVS A;  2F22 A;  3QW0 A;  1NFO A;  3AG4 C;  4OIR F;  1M0M A;  3AM6 A;  3NY9 A;  3PQR A;  2Q9A A;  1OKK A;  1MQV A;  3AOU A;  4RBN A;  3C9L A;  3MBG A;  1R84 A;  1SR2 A;  2ZFE A;  1LE4 A;  1O3U A;  1BRR A;  2WB7 A;  1VMA A;  4OIQ F;  2XLV A;  3EHN A;  5DLJ A;  2FGY A;  3N2Z B;  2HPY A;  2OEX A;  3VF0 A;  2P7V A;  2A0B A;  3PMR A;  1OCC C;  5B3I A;  1APC A;  4IJJ A;  4UHR A;  1M2O A;  5KYU A;  4G70 B;  3FDQ A;  1LI7 A;  4BPM A;  2AT9 A;  2VH3 A;  3ZG1 A;  2UUI A;  2XLD A;  4XTK A;  1I4Z A;  1I4Y A;  1ORY A;  2X51 A;  4PK4 A;  3TOL A;  5E33 A;  4JTA B;  1ORJ A;  2R02 A;  5EK0 A;  3QVZ A;  4K1O A;  4LLE A;  2L81 A;  3SNH A;  1S54 A;  4GBR A;  1C8R A;  4H54 A;  1M57 C;  1ZVZ A;  2XXA A;  4AL1 A;  4X1H A;  2OU6 A;  3JTL O;  2L9J A;  1VOM A;  1CPQ A;  3HAQ A;  1JOG A;  2YCZ A;  2E87 A;  256B A;  2HSB A;  1H68 A;  3L8J A;  4JTC B;  3VRC A;  3C9M A;  4C3D A;  2LQG A;  1MMN A;  3AJM A;  4XT1 A;  1ZW3 A;  1AVO B;  3JSZ A;  2HS5 A;  3LLI A;  3NSB A;  3RQF A;  1DOV A;  4Q4Z F;  1PD1 A;  4L6R A;  2CGE A;  2CNW A;  5B6Y A;  3GM3 A;  1KG8 A;  4MBS A;  2J9W A;  1OKK D;  2YVK A;  4PJN A;  2QPD B;  3IQT A;  2I1X A;  1L3P A;  2GAQ A;  1WGW A;  1Z6A A;  3ZVR A;  1ORS C;  2L6G A;  4N06 A;  2G3K A;  4JIO A;  3S27 A;  5EHH A;  5A6J A;  2FAP B;  4I1O B;  4CX9 A;  3KL4 A;  2W4M A;  3PBL A;  3PDM P;  4LDQ A;  2R7S A;  4OIP F;  5H2K A;  4PFP A;  2NTU A;  5L0I A;  1YDI A;  1NU9 C;  5B2N A;  1KGB A;  3VAY A;  4NTF A;  3SN6 R;  3DMD A;  4CDA A;  3QDC A;  3DZA A;  3VVK A;  2L7A A;  3RKO F;  2ZXP A;  2CYD A;  3HTK C;  3DE8 A;  5H2P A;  3EG9 B;  4QDL A;  1C8S A;  3QJT B;  1LKX A;  1VB5 A;  5L0G A;  2KW3 C;  2Q3T A;  3U3F A;  3UR3 C;  1JR8 A;  1RKE B;  3U2L A;  3V5Z A;  2LNL A;  2EIL C;  3E9V A;  1QM8 A;  3UMK A;  1G8X A;  3NMK A;  4XQ1 A;  1HE1 A;  2VCA A;  2O9X A;  1D1C A;  4WJ0 A;  2XM4 A;  1XIO A;  1RKC A;  2VC9 A;  3ZC4 A;  3OE0 A;  2Y3B A;  3X1O A;  4J30 B;  2MWQ A;  2IOQ A;  1IXF A;  5T3W A;  1JV6 A;  1M56 C;  1HMD A;  3LS1 A;  5T3T A;  4BUO A;  3ZPQ A;  2PFD A;  2AWY A;  2LFF A;  3TJ5 A;  2CNW D;  3WG7 C;  5F5F A;  2B0H A;  4CS9 C;  1F88 A;  3RVZ A;  5G53 A;  4GPO A;  2CDQ A;  5B6V A;  1U19 A;  4EA3 A;  3OWT A;  1YVI A;  1T5O A;  3MYI A;  1EKY A;  3EH3 B;  3V5Y A;  2J8W A;  3W8H A;  1YA9 A;  2F95 A;  3EGX A;  2H8A A;  3T6J A;  4JCH A;  2VCC A;  5KYX B;  1XME B;  3HAN A;  1FNT c;  5KYX A;  2NTW A;  4DS7 E;  1WN0 A;  4AMI A;  1NG1 A;  4BEM J;  3IQC A;  2CW0 F;  3O55 A;  1M0L A;  4AE4 A;  1FR0 A;  4L35 A;  3PXO A;  3IHU A;  3ZEV A;  3S3C B;  4GEH A;  5EN0 A;  2EIM C;  1A7V A;  1QPU A;  3EJN A;  2IBF A;  4WGY A;  3HNJ A;  1HE9 A;  2IYL D;  3NG1 A;  3M15 A;  3JT1 A;  3B71 A;  1CGM E;  1FAP B;  1R2N A;  3UZA A;  1M2V A;  2YL7 A;  3MX3 A;  3W2V A;  1Q0F A;  5DHG A;  3WAQ A;  2R7V A;  2IXM A;  1QLE C;  2P61 A;  4PR9 A;  4MTO A;  5KYY B;  1RJ9 B;  5KYY A;  4QI1 A;  1UCQ A;  5B6X A;  2MYS A;  2HJM A;  1TN5 A;  4G7R B;  4Z9H A;  2HSQ A;  3J06 A;  4OV0 A;  4JR8 A;  2XLM A;  1S8L A;  1C02 A;  3HNI A;  2AWC A;  4CSA A;  2XS1 A;  3IPM O;  5DQZ A;  3CAP A;  4JTD B;  4EBJ A;  5G28 A;  5B35 A;  3FOO A;  2HUJ A;  4IAR A;  3S8G B;  1E83 A;  1CGO A;  1WTY A;  2YEV A;  4JEB A;  2EPO A;  2ZXO A;  3U9J A;  4DAJ A;  4QRY A;  3FXH A;  4FWV A;  2OCC C;  3X3B A;  1QKO A;  3QZC A;  4GRV A;  5L0H A;  4B6I A;  4TL3 A;  4BJT A;  3GWL A;  3DAG A;  2WJL A;  3DWW A;  3JRM O;  3X3C A;  4GP8 B;  4PFO A;  1E0P A;  2HMZ A;  1HW2 A;  4BJ5 C;  1QHJ A;  4RDA A;  1MND A;  4J4Q A;  1NSG B;  3G50 A;  3LEV A;  1A7E A;  2KSY A;  4JJF A;  2JAG A;  2XRH A;  4DVY P;  4KNW A;  2NG1 A;  3Q7L A;  3QTH A;  2LCH A;  4DJ9 A;  2PF4 E;  2W9Y A;  1A41 A;  3QJU B;  4FPD A;  1ZHX A;  2X72 A;  3AG1 C;  2HV7 A;  1EHK B;  3SXM A;  2NPU A;  4MVM A; 
#chains in the Genus database with same CATH homology
 1F4Z A;  3C9L A;  4BEZ A;  3REY A;  1QKP A;  1R84 A;  4N6H A;  5G36 A;  2ZFE A;  5J7A A;  2JAF A;  2R4S A;  4Y9H A;  1BRR A;  1UAZ A;  3C63 A;  3U8P A;  4BWB A;  4CDY A;  2YCX A;  2M3G A;  1F50 A;  2YDV A;  2XLH A;  2XLV A;  5C1M A;  4GP5 B;  1NBB A;  5JVE A;  2HPY A;  3D4S A;  2XLE A;  3OE9 A;  5ITE A;  5JLI A;  1O0A A;  3NMJ A;  3QJV B;  4G72 B;  2Z73 A;  3S3D B;  3V2W A;  1E84 A;  1AP9 A;  2YLI A;  5B3I A;  3RZE A;  3A7K A;  1APC A;  1GU8 A;  4UHR A;  3HNK A;  2XLW A;  4G70 B;  3UTW A;  2AT9 A;  2KSA A;  3AYN A;  2XLD A;  2XM0 A;  4D4X A;  1RCP A;  1L0M A;  3P0G A;  1E85 A;  1E86 A;  3QAP A;  3TOL A;  5ETZ A;  3QBI A;  3HAP A;  2Z55 A;  1L9H A;  3QVZ A;  3C62 A;  1S54 A;  3ZTM A;  5AWZ A;  4GBR A;  4MQS A;  2BC5 A;  2YLG A;  1C8R A;  1S51 A;  2XLO A;  5JJE A;  4IB4 A;  5JUA A;  4X1H A;  5G2C A;  5JRA A;  1CPQ A;  4NC3 A;  3HAQ A;  5A44 A;  3DE9 A;  2YCZ A;  256B A;  2QLA A;  1H68 A;  4FAA B;  3VRC A;  5AZD A;  3C9M A;  1LN6 A;  2YCW A;  3EH4 B;  1Q5I A;  4ULV A;  3L1M A;  4XT1 A;  3HAS A;  1KME A;  3OE6 A;  2Y02 A;  3NSB A;  5BR2 A;  5ITC A;  4L6R A;  1S8J A;  1GUE A;  5B6Y A;  4G7Q B;  3ABW A;  1CWQ A;  1KG8 A;  2R4R A;  4MBS A;  4WGZ A;  4G7S B;  4WW3 A;  2I21 A;  4MQT A;  1AT9 A;  5JJJ A;  3RFM A;  2QPD B;  5G2D A;  2I1X A;  4X31 A;  4XXJ A;  1YYJ A;  1P8H A;  3QBK A;  2XL8 A;  4XTL A;  4XTN A;  4PXK A;  2YL3 A;  3EML A;  5G2A A;  4UG2 A;  3VW7 A;  1QQ3 A;  5JSL A;  4CX9 A;  3PBL A;  5H2K A;  3NY8 A;  2NTU A;  2YL0 A;  5B2N A;  4JEA A;  1KGB A;  5JS5 A;  1IW6 A;  3QW1 A;  2I35 A;  3MBV A;  2YLD A;  1X0S A;  1PY6 A;  5DHH A;  3HAR A;  4HWL A;  3SN6 R;  4CDA A;  1MGY A;  3QDC A;  3VVK A;  3DE8 A;  5H2P A;  3KJ6 A;  4U9E A;  5H2O A;  1C8S A;  4JQ6 A;  5A8E A;  3QJT B;  1H2S A;  3ZQV A;  4D4N A;  3OAX A;  1IW9 A;  3UON A;  2VT4 A;  3QBL A;  4JKV A;  5FJG A;  4CIP A;  1KG9 A;  1JAF A;  3PWH A;  4X32 A;  4CJG A;  3DQB A;  5H2H A;  2XL6 A;  5A45 A;  1P8I A;  3M4C A;  3ZTZ A;  2LNL A;  1BM1 A;  1QM8 A;  1VJM A;  4KNF A;  3UTX A;  1C3W A;  3IQ6 A;  2KSB A;  3NMK A;  4MD2 A;  2XM4 A;  1XIO A;  3EH5 B;  2ZIY A;  3OE0 A;  4FA7 B;  5F8U A;  3HNL A;  1YYX A;  1IXF A;  4QID A;  1JV6 A;  4G71 B;  4BUO A;  3ZPQ A;  3UZC A;  2F93 A;  4N4W A;  2Y01 A;  1F88 A;  3OE8 A;  5G53 A;  1FBB A;  4GPO A;  4JE9 A;  2YL1 A;  5B6V A;  1U19 A;  1LM3 B;  1CPR A;  2CCY A;  1GZM A;  4EA3 A;  3NYA A;  1FBK A;  4MD1 A;  5TGZ A;  1EKY A;  3EH3 B;  1YZC A;  2J8W A;  2EI4 A;  1DZE A;  2F95 A;  3UG9 A;  1JGJ A;  2KS9 A;  2Y04 A;  5H2I A;  4CDV A;  5AHY A;  4DJH A;  4HYJ A;  3ZPR A;  1XME B;  3HAN A;  2NTW A;  4DS7 E;  2WJK A;  2Y03 A;  4HYX A;  5AX0 A;  1BBH A;  4AMI A;  2YKZ A;  5DYS A;  1Q5J A;  2L6X A;  4N4Y B;  1JV7 A;  3BVD B;  3M4B A;  1PXR A;  1M0K A;  3UTY A;  1M0L A;  2YDO A;  4XT3 A;  5B6Z A;  3VGA A;  3QBG A;  4CJO A;  2PED A;  3M79 A;  4K5Y A;  4L35 A;  4AMJ A;  3PXO A;  3ZEV A;  1XJI A;  3S3C B;  1P8U A;  5EN0 A;  3QJS B;  3DDL A;  1A7V A;  1QPU A;  3HAO A;  5BR5 A;  4WGY A;  3HNJ A;  2QPE B;  3M15 A;  5JT4 A;  5B0W A;  1HZX A;  4PXF A;  1R2N A;  3UZA A;  1M6T A;  2YL7 A;  2J9B A;  1VGO A;  5DHG A;  3QAK A;  4LDE A;  1X0K 1;  1S52 A;  3TOM A;  1YZA A;  2BRD A;  5H2M A;  4QI1 A;  3S3B B;  5LWE A;  5H2N A;  1UCQ A;  3VI0 A;  4DKL A;  2YCY A;  5B6X A;  3QJQ B;  2ZZL A;  5AX1 A;  1TN5 A;  4KLY A;  4G7R B;  4BEY A;  3ZQY A;  4OV0 A;  4JR8 A;  2XLM A;  1S8L A;  3HNI A;  2G87 A;  3QVY A;  5AHZ A;  3UTV A;  3ODU A;  4EIY A;  3CAP A;  3T45 A;  1GQA A;  5G28 A;  5B35 A;  3FOO A;  4GP4 B;  3COD A;  1X0I 1;  4IAR A;  5H2L A;  3S8G B;  1E83 A;  1CGO A;  4JEB A;  3VHZ A;  3QJR B;  3VG9 A;  4DAJ A;  5AGF A;  4QRY A;  1S53 A;  3X3B A;  1BRD A;  3NS0 A;  1QKO A;  4GRV A;  4WAV A;  3WQJ A;  4TL3 A;  4EJ4 A;  1BRX A;  4IAQ A;  5JP7 A;  2WJL A;  4A4M A;  1E12 A;  4FBZ A;  4ER9 A;  5KKH A;  1JFP A;  4GYC A;  3X3C A;  4GP8 B;  1E0P A;  2Y00 A;  5JJN A;  3NMI A;  3FOP A;  5B34 A;  1QHJ A;  4LDL A;  1PXS A;  4J4Q A;  3COC A;  1TN0 A;  3S8F B;  4U9D A;  3AYM A;  2KSY A;  2RH1 A;  5H2J A;  2JAG A;  2J4Y A;  3PDS A;  3V2Y A;  2I20 A;  4XTO A;  1S05 A;  3QW0 A;  1M0M A;  3AM6 A;  4LDO A;  4BV0 A;  3NY9 A;  3ZWI A;  3QJU B;  1CGN A;  4FPD A;  2X72 A;  3PQR A;  1EHK B;  5B6W A;  4BVN A;  1MQV A;  3IQ5 A;  5G54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...