4JL1A

Crystal structure of a bacterial fucosidase with a multivalent iminocyclitol inhibitor
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-L-fucosidase
publication title Exploring a Multivalent Approach to alpha-L-Fucosidase Inhibition
doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
total genus 163
structure length 439
sequence length 439
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jl1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jl1A01
4D6IA 1NWRA 3SCRA 5LA1A 4HZ6A 4MNLA 2JIWA 3VUPA 3T09A 1FP9A 4D6HA 1R86A 3ECQA 3PTQA 2EABA 3DDFA 4HOZA 4EANA 2XN1A 2F7PA 2ZWYA 1OIFA 3MV11 4JHZA 4E8CA 3SUUA 1PPIA 1QW9A 1R75A 1E6PA 2BVDA 4M80A 2F18A 2YL8A 1E56A 5JBFA 3EYPA 3GTNA 1KTCA 3K4DA 5CLTA 4HA4A 2EADA 2V3GA 4AZ5A 1LQ0A 1TQWA 1MW2A 3CIVA 4E8DA 1DWIM 1WKYA 3M7SA 1K9DA 3VSUA 3LX9A 1PX4A 1E6RA 4H8UA 1V6WA 1GOQA 3D50A 2XSAA 2W62A 2WAGA 2BV9A 4KMQA 2XUCA 3N13A 3DECA 3EJQA 3AMKA 4W93A 4M82A 2V5DA 3WY3A 3MMDA 1VIWA 1YHTA 2F8QA 3BLKA 4ATLA 2DIEA 1AQMA 2C8NA 2J7BA 4W5ZA 3DDGA 2XN0A 4YN5A 5BXRA 4AD1A 1ISXA 1LL4A 3CLWA 1TZ7A 5ECUA 2G3MA 2CKRA 1J9YA 3ARSA 2A3CA 5KEZA 2XHYA 3DX0A 2J25A 2OYKA 1QHOA 2UY5A 3MANA 4J28A 1XSIA 3PZIA 5FL1A 4K68A 1QI4A 4OZOA 1OD8A 5E0FA 3N04A 5DF0A 3CO4A 3UG3A 1C7TA 1H1NA 1PJ9A 5A6SA 4GI6A 3UCQA 2VX7A 4QP0A 5A6LA 1JZ6A 2DSVA 1MQRA 2VX5A 3RCNA 1FHDA 2CERA 2OLHA 3O6AA 1QNPA 3WQ5A 5BROA 4MDOA 2XIBA 3WD3A 3GBEA 5IFTA 1MWOA 4B3LA 3UG4A 1KTBA 2BY2A 2CBVA 4AISA 4DUXA 5FOOA 3POCA 1KQYA 5KZ6A 1GQKA 4TXEA 5E6YA 1MQQA 3WD1A 3WDPP 3CZJA 3RO8A 2D0FA 3FNDA 4D6EA 5DT5A 1D2KA 4FNTA 4ATWA 2E40A 3OLEA 4TTUA 2VT0A 2O9OA 3A47A 2XYLA 8CGTA 2WMGA 3WY1A 2CIPA 2W61A 1WZLA 4UTFA 1E71M 2BVYA 2XG9A 1KXHA 1ZBCA 3GNRA 5JIPA 1MW0A 4JKMA 4P8XA 2D73A 4CD8A 1DEDA 3M6DA 4MJ4A 3HJEA 3T0DA 1UR4A 3BVXA 4ZXLA 3HG4A 3WY2A 2Y2WA 1ITXA 4JAWA 1G5AA 1OD0A 3S6TA 4W88A 4CU7A 1IZJA 3W6LA 3ARZA 2WVVB 3MSDA 4GXPA 3WNPA 3WMBA 4W5UA 4J3TA 1TQVA 2Y4SA 1UUQA 2X05A 3IAPA 1GQIA 4W84A 2F1BA 2XN2A 2O9RA 4FNQA 2DT3A 1GOMA 2OW7A 5I79A 4MJ2A 1PX8A 3W38A 1TR1A 2DSZA 4FK9A 4GZIA 5HOSA 2YL6A 3ZJ8A 5AC4A 1NOFA 2J8FA 1HF6A 3THDA 3SCQA 4X9YA 2J75A 1VRXA 3A6OA 3OZPA 4H8HA 1TFVA 3UG5A 1KGUA 1XD1A 5DFAA 1PZ3A 4OGZA 1R8LA 3CMGA 1ECEA 2F1AA 1R7AA 2Z1SA 3D5HA 2E4TA 5A2BA 3NDZA 1NQ6A 1EOMA 1R7OA 1E6SM 1M53A 3VGEA 2PWGA 2IXVA 2PWEA 1CENA 4LYQA 5HBFA 2FHCA 2YBUA 3SUVA 2J78A 2ZX8A 1UASA 2Z1KA 2ZXDA 1XSJA 5JIWA 2O92A 1TVNA 3GNPA 4J3VA 3W25A 3WNOA 4CKQA 4YHEA 4UQCA 1CLXA 3JUGA 3T2QA 4MAVA 5GQBA 4DWSA 3RPMA 1GUVA 3GXIA 2J74A 1OWQA 3VGGA 1KWGA 4LYRA 2V5CA 5BXPA 1I1WA 2CPUA 3VDAA 5CSYA 4PMUA 2QPSA 4AZCA 1JAKA 1W32A 1HP5A 3TA9A 3AYRA 3K4AA 3VO0A 3VD9A 1JIBA 1UWIA 3U5YA 2FH6A 1WZMA 3ZR6A 1CPUA 3AHYA 1DWGM 3SCTA 3N12A 2VO5A 1EHNA 3TTYA 2EQDA 1JDDA 3W4RA 5ABHA 2NSXA 1B3YA 1HJSA 3DX3A 1PZ2A 2WMJA 4PCSA 3CUHA 3U7VA 3AS0A 4AIUA 3AI0A 3K8MA 3CMJA 1JL8A 2F7RA 3WNNA 1CEOA 5CG0A 4XB3A 4P8VA 4HU8A 1J01A 2W4XA 5HNNA 3BCDA 3CHDA 5HXMA 2E9BA 1QHPA 3LMYA 2XM2A 3NYDA 4NRSA 2DH2A 2CCRA 4GI9A 2GJPA 5A8OA 2WNWA 2YA0A 3VILA 2PB1A 3I3DA 3AICA 1Q6EA 2VTFA 4QLJA 1EDQA 3RDKA 3RIKA 4UQEA 5IHSA 1ZU8A 3MUIA 1TQTA 3GBDA 1TQUA 1H09A 1XYZA 1CXFA 3VU2A 2E3ZA 5A6JA 2WVVA 5FKYA 1UH2A 3RM9A 1SR0A 3AMDA 1JI1A 3ARRA 3IK2A 5IDIA 4U2ZA 5A6BA 1SFSA 1BVNP 4M56A 2OSYA 2NT1A 2WYSA 1VENA 1UWTA 4CD6A 1P6WA 3WL0A 5GPRA 1S46A 5D9MA 1K9TA 1DWFM 3FAXA 4LYPA 5F7UA 2WHLA 1RD6A 7TAAA 2WBGA 3AIRA 1HWWA 3WQVA 1MYRA 1MXGA 1J0KA 1DTUA 4F9JA 4WKHA 4BS0A 4JCMA 3OGVA 2PWHA 1VJSA 1X1NA 1W1VA 3CHFA 4DO4A 3WH8A 4HZ8A 1F4AA 3TTQA 3A3HA 2YIHA 4GIAA 2PWDA 3WH5A 4PUEA 3VMOA 2E8ZA 4D1IA 1W1YA 3MS8A 4AMXA 1VBUA 2BHYA 1ZS2A 1BG4A 3KLKA 4GZJA 5EB8A 4PSPA 1EH9A 3VM5A 1CXIA 2YLLA 4CD5A 1Q6GA 3GZAA 1KBKA 3CH9A 4D6JA 4AXNA 3KL0A 2X1IA 1JNEA 1JYXA 1NH6A 4UQ9A 1G0CA 4CU6A 3VTRA 1CWYA 3L2MA 5CQ1A 2AMGA 1W9PA 3LPGA 3KL3A 3WBAA 2AAAA 2BY0A 2YOCA 2BNJA 3H54A 1J0HA 5A6AA 4PMZA 1TA3B 4H8VA 4V2XA 2DT2A 2VZSA 1UWSA 1QHZA 1Q6FA 2XVKA 1W3HA 1E15A 3VX1A 1BF2A 4OBRA 1E72M 3L4XA 4HA3A 4DWSD 1E4MM 4MNMA 1J18A 4U2YA 3WENA 1GONA 4WK9A 3SEPA 1LL7A 2DQXA 1M7XA 5I0DA 4NI3A 4B3KA 4AZGA 1MFVA 1UHVA 3BVVA 3BUIA 3K46A 1WDPA 3PZVA 4JL1A 1E3XA 1GOIA 4OOUA 4W7VA 2CYGA 1GHSA 3ARPA 1H41A 2VI0A 1EO5A 2ALWA 2XJ7A 5A8QA 1BLIA 5ABFB 1W3LA 2X8RA 4DUVA 4KGJA 1BPLB 2EACA 1JFHA 1GPFA 1C7SA 3U5UA 2ZICA 4U3AA 1ZBKA 3APGA 1WNOA 3VMPA 3N1AA 1XCXA 2CITA 3PTMA 3W29A 3W26A 1KXTA 2XFYA 3BUDA 2YBTA 1MXDA 2IGTA 3VD5A 4MTVA 4Z2JA 1HKJA 2YLAA 2BY3A 3ZJ6A 1B90A 4P8WA 4WKFA 1HKKA 1XH2A 3WEOA 3EDDA 3AS2A 4UFKA 4OIFA 1B1YA 1XHGA 3WD0A 2VC9A 1V6YA 5A6BD 1OGBA 2X09A 2PC8A 3U7BA 2DSUA 1E70M 2EJ1A 3D51A 4PSRA 4HOXA 2D20A 1OINA 4UFIA 1ODUA 1LF1A 3U57A 1E55A 4ACYA 1WP6A 3M07A 2ZX5A 4E2OA 2WANA 3WKZA 5I23A 1QWNA 4AZ6A 4Z2LA 4Z2KA 1FH7A 1SZNA 4W7WA 2X2HA 2QHAA 3L4WA 1BHGA 2VVSA 2DDXA 5C8BB 1R85A 2ZUMA 3AFBA 1BGAA 1XSKA 1TMQA 2CETA 4ZEPA 4J3WA 3EDJA 2E8YA 1E0XA 1ESWA 3TP4A 3CGTA 4UOQA 1ISYA 3HN3A 5E1QA 2FDMA 3VKKA 1NWSA 3WNKA 1UA7A 3N18A 2E9MA 3LXCA 1TA3A 3RMEA 1V3MA 1IT0A 3OGRA 5E0CA 3WQ8A 3QHNA 3ZT5A 2VRQA 1H3GA 2WXDM 3CZGA 1EDGA 1J12A 1VEPA 2J8GA 3AIBA 4LPCA 1GOOA 3GXDA 4NZFA 1LL6A 2C0HA 1EIBA 1UQYA 3AMCA 2BVTA 2D24A 3GH7A 4TVUA 3T2OA 1T0OA 3WH7A 1JXKA 2WK2A 2YDSA 5D8ZA 2J62A 1UWUA 4WSJA 1GOWA 3TONA 4NRRA 4WJXA 1JZ7A 4AMCA 1XYFA 3MSGA 1EXPA 5FCZA 3IJ8A 2WM0A 1G9HA 2PWFA 1ZBVA 1FOBA 4HMDA 3TV8A 4GINA 3VVGA 1B3ZA 4PTXA 3F5LA 1GHRA 1B3XA 3FHQA 5ABFA 4B9ZA 3NSNA 2ZWZA 3B8SA 4CVUA 2TAAA 3DX1A 2RGMA 2EPKX 1RH9A 4M24A 1B31A 1CGVA 3J7HA 1SYTA 3ZO9A 2OSXA 1K9FA 2W5FA 3KEHA 3SCSA 2PBOA 2V3FA 2FE0A 2VCAA 3VGDA 2GK1A 3PZTA 1Y7VA 5FD0A 2J4GA 3AZTA 4D1JA 4W7UA 4H7VA 3CPUA 4V27A 3UR8A 3OB8A 2WSPA 4TVCA 3L2LA 1MFUA 2EO7A 1TQSA 3D4YA 2X2IA 2A3HA 2G4FA 4PTWA 1JF6A 1LJYA 2EPMX 1J0YA 3UR7A 3ARVA 2VX4A 1PIGA 4W8AA 1B9ZA 1VFOA 1ZB5A 3DYPA 3WUFA 3AHTA 3ZR5A 5A8PA 2WWCA 3NIYA 2D1ZA 2VCBA 7A3HA 4EAMA 1NM9A 2G8ZA 1HVQA 5CLWA 1KBBA 1UD4A 4FLRA 2DSKA 1UR1A 4JKLA 3GH4A 4W87A 2GJRA 1C3FA 1FHLA 2F61A 3CZNA 4BCEA 4AZBA 1QW8A 1E4NA 2OWCA 3ARXA 2G3NA 1ZL1A 4DM1A 1E6XM 2XVLA 3QHOA 3BLBA 3EJUA 3EMCA 3T0AA 1R46A 1QWUA 4PEEA 1E6ZA 4C7FA 2W66A 1W1PA 2WKGA 4JKKA 2WHKA 3DX2A 1DWJM 2EPLX 1F4HA 3CUFA 1QI2A 4MB1A 4AZ7A 5JBEA 4NF7A 5HPCA 3BSHA 2XWEA 4GI8A 3UEQA 2BS9A 3LXBA 5E09A 3SUTA 4ZE5A 2Y5EA 2VZUA 3CZEA 3BVUA 2DH3A 2CBUA 4IUGA 4MADA 2XFFA 3TTSA 1CBGA 5E6ZA 4CU8A 3DX4A 1E0VA 2J7DA 2XTKA 4AYGA 2WC7A 1CECA 1XRVA 1DWHM 4Z2HA 1AMYA 4KRUA 3AXHA 2FHBA 3PZMA 1VFMA 5IXEA 4FF5A 1I1XA 1JAEA 3AISA 3VPLA 2G3JA 2QMKA 2MANA 2RGLA 4P7NA 5DT7A 2IUZA 5D9OA 1XD0A 4W8BA 3W27A 4BQ4A 4A4AA 2ESCA 1JXJA 3A24A 3ZMRA 5CPTA 4PMNA 2ZUTA 1QBBA 3WUBA 3S5ZA 5A8MA 5CGTA 2VURA 3D3AA 4TTGA 1B30A 1JGIA 3CZLA 4Y7EA 2UWFA 1UZ4A 4NXKA 1TG7A 5I77A 4J3XA 4JFWA 1ITCA 3BMWA 4CN1A 3NDYA 3MKKA 2QLYA 1JYNA 2WKLA 4QFUA 4KGLA 4L4OA 4A3YA 4XUYA 1D3CA 4QCFA 4JFSA 3MUAA 1KB3A 3IGUA 4CCCA 3A4XA 1OBAA 1U2YA 1CGXA 3GXPA 1W9VA 3FN9A 1BYDA 1JDAA 3POHA 3NSXA 3VD3A 1GVIA 1H5VA 1V02E 2V38A 1E1FA 3CV5A 2VQTA 1GQLA 4PUDA 5CGMA 2FH8A 4XZWA 2BHUA 4AW7A 4H2CA 1UYQA 3TTOA 2UY4A 4HTYA 1VEOA 1HNYA 2X2YA 1GVYA 3SCUA 3W82A 4NX0A 4HZ7A 2VQUA 3AYSA 3WFLA 2W92A 2WMKA 4A3HA 4D6FA 4S3JA 3ZOAA 1V6VA 2EPNA 2DPEA 4E4PA 5E70A 2ZXAA 3W0KA 3BAKA 2J7GA 3FY1A 3OG2A 3H53A 1V03A 3MU7A 3N11A 2X2JA 1UZ1A 1X6LA 5AY7A 1M03A 5CPQA 3WMSA 1V08A 2NT0A 3MMUA 1O7DC 3AXIA 2YA1A 3ARQA 3WUEA 1UR2A 3VIPA 4F9DA 1TCMA 3MV01 2OWXA 4PN2A 4F8XA 1PEZA 4U5IA 2ZX9A 4AD4A 1C8QA 2WZIA 3WH9A 5M03A 4UQAA 2WMIB 3GM8A 4F66A 3BGAA 4UFJA 3LPOA 5JBDA 1HJUA 5M5DA 3LRLA 1E3ZA 1QNOA 1BVZA 1TE1A 3KE0A 1VAHA 3L4YA 1NWTA 3PZGA 4C7GA 3EJPA 4QAWA 2YFNA 3B9DA 2HISA 3CUIA 1WDQA 4UQBA 1E9LA 1ZJAA 4GO9A 5A6KA 4PYSA 5EFFA 2J77A 2O9TA 1JZ2A 5FL0A 1E4IA 2O9PA 7CGTA 5FIPA 4LXFA 5AC5A 4JFVA 2VUYA 2BXYA 3NCOA 1QNQA 3M46A 2G41A 4NZCA 4PMVA 4R5EA 4AC1X 1WCGA 1NP0A 3RM4A 4CD7A 4PMQA 2YL5A 3HG5A 1L0PA 5I3DA 2QF8A 3AOFA 4TVDA 1B2YA 3LRKA 3WF1A 1CDGA 1VFFA 5A69A 1E73M 3SURA 1KXVA 1QVBA 3PZOA 4UFMA 1OIMA 1UKOA 1HKMA 2YFOA 5LA0A 3VGBA 1V3IA 1V3JA 2GVYA 5CJ5A 1J10A 2VRKA 3BVWA 1CGWA 2OYMA 1V3LA 1O6IA 2JEQA 2WHMA 3WY4A 5ABGA 3OLDA 3F5KA 3GDBA 3WUGA 1JD7A 3EJTA 4AD5A 1R47A 2XVPA 4TX6A 2WCGA 2W67A 1Q4NX 4H41A 2VMFA 6CGTA 1NOWA 3AZSA 1JYVA 3ARYA 2ZX6A 5A3HA 2JALA 3B9AA 1WDSA 1BG9A 3AIEA 1J0JA 3FXYA 2PI6A 3L4TA 1VF8A 1EQCA 2CXGA 4WLCA 2GFTA 2EEXA 3F5JA 3RJYA 5I5RA 2WC4A 6TAAA 1GJUA 3WDHA 5A95A 3LPFA 4PMYA 2W91A 2J47A 2GUYA 4M81A 4AWEA 1DP0A 1H49A 2HVMA 1VEMA 5BXTA 3BLPX 4AZHA 3VX0A 1UKQA 1CXLA 3VM7A 3AS3A 4TX8A 3VSTA 2VR5A 3AMGA 4W86A 1GW1A 3IJ9A 4J7RA 4PTVA 4CUCA 1EGZA 3UESA 3AHZA 5BXSA 2NW0A 1BSIA 2J7FA 5CZKA 1B3VA 1CXEA 4L4PA 5DMYA 2WSKA 2JIEA 1HL9A 1E6NA 1LLOA 1UR9A 3ARTA 1XH1A 4R27A 2FGZA 1CGUA 1UKSA 1KXQA 1K9EA 2CBJA 3WQ6A 1UWQA 1XCWA 4XZBA 3WDJA 3HG3A 3PZNA 1FFRA 3WF4A 3OLGA 3WFZA 1W9BM 4AZIA 3NJ3A 2WMHA 3CTTA 1KGWA 3MI6A 1GNXA 1FFQA 2PF0A 3IAQA 5A1AA 1H11A 1X6NA 5BYWA 1CYGA 3O2LA 4HPHA 4W8LA 2VRJA 3II1A 4S3KA 2QPUA 4MAZA 3W24A 3CUJA 3AQUA 4ACZB 3SCNA 1J0IA 8A3HA 5I24A 3NUKA 1QBAA 2ZUWA 2JFEX 2FGLA 4IPNB 3ZT6A 3ZT7A 4FNRA 1CGYA 4CN4A 4N42A 2ZUNA 3RJXA 3WD2A 4FNSA 1KR0A 1XC6A 3S5YA 3OZOA 1SMAA 2VR4A 1MQPA 2WHJA 3SCPA 4BQ5A 3ZSTA 5D8WA 2J7EA 3DHUA 4MPKA 4D6GA 3LXAA 2J7HA 3VIFA 4CVWA 4QCEA 3EDEA 3WQWA 5I2UA 1MW3A 3VSVA 5EBAA 2VZOA 2FYVA 4UZSA 2CHNA 1V0MA 4AIOA 2WZHA 1VBRA 3PZ9A 2VVNA 4HMEA 2ZXBA 5BRPA 2D3NA 1RP9A 1JI2A 1IZKA 4AEEA 4PMXA 3WL1A 3BC9A 1GOKA 1WDRA 1UA3A 4MB4A 3WEZA 3HG2A 3A4AA 4JL2A 4OOZA 3WN6A 1JZ8A 4KWUA 3DYOA 1W9UA 1AQ0A 1CXKA 4FNUA 2A3BA 1UQZA 3HMCA 3ALFA 1UD2A 4HOWA 4AEFA 4B15A 4Z2IA 2YKKA 3THCA 1WAWA 5AYBA 3CC1A 1J0ZA 2D3LA 1HL8A 1GJWA 4CCDA 1OCQA 3ARUA 4HU0A 1K6AA 2WW5A 1UKTA 5BRQA 4H04A 1C8XA 2DGAA 1WO2A 4GQQA 4BF7A 1DHKA 5A94A 4AD3A 3AIVA 1XH0A 2WLZA 1OM0A 3BH4A 3A4WA 1HX0A 2OYLA 1GCYA 1EDTA 1CXHA 1WPCA 4M8UA 5I78A 1Q6DA 2YL9A 4Q22A 2C7FA 3WNMA 3QOKA 1HJQA 1DWAM 1TUXA 1EO7A 4C7DA 4ZE4A 4ZFMA 3IANA 3WQ4A 3CHCA 1JD9A 1QI0A 3VIJA 1R34A 3BUBA 3ZJKA 3GNOA 3O9NA 3WDIA 1O7AA 2FHFA 2AOSA 3EMQA 4P7RA 1E5NA 2F2HA 3VDBA 1CTNA 4OBSA 3WDRA 4PTMA 1EA9C 6A3HA 1C93A 2W63A 1M04A 2EXOA 5D9PA 2BY1A 3DHPA 4U5KA 2ZX7A 4W89A 1UD5A 2G3IA 2ZUUA 1UD6A 2UY2A 3AROA 3WF2A 1G1YA 3RM8A 4DWSB 4YHGA 5C71A 4FLQA 1JZ3A 2D0GA 4DUWA 4ACZA 1HXJA 4EKJA 4ZXOA 3K1DA 2YJQA 4PMOA 4AZCB 4X0VA 1V6UA 3W28A 3AIUA 1V0NA 5A8NA 1MVYA 2YA2A 1OGGA 1NWUA 5DEZA 1W9XA 1NOUA 3N17A 3GXNA 1W1TA 1YQ2A 2EBNA 3WD4A 3SUWA 5AYIA 1KR1A 4BA0A 1US2A 4M1RA 3EDKA 4MNJA 2OW6A 3OA5A 5DO8A 4HA1A 3SCVA 1B0IA 1EQPA 2WLYA 4Z2GA 3WH6A 1H4PA 4B9YA 3WF0A 5TD4A 2V3EA 3BUPA 2QV4A 3T08A 2Y8VA 2VNCA 2X0YA 1G01A 4QLKA 4DO6A 3ARWA 3MMWA 2V3DA 4P7QA 5CPSA 4TOQA 4J27A 3VDCA 1ISWA 1HKIA 3VIHA 5BWFA 2WCAA 2ZOXA 2OSWA 1OSEA 4AIEA 3WIJA 1VB9A 2WC3A 3TOPA 1R33A 1E1EA 2E9LA 2CHOA 4EK7A 4M29A 1U33A 4UZUA 3PN8A 2GSJA 2WWDA 1E40A 3CUGA 1JF5A 1J11A 1QNRA 3BXWA 1E6QM 1UH3A 1VFUA 4BQ3A 1JYWA 4FLSA 3EJRA 4KRTA 5EFDA 5E9AA 1N82A 1PAMA 1W3KA 1TVPA 4CD4A 3AXXA 1OGSA 4WSKA 2WBKA 2UY3A 3CHEA 2Q8XA 3PHAA 3ZJ7A 5ABEA 2WVUA 2VZVA 4NXSA 4GPNA 2CESA 1OT2A 3CBWA 3BAYA 3W81A 1ISVA 2Y8KA 3F4VA 4U3CA 2OWWA 1UKPA 2XGIA 3WMCA 4URIA 1GZJA 2IXUA 4HPGA 3K8KA 1FH8A 2CKSA 3VGHA 1HN1A 4JFTA 5CXPA 2DT0A 1W3JA 1PS3A 3BAXA 3LRMA 2J7CA 4LX4A 2GJXB 1ZJBA 3QOMA 3MUZ1 4ZENA 4HP5A 1Q6CA 3A22A 1A3HA 4J3UA 1ZBWA 2YDQA 1CNVA 2F7QA 3OIHA 1RPKA 3VGFA 4GKLA 1LG2A 4JFUA 4AD2A 1E0WA 3I3BA 4GO8A 4MNKA 1CZ1A 2XWDA 1JZ5A 3VIMA 3IJ7A 3K8LA 3QR3A 4QDMA 4BZYA 2GDVA 1PBGA 1UD8A 1JNDA 4UOJA 1C90A 1KFWA 1BYCA 2J79A 3GXTA 4D6CA 4J3SA 2VL4A 4UOZA 1WZAA 4JIEA 2WCSA 3WF3A 3AHXA 1QI3A 4MB5A 4V28A 1BFNA 1KCKA 2XIIA 3HZ3A 1D7FA 1BGGA 1UR8A 4AD0A 2XVNA 2X0HA 1R87A 3B9EA 3AIQA 3VIGA 3FAWA 3GXMA 4F79A 3VIIA 1W2PA 5D9NA 3NSMA 4LGXA 4JHOA 2D22A 1OB0A 1FH9A 4PMRA 4AYSA 2XPKA 2D0HA 1LG1A 1WE5A 2GDUA 2JF7A 1OT1A 1QPKA 3S2CA 4JCLA 1U30A 4PBGA 4XV0A 3D4ZA 2CBIA 4OUEA 1ISZA 9CGTA 3UETA 1Z32X 3EJSA 4FMVA 5HPOA 1C92A 3PBGA 4P8UA 3VD4A 3PZQA 2ZUSA 4LQ1A 4RL3A 2DIJA 1KGXA 1KWKA 3WNLA 3G6LA 2WPGA 4GQRA 3EMZA 4DM2A 1W2VA 5I6SA 3BMVA 3T0BA 1MW1A 1E43A 5GNXA 4U33A 3L4ZA 4UQDA 1H2JA 1H0GA 1HTYA 2ZUVA 1V02A 2YDRA 3KWXA 3MUY1 3LPPA 4XX6A 3VMNA 3KL5A 3OGSA 4TUFA 2JF6A 2ZIDA 3VOCA 5IFPA 1E4LA 4X0NA 4DO5A 1BYBA 3UERA 3BAWA 3HU7A 1ODZA 3G6MA 1AQHA 3PTKA 2A3AA 3SUSA 4MDPA 3A21A 5A6MA 3AHVA 1VJZA 2WZEA 3VDHA 3SCOA 3SIMA 1QNSA 1FA2A 3ZSSA 2DSWA 1AVAA 3FW6A 1XGZA 2WVTA 3GH5A 4UNIA 1EHAA 1WB0A 3WBEA 3OLIA 3E1F1 3A23A 2EPOA 2XM1A 1KQZA 3I3EA 1V3KA 3BSGA 4RE3A 5LYRA 1NP2A 1HT6A 4W85A 1EOKA 1HP4A 3AS1A 4U31A 3ZIZA 4QLLA 4P7OA 4FNPA 2GJXA 2VOTA 3AJ7A 5CSUA 3DYMA 1WZKA 5M17A 4OJYA 3VINA 4CCEA 1B3WA 5GNYA 1PIFA 2EAEA 5D4YA 2QMJA 4CGTA 4DWSC 1BYAA 1LWHA 3KZSA 3CZKA 3EBVA 3FHAA 4D72A 1UH4A 2JE8A 4PRWA 5HDRA 4OKDA 3WDQA 4UR9A 3CZSA 3RILA 3A5VA 3BVTA 1HIZA 3WELA 1C91A 3ZM8A 1QX1A 4IM4A 1US3A 5C70A 3W53A 3MO4A 1HJXA 1W9DM 3QGVA 5GNZA 3H55A 1L8NA 4NSBA 4NZJA 2VJXA 3BAIA 4PMDA 1UWRA 2Y24A 1UD3A 2E0PA 3W37A 1GORA 3GXFA 3QHMA 5LA2A 3VIOA 2DEPA 1HJWA 1W91A 1IV8A 3VNZA 2CNCA 3T2PA 4D6DA 4JZ5A 4UFHA 1JZ4A 1XV8A 1UG6A 3L4UA 2DT1A 2JEPA 1C8YA 3CZ8A 4GZEA 2VX6A 4WIWA 1V0LA 4CN6A 1A47A 4ATDA 2WMIA 2BHZA 1BQCA 3EDFA 3VIKA 3D52A 1H0IA 2CEQA 4WKAA 3L4VA 1M01A 4D71A 2ZXQA 5IHRA 4BQ2A 3BCFA 4FLOA 2F7OA 2D23A 3VD7A 1LWJA 4P7LA 3WEMA 4EE9A 4IISA 5M3WA 1HVXA 3W6MA 2BFGA 5EMYA 1SMDA 1KCLA 2XSBA 3PZUA 4RE4A 3ALGA 4HMCA 1HXKA 1G94A 4Q7NA 2GK1B 2B31A 3OBAA 4UFLA 1QI5A 1BTCA 1CGTA 3SCWA 2ZE0A 3GYCA 4YPJA 2WB5A 5BCAA 3WSUA 2XVGA 1NARA 3KLLA 5A2CA 4ML4A 1PX3A 1I75A 4AMWA 2PBGA 4AY1A 4PCTA 3AZRA 3AIWA 2D2OA 1V6XA 3BUQA 3AMLA 3VNYA 3BAJA 2WMFA 2A3EA 2VCCA 2VZTA 2BXZA 1UOKA 1QOXA 1HJVA 4KH2A 4WF7A 1V3HA 1FP8A 2XGBA 3N15A 1BAGA 3ZQ9A 4N0RA 4RE2A 4B16A 1JG9A 1GQJA 4IPLA 1CLVA 5JUVA 1JDCA 2WVSA 1UR0A 2XFRA 3DC0A 1E5JA 1RP8A 3N9KA 1CIUA 4MB3A 4UCFA 1JFXA 1V0KA 5A2AA
chains in the Genus database with same CATH superfamily
4R26L 4AC7C 2XZAL 3TNMB 3VXMA 3PE9A 4NNAA 1Z8AA 2FVNA 2PZ0A 3O9WB 3M0XA 4MA1B 3NN8A 5DEGA 1WT5C 3UTSB 2JKAA 1QVOB 5IVOA 4AE1A 4H6RA 1QATA 3QHTC 3NIFE 1WOBA 5GRUL 1K9DA 1X5KA 1DSWA 2I9LA 3EJQA 3ZVHB 1ZSDA 2OL3B 1IE7C 1ZKAA 1W6WA 1KRBC 2PLMA 2R1XB 1BSLA 2BWGA 4FHBD 4ICXA 4NVTA 2ZRZA 4OB5L 5AVTB 2XA3A 1H15A 1F3JB 1VESA 1F7BA 1DJYA 3CZFB 4E5XB 1PVHA 1FQ0A 5BROA 4MHHG 1YN6B 4PJXB 3TT3L 3T65A 3PWVB 3NQCA 2BY2A 2CBVA 4S2CA 4ZMZA 3Q44A 3SYPA 5E6YA 4PJHF 1KY7A 3P67A 1J8HB 2RCSL 2A2IA 3QORD 4PGLA 5IHBA 1KT2B 4AMKL 4YTTA 3EYFB 3EUDA 2CAKA 8CGTA 2TSAA 3VRLF 4BQ9A 4P8XA 2GEEA 3F7VB 1FV1B 3LH2L 3NEXA 3WG6A 2VLRE 2ZUYA 3GDTA 1TIWA 4JO1L 3V4PL 5T33L 1PAZA 5BQ7B 1OD0A 3S6TA 2Y1HA 3N2CA 1EEYA 2AERT 4XCEA 4XH2B 3IEAA 3DVNA 2FK9A 1A4BA 4B0MB 1B3JA 5A6IA 2OW7A 1TUFA 2HTKD 4GZIA 1J6OA 1HF6A 4GXVH 1KB5H 3THDA 3E80A 2BM3A 3D2TA 3VI3A 5G2WA 1M5WA 3DC8A 4P2QB 5KG9A 3DHJA 3FZUC 3L23A 5J89A 4HHPA 2FIRT 1G1OA 2VDLB 3ZDYF 1XIWA 3U36A 1IQWL 3IJSA 1J5IA 1UASA 2R1WA 2N7BA 5AZ0A 2CLFA 1X6UA 3DURA 1WUZA 4HD5A 3W2LA 4YHEA 3FMGH 3IVUA 1KWGA 4LYRA 3RWIA 4P3DA 3PWNA 1LO4L 4RNRA 3JUZA 1JAKA 1UCBH 4L65A 4N9CA 4I6KA 3VCLA 5B7YA 4Q8BA 1XQLA 3C5QA 4OUUB 4WCYH 3USBA 1P4UA 4JO3H 4Z1DA 3RUGB 2ABAA 4RQQB 4MG4A 3KLAA 3FQ1A 2FQIA 4XP6L 1TJGL 4FTVB 2IH1A 2DH2A 2CCRA 5LGHL 5KBKA 2QV2A 5D2WA 3LKRA 3ES6A 4U6VH 3RWGB 5D4JA 3V9CA 2EYTB 4XGZA 4A04A 1KF9B 4I48A 3RM9A 2ZJSH 3ULUF 3SCMC 3WTVA 3AMDA 5T9CE 1UWGL 5MENA 4TMPA 4Y16C 4NKIL 4W4OA 1VENA 5HWJA 1ACXA 3FAXA 4LYPA 3RMJA 4L8BB 4L9LA 1UT9A 2HLAA 5A3IC 2IXQB 4X99A 3FJLA 4RGND 4FYQA 3JWNC 3VMOA 1T3FA 3SE4A 3C5SB 3GO1H 4IU3B 3U7WL 1BG4A 3CC5B 5EB8A 1LUCA 1GGCL 3LIUA 2OU4A 1FHNA 1KYDA 4GNKB 1ORQA 2DTML 4E36A 1PZCA 5DEFA 3U0WH 4A21A 1AR2A 1JNEA 5FKPA 4LPXA 3L1OL 5J3HD 5D5ME 4M3KB 3KW7A 1TTJA 3KL3A 5LKNA 1HNFA 1A8JH 2YOCA 4EI5D 5L8JB 2X30A 4X6FA 3SODB 3KPRD 1QSVA 4BDVB 5CD5D 1LRQA 2NQHA 4L4TB 1MWAB 4NGHH 3L4XA 1E72M 2XBTA 2OZ8A 3R4IA 5AAMA 1W17A 3WLMA 5I71C 1GYAA 1L4IA 1BX2A 4AITA 5DZJA 2HT4D 2RACA 1I8IB 1NGZB 3RRXA 2AJYH 4AXWA 3QFGA 1GHSA 1H41A 4Y4HC 2VH5L 1E8XA 4Q7IA 1OTUC 3U5UA 4X7SL 2Y2TA 3CVDA 1WNOA 4XC1H 2FUQA 3PTMA 2DYPD 3W26A 2NXYD 1KXTA 4NYYA 4EIUA 5IMOA 1NVMA 1GOFA 4KMLB 3AW5A 3SD2A 1UJQA 1OABA 4Y90A 4POCA 1JN6A 1LO0H 4Q7DA 1PNDA 3EEZA 5KVFE 2D9QB 4E41D 1FLRH 3WL9A 4XUGA 2LE9A 1MFDH 3P40A 4BFGA 2XFXA 2DSUA 3TU6A 3CFKA 3S8HA 1LF1A 4ACYA 4PUBL 3DGGB 1CR9L 5CILL 4D9LL 5C9JB 3HC2A 3H9SE 1H3UA 3S42A 1IAIH 3DGCR 1IC4H 2O30A 4LQFL 1N0XL 3T71A 4R90L 4F0HA 1A5OC 5K9DA 4IPIA 3Q1SH 3X14A 4R5XA 1NWSA 2P5WD 2ZOKA 3RNKB 3OGRA 2G37A 5TTRA 4NQSA 3QIWA 1P7TB 4UTBL 2DKSA 1NBZA 1I7TA 1QSEA 4BM7A 1JJKA 4N6FA 1T0OA 4M5SA 1E5UI 1JXKA 3OKLB 4S1SH 4KY1L 3C56A 4NSKB 4F8NA 3TAKA 1EXPA 3QUYD 2EDWA 4K94C 4YSEA 3S98A 1CYWA 2WZPD 4KRPC 8RUCA 1WFUA 1B3XA 2AFNA 4J3OH 2ZWZA 4GG6A 2WQAA 4H26B 3VXOB 4ZDHA 5DMKB 3FT2A 1K9FA 3D25B 2PBOA 3PPCA 4KBPA 2WXHA 4V27A 3WJSA 4JOMA 2OMXB 1MO0A 4TVCA 5GS1A 4CC4C 3SZKC 2EPMX 1OB1B 1F00I 2DU2A 3Q13A 1MEXH 4S1DC 5GHWL 1EGJH 4F58L 1UD4A 3AG2B 2ODHA 1ZHKB 3WJLC 4YN3A 1AIFA 1C3FA 1WKDA 3REQA 4KKAD 4C6MA 4U6YB 1C9SA 3FFCD 2VXSH 4EVZA 3BLBA 4I5RA 4WDIA 3TJHC 3PQYD 3MV7B 2WHKA 5EU6A 4FN0A 1FC2D 4S2BA 4X4XA 2HJKB 4AZ7A 4GI8A 4PRAB 3RFZC 4PRIB 4C54A 1DL7H 2Y36H 4M62H 4IUGA 1TOXA 2YSSA 1CFNB 5IBUB 3PGCA 4C91A 5I1HH 3BURA 2F7IA 3HV9A 1OG0A 2AEPH 3VH8G 3QUMH 4V1DB 4AQ8C 3V0HA 4W6XB 3A24A 5CPTA 5AYZA 4B3EA 3Q6GH 5EUKA 1P5VA 2IWEA 4HIQA 4Z7VE 5D7IE 1D9KC 1IGSA 5F3BB 2YRBA 2R14A 3PV6A 4F2EA 1BAFH 4R4NC 1OARL 4ONGH 3TCLA 1OF0A 3VQ1C 4RK8A 3T55A 2MQ0A 2OCCB 2FJFB 5IFHH 2NYKA 2POTA 2Y9RT 4HHGA 3U79A 3ZKXC 4JW3A 4K15A 3NWRA 2A4AA 1CBVL 1V6VA 4YIQA 1IEAB 1JPTL 3DKLA 3CFEB 1N67A 2C18A 3MZNA 1XX9C 5I3IA 4Q6KA 1C08B 1E0UA 4EN2A 1RSFA 5G5DB 2TODA 5I1GL 3I6TA 3OTTA 4ZZ9A 1GZPA 4NIKB 3PB2A 5E4AA 1FDYA 2Z4QB 1FRBA 5JBDA 2F54B 3GD6A 2CJ3A 4WI4A 3IRDA 1E5AA 3KE0A 4XO8A 4DBEA 1NWTA 3I68A 3EJPA 1X96A 4EMZA 4PU2A 3QNYB 3UTSD 2E4FA 1JPMA 5F8QC 4JFEA 3LNEA 1QFWL 2FJGA 4OCSL 3CB3A 1G6RB 3CN2A 4ZPVA 3DFSA 1S3TC 2O1AA 3QAZC 4EF9A 12E8L 3NCOA 3PCYA 3M46A 1DLHA 3G6JA 4GISA 3CK0H 4U1JA 1YEEH 1IARB 2Q09A 4MYAA 4KQ0A 4BCZA 2KDYA 4FQXB 3HG5A 4Y2DC 2J1XA 1B2YA 3KPPB 4DJED 4IRSA 1U91B 4GUHA 4IGNA 2BVOB 4NRXA 1S7VA 5D72H 1J10A 3QAQA 3HAEA 2OMTB 4FFZL 4BSVA 1MREH 1H51A 2OT1A 2VMFA 5K9QG 4G8GB 4JDEB 5BXFB 4X5QA 1MUWA 3D0CA 3FFOA 3GPEA 5DFTA 6TAAA 3F5WA 4MCZA 4HULB 2Q7YA 1H3PH 4I88A 3M47A 1YE4A 3MMEB 3L3HB 4N6RA 3BLPX 1K7FA 3L3KB 3AS3A 3ZHFA 1TEYA 1J8HD 2J1KA 3J2PA 4IBUA 5IB1A 3Q06A 4PTVA 1ZLDA 1BA9A 3HZMA 5D9SA 4YFDB 5D2NB 3GB7B 2MKWA 1UR9A 2PDXA 4H1LG 3HHSB 2GQ9A 3E02A 1MRCL 4P9HL 5JHMA 4MNGB 3IDJB 2DBLH 3TA6A 3TEXA 2CDGA 3RRQA 1BG1A 2WMHA 3NQ8A 4UBDD 3IRZA 1PSCA 3II1A 1K8DB 1X9RA 2F19L 1W5QA 2L4OA 4ODTL 3GAYA 5I24A 1BQLL 1G9NH 4MAYC 3GB6A 3ZT6A 3ZT7A 4EPEC 5LBSA 4XSLA 4LLWA 1YPXA 3BZJA 4N2GA 2PPFA 1V93A 1NOLA 2VEGA 2F74A 3OZOA 3K80A 2DDQL 2A5HA 2P3EA 1ACYH 1ADOA 2KH2B 1T5AA 1A65A 2TMDA 2J7HA 2OTUB 4QCEA 5I19H 1LD9A 1NC4B 2VZOA 3T8XA 3AU1B 4K8RC 1EB3A 4ZX3A 4DZ8A 4CMMA 2WZHA 4HMEA 3HG1E 1G4MA 1PZDA 4HIIA 1EAPA 3CHVA 4IFOA 4G6CA 2O5YL 3WLBB 5IB4B 3KXFB 1I4NA 2X9XA 1T04B 2A3BA 3HMCA 4B15A 4EJ1C 3BKYH 1HEZB 3D48R 4GY4A 5DTFA 3B2PA 5CEZE 1OX4B 4UI2A 4BF7A 4Q4EA 2KUTA 2CJSA 1X5HA 5ITBL 2OMVA 3P0YL 2W60A 4BWLA 2O7SA 3CFDA 1ZENA 3E49A 2XHNA 2KYIA 3RX9A 4BCXA 1V8HA 1HHJA 2Z00A 5JTWA 1YYAA 4RGNE 1UBPC 2F38A 4Y1TA 2EKGA 1IGCH 1RPUA 1CTNA 4BH7B 4FTVD 1HL4A 1EA9C 4NN6B 5KVDL 3KS6A 1X1ZA 4P23A 1TJIH 2YPKB 2WYHA 1FIGH 1SDDB 4IJ3B 4ZAKC 1GOXA 4L5FE 4DWSB 5EOTA 2RUSA 1J05B 4YHGA 3CFJB 3MC5A 1UM6L 4JPGA 2YLHA 3J8F7 4YX2H 1R2SA 4DUWA 4L3EA 4R4BB 4ZXOA 5AZEL 3S5SA 1B88A 2Y72A 3AIUA 1PG7H 3UZXA 1OGGA 2GBTA 1T0NA 4JM2F 3QO1A 4XCYB 3NSYA 5EU4B 4Q8TA 4YL9A 5DO8A 2WLYA 4UTHA 1H1YA 5KYWA 4I8YA 3IS4A 3TFCA 3WKML 1N19A 2CBOA 2V3DA 4G43A 4EUPG 4F3FA 3C8KB 4IKJA 4J27A 3FBKA 1IMHC 3FT4B 4HS3B 1S7WB 4GAYB 1WWCA 2Y7LA 1RIVH 3H3PH 1U33A 2W9EL 3BXWA 3N50A 4U10A 4K4KA 3GC4A 2HP4A 4L4TD 3NZPA 2XC8A 4P3CL 5F1UA 2XQBH 5HJ3A 2Y8KA 5TBOA 2P4AB 2G2RA 3NPWA 3UGXA 4JUSA 3OBKA 3GC5A 2CKSA 3RX3A 2VDQH 5I03A 2J20A 3APNA 4DT2A 2ICWA 1X8CA 4LX4A 2GJXB 5KINA 1XIGA 1ETB1 1Q6CA 3D47A 2NUXA 1HE7A 1H7PA 2X40A 2YDQA 4IRZH 4Q8QA 4E5XG 4WZHA 4RAHA 1SBSL 3NA9L 1C90A 3FCSB 4N0YH 3ONBA 3O3BB 4OD3L 7PAZA 3DENA 1MLBB 2HFFB 4JG0L 3EXJA 2A21A 3F7YA 1K72A 4K8RL 2A77H 5BRZA 1S9WA 4GYPA 2P5WE 2AKZA 1QEWA 2EVJA 3GR4A 5I6NA 1NMCC 3H4FA 4KZCA 3HN5A 1E9PB 1Y5XA 4OFKA 3BT0A 1P1VA 6PTDA 2GDUA 3DIVA 2FT6A 4MQXD 4LE8A 2YXWA 1ELSA 1M71B 4NT6A 5CZRA 3MRDB 2OODA 2ZUXA 1XLFA 1TZGL 2ZUSA 2QIIA 4CA4A 1EMTH 2WPGA 1A6PA 3T0BA 3SBWC 1G43A 1G4PA 2QJIA 1NSNL 4WJ5A 1TJ2A 4IDJH 1JF1B 4OIIL 2ZVRA 1J1PH 4K8GA 3RIAF 2XIOA 1U58A 1LNUA 2CK0H 1SGJA 3KR3H 4U3XA 1IEBA 5BJTB 4LPUA 3VGAB 5FESA 3OB0H 4AGLA 3MR9B 2OMBA 4R2GD 2I26N 3NTCL 1RIUH 4P2OA 1KV8A 4WKZA 1I8LA 3NQVA 3E5BA 1H7RA 4IOIA 4DI8A 5DC4B 3N1MC 2EAEA 2VR7A 1D5ZB 5F7HA 1CE6A 2K8QA 2OX4A 1HIZA 1EZSA 5E94A 3DOSA 4QYOA 4XNUH 5C54A 3TFKD 4OGYH 4TYUA 1GYNA 1YXCA 2WINB 2NQJA 2GSHA 1QT1A 2DJMA 3GYEA 5BOJA 4OFVA 1IV8A 5K9JL 3VNZA 2CNCA 4D6DA 3HE6C 3RPTA 4UXDA 3N1PC 1ICTA 3TR2A 3U46B 5E2TL 4WY7H 3ZBMA 2ZNWA 2WMIA 5CEZH 4PB0L 2D2GA 1XLAA 2Q3OA 4D71A 4YNYA 4JPWH 3BJFA 2MCMA 2FT8A 1LWJA 4OZHA 1VZGA 3IJYA 5LN4A 3W6MA 3TGXA 3CIQA 1HXKA 1G94A 2E09A 4PRID 1YMYA 1TKWB 4I3RL 4AVKA 1Q90A 5HVFB 5C2BH 5T3ZL 3M16A 3HS9A 5JUEL 1DLFH 1A4MA 1PTDA 4L5FH 4AYEC 1KTDB 2XGBA 4N2YA 4V1DD 5JUVA 3AWEA 4LVOC 1N8WA 4OZIF 2R2HB 1CIUA 4MB3A 5HYFA 1DCLA 3RHWK 3KYMA 1ZT7B 2EABA 2H6PA 3TJEL 4HOZA 4DHLA 4TKWA 5EZOH 4Y2OB 3O2WL 4YXKL 4AVJA 1HJBC 5DBTA 4M80A 1PDKB 2PPGA 2F18A 4RNHA 3UJEA 4ZFCA 3VYOA 4X9HA 5CLTA 3SCMB 3EGSB 2Y1VA 5EOCH 2DLEA 5SWQB 4Y16B 3LS4L 1GOQA 4N8CL 1A7PL 1RZPA 4H7CA 3NP3A 1A3QA 2AV7B 2F53A 2BNUA 5EZLB 2APTA 4KK6C 3IMRA 5JLZB 2G3MA 2FWUA 3MT1A 3OAWA 5CHNA 3TT1H 3ARSA 5DHEA 3LA4A 3AT8A 2P3YA 2GGEA 4F20A 2XISA 5FL1A 5E9DD 4G6AC 1HILA 1JPEA 2OL3L 1TO3A 4YFLF 4O4YH 3ITTA 5DRNB 1OTSD 5DF0A 4BIKA 3W7GA 2DPKA 2CWRA 4P4RB 2A9NH 1K7EA 3PFUA 2Y69B 2GYSA 5DMIH 4H9VA 2F54D 3G5XA 3FDWA 2BCKB 1XRFA 2R23A 4F33B 2Y06H 4X22A 4XHJD 2HZHA 4X4KA 3E0IA 3HVNA 3QH3A 4IJTA 5U7SA 5I1EL 2ESVA 3DJ9A 3DX7B 3FNDA 4ATWA 1MIML 4N85A 3OLEA 1FFOB 3PWIA 4JNZA 3EAKA 4A7SA 5I71B 1WZLA 1VZIA 4ZS7H 3X12A 5JIDA 2VFGA 3P93A 4MJ4A 4XD6A 4J40A 4FQXD 2KQMA 2BRRL 4NC2B 5EU3A 3JU2A 5B22A 4ODVH 5DURB 1UR4A 1KPUA 5HHQB 1R3LA 4NO2B 4Y4HB 3VWJA 1JZDC 4LLDA 3LTSA 1JQXA 1J8HE 1RUAL 2PRHA 4J3TA 4GRLD 1OPGL 2FZ8A 1UUQA 2ISFA 4AK2A 1RZKC 5GGQH 3F7LA 4RSYA 4DKEH 3S36X 2J8UB 4JKPL 1AGEB 4IOSA 5FUZH 4Y6GA 2XBZA 4HD9A 1KENL 1LOSA 3BZGA 3TN0A 3ZUNC 1JNLL 5I1IH 5B1JA 1S7XA 1KV5A 4L4JA 1DANT 3CMGA 2ARJA 2F1AA 2Z1SA 4Z0SA 4TVSa 1EOMA 4WGKA 4HW6A 3AREA 4IH3A 4ABVA 1TWDA 4FERA 2YD7A 1KOAA 4UILH 1F8MA 4KHXL 4AX3A 4AWUA 1UACH 3WHXA 1TZIA 2A74C 3GG8A 5IQNA 3G3DA 5CZXC 3BOLA 3DIPA 1R3HA 2REQA 2VDLL 4MZRA 2HT2C 2B77A 3GSQB 5B1BB 1QPNA 1BYNA 3ZHDA 2IQAA 1NANI 4DHGA 1MELA 3K4AA 4J3OF 2XSKA 1UWIA 4MXQD 4JPVL 3ZR6A 1INEH 2J9ZA 1CO1A 2NSXA 2YYUA 3LY0A 2FVMA 3CUHA 1E8ZA 2OP4H 5EO1A 4YDIH 5F2FA 1X7IA 1C5DA 1G0XA 4HU8A 4PRPB 1SEBA 5TAOA 1P7QB 4KRPB 4H2HA 4QLJA 3GUFA 3H6AA 3RIKA 3U1QA 3ZLHA 1D7BA 1CJYA 1P1ZB 4PGCB 1ICPA 1BZEA 3SZ8A 1KJVB 3X3FL 4XNBA 3DO7A 1OAZL 1N6QL 4KZDL 3PF3A 4K3DL 1E27A 4U2ZA 3KWVA 1SFSA 3U4EA 4M56A 1UP0A 2NT1A 3FL7A 1KCSH 1P6WA 3BJ91 5CZVL 1YNLH 3V5DB 1F6LL 3T05A 1OEPA 4JPIA 2GPTA 3OSKA 3STLB 4F9JA 3KXFD 4LK4A 1KRCC 5F9WC 1QACA 2PDPA 2PDQA 4UU9B 3V2AR 2D7TL 1W5MA 3D39D 3H22A 4NKQB 3SW6A 1XL6A 3QNZB 4GZJA 1TPVA 2YLLA 4O53A 3O63A 1KBKA 1TZOA 2WO3B 5DRZB 1DEEB 5DU7A 3TN4A 2XI9A 4L8CB 2MCG1 2AMGA 3U9WA 2AAAA 2BY0A 4FHKA 4UWQB 4KPHH 3VNLA 3VNIA 4YS4A 4PMZA 1FWIC 1MHEB 4B53A 4AENB 1W3HA 3B9VA 1HKLH 3Q5YA 3FRPB 4KNTA 4OV5A 4MM1A 3DX6B 1NIUA 1YEDA 5M95B 4DWSD 5AENA 3O2DA 1UBSA 2NZIA 5F96H 1FNSL 4LHUD 2XFGB 4O8AA 4WJ8A 3CFCH 4ENLA 4B5ZA 1EGVA 4K3GA 3S3PA 3ELQA 1FWFC 1VGKB 4XPTH 1RZKL 3TC7A 1N5YH 4AM0B 4M6OH 4K3ZA 1C7SA 2VXUL 3APGA 4JAMB 1KCBA 5F97E 2CITA 4K2UH 1Z69A 5AYTA 3C8FA 3H4HA 2QKFA 1W1B1 1HIML 5IQ7H 1ZSHA 4FA6A 4Z08A 1IEWA 3ZJ6A 4EIZC 4L1WA 3WLHA 1F61A 2V4LA 3EDDA 2P7TB 4LB8A 4HUWB 3L9EA 4GJTB 3OP2A 3W1XA 5CO1A 4G7EA 2NQ5A 1JV2A 2FB3A 4O2CB 3LHPH 3CIAA 1OGBA 5JU6A 3ZKXB 2VDNH 1P6FA 3UJRA 1S7SB 5E8OB 5LGYA 3FCUB 2OSLA 3RVTC 3UJJL 4PI0A 3GIQA 1M2OA 1BHGA 4RMQA 2OMUB 1B4RA 4HJFA 1YEGL 3ETBF 3JVGC 4G6ML 3HN3A 1JZJA 1T89A 4ELMF 2XIJA 2YQ3A 3QDGA 1V3MA 2H26A 3EWBX 4CQ8A 5J06A 1FCBA 1GYUA 1QLRB 1SXNA 4NYLB 4K9EC 4YCPA 1XAUA 3DUGA 5EDSA 3PXLA 2B2XL 4PIRF 2BDNH 2VDKH 3ZS4A 3FB7A 3TIEA 5CKSA 1G9HA 4QRAA 4BK9A 3KS0J 2OKTA 4Y8FA 3HI1B 4RNJA 2EICA 1SVZA 3QAZB 2WXPA 1TX0A 3H2AA 2VAAB 3D18B 2EO9A 2IPGA 2VXQH 3FB8A 4TNGA 1KGCD 1SXAA 3OHXA 3QFJE 3AZTA 2WSPA 5FGCB 2EO7A 4Z77A 5K59E 2X2IA 1JF6A 4L4MA 4J39A 2YXOA 1GVRA 1R5IB 4DVBA 1JCNA 3T5WA 5A8PA 4HA0A 1NM9A 5IKCA 1BQSA 2CDEB 2DLFL 4MXWH 3MBWB 4ECLA 1RJCA 3FYIB 1FHLA 1A7OH 4AZBA 1ETJA 3AQYA 3HN8A 1RBAA 4OJFL 2FX9H 3C61A 5LNVA 2UWEB 5HYSA 1VBHA 3O8XA 2D7NA 3MXVH 2FB2A 3UADA 3K6IA 2DQHH 2RALA 5ILTL 5I3GA 4ZE5A 1MF2H 4A6YA 4ZMLA 5FSEC 4HX1A 4X63A 1U6AL 3GJFH 1J8KA 4AQLA 4LCUA 4JQAA 5FEBA 1R5VB 2WC7A 3VXSD 1SDYA 2R69A 2OPJA 1TTCA 3TO2A 4HK0B 1INDH 3H12A 3BP4B 4M6QA 4JY6B 4ZRGA 2MANA 4Z95L 1IKFL 4YGVB 4J9JA 5FYLD 4RZBA 4PRIE 5KN5B 2Z93A 3GZQA 2LFEA 2YAMA 1BBDL 4PY8I 1W0YT 3HBQA 1R24B 1IAKA 3ML9A 1XIJA 1D3CA 4QCFA 1ONRA 4NU7A 4OF8A 3P0XA 5C55A 2ADGA 3A5FA 5CD3A 4US6A 3FN9A 4HYWA 1JDAA 4HNNA 3BEVA 1R3IH 2GTQA 1RK7A 4PJDA 4UT7L 2JI1A 3T3ME 4IKLA 5D37A 1QRQA 3CU1A 4LHUG 4QJ5B 2WMKA 1M7DB 5HHXL 5D7IF 1QO5A 3V4VA 3OG4B 2P48B 1IEHA 3RQ3A 1RJQA 2J7GA 3HHMA 4OGAC 5EFIA 5I28A 1IR2A 2I69A 2XRAH 1N8ZA 2OFQA 2D7PA 4HHAB 2HYMA 4Y9MA 1Y18B 1CX9A 4E5TA 1MHHA 3MRPA 4XIMA 4JZOB 4J2MA 3LZ5A 4UQ2B 4MAUH 4JDZB 1PD0A 1P7HL 1D7KA 4PJAA 3SSJA 5DRXB 2X70A 4BFIB 4FOJA 1WWBX 2KS0A 3L3DB 1XDMA 4WEBH 3TEYA 2CKNA 3QR2A 2W79A 3KAAA 1F3WA 2LU7A 5E9DE 2R0LH 2PYED 5I1DB 5CSSA 4XCFH 3DX5A 4OZ4B 4PJEB 3B9OA 2D3VA 1S2TA 5LO7A 4Z7WA 4ZAKB 2EXYC 3SCMD 1VRSA 2Y7DA 2P24A 4PGDA 4F2BA 1RJLB 3GDLA 5HMEA 4YHIA 5E8PB 1YEFL 4QEHA 2EIKB 1WVZA 4PS7A 5MEQA 3OVQA 4AB4A 4KVCH 3G7TA 1F4YH 3UMNA 1VFFA 5AOIA 1N5AA 1G6RL 3LLXA 4JX5A 2WB7A 5A3ID 3N42F 4K23L 1V3IA 1ICSA 3WIAA 3INPA 1KJ3L 1WAAE 1R3WA 5E6ID 1IAOA 3WY4A 1CK0H 4FOMA 3VA6A 4HEMA 3LMZA 3KDMB 1DJWA 2P5PA 4RZ4A 3G04B 1YUKB 5T1LA 4JG9A 5IROC 1S6NA 3WIFB 5DCEA 5A3HA 2ZRUA 1UGKA 2R29H 3FFSA 3L4TA 1W3TA 3TE9A 3D34A 5HHMD 5C6PB 3JVAA 5AWNH 3MLUH 1PYMA 1TCDA 2HVMA 4E68A 1C16B 5JDJA 3OVGA 1OP5H 4Q0XH 4IOTA 3AHZA 3F2LA 3ML8A 4V2CB 1BLNA 3KRSA 3TW6A 3QI9C 3MKVA 3ZE1B 1I1FA 3WTYA 1EFXB 1N59B 5DURD 1UWQA 4Y4HD 1YX1A 4LIQH 4AF0A 4PHZA 3WFZA 5GJMA 4F9LC 2DI8A 4GUOA 3O2LA 3MLZL 2QPUA 5GS0H 5TE6H 3GUTB 1YYLH 2E1DA 5F89B 3WBYA 3FN0L 4IPNB 2H32B 3N85L 3CH1B 4GUGA 4PM1A 4HJGA 2CBQA 2VR4A 3FT3A 1TX2A 3DHUA 4MQSB 2P46B 3LTVA 4EOWL 2PP3A 4OV9A 4MNGE 1NMCB 2B1HL 1KKOA 1MW3A 3QS3A 4YLBA 2PE4A 4UZSA 1WF5A 4KS0A 1AZCA 4NDMA 3KBSA 2ZCKH 4PUNA 2V9RA 3H0TB 2CZFA 1M6OA 2IV9A 2JKLA 4FIRA 1AGBA 3I7SA 1IKNA 3P4NB 1ETZA 2G4EA 1AP2B 4I5BA 2V69A 5D8JL 2HTMA 3UYRL 2ITEA 4ANVA 1SN5A 4I87A 4Z5RA 4F37F 4DZIA 4XPAH 3BH4A 3ZZLA 2Z1WA 4GUJA 1IXPA 4AFYA 4BRVA 5JOFA 2V6AA 4I18A 1BEYL 4C7DA 1S9XB 3WQ4A 1BREA 1J8VA 3CO8A 3VIJA 1R34A 3BUBA 3LIZL 3NNTA 4FALA 5FF4A 5AW4B 2AMXA 3VI4F 2W95A 2SODB 6A3HA 1P7QD 3D39E 4GKZB 2X7VA 3OGCB 1ZVNA 3M0KA 3SSGA 4D2JA 3MRQA 5AOJA 4M4RB 4XB8A 1CICD 2WJDA 3P73B 5EOQL 3VGAC 2XZQL 4HQQL 1XT5A 5FGBC 3SDYL 4CSTA 1C8VA 3MJGX 2DQ6A 3R19A 2IPTH 5J11B 3NRQA 1XGEA 3HI5H 1YQ2A 1MH5B 4ICMA 2I7OA 3SCVA 3HE6B 3W84A 5AZUA 2LTQB 3WMLA 3L9BA 2VNCA 3ZRFC 2HXAA 2VW4A 3NIDB 4TOQA 3W1QA 3QZBA 3B04A 4OVXA 1XGUA 1IL1A 3TYEA 1JRHL 1SXCA 2JKSA 2H90A 1QNRA 4UDTA 2V5KA 1ZD6A 1MJJB 4C56D 4H6KA 3RFAA 1LE5A 1JWSA 1RURH 3C5ZD 1T40A 2UXTA 1OT2A 4WW1A 5CJQH 2IAMC 3BAEH 2YCKX 1TITA 5C7HA 2FT7A 4URIA 5JHDE 1H50A 5H37H 2GTWA 4Y1AB 2WWMC 4HIBA 3KPQB 4FI8A 3FQWA 1KNWA 3BZDA 3HOGA 3MLXH 4LVOB 3B7YA 1A6AA 4N4YB 5CBIA 1XRSA 1R5WA 1RPKA 3JZ7A 4E42B 1D9KD 1PKQA 3BJSA 5HHNA 5DJ6A 1BYCA 1ZS8A 7TIMA 2R82A 3QMTA 2BP0A 1UCWA 1DPMA 3W7KA 1FNEA 2G95A 3FU8A 3UCRA 4XWGL 1OJXA 1NBVH 5C7XH 1FORH 1RI8A 1ILSA 3DKHA 3FT1A 1FA4A 2VUOA 5FOBA 2PTTA 2EIJB 4QR7A 2PRLA 4TF4A 3NPZB 4E2VA 2ZXWB 3M41A 3N9GH 4LUTA 3G8RA 2V33A 2YYTA 5LNWA 3TEZA 4OJDH 4XV0A 1WTGT 2DI7A 3MJ7B 1CI3M 4N2EA 5D1ZD 3FGCA 3LRGA 4CMHC 1ICQA 5F7EL 4QRQB 4M3HA 1A9EB 1E4XH 2C9VA 3BMVA 1FBIH 3BDXA 3G1HA 2W38A 4HIJB 3A6BL 5GRWA 4C1LA 4PMEA 8FABA 4MMXC 1AXTL 4PJ9A 1KGCE 3FTYA 4H19A 4N6EA 5HY9A 4LEXH 2WZEA 2HPIA 4PR5B 3F58H 4HJJH 1CW2A 4AK1A 4DN3H 4NBYB 3WO8A 3I3EA 1CFBA 3FT0A 1I1RA 2AZAA 4U1MB 3U4FA 4QLLA 1KW1A 5LLIC 4KESA 2FZ9A 1VPOL 4FXGA 2GJ6E 1OWWA 2AK4D 1ZEAH 4F3HA 1UH4A 3MRLA 4R84A 4Y2DD 3BVTA 4KNSA 3AQDA 2K7PA 4ZB0A 3FH8A 1MQKH 3MTWA 2EIEA 3Q8CA 4ALAH 1C12B 2R51A 2VJXA 1WV7T 5CWSB 4XXWA 1Q6LA 4R26H 5AN7A 4FYTA 4HKBA 2XZAH 3GXFA 3SDDD 1L9RA 1FWGC 4PVNA 2X4PA 3VXSE 1I4FA 5IG7A 2WV3A 1TNMA 5FYLL 4HJSA 1UT1A 4L5ZA 1A9BB 1EANA 1JGVL 4NZ1A 5DVMA 4H0GA 2VC2B 2ZXQA 1N70A 1MHCA 3QXAA 2D23A 3H7RA 4PJ7F 5LXXA 4YBHA 3MVIA 2J73A 4N9GA 1QOQA 5IIEA 5GIRB 2TSYA 3KMDA 3GYCA 2A74B 3QW4B 5A2CA 2WXKA 2PBGA 4R5VA 2YKLH 5DGQA 4KI5C 1MCKA 4PVMA 3DEQA 1PYWB 1RA0A 1GVOA 3HLAB 3BYTA 1Y1UA 1FP8A 3KHOA 5LHDA 2DW5A 3MGOB 4GEIA 3OWRA 4OB5H 3SE3C 2Y89A 2IFFL 1WCBB 1FFPA 4CBZA 3AU0A 4Z23A 4K73A 3N9KA 1N0LB 3O0KA 2FUTA 3FFDB 2BVQA 1YNTB 4DJFA 4D6IA 1GZHC 4QEGA 1YJDC 5TE4L 4MAYD 4P49A 3VFOA 4L56A 2A7PA 3PAYA 2W59A 2X16A 1PPIA 5LNDA 1R75A 1NDYA 3JV6A 4TUOA 2A3LA 1UGNA 3UG8A 1QNVA 3CM4A 4ADSA 3FRPG 3TPUA 4AZ5A 1DIEA 3ATEA 4E8DA 4K8RD 2ITFA 5L6UA 2BX5A 1MAJA 2XSAA 3MHFA 2Y5TA 5I66A 3LH2H 3L6FB 1JUFB 4JO1H 1Z9PA 5T33H 3V4PH 5DMMA 4OIAA 5DS8A 1JPGA 2B1AH 2J7BA 4HEPA 3UBGA 5F9WB 2PYEE 4NERA 3BHBB 5J1AB 1GVSA 4QLRA 4B9GA 3RPBA 4J28A 5DFVC 2AGJL 1GK8A 4F8TA 1OF8A 2QHLA 4XRCB 1QA9A 2GVLA 3BD5A 3RF9A 1JZ6A 1MQRA 1SOQA 3O6AA 1U41A 5JDSA 2PDBA 4JDBA 1TV8A 4JFFD 1KTBA 5FOOA 4LP4A 4TXEA 4UMSA 4LU5L 3RO8A 3IGLA 4GC4A 4ZAKD 3O11B 5TDNA 3A47A 3QN3A 4GP4B 4LESA 3WS3B 2CIPA 3NZ8B 4KRMB 3VRIA 4FEIA 2D73A 1LO4H 2YQBA 3CHQA 2VW6A 5HHME 2DAVA 3ARFB 4I1RA 3CAQA 3TU9A 1G5AA 3JYBA 1M3JA 4OZFH 3EJZC 4U1HA 1T7LA 2J6XA 5C0CA 4QROA 2QVIA 1I7UA 5E5UB 1K4GA 4XAGA 4UDUB 2XN2A 2QFPA 1OP3K 3OKYA 2J43A 4A7TA 5KETA 4XP6H 2HN7B 1TJGH 3CNYA 3QRHA 4QBXA 3IV8A 1P0KA 3W74A 4RXGA 3W23A 3PTDA 2P26A 3VKJA 2VDPB 4O4WA 2E56A 5AOUA 1ECEA 3CU7A 1KYFA 1CDYA 3D5HA 2APSA 4MDJB 3P77A 4O9HL 1UWGH 4Z3GA 1K4CA 4IS6A 1X44A 5LCVA 1QOPA 5HNTA 3QXBA 1I7RB 2F6AA 4YU1A 1MFBL 3LN5A 1FWAC 2J8UE 3WNOA 1D8WA 4WEVX 4GBXA 4MAVA 3E38A 4POYA 1ZQ5A 3PS6A 4YO0B 5FJRA 1KYUA 3MLTB 5FO8B 1BV8A 5T3ZD 5DJXB 3U1SL 3B8IA 3VD9A 1EFXD 5DHXB 2DZXA 3NSDA 3SN0A 1MCDA 5E23A 1SSGA 3TQKA 3CXOA 4UTIA 1XCTB 3F7QA 3L1OH 2R0ZL 4X4YB 3C86A 3U0TA 1L5GA 1I2PA 2H4EA 3QGAC 3OR7B 4XZUB 1J01A 3KCLA 4X80H 1H60A 4KOCA 4H9ZA 4X8CA 4QHKI 5HD8C 1U8NB 1JPSL 3IFOB 3U3HA 3MUIA 2QEJA 4LRTA 1NDGB 4K94L 2P8LA 1I9EA 4OV6F 2PDCA 1UWTA 5AHNA 3SI9A 4MJ6B 1S46A 3O9WD 3ETBJ 2FQEA 5JOEA 3EOUA 4K3JL 3EFFA 4JCMA 1IM3A 2PWHA 4PFMA 5D7SL 4LOUC 3B0XA 1VLIA 3ULAB 2WPBA 4G8FB 1EUUA 3ZYZA 2OB3A 4BV1A 2QPEB 4DPRA 1XIWC 3TO4C 1VBUA 3G1DA 5D7JA 5A2JH 3KZ8A 3S88L 5KVFH 1P1MA 1O9VA 1HU8A 4PWKA 5LQBL 2Z25A 4N8VA 4GQ0A 4YHNA 1JDFA 3FS2A 2GBUA 1W8NA 4ZR8A 5T5NG 4H25B 1ID5I 5F3HB 4KEVA 3TROA 8XIAA 1HQRB 3L2MA 5B38G 3MAWA 1IQDB 4D8PB 1WOAA 3WBAA 1NGXA 3LHWA 1R30A 2DM7A 2R0WL 3MFGB 2I1OA 3KYOA 4PUBH 4WFGD 1CR9H 4IQHA 4D9LH 3G5VB 2OULB 3PIQA 3KPSA 2H1LM 5DVLA 3P74A 4XMUA 3D87B 5DJ8A 4LQFH 3EOTH 1N0XH 2E86A 4I2XB 3LI0A 3CUXA 3EAUA 3CMOH 2Z0BA 4IK7A 3RU6A 1UOLA 4FEZA 4QG8A 5LVEA 3GKFA 4GUCA 4XO4A 1XYMA 4PV8B 3MC0A 3IV3A 3ZTJG 2I9TA 2X0VA 2BK8A 4UTBH 4C56E 4GCAA 1KV7A 1XI3A 3DI0A 3SYCA 1T8QA 1ZBKA 5CJOL 3HE6D 2QCDA 1SXSA 3W29A 4W4OC 5I9QB 4XSMA 4KY1H 3ME0A 4FJ6A 1GGIH 4JQ3A 1XEUA 4HALA 1FGVL 4B9PA 1R9YA 1UP2A 4A6GA 4M7LH 4ILSA 4Q8PA 2Y62A 3BL3A 3BW9B 5L7XL 5E95B 4HKXB 3FDGA 2CRIA 4OF6A 4FQQB 5I26A 2DWYA 3UZQA 3LV3B 2EKCA 3GLEA 1TQBC 2VGFA 3SE4C 2D20A 4UFIA 5INDA 3DBPA 1S2UA 2FZMA 2E6DA 3TIDB 4WWKC 5F1OB 1I8KB 3MMTA 5B7MA 5I1LA 3KLHC 3V0DA 2Y1YA 3CCHB 4FAAB 4P2QD 1IFRA 3E3HA 4OAWB 3QYQA 2DV6A 5GHWH 3FF7A 4Y1AD 2FZBA 3CV7A 2G4GA 4UTWA 1NIAA 1PZ0A 3G9AB 3RMEA 2E7LC 2GJZA 5KS9F 3VXTA 2PO6B 3G77A 4YC2C 1B57A 3UPCA 4PP2A 4LHQB 4NG3A 3GXDA 4PJFF 4K07A 3PWJB 5F7AA 1HWGB 4YHPA 3B7TA 3GH7A 3BVNB 3T2OA 4NRZB 1YHPA 2WK2A 2LVCA 4N1EA 1A1OB 4XPGL 4LNRB 5JORB 2VGBA 4KZEL 4U1KA 1R0MA 3R0NA 2HPMA 2Z7ZA 3ZL4L 2DQCL 1DORA 4DNLA 3MNVB 4Y8DC 5CP7B 2A6KA 3ZZSA 4GH7B 2QYGA 4N26A 5BO1H 4GI4A 2EPKX 2QQQA 4ZFOA 3GSMA 3LEXB 1UM4L 1NAMA 3EYSL 2ITCB 3TF4A 3F12A 4AUUA 1XKYA 4W7UA 5F4XA 3L2LA 4KK6D 1E8WA 5G4MA 3STBA 5ES4B 5DQ9B 3QZPA 4C6EA 4HPOH 4OKVB 1E9ZB 4G6AD 1RMFL 1Y6KR 4AX6A 1TRDA 2WY3B 7A3HA 4WO4B 3VG0H 2P47B 5KVDE 2AK4E 4JNXA 3HIJA 1OARH 4G7YH 3VD1A 1WBXA 3CZNA 4BCEA 2ICES 3I50L 5FGCE 3KPRE 2EEAA 2OQJB 4J2XA 3TKFA 2A4EA 5JBEA 3BSHA 1HC1A 2N7SA 4NT0A 3PHQA 2Y5EA 5E99L 3CZEA 3WN5A 2FZDA 3RPIA 1E3FA 3V5HB 3W0WB 2JKEA 1ZOXA 1JPTH 2DLTA 3LZPA 3WEBA 5AC8A 1ML1A 3CFUA 3QI9B 3VKDA 1AMYA 4KRUA 1L9NA 2DIBA 3W5MA 1KCZA 1GTEA 2G3JA 3MYJB 3VWKC 2PW2B 5JPMA 2QGYA 1I1CA 3PJSB 2UBPC 4P7NA 4NCDA 1G9MH 1VADB 4U05A 3L3OB 3RL1B 3P2TA 3SPGA 1LMKA 4QITA 4N7QA 1KCUL 4AIZA 5C0BB 1TJXA 3B8YA 4Z8FL 4KJPC 3HKZA 3KBMA 1JYNA 3GSOA 4XUYA 4S38A 2XETA 4E41E 2FLRT 1H8OA 5GS1C 1QFWH 4OCSH 4NRYA 3V0EA 4FULA 4NZ5A 2VQTA 5FA5A 4PVLA 4CJ1A 12E8H 2BHUA 3U83A 1BIHA 4LEQA 3TTOA 3QPXH 5XINA 2X2YA 4ANWA 3IN2A 1AFVL 1X5IA 3SGJC 1OFBA 4FB7A 1HOCA 3LNIA 4NQCA 4DJMA 5CZXD 2HT2D 3ASNB 4X8GA 1T5WA 1X6LA 3C6LB 3BO8A 2IIJA 3HLKA 3WMSA 2EE9A 1FZKA 2NT0A 1RXOB 3L3JB 2Y5SA 1TR7A 3JS3A 5FYKD 4LOFA 5DQJB 3SB3A 3AWFA 1ZPLA 2AJVL 3T3MF 1A5SA 4YXHL 3SBRA 4LF2A 3CVHB 4UNUA 4NAQA 4NJHA 2AC0A 3FOKA 4Q6IA 3FCPA 4XN5A 5DJYA 1HYSC 1EHKB 5LAXB 1HYRC 4PY7A 4OSUH 1E4IA 4QTHA 2VMEA 2FCBA 5FIPA 3RX5A 4LEOB 2FIKA 4PLKC 1V8EA 5F71A 2QVNA 3EWXA 4H8WH 5JW5A 5CZTA 4APQA 2R4RL 4CD7A 5AG8A 4OECA 3BV4A 3EYUL 2R2BA 5AB0A 1MRCH 4JFFE 4P9HH 3TBVA 4A7VA 4K6AA 5G1MA 3M8OH 3HFTA 1KIQA 1XF4A 3UBFA 2QCFA 2BB0A 1FZJA 1CGWA 3EGJA 5L4FA 3W22A 2G5WA 1A2YA 2JEQA 4HUKB 1LEGB 5KOMC 2DL9A 5HDQL 3FFCE 5A16A 2WCGA 5B7FA 1AXSB 2HA1A 3F2BA 2L8AA 3B2UC 3PQYE 1NLBL 4MYPA 2DDQH 2ZX6A 3B9AA 2XXMB 3WUWB 1UXWA 1H3TA 2PI6A 1WCQA 3B37A 5J11C 1FN4B 4LV4A 4LH8A 2DQEL 2O61A 1E6OL 2WGXA 4M61B 1WA2X 3ERXA 2OZ4A 3RDTA 4PBDA 2LTQC 3UO1L 1WA0X 2BIPA 4W86A 6PAZA 1OCWL 3DO3A 3RPKA 1GW1A 2O5YH 4BJHA 3GHPA 1IBBA 2IAMB 1ED3A 4X6CE 1Y07A 5DZ9A 1S7QA 3MV7D 4WI6A 4GAJH 1CGUA 3C5XA 4ZODA 1OM3L 3ETTA 3C2AL 4YQXL 3SDXF 5DYOA 5FAJA 1YN7B 5ITBH 3PNUA 3P0YH 1FO0A 3BX7C 3DARA 2VN5A 4JDVA 4D0CB 5DELA 2IDCA 4V1XA 4MAZA 4KO5A 2PDLA 1QXLA 5D2YA 1CBJA 3S5OA 4GY7A 2FGLA 5GS2D 4MDRA 1JHKL 3WD2A 5C0AB 1DFBL 5T3ZE 5DHVB 3W39A 3CE1A 4NUWA 3X11B 5PCYA 4X2RA 4NO0A 5ISZA 3FOMB 5IVXB 1M1XB 1AZ2A 2MRYA 2WBJC 2JQAA 43C9B 1DBJL 1JGDA 3RVTD 1RP9A 1WDRA 3FYEB 3WEZA 1XR8A 5EOCJ 1JZ8A 1JR1A 4CMHB 2M83A 5ALCL 1MIEH 2GQ8A 1MCQA 5BO0D 3CDYA 4ZO6A 2QULA 4DY1A 5A7BA 1IJNA 4M51A 3WKMH 4MMXB 5A94A 2WLZA 2PFHA 5HYJB 3R7RA 2QNEA 3L1FA 3QOKA 4F9PC 1XCQB 1KG0A 2Y7EA 3UTSE 1O7AA 1IVLA 2DWDB 1GOHA 1F9CA 5DYFA 2W9EH 4RRPA 2FSEA 3TA4D 2NNXA 1KLUB 2A6IA 4PTMA 1C93A 3DX9A 4U5KA 4N5UA 3NIFF 3CAVA 3SKNA 4P3CH 2V2TA 5DD5H 2IH3B 4LSSL 1PNCA 4FLQA 1N64L 1JZ3A 2PDMA 1AZRA 4BFKA 4IEFB 3OX8A 3VE0B 1S5IH 2DWTA 1BXAA 5KAQG 5IB2B 5DEZA 3N44F 2AKMA 3TBCA 3C6SB 4ODUB 3LKOB 3FTZA 1BMWA 5HHVL 5ESQA 3WIHA 3BWSA 3NA9H 2UUDK 3L95A 2I7SA 2GHWB 2IPKA 4OD3H 3HBLA 4JG0H 4PJXE 4MNQA 4K71C 4J2PA 5F7YC 2NUTB 2X7WA 2VHLA 5AW0B 1HGYA 3IDNA 1MN4A 1P43A 2BP3A 3P5YA 1IBGL 3PFMA 2GSJA 1XGRA 4H6QA 1PB0A 4OGXH 1ZIAA 4KUZL 5JHLH 1BFOA 2UY3A 3CHEA 4BWLC 4HGKC 5IJVA 1JK8A 4G8GD 2GUBA 1ISVA 5DXWA 1RU9H 3QDMA 4RX0A 5IFJB 4PRBB 1K5NA 3WFBH 5IQ9A 2CLZA 3XIMA 3DV4A 4P23C 3B56A 4E9XA 3Q45A 4H1LH 3DGBA 4G5ZL 4LAMA 4QIRA 3K8LA 5EN2B 2VWSA 1WJ3A 4D6CA 4MZ2A 2Q8BL 3PPSA 4DPBX 3HC0B 4XPFL 3WTWA 4P2QE 4DF1A 1FYTA 3FLUA 1QI3A 3VXQA 2XIIA 1D7FA 2JLPA 2ATMA 3KBVA 1CZ8L 3U1PA 1BM7A 2ZZ5A 5HJLA 3VIIA 3QJQB 2Z35A 3K74B 3RNQA 1SPQA 3JTTA 1WE5A 3HUJB 4OCMC 1IAIM 3EYQC 4NL1A 3D4ZA 4S2SB 2YD8A 3BIBX 3PBGA 4OGAD 1JRCA 3IK4A 4LALA 4UIMA 1JCKA 2C13A 4RL3A 5IBUG 3STZB 2MPAL 5K9JH 4RDQG 4I0PA 3KEDA 1NC4D 2ZWNA 4UQDA 5FDWA 4TV3A 3K13A 5IVZA 3PXJA 3LPPA 5B80A 3RUGE 3QUZA 5E2TH 4ZUVA 3FA5A 1HK6A 1G84A 3UYPB 4FTVE 3UAFA 1CS6A 4XN2A 3M0YA 2WMPB 3CWOX 2FBJL 4GBDA 5CN3A 2L7JA 4I3RH 1EFQA 1YEYA 3OQRA 5IB3A 3VXMB 1L6XA 4S3BA 3KZSA 3UXAA 5CAHA 3F4DA 1HINL 3FHAA 4ZMWA 4PJBA 4JTAA 4PRWA 4UINH 3FTXA 3WELA 5G4HC 3BVJA 1QX1A 4IM4A 3MO4A 1L8NA 1JULA 4GYPC 5DVOA 1KFAH 2ZRWA 3KLQA 2VC5A 4XCCH 2PR4H 4OR1A 2I9LB 1DIOA 5IROD 1JGUL 3SPHA 2HV5A 4YXKH 4CN6A 2VL5A 4GUPA 5D1QA 3ARFC 4PTUA 1L7IL 5GJSH 1VD6A 5D5MF 1FFNA 3UZVA 3AM8C 3GKWL 5IHRA 4A55A 3BSZL 2QZRA 4PS4H 2PF8A 3VD7A 3AG3B 3K2GA 4L4TE 4L9ZA 3SZ6A 3TYFB 3LS4H 2Q5BA 3G6DH 4GKSA 4EUPH 2HJFA 5ETUA 5TH2A 1H15B 4HMCA 4A37A 1ADWA 1KIPB 5HI3C 3W76A 4W9CC 3TV3L 5EDXA 2VC2L 4AY1A 3N0PB 5DLLA 2D2OA 4X8JB 2ATKB 3MRNB 4QG6A 3QI9D 4FQCH 5C9KA 3T65B 5H94A 3CJJA 1JFQL 4C57C 4WF7A 2ICCA 4BELD 4K39A 1BAGA 4N0RA 4J6RL 3MBEA 2W0FA 1BQKA 2I32A 1JDCA 4H9YA 5FS5A 3HA1A 1NWRA 2VQ1A 2KLRA 2JIWA 3T09A 1ZFJA 1TZ8A 3ECQA 3DDFA 3C08L 1X5LA 4ZNCD 3HMXL 5EIIB 2FJKA 5FYKL 2WLMA 3C2OA 2AF2A 3P82A 2AQSA 2VCOA 4XCEB 1MIMH 4KKXA 3DVNB 2EADA 1MW2A 3CIVA 4I9MA 3QCUH 2OMYB 2JXMA 4LCWA 1WQVT 2IANB 4ZX5A 5FUOL 3N13A 2C3VA 2BRRH 1E9OA 4GJ1A 2F8QA 3ZMNA 3VI3B 4YN5A 4C6FA 1ONQB 5CIPB 4FFYL 4O2EA 2NNAA 1XIWB 3U36B 3H26A 3TO4B 2RDWA 4PRTA 3IJSB 3IF1B 5E0FA 2R1WB 3IKKA 4GYKA 3DURB 4JKPH 4QD2E 1S3HA 3EADA 3K2MC 4IG2A 1KENH 3QXWA 3LPWA 4XBKA 4PFHA 3BEWA 3RWIB 1QNPA 3B3IA 4P3DB 3PWNB 4YAQB 4RNRB 4ONOA 1AZVA 3GBEA 4WUUA 3PXHA 1FWSA 3SSZA 1TVBA 4R34A 2X4OA 1G9EA 4KHXH 4ZFGH 3PGDA 5HVWA 3C2VA 2YXVA 2E40A 4UC5A 3QFDA 2EHHA 1OZUA 1TJHL 4TTUA 2VT0A 4B5UA 3WLSA 2VDLH 1Y0LA 5J6HB 3KLAB 1IC5H 1DSFH 3KPNA 2HAZA 3IS1X 2ZOLA 4NKCA 4M6AA 1OXYA 2X1WL 5DD3H 3HG4A 3LKRB 1JPDX 3ES6B 5K4XA 4NBZB 1JHTA 3QEHA 3OZKA 5MENB 2DQUL 3TYCA 1K03A 2ZZ1A 4NOFA 4JFDA 4NWTH 4NN5C 1CGSH 4W84A 2F1BA 1RFDL 2Y2YA 1NAL1 5I79A 3BDKA 3MP4A 3BWWA 2YX0A 1QDSA 5JIMA 3F62A 1N55A 4AC4A 2NNRA 2AP2A 2HLAB 3RIAK 3MV7E 3ILPB 2ITDB 1SEQH 4ZBJA 3QZAA 4W70A 3DUHA 4NFBA 4Y1SA 1CC3A 2J5WA 3IGSA 1CLOL 2O5NA 4U7KA 3V0SA 4UTAA 3X3FH 4QF1A 1TQBB 6REQA 1N6QH 1EA0A 1T3FB 1NQ6A 4K3DH 5FCSH 5IVNA 2IXVA 4JLRA 1OGAA 5CZVH 1LUCB 3SGEH 2VDPL 2VXNA 4WWKB 1ORQB 5I9QC 2GB2A 5DEFB 4UTLA 2IAMD 1CLXA 1N8IA 2ADYA 2E6AA 1GUVA 3HPXA 1G7PA 2Q01A 3FZUD 4V1DE 3VNMA 4TSAL 2ZA2A 2QPSA 2WWMD 2IGFL 1DUYA 4X6FB 2BGQA 2FR4A 4NZTL 4R8WL 1DWGM 4YC2B 5T1JA 4N4QA 1EUTA 1EHNA 4N68A 5C09B 3SE9L 2X28A 4IOFC 4Z7VF 2OCJA 5FM4A 3O45A 3ZE0B 2FNWA 1BX2B 2W4XA 1Q7QA 3MJ9A 1IQ8A 3LMYA 3NYDA 4NRSA 2Y7GA 4DFIA 4BQ8A 2PB1A 4PLNC 4K9EL 4R7NA 4BWUA 1EDQA 4GP8B 4UQEA 5IHSA 3GBDA 2PO6C 3NFSL 1UH2A 1KXTB 1R38A 3PP3H 4G1MA 2EDTA 1JJUA 5IMOB 5KTLA 2XU2A 1Z9SA 1J9CT 1MWAH 5F7UA 2QR6A 3MJ6A 3HQOA 1HHHB 1PTZA 3OGVA 3QR0A 3WTSA 1X1NA 4L1HA 4O11A 1IGIL 4WHTB 3EX3A 3BKCL 2WNQA 1YMMA 3WL9B 2CCWA 2PWDA 4Y16D 4D1IA 4ZL1A 2XFXB 1W1YA 1Y5WA 2V68A 1OCJA 2F54E 1HIMH 2BVEA 5HYJD 4L64A 2YPLA 3O4LA 5SX4H 2OTWA 4UT6H 4JVUA 1NH6A 4PS8A 1CWYA 3SDAA 3QWQB 1SOXA 4Y5YA 1EZUA 2WXIA 1QHQA 2ZOKB 1DBBL 1GYWA 3CN3A 4WO4C 5HJBA 4NQSB 3CUPA 1QHZA 1E15A 5LIUX 4PTTA 2QGCA 1LWRA 2GK0A 2ISSA 1YEGH 2ZZ4A 4G6MH 4OBTA 3VWKB 5FACA 1WSST 1YEHH 3PL6C 4CC0A 2VI0A 4KFNA 2N01B 1RUQH 4GG6B 1D5BA 1QO2A 2XH2A 4ZDHB 2ZUQC 1E51A 3EWZA 3FT2B 1Q94B 4G8GE 5J6GA 4H4IA 1GEQA 1MCSA 4A3UA 5D4HA 3WU1A 1T0PB 1A8ZA 5KYYB 3CYJA 2HG0A 5GS1B 2XT1B 3HS0A 5JPNA 4U4IA 1P4BH 1YQVH 3L3OC 1OTUD 2VUKA 3S9DB 1B1YA 4KTDL 4QE5A 3JWDC 4RGOL 4K1GA 43CAB 3WJMA 1H9DA 4H40A 4DKAA 5D2NE 1WP6A 4QOKA 1AIFB 3CHPA 4FYRA 1E2ZA 2WANA 4PW9A 4E0CA 4KI5D 2O6CA 2J66A 4WDIB 2HG5B 2ZC1A 4OM1H 3WQGA 2ZT9C 2CETA 5EU6B 3EDJA 2C1IA 2E8YA 3MWCA 1AGCA 2OCZA 3HOJA 4JO2L 2XPZA 4E9SA 5EBLA 4WI7A 1KGYE 2V6HA 2DLFH 3ZT5A 1H8SA 1M7UA 3X13A 4XOCA 4WW2A 4UNKA 3AIBA 1HXMA 2BSTA 3EOOA 3PGCB 2EUVA 2UYLA 4UB0L 2F8XC 4TX9A 4GS7C 4HN8A 3L1GA 3WUWG 4OJFH 2P8PA 3HMJG 2H9GA 1C5BL 5AW6B 3H70A 4WJXA 4HSCX 4AMCA 3BG9A 3C6LC 5JW4N 3NQBA 4G1NA 1TV4A 4GINA 3B97A 4B7IA 1XDJA 4O00A 3APTA 1P5VB 3HURA 3SPCA 2APVA 2RGMA 3WLJA 2J27A 1ILUA 2ALDA 4O51A 5E51A 3KXFE 2CLKA 3KEHA 2P52A 3PV6B 3VGDA 2VEMA 4JM0A 4PRPD 4Z95H 2DWXA 2BSRA 3TCLB 4KRPD 1GVFA