4JL1A

Crystal structure of a bacterial fucosidase with a multivalent iminocyclitol inhibitor
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploring a Multivalent Approach to alpha-L-Fucosidase Inhibition
doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
total genus 163
structure length 439
sequence length 439
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jl1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jl1A01
3E1F1 4CU8A 2XJ7A 5ABGA 3N15A 2CNCA 1XCXA 3SCSA 2BNJA 4HA4A 4CN4A 1HJQA 4PUDA 1WAWA 4QDMA 3AIQA 2WMFA 2ZX7A 1ZBWA 1WZLA 3SEPA 3EMQA 1H5VA 4UQ9A 1HP4A 1JGIA 4IUGA 3ECQA 4AZCA 5FOOA 4TVDA 4H8UA 1V0KA 4HZ7A 3WMSA 1EOMA 1GOOA 2J75A 1ZJBA 2G3NA 1VJSA 3LX9A 1WDQA 3WH5A 2WLYA 3D5HA 3UCQA 1KXTA 1UR8A 1RD6A 4CCEA 2E8YA 1CENA 4Z2JA 1HJSA 3VINA 6A3HA 5TD4A 3AXIA 2ZE0A 1BYBA 2ZX9A 4TX6A 1QHPA 1CXHA 4PEEA 1MQPA 3AHTA 2DEPA 4BCEA 2VVNA 3AXHA 1ISVA 4AWEA 3L4UA 2WANA 3EDJA 1PX3A 3IK2A 3VPLA 1FOBA 2JF7A 1E43A 3WUBA 2EXOA 2WSPA 2ZUUA 2EEXA 4ZXOA 3KL3A 4TVUA 5CLWA 2GDUA 3A4WA 2F8QA 1B3YA 2W63A 1G01A 3D4YA 5D9MA 3AIEA 1JZ8A 1OD0A 3CIVA 1XH2A 2XFRA 1EDGA 2EPLX 1PIFA 1V3KA 1VFUA 1M7XA 1D3CA 3U57A 3DX2A 4UOQA 4WKFA 3GNRA 1XCWA 5I6SA 1H41A 1E6NA 5DO8A 1WCGA 3OLEA 5GNYA 2PBGA 3VDCA 4OBSA 3GBEA 3EYPA 5C71A 1PEZA 3D52A 1ITXA 3SUUA 4AZIA 3T08A 2OYLA 3MV01 1G0CA 3IJ9A 4UQBA 3GNPA 4JHZA 4TTUA 3WUGA 1LWJA 2C8NA 2W5FA 4PMVA 3MV11 3D3AA 5IFPA 4D6JA 2Y8KA 1QNSA 3ZSSA 1NOWA 2EJ1A 1W91A 3CHCA 4Z2HA 2DSVA 1J0KA 3BGAA 2J4GA 1UD5A 3BH4A 1MW1A 2J77A 3VTRA 7A3HA 1R47A 1OWQA 3W38A 2J47A 1TQTA 4MB3A 4CN6A 5HDRA 1HN1A 4UCFA 2A3BA 5D9NA 1NQ6A 2CBIA 1E4IA 3AMDA 3WDPP 3DYMA 3ZT5A 4CCDA 3AJ7A 1WE5A 3LPOA 4MAVA 1NM9A 4FLRA 5BRPA 3RIKA 1LQ0A 1ODZA 3ARWA 1W9XA 2E40A 3WENA 2CESA 1OB0A 1DWGM 5LA1A 2XVLA 1UWTA 2VCBA 1GQJA 3RM9A 2ZWZA 2J7DA 1C91A 1PX8A 3SIMA 4HOZA 2A3AA 2XFYA 3N18A 4FNQA 1E71M 1PIGA 3TTOA 1IV8A 2F7PA 4CVWA 4JAWA 4QAWA 3AIVA 1PS3A 4LGXA 1CGVA 2VZOA 1UZ4A 1R7AA 1J11A 1BHGA 3L4TA 4URIA 5HOSA 2F7RA 2ZX8A 3NYDA 5I79A 4ATWA 3WQ8A 4ATDA 1JD7A 1ZJAA 3EJTA 1D7FA 3BSGA 3BAJA 1ZU8A 2Z1KA 2WCAA 2QF8A 1VAHA 3SCPA 1CXLA 1T0OA 1M53A 1CGTA 2D24A 3T0DA 3TTQA 2FGZA 3OBAA 1ISWA 3B8SA 3GH5A 5HPOA 2Y2WA 2EBNA 4C7DA 1E3XA 1HIZA 3BUDA 2DT2A 1Q6EA 1E3ZA 4AZHA 2XIIA 2DSUA 3AMCA 2G3MA 1HKMA 5ABFB 1LL6A 1U33A 3HG4A 3LXBA 2E9LA 3WL1A 4LYRA 4UTFA 1E5JA 3MANA 2IXVA 3BVTA 1UKSA 1Q6FA 1M04A 4F79A 2XSBA 4PTMA 3EDDA 2Y5EA 4AIOA 1DEDA 2XVKA 1E72M 2ZUVA 4PBGA 1QHOA 1HKIA 2YDRA 4K68A 4D1JA 3AISA 4LYQA 1JYWA 1B1YA 4M56A 3GXIA 1GZJA 3AIWA 4NZCA 1MQRA 2Q8XA 1EIBA 1W9DM 2WMIA 1V0MA 3CZGA 3O6AA 1SR0A 2YL6A 3CUJA 2OWWA 3EJRA 2WBKA 3FN9A 1XSJA 2D73A 1Z32X 4HU0A 2WHMA 3VM5A 2F2HA 1E55A 3W29A 1KXQA 4D72A 4EK7A 3K1DA 4V28A 4N0RA 1QBBA 4HZ8A 4V2XA 3ARZA 4AEEA 2RGLA 5JBFA 1LF1A 2E0PA 3SCWA 1QI3A 1JZ7A 1OGGA 2VZVA 3AQUA 1NH6A 1HJVA 4JHOA 4WSJA 1UZ1A 2BY0A 1R34A 1TQSA 4DO6A 1HVQA 3G6MA 2XM1A 3RMEA 4AEFA 2J7GA 1HKKA 3B9AA 3WH7A 3UERA 2PC8A 3AIUA 3GXFA 1JG9A 2AAAA 3VD5A 2J78A 1UD4A 3VGDA 4KH2A 2V3DA 2EPNA 1UKOA 2WC3A 3F4VA 4U2ZA 1HJXA 5F7UA 4ZEPA 1JF6A 1G5AA 2WMHA 5A6JA 3GXMA 2DDXA 1W1YA 4MB1A 2HVMA 4NRRA 3FNDA 2B31A 2V3GA 1FP9A 2G3IA 4NI3A 4XV0A 1V03A 2E4TA 3TONA 3CHEA 4BS0A 3KLLA 3AS2A 2BY1A 2C0HA 1W32A 3KE0A 3WUFA 1UH4A 2J7BA 1FH9A 2F61A 3LPFA 1VBUA 3CC1A 2D23A 1BG4A 4OBRA 2VCCA 2YLAA 1MW0A 1TVPA 3MSDA 4M29A 2X0YA 5AC5A 3BVVA 1ISXA 4DWSB 2ZXDA 2WKLA 4FK9A 4ML4A 3EJQA 3WBEA 3U7VA 3NUKA 2ALWA 1GQLA 1JXJA 1NOFA 4NZJA 4UQAA 4UOJA 3WF1A 5FL1A 3WN6A 1W2PA 1NP2A 2WCSA 2CKRA 3A22A 2XGBA 1JF5A 1QNPA 2VX7A 1W1TA 2BXZA 4BQ5A 1OBAA 2DQXA 1QNRA 2VT0A 3UETA 8A3HA 5HBFA 2VTFA 4BA0A 1UG6A 1W3LA 3VX0A 1UOKA 1HL9A 6TAAA 2CEQA 4KRUA 2WMGA 5A94A 3LRMA 4GQQA 1ODUA 1H09A 3WH9A 1SMDA 5A8PA 3L4VA 4W5UA 2QMJA 1V6UA 3K8LA 2WVSA 2EQDA 3AZSA 3HMCA 4H7VA 2VRQA 3BC9A 1H1NA 5ABEA 4GINA 2WVUA 3ZT7A 1R33A 4KGJA 2D3NA 1W3HA 1TUXA 3AZTA 3QOMA 4W8AA 1J0HA 1KCLA 4AIEA 5LYRA 1HP5A 2WVVA 2QLYA 1J0IA 3VD7A 1JDCA 3MS8A 3EJSA 2BY3A 1E6SM 4RE4A 2VOTA 1EDTA 1V6XA 4Y7EA 1LWHA 1J0ZA 4ACYA 5M03A 1R8LA 1KGWA 2CIPA 2YOCA 4BF7A 4PMRA 4NX0A 1B31A 1TMQA 4BQ2A 3A21A 3UR8A 1F4HA 3A5VA 1C90A 4UFJA 1QI0A 1A3HA 1VEPA 4HPGA 2XVNA 3WEOA 2X1IA 3FAXA 4HZ6A 2O92A 2FH8A 1AVAA 1UASA 1GQIA 3VMOA 4A4AA 1FP8A 4DWSC 4UFIA 2YFOA 4W8BA 1W9UA 4KMQA 3ARPA 3DX4A 3VD9A 5CQ1A 4X0NA 1KWGA 1XSKA 1OM0A 2F7OA 4S3JA 2TAAA 2PWDA 3EJUA 2J8GA 4U3AA 2X0HA 1ISZA 2G41A 4HA3A 3VD4A 2WYSA 4OOUA 4IM4A 2VR5A 3FHQA 2X09A 4FNPA 1BG9A 2X2IA 2GVYA 1H0IA 4TUFA 4U33A 4XUYA 2VZUA 1JIBA 1UQZA 3L2LA 1KB3A 1H0GA 5I3DA 4L4OA 1J0JA 3SUSA 2VQTA 1FFQA 4OGZA 4F9JA 1K9EA 2VX4A 3HN3A 1W3KA 3S6TA 4DUXA 1WZMA 4Q7NA 4MDOA 1HKJA 2ZUTA 3BXWA 3T0BA 2ZOXA 3RCNA 3CUGA 3OLGA 4D6FA 4P7NA 5BWFA 1JDAA 3APGA 4B3LA 4TVCA 4E4PA 2BV9A 4AZGA 3M07A 1E15A 1XGZA 3GH7A 5E6ZA 3U5YA 3ZOAA 1UH3A 2WCGA 1BTCA 1EO5A 3CZSA 1US3A 2BFGA 4FNRA 3MUAA 1E0WA 3EMCA 1BPLB 3ALGA 1OGBA 2ESCA 3BVWA 3VKKA 4NSBA 1UD6A 1GUVA 1WO2A 5CZKA 3UG4A 1OSEA 5HXMA 1UR0A 1BYCA 2QPSA 3VIFA 1DTUA 1UWUA 5FD0A 4IPLA 5EBAA 3IAPA 2OLHA 3BMWA 5CPQA 3VMNA 5I0DA 4M80A 1US2A 3WL0A 2VC9A 2YDSA 4OOZA 4PRWA 3W37A 4PMUA 3I3DA 1UUQA 1EQPA 2WB5A 3GYCA 2WVTA 2W66A 4JFUA 4AW7A 4CD7A 3ARYA 5KEZA 4U2YA 3WH8A 3VILA 2FHCA 1OIMA 1QOXA 2VX6A 5I23A 4YHEA 2AOSA 2PI6A 3AXXA 1B0IA 3D51A 4PMQA 3POHA 2D1ZA 3WUEA 5GQBA 3L4XA 2CHOA 3W81A 1CXKA 4H41A 4MTVA 2CYGA 1O6IA 9CGTA 4E2OA 5GPRA 1VFFA 3BAKA 2GK1A 3PZOA 3A4AA 4WIWA 1VFOA 4WKHA 5A6BD 3DYOA 1J0YA 1EHAA 2QMKA 4D6HA 3JUGA 4ACZA 5A6AA 3BVUA 2YDQA 2XWDA 2YA2A 3BLBA 3WQ6A 2Z1SA 2J8FA 2J7HA 1V3LA 3N17A 3EBVA 3HG5A 1GORA 3K8KA 1VEMA 2E9BA 3DX1A 3UEQA 5FKYA 4F8XA 2BXYA 3AICA 2O9RA 2J7CA 5BCAA 2A3HA 4AXNA 3DHPA 1XYFA 1C93A 3VSVA 3ZR5A 4CN1A 2YIHA 4AZBA 2OWCA 2VR4A 4M82A 3AYSA 3VD3A 2XHYA 1ZL1A 1ECEA 2GUYA 5A8QA 2CHNA 1B30A 3MU7A 2X2YA 3ARVA 3N9KA 2CBUA 3H54A 4DM1A 1J01A 3W4RA 1SMAA 1LJYA 3D4ZA 4M81A 4NXKA 2VX5A 4PTVA 3BVXA 2CKSA 2NT1A 4J3VA 2DIJA 5E6YA 1R7OA 1R46A 3VDHA 3SUVA 1U2YA 1UD8A 1JYXA 2EABA 1E4MM 3IGUA 2O9PA 5AY7A 1E70M 1VB9A 1Q4NX 4BQ3A 3MO4A 5AYBA 4AZCB 3POCA 3VM7A 2WXDM 2OW6A 3IANA 4QCFA 2FGLA 4H8HA 1QI4A 3LXCA 4GZIA 4IPNB 5CSUA 1TQVA 4B9YA 3A3HA 1V08A 1TVNA 2W4XA 4M1RA 1QHZA 3OZOA 1XSIA 1UH2A 1NP0A 3G6LA 1UKTA 1C8XA 1V3MA 3K4DA 2OSYA 1JYNA 2PBOA 3NSNA 3A47A 4Z2LA 2EPOA 5D4YA 1JFXA 1BAGA 3W0KA 3VGBA 3NSMA 2VURA 1X6NA 4XB3A 4AMWA 2WC4A 3HU7A 3QR3A 4KRTA 4RL3A 3A6OA 1JNEA 1YHTA 1OT1A 3F5KA 5JIPA 3QGVA 4PMXA 4CD8A 4JL2A 3ZM8A 5LA0A 3QHMA 4AMCA 1JD9A 1EDQA 3UG3A 3RO8A 4C7FA 2BHYA 3AIRA 1UKPA 1ESWA 3NSXA 2IUZA 2D0FA 1KR1A 2WVVB 1B3XA 1LL4A 4NRSA 1H49A 4MPKA 1ZS2A 1NWTA 4U31A 3T2QA 3WDIA 4TTGA 1VENA 3PTMA 3WD0A 1QWNA 5CGMA 3RJXA 4WK9A 3W27A 2DT0A 1FHDA 4EKJA 1H4PA 2YFNA 4E8DA 2ZICA 4GXPA 2YLLA 1GQKA 2XFFA 2F1BA 3DX0A 3AIBA 1EH9A 2GJPA 3PBGA 1O7DC 4F66A 5DF0A 1MWOA 5DT5A 3LMYA 2EACA 1HL8A 3ZSTA 2UY5A 1W9BM 3PTQA 1HVXA 4PCSA 5A95A 1QI5A 2W67A 1WDPA 1BYDA 5HNNA 2DSWA 2GJXB 5I24A 3VGHA 2VCAA 2XTKA 4DM2A 4A3YA 2CITA 3KL5A 1UR2A 3VOCA 4LPCA 3OLIA 3PZ9A 1AQHA 4MDPA 4FLSA 5DEZA 4CVUA 5A1AA 1MXDA 3S5YA 4P7QA 4P8VA 3TV8A 3OG2A 3TP4A 3CZNA 4AD5A 3CMGA 1PZ3A 1QNQA 4J28A 1UD2A 3SCRA 1LG2A 4WSKA 1WZAA 3VIPA 1R86A 1JXKA 4J27A 1NWSA 3EDKA 1K9TA 4LYPA 3WELA 3VGGA 1GPFA 1JZ5A 1KBBA 1CZ1A 2GJXA 5CPTA 2XYLA 4AYSA 3VX1A 1UD3A 2X2HA 1AQ0A 1BLIA 5E1QA 4UZUA 5A2AA 3WD1A 4ZE5A 4PYSA 1WDSA 3QOKA 1L8NA 3II1A 1HXKA 4H8VA 1B3WA 1B3ZA 3VIGA 5A6BA 3BAIA 2DIEA 1UHVA 4PTXA 4GI6A 5FCZA 2IXUA 1ISYA 3K46A 3RM4A 3THDA 1KTCA 2WWDA 1JZ3A 3OA5A 1CGYA 3BCDA 5A2BA 1LL7A 2OSWA 3FAWA 1C8QA 1ZBVA 1J9YA 7TAAA 1KR0A 4CUCA 2EAEA 2MANA 2WKGA 3HG3A 3VVGA 4RE2A 2A3EA 1M03A 4D6IA 4DUVA 5CJ5A 1QPKA 4UOZA 2XG9A 4GI9A 4JL1A 4W87A 4W89A 2WMKA 1TQUA 3S2CA 4PN2A 1CNVA 2XVGA 3FY1A 5EFFA 1JI2A 2DH3A 1DWJM 2A3CA 3SCQA 3OGVA 5DMYA 3ZJKA 3AOFA 4W8LA 4AD4A 1TA3A 1I1WA 3CLWA 1TCMA 3U5UA 3EDFA 3WFZA 2WMIB 4Z2KA 1JDDA 1UWSA 5A2CA 1CXEA 5A6SA 1XH1A 2WW5A 3WNLA 3LRKA 3NDYA 3LXAA 2CERA 1MW3A 2EADA 3KZSA 1TG7A 4AD2A 2WLZA 2RGMA 3D50A 2PWFA 5M5DA 1UWRA 1C7TA 3KLKA 1XD0A 3BCFA 3GBDA 1WKYA 2WK2A 4GKLA 1V0LA 2XN1A 4X9YA 2BS9A 2EO7A 2D20A 4JCMA 1GW1A 1TE1A 1RH9A 1UA3A 1TA3B 4F9DA 1MXGA 2JIWA 1WB0A 4AC1X 2CBVA 3GTNA 1V3HA 1EA9C 3NJ3A 2JF6A 3OGSA 1CGXA 2PWEA 1SFSA 1VF8A 4EAMA 1W9PA 2YA0A 3VO0A 1GJWA 2J7FA 3WY4A 1GVYA 3WD2A 3ARQA 4W86A 4GO9A 3VSUA 1BSIA 2J62A 1HX0A 3AMGA 4FNUA 2PB1A 3W82A 1AQMA 3CPUA 3K8MA 2XN0A 1FFRA 3GXTA 2VZTA 4UQDA 2G8ZA 4E8CA 5EFDA 4PMYA 2ZUSA 1U30A 2O9OA 3KL0A 1HNYA 4QLKA 3ZJ7A 1V3IA 1N82A 1UWQA 3VIHA 4H04A 3GXPA 5JBDA 1QBAA 3HJEA 1NOUA 3WH6A 1QNOA 1CLXA 4HMCA 2WMJA 4MAZA 5DT7A 3TTYA 2VVSA 4WJXA 5A6LA 4OKDA 1HTYA 2GJRA 1GONA 4CU6A 5CLTA 4PMDA 4ATLA 1AMYA 2W61A 1MYRA 4YPJA 3ARRA 2CETA 5A8NA 1J12A 4JFVA 3N12A 1KQZA 3BAXA 1BYAA 1G1YA 1V6VA 3SURA 1L0PA 4CD4A 4LQ1A 2DT3A 3SCUA 4MJ2A 4UFMA 1CPUA 5BXRA 1PJ9A 2V5CA 1ZBKA 1KGXA 6CGTA 5CG0A 2AMGA 3W24A 5I2UA 4HU8A 1E4LA 4J3XA 1ZB5A 1J10A 1V02A 1MW2A 1MFVA 5A8OA 3PZUA 4AYGA 2UY3A 3VGEA 1S46A 1RP9A 4P8XA 4D6EA 1E6ZA 2V5DA 2VQUA 1UWIA 4PSRA 2XVPA 3ZT6A 1JL8A 3WFLA 2O9TA 1CLVA 1E0VA 1CGUA 2EPMX 3ARXA 5FL0A 1Q6GA 4AZ6A 2YL8A 3THCA 3BUPA 5A69A 1B90A 2WHJA 2W91A 2OYKA 2QHAA 1QI2A 3WMCA 5D9PA 4Z2GA 3L4YA 3WDHA 3HZ3A 2XUCA 3SUTA 3VDBA 4CGTA 1KFWA 1E0XA 3AMKA 1C3FA 2F1AA 5AYIA 1EOKA 4IISA 4P8WA 1DWAM 2JE8A 3CZJA 1PBGA 1GHRA 4FLQA 4HA1A 1TR1A 4JFSA 3WNPA 4GIAA 3IJ8A 3TOPA 1MFUA 5M3WA 4UQCA 1DWFM 2DH2A 2JALA 1V6WA 1HXJA 4FF5A 3W25A 1OT2A 4GQRA 2YA1A 1W2VA 3ZJ8A 1E1FA 1GVIA 4UFHA 1FHLA 4HMEA 1E73M 1IZKA 3TA9A 1VJZA 2DGAA 2WPGA 1K6AA 1XH0A 1HJUA 2W62A 1XRVA 2DT1A 1C8YA 1RPKA 4HTYA 4HOXA 3O2LA 1G9HA 4JCLA 2ZIDA 2QV4A 4XX6A 1DHKA 2IGTA 5BRQA 4TX8A 2E8ZA 3VIOA 5I78A 2WC7A 5EB8A 2CBJA 2Y24A 1VEOA 5IHSA 2WHLA 3WDRA 3FHAA 1LG1A 3AHVA 3HG2A 1B9ZA 2ZXAA 4UQEA 1B2YA 2OYMA 4PMOA 1QW8A 4JKKA 3F5JA 3T2PA 2C7FA 3A23A 1XYZA 2XWEA 3WF4A 3WNOA 5BXPA 2VZSA 3WNMA 1UR4A 3U7BA 1R85A 1EXPA 2XPKA 1UA7A 3BSHA 3J7HA 3VSTA 3B9DA 5CSYA 4KGLA 1X1NA 3KWXA 3T2OA 2VL4A 1PAMA 1E5NA 2ZX5A 3N1AA 1VBRA 1OGSA 1SYTA 2ZUNA 1V3JA 1OINA 2V38A 4W5ZA 2E9MA 2Y4SA 3PZVA 4W84A 1QX1A 2PWGA 4U5KA 1E6PA 1CIUA 4OUEA 4CD6A 3DC0A 3WDJA 2XM2A 4AIUA 1MQQA 3AHXA 3MUY1 2GSJA 2F7QA 5GNXA 4M24A 1NWUA 4FNTA 3FW6A 4J3UA 2EPKX 4UR9A 2YL9A 4UZSA 3O9NA 1JZ6A 2V3FA 3OLDA 4KWUA 2QPUA 3DDFA 1Q6DA 1WDRA 4WLCA 2J7EA 1GOIA 1DP0A 2FHBA 1H3GA 1KTBA 1CEOA 3KEHA 3MMWA 2WM0A 4V27A 1XC6A 1B3VA 3S5ZA 1LLOA 4M8UA 3ZQ9A 3WD4A 2ZXBA 3N11A 2GK1B 3DX3A 5BROA 4FNSA 2F18A 1DWIM 1I75A 1NWRA 3T0AA 2WSKA 3GXDA 3VUPA 1G94A 1WZKA 4MNMA 3W53A 2BVTA 5ABHA 1UR9A 4AZ7A 2V3EA 1BGGA 4RE3A 3VNYA 1CTNA 3EDEA 1M01A 1TQWA 4XZBA 2XSAA 4C7GA 4A3HA 1JAEA 3DYPA 4ZXLA 3WY1A 2OW7A 3WY3A 1E56A 5A6MA 3CTTA 1QVBA 4DUWA 1IT0A 3CO4A 4L4PA 4FMVA 3H53A 8CGTA 2W92A 3MUZ1 1JAKA 3VNZA 3VIKA 1BGAA 3OZPA 1CYGA 4MNJA 3I3BA 1E40A 3WNKA 4TOQA 4W85A 3W6MA 2G3JA 3L4ZA 3M46A 5IDIA 4CCCA 3WSUA 3H55A 3SCTA 3ZR6A 4ZE4A 1KQYA 1E9LA 3PZIA 2J25A 2VMFA 3WQ4A 4BQ4A 2JIEA 1HT6A 3UR7A 3OB8A 1WP6A 3RPMA 1KXVA 3GXNA 1PPIA 4PTWA 5A8MA 4QCEA 1WNOA 4S3KA 1BF2A 4EE9A 3AHZA 3VU2A 4J3TA 3WQWA 5JIWA 4U5IA 4NZFA 3WDQA 2FHFA 4J7RA 2GDVA 4DO5A 5E9AA 3GM8A 1GOKA 5IFTA 5M17A 1TFVA 2UWFA 5LA2A 1ZBCA 2VUYA 4D6DA 3FXYA 3QHOA 1E6QM 1W1VA 2ZXQA 1KXHA 4MNLA 1JNDA 3CBWA 4NXSA 4ACZB 1UKQA 3VDAA 4P7LA 1Q6CA 4JFWA 3WBAA 4BZYA 1H11A 2D0HA 3QHNA 3CUFA 1XD1A 3BAYA 3WD3A 3WF2A 1GOQA 3CH9A 4YN5A 1K9DA 3ARTA 4J3SA 1BVNP 2D2OA 2JEPA 4GZJA 4YHGA 3BMVA 3WEMA 4PCTA 3LPGA 1A47A 3L4WA 2CXGA 3WKZA 4OJYA 3B9EA 3NDZA 4PMZA 3M7SA 4B15A 3W28A 4DWSA 4R5EA 4LX4A 4AZ5A 3GH4A 4AY1A 4D6GA 3K4AA 1VFMA 3WF0A 5D8WA 4W7VA 1E4NA 2VRJA 1MVYA 1HWWA 3SCVA 4UFKA 4UNIA 4WF7A 1V6YA 4Q22A 2WAGA 1GJUA 3GNOA 4W93A 3A24A 3ARSA 4QP0A 4J3WA 1KGUA 2WNWA 2BVYA 2JEQA 5JUVA 4OZOA 4JIEA 4XZWA 4MB4A 5BXSA 2ZUWA 4QLLA 4ZENA 3UG5A 5HPCA 3AFBA 3VIMA 4AISA 2X2JA 3VIIA 1PZ2A 3PZMA 2YBTA 5C70A 3AI0A 2PWHA 3BLPX 1GNXA 2WWCA 1C7SA 1KWKA 4H2CA 3CV5A 3VMPA 5JBEA 3AROA 3PZTA 2VNCA 4JFTA 3F5LA 4PUEA 3SUWA 3A4XA 4MADA 1FH7A 5CPSA 1ITCA 2WZHA 5DFAA 2VJXA 1R75A 4FLOA 3I3EA 2PF0A 3MSGA 4AMXA 4B9ZA 3DDGA 4NF7A 4W88A 3WY2A 2FE0A 4JKLA 2WZEA 1CXFA 3AMLA 1QW9A 1FA2A 2WZIA 3PZGA 4B16A 3AHYA 1E6RA 1XHGA 5IXEA 2FDMA 2NW0A 1RP8A 1W1PA 4D71A 3BUQA 2ZX6A 2J79A 1CGWA 2OWXA 4GPNA 1UQYA 5CGTA 2JFEX 1W9VA 4HMDA 5E70A 1X6LA 1VIWA 2BHZA 3CGTA 4X0VA 3RJYA 3EJPA 4CKQA 3SCNA 3PHAA 2XGIA 2VO5A 2X05A 1BQCA 1K9FA 4CD5A 2HISA 3AS1A 2WBGA 5AC4A 2CPUA 1D2KA 4AD0A 2XN2A 5GNZA 2DPEA 2BHUA 1GOWA 4QFUA 1C92A 2UY2A 4W7UA 3BUBA 2ZUMA 5I5RA 4PSPA 4ZFMA 1SZNA 3IJ7A 3CMJA 1OD8A 4DWSD 4CU7A 4AD1A 5I77A 5E0FA 3CHDA 1NARA 1FH8A 4JKMA 1OIFA 2YJQA 2DSZA 4OIFA 3WQVA 2FH6A 5KZ6A 4GO8A 3PN8A 3T09A 3MKKA 4QLJA 2D22A 3DECA 2YKKA 5CXPA 3CUIA 5ECUA 5C8BB 1CBGA 5BXTA 4Z2IA 1V0NA 4P8UA 3VIJA 2VRKA 3M6DA 3W26A 4HOWA 3PTKA 3BUIA 5E0CA 4U3CA 3ZO9A 1GOMA 3TTSA 1BVZA 3AS3A 3CZ8A 3LRLA 3CHFA 3WIJA 3AS0A 4MNKA 1E1EA 4JZ5A 2DSKA 3ZIZA 2UY4A 3SCOA 1JZ4A 3WEZA 4UFLA 1W3JA 2YBUA 5ABFA 5D8ZA 3L2MA 4AD3A 4PMNA 3OGRA 5E09A 5BYWA 1JYVA 3ZJ6A 2BVDA 3BLKA 3LPPA 2D0GA 3AZRA 1I1XA 2D3LA 1XV8A 1H2JA 3GDBA 1QWUA 2ZWYA 3ZMRA 2Y8VA 3BAWA 3RILA 1UR1A 2VI0A 4LXFA 1J18A 3DHUA 4N42A 3GZAA 3WF3A 3ARUA 2XIBA 3EMZA 4DO4A 2YL5A 2NSXA 3CZLA 1WPCA 1EGZA 1EHNA 1CXIA 3IAQA 4MB5A 1CECA 3RDKA 2G4FA 3RM8A 1CWYA 2J74A 1JFHA 5IHRA 5EMYA 1O7AA 1V02E 2CCRA 1YQ2A 3W6LA 3MI6A 3N13A 3PZNA 2BY2A 4HPHA 3NIYA 1PX4A 1OCQA 3MUIA 4MJ4A 5FIPA 1UYQA 3UESA 5A6KA 1Y7VA 1VRXA 4P7RA 2X8RA 4W7WA 1E6XM 4P7OA 2NT0A 1TZ7A 3MMDA 3N04A 2WHKA 4HP5A 7CGTA 3PZQA 1KBKA 1BFNA 2FYVA 4GI8A 2OSXA 1F4AA 4R27A 4TXEA 4EANA 3OIHA 4B3KA 1JZ2A 3MMUA 1R87A 3CUHA 2GFTA 5D9OA 2E3ZA 1EO7A 3CZKA 1DWHM 1JI1A 3WNNA 1IZJA 3WQ5A 3WMBA 4WKAA 1EQCA 3AYRA 4D1IA 4D6CA 1GHSA 1P6WA 1GCYA 1KCKA 3VGFA 1HJWA 3ALFA 5A3HA 1CDGA 1HF6A 3NCOA 3CZEA 4GZEA
chains in the Genus database with same CATH superfamily
5KSVA 1SJVA 2IIJA 4K3EH 5A7BA 2ZVRA 4WJ8A 4EI5C 4NNYB 1XCXA 4YHOH 1E4WL 4B0MM 5TGBB 3VNDA 3FSWA 5AOMA 3VFOA 1EXBA 3SCSA 4I18C 4KKLD 3NJFA 4PY8J 3GNML 1GGCH 4M6UA 3M47A 2EZ0D 1AE6H 2NVDA 4PB0L 1N5AB 3H2NA 4QDMA 1JFQL 4MAUH 2QSCH 1LLAA 2ZX7A 4R3SA 1ZBWA 1WZLA 3SEPA 4MQXD 3K6OA 3WIHH 1OFBA 4ZFFA 1J8RA 4UQ9A 4XX1E 1JGIA 4BQCA 1HP4A 1R24B 4GRWE 1U8OB 3BO9A 4IH3A 3STCA 2Y72A 4XMZA 1KJ2H 2W65A 5GISH 5CC3A 2V17L 4H8UA 1F5ZA 4A37A 1V0KA 2MNJB 1IRAY 3E9AA 4PL2A 4TVDA 3TKFA 1E7UA 2HMIC 4A35A 1EOMA 4X7FC 2J75A 3W7EA 2R1WB 3LX9A 2CO2A 4EI6A 2ICSA 1XRSA 1ICTA 2UZPA 3ISRA 3O2DH 1P7TB 2BP1A 1SQMA 2CZNA 4NPJA 3D5HA 3M0MA 1WUFA 1NFBA 1U4EA 4HWZB 5CPOA 4HKJB 4LDCA 1UR8A 1RD6A 5EU6E 4CQ8A 4ZXBB 2E8YA 1FCGA 4LHQB 2B1HL 1SZEA 2O7QA 4X60A 3VINA 3PAZA 4Z2JA 6A3HA 5TD4A 4F20A 5HQMA 5DJ6A 2ZE0A 4JEJA 1CQYA 3P40A 1Z3GH 2X3AA 1AXTL 4LE8A 1S3HA 3GRWA 3QEQA 4IKNA 1MQPA 4PEEA 4GMEA 5I73C 3RNQB 3UJTH 3NK3A 3CQHA 1CFSB 1EGJH 4HHPA 1ISVA 4AWEA 3G6JE 1V4YA 2OYPA 2EVHA 2I17A 4GXWA 1T1XB 2OMXB 2R6OA 4NOBA 1TTCA 4HZAA 2WANA 1OAJA 1J5TA 3EDJA 3GBNH 1BF8A 2BSTA 1PX3A 2QUTA 1GWJA 4NCDA 2IH3A 5LGJB 4X8CA 3VPLA 2JF7A 3SE4C 3P81A 1OAKH 3N6YA 5BVJB 5E08L 4G9PA 1S9YA 4O4YL 1TWWA 4LL1A 5CLWA 4QJ1A 2JCWA 5DSCB 1NGPH 5D71H 2ZRZA 3TJIA 1NC4D 4G43B 4PJDF 1A5AA 1B3YA 2W63A 4P2OA 4JQIA 4ALAL 1Q7QA 4QS6A 1GGCL 2QFRA 2FEDD 3ITOA 4G1KA 2DBLH 3RLUA 5AZ2L 2PLTA 5KG9A 4BKLB 3S2MA 3QSKB 3AIEA 1J6OA 3B8DA 2WXNA 3SSZA 2EO1A 4UT6A 4GA8A 5JYMA 3MACL 4XNZB 1FYTA 4HU2A 1MUMA 4LVGA 4PFHA 4XVSH 4XVTH 1EDGA 4NJ9H 2E86A 2W6RA 5EF1A 1M7XA 3SCMB 3R19A 4OV5A 3DX2A 3NQ8A 3R2GA 3GNRA 2HTKC 5A7EA 3LY0A 4JO5A 5BZAA 3V6OA 4Z08A 2DTSA 2HP4A 4K94H 4XVJH 1EJOL 1KACB 2OCZA 2HRHA 2FPYA 2Q5BA 5G1YA 3CN1A 1VCFA 2WNXA 4OBSA 1HINH 4F7KA 4I9WD 1Q9OB 3GBEA 5K69A 4KUZH 1PEZA 2D69A 1SYSA 2C3WA 3RU8H 3D52A 3SUUA 2NY0B 3H85A 2K70A 3KXFB 2IQTA 2BM3A 4O0KA 1XLFA 4RZ6A 1HIML 1S9YB 3GMQB 4R97B 4IDJH 3TT1L 3UZVA 1CF8L 5KOMC 1NCOA 3QPKA 3LKSA 4G80B 4OZHB 1XFCA 3RVUD 2VGFA 4OWGA 3PLYA 2AQPA 2E77A 5I66A 4HLZH 5I3JA 1FH5H 3V0AC 2B5IC 4GYFA 2VDKL 4J40A 3WUGA 3WV0A 1GPOH 3CVBA 1SZRA 1GYCA 1KBWA 1UURA 2J1YA 3VFGH 2CMRL 2POTA 2W5FA 3Q4DA 3O6FC 4ZQKB 2QUUA 4OTXH 1YMME 3NCMA 5IFPA 3K6IA 5JUEL 3RLSA 3IAGC 2UX7A 1CJYA 2VLMD 4HZLA 4NQEE 3ZSSA 4RNIA 4C6KA 2WQPA 1T7VA 2YXVA 3IDJA 4HS3A 5AKQA 1J0KA 4RDBA 2EG8A 3NPWA 2MHAA 4H2AA 5U4NA 1A0EA 5DCBA 2J4GA 1MRDH 1I1RA 4LLWA 4Q89A 1HHIA 5HHVH 3ULUE 3B2PA 2HFTA 4GY4A 5EZLA 4CNOA 1AKJB 1MW1A 2QKIA 5DQDH 3ECBB 5SV4A 2MJWA 5AENA 1ID5I 3NCEB 2J77A 4R7OA 2GY5A 2IPUK 1NOAA 5HYQA 3PWLB 2PDGA 3W38A 3AQDA 1L3NA 4OLXH 2YKLH 4MX7A 1VFBA 2WCPA 4U1JA 5IQ9A 1QUNA 2XWRA 1A3QA 1MEIA 35C8L 3HNTL 1PYFA 3UCDA 3CLFH 2P8LB 5K2ZA 4LKCA 4MJID 3NRQA 4IFKA 3UTTB 4QHKJ 3HOJA 2FL5A 3VXRD 2GUBA 3E5PA 1YEIH 1NAKL 2UWEE 5D7JA 4M6MH 2ESVB 3W9DB 3QIUC 4BSVA 1DPMA 1KLYA 3ZLQC 1Q9WA 2Y61A 1E51A 2H1LM 4HT1L 1S38A 3TMLA 2V9TA 3ZT5A 4CCDA 5L6YH 1T7ZA 4J4PA 2IQ9L 2WNQA 2FB3A 4QRTA 1BQKA 4M00A 3R06A 1JXFA 2Y89A 1G7LB 1ED3B 3H6OA 4HTBA 5BU9A 4U0RC 2YJLA 3L2NA 3WNIA 3QSRA 4FLRA 3VFNB 5BRPA 3G1AA 2FSEB 4RGNC 1IGYA 2DLFH 5AL8A 5CD5C 3ANYA 2VDQL 4J5VA 1NAKH 1BVWA 4FFWC 3NIDB 3SSJA 1N55A 1F4WH 3X3GL 5LA1A 2ZZ6A 3QM3A 2CA4A 1UWTA 3SKOA 3VFRA 1GQJA 2VCBA 3N2MA 3STBA 3VJ6B 3VVVA 3RM9A 5HGHB 4UTHA 4HCGA 5HHOA 3NSCA 4O2CA 4E36A 3SB0A 4HOZA 3UR5A 2EC8A 2A3AA 2XFYA 2VGBA 5D09A 4P5RA 1J87A 3U9UA 3D3VA 4ZQTA 1E71M 1QZNA 1UXSA 1SJDA 4WY0B 4LQFL 1LP9A 1QATA 3GSWB 1DDTA 4XHJD 1HK6A 2MMXA 4IIQC 1PS3A 4QAWA 1B4KA 2FJFA 3G5ZB 4EI5D 1HGYA 2J2ZA 4PRRA 2V2WA 4N90D 5DJ8A 5CCGE 1R7AA 1UZ4A 4Y9MA 5GRJH 3MCNA 3L4TA 3TBYA 2OR8A 2X40A 2ZX8A 5HOSA 4FTVE 4ATWA 5EOTA 2HRWA 3WQ8A 2VDOL 4OE7A 1PIIA 1U95A 4KXCA 2POZA 1JD7A 1EGJA 5FCUH 4U05A 2GHWB 3C4UA 3HV8A 3EJTA 2PTDA 3AT8A 4WXZA 1W72A 3VWJC 2Q9OA 2WCAA 5BV7L 5D9SA 3CTLA 1UM6H 5CSBA 1CXLA 4D0CA 4AI7A 1XLIA 1AP2A 1YEJL 2O7SA 1CU4L 4ZTPH 3U25A 3B9VA 2XG4A 1ISWA 2DUAA 1T4KA 3SW6A 5KBNC 5HPOA 3SPCA 3R7MA 1ZXKA 1H0DB 1OALA 2DM7A 3IEAA 4QGYA 4DGYH 2Y2YA 1TV2A 5BOJA 4C7DA 1LTDA 1M57B 3LVEA 5F0JB 5TE7L 2B20A 1Q6EA 4MF4A 1GZGA 1LBFA 1XG3A 2B0MA 5IHLB 1TVLA 3AMCA 4O13A 2R4SH 1V10A 1F73A 3MT1A 5EH1A 1PYWB 4ERIA 3TQPA 3PREA 1J6PA 5IB4B 1LL6A 2NX9A 3ZLHA 2ZZ4A 1EJRC 5CPNA 4IQJA 2WXFA 2DQCL 1QEWB 1H3WM 2I60L 3LXBA 3RTQB 1A7NH 2QS8A 2FLBT 2ZZ1A 4OFCA 2E9LA 3IJHB 4KAQL 4LBAA 5E23A 2JKRM 3TBTA 3D2UA 3WL1A 4L05A 5I0WA 3QG6B 4ZOEA 2IXVA 1ELSA 4KVNH 1A0QL 3AXLB 5CU5A 1SVZA 4F79A 3QYCA 4GAYB 1K4GA 2UWEA 4M6PA 3EOAA 1ZHNA 2OTPA 2Y5EA 1UFGA 4N2DA 4Q9BA 4R53A 5I8EA 4ENZA 1WAEA 4Y88A 3T07A 5MENB 2APBA 3PBWA 1GW9A 1OPGH 2NXGA 2HWGA 1E72M 1WWCA 3RVVC 4PBGA 2DICA 4GKOA 3O45B 1TV8A 2I60H 1HKIA 2A85A 1H6FA 2YDRA 5CGMA 2E74C 4PP2B 2UUDK 5JDSB 4X98A 5ACZA 4XPTL 5DLLA 3RLGA 1J5SA 2NYKA 1MY7A 3RKDD 2OJEA 5C0IA 1CI3M 1LZOA 2XTJD 3CAWA 5DHDA 1EZWA 4RPPA 2GVLA 3RIAF 1TXKA 1SHMA 4F8OA 5BPPA 1MCPL 2CJUH 3X11A 2XT1B 3OJDA 1W9DM 2WMIA 3EUUA 5F3BA 3CZGA 1WDWA 5C0JA 2DL2A 3BMXA 1NLBH 3OKNB 5HYSB 2BASA 1H6TA 1CFVH 3B2MA 1VZHA 5FYLL 4KWSA 4NUGL 5EOCH 5MEOB 5L88L 2VN6A 5I8KL 4XCNB 1R5IA 1JGVL 1GAFL 1CCZA 4BR1A 2NQZA 2P28B 1JPIA 5D1ZI 1XIJA 1IJNA 1JGVH 1GAFH 1UXWB 1HS6A 2D73A 1Z32X 2ZWSA 3ESNA 3F3HA 3OSKA 3JS3A 5AW7B 1ZS8B 3PTDA 4GP4B 2WHMA 1RUAL 5CKAA 4CSZA 2RFXA 1WISA 3ZKXB 1E4XI 4FTVA 3W29A 1FWJC 3OB0K 3ULVL 1EEXA 2WTRA 4YNYB 4P5MA 5AVXB 3K1DA 1CVSC 1TPUA 1AGEA 2YXGA 3L67A 1BBDH 3RMJA 3W76A 3T4AB 3OQEA 2VDLL 4GSDL 5GVJA 1YPFA 2Q7YB 4Q8WA 3KPTA 5D7EA 3IIOA 4Y9BA 4NQCD 1SY6L 3ARZA 5AVQB 5ACZB 4L9DA 3WIFB 4PI0A 5JBFA 1LF1A 4WEMB 4ODTL 3KPRA 1QI3A 3FU8A 4L80A 1KGYE 3PL6A 3NCCB 4GKSA 4JBSA 4Y4HA 5C97A 2DQUH 3I9IA 2HTLC 4WGVB 1OGGA 4ELKA 2Y5QA 4B9KC 1NH6A 2I56A 2PYEA 4KQ4H 4WR3A 1BD2D 3W1XA 4OZIF 1QOQA 3GG8A 3LN3A 2JKXA 1Q9LB 2GQ9A 1YEHH 3QUGA 4LIQL 1OF8A 2ZXGA 1M6UA 1EKOA 3CG8A 5CEXB 3MREB 3V4PA 1S7VA 2B7NA 2PS2A 1P0NA 1A5OC 1M1BA 4N2EA 2YRZA 4LHUB 5ICZB 4ZB5A 4AHPA 4Z0JA 1OAZH 4LDOB 5EDSA 1OCJA 2PC8A 5I0YA 1XCTB 3FX4A 5ERWB 1UB5A 4NM8L 4GX9A 4OTXL 5D04C 1PZSA 1JG9A 2AAAA 2EC9T 2JI2A 5SWQB 4NZ4A 2YCEA 3TOYA 4DNHA 2CMRH 5A2JH 1OP9A 4O4VA 5C0DA 2V3DA 1PVNA 2R9RA 2NY6B 2XXMB 5E9DA 3FCUB 1XF2A 2H0FA 1UKOA 4TUKL 4DTGL 3CNKA 3PAJA 1HEZB 4OIIL 2Q8AL 4BK8A 1NCWL 1AZ1A 2WC3A 4F40A 3VRLF 1BF6A 2GYSA 3FT4B 2IQAA 5DUBA 2IFFH 5BQ7B 4LWWA 5D1ZB 2XYCA 2XH4A 3H7UA 2COVD 5F7UA 2ISWA 3W02A 3FQWA 3M7FB 2WMHA 1IHIA 3GXMA 1E4WH 3SBQA 3UQNA 5DQDL 4GFIA 2NRDA 4IHCA 3X1GA 1KEGL 2WZ5A 3GK8L 2B31A 1NINA 4ODHL 4GQGA 5C09B 1II4E 1F58H 1V03A 3TONA 3S2AA 1E27A 1O1ZA 4PJ9C 5K9OB 3NQ6A 1YJDL 1P5BA 3AS2A 4O11A 4B5ZA 2GQHA 4NHCL 3R10A 3KE0A 5FJJA 3OHXB 2E28A 3WUFA 1EPFA 4KPHH 4P23D 2YC1B 5LBSA 5IVXB 1S1RA 3HE6D 4PGZA 3MV7E 1UB5B 2C13A 5JXQA 3KPNB 4XZLX 3NR0A 4LCYA 4RCXA 1D9KC 4MNQE 1KPUB 2VCCA 3Q7JA 3CBKB 3E0IA 1MW0A 4D9QE 4JQ3A 4BK4A 3DFPA 4M29A 1TVPA 1KC5H 1T3FA 1ISXA 3BZDA 2PTTB 2ZXDA 2XZ7A 5EORL 1TU2B 4D9RD 5SWSA 3UIYA 4C1NA 5E2JA 4L3EE 2NQLA 2YR1A 5D1ZA 3V8OA 2IG2L 1I8LC 2P80D 3MLYH 4I18A 4NC2B 3DENA 4K8RH 3HUJF 4YCOA 3GRGA 4BE5A 2JK5B 3CUZA 3DETD 5B7EA 5TTRA 4A6YH 2BDNL 3NOIA 4MCNA 4NRYA 3LQGA 4MLJA 4OCSH 4JO3H 4NZJA 4TXVB 1J5IA 3PQYB 4O18A 1BFVH 3EH4B 1VYSX 1XJBA 4WHCA 4I5UA 1E27B 5SX5H 1LLWA 3GBLA 1XFBA 2Y7DA 2WGNB 2NQHA 2CKRA 1POKA 2J12B 3WN5B 2R27A 1VLXA 4U1LB 2XGBA 1JF5A 1MHHB 1D5RA 2NWRA 5IJVA 5D6CA 2BMKA 5GRWA 4BQ5A 2XJKA 1Z6KA 3O9WC 2G60L 3O8XA 2HJLA 4U1SA 3U0TA 2A9MH 1QNRA 4U1KB 2HG5A 2YD0A 4BEIA 2GK2A 4KJPC 2V68A 1VACA 5AVRB 2V8ZA 2YZRA 3BUVA 3TXAA 2ZRVA 3GXUB 1HL9A 1O5PA 5F71A 2HLAB 2UZIH 1MVUB 2XHNA 2ODOA 4KRUA 2GJ6B 3W7IA 3UCRA 2VR2A 5EUOF 4LANA 1ZGLB 3EH1A 4BQ8A 3O3DA 3RTQC 4JHBA 4F8TA 1VGAA 3QUMA 1W17A 3MRRA 1BF5A 3ZRFC 2XA8H 1BXXA 1RZFL 2VSCA 5CN3A 5E0KA 3MACH 5F88B 4A2LA 2CBQA 2G2RB 1Q66A 3QW3A 1Z3NA 1B4EA 4K1WA 4F0SA 1T1WA 5C9RA 3CFEA 3VB9A 3NZPA 5GGRA 4C6BA 1CDCA 5HR7A 2JLLA 3NTYA 2QJNA 5E03A 5CGYC 3HC4H 3QUKB 2BK8A 4X5WA 1OYAA 3NPVA 4UB9A 4ZNEE 5HBBA 4Y6GA 5FSEC 5K5YA 4FQ2L 3GSMA 2EQDA 3AZSA 2FB4L 1VF5C 4FQJL 3RNKA 3V4VB 1B2WH 1A9EB 2ZBTA 2J66A 1H1NA 4GINA 4JFEE 1PG7W 1WAUA 3HFMH 1R33A 2ZTKA 4UTBL 4KKCC 1S9XB 5HHNA 3CB3A 1YC7A 3S4SA 4W8AA 3V3WA 1T41A 3VXSD 1E5YA 3UGXA 1HP5A 1RVFL 1VYPX 3CL7A 4A29A 2DWXA 1BD2E 2PSNA 1LBLA 2B59B 5I15H 1PO9A 5D7LE 2L7JA 4NOFA 2AITA 5E8OB 2HPOA 5B8CC 2DZBA 1DV7A 2J3SA 4IFOA 3WXWH 1MFBH 4A7SA 4JFPA 1K02A 4UR8A 5M2FX 3VZXA 4HGWA 2NY2B 4OQTA 4L1LA 3F4WA 1FL3A 2JNZA 3N19B 4UTKA 1F3DJ 2CCWA 3M1OA 1PKLA 1KFLA 4RE4A 3NDYE 5HHQB 1GA2A 2FLMA 1SJBA 2KERA 4IBYA 4R2GB 2G2RA 4Z3IA 1URLA 2PGRA 3MX0A 4Y7EA 2XN9E 1LWHA 2XSKA 1MI5E 4ACYA 4XO3A 5M03A 1W1A1 3F7PC 1R8LA 4ZX5A 4KV5F 1KGWA 1MRDL 3CH0A 5DJZA 3BGJA 1TZ9A 4PMRA 4LLUA 4NX0A 5IESL 2QDGA 1F90H 5ICXB 4OZHE 4Y2WA 4ZBCA 5TJWK 4A6YL 1XBZA 3GKAA 4QRUB 3OKEA 1CDHA 1TMQA 3MZGB 3UF9A 1Y18A 2NZIA 3HJ0A 4LNYA 4BQ2A 1H9VA 3MLWH 4BZ1H 1EJTC 3UR8A 1FWTA 1LM1A 3H2OA 3BRDA 3F5WA 3WE1A 2PDLA 4KXZH 1A3HA 1AO7D 1R3KB 2VW4A 2ZWNA 3KPMB 8PAZA 5KSAC 2X1IA 1T8XA 3FU0A 2QCHA 2NY5L 3HPZA 4S0SD 2Z0BA 3PJSA 3E80A 3QBUA 2O92A 4LLWB 4B6ZA 2EE2A 1UASA 3VFPB 1GQIA 4JFFD 1OSZA 2VP8A 1AZUA 2EAWA 4OV6F 1IJ9A 1GGYA 1FL3B 2GGGA 4XO4A 5IVZB 4UFIA 3EYFA 3LHPL 2C79A 1YEEL 4KQ0A 1XLCA 4QRQA 3ARPA 4W8BA 3DX4A 4C6PA 1PTAA 4ZMVA 2ISVA 1RK0B 1B0GA 2E56A 3A3WA 4HISA 1CDIA 4YPGA 1ZA6A 1OM0A 3IMBA 2QCMA 3D39B 3NZRA 2DLHA 2PWDA 2WUCH 1BWKA 2J8GA 2VFFA 4U3AA 5CD5D 1HHJA 3QFGA 5IK3A 2H2SD 2A6KA 3OP2A 5PTDA 4P57B 1A6AB 5CC6A 2QVNA 4IK7A 4RGNE 4HA3A 1A3RL 3REVB 4GP5B 3MW7A 3ASNB 4PJGA 1BBDL 1G6RA 1JNNH 2JVUA 2YPLE 4AIZB 1XLJA 1NFDE 3AYTA 2AFNA 4LYKA 2HWZL 2O5YL 4FNPA 4LSQL 2UZIL 3HPLA 1OGAA 3C5XA 4PVNA 3R25A 2GVYA 3PWPD 4EPKA 3AU2A 1RJZB 1KCSH 5DQJA 5KUMA 1TJ0A 4LS2A 3DX6B 2NNFA 1FLTX 3CFMA 4U33A 5E1HB 4ALAH 3MCYA 1DBTA 4DK5A 4OZFA 1OCWH 1ROWA 3QQDA 1UQZA 3L2LA 4Q9CA 3LRSA 1KB3A 4BFRA 4DSYA 1JCLA 3L0GA 4KU1A 1SDAB 1FWCC 2AV1B 3LCHA 3I7RA 1QTSA 2Y36H 2VQTA 2FZMA 1REIA 2RUSA 3K2KA 3W0WB 1FFQA 2C0AA 1K9EA 3DSNA 3W7MA 4PRTA 1Z7JA 3D3VB 3B9NA 3HG1E 4XI5D 4C1KA 2Q87A 3UNDA 4QUOA 4Q7NA 3KAOA 1LQSR 2VDQB 4M3HA 3UAFA 1AHKA 4W9LC 2GABA 3MRBA 3TNMA 2ZOXA 4Y4KA 3CQJA 4U4MA 3CUGA 1KELH 3LEVH 1P7KA 3VCRA 2PN5A 3LCYA 2HKHL 2OI9C 4QYOA 3OJMB 3APGA 4B3LA 5DD5H 1G1KA 4F57H 1JV5A 2CC0A 2KDYA 4FLHA 2BV9A 3FO0L 3LNPA 4I3GA 2ITDA 1GEQA 1P69B 1MG2C 1AG6A 4AZGA 2MQGA 3M07A 3UADA 1XGZA 1E15A 5KITA 3U5YA 5E6ZA 5TQ0H 3D09A 4JNZA 1OGAB 1T22A 2H4EA 3HPJB 3OAWA 3RVTC 1VZGA 2N7SA 3ZOAA 3X12A 2PDYA 1UH3A 3INUH 5FX3A 4QHRA 2VQ4A 1TJGL 1NUDA 1ZLVH 2HAZA 5CZVL 4QXTB 3EPNA 2AERT 1EO5A 2DY3A 4QRRD 3U1PA 1IEHA 3QWNA 3ABSA 1SEQH 4OJFL 3INPA 1QSFB 1L8PA 4LZKA 5EKYA 2YOAA 4FNRA 3LGEA 2DWDB 2AV1A 2IQDA 3JZ7A 4MVBD 1XLDA 5DRNB 3ALGA 3HI6L 3M5ZA 1QTWA 5IROC 3VKKA 4NSBA 1OFEA 3EIFA 4XN2A 5HHPA 8FABB 3NESA 4H6RA 2EYRB 3NP4A 1L6FA 5FYLD 3AC0A 3CLEH 4JNXA 4L4VB 1CDUA 3QUHA 2YEQA 5GS0H 4DP0X 4AL8L 4B53A 5ISZA 5L88H 1OX5A 1DTUA 3D2UB 1UWUA 4W6YB 5J89A 2XDFA 1EZVY 5K9CA 2IPKA 4PBVC 4IPLA 3FBQA 3LH8A 4PS3A 5CPQA 3VG0L 5B1KA 4M80A 1AH4A 4XMKH 1ME8A 4QHMA 5ESAA 4I0KA 3WL0A 1ZHNB 1AI1H 4XMTA 4OOZA 3V0IA 4EXKA 2ERJB 2RKXA 4PMUA 4I89A 1I3UA 4L8CB 4P9HL 1UUQA 2FO4A 3ARGD 3OX8A 3B6SB 4XB7A 4F7CB 1EQPA 4ISVB 2ADGB 2WTOA 5IHZA 1EB3A 2YEZB 2F58H 4JFUA 2JXMA 4HHWA 5FOBA 5GHWH 3G24A 4JZNA 5C08B 4WOQA 2CBMA 4QBXA 4XD5A 1AGCA 4J3OF 4AW7A 1L4IA 4QY8B 5KSBA 1KCZA 4XD4A 4CD7A 4E0CA 2ZP9A 3TV3H 4BZ2L 1WTGT 3SO5A 2FHCA 5A6TC 3USZA 2VX6A 5KJ7E 2Q71A 3O9WB 4YHEA 2NY1C 4LQFH 4ATTA 4O9HH 1NA8A 2PI6A 1B0IA 3UGUA 3DJRA 3D51A 3NDOA 1IEVA 3POHA 1CE1L 4M62H 2AABH 2C9SA 5EO1B 2V7HB 2H26B 4F8LA 4H41A 3R94A 3UZXA 3DGBA 5AYTA 1DTNA 3N5AA 2ZOWA 1WD8A 1MEHA 1DE4B 2OMTB 3NVQA 1VFFA 3EHBD 3TA3D 3VFMA 4NJIA 3PZOA 5CS7A 2P9RA 5AVTB 3M5VA 4WIWA 3K0WA 3L9EA 3PBMA 3P11H 3E2QA 3HBQA 5LNVA 4WTZG 3B43A 3FB5A 4YQXH 5LGHH 1E9ZB 2WUBH 2DQEH 4JPWL 4HUVA 2A6LA 1XWVA 5IT2L 5A6BD 3VYPA 4YMZA 1J0YA 4JY4B 4WVRA 2QMKA 4H4NA 4O50A 4D6HA 4GIEA 3DRTA 5C0AA 4AGOA 3HC4L 3K0YA 3MRLB 5BO0D 3QUML 2RHGA 1YEKL 4PJ5D 3RY6C 3W1ZA 3A6BL 2VEPA 2X6CA 5F7YC 2J8FA 2JH2A 2V9DA 5AOZA 3TWYA 5HHXL 3U1QA 5I73B 1O7SA 1OEPA 2VDIA 3N17A 2NY7L 3HG5A 5CIPA 5IBLD 1IIHA 3EGSA 3RWEB 1RZFH 1NMAL 2C5DC 3WOVA 1WA2X 4XHQA 4XVUC 4AG0A 5FKYA 3MREA 4PWEA 1P7HL 4GD0A 5E95B 2BXYA 3D48R 3Q1SH 1V51A 3ET9F 3AICA 3CM4A 1X5AA 2WWMD 4FFYH 4L2LA 1R2RA 1TPB1 4LCWB 4PUJA 3OAYH 3WMLA 1TZHB 4TV6A 4OI8A 4P5TD 2A6IB 3L9YA 4JM0A 5EBWA 5BU6A 3QQ4B 1C93A 4W9TA 4X6CF 2QKFA 2Z25A 3TFXA 4M9PA 3MMEA 5FEWA 1QA9B 2Z4QA 4Z8FH 4BSWA 4LLQB 3LSOB 2NY4C 1ZL1A 1F6KA 2GWGA 5IBUG 5KYYB 4YX2L 2E6FA 1EGVA 2V5YA 1LDCA 2X2YA 1NBYA 1S7TA 4NBYB 2CBUA 3H54A 4DM1A 3TN0A 4X6FB 4ADTA 3QPXH 4A2GA 2P0OA 3W1PA 3AWGA 4PBDA 5HQEA 1X7TA 5J11B 1A3LL 3OV6A 4K71B 5IHUH 2WQ8A 1AY1H 1BZ9A 4G8IB 2VX5A 2CKSA 1FJ1B 4PTVA 3TQ0A 2KAUC 2AMUA 3H2MA 3W2UA 2ED8A 2DIJA 4NM4H 5E6YA 4N0UB 3KM1A 4XN7A 1CT5A 3GFZA 2ZF9A 1OX6A 2AXHA 1J8KA 1U2YA 1UD8A 3IM1A 4CNSA 3TBSB 4EUPH 1SOQA 4KXBA 3N14A 3GNDA 5TE6H 5F2MA 1E4MM 1F6PA 4BHUA 3IGUA 4IJTA 3MLZL 3RAOA 2NW3B 1NL0L 1Q4NX 5ITFB 1X9UA 3FH8A 5AVWB 3MO4A 4OJDH 1C5BH 4LCWA 4ZB0A 1YNTF 4F3FB 4LDLB 3V5DB 3H7BB 4FG6D 2B81A 5L0QB 2C71A 1MDLA 3TZNA 2P3EA 4R7WA 1B88A 2WXPA 1U3HB 4ZAKD 1YECL 1TJ2A 4FQLL 4HAFA 3U7AA 4C47A 5LNGA 2W0PA 4X80H 2VABB 1G0XA 3ESVF 1R17A 4GC3A 4QCFA 3TJXA 2VXVH 1UWYA 4Y2OB 4H8HA 5BW7A 1QI4A 4UYQA 4MDJB 3QDJD 1Z5HA 2ITCA 3D6NA 1DVUA 4ICXA 1ND0B 3MC0A 4IPNB 2WYTA 3X3FL 4B9YA 2DEYX 5EBGA 3MRNB 4AYEC 3JR2A 2GUUA 3OZOA 4FFZH 3QORD 4YJ5A 1UH2A 3P69A 4BUHA 1A22B 1OAZL 3G6LA 3PS7A 1K5NB 4FJZA 4MA7H 4OM0L 3QDJE 4CQ9A 1PL3A 2YQ2A 4KTDH 1IXQA 2CDGB 5D8JL 4XC1L 4LLMA 1NTHA 3RFRA 5JA8B 4LAQH 4L1DA 1R1CA 5F9OH 1OCCB 3NSNA 3WAJA 2F8XC 2CLLA 1I8LA 5B38G 3TA3B 4JTLA 5D4YA 1TRIA 4KUZL 3U9PH 4RZ5A 3DVGB 2PDNA 3HU7A 2NW3A 4MDIB 3ZRSA 5GZOC 2JELL 1YXCA 4RL3A 1KG0A 5HYSG 2BOCB 4O5LL 1EMTL 4XNQA 1VHCA 4HCHA 2TMDA 1OT1A 3UJIH 3ZE1B 4MAYB 2XWXA 3ATYA 5I9QB 8XIAA 4UV4H 4JG1L 3V4VL 4MNGE 5JIPA 3IDIB 3OPZH 2W9EH 1ADQL 4LW7A 4TUJB 1OARH 5AW5B 1EDQA 5IOKA 3R8HA 4XNUH 3UG3A 1N64H 4UTAH 1TELA 2Q3RA 2VLLA 3BIKB 1TVHA 4GXUM 4HT1H 5GGSB 5DHVB 4A55A 4DJDD 4Q8VA 3U0PB 2F1EA 3C0JA 2H6OA 4QDWA 2VLRB 2LU4A 5F89B 5FDYA 5IFAL 3Q48A 4HD9A 4HKBB 4PRHB 1KV5A 4AKOA 2QDHA 3APTA 3OVRA 1OYBA 1WSST 1RVGA 2ZCKH 2WVVB 3B7TA 3UC0L 1MREH 4V1YA 1TV4A 1MZZA 2DJ4A 3ZPDA 3CLMA 1YNLH 4NRSA 2OR9L 1H49A 1ZS2A 5IZ7A 2YWZA 1AO7B 5TQ2L 2FO8A 4C4BA 2R2BA 2FD6H 5JNYA 3MYJB 2OMYB 4GGBA 5B7YA 3SPJA 2PP8A 4IP4A 3S3GA 1WWWX 1BSLA 4TLUA 4V1DE 4BH7B 5GGSY 4NQUA 5DD6B 4ZUSB 1RUQL 3T77A 3GBNL 1N6VA 2FNBA 4JM4H 1YYMH 1JUFB 3DUSB 3FFDB 4OF3A 2Z1BA 3D07A 3MZNA 5EYWA 1X4XA 3C5JB 2BSDA 5GS2H 2NX5E 4FN0A 4GXPA 3W00A 1JPKA 1HKLL 1Z5LB 2A6JB 2F1BA 2IQ9H 1FDLL 2VMEA 2OMNA 3QUXC 2FKPA 2CRMA 4GIYA 2I7GA 1FFOB 2J4WL 1Q63A 3ES7A 4M1CC 1NQKA 3NWRA 4GUJA 4P2YA 1NCDH 3QISA 1HKFA 3QIWD 4FI8A 2DN7A 3VXPA 4DKFL 1KLGA 4DW2L 1ZLDA 3GDRA 2EACA 4TQEL 4C6NA 2DJMA 1VKXB 1Q7ZA 3GSNB 4Y5XA 2JJUA 5CLYA 2O5ZL 5HI5D 4JRWA 3KBPA 2E6PA 4NKDA 4DKTA 1N5YL 1O68A 3DOPA 5F89A 1F3XA 3VFTA 2XM1A 1Q94A 2B9BA 1NGZB 1YMMD 1GK8A 2FNWA 1XQLA 1VBRA 3G1RA 2UYLB 5HNNA 5I24A 5FYJH 2GJXB 1A6ZA 4FERA 4C56D 4LBEA 1JNNL 4EN3D 1XIWA 2N0MA 4HUCA 2VCAA 4JZJC 3CIWA 4JTAA 2F74A 2Z0UA 2CITA 4A3YA 3TGXA 1YUHA 4QRUA 3RG1C 4XO9A 1HZHH 4O57A 1HCYA 3F12A 3SPVA 3PZ9A 1YC8A 4QOKA 3U4EB 4KCTA 1EF2A 1BEYH 3H7RA 3TBVA 1JHTA 5KBDA 4NM4L 4XZ4A 1MXDA 3ZFHA 2QR0A 3BDYH 3EJYC 4MJ6A 2X9YA 3XINA 1J05A 3IUHA 3WO8A 3RBSA 2X4TB 3QNYB 5EEZA 4AD5A 1IR1A 3OVUB 1H3VA 4C59B 3TC7A 3PUDA 1NCBH 5IMLA 3QZPA 2G4GA 4J28A 3TT1H 1PHWA 3T3PE 4KKAD 4X4XB 5D7JD 2Y0FA 1UACH 1DBBH 2CGZA 3SCRA 4MNQA 3CHPA 2XWZA 4H9UA 3MVSA 5CJOL 1TJ1A 2FGWH 3BISA 2OK0H 5KSAA 5AHIA 2QEZA 1M05A 4Y7OC 3VYNA 1JRHI 3SYQA 1RLCL 4NWTL 1TQCC 3MU3A 4KK6C 2LLLA 3WELA 4PTUB 1AOZA 1JZ5A 5HWNA 1W6LA 1OM3L 2GJXA 1IXOA 3FTGA 3BJFA 2H9GA 3D18B 4R4BA 3C2AH 2RR3A 1JV2A 1Z9LA 4X99A 1RUML 5SV3A 4HIJB 1S2WA 4RZBA 5CPTA 4P2RD 4FABL 1UCBH 3SY6A 3C5ZC 3TO2B 1XR8B 3ZE2E 4Z7NE 4A05A 2B1OA 2O6CA 3ONCA 1JPEA 1UD3A 3HO8A 4QXIA 4E4FA 5FYKE 1NFDB 1TCRB 3E6HB 4S1RL 3PDDA 4GVFA 2DZVA 1C9SA 4GG8A 4UZUA 5AOKA 3WD1A 3MBWB 3NQGA 5E9DD 3QOKA 4GBUA 2X7LA 1L8NA 4NYYA 4MJ6B 4JTHA 3T40A 2A74A 1HXKA 3FTVA 5I1IL 1HYSC 2ACSA 3MUXA 3QV9A 1B3ZA 2NSOA 2HPTA 4OVXA 5ABFA 5DRZA 1MAJA 1U6AH 3GKWL 1VYRA 3EX1A 3HURA 3BHBA 2VEIA 4XOBA 3APYA 2LV4A 2NR6D 3K46A 4PB9L 4PRPD 3L5JA 2WJEA 3QY8A 4EN3A 1AL8A 4PUKA 2G95A 3HG1B 4W4NA 1TYGA 3BWAA 1U58A 1C8QA 6ENLA 2ZDSA 3BPCA 3FGCB 3NCYS 3MMTA 4Q7BA 4LKXA 1J9YA 4GCXA 4CUCA 4YZFF 2MANA 4YLCA 3V7MA 2PP9A 3GZOA 5DN1A 1R5VA 4OZIE 3NG5A 3DMMD 4XMLL 4RE2A 3TYFA 1M03A 1M3IA 3HZVB 2HFEA 4DUVA 1Z6JT 4A04A 2XG9A 3PSWA 1GZQB 4K7PH 5D2VA 5D55A 2H3BA 3DOSA 2C9QA 2CRYA 1TQUA 2HTMA 2Z64C 3NN8B 4Y1AE 3MN8A 4N5EC 1T8QA 2A9NH 4PP2A 3X12B 1Q8AA 1YTEA 3BKYL 1DWJM 4K3DH 2KX9A 4M4PA 5JIKA 3RWCB 1PS9A 2A3CA 5FJTA 4C91A 2JJWA 4MA1B 3LKOB 2HQAA 4GW1A 5IQOA 4F9LC 3TV3L 2WO5A 4GUPB 2A77H 3NCWA 5HGAB 3RWDA 3CLWA 1WXZA 5AVNA 3U5UA 2K7QA 2CLRA 5SWSD 4AUJA 1C16A 1UC6A 2Y69B 3SGEI 1GT8A 2YN3A 2WMIB 2YK1L 4JTQA 5GJTH 5C3TA 2YD4A 3UTOA 4Z2KA 2A9ML 1IARB 4ZPVA 4JJOA 2CR3A 4Z23A 3MZTA 2NZ9D 4QSFA 5DZLA 1XH1A 4EN3B 3GMPB 2YDAA 2VDKH 1NFIA 2WLKA 1MHEB 1VPOL 3DLQR 2NUTB 2OMZA 3QUYD 4TLTA 1RMFH 3VI4F 3DJTA 4DZBA 1NCJA 4GW5A 1YY8A 1J8SA 4UQ2B 3PWNA 3IU4H 5CILL 2CERA 2AEPL 2EADA 4DKAA 1WWBX 4RXFA 3STEA 2NUPA 4G8EB 4HIIA 5IROA 3T0EC 5MI0C 1TKWB 3JVGC 4XBGA 1EAJA 3FQTB 3RU8L 1ZT4A 5CGBA 1RUPH 1U2CA 3KLKA 1J4EA 2WTRB 2GLKA 2YXOA 2MPAL 3ILQC 3ZL4H 4JIPA 1G5GA 4JFDA 4DVRL 1Q90A 4MQSB 4H7CA 1CL7H 2PW1B 4MYXA 4GKLA 4Z77B 5K9QI 4X9YA 1S7SB 3UWYA 1MHPL 2HCZX 4U4BA 1M68A 3GX9A 3SN0A 3SGDI 1RH9A 1A2YA 4AC1X 2CUAA 4G82A 4UM8A 1XDTT 3O6FD 4PJCA 1WB0A 4M7LT 1V3HA 5HGBB 4HSHA 2WOYA 3WQFA 1HJBC 1L5GA 1RZ8B 3GC2A 1EA9C 4BRVA 4CNIA 4EBQL 4EQ2A 1VF8A 2JF6A 2JKPA 3FO0H 1BEXA 1L9MA 2BOBA 4NQVA 4KPHL 4S23A 2BNRD 2BWDA 3CXHJ 3ZE0B 2V5LA 2CCVA 2PFHA 3NPSB 1OM9A 2WBJB 3MRDA 4F57L 5I1KH 4G7YL 4WO4B 3ZMEA 3GG1A 3WD2A 3ARQA 2C1OA 3EFFB 3PDOA 2A3TA 2BIOA 3PIQA 3NBNA 2HNEA 4OCYH 3HB9A 3S1GA 1TF4A 3MJ7B 3V6ZA 5DK0B 4A3QA 1BSIA 4ODHH 4FFWD 3NZSA 4WGHA 2F68X 1VDGA 3KYNB 4PJGF 2R4RH 4Q9RH 1EP3A 1N59B 2PB1A 2XSXA 3IIVA 3VXQB 3LERA 4O10A 1NSNH 1G7JA 4Y4KD 3WX7A 2R1YB 3FUKA 4FULA 2CLPA 4LSDA 2VUKA 2XN0A 1HHKA 4P23C 5F1NB 3CD4A 3PAUA 5J5EA 1I2RA 2GOKA 3LSBA 3O2WH 4ZFGL 3QFJD 32C2B 2Z26A 4QF1B 5KS9E 2IQAB 2INFA 4PH8A 4JY4A 3N3TA 4OKVA 3KUMA 2WW8A 5I1KL 3GKFA 3TYGL 3B7UX 3FO9B 2ZZ5A 1N18A 2ADJB 4KEZA 3KL0A 4QLKA 3LDBC 2LABA 4I8YA 3ZJ7A 5KMYA 4OCNC 4PWJA 1IBBA 1ZLEA 1KB5L 1KGJA 4H8PA 5EU6A 2WQVA 1BCIA 1OTUC 1JDFA 2PDCA 2X6UA 1W0YT 4ABWA 3C2OA 3D2TA 4PHZA 3GXPA 4LU0A 3W7QA 1PNCA 5JBDA 4M7KH 3K81A 5JXEC 2B4CH 3CHOA 2QKIC 2J1XA 3FRUA 4UR7A 1CLXA 2B3RA 3UPRA 4R0LA 3TTYA 3OR7A 1A9BB 4OKDA 4JFFB 4F7TA 4O53A 2BTMA 2GJRA 2GB2A 4LNVA 3P3UA 4ERSH 2WBJA 3MRDB 5I03A 2I14A 4KX9A 4CU6A 1PW3A 4U1HB 4KK8C 1AMYA 4XTDA 5GISL 4ATLA 4DOHE 3CFBA 1MYRA 4LCYB 2DWYA 3L4CA 1XRTA 2ZYFA 3NL5A 4E8GA 3QQ9C 3Q6FA 2IPUG 3US1A 4KI1A 5GRUH 5JOPD 3MV9D 1BFSA 2PABA 2Z4QB 1G1YA 1XH3B 4L8DA 2ZOLA 3MUCA 3SURA 1EFXD 3E0GA 4PJFA 3L95B 3WLIA 3O3BB 3O3AA 1OF0A 4ENED 3IGAB 4AYFA 4TQHA 5JQ6L 2X5PA 3IJSB 2O4QA 1DR9A 4FS0A 4M6NL 2IBZX 5SWSB 2CIKA 1QW7A 4UFMA 3VSQA 1UXMA 5BXRA 2Z35B 3S47A 4GSQA 1DBAH 1KGXA 1W3TA 3W11C 6PCYA 3GIZL 4LLVA 4PU2A 4ONHA 3UD6A 2BP8B 3F64A 3ZDZE 5IB5A 5TH2B 3CQIA 1BZ9B 4U7SA 2X0UA 4OFYA 1J10A 3B5GA 3MTWA 4YDNA 2QUMA 1B6DA 2W0FA 4U6XB 2LAAA 1VP5A 4U6YB 3L48A 4A7GA 3T6VA 3SGUA 1ICPA 5DRWB 3QZBA 4AYGA 3PZUA 4Y4FB 3GIVA 2HLEB 1GR7A 1PEWA 2BSBA 3JWNE 1K70A 3VGEA 3DFNA 4ETYA 2VN4A 1S46A 1QFWI 4PJXA 1P9MA 2O61A 4P8XA 5KSUB 3MNMA 1E6ZA 2V5DA 4Z95H 3MYOA 4K23H 4QHKI 1YEFL 2YLHA 4PSRA 4N90E 5D1XE 1ZANH 4WCJA 1SXAA 3C60D 4UMSA 4IIEA 1MVUA 4NHUB 3RWHB 2VSDA 4B5SA 2ADIA 2FTWA 3B0PA 3G8RA 3DTDA 4L48A 3W83A 1U91A 2BZNA 1CGSH 3WLOA 3ARXA 4NDMA 2P3YA 1Q6GA 4FR6A 4YDVA 1Q65A 1TOXA 3THCA 3PPSA 3DMMA 3UU0A 3GG0A 1MHCB 4P9MH 1ASQA 3NSDA 2G4JA 3N6JA 3QXUA 5A69A 3UY8A 5EIVA 3MAWA 2WHJA 1JZ7A 1NEYA 3BGMB 2QHAA 4H1LA 2CLVA 3KZ8A 3WMCA 2CO7A 3I75A 2V2DA 3GMQA 5D9PA 25C8H 1HH6A 4HNLA 4MKNA 1MRFL 3IRCA 4C6EA 5EU7C 3WH5A 4Z2GA 3GVVA 2ACRA 3L4YA 3MB9A 3SGJA 3MLSL 1KLUA 3L9RA 1PDYA 1A5MC 3KR3H 2BG5A 3FJ6A 1KN4L 3SUTA 1XLBA 5E5UB 4X7EC 4DQOH 2PR4H 3WHE1 1E0XA 1YVLA 3AMKA 2WV3A 4HIPA 2F1AA 2BVOB 1RK7A 4ES8A 1C3FA 5ABGA 7REQA 4FXTA 1IAOA 2JE8A 3SYCA 3LIZL 1AJZA 1PUDA 3ZX1A 2BNQE 4PJEB 2ADFH 2XFGB 5DU7A 2HFGH 4JFSA 3SODB 1YDVA 5LB1A 3WNPA 4HH8A 5TF1H 2OQYA 2WOBA 5E8OA 1MY5A 3QXTA 1J9RA 2Q6WB 3U83A 1PLGL 2ATPA 3P9MB 4PJDB 4JTCA 5M3WA 4KJPD 3ANUA 1JHLL 2ZTBA 1U91B 5KBPA 4DLMA 1D6EA 3II2A 4FQIH 1IC5H 1VFBB 4TSBL 3T6WA 4XKYA 1GVIA 4PJIE 1KM3A 5D4QA 1FHLA 4XCCH 5C8JA 3R8RA 3W9EA 3HB3B 4XXWC 1E73M 1E9QB 3SR7A 1J9SA 2R56H 1WAPA 4L9LB 4H9ZA 2DORA 1P6BA 5KSWA 2VL5B 3F7KA 4OQTH 5AAMA 3WKQA 1VJZA 4PTDA 3JTBA 2DGAA 4ODSL 3BEVB 1CG9A 3TH6A 4NQED 2QJDA 5HDOA 1N7KA 6TIMA 4N02A 1K6AA 4RW3A 1XH0A 1Z69A 1TZZA 3GR7A 2DQIH 3IVKA 1PWMA 1UC4A 1QAWA 1T6WA 3E9UA 2JLPA 1IKNC 2IGFL 4ASTA 2CALA 4H00A 3UXLA 3SBWC 4HTYA 4HOXA 3O2LA 3B2XA 4TNWF 5KSBE 4IPPA 2C3VA 4PR5B 4Q0XL 4US6A 4P5KA 4X5XB 2CH8A 3JV4B 4JDTL 4ZUSA 1A50A 3E2SA 3LYRA 2B7DT 4JCWA 5D4HA 3WFCH 4ORGB 1FXQA 3BEWA 4LV4A 2PCXA 3M17B 1DHKA 2VXSH 2IGTA 1ZLUK 4DEUA 4WEBH 5IF0B 5K9KB 1GG1A 4BZ1A 3VIOA 2W0UA 4N8PA 4NQXA 1VEOA 4EOUA 4KK8D 3VJ6A 3FHAA 1IU1A 3PABA 3WDRA 4FA3A 4KBXA 2OCFD 1UUNA 5F1IA 1MEXH 4KPLA 4UQEA 4XVUD 2CKBB 4XNYL 3DFQA 4PMOA 1QFEA 3SHSA 2PETA 2XXCB 4IKIA 1PCSA 5D1QD 2C19A 2NXZC 3NQMA 5A16B 4H0LC 4ADGA 3O6KH 2QQKH 3QS3A 2HXAA 4JQ2A 4AUBA 3SZ6A 2AXWA 1UM5L 3Q65A 1UJQA 5BXPA 1UUMA 1KYFA 2Y22A 1G9MC 12E8L 2VC6A 3SDOA 2E67A 1UR4A 4UT9H 3CMFA 3UZVB 5CJQH 3LS9A 4GG6F 3BD5A 2XPKA 4REQB 3BSHA 4BH8A 5I71C 1F97A 1HWGB 1KPVA 1CN4A 2G5BA 4HW6A 4I85A 5L2JB 2FLRT 4YO0B 5CSYA 2GC7C 3OMZA 4Y4HC 4Y5XC 1XSOA 3FQ1A 2Q3ZA 2VLKE 3TS8A 1E5NA 2P5PA 4MG4A 1IEWA 1HHHA 1LDPH 3AACA 1M41A 3C60B 3H7VA 5I7GA 4ECLA 2Z31C 1MO0A 3WIHA 2HH0H 2UY7B 3L7FB 4HIHB 4OFVA 1OGSA 2G75B 4YFLI 4ZO6A 4IHBA 4EQ3A 5I16B 3GSOA 3HGRA 3SAZA 3YPIA 4JZJA 1T66C 4L5ZA 2WYHA 4MKTA 2CZEA 2XISA 3GDTA 2XBDA 2ZZ7A 2BX7A 4HYVA 3NZQA 3S8WA 4R3UA 5FF6A 1UPPA 2HJFB 2DZSA 4UBDD 3MBXL 4Y9FA 1QJWA 4AH7A 1NMCC 4KTEH 5JHLH 2H90A 1ZV9A 3FTSA 2Q8AH 5FGSA 1LE5B 4OLZH 3FXIC 2YB1A 1AXSB 5MHBA 1W1ZA 4OUEA 5TQ2H 3DC0A 4IBVA 3OZKA 3IJQA 1RJYB 1XAKA 4U1JB 5GGTH 5H2BB 1KV3A 5KN5A 1BWMA 1NC4B 3ZQXA 1LP6A 3P74A 1MQQA 3IV8A 5JQ9A 2L3BA 3MUY1 2GSJA 2O1AA 3JWDL 3QQXA 4LSPL 4NNXB 1BJ1J 2ZYIA 5CJXA 2FZDA 1RU9L 1T0NB 2DM2A 1OC6A 4J8QA 5I1DB 3QW9A 2BOGX 3H9SE 4TSCL 5JORA 4DYEA 3LZFL 2VWSA 3PHQA 3GEFA 4G71B 5D5MA 1SF3A 4I5RA 3F6JA 1FZKA 3MR9B 4TUUA 4UOW0 4UZSA 4WGKA 1P4CA 3O9NA 1ET7A 1S2EA 1IBHA 2QPUA 1R3IL 4Z7NB 4H8WH 2FJSA 2RAGA 4OECA 3UBXA 2J7EA 4OZ4A 1TJXA 4YDIH 5GGVL 1H3GA 3FUMA 3S34L 3WFDL 4AYBA 5IHHA 3WTSA 2IWFA 3N85L 4DVBB 1T03L 2WM0A 1P2CB 3EGXA 2VXUL 1IC4L 1NFPA 1I8JA 3N85H 4OFPA 1ZCRA 3ZQ9A 4E9QA 4PI2A 1E5BA 5JHMA 5T3XD 2GK1B 4H9VA 1OW0A 8TIMA 4BEUA 2O0TA 3VFRB 1WZ1L 3RIAK 4G6ML 1LOQA 1XWYA 4UAOC 5BROA 2OZ4H 4F8PA 2W9LA 1D9KA 3FTZA 4HETA 1MQKH 4WWKD 5AOJA 5C0JB 3BLEA 4Y4FC 3C2FA 4PW3A 1MI5D 5EC2A 2LAGB 1PZ5A 4JVUA 1OD7A 5KVFE 2AJYL 1ZTXE 5GZOD 1XF0A 2WKJA 4GFXA 3P2TA 1Q1JL 4D7PA 2UX6A 3EPMA 3GDLA 4AZ7A 1L6SA 2VR9A 3X1NA 2KQMA 3AU0A 2OFJA 3T3ME 3B8IA 2CIIB 4HS8L 4O2EB 3ZGHA 1JGEA 5H6HA 4N0CC 3D3VD 3EDEA 1KM1A 4NZ8A 5FI8A 3QC5X 1E0OB 4XZBA 1EXGA 3HFTA 3IJYB 4PRAA 4WAFA 3KXFE 4OB5H 3R8BB 4A3HA 5A43C 2J13A 1SN2A 3MR9A 4H44C 3W1QA 4JDZA 5IMOB 4ADIA 3CYVA 3WYRA 3QYSA 4IM8A 5J12C 3U36B 3BGFB 5IM7B 1AP2B 1U8HA 4KNSA 5A6MA 3HS0B 3MCG1 3KJ6H 1TSIA 3DOIA 1WIUA 3DPDA 4US5A 4MNHA 4PRDA 3CO4A 3TZVD 3ULVE 4XX5A 1MOEA 4CADA 3EJYD 4PJBA 5GIRB 5ICUA 2XN9D 1FLRL 2O93L 3WEXA 2AJSL 3OZPA 4HG4K 3I3BA 4X4YB 2ZRWA 2E59A 1QHQA 3WNKA 1E9PB 4L0PB 4A2FA 3ZVVA 1ONRA 2R2CA 1THFD 2EG6A 1IM3A 1CFMA 2GC4C 1R3HB 4MQ7A 4AK2A 1ZGLP 2OEJA 3HG0A 4BHUI 4ZB2A 1U0QA 2P44B 5E1GA 4HK0B 4UT9L 1XLKA 4KHXH 3PF3A 3V7AG 5D7LD 4KI5F 4FF9A 4PGDB 4NT6B 2OO0A 2LE9A 4B5XA 1O5XA 2EIKB 2J25A 1GOFA 1QSEE 2NPLX 4NSKB 4XAKD 4LARL 4GUQA 1BKSA 4FB7A 4NQDA 2YD2A 3ARBA 1Y5WA 2A1YA 3HMWL 1TKWA 1WP6A 4XBGB 4L4TA 4BFOA 1I4NA 1KXVA 3R11A 4UT7L 1V55B 1AS8A 2K3TA 5G5DB 5A8MA 4XISA 2IEPA 3B34A 5DC9B 3S3PA 4HBKA 2R2EA 2W60A 4DN4L 2JGYA 4FR1A 2Z8SA 5IJKC 3NZ8A 4QCEA 4S3KA 1FVDA 4M1CD 3O4LB 4OLYL 4DP1X 3IMUA 1XQ4A 3LKPB 2JIXA 3VU2A 3ATBA 4XOEA 1T0PB 3BDKA 3WQWA 4IS6B 3UJEA 3WDQA 3DIFA 2Y1ZA 3NIDF 5E9AA 2CLMA 1GOKA 5FECA 1FNLA 1D5XB 4XWGL 3IACA 4JGJA 1H8SA 3FRPA 4FXKB 5K33A 4W9JC 1TFVA 5C5YA 4UM8B 2UWFA 5DQPA 1TMCB 3TF7C 4GXUN 4OB5L 3QJUB 3PWUA 3ZHDA 3FT3A 1AGFB 1E6QM 1W1VA 2PGWA 5EEYA 3WIAA 5KVDL 4GAGH 3RWJA 1KXHA 3G6AB 4JPQA 1DL3A 4XCNA 4H4IA 2A4ZA 5J1AB 1XXFC 1QFWM 1JNDA 5HA7A 5FCUL 4H8WL 4GYPC 3C8KB 2ZXCA 2AK1L 5IIEB 2V9RA 3CFIC 5JMUA 3BGGA 5FO2A 4PGBB 5G4OA 1XS2A 4KRPD 4BZYA 4Z0XB 1FV1B 2D0HA 5FGCB 5B3NA 1IBGL 1E28B 5C0RH 1FCVA 1QFWL 1IGJB 4YHLL 1IQWH 1RU9H 2R1YA 3C8FA 4Q4RA 3IPBA 4I3SH 5FUCC 3THML 2HVJA 4Z7WF 3LCFA 1K9DA 1NDGA 3IVTA 2XOTA 2D2OA 3DX8B 3MCLH 4Q4EA 1Q13A 3G5XB 2W65B 3ELAT 3WEMA 2OQJB 4IWWA 5F7DB 3FK3A 5B7ZA 3TN0B 5MI0B 3WJJC 1YLVA 3ISIX 3RX5A 1QNZH 3DGGB 4CAGA 3TA6A 5IOBA 1UVQA 5CG7A 1GOXA 2J21A 2CXGA 2QGEA 3F05A 4KO9A 1FNSL 5D8JH 2V2TA 2JWYA 1GGIL 1VRSA 2F5BH 1FJ1A 3Q8CA 4NGHH 1AJ0A 4GABA 1US0A 4HPXA 5BMXA 3H4WA 2FX7H 1ZHLB 2PYEB 3P4NB 3KWSA 4PMZA 5IB2A 1HG3A 3IFNL 3G2GA 4NKQB 4EDXB 4B15A 2OL3B 3E8UH 4QMEA 2QGHA 3W28A 3NA4A 5DJ6B 2Q8BL 3OMNB 3WN5A 5HD8D 5KYUB 5ENLA 5EBUA 3FFCA 5DEJA 3W71A 4D6GA 3PJTA 1G4MA 2CBTA 1QLRB 2GIXA 4FQCH 4ZYKB 2TPSA 4C6IA 4X4ME 5C07A 5D8WA 4CEUC 4WSHA 2H2PC 2ZCLL 1GS7A 4YDZA 3DFYA 5F4SA 2VWEE 3VFOB 3F4NA 1FV1A 4YVVA 3P9LA 1JVLA 4NUWA 4JRYB 4F37K 4UNIA 2YKLL 5TBOA 1V6YA 3D0CA 1FWXA 3ULUF 3K6SA 3N44B 2ITCB 3I6KB 3TT3H 2WBJC 5IB3B 5AB3A 3TL5A 3QQNA 2OZTA 4RQQB 4YHKH 1RY0A 4YTSA 4R3SB 2RIKA 3VC5A 3AREC 4LK4A 1MCNA 3FJTA 2YWYA 4WI4A 4LVNC 4WEEA 2GBTA 3J8F7 4BY3A 2FT8A 2ICES 4HNOA 2AXFB 4DFIA 3GI9H 3JWOL 4ZQPA 1ZLSL 4P2QE 3TIEA 3UG5A 3AFBA 3QPZA 1IF2A 4KESA 3MLRH 2LGNA 3VIMA 2CDGA 1TTIA 1XI3A 1NPNA 3GS4A 4XR8C 3MCMA 3FQNA 3VOHA 3LI0A 1F4XL 3QULB 1JWUB 2ZONA 3BLPX 1KLFB 1HAWA 1WBYA 3EOTL 2V6HA 2GK0A 5DVPA 4N6RB 1KCBA 1C7SA 2WWCA 5C6MA 3MDJA 1AGBB 3QO0B 5IVXA 1DIOA 4U1MA 1YDOA 4IYKA 1TJIH 1L0XA 5EU4A 1DO6A 1E7VA 1ZQ5A 5D2LA 3BIBX 2AGKA 4GSUA 4MYAA 5GS0L 5F3HA 3W0WE 3FCSB 3PG2A 4M5YL 5C0BE 1IFHL 2AGJL 2HZHA 2NLJB 3AUJA 5CPSA 2NV2A 5DBTA 1K6QH 1IGML 4LS0A 1OTSC 4EEEA 3QXBA 5LAXA 4WTZA 2VJXA 2QDWA 1P9MC 3I3EA 4NZUL 2PF0A 3GGWB 1FO0A