4JL1A

Crystal structure of a bacterial fucosidase with a multivalent iminocyclitol inhibitor
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-L-fucosidase
publication title Exploring a Multivalent Approach to alpha-L-Fucosidase Inhibition
doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
total genus 163
structure length 439
sequence length 439
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jl1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jl1A01
4U3AA 1VB9A 4LXFA 5A6KA 1J0HA 1DTUA 1K9FA 2J78A 4HZ7A 2FGZA 1X6LA 1C8XA 3SCPA 3ZSTA 1QI5A 1NOUA 2C0HA 4V28A 5A95A 1GQKA 1HTYA 1KR0A 3L2LA 1CWYA 3RO8A 3NYDA 3W29A 2QHAA 3BUDA 3DDFA 3A5VA 1CYGA 1CECA 1GCYA 2CERA 4U3CA 4D6FA 4NZCA 2D1ZA 1LWJA 1H2JA 1QBAA 1KB3A 1B3WA 2D0GA 4B15A 1UD8A 2A3EA 3EYPA 5AYBA 3LRLA 1W1VA 4Y7EA 1H49A 2PWFA 4X0VA 5I3DA 1JL8A 3AS0A 2Y5EA 4MADA 3VIPA 1GQIA 1E0WA 3GXIA 3VM7A 3SCTA 3GM8A 2ZWZA 2CBUA 1WKYA 2D3NA 1UKPA 2VVSA 1AMYA 2IXUA 4EKJA 2X2HA 3U57A 1L0PA 2VQUA 2V5DA 2F1BA 2OLHA 3PZMA 3GXMA 4B3KA 3HG2A 3D4YA 3EMCA 3DHPA 3CO4A 2YLLA 5DMYA 1Q4NX 3QOMA 4XV0A 5I24A 3TTSA 4U2ZA 2CXGA 3AIQA 2BY3A 4V27A 4UOJA 4GZJA 1V08A 3K8LA 3EJUA 2TAAA 5HNNA 4BQ2A 1C8QA 2DSKA 2WZIA 3PZ9A 2DSUA 3AS3A 2QPUA 4CU6A 1BHGA 1AVAA 4J27A 1PPIA 1AQ0A 1R87A 2V38A 2AAAA 3FAXA 5DF0A 5M17A 4PUDA 3ZR5A 1CXIA 4DO5A 1C90A 2BHUA 4HMCA 5I6SA 1WZKA 3WY4A 1CTNA 2DSZA 4JHZA 1HJVA 2JIWA 4JIEA 4MTVA 3W53A 1JNDA 1KCKA 2ZICA 1JZ7A 3OGVA 2DIEA 1E55A 3N12A 2WB5A 1U30A 4URIA 1VFOA 2ZXQA 2G41A 2BY0A 1JYNA 3PTMA 5E6YA 2JIEA 4W7VA 4UQCA 2YA2A 4K68A 3AQUA 2CNCA 5IDIA 3BLBA 4V2XA 1HIZA 3GH5A 4P7RA 3ARXA 3WH7A 1LF1A 1KWGA 1TR1A 3ZJ6A 1BAGA 3AIWA 2X0HA 4AISA 3APGA 5GNZA 1E4MM 2CPUA 1CZ1A 3ZM8A 4PMQA 2YDRA 1W9DM 4HMEA 3T09A 3VIOA 3I3DA 3DX3A 3SCOA 1GQJA 3MUIA 1V3IA 1CDGA 1V0LA 2VJXA 3NUKA 5BYWA 2WVVB 1V3JA 3F5JA 3PHAA 2ESCA 4HZ8A 1XV8A 4WKFA 2E9LA 3PTKA 1VFMA 2EBNA 4PMNA 3ARQA 1JXKA 1BGAA 1FHLA 4A3YA 4IISA 2J74A 4P7LA 3WDJA 3MI6A 3WBAA 1EO5A 1UD4A 2WMJA 1XHGA 1UWTA 2DPEA 4MNLA 1J9YA 4CN4A 2XUCA 4D6HA 2X8RA 1QWUA 1H41A 3SUUA 1IT0A 1TE1A 1MXDA 3NSMA 1CXEA 1UUQA 4OJYA 3RM4A 1XH0A 1W1PA 1BG9A 1V0KA 3VOCA 3ALGA 5D8WA 2PWDA 1OB0A 2PBOA 2G3IA 3WQ6A 5CZKA 2VX4A 2FHCA 4UFLA 2BHZA 2NT1A 4P8WA 1G0CA 3W38A 1JDCA 4PMXA 1EGZA 4RE2A 3A24A 2DIJA 1UH4A 1CGXA 4H2CA 2F7PA 3GXNA 4YN5A 2WVTA 1J12A 4D6EA 2Y2WA 4TOQA 1S46A 3NJ3A 4J28A 5DFAA 1JG9A 2Y8VA 1C91A 5IHSA 4MDPA 2YOCA 1UH2A 1X6NA 4FK9A 4TUFA 1J0YA 4W8LA 3UG3A 3CUGA 3ZSSA 3ARUA 4CCDA 1JZ2A 5D4YA 1QPKA 5A8MA 1OBAA 2V3EA 3HZ3A 4JFVA 3EDJA 4LYQA 3PZOA 3RIKA 2DH3A 2YIHA 4JKMA 3AICA 4KRTA 1IZKA 5M5DA 5BROA 4M8UA 1D3CA 1WCGA 1ZL1A 3CHDA 2O9OA 2X2IA 3AFBA 1ISWA 4GZEA 1PZ2A 2J77A 1E0XA 2Z1SA 1B30A 3PTQA 1EDQA 3WFLA 2F7RA 2QMKA 2VRQA 3DC0A 3LX9A 3WMCA 1XGZA 2XVKA 3CUHA 2EEXA 1TMQA 2VMFA 4LQ1A 1JF6A 4EE9A 4UOZA 3TP4A 2D23A 2DGAA 1MW2A 3I3BA 3GBDA 2XTKA 3VD9A 2YL9A 2OWWA 5I23A 4NSBA 4FNUA 4Z2GA 4HMDA 1ZBVA 3WY2A 4UQBA 4AIEA 1OD8A 1GHRA 4W89A 4PUEA 1EQCA 2W66A 5HPOA 1PBGA 3OBAA 4BQ3A 2DT3A 3FW6A 3WF1A 2J8GA 4PMRA 3WQVA 1QI3A 1CXHA 1UH3A 1EHAA 4L4PA 4C7GA 3WNNA 3GYCA 1LL7A 4JKLA 4PMOA 3HG3A 3AIEA 1J18A 2IXVA 2ZOXA 2AMGA 3POCA 4PMYA 7TAAA 2XG9A 4U33A 3M7SA 2XIBA 3BAWA 3ZMRA 4HP5A 5CXPA 2DSVA 3KL0A 4PTXA 4YHGA 3VUPA 3FXYA 1WE5A 1ZS2A 2GJRA 1J01A 4XUYA 3TTYA 3BUQA 4AZCB 1G01A 3CH9A 3BGAA 1XRVA 2ZXBA 1G1YA 2D3LA 3OB8A 1SZNA 3WQWA 3WF3A 1KGUA 1TQTA 4CN1A 1JZ8A 2W92A 1OSEA 2FHBA 2UY4A 3F4VA 3L4VA 2JF7A 5ABFA 1E73M 3W24A 3SIMA 3THCA 2OYKA 3AYRA 3VIFA 3VGEA 4NRRA 5ABHA 2YFOA 5BXRA 4DWSB 1HKKA 4AIUA 3VIHA 2A3HA 3B9EA 1UQYA 1V3HA 1QVBA 1T0OA 3DX1A 4GO9A 3ZQ9A 5A2CA 1X1NA 1B3XA 1C93A 1O7AA 2WBKA 3HN3A 4WJXA 1RPKA 1Z32X 1E70M 3WD4A 2GJXA 1XH2A 5TD4A 4W5ZA 4UCFA 2G3NA 2CETA 4E8CA 1XSKA 3SURA 4UFMA 5M3WA 2PWHA 1XC6A 4JFUA 1DP0A 1OD0A 3ARYA 4LGXA 3TV8A 1G9HA 5LA1A 3IANA 3BVXA 5ABEA 4ZE4A 2Y8KA 3IAPA 3T2QA 3MUAA 1MFUA 4JL2A 1OT2A 4DWSD 5I79A 5I2UA 1W2PA 2DSWA 3EJSA 3WH5A 2CITA 2OWXA 1GVYA 5EFFA 1CPUA 1E3XA 2EPLX 1M04A 4UQEA 3W25A 1F4HA 4LPCA 3K8KA 1D7FA 3VSUA 1PX8A 1R75A 1I1XA 3GNOA 2J7EA 4AWEA 3WNMA 3JUGA 3ZT6A 5CSUA 5A6JA 8CGTA 4D6DA 4GI8A 3WSUA 4PCSA 4B9YA 3MS8A 2J25A 3A47A 1VENA 2FDMA 4HU0A 1TQSA 1BSIA 5A3HA 4W8BA 4P8UA 4ACZB 3AMLA 2DQXA 3B8SA 1K9DA 1UKTA 5I5RA 3L4WA 3NCOA 3KZSA 3EDFA 3RMEA 2BNJA 3RCNA 5M03A 1K9EA 1R7OA 2JF6A 4UQDA 2W67A 3W26A 4PMUA 4M82A 3HG4A 2WPGA 2JEPA 2ZUTA 1E5JA 2OW7A 2J7HA 3MMWA 5BCAA 1UKSA 3LPPA 4NZFA 3VSVA 2UY2A 4P8XA 1VFFA 3ARPA 1R47A 3T0AA 1E6NA 4H8VA 4XB3A 1EXPA 3FN9A 1GZJA 3GNRA 1V0MA 5FKYA 3GTNA 1E40A 5GNYA 4L4OA 3AS1A 4AYSA 4DUXA 2WM0A 1PX4A 5A8OA 2JE8A 1HP4A 4ZXOA 4QDMA 5BXSA 4ZFMA 4YHEA 4LYPA 2VCBA 3BH4A 4AEFA 1JD7A 4Z2JA 2F2HA 3BAKA 2J7BA 1EIBA 1QHOA 4HOZA 5A6AA 5FD0A 2A3AA 1US2A 4BCEA 3MV01 2XVLA 2C7FA 2WANA 1I1WA 1Q6EA 1HKJA 2YKKA 1QWNA 1GJUA 1GONA 3WEMA 5C71A 4P7NA 5KZ6A 4AD1A 1JZ6A 2WMHA 3SCUA 3CGTA 2E9BA 1ISVA 2XN0A 3AMCA 1TVNA 3CZSA 1E6ZA 1E6QM 2J47A 2WWDA 3VKKA 5JUVA 2RGLA 5HBFA 4CN6A 2VI0A 4B3LA 1C7TA 4UZSA 4F8XA 4EK7A 2FGLA 1GJWA 5LYRA 4W5UA 3G6MA 1M53A 3AIUA 3MSDA 3S5YA 4MNMA 1OWQA 1ISZA 3VMPA 4AZ7A 3VINA 5CGMA 2DH2A 2DT2A 4JFTA 2EADA 3EJTA 3UEQA 3MU7A 3LPFA 2WKLA 3GNPA 3WQ5A 3AZSA 2V3GA 4PSPA 4X0NA 4Z2HA 1JZ5A 1CBGA 4AW7A 4H41A 3RM8A 1PZ3A 2BXZA 3BCDA 2EPNA 2V5CA 2CKSA 1QI2A 4NF7A 3PN8A 1H09A 4QLLA 5A1AA 2EACA 2VO5A 2WMKA 4UFIA 2X0YA 2VZOA 1C8YA 1B2YA 1MW0A 2YDQA 1V02E 3A21A 1MW3A 2F8QA 4OIFA 3VIMA 5GQBA 5CPTA 4UQAA 3W6LA 4M29A 4P7QA 3ARVA 3TA9A 2VCCA 3N13A 2D20A 3WNOA 2OWCA 5FL1A 4PEEA 5GNXA 4J7RA 3WDHA 1G5AA 4WKAA 4AZBA 3ZIZA 4JCLA 1UYQA 1UD5A 2ZUVA 5IFTA 3FAWA 4QP0A 1JYVA 4MNJA 1NP0A 3MV11 5CGTA 4QFUA 4D1JA 1GOWA 3AIBA 2WLYA 4M81A 3BCFA 3VIKA 1UG6A 2OYLA 1H3GA 2CYGA 2F7QA 2VZUA 5D9MA 2CHNA 3F5KA 3AIRA 1E6SM 1V6VA 3IK2A 1WDQA 2EXOA 4P8VA 2F18A 4AD2A 1EDTA 4EAMA 3WMBA 1W2VA 1JAEA 2FYVA 4FNTA 3AROA 5BXPA 3WQ4A 3UR8A 5I0DA 2Y4SA 4JKKA 4RE3A 4CCCA 1IV8A 2XSAA 2DEPA 4GZIA 2QV4A 3BC9A 4W7UA 3IJ7A 5I77A 1WZMA 1ZU8A 2OSYA 4MAZA 1OGBA 4ZEPA 5E0FA 2WXDM 4PN2A 3SEPA 4HZ6A 2VUYA 4AZIA 4PMVA 4QLKA 1G94A 3WY1A 3AHXA 3M46A 1RD6A 1XD1A 5CLWA 4B9ZA 2D73A 2XWDA 4LX4A 1HWWA 1DEDA 1XYZA 7CGTA 3PZTA 4PMDA 1BYBA 1UR1A 3VGBA 4AD3A 4PCTA 3AHYA 1P6WA 4IPNB 4N0RA 1V0NA 1WO2A 1J0ZA 1UD3A 3U5UA 2V3DA 1ITCA 5GPRA 2WHMA 1KWKA 3LPGA 1JZ3A 2JALA 4MJ4A 5AC4A 1Q6GA 4DO4A 3H54A 2BV9A 3ZT7A 3GZAA 3OGSA 1QX1A 4MB1A 3VDAA 3NDZA 3BUPA 3U7BA 1KR1A 3AJ7A 1BQCA 4D6IA 3K4AA 3L4YA 3WUEA 2VX5A 4CUCA 2E3ZA 1JXJA 3AXHA 3AYSA 3VIJA 1E4NA 3MSGA 1GOKA 1SR0A 4W8AA 3D52A 3WDQA 1FA2A 3OLIA 4WKHA 5A8QA 3OLDA 1GOOA 2WK2A 4MB3A 4UNIA 1BLIA 3GXPA 4JHOA 4HA3A 3VGHA 4S3JA 2X2YA 3MO4A 1MQPA 1US3A 3WUFA 3GXDA 1UWSA 2YBUA 3OA5A 2XFRA 2D2OA 3MUY1 4AYGA 1ZBKA 4N42A 3D50A 4AZGA 2A3BA 3LXCA 1VEMA 3WF0A 3THDA 3VNZA 5HDRA 1JYXA 4EANA 3WUGA 4D1IA 1BYCA 4HTYA 1V6UA 4RL3A 1QNOA 1YQ2A 1TUXA 3RM9A 3CZGA 4CVUA 2E4TA 4ZE5A 1ZBCA 3WEOA 4YPJA 1NWTA 4KRUA 3WELA 3W27A 1DWFM 3SUWA 2F61A 5DT5A 3TTQA 1W3LA 4XX6A 3BVUA 1WDPA 8A3HA 1BF2A 2J8FA 1YHTA 1PIFA 2JFEX 5BWFA 1O6IA 2CBVA 1E6XM 2PC8A 2D22A 1RP9A 2XFYA 1N82A 4UTFA 5E70A 1W32A 2CEQA 3LXAA 3FNDA 4PMZA 3KEHA 1QNSA 2FH6A 3OIHA 1UHVA 4FLOA 3ALFA 2A3CA 2CCRA 2GVYA 4HU8A 3CMJA 3MKKA 3VPLA 4GI9A 2ZIDA 4ZXLA 4U5KA 3AHVA 4UZUA 2J7FA 1UR2A 4AZ6A 4AD0A 2RGMA 5AC5A 4PRWA 1UWIA 1AQMA 1VBUA 1EOKA 3L4XA 2CBIA 3HG5A 2AOSA 1CNVA 1M01A 1JD9A 3L4UA 3CZKA 5A6LA 5E1QA 2WZHA 1TA3B 3DX4A 1FOBA 1PJ9A 3N15A 1VEPA 2FHFA 3PZNA 2J4GA 1J0JA 1JDAA 3VU2A 1EHNA 4OBSA 5A94A 4W7WA 1NOFA 4KGLA 2JEQA 1V6XA 3K4DA 1R8LA 4WF7A 1QW9A 1M03A 1SMDA 4R27A 1KBBA 2ZUUA 3BAJA 1HJXA 1MFVA 4CCEA 4AZ5A 1H4PA 4B16A 4FMVA 3BSGA 1WDSA 1NM9A 4H8HA 3II1A 5BRQA 4CD7A 4OKDA 3SCWA 2VCAA 5CPQA 1GOIA 3GXTA 2OSWA 2Z1KA 3LXBA 1AQHA 3WH6A 5A2AA 2G3MA 1ZJBA 1FH8A 2VX6A 2BS9A 3DDGA 1UR8A 2GSJA 1NH6A 4PTVA 4TVUA 3ARZA 5FOOA 3CBWA 3TONA 3BUBA 1NQ6A 3UG4A 4F79A 2WMIB 3WMSA 4DO6A 3ZJKA 2VR4A 4ACYA 5JIWA 1HJSA 2EO7A 3MANA 1SFSA 3O9NA 1GUVA 3W6MA 2OW6A 4J3UA 1UWQA 4ATDA 3KWXA 3AHZA 4R5EA 1W3JA 2X09A 3T0BA 3ZOAA 2HVMA 2GK1B 3WENA 3DECA 1EQPA 3CUIA 3H53A 2QMJA 2XIIA 4C7DA 6A3HA 3PZVA 1FH7A 2EPMX 3WD0A 4JZ5A 1DWAM 4CKQA 1LQ0A 1UOKA 4HPHA 1FFRA 2W5FA 3A4WA 5IHRA 4UR9A 2VL4A 1HX0A 2CIPA 1R46A 2VC9A 2Y24A 3CIVA 3MMDA 5EFDA 4XZWA 4HOXA 1FFQA 5AYIA 5F7UA 3W82A 1DWJM 4GI6A 1UR9A 3K1DA 1TQVA 3ARRA 5E9AA 1MQRA 3N17A 5IFPA 4J3VA 1OT1A 3PBGA 2QPSA 3CPUA 2XM1A 2ZUSA 5DO8A 3LRKA 4AZCA 4AIOA 1UZ4A 2B31A 4NI3A 4W86A 1CXLA 1BGGA 1KTBA 4MDOA 2E8ZA 3VD7A 1PX3A 3KE0A 2G8ZA 1GW1A 5JIPA 1E3ZA 1TVPA 1UD2A 3WH9A 1HKMA 2YLAA 3L4TA 3VX0A 4DWSA 1KFWA 2ZUMA 1R85A 1VJZA 1U2YA 3J7HA 1QHZA 1CENA 3UCQA 1JI1A 3BXWA 3EJRA 3LRMA 3VSTA 3TTOA 1BTCA 1B1YA 1KCLA 5CPSA 3EMQA 3PZGA 1HVQA 2WSKA 3WBEA 2VR5A 4DM1A 4DM2A 2X1IA 3BUIA 2EPOA 9CGTA 1HJQA 4S3KA 3W0KA 3LPOA 3M6DA 1MXGA 4W85A 5DEZA 1SMAA 4AXNA 4UFHA 4D6GA 4BS0A 4NXSA 1UD6A 3PZQA 1GPFA 1E43A 2PB1A 3WF2A 1OGGA 1ODZA 1W91A 5IXEA 1HT6A 4CD8A 2O9PA 2ZE0A 5EB8A 3A4AA 4PSRA 5DT7A 2G3JA 1OIMA 1ZJAA 2E40A 1UR4A 1HL8A 4AMCA 4ZENA 3T08A 3ZR6A 1DWHM 4OUEA 2ZX8A 4MB5A 1V03A 5BRPA 4MPKA 1WZLA 4NZJA 3EDKA 4UOQA 3M07A 2J79A 3NSNA 3POHA 2D0FA 1CEOA 3VDHA 3VVGA 3WNKA 1WDRA 1UQZA 4MNKA 1WP6A 4JCMA 3CUJA 1V6YA 2PBGA 2ZXDA 5LA0A 4WLCA 6CGTA 1HNYA 3D51A 2WMGA 2PF0A 1CLXA 3FY1A 3VGGA 1JI2A 2XVNA 3D5HA 4TXEA 1VFUA 1VRXA 3ZJ7A 3OZOA 4DUVA 4P7OA 4OBRA 1R33A 2IGTA 1JAKA 1ISYA 5I78A 2YBTA 5CG0A 4PBGA 1CGTA 3QHNA 1R7AA 1SYTA 2D24A 3CZLA 1WZAA 2O9RA 2CHOA 3N18A 1EA9C 1E6PA 1JF5A 3AI0A 3WDPP 3QOKA 1EDGA 1NWSA 3W81A 2ZX6A 4AD4A 4JFWA 4JFSA 3PZIA 4W87A 4TVCA 3CLWA 1B3YA 2GJPA 2XHYA 1JNEA 1TG7A 1B3VA 4Q22A 2PWGA 3VGFA 4CU8A 1J10A 4KWUA 3DYOA 4BZYA 1UWRA 3SCQA 1KQZA 1HXKA 1PS3A 2YA0A 1OM0A 1RH9A 2EPKX 1QHPA 4JL1A 5BXTA 2WMFA 1QI4A 4QCEA 2BVTA 3MUZ1 4NRSA 4MJ2A 3AMDA 1W9PA 5A69A 2ALWA 7A3HA 5D9PA 1QOXA 4ML4A 3W28A 3BLKA 1UWUA 1E9LA 2GUYA 2ZWYA 3T2PA 3CHFA 2ZUWA 1XCWA 3ECQA 3HJEA 3AZRA 1DHKA 1V3LA 3SCRA 4WSKA 1E15A 1EO7A 3IAQA 4PYSA 4GQQA 1V3KA 5E6ZA 1KGWA 4OZOA 3AHTA 2VVNA 4FLRA 4DUWA 5A6BD 3T0DA 1XSJA 3RJXA 1XD0A 3BMWA 4IUGA 5ECUA 1OINA 1E72M 1JYWA 3PZUA 4W88A 3UR7A 4J3TA 4F9DA 3AOFA 4C7FA 1VF8A 1V6WA 3IJ8A 3KLKA 2WVUA 3EJQA 1NOWA 1CXFA 3VD5A 3BLPX 4E4PA 1E1FA 3AXIA 4J3SA 3KL5A 4WIWA 4D72A 2XYLA 2NW0A 4OOZA 1K9TA 3BVWA 1XCXA 1UA7A 3O2LA 1E6RA 3N9KA 4U2YA 4CD4A 2EJ1A 3OGRA 1V02A 3RPMA 3AXXA 1W9UA 1HXJA 4KMQA 3VD4A 4GQRA 3CHEA 1NWUA 5A6BA 4U5IA 3ZT5A 3UETA 5FCZA 2W61A 2WLZA 3CV5A 3VILA 3GH7A 4QAWA 1DWIM 3EMZA 5ABGA 4FNRA 1VEOA 2C8NA 1TQWA 2BVYA 5AY7A 4UQ9A 4Q7NA 5FIPA 5HXMA 4J3XA 2BHYA 3VNYA 4AMXA 3WF4A 2XGBA 4BA0A 3VDCA 5CJ5A 4WSJA 1Y7VA 4TX8A 1LL4A 3SCVA 1LJYA 3DX2A 1VAHA 1W9BM 4J3WA 2OSXA 3VM5A 3UESA 5D9OA 3CZNA 3KL3A 1JIBA 4Z2LA 1W9VA 2DT0A 4HA4A 1FP9A 4KH2A 4GINA 2D0HA 4AZHA 3EDEA 3DHUA 1FP8A 4M1RA 3SUVA 2GDVA 4BQ5A 1HVXA 4W93A 3N11A 2WCGA 4Z2IA 1QI0A 5C8BB 2O92A 4H8UA 1B31A 4FNPA 3CZ8A 5E09A 3K46A 3WH8A 1WNOA 4RE4A 2WYSA 1XYFA 3WY3A 2WC4A 1QNQA 4H7VA 4CD6A 3VIGA 1MYRA 1VJSA 4ATWA 1E71M 1NARA 2BVDA 3SUTA 2F7OA 3CC1A 1BVZA 2WKGA 1QNRA 1KGXA 1R34A 5A6MA 4AEEA 2CKRA 1Q6CA 2E0PA 1WPCA 5CLTA 2PI6A 1C3FA 2PWEA 3BVTA 3A4XA 1ESWA 3F5LA 2XN2A 2FH8A 1GVIA 1KBKA 3H55A 4GPNA 1ITXA 2YL5A 1O7DC 2XJ7A 2WBGA 4BF7A 2ZX5A 4D6CA 2YL8A 1U33A 4M56A 1ZBWA 1LG2A 3AZTA 1CGYA 4IPLA 4HOWA 1HN1A 1HJWA 2J62A 2VT0A 3ZJ8A 2WVVA 3WD3A 4BQ4A 1HL9A 1E5NA 1E56A 2VRKA 5D9NA 5HPCA 1BPLB 2DT1A 3EJPA 1HF6A 1CXKA 3L4ZA 4U31A 3N1AA 4TTGA 1J0IA 3WDIA 3AISA 3OG2A 1H11A 3WFZA 1LLOA 3K8MA 3WNLA 2W4XA 1BVNP 1UASA 1ZB5A 2XVPA 4D6JA 5CSYA 3EBVA 2NSXA 3GH4A 3OLEA 4UFKA 5E0CA 2BFGA 5JBEA 2BY2A 5CQ1A 1E4IA 1XSIA 1MQQA 1VBRA 3D4ZA 3MMUA 1GHSA 3WUBA 3WN6A 3AIVA 3EDDA 3BSHA 1E1EA 1ECEA 1J11A 2WVSA 2GFTA 3DYMA 1HJUA 3IGUA 1PAMA 2XSBA 2UWFA 4FNQA 1BG4A 2QF8A 4W84A 1CGVA 3HMCA 2WNWA 4OOUA 3BAXA 1E4LA 4NXKA 1JDDA 1UKQA 2VTFA 3WDRA 1Q6FA 4GO8A 4CD5A 3OZPA 4QLJA 3SCSA 4WK9A 2WCSA 1TQUA 1UR0A 3FHAA 4MB4A 5ABFB 1NP2A 1JFHA 4QCFA 3BVVA 4Z2KA 1TZ7A 2XFFA 4KGJA 4E8DA 4H04A 3GXFA 3CZJA 4GXPA 2GDUA 2MANA 5A8PA 3ARSA 4ATLA 2V3FA 1M7XA 5EBAA 3A22A 4D71A 2NT0A 2WSPA 2GJXB 1JFXA 3G6LA 1LL6A 3UG5A 3GBEA 4NX0A 1GNXA 2WHJA 2UY3A 1CLVA 2QLYA 1OCQA 3VMOA 4F66A 4GKLA 5A8NA 2XPKA 1B90A 1JGIA 4FF5A 2OYMA 2E9MA 2W62A 3S6TA 3S5ZA 1IZJA 2O9TA 4PTWA 1HP5A 3L2MA 1TFVA 3ARTA 2BXYA 1C92A 2BY1A 4GIAA 1H0IA 4JAWA 4FLSA 1KTCA 1BYAA 4M80A 1TCMA 3CZEA 1R86A 1CIUA 2ZX7A 3NDYA 3UERA 3FHQA 4MAVA 1FH9A 3WL1A 3CMGA 4FLQA 2UY5A 3CTTA 2IUZA 2HISA 3VTRA 3WIJA 4AY1A 1TA3A 3WNPA 2WC7A 5LA2A 1CGUA 3RJYA 2XN1A 2VRJA 4UFJA 3N04A 1BFNA 2ZUNA 2VURA 3KLLA 3WKZA 4HPGA 3BAYA 2WW5A 2G4FA 3A6OA 2WHLA 2WC3A 3A3HA 5A2BA 5EMYA 1KXTA 4F9JA 1UZ1A 2YJQA 1H1NA 2VNCA 2WZEA 3T2OA 1E0VA 3NIYA 1F4AA 3ZO9A 1H5VA 1VIWA 3VD3A 1J0KA 3VGDA 1ODUA 3DYPA 2VZSA 1UKOA 3D3AA 1C7SA 2VQTA 1CGWA 3DX0A 2X2JA 1W1YA 2WMIA 3RILA 1WAWA 3O6AA 3SUSA 3VO0A 1B9ZA 3BMVA 3W37A 3OLGA 2WAGA 1W9XA 2W63A 3QR3A 1EOMA 4AMWA 1Q6DA 1KXVA 4HA1A 1OIFA 3W4RA 2GK1A 4TVDA 4OGZA 5FL0A 4CVWA 1H0GA 5JBFA 2Q8XA 3U7VA 3U5YA 2J7GA 2VZVA 3CHCA 1WB0A 1MVYA 1PIGA 3WD1A 1MWOA 4FNSA 2J75A 2WHKA 3VIIA 2VOTA 1NWRA 2ZXAA 2XVGA 3WEZA 2F1AA 2J7DA 5A6SA 1D2KA 3NSXA 1HKIA 1L8NA 3VX1A 4LYRA 1EH9A 5C70A 3WL0A 3E1F1 1KXQA 4XZBA 3LMYA 1FHDA 2DDXA 3QHOA 5D8ZA 3WD2A 3A23A 4TX6A 2YFNA 1GORA 1QW8A 3QGVA 2XGIA 1W3HA 4CGTA 3AS2A 1KQYA 1W1TA 2YL6A 3VDBA 2ZX9A 2WCAA 2WWCA 1KXHA 3B9DA 4M24A 4AD5A 3AMGA 1GOMA 2X05A 1I75A 1BYDA 5JBDA 2YA1A 3QHMA 4DWSC 4A3HA 4A4AA 1W3KA 3VMNA 1GOQA 2CESA 1QNPA 3WQ8A 1MW1A 2YDSA 1QBBA 4PTMA 4ACZA 4X9YA 1K6AA 1JZ4A 2VX7A 1B0IA 1B3ZA 2XWEA 3CUFA 4IM4A 4TTUA 4CU7A 1GQLA 1V3MA 1LWHA 3RDKA 1LG1A 3I3EA 1A3HA 3S2CA 3GDBA 2EAEA 3SCNA 2XM2A 1RP8A 2W91A 2VZTA 1XH1A 1ISXA 1UA3A 3AMKA 1DWGM 5KEZA 3BAIA 3IJ9A 2EQDA 3B9AA 2E8YA 1A47A 1PEZA 3ARWA 4E2OA 2J7CA 1OGSA 3TOPA 2CBJA 2FE0A 5HOSA 2EABA 3HU7A 6TAAA 4AC1X
chains in the Genus database with same CATH superfamily
2IQAB 4A66A 2INFA 4MD0B 1IFGA 4RV3A 3D87B 4LMQE 4KMLB 4EXBA 4Y9GA 5D7HA 2IKGA 1KR0A 4ZX5A 4KKCC 3VC5A 1CBVH 5F89A 1DJZA 1UXMA 1JRHI 4AGLA 4LAOA 1R30A 2XQYK 5CBEB 2WNQA 1AYOA 5DJXB 1B3WA 1PG7H 4G1NA 4K2UH 1M7OA 4TX9A 3ILPA 5FW8A 5D1ZD 4ZDHA 4L8SB 3QFWA 1F3DH 3G6JB 3G6JE 4V1DA 5FM4A 3S36X 4GUPB 3S9DB 2Y5SA 3T05A 3P61A 4JNZA 3NABL 2HA1A 3ML8A 3BW4A 2H32H 1SJCA 4EKJA 1SDAB 4WDTA 2LU5A 1A3XA 2OLHA 4NO0D 3VAVA 3MRFB 1UXWB 3NZ8B 1IWPA 1C9WA 1PF3A 3FFCA 4NQUA 4LEFA 2CNZA 3GTHA 1XICA 5IM7A 1ND0B 1C16B 4JBRA 3DENA 5HNNA 2DZVA 1W6WA 1SOXA 2N56A 4NKDA 2DSUA 5CSRA 3ZFHA 2OU4A 4UV7L 1EXGA 2B0MA 2Y7MA 4HIBA 3TW7A 5CAHA 3VRJA 1CXIA 3PHOB 5IIEB 3OGCA 2H4EA 3PWNA 4IGHA 1H9DA 3P3YA 4DJEA 2W0UA 2AJUL 4M6OL 3WSQH 4NQDA 2VDNB 1ADQA 2ZA2A 2YSTA 4Z0XA 2QR0B 2YPKA 3RZCB 3WLIA 2JIEA 4UQCA 3PNRB 2YA2A 2X28A 5AVSB 2VQ1B 4RXGA 1F58L 4P4KB 4G83A 4A2EA 6PTDA 2VLRA 3NFUA 1UWGH 1K8DB 3SE9L 1FX6A 3FTWA 4OF0A 4LAUA 4O0QA 1ML0A 1A5BA 3WLHA 3W11C 4IISA 4P7LA 2AXFB 1M7JA 3FX4A 4WJEA 1LLAA 5FV1L 2X8RA 4G6AC 4I8DA 5HHQB 4NM4L 5CJNA 1D2OA 3BG3A 4ONVA 3V4VA 2PWVA 3MQIA 3P4MA 1OB0A 1SQMA 3ATYA 1JQVA 2P5PA 4FFYL 3OTTA 1YN6A 1WFUA 4LEOB 2FO8A 4ELKA 1JUFB 3PY9A 1WT5C 1ZD6A 4W81A 1G7JB 1TEYA 3OPSA 1BFTA 4PVBA 4PJ9B 5DX7A 3OGOE 1T22A 2CWRA 3KNBB 5FYKU 4O17A 1QSEB 1QSEE 1WC7B 3FBKA 1QTPA 1D6EA 3TO4B 4IW4C 4BHUI 1X5FA 2YIHA 2R69H 4URTB 5FKPB 1GGBL 2WB1A 1FNHA 3VXUA 3LB6C 2QQKH 1TQBB 3SBWC 1CS6A 5PTDA 3LZPA 1F4XH 5I1HH 4RRPG 3OX8B 3UC0H 1KNOA 5TFSL 3VOJA 1F02I 4H0GA 2Y9RT 3SYAA 4OFPA 5DZLA 1RJZA 4IRSA 3FYEB 4DGIL 2FNWA 4AL8H 2VDRH 4NQXB 2WBJA 1XEUA 3R5EA 1E8WA 4HIHA 2FX7L 1A14H 4PMOA 3G3MA 4YIQA 5JPMC 3H9SB 4JBSA 2E9IA 4CRPA 3VCLA 3BCJA 2HLAA 2XIBA 3O2DA 4G7QB 3RL2B 4Q9RH 3VUPA 4DKEH 3N91A 4XOCA 1AYRA 3UNDA 1GHFL 1G01A 1XRVA 5D9SA 1J9QA 2CG9X 2IAND 1SZNA 3WF3A 4JFOA 2W88A 5A8GA 1WQ5A 3WLJA 1WDAA 1FPTL 2ARWA 4YR6A 2AF2A 2AABH 1T0OA 1XYBA 4WJXA 4CSSA 3BIAX 4W5ZA 5AL0A 4LLDB 4ALAC 1KBJA 3CV6A 1VPYA 3S5LA 4ZMZA 3T1FB 1GC1L 1N0LB 3BVXA 2Y5QA 2VR9A 2RDTA 2Y8KA 3TQ0A 3GKWH 2Q6WB 4PGBB 1BREA 3LHTA 3RGVD 1XG4A 1FV1B 3LKNA 3H9HA 1VCBC 2EPLX 1RU9L 3UWZA 4PUNA 1JTOA 1R75A 4XP5H 5L4IA 1C12A 3PWIA 3QORD 3ZT6A 3WSUA 4A1RA 4XPBL 1CVSC 1H3XA 2DWDA 4RNHA 5F1KC 1GKQA 1Z9AA 2ABBA 4QCIA 4ZMTA 5CJQL 1YEFL 2OKTA 5D2XA 1ETJA 3L4WA 2N0MA 3GQYA 3CN0A 3NGFA 1AKJD 5M03A 3T3PF 2W67A 4HNNA 4APXA 1LBFA 3LPPA 4WO4A 2UY2A 4KZCA 4YXGA 4PGDB 4ETQB 3JTBA 4UBDC 4NOFA 2VXQA 4NUJA 5MEOB 3OPZL 3MCKB 5ESQB 4DLFA 1P43A 2MNWA 5DQJB 2I5YL 5IWLC 1T4KA 3N34A 2VEIA 3HLAA 2DW7A 2YKKA 4UM8B 5DCDA 3SKJL 4ZQKB 5FGSA 2GKIA 5CR1A 4RW3A 1FWJC 5CKAA 4QRRA 3BPOC 2AP2A 3O3AB 5ICZA 4ZB5A 2V63A 3TIEA 3PRZA 4HUCA 5EU6B 5HBFA 5EU6E 4KW2A 1NINA 3HTLX 4JGUA 5EU4A 1GJWA 5ADOH 2V2TB 1AO7D 3AIUA 3CDGB 2WWKO 2H26A 3SPVB 3D9AL 2EADA 3MJ7B 4F8QA 3SE8L 4O13A 1QD0A 1RZMA 1MUJA 3LIUA 2F58L 4FRWA 1MUMA 2K7QA 2CKSA 2V5TA 3MLPA 5D2WA 3HFFA 3SJVE 3B0PA 4NF7A 4JQIH 4WDIB 3KUMA 1HHHB 1AGEA 5B7YA 3S4TA 4EUPB 3N44F 2F8QA 4OIFA 3F83A 4LU5H 5DHDA 3LBCA 3UXDA 4HXBL 2UX6A 4JZNA 4M6MH 1KTDA 3DROB 4PEEA 3DX6A 1TETH 3CHXA 3U48A 3SDOA 2BCMA 5IFTA 3PV6B 1NP0A 1AD4A 5F4SA 1B4EA 1MIMH 2DEWX 3BCFA 1LDPH 5F72S 3LN5A 2CLRA 5I8KH 1WDQA 4PJFB 4XOBA 4J8RA 2F18A 1QJWA 2B4CC 3PBYA 2IALB 1IM3D 2Y4SA 3N40P 3SY1A 1OEPA 4QHUB 3BC9A 4W7UA 5ISZE 3WIHA 4WUUB 4WUUE 3STCA 1A5LC 1ICQA 3RU8H 3TFKD 4HZ6A 5H6HA 1NIBA 4QYAA 3MSYA 4MJ6B 3BPLC 3W73A 4IRZA 1S3KH 2B15A 5TDPA 4C6DA 3VGBA 1BG1A 3AHYA 2CKBA 1UD3A 2BNQD 1P7TB 5F7DB 3LPGA 5FA4B 2O61B 4MJ4A 5KBDA 3HE7A 5KVGH 4LHUA 4HSNA 1RULH 1VYSX 3CCHA 2WGNB 3KPMA 3B0UX 3WUEA 4KRPB 3GDKA 4WI0A 1E4NA 3MSGA 1JRHH 3OEXA 2A4ZA 4HNOA 4FFVC 5D05A 1YEIH 2QZRA 1BLIA 2HYMA 1OC6A 1NFPA 4M1GL 4AIXA 3DBXA 1JCLA 1UWSA 4FDWA 3B2PA 3PNUA 2MOGA 2RUSA 4JX6A 5HDRA 4OCRL 3WUGA 2R59A 3FXIC 4HTYA 3E7JA 3U6RB 3GX9A 4HK0B 3WEOA 4LOCA 1CDYA 3WJMB 4LT9A 3IACA 1S9VB 1B4RA 3X3GH 1AR1B 3AAMA 2RIKA 4JE4B 4IQEA 2DLEA 2HJLB 4QSHA 2NCEA 4UTFA 5ECJE 3GK0A 1R0AL 3L16A 3T7VA 4OZIF 1A80A 1WAUA 2AANA 4NNYA 1U58A 4D0BA 4FAAB 4F8PA 4X5XA 3CFKA 3VKBA 3UYCA 3QY8A 2VDOH 5DY3A 5HVHC 1UWIA 1VBUA 1RY0A 3GJEA 3VWJD 4NYUA 4OLWH 1O7VA 1HZYA 1HEZA 5E1QA 3S88H 2O5ZL 4JO1H 1L6YA 2JQMA 1J0JA 4E9VA 4GMEA 1Q63A 1KIQA 1KXTB 1MOEA 3MUUA 2H9AB 4FA3A 4OIIL 1HJXA 4MQ7B 2EICA 3KMDA 3SCWA 3SB3A 2D7TH 2OX5B 4Q6IB 4RGMB 4JN6A 1ZA6B 4CMMA 4R3SB 3SAZA 4GG8A 3K5SA 4DBWA 3GMMA 3TM6A 2GUUA 3LKQA 1UWQA 5DRXA 3CUXA 1RJPA 3RX2A 3HMWL 3TEVA 4HCRA 4OGYH 2GK1B 5D38A 4OTXL 3DECA 3B8DA 1XYAA 2E27H 2XWBA 4S39A 4P3WA 2EPMX 4UB0L 3QEGH 3DFTA 5FLVA 2J88L 1HZHH 1S8DB 1I1RA 5J5EA 4U1KA 2JELL 3UJRA 4Q6YA 3MMDA 3EOUA 4HZ1A 1E9YB 1BWVA 3NRPA 3P9MB 4QHMA 4LQFH 5CZJA 1FZMA 4NKIH 2JQAA 5T9BG 5EBMA 4AIOA 1PYMA 5C0FA 2QVIA 2GZXA 3CJPA 1RPXA 2XTJB 2ISDA 3LV3A 3NACH 5HJDA 1J8HA 1JCJA 4RFOL 1WITA 3NCYS 4HHAB 4Z76B 1VKXB 3TSDA 3H3PL 1KCLA 1JK8B 1XFPA 2VR5A 1HJQA 4EXPX 3TZVD 1BZ8A 1MXGA 4F7MA 4P2VA 5JQ9A 4XSLA 4BS0A 3KM1A 3OODA 4LLQB 2PB1A 4EKXA 1ZAHA 4ZJ9A 5IXEA 3QJFB 4QRUB 4Z0SA 2ED9A 1Q72H 4XSMA 4PSRA 1UJPA 1IAIM 5MEQA 2GTWB 1DWHM 4G5ZL 4I9XA 4LZKA 2GJJA 3B7YA 3GD1C 3ESUF 3TYGL 2IPUG 4UIKH 3D0AA 4YS1A 2DJXA 3S6OA 5I8OH 1N4XL 4PRPD 4AQLA 3MRPA 3C60A 4AEOA 1PUDA 1JAKA 1R3YA 4PBGA 4G8TA 2PZNA 3KPQA 4L37B 2OB3A 5FM8A 3FCTA 3GB6A 4NP7A 1NCAH 4AD4A 2MQ3A 4JFSA 3PZIA 1KGIA 3NA4A 4MMXC 3BKJL 2ZJSL 3MBFA 4RBPK 3GJFK 3REQA 3ALPA 3CWHA 3AREA 1H5YA 1X1OA 1KJ2A 3VNLA 5BJTA 3W0WB 3W0WE 1GZQA 1DYSA 4OLZL 4P2OA 1HL5A 4WVXA 1SZGA 2KERA 1Q45A 1WAEA 2ZWYA 3Q2LA 3N43B 4H1LH 1Z3GH 3WLSA 2D2HA 2IXQA 4Z7VA 3NZSA 3ZKXC 3MDWA 3F5WA 4M7LL 1RJLA 2QCCA 2MNJB 5CP3A 3H22A 2YD2A 4IUGA 1JYWA 3NJHA 3GM0A 2Z0BA 5LXEA 4L4VA 2PU1A 3FA3A 3GMLA 5F0LB 1T8QA 2IH1B 6XIAA 4L56A 3NRQA 4J3SA 2EGZA 4D72A 1K9TA 1BGXL 4U2YA 1JRBA 3KPSB 5FYKE 3KPSE 2ZXEB 4HUWA 5IB4B 1SJMA 3VILA 3EF4A 1KDJA 4RX4A 1TYJA 3AG2B 4S1DC 2JKJA 4M8RA 4Y5XB 3KHJA 1E7UA 4J3ZA 3FQRA 4PUBH 4OLUL 4J3XA 4JFPA 4MF4A 3O3UN 1M9HA 1K72A 3QG7L 1QDSA 3TV3H 4WSJA 4Z7OE 1P4CA 1LL4A 2C7UB 3TCXA 3HAEH 1G9NH 3KGTA 1HXMB 1XZ0A 3QFEA 4FX7A 1I1AA 1Y0LA 1B0RA 3URAA 1NJ9A 1GPOL 3SGUA 5E1AB 4WV1A 4JY6B 1SU5A 3G9AB 1EBPA 2WQWA 2EE6A 4UUJB 3P2DA 2AQRA 2IOMA 4J2MA 4TM9A 3L21A 1Q9KA 2CIIB 2XBZA 4AK1A 5HHOD 4LKXA 1FL6B 5CLTA 1XF4B 5CPOA 7REQA 2W60A 1ADQL 1F6FB 3D85B 2R8WA 2C19A 1U92A 1ZHAA 3O8XC 2RB8A 3TN6A 5D7SH 2Y36L 3MRNA 4AXWB 4GG6E 2KLTA 3MLYL 3AQXA 2VC2B 4DGWC 3HBGA 5I15L 4U31A 5IB5A 3WDIA 5EWIH 1FNAA 4LRSA 5HYSG 4XWOD 4LSVL 3WJZA 3BN9C 1A1MA 4ZTEA 4NC1C 1OQXA 2UWEB 2R91A 5FDYA 1ECEA 5I18H 3G1YA 2WVSA 4IMGA 3DYMA 3LRGA 5IJBC 5BW7C 3N06B 4FNQA 3V4VL 2ZWLT 3ZVVA 3FQ2A 2YD3A 1G1KA 4JQVC 4YE4H 4CD5A 2J55A 2C14A 4UF7C 3FMGH 4WI2A 3ZDZF 2WCSA 4Q8TA 9XIMA 4OZHF 2XU2A 5HPMB 5CCKL 1JFHA 3UTZA 3GXFA 5DVLA 3PNWB 4XC1H 5A8PA 4R7JA 2V3FA 3NCJH 5FCUL 4JFEB 4JFEE 1GNXA 3V9FA 4DSYA 3FQXA 3N3MA 5KS9A 4JYDA 4EZLA 1FWNA 4G6JH 3RA7H 5JW4N 3R4DA 4HJJL 3HPXA 3V6FA 5FYJD 3EPNA 5A5WA 2I17A 4L0ZA 1LRNA 2P24A 1EFQA 1KTCA 2FJSA 4IJTA 4QEHA 4XPAH 5BZZA 4PBEA 4MAVA 3VQLA 1R5WB 4ONHB 5EO1B 1A4AA 4MZYA 4H20L 4ZUTB 2EKJA 2WTPA 1RLDA 2XV6B 2DBLL 4APQC 1XF3B 2YRZA 5A2BA 4D8AA 2BTMA 2YJQA 1JEZA 2CR6A 4BK4A 3TCTA 1EFZA 2DQFB 1RZIB 4D9LH 1I8MA 3NIYA 1R9YA 1EJFA 1QQDA 1M68A 3CL7A 4WK0B 4BFJA 3O2DL 2IW0A 4X6CB 3UGXA 3ZKQD 3BJ91 1B9ZA 2ATMA 2YR3A 4ZMWA 3CWOX 4RZKA 1O9ZA 1DORA 5BS0A 5BV7H 5CZRA 3HJ0A 5HJ3B 3W4RA 3Q8EA 4QG8A 3QQXA 5ABZA 3DUSA 1JPDX 4JRYD 1F8TH 3BPWA 1V4YA 1KG0B 1PYWB 5KBNC 1NWRA 2ZXAA 4X9HA 3WTSA 3NSXA 3VX1A 3O3BA 2XKSA 3WLMA 2WNZA 5HYJE 1QPRA 5H37G 3WD2A 2CJUL 2VSKB 1A5FH 4K3JL 1FC1A 1OE3A 3ITCA 5I8EB 3BE1H 5C0QA 1MCJA 2PYEB 5IMMA 2ZCKH 3M0VA 2ZX9A 4JDVB 4NI8A 1OW0A 2CU0A 4EO5A 5CC5A 1SJBA 5F8QC 4RWHA 2RD0A 2H3NA 3VD1A 2RGSA 4P2CG 5CKGA 5GGVY 4N4PA 1M2VB 3PWLA 3VMNA 2EDJA 3GIYA 2ZP9A 3HPFA 1JZ4A 3MCLL 1X9QA 4LRIA 3EWXA 1JGVL 1ICPA 5IHZA 2N7BA 3S2CA 3SN4A 3QJVB 5DUBA 1IEXA 1TT6A 2ENYA 4O02A 5DJCA 2F6AA 4LSUH 3I6GB 4TSBH 1OGSA 5DLMH 2X4QA 3FO1A 4GMTH 1Q2RA 2LT9A 1PKNA 4AC1X 3FQWB 4AWSA 2OLSA 1UC6A 1K9FA 1IFHH 4TV3A 3PFQA 1Y6KR 2VXUH 2BC4A 4JO2H 4MWAD 2VXQL 3L5JA 3LEXA 2MCAA 1SYSB 4NIYE 4P05A 4IK7A 1VACB 3KBNA 2CERA 3ZTNL 1OWWA 4EIUA 4PODA 6ENLA 1KB3A 5E5RB 1WA2X 1F3WA 5I3KA 1UD8A 1NGQH 4WKXA 4NY2A 4DKDC 1ZLWH 2VM3A 4TVPH 4JIQA 1BBDH 1KF9B 5I3DA 3H70A 4I9WD 1FCQA 4M6AA 1VH7A 4MDIA 5C0AB 1WKYA 4S1QL 2BIIA 1UKPA 1DBKL 4LS2A 5J6GA 2V5DA 1MLCA 4AX7A 4MGGA 1OAJA 5IBTH 2SODB 4TF4A 1GWJA 4PTUB 1OX6A 4KY1L 4ZZKA 3BW9B 4ZMYA 3PZ9A 4HGWA 5CWSB 5AW0B 1EV2E 3U4FA 3C2EA 1BEXA 4NQVA 3SB0A 1DCLA 3QIBC 1H15A 4J3OG 4NO5A 2QKIA 4B53A 2DIEA 2YMXH 1P6AB 3LD8B 4PVMA 2HG5B 5I6PA 1X5JA 4B41A 4QLRA 1KUMA 1DL7H 2IG2L 1LEKA 5JQIB 4FLHA 1W17A 4AY7A 3KRUA 3UJEA 4PMQA 1R9ZA 4GKSB 4IKIA 3X11B 4PD4J 5D7IF 3L48A 1AG0A 5IROA 1BFOA 4UINL 2J74A 3CPLA 4NAEA 4CN4A 3WIHL 1IT0A 2J24A 4ZQNA 1E65A 1C8PA 1HHJA 3JV4A 4Y2NA 1KPRB 4ABQA 5CBJA 1UC5A 4YDZA 4IRZL 1G0CA 1U5VA 4JN8A 1AG6A 3CIQA 1PLBA 1W8SA 1TX2A 4QMEA 5D7LB 3V4PB 2AAMA 2CKBL 5XIAA 4B6ZA 1NC2A 3MXVL 4DNHA 4MJJA 3RJDA 4KKBC 4G1MA 4J28A 2A5UA 4QIUA 3WFBH 3HQOA 3Q8BA 4HPOH 4FK9A 3C2AH 1U8NA 2GSMB 5C7XL 3HHSA 3T44A 2PR4H 3GU9A 2V3EA 3LPWA 2ICCA 4QAMB 2E09A 1XIIA 2BP0B 4FG0A 3NCXA 3ONCA 5BROA 4JTLA 4YWGL 2QJGA 2J77A 1B4JH 4PD4K 4JREC 2VDPH 4ZMOA 3U46B 4BFRA 1J1XH 3RVTC 3CLFH 3C8KB 2OQLA 4EE9A 3ZZQA 4NZUH 1MW2A 1SYVA 3N1QC 3V5OA 4HMDA 3MO1B 3VUAA 1LDCA 2FTPA 3EOLA 4Q8WA 1PBGA 2OXNA 2BSRA 4HKXA 4PMRA 1BX2A 4JFZH 3VJ6A 4XCYB 3PU7A 2BH0A 2J6WA 3RVXD 1ETZA 2ZZ3A 2VLLB 3WQGA 3RVUD 4OCYL 5LHFA 1GCFA 3OVGA 3WTWA 3OZ9H 2AXWA 3T0TA 3ZE0E 3TTYA 4DTGL 1JPKA 4U1HA 4YDJA 1AOHA 4FF9A 2OFJA 4R5VA 5ABFA 3KTSA 3BO8B 1CFTA 2B7DT 4G6FD 4DWSB 2DVUA 4AIUA 1L9PA 4Y2OB 2ICWJ 4WEVX 3NA9L 4OJEH 2OULB 3ZQ9A 3B9VA 3RB7A 1G7PB 3AGVA 3ETTA 2CETA 2FQIA 3S37X 5EY5A 3GKAA 4PUJA 4UFMA 5LIWX 1ZLEA 3QDJA 4XODA 4NAFB 4U7MA 5CU5A 1J05B 3GZKA 4ZE4A 2C34A 3WQFA 3QQNA 1D6VH 4ZPTB 5E0KA 4PJXE 4OSUL 4E0RA 4I5XA 1D7FA 3VSUA 1P5BA 1R3HA 4N2AA 1ZV5A 4TUKH 4GAJH 3EO0B 2I85A 5FWRA 2H6PB 1MCOH 2FDMA 4W8BA 3TJLA 4HCRL 2H3XC 2QULA 4AQ1C 3DIVA 1ZLSH 3HRZA 1SUHA 1QLFB 1MHEA 3RMEA 3VE9A 3MRRB 3NIDE 3VG9C 1KBWA 5EUKB 1E5JA 2M2DA 1INEH 3V5HB 5BOJA 1ZLUH 6PCYA 4IEFA 4JLRA 5FKYA 2K6WA 1DLFH 2HE8A 3UZVB 4AZUA 5DD3H 3TWCL 3FUDA 3EGXB 1W37A 4ERSL 1T6MA 2VERN 5IW1A 1ZDSA 4EVNB 4BCEA 1I1WA 4GA8A 1SVBA 1D2PA 1AJ7L 5KSBA 3Q01A 1TJ1A 3OHIA 1U1UA 1REQB 4F0SA 3RIAK 4HC1H 2XN0A 5F6HJ 4FQXB 3SDXA 2WWDA 5KYXB 4IGBA 4EK7A 3QYNA 4E9RA 1BVOA 2ZOTA 4QKTA 3MSDA 3F85A 1LQ2A 1QFWM 3OJDA 3D09A 4XC3L 1YTDA 3WO3B 4Z2HA 1CBGA 4H41A 2O7SA 4PTNA 4RAUA 3ZHDA 3HI1B 4ZYKB 3IWPA 1H09A 2WMKA 3N2BA 3HQ1A 5E08L 2XIJA 1EP2A 1T04B 4O51B 5E7BA 3HBLA 4LW7A 2IMNA 1BXAA 2NZLA 2A7BA 3GWJA 5G4HC 4HSCX 3B6SA 1WXZA 4EAEA 5DQDH 4QFUA 4AVKA 4ELMA 4ZZFA 2CYGA 3P9LA 2DUXA 1KCSL 1MEXL 1E6SM 3DIFA 4NRZB 2VLJD 1F3XA 3BH8A 3TA4D 3GHSA 1DO6A 4NUGH 2ZAHA 2CQVA 4RE3A 4CCCA 2MPAH 1KJ2L 3ULVF 3RWEB 3MRCB 3H26A 4Q3MA 5DJAB 3VD0A 4LLUA 4ODSH 4JQ3A 1OB1B 5FECA 4AZIA 5K9JH 1PKQA 3CNKA 4ZTOL 2QGYA 3C5SA 4ZAKB 4GS7C 1A5NC 5IBLD 2HX9A 5T1KB 4I1PA 3V6OA 3U5UA 1YYLL 1KWKA 1TCRB 1ZGLB 3Q06A 3B37A 4EWND 3B3IB 4DO4A 3VK5A 1QX1A 4CQAA 4DQWA 1OM9A 4ONOA 3N85L 4UT6A 2QADD 1BQCA 4BELD 2A7NA 4ZX3A 4GI4A 2WZPD 3L4CA 3DHJA 1A9BA 3APYA 1IBFA 2AAVA 4MLJA 4GAFB 3OLIA 4BFNA 1H5BC 3GMOA 4NO3B 1ZT1A 3VGHA 3TJEL 2X2YA 3ZMNA 4RMSA 1PS9A 1RCQA 4QKXB 1SFJA 3QARA 5HNTA 5GHWL 3JWDL 1JYXA 4EANA 2E9GA 4JO5A 3QMSA 1MFBH 5C6TH 1GAFL 4XCNB 4JIHA 1QNOA 5G1TA 2E4TA 2YCLA 2EIDA 4ZE5A 1HDMB 2R1XB 4C83B 3PG9A 4LL1A 1XX9C 1SJEA 1HKLL 3CHVA 1MJJB 4Y90A 5I26A 1E6XM 3WS6C 3FSAA 4OD3L 2DLTA 3OIHA 2R4RL 3HE6B 4Z7QB 2QUUA 2QCDB 5LHDA 1PY0A 4R2GD 1A0QL 1L9SA 3NJXA 2DZPA 3ARBA 2X9XA 3NXLA 1JNHB 2I5QA 3FKKA 2AEIT 3CU2A 2VGLM 4G8EA 4AVFA 2YYTA 4B5TA 5A6LA 2IH8A 1KFAH 3E8UL 3GFZA 3WIFB 4G1KA 1VEPA 4PL2A 1TV5A 3VU2A 4JTHA 3PWAA 5JMRA 1NQKA 4KGLA 3OAUL 4O8AA 1L0YA 1Q9OB 5EBLB 2OR8A 2J1WA 4AGQA 1SMDA 3D3VD 1ED3B 2JJUA 3HRPA 3IF1A 3MNWB 4WWKD 3F12B 3GC4A 3CQQA 2OSWA 4LNVA 4A2DA 1NUFA 5C0GB 4NPJA 1D5BA 5DWUL 5D5MF 2MIZA 2VWSA 1GL4B 1PY9A 3NZPA 3QIWB 4ELDA 3O9NA 2A74C 5CSBA 1ZLVK 3P3RA 1UVQA 1RZQA 1NFDF 3H53A 4N2BA 5DJ6A 2AMXA 3GRBA 1XBDA 4M7JL 4MX7B 1S2WA 3UTTA 1IM9D 4ODHH 1E9OB 4O1BA 3O6DA 5D8JH 5IHRA 3L3DA 1OXYA 4LLWA 4JFFE 1K7XA 1QRND 1BOGB 2AJSH 4U3SB 1N5AA 2KLRA 2NV9A 4YEFA 1C1EH 3AQZA 4ANVA 2VFHA 2A1WL 4XE0A 3AYTA 1R0MA 4Y4HA 3P2TA 4JJHA 1XRSA 3WI9A 1IXQA 4HUUB 4I2XA 2E8ZA 4JG1H 3XINA 4L65A 2ZOLA 9RUBA 2H1PH 3FB6B 1W1A1 1X5HA 4X99A 4XAGA 4P57A 2DIKA 1ZT7A 3L3KB 1IX2A 3ABMB 5D1QA 3J7HA 5T9CE 1UEYA 3MSRA 4FG6C 5MEPA 1OK6A 3S5LG 3D2UD 1K8XA 2WSKA 3RIAF 4F7TA 3ROLB 3V0JA 5A6TC 4MD5B 4F7EA 4KKAD 1H63A 3PZQA 3QH3A 4KC3B 1W91A 3IIXA 4CD8A 4NNCA 3X12A 3AY4C 5DT7A 5HYQB 1P4UA 3REWB 1UR4A 3QKEA 4MAYB 1A7QH 4OZFA 3SKMB 1KELH 4OUEA 2NX9A 1WH0A 2I69A 4LESA 4MPKA 1TZGL 4JS7A 2D0FA 2BSLA 2GPTA 1QNZH 2NY1B 1BVKA 4QY8A 4U10A 3BP6A 1NDGA 3QFJA 4TOYH 1MPAH 4N20A 4ODXB 2UZIH 2KZKA 3OZOA 4KJPD 4XCCH 4H9MA 4GRMA 4GHRA 3KOZA 4CMHC 1LK3H 2PD9A 1SYTA 3SW6A 4GBXA 1E9PB 4B97A 3UCCA 4E5XA 2CLIA 1VKFA 3MI2A 4TVCA 1BEYH 3FO2B 3T0WA 1TG7A 3WQDA 3IDGA 4L1XA 1D9KA 1EZSA 5LQBH 4KWUA 1TPXC 1KQZA 1PS3A 1OF8A 4MJ2A 3WLBA 4JIPA 4TLTA 5KTEL 5D9PA 3HS9A 5E8PB 2I9EA 5JXAH 5EH1A 3RLGA 3DRTB 3D1MC 3SGEI 4GD0A 2GJNA 5KOMC 1DVFA 5F9JA 1XL6A 4NPYB 4O02L 3QHFH 4W6XB 5FUZH 4GX8A 3Q1SL 3MMEB 3MBDA 5SWSB 5SWSE 2F5BL 4JCWA 1V7NL 2IC2A 3T4AA 2WAHA 1CICD 4Y96A 1AH3A 3CLEH 3HR5B 1NEYA 1WG3A 4DN4H 4YVUA 3BAEL 5EU7C 1OJXA 4LWWA 1KEGH 5KVDE 2YEZA 1T21A 4Y4FD 3N9KA 4FX6M 3N29A 5CZSA 3GBLA 5IJKA 3BZ4A 1SGJA 3LOWA 4M5ZL 3RF9A 1M2OA 5ID0B 5FIPA 5KAQF 4FI8A 1YXCA 3W39B 4M00A 3KYMB 4GNJA 4FTVA 1UENA 8RUCA 3RX3A 4DKTA 3SCVA 1T2QH 3HG0A 1A0CA 4RGNC 1FP9A 4GINA 4GSUA 3NEEA 2FJFB 3BEVA 1E6OH 4NWUH 4ONGL 2DM4A 3N11A 4BI6A 5I9QC 2MJWA 4UQ3A 3CZ8A 3UNTA 2XY1A 1NTHA 3FCSA 1N26A 2BJML 1IEWA 5LNVA 1U95A 3VXNA 4ATWA 1A7OH 3T3PE 4E8GA 2ISSA 3P40A 4TU1A 2WKGA 4DJFA 5K3VA 4KRNA 3Q5OA 3EGJA 4FKKA 3F5LA 2CRZA 4IDJH 3UH8A 1RPUA 3CBJB 3KPTA 1TRIA 3FRPA 2YL5A 4HYRA 2XZ9A 3EOSA 4B9PA 3RPBA 2NNCA 1JHLH 1U33A 3TCLB 4E0CA 3QB7C 2PYFB 3OW1A 3WD3A 1KJMB 2HPMA 5C08D 5I66A 3DV6B 1KBVA 3N1AA 3EWZA 1UT2A 2OMNA 2IIJA 3PIQB 1EEXA 2CLEA 3OLEA 3WKNA 3V4LA 1EHXA 5E0CA 4P2YA 4ASTA 3C6SA 3QJHB 5DHYA 2E5CA 3ILQC 5TQ2H 2PCXA 3AIVA 8FABA 4YHPB 4JKWA 1J11A 4EPBC 4PJHA 3WJLA 4HS8L 2GEQA 1URLA 1PL9A 1NPUA 3O6MH 3BRFA 1NGPH 3U9UA 3BAXA 2H3KA 2PCQA 1WAPA 4LCYB 5T1MA 4KK6D 4NUQA 2A9AA 3ELAT 4RFEA 1RK7A 1II4E 2AKRA 2QAPA 4F15C 4EE2A 2GDUA 4KQ4H 1M7IB 4J6RL 3IJYA 2OMAA 5HD8C 3P4OA 5LAPA 1AAJA 4TVPD 1NFBA 2QLYA 2ZZ5A 4WENB 3P73B 1K7FA 1MREH 1R4XA 5A8NA 2JK5A 1V5XA 3V16A 2EG6A 2AQVA 2O9TA 2CDGB 4LNRA 4XCEA 4XBSA 5IW6B 3NPVA 3SR7A 1NFKA 2YBRB 4HUXB 1S9WB 4M48L 4PJ8C 1L2QA 1JCTA 2XN9E 3H56A 1YMYA 1BIIB 2R9RA 3I75A 3RJYA 2DQUH 1OK8A 2IMRA 1S5IH 1NSNL 3A6OA 5IEKA 4BK8A 5KVFE 3ZHLA 4A3UA 2J8UA 2CZVA 3CHPA 3SDCD 1FH2A 1O1ZA 2FTWA 2J6VA 3HW7A 1F11B 2VXSL 4G8GD 5TTRA 2WZEA 1LZOA 1P4LB 5U4NA 3FTSA 4EACA 3IS4A 4BE6A 4HWEL 2NY2C 3HM7A 4G2AA 3NSDA 1C5BH 3QUZA 4DOHE 4P5KB 1G7IB 1FXPA 1L6GA 3WE1A 2DQJL 4PMFA 5DC0A 1QSVA 4D0CA 1DZBA 2P8PA 1NCIA 2XG5A 2DD8H 1HHGA 4AXKA 3NCFB 4H88L 4IRJD 4Y1TA 1H1ZA 5JIDA 2ITEA 3FTZA 4S1SH 4J35A 1CL7L 5C0ND 3FOLA 1AC0A 1D7CA 2Q8BH 3N1PC 3D8MA 3ASOB 3VFUA 4QUOA 4EN3C 3U7VA 3U5YA 1YEJH 4NZTL 3FU6A 3ATFA 5DS1A 4GCXA 4M7SA 2ZNXA 4EI6A 4XVTH 3JVFC 1FLRH 4OBTA 3PFMA 1LP9F 5EL1A 5LWYL 1PEWA 4XXCA 1XF2B 3TEWA 4MYAA 3EOBB 3BDYL 2FNBA 4U1GB 5SX5H 4MJHA 2DQGL 3LCGA 1GYNA 5HUOA 1A6VH 3JQOB 4LSRL 5D2NC 4X9YA 3C5ZD 2VX7A 4N2NA 1KM6A 1KBLA 1CT8B 4RZ4A 2PO6C 5FDWA 4LC8A 1OAZH 4KXAA 5AW2B 5CM1A 2W38A 1XLFA 3GDBA 4WVRA 1RP8A 1U8CA 4KJQC 5HGDA 3X17A 5JDSA 1YA5A 3B9AA 3QTGA 4UM9B 3GRWH 1EDYA 5HOSA 4JY4A 5E2VH 3RTQD 4U3AA 3WL9A 1DTUA 4HGKC 1W15A 4WWPA 1Z48A 1M6UA 4QGCA 3QM3A 3V7AE 4URKA 2X3CA 3RO8A 3AFLA 3CFBA 1BXNA 3LNGA 5JH1A 3BUDA 3L3OB 1YEKL 1SSGA 1Y65A 1CECA 2FPTA 3SJVB 5GSVB 3DX5A 4AMKH 1AW1A 2DYPB 1WBYB 3EX2A 4B5UA 3H42L 2PMZA 3D33A 5C6WH 1XM3A 1DLHB 2XI9A 4E2DA 4IFOA 3UP8A 2ZKHH 2P5ED 2GUOB 3TT3H 3O41A 3FOMB 2ZAGA 2G2RB 3BKYL 2X2HA 2FZMA 4Q56A 4JANB 4LSQL 3MU3A 1TOXA 3VXTA 3WEXB 4QOKD 4I0PC 1WWBX 3TTSA 3TLRA 2GLKA 4Q8MA 3HF3A 3BZEB 1H19A 5FJJA 5J9PB 5IQ9A 2CDFB 3O8XB 4HJ0D 3M0HA 4PUKA 2NXYD 1OAUL 3X1EA 5ISZB 3KVQA 2D03H 1U3NA 1PW3A 3GUWA 5L2KD 3DETC 4OZGB 4OZGE 3HNSH 5I1DB 2EEBA 1U30A 2YGOA 5KVMC 2VDKH 3CBRA 3CJJA 5JPNC 1FUNA 2EXSA 1TZHA 3GMQB 4CBPA 4P46C 2M1KA 2X0UA 4DZBB 4YS4A 5D1XA 4NC1E 4L5ZA 1Q0XL 2PCPB 3KBEA 3U1SL 3GRIA 4FFZH 4W9KC 3WH7A 4PJCA 1PLGL 1SN5A 3QT2A 3RNKA 5HGHA 5ACZB 2REQA 3II2A 2ZKYA 3FQNA 1GQJA 5G5IA 3A9BA 2VJXA 4WKFA 2R9HC 4I18C 4O2CA 5CR8A 2UVFA 1YDVA 2H6UA 3FRUB 3SKOB 1QWUA 2INZA 4DVBA 4GVHA 4OJYA 3RUBL 5D4QA 5EMUA 4XD3A 3SGEH 4Y4KA 2FPYA 2NT1A 4P8WA 3MO7A 4JZJB 5KSAC 4QDPA 2FEJA 4P2QB 3MNDA 4M5YH 4P2QE 3R94A 4WCYH 1WCBA 3HBQA 1EO8L 2I07A 4UT6L 1T0PB 2GWGA 1VBGA 2YN3A 1S39A 2XICA 3KBHE 1W72H 4GZEA 4X2PA 3WN5A 4QGYA 1FZOB 4WDXA 3GR8A 3QA3B 2NZIA 2OS7A 4JX0A 2EDFA 2B1AL 5AC6A 1R24A 2A9BA 2HX8A 4DJDC 2PDCA 1TPEA 1DXEA 5FHBH 3GBDA 3FT2A 1ZNNA 1VADB 2L8AA 3E0WA 1EIXA 1M05A 4AIEA 1JUEA 2DLFL 2PDKA 3O9WA 5HPOA 3D25A 2NR6C 2P7TB 4YIWA 1BQSA 3IUHA 3U2JA 3V0TA 4GLEA 2J8GA 1IEHA 1EHAA 2X1PA 9PCYA 1V51A 3I50L 3BMXA 2H7WA 1IU1A 2AJVH 1DQLL 2IPKB 4PRHA 3PP3K 1BM7A 1TLKA 2DSVA 3BGFB 1J2WA 5L9DL 1ETA1 1UWXK 3EH4B 3EXJA 3R10A 4H13C 4J2PA 1CLKA 5F0MB 4GQ9L 3NFNB 4AITA 4YPGB 2W92A 1VPXA 3V4BA 3O6KL 3FFOA 4B2DD 2OYKA 2IWFA 2V5JA 1T5XA 3W3OA 1POKA 3DNKA 2M8XA 1O7AA 1BXBA 5ECVA 3RXZA 3LDBB 2EXWD 3SURA 2PWHA 2OK0L 3G1RA 1VYRA 2AV7B 5J12C 3QWRD 5F97E 1XJBA 2ATKA 1CU4H 1MFUA 3CQ0A 4MNGE 5EEWA 5E8DH 1FO0A 2X6BA 12E8L 1V7YA 2NY0C 2WTRA 2DI8A 4RNRA 1SJAA 2GGIA 4UR8A 4HZMA 4QJ1A 3CDZB 4HZLB 2FEEI 5EOQH 3SBQA 1A3LL 4JQ1A 4KPLA 3SRFA 2WXJA 4I9MA 5I5RA 3MUHL 2HKAA 3VNKA 5TDNB 1JPFA 3T0EA 2VDQH 3W26A 1TJRA 1Z6KA 4Y9CA 2JEPA 2ZUTA 4WWNA 4NQ1A 1IGTA 4KUCD 1YJDH 4LBRA 1VFFA 1MY7A 1XVSA 1DCEA 5I7GA 3KLQA 3QQ4A 3RWJB 2WM0A 3PUUA 1USZA 5HHVL 3UZQB 1P2CB 1RLCL 5HJXA 2SEBA 1TJIL 1PTGA 3B8YA 5E56A 4A37A 2A3AA 5CEWA 2C7FA 5LN4A 4E41D 4N2LA 5T33L 3NJKA 2TSBA 4EF3A 3PGCA 4A2MA 2B39A 4KPHL 3RJOA 1JPEA 1C7TA 2OFQA 1D9EA 2X70A 2AK4A 3V0SA 3P4LA 4GY0A 4MNMA 2IV8A 1T03H 3M17B 1I8AA 4WJKB 2W9DL 1ZJHA 2PODA 3ZDZE 2I14A 4OZHB 4OZHE 4IMLA 3TESA 3QI9C 3X1GA 1BRLB 4FXGB 3G8EA 4KU1A 4PRBB 4YUEL 3PXLA 4OF7A 3BP4B 4C6PA 2V9TA 4YHKL 3GC2A 3G5XB 5DXYA 5GQBA 1W5MA 5B1BB 1U8LA 4A3RA 1IAKA 1DFXA 5DEGB 3RHGA 2Y6SC 2WN3A 4D3CH 2CO1A 1UYQA 3DU0A 1DBBH 2ZUVA 4QP0A 1Z6JT 1FH5L 4Z17A 1RZKH 2JWYA 4KMTH 3IETA 2CHZA 2WUBL 1H3GA 1KN2H 3O81A 2Y0SA 1LNUA 3TBSB 1V6VA 5DJDB 1G0YR 3B1TA 5DZOA 3PDOA 4AD2A 5EN2A 4XPHH 1JCVA 3CFEB 4X9GA 4R26H 1ACCA 2JFCA 4I3SL 5F3HA 3ARFD 3RLUA 3LKPA 4NO0A 3JUZA 4K4KA 4HAGA 1KLGA 1OGBA 2OGYA 3H2PA 3IJSB 4LOUC 32C2B 5FEPA 43C9B 1PCKA 1ACYL 1BM3H 2QELA 4Y5YA 1FRBA 4XO5A 3BTNA 4XMZA 3KRZA 2DQ6A 4K7PH 4Z7OB 3E0IA 3MCYA 5DURD 2BODX 1OYAA 2HXTA 3MRDB 3V6ZB 2IPUK 4D6IA 3VXSB 1RMFL 3VXSE 4E3VA 4PTTB 3E3HA 4QHNB 3GI9H 4PI2A 5FPIA 2BZDA 1NLBL 3U4KA 2ACUA 2Z7YA 1FCUA 2YBUA 4MS6A 1J8SA 3FUNA 1ZBKA 1IQWL 5EU5B 5EMMA 4K71C 3SCMB 4PV1C 1X7FA 4IQLA 2N7SA 2Z28A 4YPJA 3W88A 1GOHA 5L2JA 5DT5A 3K6NA 5CF3A 1Y07A 4GG6B 2ZA3A 3ZKSD 5JZ7C 4GYBA 5E03A 1P9MA 3S1GA 4BSVA 1MO0A 2AJXL 4PJAF 2GVYA 1WSST 4R0LC 2VGIA 4DW2L 4A8IA 4OVUA 3KHOA 4LGPB 4Y2DC 5JIHA 3IMWA 2EDLA 4Z1BA 1CGSL 3GS7A 3S37L 1DL3A 1NFAA 5A3ID 4XVJL 3HKZA 3VE7A 2NY4C 4JR5A 1GYAA 1CB4A 5GZND 2JEQA 4X9SA 3MRJA 4M1DH 4MVBC 2X4NB 1IGWA 1KBBA 4V1XA 3R25A 4FYQA 3SYQA 2QZ5A 4AQ1B 4H8HA 2CZ5A 1QASA 1BYOA 2R1WB 4MA3A 5EBWA 1SY6A 5C8JA 3DDGA 4TVUA 3QAQA 3VG9B 1O9WA 4JTAA 3PWPD 3CBWA 4OKVA 3UYIA 2Y7GA 3W1PA 2Y22A 4KEZA 3WHXA 3ZR4A 1LD9B 2G9KA 3T0BA 3PTDA 5HHNA 4Q8UA 3ATDA 3WENA 4ZVJA 4UI2A 3A6CH 1TFHA 4XXDA 1S9XA 1EX5A 2VUOA 1URIA 4Y9EA 2BFVH 1Y18A 2R27A 5DTFB 3RWFB 3VXQB 2PXYD 5E6IB 4MWFB 5JHBA 1XDTT 1R46A 1Q2SA 2IANA 3H7BB 2VKZG 3EUDA 2ORBH 5I3FA 1JN6A 5IQLA 1MFCH 5G1MA 4QR7A 3UU0A 5DO8A 1EX1A 2PDNA 1UZ4A 2HFGH 2XGZA 1NDYA 4W86A 4UAOB 1PX3A 3TBWB 1XL4A 3BIKA 4H8WC 5CUSH 3KYOB 3U0WL 3QUXC 1KFWA 1DBAH 5D7IE 4YSPA 1N8FA 1RBLA 3KPPA 4XZNX 5IP4A 2AGJL 5GIRB 3BXWA 4EI5C 1CG9A 4GUFA 3QSTA 4IXHA 3AXMA 2HWZH 3TUUA 3TEZA 1D5XB 1WYJA 2X1IA 3QORA 5D30A 5AHEA 3IU4L 4UFHA 4OM1L 5HYJB 1MLBB 1N0XH 3UXIA 4XMLL 1LO3H 4HA0A 3GFYA 3BH9B 3KH3A 2Z6FA 1AKJA 3UGRA 3O6FC 2V2WB 4KVNL 3PAVA 5F3BA 3L5HA 2BVUA 4IIQA 1ICTA 1QFHA 3POHA 3OJGA 3VDHA 1IGCH 1NSJA 1KGJA 1M9WA 5CMAB 1C5CH 4I0CC 1PG7X 3VSQA 2VYOA 1BQHB 3EIFA 4ZQMA 4P7OA 1IEBB 1KPUA 2JCCF 5B1CA 5JOFB 1WFTA 3R8BB 1OGAE 3K2UH 2PWGA 4HHLA 4OLXL 4MXQD 1W54A 3UPBA 1FVDA 2R56L 2WMFA 5T3XH 2CMRH 4NX5A 5C2CA 3ES6B 5HDWA 4KJYB 3WFHA 3FJ6A 4ML4A 1AO7A 4UB9A 1U8QB 2F74B 2CLKA 3EA2A 5MEND 2R29H 1KGWA 4OZOA 5EORL 3RGBA 1H5BB 4R7NB 2CUIA 5ABDE 1WICA 2YN5A 1WOBA 3QRHA 1KBPA 3S2AA 3U9PL 1XD0A 2FSEB 2P5WD 4PWGA 1OINA 1E72M 1ASQA 1UWEH 4QRTA 1ZCOA 4LLVA 5J13C 5D02A 1PKOA 4H7ZA 1HC1A 3DFSA 2X16A 3NGBC 3MA7A 3JV6A 4XN8A 3USZA 1XLEA 1CE1H 3LRSB 4AVJA 1RUKL 4Y1AE 1YEGL 3UETA 2QHRH 4NHUB 4G43B 3G5EA 3GH7A 4XWGH 5HQMA 2R0WH 2C8NA 1TQWA 2A6KB 4UQ9A 4XHJD 3C2FA 4YU1A 3ORWA 4ZNEE 5EIIA 3VI3A 1XSOA 1W8EA 3VNYA 1R5VA 1I45A 5A43C 1ZPLA 2R94A 4Z2LA 5FF0A 4ZUUA 3UPMA 1FP8A 1WOAA 1MCNA 3MYOA 2GVGA 4QRFA 2X4RA 2DYRB 2O92A 4AVOA 3OHXB 3SDDB 1WNOA 4RE4A 2WYSA 4XMWA 3DIPA 3TWAA 2FT6A 2BNQA 1YMMD 2UZXB 5EOCH 1XGUA 3VIGA 4K3DH 5JNYB 1EJSC 2WWNA 2J2ZB 3S1XA 2BP8A 1A9EB 3OJMB 4XCFH 3PP4H 1Q6CA 1ROCA 3VW3L 3WNJA 1JDFA 1HXYA 1G7LA 1FL3A 4N02A 2V8ZA 1RVFH 2ONEA 4GAYA 5DD5H 2AV1B 4C58B 2ZX5A 3MA9H 2YL8A 4UTTA 4IPLA 4KZDH 2IBGA 1ANUA 5D72H 5HPCA 3D08A 5JIQA 1HF6A 1CXKA 4L1HA 3GNXA 2NW2A 1T96A 5I3HA 1ET5A 1LLOA 1ES0B 3CAVA 3G1AA 2DJ4A 4JTIA 2VENA 1AUSL 2YQGA 3APMA 5F9WC 2AERT 3GB7A 2UY7A 3PHSA 4PC8A 4XNQA 3N4EA 1Q6FA 4BM7A 3UTSE 3PABB 3RMJA 3ESNA 4QCFA 3CQPA 2GSHA 1J2BA 4LVBA 5L0QB 4GXPA 4FQ2H 5DT1H 5CSZA 1UPPA 3KWWB 1U3HD 1EEYB 2GJXB 4MA7H 3JT2A 1CLVA 4M5SA 1M71A 1N2RA 4PTWA 4CQ8A 2OCZA 3MA8A 4JPVL 1UW9A 1YCSA 2QDVA 1DZ0A 3NL5A 1DQKA 4AUYA 2E56A 3B9KD 3KM2A 3RPIB 1XUZA 2AQOA 2ZX7A 1OAYH 5EZIL 1LE5B 2ITDA 3ZE0B 3DLQR 3H12A 3QC3A 3EGDA 3TK7A 1CYXA 3WLOA 3TWYA 1J5SA 4LUSA 2YMTA 1R2TA 5AW1B 1X5LA 4P5TD 5EA9A 1FDYA 3C5QA 2WW5A 4LLMB 1CIDA 4HIQA 4GMSH 3DPBA 1RR2A 4F9JA 3M4HA 4D8PA 2Y25A 1ACZA 5FF7A 1E0VA 1F4AA 4IKKA 5D7KD 4N6RB 1K3ZA 4C8XA 2C1OB 4Z77A 1GGCH 1OK0A 1TPUA 1IF2A 1Z1WA 3H7RA 1IGJB 3GMRA 3U6XA 3D12B 2Q76B 4FXKC 4YZWA 2BSED 5SX4I 3NN8A 4PJXB 1N12A 4G6KL 3SUSA 1OCWH 4Y5VA 2C4XA 3OKNA 2W63A 4OFDA 4YSQA 1AGCA 3FO0H 2VMDA 1LTXA 4HA1A 3KWVA 2TMDA 2E6QA 1FKXA 4TVDA 1TPXB 2WINB 3SQBA 3CHCA 5JA8B 4WEBH 3OM3B 1BWMA 4K9EL 3SDAA 3MODL 3H23A 3WEZA 3L7EB 5L7XH 3KRBA 3NIDB 3BISA 2ATAA 2P53A 4ROQA 2A6DA 1LCOA 1ZP3A 1KQYA 3F2LA 2R51A 3MGOB 3QY6A 2JIXB 4QRPB 4G7YH 1H8NA 4QRPE 1U42A 1FO0L 1XPGA 1WA1X 4F33B 3BG9A 4HX1B 2YXFA 4KI5F 4NGHL 4OJFH 1WUNT 4A2LA 3Q8CA 4BFAA 4F2TA 1FGNH 3TZVA 1S9KC 3S36L 3IRDA 4MNHA 3DJRA 5EU7E 5JHMA 4MMZA 1A3HA 5IK3B 1XBVA 3R6IA 5J6SA 1K2DA 2ZNWA 3RDTC 2NYZA 4REQA 5LCVA 4R90L 2W9EH 4P9HL 1HH9A 2OL3B 2GSEA 1NEUA 4JO8A 4OFQA 3VNDA 5C9ZA 1IGFH 2YLHA 1GGTA 2WWKT 2Y7QA 3DWTA 5LSMA 5G4MA 2GHWB 2BW4A 1QI5A 3LZFH 4P5MA 3TYZA 1CWYA 5J1SC 3TJHD 5IBXA 5J57B 3MOBH 5M2FX 4U3CA 1DVQA 1ID2A 4RGNB 4RGNE 2I9TA 1NMBL 2FJUB 3I85A 1BPVA 2X1UA 4BKTC 3V5DB 2PWFA 3ME0B 4X0VA 2OMUA 4RW5A 3RU8X 1JWSB 3RPTA 4E5XG 4HWUA 3GM8A 4NT6A 2PS2A 4IOFD 2F1BA 3GXMA 1Z5LB 4ODWB 3O2WH 2AS5M 3CO4A 4Q32A 3FB7A 5HYEA 2IPTL 4U2ZA 4AYEC 1HJBC 4UOJA 3DGGB 2ZCLH 1VERA 1N67A 1X9RA 3O2VH 3GR4A 2V2HA 2WZIA 1MJ8H 1NFDE 3NCCB 2D69A 1D3HA 2FEDD 2V38A 3V0FA 4QHRA 1KGCD 1S7SA 1CF8H 4D0DB 5FS5A 3M0JA 1XGQA 2YPLD 3LK6A 1NAMH 1OSPL 1KFEA 4UIOA 3GC5A 1MRCL 1GGYA 2MRYA 5AVHA 3O4LE 3H7UA 3GWQA 1VFOA 2WQAA 4L1WA 3ARDD 2G0LA 3VYLA 4HKBA 5LGYA 2WBWB 4QJ3B 5AAPA 1GMEA 4G8AC 2V30A 1F05A 4C6NA 1TR1A 4FXTA 3MV7D 4NZ1A 1A1OB 1XGPA 1TJXA 3APGA 3K72B 3OG4B 1Z69A 3K2GA 1EZWA 2WVVB 4R4BB 4LFHG 2E9LA 3PTKA 1CQYA 2Y5TA 5B1JC 3VNIA 25C8L 4HN4A 3MI6A 4F15B 3SE3C 4YDIH 1MCWW 1EO5A 1QU4A 4MJID 2WMJA 1UWTA 4MNLA 4PL1A 1SEQH 1YE4A 2AW2A 1SO5A 3BESR 1E2ZA 3D34A 1LM8V 3Q67A 1MWAB 5JPMB 4HNVA 2NY3C 5FOBA 3NPUA 2PPDA 4NRYA 4ANKA 4GKTA 1J9CT 4KTDL 3GXNA 4ES8A 4YMPA 4RFNC 2WNKA 4HAFA 4H5SB 1UZ8A 2HPTA 1A0DA 3B04A 4W4NA 3FU9A 5HHOA 4WFGE 3TAKA 5FGRA 2KS0A 3ARUA 2XZAL 4IU2A 2H1LM 1NDMA 4JFVA 1RZFH 5IRPA 3PZOA 3GT6A 2GK0A 2XWRA 3D5OF 4J3OF 4X60A 3U2SA 1VGKA 1P5UC 4E42A 3P0VL 1FNGB 3NZUA 5CIPH 2MOQA 1EDQA 3I02B 3O0RL 5K9KB 2HSAA 5EYWA 4ZFGH 3FRPG 3PJSB 2VMFA 4LQ1A 1DE5A 4LCVA 4UOZA 1DUYB 2PP7A 3U4AA 3KW3A 4GYPC 2ICSA 2XTKA 5AYYA 5E5MB 3B9OA 2YL9A 1PZUB 1ZBVA 1PXGA 3AXLB 4Q4PA 1RY8A 1E4JA 1AIFA 1I4FB 3G24A 5H91A 4MMYB 1D7BA 35C8L 3ZLHA 1Y6MR 4RMQA 1CB2A 4WGHA 3HNTL 3R8QA 1I9IH 1F4YL 3ZMRA 3U0TA 2ZC1A 4JHWL 5DVMA 3QQ3B 3FN0L 4KI5C 1OCBA 4LUTB 4ZD3H 5I5IA 3Q6FA 4HEMA 3F7YA 5DHVH 4PP2B 1E73M 3PDGA 2OTPA 3HHMA 3VIFA 2HMCA 2DORA 4X0KB 4H01A 2NVDA 1EPFA 4NJAH 4YLCA 2WBKA 2CUAA 1RPKA 5ITBL 1UEMA 5D2NB 2G3NA 5D2NE 4ZO9A 4RH4A 3B0XA 4BSWA 1TJHL 1MRDL 2IQTA 1QT1A 4LGXA 1QWKA 3C8NA 1JGDA 4ZMPA 2TRHA 1L4IA 4JFFB 5ABEA 3MUAA 3D39A 2VDLL 1SY6L 3EJSA 3WH5A 4HDIA 5EFFA 4G1EB 1DKWA 4YSEA 4F40A 3EO9H 3BPOB 1SJDA 4ZFCA 4AIZA 3APDA 5MHSD 2NCMA 4QTIH 5CSUA 1GOXA 3VOIA 4GRWF 1PZAA 2AC0A 2D9QB 1FVPA 1SJHB 5E8NB 4B9YA 5CBAA 3EA1A 4TV6A 3MNZB 3AMLA 2PCEA 3KVKA 4PRNA 3LQAH 4IMDA 1R5IA 2XWTA 5E94B 2FLMA 3VVWA 1JGUH 4L5FE 3TNOA 4X3ZA 5EZLA 3CK0L 3C9NB 5GS1A 4WQOA 3NQ8A 2OW7A 4CJ1A 4JPGA 4TUOA 4NQSB 4PRDA 1T3FA 4POZC 4YDKL 4H8VA 2BVQB 1VDGA 5JW4R 2RJGA 4DP8X 2I5IA 4GRLD 3D0VB 1CDUA 3IJ6A 1SR9A 3CH1B 4GABA 4LB8A 1BAFH 1NC4D 2V17H 4HBCL 3ULVC 1DUZA 4OF6A 2E7LC 1PYFA 4BFFA 1QWNA 2WXQA 5GGSA 1KRMA 1AIZA 3SCUA 4OWGA 4K15A 1AACA 4HN8A 2QQNH 2HNEA 1E6QM 4FA6A 5JUVA 1Z42A 3TIMA 3RWDB 2RDUA 4F8XA 3GSQB 1MEHA 4JX4A 4N26A 1IAIL 5CSSA 3IDXH 3C0SA 2GC7C 5F7EL 3INOA 3VFLA 5AVTB 2OMXA 3BPLB 4F4RA 3GYEA 3AWOA 5SX4H 4D9RE 2XFWA 1PKMA 2ZRZA 1DIEA 1WX0A 4C6FA 5K9XA 2CZNA 4BFIB 1D5ZA 3PN8A 2KZHA 2EACA 2X0YA 4UTAH 3T8XB 1NFIA 3AB0C 1T89A 5K5YA 4RZBA 4EMZA 4MWAA 4KJWD 1E30A 5I1GH 3EZJB 1ZWIB 3EG9A 1E5AA 5C55A 1IB5A 1Q7QA 1YQVL 1BZ9B 3SECA 4AZBA 1JYVA 1BVLB 4G8FB 4HEPA 3STZA 3GO1H 2B7QA 4QT5B 2F7QA 2R1YA 2GTQA 1X38A 3IK2A 1UT1A 1JCKA 5F7FA 4JRLA 3AT9A 3NQGA 4UV4L 4QXWA 4YK4C 2JJTA 5B39A 3W23A 5I0DA 5CP7B 2XSAA 4P23C 1QOQA 4J3OC 3QEZA 5C6MA 1L5GB 1FNEB 4TQEH 3Q2WA 1TV4A 4Z7AA 5FUOL 2BXVA 1QO2A 1T7ZA 4E38A 1EFXB 3M46A 5JQ6L 3Q2CA 4B9ZA 1JFQH 2OJZL 3G5YA 2NQ3A 4U05A 1PCSA 3EFFA 4X6EA