4JL1A

Crystal structure of a bacterial fucosidase with a multivalent iminocyclitol inhibitor
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploring a Multivalent Approach to alpha-L-Fucosidase Inhibition
doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
total genus 163
structure length 439
sequence length 439
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jl1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jl1A01
1G94A 1ZBCA 4V28A 1CGVA 1MVYA 1EGZA 3CLWA 4LYRA 1FHDA 4PRWA 3WQ8A 3KL0A 1H49A 2PWEA 3EDJA 4MPKA 2X0YA 2DIEA 4JHOA 3AICA 3M46A 2CCRA 3WNNA 3DHUA 5E0CA 1BFNA 2WAGA 1A3HA 1R46A 4A4AA 1AVAA 2OW7A 2WVVA 3GBDA 2W67A 3CZNA 2OSYA 4HMDA 1HKMA 2Z1SA 3OLGA 1E5NA 2XPKA 1BLIA 3DC0A 1UD8A 2O9TA 3DECA 3RM8A 3TTQA 2XYLA 1B2YA 4J27A 3DX1A 3HZ3A 1E1EA 4UOJA 5E09A 4B9YA 2D0GA 1XH1A 4S3JA 3W53A 3PN8A 3I3DA 1UKSA 2GVYA 1BVNP 3L4TA 1HXJA 1PS3A 1D2KA 1LWJA 3GM8A 4QCEA 4PMNA 5BXPA 3BAYA 2EEXA 4NSBA 1JL8A 4DO5A 3FAWA 4A3HA 2DPEA 5BROA 1BTCA 2ZX5A 2E40A 1KXTA 1ODUA 4IISA 1QNRA 5A6LA 4FNTA 1E56A 2FHBA 4JFTA 4A3YA 2PC8A 4UFLA 1CGUA 3VMNA 4P8WA 1HJQA 4KWUA 1KBKA 3SEPA 3IJ9A 3CUJA 3LXAA 3AMLA 1VENA 1V0MA 2CESA 1YHTA 4M8UA 4AIUA 3TTSA 4F66A 1V3JA 1FHLA 2CKRA 5LA2A 1WO2A 1JFXA 1BF2A 2D2OA 5LYRA 4ML4A 3WY4A 4FNUA 1QHPA 2XM1A 4W84A 3TP4A 2CPUA 1I1XA 4U2YA 1HT6A 4OZOA 3ARVA 3WUGA 3VD9A 2PWGA 4HPGA 4HA3A 3SUVA 4CCEA 1FFQA 1W91A 2VQUA 1TE1A 5A2BA 1J0YA 1KR0A 4MJ2A 3BAIA 5A69A 4XZWA 1EO5A 1XH2A 5I77A 2WKGA 3VIOA 2BNJA 1E1FA 1BGAA 3DX3A 3F5KA 2XN2A 3CV5A 3OGVA 3AZTA 1JZ8A 2BFGA 4GI8A 4FF5A 3L4WA 2EBNA 4KMQA 1V3LA 2AMGA 3PBGA 3W25A 2F18A 2YOCA 1QHOA 1BQCA 1XCWA 4WKHA 3K8LA 1VFUA 3SURA 4E2OA 3A22A 2GJPA 4BQ5A 1X6LA 3GXMA 5DF0A 8A3HA 3BUIA 2OLHA 1RP9A 3WL1A 2D1ZA 2V5DA 1CGYA 2DSWA 3FY1A 1XH0A 4DO4A 2J7EA 1B90A 1NWUA 2VX4A 4Z2IA 2OSXA 1TZ7A 4FLSA 4HU0A 4MAVA 2W91A 3AYRA 1KTCA 1RP8A 2J78A 2PWHA 1PIGA 3MUY1 4D6GA 4HZ8A 2Y5EA 4UFJA 3WD0A 3GXDA 1AMYA 4OOZA 3O6AA 2D3LA 4W88A 4QCFA 3VIMA 4DUVA 2EPKX 3CC1A 1QOXA 3OLIA 2WMJA 4PBGA 1V02E 2OYKA 1OIFA 5BRPA 2WLYA 4RE2A 2GDUA 1US2A 5HNNA 1R87A 3SCPA 3LPGA 5DMYA 4TTGA 1JDDA 1OCQA 2D73A 3HMCA 5D4YA 1AQHA 4MB1A 1K9TA 1OB0A 3GXFA 3VGBA 4AD4A 3OLDA 3L4XA 1W9PA 3N17A 1HKKA 2CBUA 5E1QA 4CUCA 3WY3A 1C90A 2WMKA 4DWSD 4DUXA 3N13A 4MB5A 3NSXA 2JIEA 2C8NA 2ZUUA 5DT7A 2YFNA 3AYSA 3PTKA 4HA4A 2WMGA 3RO8A 3GNOA 4ZENA 2WPGA 1G01A 1V6VA 2IXVA 3VSUA 2BY0A 3POCA 1ZJBA 2WCAA 5D9NA 4CVWA 4R27A 2GJXB 4NZCA 4IPLA 2BHZA 2JE8A 1TVNA 2V3EA 1CXHA 4GKLA 4TVDA 3A23A 4M81A 2YL5A 4UFIA 2XGBA 3ARTA 1QNPA 2CEQA 1TQWA 2TAAA 3AHVA 4AZ6A 3MKKA 4ZE4A 1MW0A 5IXEA 5A1AA 3ZSSA 3WNOA 3PZNA 1VRXA 4UQDA 4U2ZA 3MV01 3PZUA 4W85A 1JYXA 4UTFA 1E0XA 2C0HA 4AMCA 2VX5A 1R7OA 5FOOA 2GUYA 1TQVA 3AHZA 3HG3A 4BQ2A 2B31A 4LPCA 2DGAA 4V27A 2VC9A 2OWXA 1UKOA 3SCWA 3ZJ8A 4Z2LA 3W38A 4Z2GA 1NP0A 2ZUSA 4B16A 2QF8A 2NT1A 4HU8A 1K6AA 1XYZA 3EDKA 1BYDA 1VFOA 3BLBA 4XV0A 3TTYA 2FGZA 3EMCA 3AS2A 3L4UA 1UWSA 3VIKA 1OWQA 2GJXA 4FLRA 1CXLA 4NF7A 1UR4A 3AJ7A 3BUQA 1GOKA 2F2HA 3VD4A 4NRSA 3WUEA 1GQLA 3CUHA 3H55A 3ZOAA 1CPUA 4KH2A 2ZX7A 3PZVA 3WNLA 4B9ZA 3WENA 5A6SA 2XUCA 4HOWA 2WB5A 1MFUA 3WF3A 3UEQA 3WF2A 4M29A 1XV8A 1FOBA 1GZJA 4W8LA 1Q6CA 3BVVA 2FH8A 3TTOA 4B15A 1DTUA 1UUQA 1H4PA 1JD9A 1HJVA 3S5ZA 3K1DA 1ZU8A 4CD8A 4MTVA 1E72M 1JYWA 1KXVA 3H54A 4BF7A 1JAEA 4TOQA 4W5UA 1V0KA 4WIWA 1B3XA 3RJXA 5I2UA 2EPOA 3CHFA 1BYCA 1UH2A 2WW5A 1H0IA 2WK2A 1JZ4A 2ZWYA 4UZSA 2D3NA 4PTWA 3MV11 4JFSA 3PZMA 4QFUA 2E8YA 5IHRA 2A3CA 4CVUA 1LG1A 4UZUA 3VIFA 3KLKA 3UG5A 3N11A 4OIFA 4LGXA 3BVXA 1DEDA 2XVNA 3WUBA 2X0HA 3CMGA 1BGGA 4P7RA 2Y8VA 3SCVA 3VNYA 2J7BA 4ACZB 4H2CA 2XSAA 4FNSA 3ARXA 4UOZA 1GW1A 1NWRA 3G6LA 1UH3A 2XN0A 3T2PA 1MQRA 2AOSA 1UZ4A 3AI0A 4F9JA 1E4MM 4WKFA 1O7DC 2CBJA 3IJ8A 4TVUA 5A6MA 4GO8A 2VJXA 2W4XA 3WBAA 2DSVA 3EDDA 1V03A 2X2YA 4W87A 1A47A 3FAXA 2Y24A 4GZEA 1KXHA 3OGRA 3EJSA 1KQZA 3LXCA 4U3CA 4EK7A 2WCGA 2UY2A 1W3LA 5AY7A 5EFDA 4J7RA 2CNCA 2D23A 1XD0A 2VI0A 4XZBA 3M07A 1V02A 5BWFA 3DDFA 4PMZA 4OOUA 3AXIA 2XSBA 1W1YA 1CECA 4PTXA 4MNJA 1GONA 2QMKA 1V0LA 2RGMA 1IV8A 4W8BA 3PZOA 2XIIA 4PMOA 2PBGA 2ZE0A 3CO4A 3AS0A 1M04A 1XSKA 5GPRA 2NW0A 2XVKA 3VM5A 3SUTA 3ZJ7A 1K9EA 4EANA 4CCCA 1OGGA 1FA2A 5CG0A 3LPFA 3AZSA 3MI6A 1HP4A 4NZJA 1ITXA 5A6BA 1D7FA 2X1IA 1WCGA 2ZUWA 4H41A 1J0JA 1B3VA 3WD3A 1FP9A 1LWHA 1BPLB 2F7QA 3VU2A 1H5VA 3WN6A 4H8VA 1VFFA 3JUGA 3ZJ6A 4AZIA 4M24A 3WDQA 3WQVA 4CKQA 1AQMA 1HX0A 5CGMA 4HOZA 3BMVA 3BLKA 1UWRA 1MXDA 1CTNA 5DO8A 2F1BA 2EACA 3A3HA 3OGSA 3VTRA 3AIWA 3CZSA 1VIWA 1J12A 4AZCB 2CYGA 3K4DA 1JYVA 5CLWA 4ZFMA 3SUUA 2BXYA 3DX2A 2Y2WA 4UQBA 4CN6A 1HN1A 2YL9A 3AROA 2IUZA 3MUIA 1W3HA 3PZIA 1W1VA 2XTKA 1OSEA 5ABFB 4ZE5A 1BYBA 4HZ6A 5FIPA 1WPCA 2QLYA 3BXWA 5E6YA 1SFSA 4D6HA 3AHTA 1C7TA 2BVDA 3W4RA 3HJEA 3VGFA 5ECUA 4PEEA 3WH7A 1C8YA 5I3DA 4TTUA 1H2JA 2WANA 3GXIA 3KWXA 5JUVA 3VVGA 4EAMA 1Z32X 1ZS2A 1GOIA 1K9FA 4HOXA 1U2YA 2PI6A 2FYVA 4UQEA 3KE0A 1WB0A 1Q6FA 4AIEA 4GIAA 1KFWA 1UQZA 1ISWA 3GH4A 2ZUNA 4XUYA 4AMWA 2VZVA 1QNQA 2ZX9A 1C3FA 5A8PA 3AIUA 3ZMRA 4HMCA 1Q6EA 1CYGA 3CH9A 1WZAA 3A24A 1RH9A 1W1PA 5HPOA 3ARSA 1JZ3A 1GNXA 1KGUA 3K46A 3D52A 2JF6A 5A95A 1HL8A 1E0WA 1NWSA 5I23A 2DQXA 3VX1A 2CBIA 1SZNA 1C8QA 3CHDA 4W86A 2ZUMA 3WNPA 1UR1A 4FNQA 4E8CA 5DEZA 2YA2A 3B8SA 2XHYA 3GXNA 4ACZA 3VILA 3HG4A 2YDQA 3AIBA 3WY2A 1TVPA 3N15A 4KGJA 1O7AA 5FCZA 3ARRA 2VCCA 1HJWA 1KR1A 3DX4A 2Q8XA 2DSKA 1E5JA 1I75A 1WDPA 4CN4A 5CQ1A 2WZHA 4JFUA 1GQKA 2Y4SA 3FW6A 1GVYA 1BHGA 3RIKA 3WH8A 4WKAA 3WQ6A 3S2CA 4ATDA 4YHGA 1QHZA 4KGLA 3CGTA 4D6JA 4JL1A 2XVPA 3G6MA 5EFFA 5D8WA 3D51A 1ITCA 2A3AA 3NJ3A 5C8BB 5A6AA 1LL6A 3VO0A 3WELA 2V5CA 1QPKA 1NOFA 3ZM8A 4GXPA 3WDJA 2EADA 2WZEA 1KTBA 3D4YA 4UNIA 4AXNA 1IZKA 2BY2A 3W81A 1CXIA 1XCXA 3THCA 5D9MA 4U5KA 1JNEA 1J0HA 1CGXA 1G9HA 2YKKA 3BH4A 1JXKA 1R47A 3WUFA 4AD3A 2J25A 4M1RA 3WEZA 2RGLA 1HNYA 2WMHA 3EBVA 3GTNA 3D4ZA 2J8GA 2DT3A 4EE9A 3CIVA 4QLJA 2E9MA 2W92A 1KQYA 3SCRA 1J01A 3TOPA 4R5EA 3VDCA 2E3ZA 5JBEA 2V3DA 2G8ZA 2J62A 2BVTA 1ZB5A 4X9YA 1GQIA 3WFLA 3MUZ1 2O9RA 2PWDA 1V6WA 4AW7A 4UCFA 1JDCA 2FDMA 3O2LA 4WSJA 2YDSA 4W7WA 1QW9A 1UASA 1E6SM 3BCFA 2FHCA 3ZIZA 4CD5A 2ZUVA 3BGAA 1JZ2A 4E4PA 3AXXA 4J3VA 3CHCA 4KRTA 3A47A 2FH6A 1V3HA 1UD4A 1ZL1A 1QI3A 1TUXA 2E4TA 4Z2HA 1E6PA 1B3WA 4L4OA 1KGWA 4DUWA 3W24A 2YLLA 2VMFA 4LQ1A 4N42A 4M82A 5EB8A 2WWDA 4MJ4A 4PCTA 4JIEA 3AQUA 3BAKA 3W82A 1BVZA 1UD6A 4NXKA 4D6DA 4BA0A 3M6DA 4D72A 3WF4A 3FN9A 1EH9A 4D6CA 1CNVA 1UOKA 1UR9A 6TAAA 1PX4A 3S5YA 4WJXA 1UWTA 3VDHA 1W9UA 1MYRA 3ARPA 1R7AA 3PTQA 4AC1X 3AIEA 1OGSA 3OB8A 2O9PA 4JFWA 1WDSA 4AWEA 2CIPA 1W1TA 1NM9A 2YFOA 1SYTA 1M01A 1MWOA 4WF7A 1EOKA 4YN5A 5AYIA 2DH3A 4JL2A 1FH9A 4UR9A 5EBAA 4OUEA 1UG6A 1JF5A 1XD1A 1J18A 1GQJA 1HJXA 4FMVA 1ZBVA 4CGTA 1JAKA 1EDGA 3NCOA 3BMWA 3GH5A 4D6IA 4D1IA 4LYPA 2VT0A 3ZQ9A 5M17A 3F5JA 3KLLA 4PMYA 3WL0A 2EAEA 2BY3A 2WWCA 1WZMA 1R34A 1QW8A 1US3A 3EYPA 4HTYA 5AYBA 3W0KA 1E73M 3UR8A 3VDBA 3VUPA 5CZKA 1AQ0A 2E8ZA 3AMDA 2YIHA 3WY1A 1V08A 1W9VA 2WC3A 3OIHA 4MDOA 1C92A 2X2HA 4D6FA 3IJ7A 3VGEA 4MADA 1GVIA 4GI6A 2E9BA 4AEEA 2VVSA 3IAPA 2VZTA 4XB3A 1UQYA 4B3KA 5A8MA 3II1A 4ZEPA 4JCLA 2JF7A 4P8UA 4C7DA 3WBEA 4DM1A 3HN3A 1QWNA 2IGTA 4X0NA 3WFZA 2GJRA 5AC5A 1KB3A 5CJ5A 3QGVA 2WHKA 6CGTA 3VM7A 2X2IA 4AIOA 1FFRA 1JGIA 8CGTA 2G4FA 1TCMA 1R33A 2FE0A 2BXZA 4J3WA 2ZXAA 4OKDA 4MDPA 4QDMA 4AZ7A 1C8XA 1L0PA 1RD6A 2XJ7A 1T0OA 5D9OA 5FKYA 3A4WA 3IGUA 3UESA 3RILA 4MNKA 4H7VA 3WEOA 1GUVA 3LMYA 2ZUTA 1HIZA 4M80A 4P8XA 1NOUA 1L8NA 2F8QA 1PBGA 2JALA 3SIMA 3DDGA 4OBRA 3VMOA 3GXPA 4K68A 1VEOA 2F7RA 3MANA 4GPNA 3WH5A 4PSRA 2VURA 3RM4A 4WLCA 3K8KA 2XGIA 2VR5A 3M7SA 3WIJA 2EQDA 1MW3A 3UG3A 1VEMA 3ALFA 1WAWA 1R75A 1E4LA 4YHEA 5M5DA 5CPTA 1GOMA 5I78A 3I3EA 4HP5A 3A4AA 5D9PA 1KCLA 3T0AA 2WC4A 5IFPA 4NRRA 1C91A 1JZ6A 4HPHA 2VNCA 2WM0A 2YBTA 2J75A 3A5VA 3VIJA 4IUGA 3VIHA 2DH2A 1HJUA 3BUBA 3FHQA 4Z2JA 4PMDA 5BRQA 2JIWA 5CSUA 1IT0A 3EDFA 4JKMA 5JIPA 3T09A 1UA3A 1PZ3A 1J9YA 3WSUA 2EPLX 1E4IA 1V3KA 1VJSA 1QBBA 1VFMA 2V3FA 5KEZA 3WDRA 1CXKA 3LRLA 2BV9A 3PZGA 3VD3A 5A3HA 3VDAA 3ARZA 1OD8A 1WE5A 1TQUA 2EPMX 2DT2A 2BY1A 5FL1A 3BLPX 1W9DM 3D5HA 2WBKA 3RMEA 4W7VA 1IZJA 4U33A 1PEZA 4GINA 1MXGA 3CPUA 3CTTA 1JD7A 2YLAA 2ZXQA 3PTMA 3RDKA 2QV4A 3VINA 2W66A 3VGDA 1OT2A 4TVCA 1UD2A 1M53A 1YQ2A 4BCEA 1QNSA 1JZ5A 2JEPA 3WDPP 4FNRA 3A6OA 3SUWA 1PPIA 2VZOA 1Y7VA 5GNZA 4FLQA 5EMYA 4DWSC 2VCAA 3SCSA 1E70M 2F1AA 2WC7A 3WMSA 1HP5A 3VX0A 5M03A 3VIIA 4DO6A 1GOOA 1SR0A 3SCTA 4C7GA 4RL3A 1QNOA 3VNZA 2DT0A 2CHNA 1QI4A 4M56A 1W2PA 1XHGA 2ZX8A 4NZFA 2XN1A 1KCKA 3L4VA 5GNYA 4PCSA 2UY5A 4OBSA 3GH7A 1C7SA 1R85A 5A8OA 3ECQA 4UQCA 4TUFA 4AMXA 3BVUA 5E9AA 2YBUA 5IDIA 1LLOA 3W27A 3J7HA 2VR4A 2ZWZA 3N1AA 3WNKA 2O9OA 1K9DA 3N18A 2G3IA 3N12A 3W6LA 2Z1KA 3AMKA 3BAWA 2QPUA 1EQPA 2HVMA 1KGXA 4RE4A 3TA9A 1HJSA 4UFMA 3W26A 4UQAA 3SCNA 3UCQA 2VZUA 2J7DA 3RM9A 4H8HA 2CHOA 3AS1A 4HA1A 1KBBA 2WVVB 3ARQA 2GK1A 3OLEA 3U7BA 3W37A 1FH7A 1UWUA 1UWQA 1E9LA 3HG5A 2XIBA 3CHEA 4H8UA 4TX8A 5LA0A 1TMQA 5I6SA 1CIUA 3UR7A 2J77A 5GQBA 2EXOA 1NWTA 1HVQA 2X8RA 4Q7NA 2J7HA 1M7XA 2VRJA 5CGTA 1XC6A 2DEPA 2DSUA 3NUKA 1JDAA 1Q6GA 2V3GA 1HTYA 4FK9A 4LYQA 3BC9A 4AZGA 1J11A 1PIFA 2EABA 3ZSTA 1SMAA 1UKTA 7CGTA 1ECEA 5A6JA 5ABHA 4FLOA 2IXUA 4AD5A 1E71M 3PHAA 3K4AA 3VMPA 3U57A 1QI5A 1F4AA 3LRMA 5HBFA 4PUDA 5E0FA 1VB9A 2V38A 5A2AA 3CZEA 3VSTA 1F4HA 1ZBWA 4ZXOA 4DWSB 5CLTA 1CGWA 4PUEA 3VOCA 3WNMA 2J7FA 4CCDA 2WHJA 3POHA 1E4NA 1JG9A 1P6WA 5KZ6A 1VBRA 3BSGA 3SCOA 1EDQA 3SCUA 4ATWA 3EJQA 3B9DA 3LXBA 2PB1A 1UWIA 4GI9A 3AIRA 1HXKA 1DWIM 4PYSA 1JNDA 3T08A 2F7PA 4JFVA 3ARUA 4W8AA 1TQTA 2WNWA 1OD0A 1EOMA 3L4ZA 1E0VA 1JF6A 1QX1A 2DDXA 2PF0A 1S46A 3T0DA 5DFAA 1XSJA 2VL4A 1DP0A 2ZIDA 1B30A 4QP0A 3BSHA 3WEMA 2WMIB 2XFYA 7TAAA 3T2OA 5HOSA 1EO7A 9CGTA 4BQ4A 2WSPA 4JAWA 1LJYA 4W89A 3S6TA 3GBEA 2A3EA 5JIWA 1GORA 4UFHA 3N9KA 5AC4A 3EJTA 3E1F1 4MNLA 4JHZA 2D24A 1CENA 4PMUA 3QOKA 1DWJM 4F79A 4CU6A 3KL3A 4CU7A 1B3ZA 1DWFM 2WMFA 2OYMA 2W62A 3UG4A 1C93A 3WF1A 5CPSA 2JEQA 5A6BD 3NSNA 3BVWA 3AFBA 3PZQA 1QBAA 1W9BM 1OGBA 3NDZA 3CZ8A 1FP8A 1V3MA 4JKLA 4AYGA 2FHFA 1CEOA 2CKSA 3U5YA 2ZX6A 3D3AA 4UFKA 5HDRA 4F9DA 3WF0A 3WMCA 1GOQA 1W3JA 3MMDA 4MNMA 2VCBA 4GQQA 2WVUA 1GHSA 1V6UA 2X05A 1XSIA 3MUAA 1LF1A 3EMZA 1ODZA 4GZIA 4PMQA 4P7OA 1U33A 2XG9A 2VOTA 2VO5A 1B31A 4PTVA 3NIYA 4PTMA 1EHAA 4J3SA 3ARYA 1J10A 5A94A 3TONA 1MW1A 1X6NA 2G3MA 2A3HA 3MS8A 1TQSA 1H09A 3AZRA 3OZOA 1HVXA 3CZJA 2J8FA 3HU7A 1ISYA 4AD2A 1H0GA 4GO9A 3ZT5A 5E6ZA 3LPOA 2PBOA 5I24A 1CBGA 4Q22A 2VX7A 3I3BA 1E6RA 1MQQA 1VJZA 3OA5A 3WQ4A 2XFFA 1FH8A 4QLLA 3GYCA 4C7FA 1B3YA 3MSDA 1ISZA 4BQ3A 2J47A 1CZ1A 1MW2A 4AZHA 2CETA 2ZXDA 3A21A 2GFTA 4NXSA 3WDHA 3AXHA 4W5ZA 4CD7A 1XYFA 2F61A 1V0NA 3CMJA 1D3CA 3BUPA 3L2MA 4N0RA 3T0BA 3WKZA 4AZ5A 1EXPA 4IPNB 4J3XA 4CU8A 4JKKA 2UWFA 1CXEA 1E3XA 4OJYA 3N04A 1LL4A 1R86A 1G1YA 3GXTA 1UR8A 1EA9C 2PWFA 3CZGA 4PMXA 3OG2A 1BYAA 3DX0A 2YDRA 4QAWA 1UD5A 4QLKA 3D50A 2J7GA 4U5IA 1GHRA 1PX8A 4FNPA 4MB3A 3QHNA 1UA7A 1JXJA 4GZJA 2YA0A 2J4GA 2WMIA 1XRVA 3WD2A 1WNOA 3NDYA 3IK2A 1V3IA 3AISA 1DHKA 1TA3A 5C70A 1KWKA 5E70A 1H41A 2XWEA 3F4VA 2Y8KA 1TFVA 3L4YA 2VUYA 5ABFA 1JFHA 1WDQA 3WH9A 4D6EA 4WK9A 2UY3A 1VAHA 1LG2A 3IAQA 3CUGA 1UHVA 1CXFA 2D0HA 1JI2A 2BHYA 3ZR6A 1UKPA 3AHYA 4AD0A 2VX6A 2WLZA 3GNPA 1UYQA 2XM2A 2G3NA 3QOMA 4P7LA 1E6QM 1M03A 1BG9A 4NI3A 1E15A 4J28A 1B0IA 2BS9A 3UERA 3BAJA 5HXMA 1ZBKA 1LL7A 5FD0A 4H04A 1CWYA 2E0PA 1OIMA 2EPNA 5A2CA 1TA3B 4B3LA 4NX0A 3LX9A 1VBUA 1DWAM 4X0VA 3TV8A 2F7OA 3WQ5A 3BCDA 4UOQA 1GPFA 3W6MA 4MB4A 3SCQA 1H1NA 1NQ6A 5CXPA 3KZSA 1JI1A 1R8LA 1OBAA 4UQ9A 1W2VA 2W63A 3EJUA 2X2JA 1JYNA 2JFEX 1WP6A 1BG4A 3DHPA 1V6YA 3CUIA 1RPKA 1MFVA 5F7UA 3AIQA 1NARA 1WKYA 3APGA 1UR2A 1UD3A 1UKQA 1HL9A 3ZJKA 1SMDA 4RE3A 1GJUA 4AZCA 3VPLA 1Q6DA 4TXEA 4P7QA 5BYWA 1EIBA 2UY4A 1HKIA 3CUFA 1VEPA 4BS0A 3ZT7A 2VRKA 1PX3A 1DWGM 3LRKA 2HISA 2QHAA 2WHMA 1OM0A 2DT1A 1BAGA 1ZJAA 3RJYA 1JIBA 2OWWA 3FXYA 3MU7A 5ABGA 4PMVA 4AY1A 2WKLA 1WDRA 3W28A 1E40A 3CZLA 2J79A 2YJQA 2VTFA 2OYLA 2VZSA 3EMQA 1V6XA 3GDBA 2YA1A 3WH6A 2VRQA 4E8DA 4PSPA 1J0KA 4P7NA 3W29A 1ISVA 4P8VA 5I5RA 2ESCA 1CLXA 4D1JA 4AEFA 3VIGA 2XWDA 4CD6A 3AHXA 2G3JA 3QR3A 4KRUA 3L2LA 4HMEA 5BXTA 5IFTA 2CXGA 3AS3A 1W9XA 3U7VA 2QPSA 3RCNA 2X09A 3KEHA 2CITA 2CERA 3DYMA 4PMRA 3UETA 3VGHA 5FL0A 1W32A 3WD1A 4ATLA 1E3ZA 3WD4A 2OW6A 5GNXA 2XVLA 2XVGA 3LPPA 3FHAA 4PN2A 3MMWA 2MANA 6A3HA 3VSVA 1Q4NX 3ZO9A 1TG7A 1EDTA 4Z2KA 4V2XA 3QHMA 2XFRA 2NSXA 3DYPA 2DIJA 4EKJA 3U5UA 4JCMA 1OINA 4HZ7A 2W5FA 1QWUA 1UH4A 1PZ2A 2WSKA 3EJRA 4IM4A 2E9LA 3VD5A 1W3KA 4AYSA 1B9ZA 3AMCA 2BHUA 4LXFA 1NOWA 2CBVA 4J3UA 1KWGA 1LQ0A 4CN1A 3NYDA 1WZLA 2D0FA 1GJWA 2OWCA 3KL5A 4BZYA 1E6ZA 4URIA 1U30A 1UR0A 3VD7A 4L4PA 4AZBA 2D22A 2GSJA 1O6IA 2W61A 4W93A 4OGZA 1GOWA 1G5AA 5I0DA 2D20A 1N82A 3BUDA 3IANA 1HF6A 4J3TA 3BAXA 4Y7EA 5I79A 3AIVA 4JZ5A 3EJPA 4W7UA 3WQWA 1ISXA 4AD1A 4S3KA 1MQPA 3DYOA 1QVBA 2C7FA 3WDIA 2BVYA 3A4XA 3ZT6A 2J7CA 3O9NA 5A6KA 5A8NA 1EQCA 5CSYA 1HWWA 3GZAA 4DWSA 4GQRA 1I1WA 4ACYA 1J0ZA 3OZPA 3RPMA 5LA1A 2ZOXA 4AISA 5ABEA 3OBAA 2ALWA 3AOFA 1CDGA 1XGZA 3VIPA 2WVTA 5CPQA 4TX6A 2NT0A 3PZTA 1VF8A 2VVNA 2G41A 3GNRA 3T2QA 7A3HA 3SUSA 4F8XA 5BCAA 3B9EA 4ZXLA 1CGTA 3B9AA 5BXRA 3EDEA 1E43A 2QMJA 2WCSA 2AAAA 4WSKA 3ALGA 4YPJA 2WYSA 5IHSA 4U3AA 3F5LA 1QI0A 1G0CA 3NSMA 1DWHM 3MMUA 1BSIA 1JZ7A 1PAMA 2YL8A 5DT5A 1GCYA 2FGLA 4XX6A 1E6XM 3VGGA 3BVTA 2J74A 1E55A 4CD4A 5JBDA 1E6NA 2O92A 1HKJA 3PZ9A 1H3GA 2WVSA 2A3BA 3VKKA 2GDVA 2WBGA 2GK1B 3AMGA 3ZR5A 1X1NA 1H11A 5BXSA 2ZICA 5M3WA 2WHLA 3H53A 2ZXBA 4LX4A 3HG2A 2DSZA 1QI2A 4U31A 1OT1A 2EO7A 5C71A 2OSWA 2WZIA 3CZKA 1PJ9A 3THDA 1B1YA 3MSGA 1EHNA 1CLVA 3CBWA 5TD4A 1J0IA 4DM2A 1ESWA 3QHOA 2YL6A 3WMBA 2EJ1A 2VQTA 1NH6A 4D71A 3K8MA 3MO4A 1NP2A 5HPCA 5D8ZA 1UZ1A 2WXDM 5A8QA 1TR1A 3FNDA 3ARWA 5JBFA 1KXQA 4MAZA 1WZKA
chains in the Genus database with same CATH superfamily
5I18H 4K5PA 1G94A 2BSTA 4C5ZA 4MKSA 3RE0A 4V28A 1OTUC 4RNHA 3ZR4A 1PQZB 1AMXA 4OV5B 4FXKA 3W83A 1C5CH 1ZMYA 1QYGL 2QW5A 5FJTA 1HWHB 1RK0B 4EIUA 3W9DB 5AVHA 3S2LA 2PWEA 5C5YA 3BLIA 1YEJL 3QPXL 2X0YA 4PCFA 1DSFH 3RVUC 5F7AA 1XDLA 3LJ3A 4HEME 5F9JB 4HIIA 3LD5A 4L1LA 1QT1A 3F12A 1SJVA 2QZ5A 5GGRA 2CCRA 5CP3H 3BQ5A 3FRUB 3NPSC 1MDTA 4QEHA 2GZXA 3ZTEA 4IRJC 2OW7A 2WVVA 3GBDA 4ONHA 1HHKB 3HKFA 1MAMH 3J07A 4HMDA 2Z1SA 3O0FA 5E6IB 4R96B 1K77A 2VDOB 3DJRA 4BH8B 3BSZL 3H7BA 4ZQKB 3FUFA 3MWAA 4S1RH 5IJKC 2G37A 1TVBB 3DECA 1I1CA 1LLAA 3TBWB 3TVMD 1JR1A 2XYLA 3RM8A 4B6ZA 5FYKD 4J27A 3WO3B 1P1XA 4P2OB 4AZ7A 3DX1A 4B5VA 1E1EA 2ZWKA 3ARDD 1BQLH 1XIBA 4YHKH 3SY8A 2AJYH 3MOAH 4XNAA 2PDBA 4G72B 1U3ZA 4B9YA 2R27A 4M5SA 4TYUA 2J13A 3HLAB 1XH1A 3QQXA 3UJIH 1IXOA 4S3JA 1HI6A 1ZOXA 5FECA 2DUZA 3I3DA 1J79A 1UKSA 2GVYA 3ME0B 1OAZL 3HS8A 3IKCA 4PQXA 3ZUCA 1KBIA 5IGXH 4GQBA 4QT5A 3M0JA 1D2KA 4YDNA 3EBIA 1LWJA 1TJGL 5I1JH 1NBVH 3BAYA 4G2AA 3TN0A 4QIUA 2BZCA 4DB7A 1AQ8A 3GZPA 2PR9A 2E9GA 5ALBL 4DO5A 4FMFA 4V1XA 4Y5VA 1RCXB 4KV5F 3WIIL 3BQVA 2DPEA 4MHBA 5BROA 4S2BA 4KKQA 4M6NL 4MDRA 4B7IA 2PGWA 1DCEA 4OF5A 3EOSA 2Y2TA 4EUPB 4LFYA 2DW6A 1QMLA 3GDRA 4NGHL 1IGMH 2PC8A 4PFMA 2A99A 4GXVL 1SQMA 4ASTA 5G4NA 4P8WA 3QEQA 2XZ9A 5G2NA 3JXAA 3R10A 5LNVA 3P14A 4QJ3B 1WC7A 1JVNA 4BWLC 4NJAH 3NURA 3LXAA 5JDSB 3WN5A 1YPZE 3KYKH 4PJXA 4TV6A 4A6YB 1HHJB 5IKCB 4ZQPA 1KV7A 5EOCL 4M5TA 4LT7A 2IH3B 4P9MH 4PJIA 2J24A 4HHAA 2WNGA 5B21A 2BC4B 2X7WA 3S6OA 1OADA 4AIUA 4C60A 4ZGYA 3SPVB 2BNRD 3PJXA 1IM9D 2J55A 5XIAA 3U36A 1V3JA 1CTMA 1FHLA 3STLB 2CKRA 3BW4A 3HAEB 1WO2A 1XCTB 4YIQA 3VI3B 2FECI 3GMPB 1UJTA 4ZDHA 5KSAD 3ZDYB 5T3ZE 3IFNH 4TSAL 3TZVA 4RW5A 3DIFA 4ML4A 1R30A 1R38A 3VXRD 1J96A 3V6OC 4A2LA 1GTNA 5AC8A 3BGJA 4U4BA 2GIYA 1QHPA 2XM1A 2JGYA 4A7VA 1IM3A 1W8EA 1ZVHA 5DO2C 3SKUD 5I1HH 1RQEA 4HK5A 1M1SA 1I0BA 3LQZA 4IZGA 3H9SE 1UUMA 2GTZB 4JO2H 4KTDH 1ZK9A 1HT6A 1OJXA 1RZJH 3L3DA 3D8MA 4NKDA 2DZUA 1PZBA 3IDGA 3LKNB 2NXHA 4FR1A 4L61A 5HAOA 3NABH 2QPEB 2CMRH 1EDYA 4QCIA 2IPUK 1SDDB 4R90H 1A4BA 2KZBA 4Z7QF 1GTFA 1FFQA 3DPBB 3MCKB 1HL2A 4HJ0C 4G8FA 5FA5A 2VQUA 2DQFA 3MJ7A 3QORC 2NRDA 1CURA 2KLSA 1AAJA 3CEUA 1R3IH 3KWSA 4JXCA 4OI7A 1HKFA 3VFOA 2ACRA 1F11A 1OK0A 4IRSB 4O00A 3VFTB 1FSKC 2NX5B 5FYKU 4FL4B 3FVMA 5C2BL 1QEXA 1IAKB 1GW9A 4LCYB 3H9SA 4UYQA 1P84K 1UWEL 2WKGA 2O72A 3EHBB 4PJHB 4EI5D 1EFQA 4JY9A 1ZLSH 3SM0A 4NCC1 1F3WA 1LNUB 2V9DA 5LXXA 1AO7B 3F5KA 2NY3B 3L7FB 1N26A 3UXFA 3CV5A 3VU1A 1L6WA 3SQOH 1AH3A 3L3JB 4Q6XA 1F3DH 2RDWA 4L48A 3HF3A 35C8H 3L7EA 3QLLA 1KB5H 1AG0A 2OQHA 3S9IA 1E5CA 2DY3A 2EBNA 3RRAA 3W7GA 2C15A 4JY8A 3PBGA 1HXMB 2AMGA 2H2SD 4XTRC 2F18A 1CB2A 3VCNA 1BQCA 3KPLA 5I1EH 4GT7A 4WKHA 3K8LA 1VFUA 1OX4A 2RJGA 3VE0A 3SY0B 2V30A 1S3HA 5DDHB 2GJPA 2HJPA 3REVB 1WD8A 3RIFF 2R1KA 3ARDC 4IBTA 4F7CA 2WJDA 2EHHA 4I9AA 4GE8A 2VH5L 2V17L 5DF0A 2D2CC 3BUIA 6FABL 1KLZA 1NDGA 3VXSE 5LDSA 1E28B 4TTDD 3ZE1F 4HLZG 2DZEA 2V5DA 3UAJA 5F1NA 5B1JC 3RWCA 4OJEH 2FEEL 1MPAH 3HC0B 1O6TA 1EQWA 3FY1A 4PFHA 4DO4A 2G0LA 2QV5A 4X2PA 4AVKA 2DKUA 2BNQB 2J7EA 3MBDA 4X6DF 1V27A 4F0HA 4PTUB 4C4KT 5J89A 2AJZA 4JHMA 5HI3D 4IDLA 3Q06A 4Z2IA 5MF5A 3HGJA 2YD8A 4BI6A 3O6FA 4FLSA 3IDMB 4HU0A 4JTFA 3NM1A 3JBG7 4A6YH 4ZQRA 3TU6A 1JVOA 3AYRA 4TV3A 4RZ5A 1KTCA 3QAZB 3NQEA 2CM5A 1M6OA 3OJVC 5IW1B 2PWHA 3IJEA 4MYAA 4G6KH 1RJRA 4WX2A 4ZTPH 4HZLB 4JRYA 2OMVB 2PPAA 4M48L 2ICEB 3D25B 4OZGE 3V5KB 1EEPA 1J1OH 4FTVA 1TQBC 3V0VB 5JQHC 3R8GA 1SOSA 2CM6A 1VKXB 4B97A 3QBUA 3HZKA 2YD4A 2Z3FA 4QLWA 4UFJA 2J6EA 3NZHH 2JGQA 5L2JB 2C7UB 4OOZA 2D3LA 2VLRA 3PUCA 2NWRA 3V79C 4Z17A 1JTOA 3IJSA 3S2NA 3QO0A 4MXVF 1QOXA 4JTEA 1BQHG 4Y5XB 4EOWL 2WMJA 1Z5LA 2DF3A 1KYDA 2VMDA 4GRWF 1L9SA 1V02E 3H42L 5KOVC 1MCBA 4H40A 4M61B 4MNQB 5DI8B 3V9CA 4DOHE 1S2UA 4LVFA 2VUNA 1KFAH 1M7UA 2GDUA 3DBNA 4E68A 2VDML 4M5ZH 1F9CA 3SCPA 3LPGA 4GYBA 4PJHA 1JMZA 1LO0H 1YDPA 4FTVE 1AC6A 5LG6A 2OP4H 1RSYA 4R5TA 5EC1B 1AQHA 4F37K 3U6RB 3M0YA 2WKJA 4BI7A 1SYVB 4YLQT 3FCTA 4JFHE 4A04A 1F6PA 4A8NA 3BCJA 1OB0A 4NAMA 3DEQA 3FBQA 3GG8A 1AZCA 2VLRE 3OLDA 2BNUB 2MCPL 1AXIB 2A6NA 4LSTL 3N17A 3W2DH 3ILQC 1W8SA 3STGA 2I60H 3HZVB 2MNRA 3RP1A 4CQDA 1KT2B 2WOYA 3N13A 5BU6A 3GD1C 4L4VD 3STEA 1H3WM 4O9HH 5KTEL 3MRNA 5DUBA 2D3JA 1XXFC 3OQEA 3TJEL 1Q9WB 4WDIB 3K2UL 4GSRA 1B0GA 3Q01A 2YFNA 2C4XA 3I2CH 3AYSA 4TS6A 5E2WL 4HA4A 4TSAH 4HCIA 1WUFA 1YMME 3TMLA 2VITB 3T2NL 4CQCA 3KW3A 1YQVL 3EJYD 4PJHF 3GNOA 4ZENA 2IWKA 1H3TA 5FAAA 5B1BB 4XZ4A 1CWVA 3F7VA 5GS1C 3WUWA 2C4FU 4DP8X 5B7YA 1KFKA 4MCNA 3RCYA 3HAEA 1IXQA 5LNRA 1ZSDB 2YZ8A 4Q52A 5DJ6B 3ES8A 3N9RA 4R27A 1F58H 3RNQB 5IUCA 1IMHC 1OZTG 4B5ZA 5EULV 2GJXB 2PW2B 4N9GA 4V2BA 3WJLA 5ITBL 4JFQA 3SJVA 1T0NB 4KKZA 5KYXB 3HZMA 5CBIA 2IH3A 2JE8A 3TV3H 4ZSOE 1K8DA 2H8XA 2D7OA 2HFTA 3CQFA 1CXHA 3N44B 4HW6A 4ZT1A 3T0XA 3VYPA 3ZTCC 1PZUB 1HOCA 3MRPB 3HO8A 3MAWA 1IVLA 3G8EA 5T1MB 1AC0A 5D2LB 1JGEB 3QQ3B 4PJ8C 4F3FA 1N9PA 2ON3A 3DBXA 4JFFD 1JPTH 4PWFA 3LY6A 5KJ4A 1GPOL 5CEYA 5CAHA 4HWEH 4Y19D 2BSBA 2YPLA 4Z7QE 2PD9A 4R7DB 1E9QB 4MNQD 5B7EA 1QNPA 4G9DA 1FGNL 2CEQA 2JB6A 4XBJA 2WLIB 1TQWA 2TAAA 1PYWB 4BA8A 3TN5A 4AZ6A 4PB4A 2IQ9H 5M7QA 1QFHA 3QG6B 3EH1A 4PAZA 4HB7A 3JTBA 5HUOA 2IGFL 4F93B 1G67A 1EJSC 4IBSA 1OANA 5A1AA 3ZSSA 2B1AL 5ILTL 2YAEA 4ZFZB 1TWWA 2L7EA 3OTTA 4GXUM 5TE6H 4ENLA 1GYWA 2Y07H 3C6SB 3T4CA 3GW0A 3MW7A 2VWEC 4UQDA 3QISA 4ZOBA 2VDQL 1A2YB 2IPUG 4WFFE 1AGDB 4E9YA 3T3MB 1XUZA 4JZJA 5IM51 5L4FA 4JVUA 4GAJL 1DL7H 3BXNB 2WLLA 3SDDB 1I45A 2C0HA 4KS0A 4IICA 1N0LB 4ANWA 2YSWA 3P7YA 3N2CA 1TQVA 4HIXH 4AYEC 3CVHH 3DJSA 2AJYL 3MOAL 1I1YA 4UQ2B 3CXDL 4WUUE 1BBJB 4BH7A 2B31A 3GG7A 2FVNA 5HDQL 1WBYB 1UJ3C 2XBDA 5TH2A 2VC9A 4Z7WB 4JICA 4JIHA 5HWMA 4P3DA 1UKOA 4WWKA 4NVTA 3ZJ8A 2HPIA 3VWJC 1FDLH 3E8UL 2ZUSA 3NZ8B 4NJGA 4JW3A 2DDQL 4M00A 1VRSA 1XQ4A 1CFSA 4GD0A 3U0TA 5BVPH 4I1NB 4ZNCD 3LMZA 3NIFF 2ZZ4A 3NOYA 3K6IA 4S3GA 1S7SA 4JY4A 4XC3H 2ZG3A 1UACH 5ICZA 4JQ3A 5BW6A 2O6CA 5IVZA 1W16A 2X89A 3JTSA 4E42B 4PUMA 5DC0A 3EG9B 2JIXB 4XNQB 3RNQA 3KPSB 1ZGLP 1KM1A 3F7KA 1CXLA 4TRPL 2GJXA 2IQ0A 5CAYB 4R84A 1UR4A 2MIZA 4KO7A 3BUQA 3TSDA 1GOKA 4R53A 1KA9F 3VD4A 1S5HA 4N02A 1GQLA 1OHQA 4Y19A 1I31A 3FJLA 3CUHA 4YK4B 3SBFA 3UP1A 4P2QA 1G4TA 4BE6A 2DVXA 3K30A 5FW7A 3QH3B 1TEGA 5KYUB 4JHBA 3VFLA 1PU0A 2PR4L 3EOLA 2XQBH 4U1HB 4B9KC 4YN5A 1LBMA 5KSBA 2YGYA 3ZOAA 4AYBA 1Z9NA 3PZVA 1YTEA 2NX5D 4WGVB 3RUBL 5IW6B 3OAYK 3VOJA 2E7HA 4JPWL 1EBPA 4LSDA 5B1CA 4EDXB 1VCGA 4PGCA 1YPFA 3CXHK 2NY0B 1E6JL 3QCVH 4N0CC 3PBWA 1I6NA 1ES0B 4P2OC 1AGFA 4UTAH 4L3EB 3UEQA 3WF2A 2YD7A 1PSKL 2ZCHH 4M29A 5EBWB 4KTEL 1GZJA 2YUWA 3NIGE 1EAPA 3BVVA 3V8OA 2QCEA 4IOTA 4OI8A 2WQPA 3QCTL 1KN4H 4GNJA 4F0SA 1FKWA 1JD9A 3NNTA 3S5ZA 3PF3A 1YYMH 1BQUA 1IQWH 3IN2A 3FUMA 4LSVL 1DANU 3OBKA 5GJSH 4BFGA 3QEGL 2GW5A 4ANKA 2WLHA 1KXVA 4NB7A 3WGUB 3TQ0A 4BF7A 2CK2A 3I75A 4W5UA 4WIWA 2RAGA 1MWAB 3AG3B 5EUOB 3EJZC 3RJXA 4C6BA 1G4EA 1TXKA 3APNA 3DRTB 1QD0A 1TPDA 2AQWA 1BYCA 3ICJA 2WW5A 2V4LA 3CXOA 3DESA 1U3NA 3ZTNH 1H0IA 4B5UA 2WK2A 3MGAA 4Y89A 1TRDA 2DQEL 3P77B 2ZWYA 4LVEA 2HJKA 3KXFB 1L9WA 3VFWB 3FU0A 5D70L 4IXHA 4LBUA 4AD0A 1GC1L 2H9AA 3S4SG 3IIPA 3RCMA 3RAJL 3TAKA 4JFSA 5FSEC 3ASNB 1Q9LA 3ABLB 4PG9B 5C0EA 2JCCF 2HCZX 4MXQC 4QD2E 1EHXA 2GJ6D 4BSVA 2A3CA 4KK9C 1ZHNA 1SZFA 2DJXA 3VAVA 4WI8A 4DVBB 2X1RA 3KLKA 2ICEA 3D25A 4RNRB 4OIFA 3HG1B 3BJ91 3UG5A 4F7MA 1LWIA 5FAGA 3SRFA 1DEDA 1AS7A 3WEXA 1OX5A 3CHOA 3LSOA 4LF2A 3WJYA 4HUNB 4GX8A 2PDHA 4ROQA 1BGGA 4K23H 4GBXB 4ZAKC 3HLKA 3UDWC 4DGVH 4MZ1A 1T1ZA 4RZ6A 3SCVA 2J7BA 1A8ZA 3UNDA 4DJDD 3ULVH 4FNSA 1PB0A 2AXFA 4LLMA 4UOZA 5LB1A 3TO2B 1B4RA 2X28A 1NIUA 1JCNA 2W6RA 1WRFA 3DV4A 3OKEA 4Z7VF 5EIIG 3G6LA 2EEFA 2XN0A 4ZCWA 2W0LA 5IBUB 2VDIA 4APQA 3V6ZA 1AG6A 5BZXA 1MQRA 4ABWA 1UZ4A 1GGUA 3FB6A 3K6NA 3KOWA 1AR2A 4LEOB 3VQLA 3BAEL 3BVNB 4KK6C 3ITTA 5EZOH 5FO7B 4TMPA 5AYUH 2EYSA 2P7TB 1IJNA 3U4BL 3RVWD 3C6CA 3NEXA 5H94B 4E9XA 1O94A 2DSVA 2OX4A 5DFWH 2HLAB 3BP7A 3AXMA 4MCZA 5CP3A 1YJDL 4NUJB 1SVCP 1CDJA 3UJEA 4W87A 4O58H 1CFVL 1JGMA 4BEQA 3FAXA 2WV8A 5DZOA 3ABQA 1U8CB 2Z93B 4JPQA 1JCLA 5DUPH 1MMFA 3HJZA 1AHWB 4Q6KA 3U7YL 4GEJA 3W0KA 2HNHA 3BP5A 3OGRA 2XIMA 3TQKA 5DMKB 1EO8H 3G3DA 2I07B 4M7LL 2H9GB 5D71H 3T8XA 1E7VA 4MS6A 1W3LA 4H4IA 2XA3A 2YPKA 4C57C 4IIFA 2LE9A 1HS6A 1ZIAA 1J5IA 2HFFA 1DVJA 4J7RA 2CNCA 4A6GA 5AZ2L 4I9TA 4XZBA 3H8AA 2OAAA 1XXDC 3R8HA 1I8JA 3S5NA 4XX1E 1EPXA 2VGLM 1FTXA 3D85D 1XZ0A 5I17B 1A4CA 4PMZA 3VZZA 2BVOB 5C0CD 2GIXA 1D5MA 3DTXB 1W1YA 1CECA 3MRIA 5CZTA 5FDWB 1OXYA 4JM0A 4RWYL 5BW7C 2AS5M 1MCDA 2FUTA 5IG7A 5F0JB 1V0LA 1X7IA 2KAUC 3S96B 3NQIA 4PG9A 3GZQA 5J1TC 3IGSA 1T89C 3LAFA 2OMXB 1IGYA 3FKKA 5GPRA 1UZ6E 4OSUH 4O16A 2GBAA 2MQGA 3IDUA 3VFRB 4N0CD 2NY5C 2LU3A 3VM5A 2IG2H 4PHXA 1E90A 3VRIB 3SUTA 2BVUA 4IMKA 4L18A 1FA2A 4YDZA 3SDAB 4XMUA 2LABA 4HPXA 1T2JA 3MI6A 5GRJH 3AZUA 5A6BA 2WINA 5C07A 1WCGA 3VUSA 5E2TH 1B3VA 1LWHA 2QXWA 1DV7A 5CJQH 3O4LB 2V5KA 2IIJA 3OIHA 3BFWA 5HNRA 3TYGL 3WN6A 3M1BA 3MSRA 4FOKA 2KPNA 3UYRH 1VFFA 2PDGA 4G1EB 4M24A 2QIWA 4HT1L 5DXWA 3B8WA 3WQVA 3GFXA 1OY3B 2QHRH 1HX0A 3ZXAC 1XLCA 3CN1A 3BMVA 3KBWA 1CTNA 1MXDA 2CA3A 4GNVA 2ENQA 3SCMD 4IW4C 1KTNA 3FQWA 5IB4B 3RWFB 1FRGH 4RXFA 3K5SA 1UEYA 3EF4A 1XB6A 3GU2A 3TIMA 5F89A 3D85A 3SYOA 2PURA 1JPSH 2OXHA 1U8HB 4ZFMA 2BXYA 1R24B 3DX2A 2LU5A 3RTQD 4NKCA 2QGHA 4TNWK 4CSPA 2GK0A 5PCYA 3IPWA 3WSQL 5ACMA 1Q2RA 1HN1A 1IBFA 1OB1A 1E7UA 3EZJB 5K9JH 4MJIE 2W80C 3IMTA 1YN6B 4RLDA 1UACL 3MLVL 4ZOAA 2IUZA 4Y5XC 1UZDA 3MUIA 1YMMD 3E6FA 4XPHL 3H7RA 2H7WA 1RHHA 5DSCA 2D7MA 5E00B 3SGEI 1WPCA 4O8RA 4OCNC 3ZZQA 1FDLL 4QTHB 1OOAA 1TWZA 7FABL 2R9RA 1AKJA 3PPHA 2PCYA 2X4QB 1BGXL 1ZPLA 2V5MA 3LEVL 4U1KB 1S7UA 5JUEH 2VGFA 1A9EB 5CR1A 3AHTA 4D6HA 1C7TA 4JJOA 2YK1H 3HJEA 4PRIE 3RB7A 2XH0A 5ECUA 4C55A 3WH7A 1O5XA 1PDZA 5D9SA 4D9QE 4P5MB 3TBCA 4JY5L 2BWDA 4L8CB 1XYAA 4ZSUA 5JUVA 5C0CE 1IBDA 5JU6A 4EAMA 4GP8B 5AAMA 1R1CA 4N0YL 4TN9A 2MSPA 5E03A 4HKBA 3RKPA 3TYFA 1A3QA 1KGYE 2LLLA 1U2YA 1DZBA 3CSFA 1AGDA 3OPZH 2FPTA 3GFYA 2G60H 4PRBA 4WSHA 4LBAA 5C0IB 3CMOL 2IC2A 3C6SA 4GSXA 4IFKB 3GSWB 4PWEA 1WXJA 1BWMA 1AH4A 1SFJA 2X70B 3BZEB 3PWNA 3LI0A 2XCMC 3OX8A 4PS8A 5CP7A 5J6GB 3GH4A 3N6HA 4IM8A 4S3FA 4AVJA 4XUYA 4AMWA 2EC8A 2YW3A 2VZVA 2DQIH 3MX0A 4KK5C 4Y4FD 2GK0B 4G9DB 1GGCL 4XIAA 2AQSA 1DVSA 1I3VA 3ASWA 5AKTA 4JG9A 4YJZL 3APYA 4Z1BA 2SFPA 4JM4L 4GFTB 3EB2A 2W8CA 1G0XA 1DJQA 4AM0A 3UG8A 4X8JA 5CAKA 5SWZD 4KNUA 4DY1A 3PLYA 1EA0A 2XV6B 5K9QG 1W1PA 1L6XA 1CZ8H 4X4XB 2ZDRA 1JZ3A 2EXYD 4YSOA 3KHQA 3VOIA 1ECYA 4UBDC 5AKSA 3MCMA 5GIRA 4QRRB 2ZRZA 2EDRA 2ZOTA 2ROYA 3CL6A 4GHRA 1AZVA 3WLKX 3OR6B 3ROOB 1CLCA 1NCWH 4OF0A 3GBMH 2JF6A 1DJSA 3VE9A 2PYFA 2Q7NA 1S2EA 1BA9A 4AWSA 5KSVB 2VEIA 4NOBA 4X5QA 1LK2A 4FF9A 1WZ1H 1QSFA 1TR7A 1SZNA 2YGPA 2VSCA 1C8QA 5IBLD 5IOPA 3OOQA 1SGKA 5EIQA 5PTDA 2MCMA 5JR1L 1HK6A 3GC5A 2OYPA 2OCZA 4GIYA 2QQ6A 3NJNA 3QIUB 3NCYP 4XAYA 3SW6A 1MHHA 4F8OA 2XKUA 3RAJH 4JO5A 2ZUMA 4N9CA 3GJFB 3TH3T 4JAMA 3X2QB 4EO5A 5CBEB 3RLUA 1FWJC 1K3IA 4UU9A 4G42B 5EOCJ 4EZLA 1QHQA 2PGEA 4XC1L 3PWLA 1M7IA 3OB0K 1AZ2A 2VXNA 5F44A 4O4YH 4XNMB 4Y7MA 3AY4A 4XE5B 1KXQE 2EIDA 1F42A 1F4YL 3IJYA 2OTUB 2VM3A 2IDQA 4KGJA 2JIXD 3U4EA 4NI8A 2AQTA 1QSFE 1BW8A 1D3GA 4R7XA 3MBXL 1KR1A 4GKOA 1X3DA 2A6JA 2PXYD 3CC5A 2VDMH 2CLKA 3NCJL 1WDPA 4E8GA 3CCHB 1G7PB 5F8RC 4YXGA 5I1IL 1XICA 3X13B 1MRFH 1GQKA 1RBAA 4Z77A 4WVXA 3I6GB 4DP4X 5FFGA 4M3HA 3IUDA 2PWUA 3WGVB 2RQ8A 4MXWH 3AGWA 4WEBL 4OLXH 4HK3J 4PS4L 4U6HA 5EZLB 2ATSA 3OR7A 1OCOB 2XG5A 3TVMA 1ZXKA 1VA9A 3LS4L 3RLHA 5TE4L 2R4RL 5EFFA 3DO7B 3ZRFC 5D8WA 5C97A 1CGSL 2A3AA 1VERA 5T3XH 3VO0A 5LGJB 4K9EH 2X4RB 3SKNB 5AW5B 3ZYJA 5J06A 2V5CA 1BYNA 1QPKA 1UM4H 3ESVF 5DQDH 3H26A 2HX8A 4IIZA 3FK3A 3MNMA 3DSNB 4FNLL 4J8RA 4XVUC 5AAWA 1T7LA 3N1GC 1T0MA 1GIGH 1SLWA 2V2WB 1O5QA 4K7PL 3RX9A 1T83A 4EZJA 2RCSL 5DK2B 1WAAA 4Z3FA 3QPZA 2PPFA 4XI5D 1V05A 5LWYL 5KINA 1KULA 3CWGA 1KTBA 2ZUQC 4F1ZA 5IOKA 1CFTB 1MFMA 3PBYA 3QJSB 3W81A 1NBQA 2J8TA 3WMLA 1BVNT 5IMKA 3K1KC 4BRVA 4DGWC 3N43F 1KN2L 3O2DA 3FB6B 1J0HA 3SYCA 2OU4A 3PVFA 4F2EA 5HYJA 3N29A 2F5AL 1XFBA 2AQVA 3EGXA 1GTHA 3BH4A 4GUHA 2DWEA 1FF5A 1EMTH 3DGRA 1KNWA 1HNYA 1D6EA 1OTTC 3MHFA 2MJWA 3D4ZA 4JHAH 4R97B 4AY8A 3DN5A 4R7LA 4BFBD 1NOAA 2HG0A 2E9MA 1L9QA 1KQYA 4MRBA 3GR4A 4K9JA 3SCRA 4FX6M 1J01A 1NGYB 3CXDH 4Y9BA 2C1IA 1A7OH 1TEFA 5EY5A 4PV8B 2DI9A 2V3DA 3MRJB 4O1BA 3RHGA 2G8ZA 3KHDA 2Q8LA 3EG9A 4ZMWA 3VXMB 1H19A 4L1TA 1U36A 3ONBA 3US1A 3GRBA 4OM0L 3N9GH 1OCWL 1AH0A 4ALAL 2R9HD 1WTLA 4ELKB 3OKOB 1Q9LB 3QARA 5I0WA 1BP3B 3KPSD 4HGWA 4UANA 4X9YA 3MREA 4HT3A 2MQ3A 5I76B 3B0YA 4PJXE 4XKYB 4XAKD 2X4SB 5IIEB 2BRRH 4PJIE 4KPHH 4IBQA 4WSJA 3DUHA 4NQVB 1G6RH 3C2AH 4LEXL 3S0CA 3WLJA 5ENWB 4PEKA 5DN1A 1H9VA 5KS9A 3IMVA 4Q8BA 5JIHA 4W7WA 5D5MB 3APMA 2HN7A 2O9OA 3MBXH 4H1LH 3PN8A 2ZUVA 1QTPA 2VXSH 1JZ2A 5F7HA 3DIPA 5ITFA 4J3VA 2DWTA 4KRTA 3A47A 1NGPH 1N68A 2GBUA 5CILL 4F7KA 1V3HA 3PUEA 2M26A 4Y9OA 4XSMA 1U92A 4YX2L 3MZ2A 3B34A 1CL7I 1QI3A 3HRPA 1RZJL 1JRBA 4Z2HA 1B3WA 4UTUA 3HHRB 4XN8A 1FCQA 3A3XA 2DZWA 5EA9A 2GYSA 2G50A 4DUWA 1H15A 4AYFA 3QNXB 1NMBH 2J9YA 4MJIB 1LE9A 1L2QA 3W24A 4N2GA 2H8ZA 3TK7A 4LH8A 1W37A 4NJ9H 3WIFB 4ENZA 4REQA 1JPEA 1IM3B 4N8VB 3P0YH 3KHJA 3M0ZA 1NIDA 4PCTA 5F4SA 3HHSB 4BYHA 1KACB 4RMTA 1YEGH 3BAKA 5J6HA 2CLFA 2G5BB 2IKIA 4QHUB 3LS5L 3AVEA 1E8XA 3TC9A 3KBVA 4A2GA 4HU3A 2Q01A 4FOJA 3YPIA 2YUXA 2O7SA 3QZAA 3MTXA 4JFQB 1NJ9B 4Q7DA 3F4DA 3FN9A 2I60L 1G7JA 1KO0A 3QHFL 5I30H 3QEUB 4D6CA 3T40A 3CQPA 2P48B 2P47B 2GSMB 3SBWA 2C3ZA 3GIYA 3TYUA 4WSGA 1UOKA 3B7SA 3F1QA 4XB8A 5A7EA 3ITCA 4NN6B 5CN2A 4R85A 4WJXA 2PE4A 3WLOA 4L4TE 1S9WB 2CBMA 2IAMA 4IRJD 1RBOB 1R4XA 1F4XH 3RG1C 3N42B 3CWHA 2P26A 2DWSA 4WO0A 3HQNA 5AHLA 1WWCA 4JFHD 2WZ6A 2ZF9A 4P3DB 4AWEA 4UNVA 1TO4A 2CIPA 3ILQD 3BWUF 1PL9A 3QPKA 1NM9A 4AGLA 4AYFB 4PMEA 5I19L 5AOUA 3UADA 4NQDB 5HGHA 3H42H 1KD0A 2PTXA 4KDWA 2QIIA 2C9XA 1M01A 4X0KB 2E25A 3M64A 3LHVA 1XF3A 5AYIA 4YHOL 4XCYB 1FH9A 5EBAA 2OXGA 4J1OA 4OUEA 1OLLA 1UG6A 4PBDA 3VXSA 1JF5A 4YNYB 3GW3A 3VFPA 1MCLA 4L4TA 4IUOA 3CU7A 4UINH 3BWZA 5DQJA 5ITFB 3GWJA 1HJXA 1S4IA 5IQNA 1QR7A 1T04A 5GZND 1P43A 4UR8A 5HJDA 2P5WB 3OMNB 4G6KL 4QXWA 5DRZA 5GRUH 2FWOA 3W76A 5A2KH 3CZFB 1JGLL 1E8YA 4UV4L 3SADA 4RZCA 4EVNA 2ZADA 3UTSA 1IF2A 4KHTL 2IQTA 3DGBA 4DJED 4IEFA 5F1IB 3DVGA 2PZ0A 1TJMA 2J56A 1UOLA 3BT2H 1EXUA 2BY3A 2EAEA 3ABKB 3EFOB 4G70B 3HS0C 4JRYE 4MQXD 4ODWB 5DGQA 1J4EA 3KRBA 4HTYA 3UR8A 2Y7DA 3WBYA 4XBSA 1XGTB 5K9JL 4AUYA 3VDBA 3VUPA 2W60B 3MRRA 4G8AC 5E2VH 4BH8A 3AMDA 3WY1A 4KX8A 1VKXA 2O93L 4QE1A 4BWLA 1DDHA 3K72B 2IV9A 4G8GB 3RZCC 3VG0H 5K93A 25C8L 3FZUD 4LVNC 4JRYB 4I5UA 1VFLA 4LDCA 1FH5H 4P4KC 5EBGA 8TIMA 4FOUA 3IJ7A 3BIBX 3ABSA 4MADA 1GVIA 4BFEA 3OJ2C 1G0YR 4KH9A 3L5IA 4P57A 2E9BA 4HJIA 3UTSE 5KG9B 4NNBA 2VVSA 1I8MB 4YVVA 2VZTA 4XB3A 3TR9A 3LVTA 3DENA 4K9EL 3ZKQD 1MJ7H 2WO3B 1QW7A 3UWZA 3JZUA 3T0EA 4B3KA 5A8MA 5BS0B 3PPSA 5BMFH 2DUXA 3SO3C 4ZEPA 4JCLA 2AK4E 3S88H 4C7DA 4OCRL 3MRNB 1CE1H 4DLFA 2BP0B 2V5YA 2IGTA 4Y1AD 3MUHL 1IRAY 1X4XA 4PS4H 4PBVC 5I1KL 1E9YB 2DD8H 4GRMA 4JG1H 1KB3A 4MXWL 4ML9A 4DZIA 4L4TB 4U49A 3ZVHA 3K1GA 5DJZB 2PD5A 4NM8L 2WHKA 3DVIA 4A8RA 3LEYH 3P11H 3VM7A 3PE9A 2CWRA 1ADQH 1TCMA 2IAMC 5C2BH 5G55A 2BX7A 2O26U 2BXZA 3AU0A 2YO3A 4S1DC 3O4LD 3RVTC 2G4JA 2DS4A 1IR2A 4X5WA 1HZKA 4NQDA 3T0EE 2IV8A 5HGHB 5LQBL 1C8XA 1QPOA 3KM8A 1WWBX 3D2TA 5D7KD 2UY6A 1NGQH 4KQ4H 1UTDA 1D9KA 3NP4A 3KYOA 1F97A 1NCIA 2J72A 4OSUL 5MI0C 2APFA 1EZVX 3HG0A 4O02B 5LNDA 5FKYA 4OUUA 1EZWA 3KW7A 4APXA 3GS0A 3UPCA 2J5LB 1COBA 2CMRL 1KIQB 3V4VH 3NABL 2J1ZA 1JGVL 1IBBA 4PBEA 4H7VA 4UT7L 3WEAA 3MZTA 3PGCA 5IVXF 1XG3A 3RGHA 3OWRA 1J6PA 1KF9B 4TVPL 2CKNA 2EE2A 3V0HA 1G6CA 3MVSA 4C6OA 1HIZA 1RUQH 3S8HA 4P8XA 3LDVA 3N41B 4M8RA 1L8NA 5HDBB 4Z0BH 3HUJF 3B1UA 1NOUA 3U6XA 1F00I 4PR5B 1VS1A 2CIKB 4OBRA 3GXPA 3TOYA 3MV8D 1SXAA 2DQUH 1KYUA 1P0SE 1WZ1L 1CK0L 3N41F 4OF6A 3NQFA 5HNUA 4PSRA 2C16A 5G5IA 3RAOA 3VE7A 3LNFA 4XAWL 2ZC8A 1U8NB 4WLCA 3MBWB 4MLJA 3L67A 1PZCA 1UBSA 2XGIA 1MW3A 1ZEAL 3UG3A 2NY2D 3ALXA 3GSNA 1IE5A 5EPMB 3GYEA 1ACYH 1WAWA 5GJMA 2WQAA 2ITFA 3EXLA 3IDGB 3LKNA 3NGBB 4UU9B 2YUZA 2PSNA 4QAMB 5HR6A 2DYPB 3U3HA 1UFGA 2V9QA 1UB6B 4AT6B 4MFHA 1GOMA 3V16A 3W1NA 2UXFA 1I1AD 2IXQA 3HC0A 3I3EA 1ODAA 2CR3A 3QZWG 4WY0F 4CADA 1EGJH 3DOSA 4BK8A 5GGSA 3A4AA 2GJLA 1C1EL 5D9PA 1KCLA 4B9FA 3Q67A 1S5WA 1C91A 4JFED 5DJDA 5I66A 1A1NA 4ETYA 4HPHA 1NF0A 3BAEH 1AXSB 2WM0A 3G0SA 1K03A 4HSOA 2HTLC 2CBTA 1IKFH 4IUGA 1HEZA 3RPIB 4Y9EA 3NCYS 3BUBA 5L4JA 5BJTA 5GSVB 4JYDA 2APSA 3LM3A 4ZFCA 1TTGA 1BXVA 3V10A 2YZ5A 3FHQA 2GUBA 1ZA3A 2HT2D 2WAHA 4PMDA 4GB9A 3S37L 5C0BD 4JPKL 4K23L 2E6DA 3P9LB 4EN3A 4JKMA 5JIPA 3V5FA 4FQJH 5C0JA 4GUIA 3ZK0A 4UTBA 2BASA 4U1IB 1LO3H 1E1CA 2EPLX 2B3RA 2JKEA 4A38A 4Y5YB 1E4IA 4XMTA 4GRLD 2XTJB 1RUQL 1HHHA 1QBBA 1URIA 1O95A 1AS8A 2YAOA 2NX5A 4M3KB 3EUDA 1VFMA 3SPIA 5KEZA 7FABH 2IS7A 3QFDB 1AIZA 1UJ3A 4B3VA 2Z1BA 3RG6A 1ML1A 3GUTB 4LB3A 3I65A 3LRLA 3PV7A 3WL1A 3NO3A 3VOHA 4DF2A 1IR1A 3CV7A 1U5HA 3ARZA 5GGSB 1B9BA 1HUVA 2NY6B 3MNWA 4YMPA 3U0PA 2BB0A 3P5ZA 4LCWB 2EPMX 3MNDA 4HSNA 4QKXB 1NCHA 4O17A 4AEHL 1XMWA 3CVIL 1W9DM 2AP2A 2W79A 4LSVH 3D5HA 1VD6A 3V4VA 2O7QA 4HUXA 3AFLA 5I09A 2NY7L 4HVBA 1IZJA 3QQDB 5FUOL 3B0XA 4CW1B 2RDXA 4B60A 3MFGB 3CPUA 1NC2A 3MLSL 4GINA 4PGBB 3FJ4A 1JD7A 1FRGL 4F9LA 1IVTA 3CSYA 2G9HB 4JG1L 3VGDA 4GW5A 4X6DB 4HK3N 4S2SA 3RMJA 2YBRA 1UD2A 1O9VA 1M53A 1O7DE 2QGEA 1A9BB 4RGND 5FF6B 3WL9A 5I18L 3I6LD 4HT1H 4E0CA 1MN4A 4WRLA 4MGXA 4KAQH 5C0BA 5I6PA 1TPC1 1WUEA 2OM5A 4DW2L 2FZ9A 4O0KA 5D33A 5LXEA 1KM4A 3EH5B 3MJMA 5G4HC 1ITQA 1I3RA 2CPCA 1TX0A 3LB0A 4Z95H 4DWSC 2MCG1 4L5ZA 1OZUA 2QJHA 3C5JB 3WYRA 1TQXA 4ELDA 1H8SA 2VCAA 3SCSA 3KS0H 2F1AA 5ABTA 2C9AA 3WQGA 4LIQL 4MXVE 1EWHA 4KJPD 4OUUB 3WMSA 4LAZA 3GGWB 4DO6A 5HGBB 1SR0A 4NUGH 4GVHA 3U2OA 1QZNA 1X9QA 3L3HB 3PWUA 4DJFC 3MBEA 2CHNA 1QI4A 4X5WB 3GSUB 4M56A 1W1ZA 1W2PA 3LM7A 5DHYB 4X2RA 3VI2A 4QG9A 1YEDB 4JTAA 2D7PA 3SY5A 1U41A 2XN1A 3LH2H 4MKMA 5KSUA 1I3GL 3L4VA 2XSKA 2OZ0A 3NGFA 4FO4A 32C2B 4GYPA 2Z4QA 2OTUA 4GSQA 2OSLB 2H2PD 5IBUG 1Q94B 4HYTB 2BOBA 2BFVL 2ENJA 1I8LA 4MAYA 1JWSB 3GK8L 4XNMA 3IFPB 4BJHA 4UQCA 1XLMA 1IIIA 2BZDA 1IAMA 3QFJD 3MVIA 3MY9A 3SIZA 4DXXA 4M19A 5HWNA 1UUSA 2BNRE 2P5ED 2Z8SA 5I15H 1P4CA 4YVPA 1KIPB 3CVHL 2IANE 3D39A 3B4YA 1M9SA 1DBKH 2OZ4L 3C87A 3D3FA 4JG5A 4Q4QA 4DYEA 3J7HA 3SKJH 1LO3L 3ARDA 2H6RA 1A6WH 1E4XI 4CQBA 4DN1A 1M1XA 3GNML 1BXXA 1S8DA 5KN5B 2G3IA 1G9EA 3EJCA 1FYTA 2NQCA 4EAYA 5C9UA 4LVHB 3BAWA 1ZTXL 2KYIA 1B4JL 1KGXA 3AT8A 3MHGA 1HJSA 4UFMA 2JV6A 1J5OL 2VD9A 4K38A 5AKVA 3W0WE 4YNGA 1PS9A 4WW1B 4IPIA 32C2A 2A9BA 3V4PH 3UCQA 1UCWA 3O07A 3C60C 3SCNA 1MOEA 4DPPA 3M16A 3IMWA 2ZFAA 1DJGA 5D7LA 1MUMA 2GQ3A 4WU7A 4ABQA 4Z3TA 4H8HA 2CHOA 2AGJL 3CH1B 3GIVB 4ICXA 4RX4A 3U7WL 4K4KA 4QXUH 5A3IC 3GNXA 3LCXA 2W60A 2ZWSA 3MRRB 2WVVB 3ARQA 3BH8B 2KQNA 3BIAX 2EG6A 2GK1A 1IGFL 2I9EA 1WT5A 1PW3A 2YMXL 3IDIA 2GGGA 4WFGE 3AXKA 5ES4B 4I18B 5EU7E 1F4XL 3OLEA 1YHPA 5SX5K 2NZ1A 4UUJA 3U4BH 2C91A 4G1NA 1O75A 2EDDA 4U7MA 4RWHA 4DGYH 5JXEC 4FF7A 4HIIB 1YTDA 4PJ8D 3V36A 4JR9H 2CDEB 1N8ZB 3L2NA 3RQ3A 4H8WH 3UTSB 3HG5A 2XIBA 1FQ0A 3TBTB 2XUWA 4LRIA 5L2KA 5I6SA 3GKZA 4I18A 3LV6A 4FFVD 4F37F 5CFAA 5JIIA 3PP4L 5GISH 2DJUA 2DM7A 1HVQA 4PI2A 1PVNA 5E4IA 1VH7A 4EQ3A 5CGTA 2FWSA 2WTRB 4NAJA 2FDBP 4B95C 3BV7A 5FOBB 2EP6A 5DWUL 3GIVA 2DZAA 3W39A 2Y0SA 2IQAA 3LS5H 1HTYA 3ZDZF 1GWJA 3CB3A 1F3DJ 1WWWX 4IL2A 2DLFL 4AZGA 2HTKD 3G5YA 4KKBC 3T2NH 1XGPA 4LSRH 3EFFB 4OJFL 4U3XA 1WKEA 1SMAA 1UKTA 3AACA 4PRPE 4RBPH 1OC7A 1MZZA 7CGTA 4Q89A 4RDQG 4HNOA 4L8DA 1YC7A 2YBVA 5A6JA 1C9WA 5ABHA 1AR1D 4LOCA 1WA2X 5F7NC 1M1XB 2QHLA 2ZRVA 3SBRA 4Q4SA 4R7WA 2GI0A 3D34A 2HVKB 3F84A 3SDOA 4TVPH 5HHMD 4AE0A 4HKPA 3K4AA 3F6LA 2W1NA 1TOXA 5I77A 4UT7H 5A16A 3FYOA 1U8OA 1UVQB 3KCLA 4PUDA 3DOPA 3CFTA 3MFFB 2V38A 3STPA 2MCPH 4LNCA 1LILA 3V4UH 3MJWA 3O0RL 3NL6A 3VSTA 1IQ8A 5C0QA 4X83A 3P4OB 4GBXA 2B7PA 2XETA 1JUFB 3D0LB 4F24A 5LHDA 4ZXOA 2VXSL 3V0JA 5INDB 5IP4A 3WEXB 3WNMA 2A7RA 3VOCA 3Q8AA 3SE8H 3E6FB 3RFRA 2P8MB 4CJ0A 4ZBCA 4L9LC 1JCYA 4YDMA 4WXZA 3POHA 3KEDA 2PDWA 4Q8QA 4AIZB 3FF8A 2X30A 1X7QA 3WFAA 2N0KA 3NFPA 4UDTB 4Z76A 3LNPA 5HNTA 1KN4L 1X4ZA 1CDUA 1WHOA 5FJIA 5KZ6A 3EFDL 4MMXC 2AAVA 4XTDA 3TT3L 1NFBA 1VFBA 4WRHA 3HBZA 4E3VA 3PQYB 1F86A 3NIGB 4P9HH 1OV8A 3RGVD 3S9DB 1AL8A 1ZLPA 3RF9A 1H6TA 1EVTC 4L3EE 4AL8C 3TXVA 4REQB 1A53A 2Q6ZA 4CEUC 3N9GL 2ADGA 3KWWA 3EJQA 5GRYA 4RGNB 4CNSA 4NFCA 4LJ3A 4MJIA 5DZVA 2XXCB 1LE9B 3KLSA 2X4TB 4ZXBD 1XL4A 2XQBL 4ZTPL 2VW7A 4HLEA 5B3JF 2L5HA 5HYQA 4LCSA 4YDIH 4PYSA 3C6LB 5KETA 3K5RA 1JNDA 1NCUA 4JX0A 1OD9A 3T08A 2NX9A 3MXVH 4H8WC 3SGZA 4A6YL 4JFVA 1T21A 4P3CL 3GHEH 5CNHA 2BCKA 2XQYA 4N9OB 1AUSL 1FH5L 2HS6A 3PG9A 3TAOA 2G5RA 3UZ5A 1V7ML 5FXCH 1XI3A 4QG6A 3KS5A 4UBPC 4KDTA 4PRIA 3VG0L 3WHXB 4TVDA 3C6LA 4EPKA 4L3EA 2VGBA 2QQKH 1NTDA 2V7NA 2HUEA 3LDBB 3OKNA 2ICWI 4CMMB 5JQIB 3KDMB 4JN7A 2QAPA 3QGAC 3G5XA 4IFRA 1PZAA 3IDYC 1ZVSB 4LLUA 3BSHA 3WEMA 1FIEA 3ARGC 1GYUA 1L7IH 2JSFA 4C8XA 2DY2A 2DMKA 3S36X 9CGTA 2PDLA 2WNNA 4QRUB 2NV9A 1KC5L 3QZEA 2RGSA 5F8QC 5EU9A 3G1VA 1A64A 1YECL 5I1LA 2BNQD 5D96B 3DXAD 2ZZ6A 4ZPTB 1A7BA 3PQYA 3GBEA 2X1XR 2A3EA 3HGSA 2TODA 4LARL 4ICWA 3N9KA 5AC4A 2HTMA 3E1F1 5MERA 4JHZA 1E4HA 2CIKA 4UDTA 2XVBA 4G5AA 4R7NA 4XVUD 2QVMA 4Z76B 4PMUA 2W59A 3GI8H 3EKGA 1XG4A 2VJ8A 2OMWB 4PV8A 4R0LC 1D5MB 4P5TA 3VXOA 1B3ZA 5INDA 3L3IB 2WMFA 3PXLA 3DWTA 4XO6A 2AABH 4RIRA 1OQOA 1C93A 5C0JB 4GG9A 4L1DA 2FQDA 2X3CA 4PCNA 5I1LB 2DTML 3S5LG 3QV7A 3LN4B 4TL4A 3L21A 2IQ9L 2VE6A 4FADA 2TMDA 2D9CA 2F68X 2MKLC 1MDRA 3NPVA 4NZ1A 4LAQL 1FXPA 2BCMA 1U3JA 4LLAA 5T3XD 1R5IA 2HRPL 1PZDA 2R8WA 5GSVA 1X9LA 4MY9A 1W9BM 1EV2E 2QFRA 4JFEB 2BSED 3OKNB 4ZFQA 2V7NB 4CMMA 3CZ8A 4GH1A 2FJGB 1BXAA 2NYKA 1MCFA 2KPWA 3HZYA 4LCUB 2DN7A 5T33H 5IMMB 3IWPA 3MVTA 4HNTA 2FHFA 1TWDA 4QGCA 1YN7B 1CEOA 2UBPC 2VDOH 2Q7YA 4JTGA 1CB7B 2R29L 1SN5A 3ZL1A 3PHOA 3MHZA 4YSDA 4U6XB 4XC1H 4PL1A 1O9WA 3PV6B 1GOQA 1DQDH 2Q20A 2XIDA 2RIKA 4BZ1H 1H51A 1N8IA 1W3JA 1P4UA 1HG3A 2E5CA 3MMDA 4MNMA 4CQAA 5IB2B 4GQQA 4XP4H 5EBUA 1V6UA 3D0CA 1CE6A 3FVDA 3MUAA 1PUDA 2NX3A 4QHMB 1DSYA 1I7UA 2M83A 2XN9B 4FZ8L 1JZHA 2QSCL 3UMTA 1U33A 3ZKMD 5L2KB 1YEGL 2UYLB 2VDPB 3TVMB 3U6XS 4DK3A 1YQVH 5DVLA 3JVGA 3AU2A 3FT2A 1N8ZA 1I8MA 4ZUVB 3MLZH 1YMMB 1CI5A 5IHBA 4PTMA 3K2UH 4KXDA 3ARYA 1JZJA 1M56B 3DVNA 3QFJB 1CF1A 4MLRA 4PJGF 4PGDA 2X4NA 2G3MA 3TC6A 5FDYA 3VVWA 2Z24A 1SF3A 1DE4A 4BK5A 5JW4M 4RKAA 1PDKA 5AW7B 3REQA 3AZRA 3OZOA 2OEKA 1AKJD 3D2UA 5CO1A 5DZPA 3IS0X 3CZJA 4KROB 2KMWA 3NFNB 4HSQA 3V2AR 3SN0A 2FLIA 3HM7A 1M6UA 4Z3EA 1ADDA 4AD2A 4H1LA 1BMWA 4CC4C 5I8KH 4PGZA 1LEGA 1NIEA 3PREA 4Y5YC 4D7BA 1MCSA 3BN9C 3VC5A 5TBOA 1JXGA 2VYRE 1CFMA 3QJHB 3N0AA 3QDGD 4FABH 8PAZA 4WFFD 4FN0A 2FB3A 2QCFA 3ITGA 1KPUA 4R33A 5F9WC 2XYBA 3QY7A 3QZPA 3VXUD 1JV5A 2NW3B 3WBDA 1B3YA 2WJ5A 2XKNB 3BWAA 3FFCE 4RGOH 1M7OA 2QVIA 1MZRA 5DQJB 3SCMB 3CMOH 1PHQA 1AG1O 1FV1A 2BW4A 2V0AA 4WI9A 3SZKC 1CZ1A 1XC4A 3UAJD 4AZHA 1ZV9A 2VDMB 3DGDA 1WCBA 4P5KB 5FYLE 5I1JL 4XMWA 4ZMNA 2PU1A 4I90A 4IX0A 4L0ZA 3NZHL 3HOGA 4KBPA 3R7RA 1GYVA 1DIDA 1A1OA 1PCSA 1DJZA 4RFOL 5DHYA 1KCBA 4XPFH 4ZUSB 2V9RA 1JPDX 4LVOB 5GIRB 3LQLA 3M0VA 4BY3A 5DHMC 4O02H 1TPXB 5HYJE 3CMJA 4YTQA 4AVHA 1OE1A 3E49A 3CL8A 1HHIB 1MHPL 3V6OA 1MO0A 3U9UA 4LLWA 3W87A 4AZ5A 2R1XA 1JHKH 4W9LC 4P0DA 3WIHH 1KPUB 1EXPA 5DJAB 1A7RL 3CAQA 4NG3A 1GHFH 3IU3B 3QDME 4O0QA 1A1MA 3WE6A 4LANA 3TO4D 4BDVA 4J3XA 4JO1L 1PV8A 3TKFA 1X9UA 2L4OA 4JRYD 5AAWC 2WLKA 4JKKA 1QA9A 1HGWA 4AXWB 1CXEA 1IFGA 1LEGB 1TZ9A 1WDDA 3LKSB 3LSBA 3NZGA 4YTSA 3W2NA 2AV7A 1R86A 4UQ3B 2Q9OA 4XPTL 3MLWL 2J57A 1WFUA 4P2AA 3UAAA 1ME9A 1UR8A 4XAGA 2G3FA 1J5CA 5FHAL 4QOKA 4WUUB 1BYAA 3ORWA 5EA0L 3VXNA 3JWNG 3MRMB 4PVNA 4NO0B 3SRKA 1QP1A 3BZDA 3HS9A 5D1ZA 3KR3H 1P7BA 4XWOD 4QRBA 1OF2A 2Y6SD 4YGVA 4I7VA 3D3VD 1OTSC 3JTTB 2G5BA 4GI4A 3VXUB 2X87A 3MXVL 3E0WA 3IT8D 1EJVC 4YDKL 3IDMA 5AQ0A 2HT4C 3OXRA 2OPJA 4GZJA 4DCQB 3L81A 2FX7H 2J4GA 3WIFA 1TIMA 3IGAB 3FT9A 4G9FB 4L8CA 3VFMA 1XIMA 2MWCA 1WITA 3H2NA 3V0TA 2BSSB 2W07A 1WGVA 2NYZA 2O4QA 3W85A 3QNXA 4J2MA 1H15B 1K7XA 1KB5L 4QOKE 1I1YB 2DBLL 4BH7B 1LDSA 3SPJA 3QEZA 5BXFB 4LCWA 2TSBA 4FGMA 4K55A 5CN1A 1TA3A 2OODA 2X38A 3GSMA 3VACA 5ABAA 3F4VA 2XWEA 5BV7L 3EYQC 4MIMA 5ISZA 1A2YA 1XHHA 3QXTA 4GAAA 1TFVA 3QC6X 3THMH 4A39A 2RH9A 5CD5D 4MM1A 1YUHA 1RZQA 1ZSXA 5LN8A 1WDQA 1TCDA 3KGSA 3I9GH 1VZIA 4YHNA 2C9VA 3GLAA 3HZYB 4LCUA 4AW4A 5I1IH 4ZJ9A 1JRCA 4ORIA 3WQOA 4N8VG 4ZODA 4D6EA 2UY3A 1MWAL 2NQ3A 4K2UL 2JK2A 4BFRA 3QG6A 3CUGA 5IM7B 4W9ZA 1NJJA 4LU5L 2J8HA 1CXFA 2R23A 3I68A 5HVWA 1PWLA 2XN9D 1C16B 1U8HA 2SEBB 5EU7C 5IHUL 4Y2DC 1UC6A 4O4YL 4G6JH 1W1IE 4H88L 4KVNL 3CIXA 3D85B 1SBSL 3PFRA 1UCTA 5ISZE 5CINH 3G08A 2R2EB 1MFEH 3QIWB 4HKXA 4IKKA 3T4AC 3SYQA 4F8TA 4KTDL 2BPBA 2VWEE 4J4PD 2NSMA 1BF6A 1M03A 3KTSA 2NY2B 2DIBA 4YPGA 3P5YA 1G9ML 4HD9A 3FQNA 3L5HA 1ZGLM 2VFEA 2UWEB 5KVDH 1T96A 3GMMA 2ZKMX 4AWUA 5FV1L 1WIOA 3P0VL 3MO1A 5E1IA 3BAJA 1YXDA 5HXMA 3D47A 4F20A 3FQXA 1LL7A 3E5BA 3QO1A 1E4XL 5K9OB 1W2KT 4Y9GA 2I69A 1Z9OA 3GBML 4ORGA 1X98A 1EWEA 3AC0A 3KP1A 3DV6A 4B3LA 3ESOA 4NX0A 4NRXA 3TFKD 2KZKA 3LLFA 3DOSB 1HH6B 2MPVA 3GVGA 3VXSD 4IGMA 3NCXA 2RALA 3BCDA 4Z3GA 4KKXA 3LTYA 5JTWA 1NEZG 4QKTA 4GUOA 4JBRA 1U83A 1KCSH 2XNAB 3DUSA 4K73A 3KWVA 3QUXD 5DUBB 2ZYRA 4S1SH 4QRPD 43C9B 1RV8A 3DERA 1R8LA 2ZWNA 2RACA 3EIFA 2WNZA 3KZSA 4HC1A 4UQ9A 4U4MA 5I28A 1X4YA 1HH6A 4JM4H 1RK7A 3KM2A 3I02A 5MEPB 1WYJA 3ZLGA 1CFBA 3HVDA 1ZLWK 4ZVJA 3UFYA 2EE9A 4ONGL 1N6VA 1S9KC 4DLMA 4JBSA 4BUGA 2YMOA 3V52H 2FVKA 2XRAH 3BGMB 3HPLB 4I77H 4OCXH 2HJLB 5CCGE 3LKOB 4OF8A 3WLQA 3MC5A 5DS8B 4BFKA 4YWGL 4QXUL 3CUIA 1NBCA 2E67A 2UWEA 2X4TA 4PB9H 1MFVA 1FWWA 2CQVA 1SOKA 2VLLB 1NARA 1WKYA 3AIQA 3VRJA 1V77A 2I27N 5EEVA 1E1CB 3WCZA 3CX5K 3OJDA 3OPZL 3RDTC 4CNIA 2Z6IA 3WV0A 2V5SA 4WFHD 1L8PA 3QUMH 4PN6A 4XKYA 3FQUB 4NBYB 4F4RA 2DI8A 1CLOL 5IGXL 3Q65A 4LC6A 1F3JB 4IRSC 5C09A 1UENA 4XVSH 3GTIA 3IJ6A 4PGEA 4IQDA 5G1YA 2UY4A 3KXFD 3QUGA 5JHDD 4BS0A 3UGUA 4PJEF 4PS7A 4U1JB 1EAQA 1YUKB 2IFGA 5I15L 2IFFH 4GBXD 1DWGM 3FKUS 2TPSA 4NX5A 3CC5B 4HUCA 1OM0A 2NLJB 4JHWL 2NY3C 1MEIA 1BAGA 1NEZA 2GCYB 3PIQB 5E08H 4OE7A 4PJ7B 3RJYA 1JZFA 1JIBA 1TETL 1QRNB 3IJEB 3MCLH 3FXYA 2JCWA 4S1RL 2Z1XA 1UBPC 4N9BA 2QZRA 3MU7A 4YS1A 5ICXA 5E4AA 3ECWA 5HHMB 2E6PA 3BIKB 3MMEB 4ODBD 3FL7A 3R06B 3NQDA 3W28A 1U1JA 2FLBT 4AY0A 3W7JA 5F4XA 6ALDA 4TUKL 3CZLA 1DVTA 3QYNA 4J2PA 1FNEA 5GJSL 3EPNA 5CD3A 4GJ1A 1P53A 2VZSA 4WTZG 1FHGA 3FCSA 4D7PA 1EHLL 5DANA 5C6MA 4LB4A 4LLMB 1YEJH 1NAML 3QPXH 1OTTD 3B43A 3QCTH 5C2CA 3WH6A 3UA4A 3FGCA 5U4NA 4Z95L 1J0KA 1IC4H 3JTTA 4WJG3 3D9AL 3KZ8A 1ISVA 3GAYA 4B53A 4P07A 3BE1L 4KAQL 4XO3A