4JKVA

Structure of the human smoothened 7tm receptor in complex with an antitumor agent
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
469
structure length
454
Chain Sequence
GTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human smoothened receptor bound to an antitumour agent.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Soluble cytochrome b562, Smoothened homolog
total genus 186
structure length 454
sequence length 469
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01534 Frizzled Frizzled/Smoothened family membrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4jkvA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4jkvA02
3PWHA 1JV6A 4DAJA 2Y00A 4GBRA 5H2NA 4D4XA 2XLVA 4LDLA 4KLYA 5TGZA 2YLDA 4GP4B 3UZCA 1QQ3A 1IXFA 1LN6A 2Y04A 3QJSB 3QAPA 4X31A 2ZZLA 4HYXA 4AMJA 3UTVA 1VJMA 3TOMA 1TN5A 4JR8A 3M79A 4JEAA 4G7RB 1X0I1 1QKPA 5JP7A 4MQSA 5JT4A 3FOPA 256BA 1S54A 4BUOA 4XT1A 4EJ4A 3FOOA 1PY6A 1GUEA 2XL8A 5G2AA 4XXJA 2R4SA 1X0K1 4XTNA 4PXFA 2BC5A 2YLGA 2I21A 3RZEA 4OV0A 4BVNA 3HNKA 5G53A 1DZEA 4MBSA 3U8PA 2XLEA 1E86A 3VW7A 2XLOA 3UTWA 1F88A 2I35A 3QJQB 2YLIA 1CPQA 4IARA 3C9MA 3QBGA 5H2IA 4BEYA 1M0MA 1C8SA 1R2NA 4D4NA 4HYJA 1P8UA 3NMIA 4Y9HA 1CGOA 1M6TA 2CCYA 3ABWA 3ODUA 3EH5B 3V2WA 4GRVA 3P0GA 4U9DA 5G54A 1BRDA 2YCYA 5B2NA 2YDVA 1QHJA 3M4BA 4CX9A 4N6HA 3CAPA 1U19A 2JAFA 1XMEB 5H2HA 2YKZA 3UTYA 5JVEA 4QI1A 5BR2A 3BVDB 4XTOA 1IW6A 3QJTB 2QPEB 3ZPRA 4NC3A 3QJRB 2XL6A 3QW0A 2X72A 2JAGA 3NYAA 4K5YA 3HAOA 5JUAA 5G2DA 2WJKA 1CPRA 1UAZA 4X32A 5H2MA 4A4MA 4QRYA 3DQBA 3M4CA 4LDEA 4PXKA 4IAQA 2KSYA 5A45A 3UONA 5B6YA 1KMEA 5B0WA 3EH4B 5JJEA 2G87A 1GU8A 4XTLA 3OE6A 4JEBA 5B35A 3ZTMA 5G2CA 3QBKA 3QBLA 3QJUB 2XLHA 3T45A 5G36A 1Q5IA 2Y02A 2XLMA 4KNFA 3ZEVA 3WQJA 5B6VA 4GYCA 5AX1A 4JE9A 3UZAA 4BWBA 1BBHA 1FBBA 4N4WA 1APCA 1S8JA 4DJHA 1AP9A 3IQ6A 1FBKA 1XJIA 5JJNA 2NTWA 5B6ZA 2YCXA 4IB4A 1RCPA 3COCA 5A8EA 1PXSA 3ZPQA 4CJGA 4J4QA 4GP8B 5AZDA 2YCZA 3MBVA 5DYSA 2YL1A 3S8FB 4ER9A 2PEDA 1BRRA 1QM8A 2YDOA 4N4YB 5DHHA 3VVKA 1GZMA 5AHZA 3HARA 3RFMA 4TL3A 4WGZA 1S53A 4QIDA 1HZXA 2I20A 3QAKA 3OE9A 4JKVA 5F8UA 5AHYA 4UHRA 3KJ6A 5G28A 3VG9A 4BV0A 3NMKA 3TOLA 5FJGA 3NSBA 1F4ZA 5AWZA 1JFPA 2J9BA 1C3WA 3PQRA 2M3GA 3PXOA 3QDCA 1L9HA 3VRCA 1UCQA 1GQAA 3QW1A 5B34A 4U9EA 1F50A 5AX0A 1NBBA 4L35A 1E0PA 2BRDA 2RH1A 1Q5JA 1AT9A 4G7SB 4G71B 1S8LA 2AT9A 2XM4A 2KSBA 5B6WA 5AGFA 3D4SA 2VT4A 1P8HA 3AYMA 3ZTZA 3HASA 4HWLA 3S3CB 3DE8A 2I1XA 2F93A 4LDOA 1O0AA 5H2LA 5JLIA 3OE0A 1PXRA 1JGJA 2L6XA 1EKYA 5ITEA 5H2JA 3IQ5A 2XLDA 1JV7A 1H68A 2ZFEA 2LNLA 3QVYA 5J7AA 3C62A 4ULVA 3S8GB 2XM0A 1BM1A 2J4YA 3UTXA 1QPUA 2QPDB 3A7KA 3EMLA 2EI4A 4JQ6A 1E85A 3EH3B 1S05A 5JS5A 3QBIA 4BEZA 3HNJA 5BR5A 1XIOA 3C63A 3S3DB 4G70B 3QJVB 4CDVA 5JRAA 4FPDA 1CWQA 2WJLA 5B6XA 1R84A 3DDLA 5H2KA 1IW9A 1P8IA 5JJJA 1YYXA 3ZQYA 1MQVA 4WW3A 3X3CA 1EHKB 1L0MA 4CJOA 3NS0A 3C9LA 1A7VA 3VI0A 3ZQVA 3HNLA 5EN0A 2KS9A 5JSLA 1YZAA 3L1MA 3HNIA 2ZIYA 3HAQA 4FBZA 1E84A 1S52A 1E83A 4WGYA 3VHZA 1C8RA 2Y01A 1MGYA 1M0KA 4FA7B 3SN6R 2YL7A 3REYA 3V2YA 3ZWIA 3QVZA 4DKLA 3M15A 1M0LA 5C1MA 4CIPA 3S3BB 1X0SA 4EA3A 1JAFA 1YYJA 1S51A 5H2OA 3UG9A 2F95A 1VGOA 4WAVA 2NTUA 2YL3A 1QKOA 3DE9A 3NMJA 2YL0A 4UG2A 1E12A 5DHGA 1KG8A 3X3BA 3NY9A 3VGAA 4X1HA 4FAAB 3AYNA 5ITCA 1YZCA 4G7QB 4GP5B 3HANA 4L6RA 5LWEA 4G72B 2XLWA 4EIYA 5H2PA 4GPOA 2HPYA 5A44A 3PDSA 1H2SA 2Z73A 5KKHA 2Z55A 2J8WA 1BRXA 1KG9A 2Y03A 3AM6A 4MQTA 5B3IA 3OE8A 4XT3A 4CDAA 2KSAA 3HAPA 4CDYA 3CODA 4MD2A 3OAXA 1CGNA 2R4RA 2YCWA 3NY8A 3PBLA 2QLAA 1TN0A 5ETZA 1LM3B 1KGBA 4AMIA 4MD1A
chains in the Genus database with same CATH superfamily
1K04A 3S0XA 3A9CA 3AG2C 3EH2A 5H2NA 4D4XA 3NKDA 4LDLA 3UZCA 2D4UA 3EFOA 3RW0A 3QJSB 1G4US 4C3BA 3QAPA 1OR2A 3ZC4A 4X31A 1VJMA 3OWTA 3CSKA 4XEFA 4G7RB 5JP7A 1OCRC 1F1MA 2J45A 4MQSA 2KSFA 4BUOA 4X0RA 2OCCC 3J06A 2EPKX 1BR4A 1OCCC 4AK9A 4IRUA 5A6KA 1GGQA 4XTNA 2I21A 3IHUA 1DZEA 4MBSA 3VW7A 2XLOA 5L0HA 4YT4A 2I35A 1G5ZA 4IARA 4G7HF 3QBGA 4OIQF 4D4NA 4HYJA 3NMIA 2EIMC 4DJ9A 1OXKA 2CNWA 5TJ5E 4BJ5C 4RBNA 3U8VA 2WZGA 3GEEA 4LDQA 2KJGA 1ZHZA 4NY3A 2YCYA 3BRJA 5KYXA 3AGUA 4PR9A 2P6VA 3LS0A 2QUPA 2HJMA 3M4BA 3CAPA 2EINC 1JOGA 3K1IC 2JAFA 2GWWA 1TR2A 4EUKB 1IW6A 3QJTB 2IM8A 1R4TA 3QJRB 4A2NB 4K5YA 1T6IA 2ZD9A 1CPRA 2KYHA 4JTDB 4E17A 1HW1A 1VLTA 4WABA 4YN0B 1UAZA 3HTKC 1Q0KA 1Y6DA 4A4MA 3W2VA 4PFOA 2CGEA 1KTMA 3EGXA 2HFIA 5EK0A 5G2CA 1VK5A 4GYTA 5CI9A 3QJUB 2XLHA 2DGJA 2R05A 1Q5IA 4J7TA 3WQJA 4CS8C 4DXWA 4EBBA 1I4ZA 2WVOA 3UMIA 3VF0A 4JCHA 4N4WA 1APCA 1NFNA 2L6FA 5KYXB 3FHDA 1SZIA 2J9UA 5B6ZA 5T3WA 2YCXA 1Z63A 1HY5A 4O6YA 3COCA 3ZPQA 4CJGA 2Q9CA 3HJCA 2VASA 2XSEA 3V7OA 3O55A 4ER9A 4YL3A 1GZMA 5AHZA 3HARA 1S53A 3EHNA 4QI0A 1SYQA 3MYFA 4JTAB 3G50A 3VG9A 4GQHA 2Y3HA 4ULWA 3I5PA 2Q00A 1C02A 4O6NA 5AWZA 2MHRA 1JFPA 2J9BA 2JX0A 2NUTB 4MTFA 4DRHB 1L9HA 3V5XA 4LERA 4OIRF 5B34A 4U9EA 2XS8A 4LDKA 4P9FA 2BRDA 4QI2A 1LS4A 3SP1A 1AT9A 4G7SB 2AT9A 3W2WA 1YDIA 3MFNA 4JJFA 1M2VA 4C3EA 4FAPB 3S3CB 4F4BA 3MYIA 1O0AA 2WVQA 1T6UA 2YEVA 2P7VA 3IQ5A 1ZYRF 1BR1A 4OINF 1XZQA 1JV7A 2R7OA 3DI5A 1YJGA 2OJQA 2LNLA 1Z7Qc 1BM1A 3F46A 1U89A 2EI4A 4BEZA 2BL2A 1MNEA 3C63A 2V3CC 2XL4A 3S3DB 1L3PA 5E3CA 3QJVB 4FPDA 3ASOC 1IW9A 2PP4A 2NSGA 3ZQYA 3DXJF 3LS1A 4FESA 4WW3A 4CJOA 1TKNA 1OW6A 1ZHTA 5A6BA 3VI0A 3GANA 2V26A 3G4ZA 2YVKA 3NG1A 1VTMP 5K0IA 3G4XA 3HAQA 4FBZA 1V54C 1E84A 4JTCB 3GORA 3U3BA 3VHZA 1T01A 1C8RA 1MGYA 1LI5A 5KYYB 3REYA 3V2YA 3VM6A 3M15A 4OIPF 1M0LA 5C1MA 3ECSA 3QZCA 1JAFA 2GA0A 3AG3C 3ZG1A 2NTUA 3RVYA 2JPUA 3JSZA 1QKOA 3NMJA 3ZIBA 1QLEC 3RQGA 5DHGA 3O39A 3EZHA 1KG8A 1ZU5A 3UGOA 3ITFA 4N06A 4FAAB 5ITCA 3B9QA 3EGDB 1Q0GA 5BQHA 2EILC 2W45A 3WAQA 4E7ZA 2FAPB 4ONSA 4H4KC 4BJ6A 2XLWA 4EIYA 1LS1A 5A44A 1WWPA 2ZXOA 3S28A 2Z73A 5COGA 2AU5A 2XS1A 5AC5A 1KG9A 2Y03A 3AM6A 3H2UA 5L0JA 3OE8A 4CDAA 2YRFA 2YWAA 2KGOA 3SXMA 1NU7D 3I4UA 5ETZA 2A68F 4NTFA 4CSAA 3DAGA 2R9RB 3PWHA 3SEOA 2IXMA 4DAJA 3RF3A 2Y00A 1VLSA 4K0DA 4AE4B 1Q0FA 4O7GA 2XLVA 4AX2A 4PJLA 5TGZA 1VB5A 2YLDA 2UUHA 4GP4B 1IXFA 4R32A 2P1AA 4UDVA 2Y04A 4HFKB 3FAPB 4AMJA 1TN5A 4JR8A 3M79A 2YQYA 4JEAA 4NQFA 1X0I1 3M1CB 2MYSA 5A6JA 1RKEA 3R7CA 3E9VA 5KYNA 1FMWA 3FOPA 1S54A 4XT1A 4EJ4A 3Q7LA 4CSAC 1OXBA 2HV7A 1KU2A 5G2AA 3O10A 4PK4A 3GWNA 2C04A 2UUIA 4PXFA 4M63A 4EHPA 3RZEA 4BVNA 5G53A 3U8PA 2DI3A 2ETSA 5B1BC 3UTWA 1V4AA 2YLIA 2OQMA 3DJNB 3FDQA 3POVA 3C9MA 3B0UX 2FGYA 1M0MA 2M64A 3C7JA 3E70C 1M6TA 1D1BA 2IXNA 1G4WR 3ODUA 2WL8A 4YWQA 2J7PA 3KL4A 3EH5B 1ORJA 3P0GA 4U9DA 3EQLF 5G54A 5BQGA 1WATA 1YA9A 5B2NA 3CZ6A 1QHJA 2CNWD 2WB7A 2EIKC 3TQOA 4ZLDA 1OQCA 1TWHA 1Z5ZA 4QI1A 3RKOF 4KC9A 3BVDB 2QPEB 3ZPRA 4G7OF 2X72A 1XZPA 4U5CE 2J9VA 5T3TA 2LCHA 5E3AA 3SNHA 3EJNA 5A69A 3KMIA 3H65A 5L0IA 3H2VA 2PFDA 4QRYA 3U2LA 3ASNC 3DQBA 1NZEA 4K7BA 2KSYA 5B6YA 1VYKA 3EH4B 2G87A 3HLZA 2R7TA 2GAQA 3OE6A 4JEBA 5B35A 3ZTMA 1QZXA 2D5RB 3W8IA 3K7DA 3Q7GA 4JW1A 3QBLA 2Y02A 2XLMA 4KNFA 3ZEVA 2YZSA 1D1CA 1Q0MA 1R5ID 5AX1A 3UZAA 1H7IA 4BWBA 3W8HA 1BBHA 2L81A 3IQCA 1FBBA 1LE2A 3GODA 3DWWA 1FBKA 2FFHA 4AL0A 1LI7A 4MVMA 2Q4FA 4HE8D 4IB4A 3WG7C 4CS9A 1NLXA 2F22A 3MBVA 2YL1A 1VOMA 4E0HA 2PEDA 1ZW3A 4WJ0A 3RH3A 2A1DD 1J8MF 4HFFB 3T9OA 2I20A 3PMRA 3CEXA 3FXHA 4JJGA 4XLNF 5AHYA 2Q9BA 2NUPA 3AG1C 2VB6A 3W4YA 3U5SA 4Z9HA 4BV0A 3NMKA 3TOLA 2AWYA 3NSBA 4MTOA 4XPWA 1TWAA 4MVOA 1ST6A 2M3GA 4MQ9F 1UCQA 1M2OA 2B0JA 2LFDA 2VC9A 1S8LA 4G71B 2XM4A 3D4SA 1P8HA 3AYMA 1HE9A 1I5NA 3ZTZA 3JRMO 2F93A 4NTBA 1FNTc 5JLIA 1EKYA 5ITEA 1A7EA 2Q3TA 4XEVA 4A4AA 4XEKA 2P0NA 2TMVP 2AWCA 4MW8A 1FAPB 2NUTA 4GEHA 3QVYA 3S8GB 2XM0A 2X51A 1RXQA 3UTXA 1QPUA 1HMDA 2QNLA 3B71A 2NSFA 1D1AA 2B0HA 1FTSA 3AJMA 3EMLA 2G3KA 3EH3B 3L8JA 5JS5A 3L34A 5L0DA 3QBIA 3LNRA 2EPOA 1OKKA 4O6MA 1S7ZA 3JCUQ 2WJLA 5B6XA 1R84A 5H2KA 5KYWB 1EQ1A 2H7BA 1MQVA 2Y3BA 3X3CA 1EHKB 4XWJA 2HUJA 3LEVA 2LK4A 3ZQVA 4DRIB 2J0WA 2KS9A 1D0YA 5JSLA 1DOVA 4NTAA 3HNIA 4MVSA 2HV6A 1T9KA 4WGYA 4B6IA 1T6QA 4MW3A 4BJ5A 4XLPF 3DD7A 2Z15A 4P6IC 3ZWIA 2XXAB 3QVZA 4H54A 2R7QA 4CIPA 1Z23A 2O9XA 4PJNA 3SXYA 4J30B 3DE9A 3ZVRA 2M4EA 5DQTA 2YL0A 1E12A 3EG9B 4X1HA 1PD0A 4LLCA 1ZVZA 3AYNA 5L0FA 2WZFA 3MX3A 1IW7F 3EGDA 1Y4CA 3HANA 4L6RA 1FR0A 5T1DB 2VCBA 3ABLC 2LFFA 4BJ6C 2NUPB 5H2PA 3OA1A 1O5HA 5KKHA 3B0PA 2Z55A 1W2WA 1BRXA 3AG4C 1GM5A 2PX3A 3KH2A 3C8GA 4MD2A 3HAPA 4Q7CA 1CGNA 3C8GB 1YVIA 1HW2A 4PACA 1LM3B 4AMIA 4IWBA 2NPUA 4Z9IA 3EHMA 3PHF2 1JV6A 5A6BD 2Q7RA 1D0XA 4U5FE 4YT5A 1OW8A 2J46A 1UFBA 1LN6A 4MVQA 1FFTC 1YARO 3JTLO 3UTVA 2W9YA 3GM2A 2KNHA 3S27A 5KYWA 3EG9A 1QSPA 3JT1A 1SF8A 256BA 4YT2A 3NKEA 4C3DA 4IGGA 1PY6A 4KI2A 4PFPA 4XXJA 2R4SA 4LLEA 2BC5A 2YLGA 3LLIA 3UR3C 4OV0A 3HNKA 1L7CA 1RJ9B 2RD9A 1E86A 1F88A 3JYHA 3RFYA 3QJQB 4MVUA 4EBKA 1CPQA 4BJTA 1JPJA 2HKVA 1TWCA 5H2IA 3N2ZB 1C8SA 4DS7E 1P8UA 3DM9B 1CGOA 1JR8A 2CCYA 2ZXWC 3ABWA 1DOWA 2J0XA 3AOUA 3V2WA 3Q6NA 4GRVA 2YDVA 5L0GA 4E0IA 4CX9A 4I1MA 3HKKA 2H7VC 1U19A 1XMEB 5H2HA 2YKZA 4JURI 3UTYA 1OKKD 5BR2A 4P9TA 4XTOA 1TFKB 3U9MA 4NC3A 5EHHA 1A41A 5DLJA 3QW0A 4YT8A 3PDMP 1SMYF 3HAOA 5JUAA 5G2DA 2NG1A 4LACB 5DQZA 1AUEA 4BEMJ 4YL1A 3B29A 1LKXA 3WHNA 4X32A 2R7XA 1U6HA 1K05A 3PCVA 1PCXA 5A45A 3UONA 4XTKA 1ZHWA 4XTLA 1D0ZA 1A7DA 2HSBA 5HV9A 3T45A 3LNMB 3GEHA 2KQ9A 2LIGA 2XXAA 4KNVA 3RIPA 4ANJA 2R7UA 2J9WA 1I4YA 2BE5F 5F5HA 1PV3A 1S8JA 4QDLA 4DJHA 1AP9A 3IQ6A 1KNYA 1XJIA 4CIHA 3RVZA 4XPXA 2HMZA 2R7VA 3A11A 3K33A 2NTWA 1RJ9A 1J8YF 3T4RA 1RCPA 5BUOA 4GP8B 5AZDA 5DS4A 2I15A 3RQFA 2AVKA 1BDJB 3S8FB 1H9TA 4DBRA 4KBLA 1NG1A 1BRRA 3QTHA 2YDOA 4N4YB 5DHHA 1NSGB 3VVKA 1BR2A 4YK5A 4IAOA 1HZXA 3FAJA 3S90A 3KYJA 5F8UA 4JC7A 3KJ6A 5G28A 3JRTA 3S29A 2L7AA 4U5GA 3K6BA 2CDQA 3V5YA 2IBFA 1C3WA 3US6A 3PQRA 2L6HA 3TJ6A 3PXOA 3VRCA 1ZHXA 1F50A 5AX0A 2IXPA 1NBBA 1EI7A 4L35A 1MMAA 1E0PA 1HE1A 3C18A 4OD5A 1Q5JA 3EPVA 2G62A 4W8PA 1HMOA 4EWCA 2KSBA 4C7OB 5B6WA 5AGFA 3AGTA 3GM3A 2RSEB 3RQEA 1VMAA 5CI8A 4HWLA 3B0VC 5H2LA 3OE0A 2QTVA 1PXRA 1JGJA 2L6XA 2EPLX 3DM5A 4RDAA 1ZZPA 2A0UA 2ZFEA 1OCOC 5DS5A 5J7AA 3C62A 3U3FA 2J4YA 2Y3DA 1Q0DA 5DVWA 4JCZA 2EPNA 4JQ6A 3Q6MA 3AQCA 2CW0F 1XIOA 3MBGA 3EH1A 4G70B 2J7PD 1EA8A 1RKEB 4DOZA 4JIOA 4G78A 1CWQA 3UNGC 5JJJA 1YYXA 1SR2A 3NS0A 1TFOB 5EGYA 4G7ZF 3SXKA 4Q4ZF 5EN0A 3LUTB 1YZAA 4JZAA 3UMHA 2PX0A 2L9JA 1S52A 4Q5SF 3IPMO 1OW7A 4CS7A 1OCZC 3MLGA 4FA7B 5CIVA 2YL7A 1ZHYA 1YLMA 4C7OA 2P61A 4DKLA 1T5OA 3S3BB 3N0TA 3DAFA 1YYJA 5H2OA 2F95A 1VGOA 1RKCA 1JRAA 4U5EE 5E2QA 3ZSUA 3O6XA 3T6JA 4UG2A 3X3BA 1WGWA 1LIHA 4CS8A 1PD1A 2E87A 3LLKA 2G3VA 4IJJA 3I5QA 2GFHA 4GPOA 1CGME 3KYIA 3LAYA 2HPYA 3PDSA 3ZDLA 2ZXPA 2VCCA 3R2PA 4ZLCA 2WZLA 2J8WA 2H8AA 3ABKC 2GDCA 2HJ3A 3CAXA 5COFA 5B3IA 4YJWA 3UGPA 4XPYA 3F47A 4XT3A 4CDYA 3CODA 2YCWA 3NY8A 2QLAA 3PBLA 5KYUA 2I8BA 3ABMC 3SYNA 3X1OA 3L0IA 4YL0A 3WODF 1NU9C 2R25A 3IQTA 1O3UA 3SZRA 4CBEA 1Z6AA 4GBRA 3KKBA 2PF4E 4CS9C 4KLYA 1QQ3A 5KYUB 5F28E 3NDBB 4JRZA 2ZZLA 4HYXA 2KK1A 1MMDA 2OEVA 3TOMA 1Z3IX 3ATPA 1H6GA 1QKPA 5JT4A 1WASA 4DVYP 3FOOA 2W4MA 4W8KA 1GUEA 2XL8A 2EPMX 1BZ4A 4MVZA 1MMGA 3KPHA 3EZIA 4MS2A 1X0K1 5AC4A 1LE4A 1JMWA 4OIOF 5L0CA 2XLEA 3BEHA 2PNOA 4AE4A 2WVNA 4LDRA 4BEYA 4BPMA 2VCAA 2OKUA 1WN0A 1R2NA 3FVYA 2YHSA 1MMNA 4U5BE 4Y9HA 2R7WA 5GPGB 3VAYA 1M56C 1C17M 3UMKA 2R03A 3IEEA 2JD3A 3CQZA 1ZU4A 4BJ1A 5L3VA 1K40A 4O79A 1BRDA 5BQIA 3DKAA 4PJMA 4N6HA 3C8ZA 5JVEA 4DBQA 4DVZA 1G8XA 1RMVA 2OOCA 2XL6A 4MNDA 2KC3A 2H7OA 2JAGA 2VH3A 3NYAA 3GM1A 5D91A 2WJKA 3SXZA 2HMQA 2OU6A 1MNDA 4Z9JA 3DMDA 5H2MA 2ZXRA 5A6AA 1JPNA 3M4CA 4LDEA 4PXKA 4IAQA 1M57C 1KMEA 5B0WA 5JJEA 1GU8A 2IXOA 2QY9A 3QBKA 2A6HF 5G36A 2A0BA 5KYYA 3EFOB 5B6VA 3GWLA 4GYCA 4JE9A 1UG7A 4K1OA 2Y3GA 5JJNA 3NYMA 3LJBA 2HSQA 3RYLA 5A8EA 1PXSA 4J4QA 2HS5A 3FMSA 2YCZA 4J7YA 5DYSA 3C8GD 1ORYA 1ZW2A 1QM8A 4DRJB 2XRHA 3JZ0A 3RFMA 4TL3A 1B68A 4WGZA 3LESA 4AL1A 4QIDA 3QAKA 3OE9A 4JKVA 1WOLA 4UHRA 4FWVA 1N1CA 2ZPAA 4NCQA 5FJGA 3TK0A 4OD4A 1F4ZA 3JYYA 2LD6A 3QDCA 1FFHA 4BG0A 1GQAA 1NFOA 3QW1A 4BEJA 2HZ8A 2R7RA 2DYSC 2RH1A 5IY5C 5D92A 2C03A 3NYJA 1V55C 2VT4A 3LEOA 2Y39A 1AVOB 2PBEA 3HASA 3DE8A 2I1XA 4LDOA 3NYLA 5L3QA 3VYWA 5H2JA 4I44A 2XLDA 1H68A 4I3MA 2X0CA 5F5FA 3S9OA 4ULVA 3T6BA 2A6EF 2QPDB 3A7KA 1O87A 1E85A 1S05A 3TD7A 3K66A 3HNJA 5BR5A 4U5DE 2Y69C 4HEAJ 1QKRA 4CDVA 5JRAA 2ASRA 1H9GA 1OR3A 3DDLA 1P8IA 2AP3A 1YA7O 1L0MA 3GEIA 3C9LA 1A7VA 3K1IA 1FMVA 3T6GB 3HNLA 4EKWA 2L6GA 5B1AC 5DS6A 3L1MA 1TQGA 2LQGA 2R7SA 3U9JA 2ZIYA 4JVSA 2OEXA 4RD9A 3EGXB 1E83A 1C03A 1LVKA 3DJUB 2ICWG 2OJED 2Y01A 3NRHA 1M0KA 2R02A 1YAUO 3SN6R 4EBJA 2W4BA 4FX5A 4MTGA 2LP4A 1IZMA 5COMA 2OG2A 4EA3A 1VYIA 1X0SA 1U0BB 3U2MA 3TJ5A 1S51A 3UG9A 4E7SA 4WAVA 4KNWA 2YL3A 1V74B 3U0CA 3N24A 5FZTA 1A0BA 1TWGA 3NY9A 1QVXA 2CYDA 3VGAA 4XQ1A 3DZAA 1YZCA 2EIJC 3QMKA 2IYLD 4J32B 5FCLA 2DYRC 4G7QB 2Q9AA 4GP5B 5B3SC 3AQBA 5LWEA 4G72B 1XWJA 5HSWA 4PJJA 2A69F 1H2SA 3K1HA 3S84A 4MVRA 2QE9A 3OEOA 1ORSC 1E2XA 4N6CA 4MQTA 2KW3C 1M2VB 4U5HA 2DB4A 4G0HA 4E18A 2KSAA 4I1OB 3X2QC 3TULA 3OAXA 2R4RA 3JSEO 2IOQA 1TN0A 5E33A 3L8IA 1WTYA 1GS9A 3V5ZA 1LPEA 2MWQA 2LSEA 1KGBA 1AEPA 4MD1A
chains in the Genus database with same CATH topology
3PWHA 1JV6A 4DAJA 2Y00A 4GBRA 5H2NA 4D4XA 2XLVA 4LDLA 4KLYA 5TGZA 2YLDA 4GP4B 3UZCA 1QQ3A 1IXFA 1LN6A 2Y04A 3QJSB 3QAPA 4X31A 2ZZLA 4HYXA 4AMJA 3UTVA 1VJMA 3TOMA 1TN5A 4JR8A 3M79A 4JEAA 4G7RB 1X0I1 1QKPA 5JP7A 4MQSA 5JT4A 3FOPA 256BA 1S54A 4BUOA 4XT1A 4EJ4A 3FOOA 1PY6A 1GUEA 2XL8A 5G2AA 4XXJA 2R4SA 1X0K1 4XTNA 4PXFA 2BC5A 2YLGA 2I21A 3RZEA 4OV0A 4BVNA 3HNKA 5G53A 1DZEA 4MBSA 3U8PA 2XLEA 1E86A 3VW7A 2XLOA 3UTWA 1F88A 2I35A 3QJQB 2YLIA 1CPQA 4IARA 3C9MA 3QBGA 5H2IA 4BEYA 1M0MA 1C8SA 1R2NA 4DS7E 4D4NA 4HYJA 1P8UA 3NMIA 4Y9HA 1CGOA 1M6TA 2CCYA 3ABWA 3ODUA 3EH5B 3V2WA 4GRVA 3P0GA 4U9DA 5G54A 1BRDA 2YCYA 5B2NA 2YDVA 1QHJA 3M4BA 4CX9A 4N6HA 3CAPA 1U19A 2JAFA 1XMEB 5H2HA 2YKZA 3UTYA 5JVEA 4QI1A 5BR2A 3BVDB 4XTOA 1IW6A 3QJTB 2QPEB 3ZPRA 4NC3A 3QJRB 2XL6A 3QW0A 2X72A 2JAGA 3NYAA 4K5YA 3HAOA 5JUAA 5G2DA 2WJKA 1CPRA 1UAZA 4X32A 5H2MA 4A4MA 4QRYA 3DQBA 3M4CA 4LDEA 4PXKA 4IAQA 2KSYA 5A45A 3UONA 5B6YA 1KMEA 5B0WA 3EH4B 5JJEA 2G87A 1GU8A 4XTLA 3OE6A 4JEBA 5B35A 3ZTMA 5G2CA 3QBKA 3QBLA 3QJUB 2XLHA 3T45A 5G36A 1Q5IA 2Y02A 2XLMA 4KNFA 3ZEVA 3WQJA 5B6VA 4GYCA 5AX1A 4JE9A 3UZAA 4BWBA 1BBHA 1FBBA 4N4WA 1APCA 1S8JA 4DJHA 1AP9A 3IQ6A 1FBKA 1XJIA 5JJNA 2NTWA 5B6ZA 2YCXA 4IB4A 1RCPA 3COCA 5A8EA 1PXSA 3ZPQA 4CJGA 4J4QA 4GP8B 5AZDA 2YCZA 3MBVA 5DYSA 2YL1A 3S8FB 4ER9A 2PEDA 1BRRA 1QM8A 2YDOA 4N4YB 5DHHA 3VVKA 1GZMA 5AHZA 3HARA 3RFMA 4TL3A 4WGZA 1S53A 4QIDA 1HZXA 2I20A 3QAKA 3OE9A 4JKVA 5F8UA 5AHYA 4UHRA 3KJ6A 5G28A 3VG9A 4BV0A 3NMKA 3TOLA 5FJGA 3NSBA 1F4ZA 5AWZA 1JFPA 2J9BA 1C3WA 3PQRA 2M3GA 3PXOA 3QDCA 1L9HA 3VRCA 1UCQA 1GQAA 3QW1A 5B34A 4U9EA 1F50A 5AX0A 1NBBA 4L35A 1E0PA 2BRDA 2RH1A 1Q5JA 1AT9A 4G7SB 4G71B 1S8LA 2AT9A 2XM4A 2KSBA 5B6WA 5AGFA 3D4SA 2VT4A 1P8HA 3AYMA 3ZTZA 3HASA 4HWLA 3S3CB 3DE8A 2I1XA 2F93A 4LDOA 1O0AA 5H2LA 5JLIA 3OE0A 1PXRA 1JGJA 2L6XA 1EKYA 5ITEA 5H2JA 3IQ5A 2XLDA 1JV7A 1H68A 2ZFEA 2LNLA 3QVYA 5J7AA 3C62A 4ULVA 3S8GB 2XM0A 1BM1A 2J4YA 3UTXA 1QPUA 2QPDB 3A7KA 3EMLA 2EI4A 4JQ6A 1E85A 3EH3B 1S05A 5JS5A 3QBIA 4BEZA 3HNJA 5BR5A 1XIOA 3C63A 3S3DB 4G70B 3QJVB 4CDVA 5JRAA 4FPDA 1CWQA 2WJLA 5B6XA 1R84A 3DDLA 5H2KA 1IW9A 1P8IA 5JJJA 1YYXA 3ZQYA 1MQVA 4WW3A 3X3CA 1EHKB 1L0MA 4CJOA 3NS0A 3C9LA 1A7VA 3VI0A 3ZQVA 3HNLA 5EN0A 2KS9A 5JSLA 1YZAA 3L1MA 3HNIA 2ZIYA 3HAQA 4FBZA 1E84A 1S52A 1E83A 4WGYA 3VHZA 1C8RA 2Y01A 1MGYA 1M0KA 4FA7B 3SN6R 2YL7A 3REYA 3V2YA 3ZWIA 3QVZA 4DKLA 3M15A 1M0LA 5C1MA 4CIPA 3S3BB 1X0SA 4EA3A 1JAFA 1YYJA 1S51A 5H2OA 3UG9A 2F95A 1VGOA 4WAVA 2NTUA 2YL3A 1QKOA 3DE9A 3NMJA 2YL0A 4UG2A 1E12A 5DHGA 1KG8A 3X3BA 3NY9A 3VGAA 4X1HA 4FAAB 3AYNA 5ITCA 1YZCA 4G7QB 4GP5B 3HANA 4L6RA 5LWEA 4G72B 2XLWA 4EIYA 5H2PA 4GPOA 2HPYA 5A44A 3PDSA 1H2SA 2Z73A 5KKHA 2Z55A 2J8WA 1BRXA 1KG9A 2Y03A 3AM6A 4MQTA 5B3IA 3OE8A 4XT3A 4CDAA 2KSAA 3HAPA 4CDYA 3CODA 4MD2A 3OAXA 1CGNA 2R4RA 2YCWA 3NY8A 3PBLA 2QLAA 1TN0A 5ETZA 1LM3B 1KGBA 4AMIA 4MD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PWH A;  1JV6 A;  4DAJ A;  2Y00 A;  4GBR A;  5H2N A;  4D4X A;  2XLV A;  4LDL A;  4KLY A;  5TGZ A;  2YLD A;  4GP4 B;  3UZC A;  1QQ3 A;  1IXF A;  1LN6 A;  2Y04 A;  3QJS B;  3QAP A;  4X31 A;  2ZZL A;  4HYX A;  4AMJ A;  3UTV A;  1VJM A;  3TOM A;  1TN5 A;  4JR8 A;  3M79 A;  4JEA A;  4G7R B;  1X0I 1;  1QKP A;  5JP7 A;  4MQS A;  5JT4 A;  3FOP A;  256B A;  1S54 A;  4BUO A;  4XT1 A;  4EJ4 A;  3FOO A;  1PY6 A;  1GUE A;  2XL8 A;  5G2A A;  4XXJ A;  2R4S A;  1X0K 1;  4XTN A;  4PXF A;  2BC5 A;  2YLG A;  2I21 A;  3RZE A;  4OV0 A;  4BVN A;  3HNK A;  5G53 A;  1DZE A;  4MBS A;  3U8P A;  2XLE A;  1E86 A;  3VW7 A;  2XLO A;  3UTW A;  1F88 A;  2I35 A;  3QJQ B;  2YLI A;  1CPQ A;  4IAR A;  3C9M A;  3QBG A;  5H2I A;  4BEY A;  1M0M A;  1C8S A;  1R2N A;  4D4N A;  4HYJ A;  1P8U A;  3NMI A;  4Y9H A;  1CGO A;  1M6T A;  2CCY A;  3ABW A;  3ODU A;  3EH5 B;  3V2W A;  4GRV A;  3P0G A;  4U9D A;  5G54 A;  1BRD A;  2YCY A;  5B2N A;  2YDV A;  1QHJ A;  3M4B A;  4CX9 A;  4N6H A;  3CAP A;  1U19 A;  2JAF A;  1XME B;  5H2H A;  2YKZ A;  3UTY A;  5JVE A;  4QI1 A;  5BR2 A;  3BVD B;  4XTO A;  1IW6 A;  3QJT B;  2QPE B;  3ZPR A;  4NC3 A;  3QJR B;  2XL6 A;  3QW0 A;  2X72 A;  2JAG A;  3NYA A;  4K5Y A;  3HAO A;  5JUA A;  5G2D A;  2WJK A;  1CPR A;  1UAZ A;  4X32 A;  5H2M A;  4A4M A;  4QRY A;  3DQB A;  3M4C A;  4LDE A;  4PXK A;  4IAQ A;  2KSY A;  5A45 A;  3UON A;  5B6Y A;  1KME A;  5B0W A;  3EH4 B;  5JJE A;  2G87 A;  1GU8 A;  4XTL A;  3OE6 A;  4JEB A;  5B35 A;  3ZTM A;  5G2C A;  3QBK A;  3QBL A;  3QJU B;  2XLH A;  3T45 A;  5G36 A;  1Q5I A;  2Y02 A;  2XLM A;  4KNF A;  3ZEV A;  3WQJ A;  5B6V A;  4GYC A;  5AX1 A;  4JE9 A;  3UZA A;  4BWB A;  1BBH A;  1FBB A;  4N4W A;  1APC A;  1S8J A;  4DJH A;  1AP9 A;  3IQ6 A;  1FBK A;  1XJI A;  5JJN A;  2NTW A;  5B6Z A;  2YCX A;  4IB4 A;  1RCP A;  3COC A;  5A8E A;  1PXS A;  3ZPQ A;  4CJG A;  4J4Q A;  4GP8 B;  5AZD A;  2YCZ A;  3MBV A;  5DYS A;  2YL1 A;  3S8F B;  4ER9 A;  2PED A;  1BRR A;  1QM8 A;  2YDO A;  4N4Y B;  5DHH A;  3VVK A;  1GZM A;  5AHZ A;  3HAR A;  3RFM A;  4TL3 A;  4WGZ A;  1S53 A;  4QID A;  1HZX A;  2I20 A;  3QAK A;  3OE9 A;  4JKV A;  5F8U A;  5AHY A;  4UHR A;  3KJ6 A;  5G28 A;  3VG9 A;  4BV0 A;  3NMK A;  3TOL A;  5FJG A;  3NSB A;  1F4Z A;  5AWZ A;  1JFP A;  2J9B A;  1C3W A;  3PQR A;  2M3G A;  3PXO A;  3QDC A;  1L9H A;  3VRC A;  1UCQ A;  1GQA A;  3QW1 A;  5B34 A;  4U9E A;  1F50 A;  5AX0 A;  1NBB A;  4L35 A;  1E0P A;  2BRD A;  2RH1 A;  1Q5J A;  1AT9 A;  4G7S B;  4G71 B;  1S8L A;  2AT9 A;  2XM4 A;  2KSB A;  5B6W A;  5AGF A;  3D4S A;  2VT4 A;  1P8H A;  3AYM A;  3ZTZ A;  3HAS A;  4HWL A;  3S3C B;  3DE8 A;  2I1X A;  2F93 A;  4LDO A;  1O0A A;  5H2L A;  5JLI A;  3OE0 A;  1PXR A;  1JGJ A;  2L6X A;  1EKY A;  5ITE A;  5H2J A;  3IQ5 A;  2XLD A;  1JV7 A;  1H68 A;  2ZFE A;  2LNL A;  3QVY A;  5J7A A;  3C62 A;  4ULV A;  3S8G B;  2XM0 A;  1BM1 A;  2J4Y A;  3UTX A;  1QPU A;  2QPD B;  3A7K A;  3EML A;  2EI4 A;  4JQ6 A;  1E85 A;  3EH3 B;  1S05 A;  5JS5 A;  3QBI A;  4BEZ A;  3HNJ A;  5BR5 A;  1XIO A;  3C63 A;  3S3D B;  4G70 B;  3QJV B;  4CDV A;  5JRA A;  4FPD A;  1CWQ A;  2WJL A;  5B6X A;  1R84 A;  3DDL A;  5H2K A;  1IW9 A;  1P8I A;  5JJJ A;  1YYX A;  3ZQY A;  1MQV A;  4WW3 A;  3X3C A;  1EHK B;  1L0M A;  4CJO A;  3NS0 A;  3C9L A;  1A7V A;  3VI0 A;  3ZQV A;  3HNL A;  5EN0 A;  2KS9 A;  5JSL A;  1YZA A;  3L1M A;  3HNI A;  2ZIY A;  3HAQ A;  4FBZ A;  1E84 A;  1S52 A;  1E83 A;  4WGY A;  3VHZ A;  1C8R A;  2Y01 A;  1MGY A;  1M0K A;  4FA7 B;  3SN6 R;  2YL7 A;  3REY A;  3V2Y A;  3ZWI A;  3QVZ A;  4DKL A;  3M15 A;  1M0L A;  5C1M A;  4CIP A;  3S3B B;  1X0S A;  4EA3 A;  1JAF A;  1YYJ A;  1S51 A;  5H2O A;  3UG9 A;  2F95 A;  1VGO A;  4WAV A;  2NTU A;  2YL3 A;  1QKO A;  3DE9 A;  3NMJ A;  2YL0 A;  4UG2 A;  1E12 A;  5DHG A;  1KG8 A;  3X3B A;  3NY9 A;  3VGA A;  4X1H A;  4FAA B;  3AYN A;  5ITC A;  1YZC A;  4G7Q B;  4GP5 B;  3HAN A;  4L6R A;  5LWE A;  4G72 B;  2XLW A;  4EIY A;  5H2P A;  4GPO A;  2HPY A;  5A44 A;  3PDS A;  1H2S A;  2Z73 A;  5KKH A;  2Z55 A;  2J8W A;  1BRX A;  1KG9 A;  2Y03 A;  3AM6 A;  4MQT A;  5B3I A;  3OE8 A;  4XT3 A;  4CDA A;  2KSA A;  3HAP A;  4CDY A;  3COD A;  4MD2 A;  3OAX A;  1CGN A;  2R4R A;  2YCW A;  3NY8 A;  3PBL A;  2QLA A;  1TN0 A;  5ETZ A;  1LM3 B;  1KGB A;  4AMI A;  4MD1 A; 
#chains in the Genus database with same CATH topology
 1K04 A;  3S0X A;  3A9C A;  3AG2 C;  3EH2 A;  5H2N A;  4D4X A;  3NKD A;  4LDL A;  3UZC A;  2D4U A;  3EFO A;  3RW0 A;  3QJS B;  1G4U S;  4C3B A;  3QAP A;  1OR2 A;  3ZC4 A;  4X31 A;  1VJM A;  3OWT A;  3CSK A;  4XEF A;  4G7R B;  5JP7 A;  1OCR C;  1F1M A;  2J45 A;  4MQS A;  2KSF A;  4BUO A;  4X0R A;  2OCC C;  3J06 A;  2EPK X;  1BR4 A;  1OCC C;  4AK9 A;  4IRU A;  5A6K A;  1GGQ A;  4XTN A;  2I21 A;  3IHU A;  1DZE A;  4MBS A;  3VW7 A;  2XLO A;  5L0H A;  4YT4 A;  2I35 A;  1G5Z A;  4IAR A;  4G7H F;  3QBG A;  4OIQ F;  4D4N A;  4HYJ A;  3NMI A;  2EIM C;  4DJ9 A;  1OXK A;  2CNW A;  5TJ5 E;  4BJ5 C;  4RBN A;  3U8V A;  2WZG A;  3GEE A;  4LDQ A;  2KJG A;  1ZHZ A;  4NY3 A;  2YCY A;  3BRJ A;  5KYX A;  3AGU A;  4PR9 A;  2P6V A;  3LS0 A;  2QUP A;  2HJM A;  3M4B A;  3CAP A;  2EIN C;  1JOG A;  3K1I C;  2JAF A;  2GWW A;  1TR2 A;  4EUK B;  1IW6 A;  3QJT B;  2IM8 A;  1R4T A;  3QJR B;  4A2N B;  4K5Y A;  1T6I A;  2ZD9 A;  1CPR A;  2KYH A;  4JTD B;  4E17 A;  1HW1 A;  1VLT A;  4WAB A;  4YN0 B;  1UAZ A;  3HTK C;  1Q0K A;  1Y6D A;  4A4M A;  3W2V A;  4PFO A;  2CGE A;  1KTM A;  3EGX A;  2HFI A;  5EK0 A;  5G2C A;  1VK5 A;  4GYT A;  5CI9 A;  3QJU B;  2XLH A;  2DGJ A;  2R05 A;  1Q5I A;  4J7T A;  3WQJ A;  4CS8 C;  4DXW A;  4EBB A;  1I4Z A;  2WVO A;  3UMI A;  3VF0 A;  4JCH A;  4N4W A;  1APC A;  1NFN A;  2L6F A;  5KYX B;  3FHD A;  1SZI A;  2J9U A;  5B6Z A;  5T3W A;  2YCX A;  1Z63 A;  1HY5 A;  4O6Y A;  3COC A;  3ZPQ A;  4CJG A;  2Q9C A;  3HJC A;  2VAS A;  2XSE A;  3V7O A;  3O55 A;  4ER9 A;  4YL3 A;  1GZM A;  5AHZ A;  3HAR A;  1S53 A;  3EHN A;  4QI0 A;  1SYQ A;  3MYF A;  4JTA B;  3G50 A;  3VG9 A;  4GQH A;  2Y3H A;  4ULW A;  3I5P A;  2Q00 A;  1C02 A;  4O6N A;  5AWZ A;  2MHR A;  1JFP A;  2J9B A;  2JX0 A;  2NUT B;  4MTF A;  4DRH B;  1L9H A;  3V5X A;  4LER A;  4OIR F;  5B34 A;  4U9E A;  2XS8 A;  4LDK A;  4P9F A;  2BRD A;  4QI2 A;  1LS4 A;  3SP1 A;  1AT9 A;  4G7S B;  2AT9 A;  3W2W A;  1YDI A;  3MFN A;  4JJF A;  1M2V A;  4C3E A;  4FAP B;  3S3C B;  4F4B A;  3MYI A;  1O0A A;  2WVQ A;  1T6U A;  2YEV A;  2P7V A;  3IQ5 A;  1ZYR F;  1BR1 A;  4OIN F;  1XZQ A;  1JV7 A;  2R7O A;  3DI5 A;  1YJG A;  2OJQ A;  2LNL A;  1Z7Q c;  1BM1 A;  3F46 A;  1U89 A;  2EI4 A;  4BEZ A;  2BL2 A;  1MNE A;  3C63 A;  2V3C C;  2XL4 A;  3S3D B;  1L3P A;  5E3C A;  3QJV B;  4FPD A;  3ASO C;  1IW9 A;  2PP4 A;  2NSG A;  3ZQY A;  3DXJ F;  3LS1 A;  4FES A;  4WW3 A;  4CJO A;  1TKN A;  1OW6 A;  1ZHT A;  5A6B A;  3VI0 A;  3GAN A;  2V26 A;  3G4Z A;  2YVK A;  3NG1 A;  1VTM P;  5K0I A;  3G4X A;  3HAQ A;  4FBZ A;  1V54 C;  1E84 A;  4JTC B;  3GOR A;  3U3B A;  3VHZ A;  1T01 A;  1C8R A;  1MGY A;  1LI5 A;  5KYY B;  3REY A;  3V2Y A;  3VM6 A;  3M15 A;  4OIP F;  1M0L A;  5C1M A;  3ECS A;  3QZC A;  1JAF A;  2GA0 A;  3AG3 C;  3ZG1 A;  2NTU A;  3RVY A;  2JPU A;  3JSZ A;  1QKO A;  3NMJ A;  3ZIB A;  1QLE C;  3RQG A;  5DHG A;  3O39 A;  3EZH A;  1KG8 A;  1ZU5 A;  3UGO A;  3ITF A;  4N06 A;  4FAA B;  5ITC A;  3B9Q A;  3EGD B;  1Q0G A;  5BQH A;  2EIL C;  2W45 A;  3WAQ A;  4E7Z A;  2FAP B;  4ONS A;  4H4K C;  4BJ6 A;  2XLW A;  4EIY A;  1LS1 A;  5A44 A;  1WWP A;  2ZXO A;  3S28 A;  2Z73 A;  5COG A;  2AU5 A;  2XS1 A;  5AC5 A;  1KG9 A;  2Y03 A;  3AM6 A;  3H2U A;  5L0J A;  3OE8 A;  4CDA A;  2YRF A;  2YWA A;  2KGO A;  3SXM A;  1NU7 D;  3I4U A;  5ETZ A;  2A68 F;  4NTF A;  4CSA A;  3DAG A;  2R9R B;  3PWH A;  3SEO A;  2IXM A;  4DAJ A;  3RF3 A;  2Y00 A;  1VLS A;  4K0D A;  4AE4 B;  1Q0F A;  4O7G A;  2XLV A;  4AX2 A;  4PJL A;  5TGZ A;  1VB5 A;  2YLD A;  2UUH A;  4GP4 B;  1IXF A;  4R32 A;  2P1A A;  4UDV A;  2Y04 A;  4HFK B;  3FAP B;  4AMJ A;  1TN5 A;  4JR8 A;  3M79 A;  2YQY A;  4JEA A;  4NQF A;  1X0I 1;  3M1C B;  2MYS A;  5A6J A;  1RKE A;  3R7C A;  3E9V A;  5KYN A;  1FMW A;  3FOP A;  1S54 A;  4XT1 A;  4EJ4 A;  3Q7L A;  4CSA C;  1OXB A;  2HV7 A;  1KU2 A;  5G2A A;  3O10 A;  4PK4 A;  3GWN A;  2C04 A;  2UUI A;  4PXF A;  4M63 A;  4EHP A;  3RZE A;  4BVN A;  5G53 A;  3U8P A;  2DI3 A;  2ETS A;  5B1B C;  3UTW A;  1V4A A;  2YLI A;  2OQM A;  3DJN B;  3FDQ A;  3POV A;  3C9M A;  3B0U X;  2FGY A;  1M0M A;  2M64 A;  3C7J A;  3E70 C;  1M6T A;  1D1B A;  2IXN A;  1G4W R;  3ODU A;  2WL8 A;  4YWQ A;  2J7P A;  3KL4 A;  3EH5 B;  1ORJ A;  3P0G A;  4U9D A;  3EQL F;  5G54 A;  5BQG A;  1WAT A;  1YA9 A;  5B2N A;  3CZ6 A;  1QHJ A;  2CNW D;  2WB7 A;  2EIK C;  3TQO A;  4ZLD A;  1OQC A;  1TWH A;  1Z5Z A;  4QI1 A;  3RKO F;  4KC9 A;  3BVD B;  2QPE B;  3ZPR A;  4G7O F;  2X72 A;  1XZP A;  4U5C E;  2J9V A;  5T3T A;  2LCH A;  5E3A A;  3SNH A;  3EJN A;  5A69 A;  3KMI A;  3H65 A;  5L0I A;  3H2V A;  2PFD A;  4QRY A;  3U2L A;  3ASN C;  3DQB A;  1NZE A;  4K7B A;  2KSY A;  5B6Y A;  1VYK A;  3EH4 B;  2G87 A;  3HLZ A;  2R7T A;  2GAQ A;  3OE6 A;  4JEB A;  5B35 A;  3ZTM A;  1QZX A;  2D5R B;  3W8I A;  3K7D A;  3Q7G A;  4JW1 A;  3QBL A;  2Y02 A;  2XLM A;  4KNF A;  3ZEV A;  2YZS A;  1D1C A;  1Q0M A;  1R5I D;  5AX1 A;  3UZA A;  1H7I A;  4BWB A;  3W8H A;  1BBH A;  2L81 A;  3IQC A;  1FBB A;  1LE2 A;  3GOD A;  3DWW A;  1FBK A;  2FFH A;  4AL0 A;  1LI7 A;  4MVM A;  2Q4F A;  4HE8 D;  4IB4 A;  3WG7 C;  4CS9 A;  1NLX A;  2F22 A;  3MBV A;  2YL1 A;  1VOM A;  4E0H A;  2PED A;  1ZW3 A;  4WJ0 A;  3RH3 A;  2A1D D;  1J8M F;  4HFF B;  3T9O A;  2I20 A;  3PMR A;  3CEX A;  3FXH A;  4JJG A;  4XLN F;  5AHY A;  2Q9B A;  2NUP A;  3AG1 C;  2VB6 A;  3W4Y A;  3U5S A;  4Z9H A;  4BV0 A;  3NMK A;  3TOL A;  2AWY A;  3NSB A;  4MTO A;  4XPW A;  1TWA A;  4MVO A;  1ST6 A;  2M3G A;  4MQ9 F;  1UCQ A;  1M2O A;  2B0J A;  2LFD A;  2VC9 A;  1S8L A;  4G71 B;  2XM4 A;  3D4S A;  1P8H A;  3AYM A;  1HE9 A;  1I5N A;  3ZTZ A;  3JRM O;  2F93 A;  4NTB A;  1FNT c;  5JLI A;  1EKY A;  5ITE A;  1A7E A;  2Q3T A;  4XEV A;  4A4A A;  4XEK A;  2P0N A;  2TMV P;  2AWC A;  4MW8 A;  1FAP B;  2NUT A;  4GEH A;  3QVY A;  3S8G B;  2XM0 A;  2X51 A;  1RXQ A;  3UTX A;  1QPU A;  1HMD A;  2QNL A;  3B71 A;  2NSF A;  1D1A A;  2B0H A;  1FTS A;  3AJM A;  3EML A;  2G3K A;  3EH3 B;  3L8J A;  5JS5 A;  3L34 A;  5L0D A;  3QBI A;  3LNR A;  2EPO A;  1OKK A;  4O6M A;  1S7Z A;  3JCU Q;  2WJL A;  5B6X A;  1R84 A;  5H2K A;  5KYW B;  1EQ1 A;  2H7B A;  1MQV A;  2Y3B A;  3X3C A;  1EHK B;  4XWJ A;  2HUJ A;  3LEV A;  2LK4 A;  3ZQV A;  4DRI B;  2J0W A;  2KS9 A;  1D0Y A;  5JSL A;  1DOV A;  4NTA A;  3HNI A;  4MVS A;  2HV6 A;  1T9K A;  4WGY A;  4B6I A;  1T6Q A;  4MW3 A;  4BJ5 A;  4XLP F;  3DD7 A;  2Z15 A;  4P6I C;  3ZWI A;  2XXA B;  3QVZ A;  4H54 A;  2R7Q A;  4CIP A;  1Z23 A;  2O9X A;  4PJN A;  3SXY A;  4J30 B;  3DE9 A;  3ZVR A;  2M4E A;  5DQT A;  2YL0 A;  1E12 A;  3EG9 B;  4X1H A;  1PD0 A;  4LLC A;  1ZVZ A;  3AYN A;  5L0F A;  2WZF A;  3MX3 A;  1IW7 F;  3EGD A;  1Y4C A;  3HAN A;  4L6R A;  1FR0 A;  5T1D B;  2VCB A;  3ABL C;  2LFF A;  4BJ6 C;  2NUP B;  5H2P A;  3OA1 A;  1O5H A;  5KKH A;  3B0P A;  2Z55 A;  1W2W A;  1BRX A;  3AG4 C;  1GM5 A;  2PX3 A;  3KH2 A;  3C8G A;  4MD2 A;  3HAP A;  4Q7C A;  1CGN A;  3C8G B;  1YVI A;  1HW2 A;  4PAC A;  1LM3 B;  4AMI A;  4IWB A;  2NPU A;  4Z9I A;  3EHM A;  3PHF 2;  1JV6 A;  5A6B D;  2Q7R A;  1D0X A;  4U5F E;  4YT5 A;  1OW8 A;  2J46 A;  1UFB A;  1LN6 A;  4MVQ A;  1FFT C;  1YAR O;  3JTL O;  3UTV A;  2W9Y A;  3GM2 A;  2KNH A;  3S27 A;  5KYW A;  3EG9 A;  1QSP A;  3JT1 A;  1SF8 A;  256B A;  4YT2 A;  3NKE A;  4C3D A;  4IGG A;  1PY6 A;  4KI2 A;  4PFP A;  4XXJ A;  2R4S A;  4LLE A;  2BC5 A;  2YLG A;  3LLI A;  3UR3 C;  4OV0 A;  3HNK A;  1L7C A;  1RJ9 B;  2RD9 A;  1E86 A;  1F88 A;  3JYH A;  3RFY A;  3QJQ B;  4MVU A;  4EBK A;  1CPQ A;  4BJT A;  1JPJ A;  2HKV A;  1TWC A;  5H2I A;  3N2Z B;  1C8S A;  4DS7 E;  1P8U A;  3DM9 B;  1CGO A;  1JR8 A;  2CCY A;  2ZXW C;  3ABW A;  1DOW A;  2J0X A;  3AOU A;  3V2W A;  3Q6N A;  4GRV A;  2YDV A;  5L0G A;  4E0I A;  4CX9 A;  4I1M A;  3HKK A;  2H7V C;  1U19 A;  1XME B;  5H2H A;  2YKZ A;  4JUR I;  3UTY A;  1OKK D;  5BR2 A;  4P9T A;  4XTO A;  1TFK B;  3U9M A;  4NC3 A;  5EHH A;  1A41 A;  5DLJ A;  3QW0 A;  4YT8 A;  3PDM P;  1SMY F;  3HAO A;  5JUA A;  5G2D A;  2NG1 A;  4LAC B;  5DQZ A;  1AUE A;  4BEM J;  4YL1 A;  3B29 A;  1LKX A;  3WHN A;  4X32 A;  2R7X A;  1U6H A;  1K05 A;  3PCV A;  1PCX A;  5A45 A;  3UON A;  4XTK A;  1ZHW A;  4XTL A;  1D0Z A;  1A7D A;  2HSB A;  5HV9 A;  3T45 A;  3LNM B;  3GEH A;  2KQ9 A;  2LIG A;  2XXA A;  4KNV A;  3RIP A;  4ANJ A;  2R7U A;  2J9W A;  1I4Y A;  2BE5 F;  5F5H A;  1PV3 A;  1S8J A;  4QDL A;  4DJH A;  1AP9 A;  3IQ6 A;  1KNY A;  1XJI A;  4CIH A;  3RVZ A;  4XPX A;  2HMZ A;  2R7V A;  3A11 A;  3K33 A;  2NTW A;  1RJ9 A;  1J8Y F;  3T4R A;  1RCP A;  5BUO A;  4GP8 B;  5AZD A;  5DS4 A;  2I15 A;  3RQF A;  2AVK A;  1BDJ B;  3S8F B;  1H9T A;  4DBR A;  4KBL A;  1NG1 A;  1BRR A;  3QTH A;  2YDO A;  4N4Y B;  5DHH A;  1NSG B;  3VVK A;  1BR2 A;  4YK5 A;  4IAO A;  1HZX A;  3FAJ A;  3S90 A;  3KYJ A;  5F8U A;  4JC7 A;  3KJ6 A;  5G28 A;  3JRT A;  3S29 A;  2L7A A;  4U5G A;  3K6B A;  2CDQ A;  3V5Y A;  2IBF A;  1C3W A;  3US6 A;  3PQR A;  2L6H A;  3TJ6 A;  3PXO A;  3VRC A;  1ZHX A;  1F50 A;  5AX0 A;  2IXP A;  1NBB A;  1EI7 A;  4L35 A;  1MMA A;  1E0P A;  1HE1 A;  3C18 A;  4OD5 A;  1Q5J A;  3EPV A;  2G62 A;  4W8P A;  1HMO A;  4EWC A;  2KSB A;  4C7O B;  5B6W A;  5AGF A;  3AGT A;  3GM3 A;  2RSE B;  3RQE A;  1VMA A;  5CI8 A;  4HWL A;  3B0V C;  5H2L A;  3OE0 A;  2QTV A;  1PXR A;  1JGJ A;  2L6X A;  2EPL X;  3DM5 A;  4RDA A;  1ZZP A;  2A0U A;  2ZFE A;  1OCO C;  5DS5 A;  5J7A A;  3C62 A;  3U3F A;  2J4Y A;  2Y3D A;  1Q0D A;  5DVW A;  4JCZ A;  2EPN A;  4JQ6 A;  3Q6M A;  3AQC A;  2CW0 F;  1XIO A;  3MBG A;  3EH1 A;  4G70 B;  2J7P D;  1EA8 A;  1RKE B;  4DOZ A;  4JIO A;  4G78 A;  1CWQ A;  3UNG C;  5JJJ A;  1YYX A;  1SR2 A;  3NS0 A;  1TFO B;  5EGY A;  4G7Z F;  3SXK A;  4Q4Z F;  5EN0 A;  3LUT B;  1YZA A;  4JZA A;  3UMH A;  2PX0 A;  2L9J A;  1S52 A;  4Q5S F;  3IPM O;  1OW7 A;  4CS7 A;  1OCZ C;  3MLG A;  4FA7 B;  5CIV A;  2YL7 A;  1ZHY A;  1YLM A;  4C7O A;  2P61 A;  4DKL A;  1T5O A;  3S3B B;  3N0T A;  3DAF A;  1YYJ A;  5H2O A;  2F95 A;  1VGO A;  1RKC A;  1JRA A;  4U5E E;  5E2Q A;  3ZSU A;  3O6X A;  3T6J A;  4UG2 A;  3X3B A;  1WGW A;  1LIH A;  4CS8 A;  1PD1 A;  2E87 A;  3LLK A;  2G3V A;  4IJJ A;  3I5Q A;  2GFH A;  4GPO A;  1CGM E;  3KYI A;  3LAY A;  2HPY A;  3PDS A;  3ZDL A;  2ZXP A;  2VCC A;  3R2P A;  4ZLC A;  2WZL A;  2J8W A;  2H8A A;  3ABK C;  2GDC A;  2HJ3 A;  3CAX A;  5COF A;  5B3I A;  4YJW A;  3UGP A;  4XPY A;  3F47 A;  4XT3 A;  4CDY A;  3COD A;  2YCW A;  3NY8 A;  2QLA A;  3PBL A;  5KYU A;  2I8B A;  3ABM C;  3SYN A;  3X1O A;  3L0I A;  4YL0 A;  3WOD F;  1NU9 C;  2R25 A;  3IQT A;  1O3U A;  3SZR A;  4CBE A;  1Z6A A;  4GBR A;  3KKB A;  2PF4 E;  4CS9 C;  4KLY A;  1QQ3 A;  5KYU B;  5F28 E;  3NDB B;  4JRZ A;  2ZZL A;  4HYX A;  2KK1 A;  1MMD A;  2OEV A;  3TOM A;  1Z3I X;  3ATP A;  1H6G A;  1QKP A;  5JT4 A;  1WAS A;  4DVY P;  3FOO A;  2W4M A;  4W8K A;  1GUE A;  2XL8 A;  2EPM X;  1BZ4 A;  4MVZ A;  1MMG A;  3KPH A;  3EZI A;  4MS2 A;  1X0K 1;  5AC4 A;  1LE4 A;  1JMW A;  4OIO F;  5L0C A;  2XLE A;  3BEH A;  2PNO A;  4AE4 A;  2WVN A;  4LDR A;  4BEY A;  4BPM A;  2VCA A;  2OKU A;  1WN0 A;  1R2N A;  3FVY A;  2YHS A;  1MMN A;  4U5B E;  4Y9H A;  2R7W A;  5GPG B;  3VAY A;  1M56 C;  1C17 M;  3UMK A;  2R03 A;  3IEE A;  2JD3 A;  3CQZ A;  1ZU4 A;  4BJ1 A;  5L3V A;  1K40 A;  4O79 A;  1BRD A;  5BQI A;  3DKA A;  4PJM A;  4N6H A;  3C8Z A;  5JVE A;  4DBQ A;  4DVZ A;  1G8X A;  1RMV A;  2OOC A;  2XL6 A;  4MND A;  2KC3 A;  2H7O A;  2JAG A;  2VH3 A;  3NYA A;  3GM1 A;  5D91 A;  2WJK A;  3SXZ A;  2HMQ A;  2OU6 A;  1MND A;  4Z9J A;  3DMD A;  5H2M A;  2ZXR A;  5A6A A;  1JPN A;  3M4C A;  4LDE A;  4PXK A;  4IAQ A;  1M57 C;  1KME A;  5B0W A;  5JJE A;  1GU8 A;  2IXO A;  2QY9 A;  3QBK A;  2A6H F;  5G36 A;  2A0B A;  5KYY A;  3EFO B;  5B6V A;  3GWL A;  4GYC A;  4JE9 A;  1UG7 A;  4K1O A;  2Y3G A;  5JJN A;  3NYM A;  3LJB A;  2HSQ A;  3RYL A;  5A8E A;  1PXS A;  4J4Q A;  2HS5 A;  3FMS A;  2YCZ A;  4J7Y A;  5DYS A;  3C8G D;  1ORY A;  1ZW2 A;  1QM8 A;  4DRJ B;  2XRH A;  3JZ0 A;  3RFM A;  4TL3 A;  1B68 A;  4WGZ A;  3LES A;  4AL1 A;  4QID A;  3QAK A;  3OE9 A;  4JKV A;  1WOL A;  4UHR A;  4FWV A;  1N1C A;  2ZPA A;  4NCQ A;  5FJG A;  3TK0 A;  4OD4 A;  1F4Z A;  3JYY A;  2LD6 A;  3QDC A;  1FFH A;  4BG0 A;  1GQA A;  1NFO A;  3QW1 A;  4BEJ A;  2HZ8 A;  2R7R A;  2DYS C;  2RH1 A;  5IY5 C;  5D92 A;  2C03 A;  3NYJ A;  1V55 C;  2VT4 A;  3LEO A;  2Y39 A;  1AVO B;  2PBE A;  3HAS A;  3DE8 A;  2I1X A;  4LDO A;  3NYL A;  5L3Q A;  3VYW A;  5H2J A;  4I44 A;  2XLD A;  1H68 A;  4I3M A;  2X0C A;  5F5F A;  3S9O A;  4ULV A;  3T6B A;  2A6E F;  2QPD B;  3A7K A;  1O87 A;  1E85 A;  1S05 A;  3TD7 A;  3K66 A;  3HNJ A;  5BR5 A;  4U5D E;  2Y69 C;  4HEA J;  1QKR A;  4CDV A;  5JRA A;  2ASR A;  1H9G A;  1OR3 A;  3DDL A;  1P8I A;  2AP3 A;  1YA7 O;  1L0M A;  3GEI A;  3C9L A;  1A7V A;  3K1I A;  1FMV A;  3T6G B;  3HNL A;  4EKW A;  2L6G A;  5B1A C;  5DS6 A;  3L1M A;  1TQG A;  2LQG A;  2R7S A;  3U9J A;  2ZIY A;  4JVS A;  2OEX A;  4RD9 A;  3EGX B;  1E83 A;  1C03 A;  1LVK A;  3DJU B;  2ICW G;  2OJE D;  2Y01 A;  3NRH A;  1M0K A;  2R02 A;  1YAU O;  3SN6 R;  4EBJ A;  2W4B A;  4FX5 A;  4MTG A;  2LP4 A;  1IZM A;  5COM A;  2OG2 A;  4EA3 A;  1VYI A;  1X0S A;  1U0B B;  3U2M A;  3TJ5 A;  1S51 A;  3UG9 A;  4E7S A;  4WAV A;  4KNW A;  2YL3 A;  1V74 B;  3U0C A;  3N24 A;  5FZT A;  1A0B A;  1TWG A;  3NY9 A;  1QVX A;  2CYD A;  3VGA A;  4XQ1 A;  3DZA A;  1YZC A;  2EIJ C;  3QMK A;  2IYL D;  4J32 B;  5FCL A;  2DYR C;  4G7Q B;  2Q9A A;  4GP5 B;  5B3S C;  3AQB A;  5LWE A;  4G72 B;  1XWJ A;  5HSW A;  4PJJ A;  2A69 F;  1H2S A;  3K1H A;  3S84 A;  4MVR A;  2QE9 A;  3OEO A;  1ORS C;  1E2X A;  4N6C A;  4MQT A;  2KW3 C;  1M2V B;  4U5H A;  2DB4 A;  4G0H A;  4E18 A;  2KSA A;  4I1O B;  3X2Q C;  3TUL A;  3OAX A;  2R4R A;  3JSE O;  2IOQ A;  1TN0 A;  5E33 A;  3L8I A;  1WTY A;  1GS9 A;  3V5Z A;  1LPE A;  2MWQ A;  2LSE A;  1KGB A;  1AEP A;  4MD1 A; 
#chains in the Genus database with same CATH homology
 3PWH A;  1JV6 A;  4DAJ A;  2Y00 A;  4GBR A;  5H2N A;  4D4X A;  2XLV A;  4LDL A;  4KLY A;  5TGZ A;  2YLD A;  4GP4 B;  3UZC A;  1QQ3 A;  1IXF A;  1LN6 A;  2Y04 A;  3QJS B;  3QAP A;  4X31 A;  2ZZL A;  4HYX A;  4AMJ A;  3UTV A;  1VJM A;  3TOM A;  1TN5 A;  4JR8 A;  3M79 A;  4JEA A;  4G7R B;  1X0I 1;  1QKP A;  5JP7 A;  4MQS A;  5JT4 A;  3FOP A;  256B A;  1S54 A;  4BUO A;  4XT1 A;  4EJ4 A;  3FOO A;  1PY6 A;  1GUE A;  2XL8 A;  5G2A A;  4XXJ A;  2R4S A;  1X0K 1;  4XTN A;  4PXF A;  2BC5 A;  2YLG A;  2I21 A;  3RZE A;  4OV0 A;  4BVN A;  3HNK A;  5G53 A;  1DZE A;  4MBS A;  3U8P A;  2XLE A;  1E86 A;  3VW7 A;  2XLO A;  3UTW A;  1F88 A;  2I35 A;  3QJQ B;  2YLI A;  1CPQ A;  4IAR A;  3C9M A;  3QBG A;  5H2I A;  4BEY A;  1M0M A;  1C8S A;  1R2N A;  4DS7 E;  4D4N A;  4HYJ A;  1P8U A;  3NMI A;  4Y9H A;  1CGO A;  1M6T A;  2CCY A;  3ABW A;  3ODU A;  3EH5 B;  3V2W A;  4GRV A;  3P0G A;  4U9D A;  5G54 A;  1BRD A;  2YCY A;  5B2N A;  2YDV A;  1QHJ A;  3M4B A;  4CX9 A;  4N6H A;  3CAP A;  1U19 A;  2JAF A;  1XME B;  5H2H A;  2YKZ A;  3UTY A;  5JVE A;  4QI1 A;  5BR2 A;  3BVD B;  4XTO A;  1IW6 A;  3QJT B;  2QPE B;  3ZPR A;  4NC3 A;  3QJR B;  2XL6 A;  3QW0 A;  2X72 A;  2JAG A;  3NYA A;  4K5Y A;  3HAO A;  5JUA A;  5G2D A;  2WJK A;  1CPR A;  1UAZ A;  4X32 A;  5H2M A;  4A4M A;  4QRY A;  3DQB A;  3M4C A;  4LDE A;  4PXK A;  4IAQ A;  2KSY A;  5A45 A;  3UON A;  5B6Y A;  1KME A;  5B0W A;  3EH4 B;  5JJE A;  2G87 A;  1GU8 A;  4XTL A;  3OE6 A;  4JEB A;  5B35 A;  3ZTM A;  5G2C A;  3QBK A;  3QBL A;  3QJU B;  2XLH A;  3T45 A;  5G36 A;  1Q5I A;  2Y02 A;  2XLM A;  4KNF A;  3ZEV A;  3WQJ A;  5B6V A;  4GYC A;  5AX1 A;  4JE9 A;  3UZA A;  4BWB A;  1BBH A;  1FBB A;  4N4W A;  1APC A;  1S8J A;  4DJH A;  1AP9 A;  3IQ6 A;  1FBK A;  1XJI A;  5JJN A;  2NTW A;  5B6Z A;  2YCX A;  4IB4 A;  1RCP A;  3COC A;  5A8E A;  1PXS A;  3ZPQ A;  4CJG A;  4J4Q A;  4GP8 B;  5AZD A;  2YCZ A;  3MBV A;  5DYS A;  2YL1 A;  3S8F B;  4ER9 A;  2PED A;  1BRR A;  1QM8 A;  2YDO A;  4N4Y B;  5DHH A;  3VVK A;  1GZM A;  5AHZ A;  3HAR A;  3RFM A;  4TL3 A;  4WGZ A;  1S53 A;  4QID A;  1HZX A;  2I20 A;  3QAK A;  3OE9 A;  4JKV A;  5F8U A;  5AHY A;  4UHR A;  3KJ6 A;  5G28 A;  3VG9 A;  4BV0 A;  3NMK A;  3TOL A;  5FJG A;  3NSB A;  1F4Z A;  5AWZ A;  1JFP A;  2J9B A;  1C3W A;  3PQR A;  2M3G A;  3PXO A;  3QDC A;  1L9H A;  3VRC A;  1UCQ A;  1GQA A;  3QW1 A;  5B34 A;  4U9E A;  1F50 A;  5AX0 A;  1NBB A;  4L35 A;  1E0P A;  2BRD A;  2RH1 A;  1Q5J A;  1AT9 A;  4G7S B;  4G71 B;  1S8L A;  2AT9 A;  2XM4 A;  2KSB A;  5B6W A;  5AGF A;  3D4S A;  2VT4 A;  1P8H A;  3AYM A;  3ZTZ A;  3HAS A;  4HWL A;  3S3C B;  3DE8 A;  2I1X A;  2F93 A;  4LDO A;  1O0A A;  5H2L A;  5JLI A;  3OE0 A;  1PXR A;  1JGJ A;  2L6X A;  1EKY A;  5ITE A;  5H2J A;  3IQ5 A;  2XLD A;  1JV7 A;  1H68 A;  2ZFE A;  2LNL A;  3QVY A;  5J7A A;  3C62 A;  4ULV A;  3S8G B;  2XM0 A;  1BM1 A;  2J4Y A;  3UTX A;  1QPU A;  2QPD B;  3A7K A;  3EML A;  2EI4 A;  4JQ6 A;  1E85 A;  3EH3 B;  1S05 A;  5JS5 A;  3QBI A;  4BEZ A;  3HNJ A;  5BR5 A;  1XIO A;  3C63 A;  3S3D B;  4G70 B;  3QJV B;  4CDV A;  5JRA A;  4FPD A;  1CWQ A;  2WJL A;  5B6X A;  1R84 A;  3DDL A;  5H2K A;  1IW9 A;  1P8I A;  5JJJ A;  1YYX A;  3ZQY A;  1MQV A;  4WW3 A;  3X3C A;  1EHK B;  1L0M A;  4CJO A;  3NS0 A;  3C9L A;  1A7V A;  3VI0 A;  3ZQV A;  3HNL A;  5EN0 A;  2KS9 A;  5JSL A;  1YZA A;  3L1M A;  3HNI A;  2ZIY A;  3HAQ A;  4FBZ A;  1E84 A;  1S52 A;  1E83 A;  4WGY A;  3VHZ A;  1C8R A;  2Y01 A;  1MGY A;  1M0K A;  4FA7 B;  3SN6 R;  2YL7 A;  3REY A;  3V2Y A;  3ZWI A;  3QVZ A;  4DKL A;  3M15 A;  1M0L A;  5C1M A;  4CIP A;  3S3B B;  1X0S A;  4EA3 A;  1JAF A;  1YYJ A;  1S51 A;  5H2O A;  3UG9 A;  2F95 A;  1VGO A;  4WAV A;  2NTU A;  2YL3 A;  1QKO A;  3DE9 A;  3NMJ A;  2YL0 A;  4UG2 A;  1E12 A;  5DHG A;  1KG8 A;  3X3B A;  3NY9 A;  3VGA A;  4X1H A;  4FAA B;  3AYN A;  5ITC A;  1YZC A;  4G7Q B;  4GP5 B;  3HAN A;  4L6R A;  5LWE A;  4G72 B;  2XLW A;  4EIY A;  5H2P A;  4GPO A;  2HPY A;  5A44 A;  3PDS A;  1H2S A;  2Z73 A;  5KKH A;  2Z55 A;  2J8W A;  1BRX A;  1KG9 A;  2Y03 A;  3AM6 A;  4MQT A;  5B3I A;  3OE8 A;  4XT3 A;  4CDA A;  2KSA A;  3HAP A;  4CDY A;  3COD A;  4MD2 A;  3OAX A;  1CGN A;  2R4R A;  2YCW A;  3NY8 A;  3PBL A;  2QLA A;  1TN0 A;  5ETZ A;  1LM3 B;  1KGB A;  4AMI A;  4MD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...