4JL1A

Crystal structure of a bacterial fucosidase with a multivalent iminocyclitol inhibitor
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-L-fucosidase
publication title Exploring a Multivalent Approach to alpha-L-Fucosidase Inhibition
doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
total genus 163
structure length 439
sequence length 439
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jl1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jl1A01
1JZ6A 4HU8A 9CGTA 3MO4A 4AMCA 4LYPA 4AISA 5FD0A 2AAAA 4W7WA 4JFVA 1ZU8A 4HMEA 1OT1A 1UWRA 2WMJA 3ZSTA 1JDCA 4MDOA 4GKLA 4PTMA 4CU6A 4IISA 2YFNA 1E4LA 4WKAA 5A6MA 4HA4A 4HZ8A 3KL0A 3KLKA 4BQ5A 2CEQA 5HDRA 5I78A 1QPKA 2EADA 3CLWA 4WSKA 3QOMA 3PZMA 2GFTA 3BXWA 1W9VA 2FH8A 1JYVA 1BF2A 4AC1X 1CEOA 4KMQA 1BHGA 4MJ4A 1R8LA 4M29A 4PBGA 2EPMX 3A24A 6CGTA 4UOQA 2J7FA 3GNPA 4JKKA 3AXIA 4UCFA 4CD4A 3VDHA 1LF1A 2ZWYA 1KWKA 1EQPA 2VCBA 2WHKA 1ISXA 4HOZA 2D3LA 2GJXB 2ZIDA 3THDA 1JD7A 2WWCA 3CPUA 1XCXA 4ATDA 3W37A 4FK9A 4U5KA 4WJXA 1J0ZA 1BTCA 1X6NA 3D5HA 5E9AA 3ZJ7A 4TOQA 1ZJBA 2EABA 4MB5A 2E8ZA 5CGTA 4M82A 2W91A 3ZR5A 4W7UA 5E0FA 4NXSA 3T08A 3BVXA 3OLGA 3L2LA 3MSGA 2EAEA 3WDJA 2WHJA 1UD2A 5ABFB 5E1QA 3AROA 1XYZA 5LA2A 4UTFA 3D50A 1OB0A 3OLIA 4FNRA 1JZ2A 3ZT5A 1GVIA 1NWSA 1HJWA 4B16A 1NWUA 3HG5A 3WD0A 2ZXQA 4PMYA 4AMWA 4H7VA 3IK2A 1UWQA 4E8DA 1GOMA 1H11A 1QNRA 1DWGM 2VVSA 3BUBA 1HXKA 4UZSA 1EXPA 3PBGA 3TTOA 4UFLA 4KH2A 3SCPA 2GJXA 1QI3A 4CGTA 1ISYA 3VSVA 4FLOA 4ZFMA 3BVVA 2WMGA 1TMQA 2QMKA 3II1A 4IUGA 1LL4A 3BAWA 4TTUA 2YLAA 5HPOA 5BXPA 4JKMA 1E55A 3MKKA 3RMEA 4Q22A 1M03A 5I2UA 4F79A 1FHLA 5BYWA 4F66A 4J3UA 2WMIB 4M1RA 3AMLA 3CGTA 2XYLA 5ABFA 4PEEA 1W91A 3GH4A 7TAAA 4GZEA 1WPCA 1A3HA 4OIFA 4C7DA 2WVVB 3LPFA 3DYOA 1Y7VA 3RO8A 1W9XA 4N42A 4CKQA 1ITXA 3SCRA 1OCQA 1G1YA 2DGAA 4P7RA 2ZUUA 3GXFA 1FH7A 3AYSA 1JXJA 3VM7A 2XHYA 1E3XA 4J28A 4AZBA 5M3WA 1MQQA 4D1IA 2W5FA 1OINA 3UCQA 2W62A 1NOWA 2A3CA 1WDQA 1MXGA 4FNPA 4D6IA 2E3ZA 3CZKA 5EB8A 1BYAA 2J79A 3SCSA 4UFIA 5IHRA 2XIIA 3KLLA 1UR8A 1NP0A 4W86A 4JZ5A 1OT2A 3SCWA 1V3LA 1KR1A 3VGGA 5A8OA 3BUQA 3RM4A 2ZUTA 2CHOA 2F8QA 1XSIA 3I3DA 3AIBA 1CECA 5M03A 3DX2A 3UG3A 1W3LA 2WMIA 2FH6A 4MNLA 3VIJA 3AS0A 1US3A 3A4AA 1CLXA 4P7QA 1RPKA 3VIFA 4H04A 2WVVA 5A6BD 3WH5A 3ECQA 3HMCA 2ZX7A 4JCMA 3CO4A 3S5YA 3NUKA 4AD4A 4QLJA 4BQ4A 4ML4A 2PWGA 3F5KA 3BLBA 4BQ3A 2VT0A 5CPTA 2D0FA 2CNCA 1V3MA 3A23A 3TV8A 1VFMA 3ARSA 3KL3A 3T0AA 1KFWA 3WNMA 4JCLA 4FLSA 1W32A 4AZIA 3N18A 3L4TA 2XVPA 5I6SA 3DX4A 3FNDA 1LWJA 1ZB5A 4CVUA 1UG6A 3BMWA 1TFVA 3ARZA 2E4TA 3EJQA 3W28A 4RE4A 3AQUA 4GI6A 3M46A 3GXDA 5KEZA 1GORA 1BAGA 1HVXA 3W29A 1X6LA 3D3AA 2YL6A 4W87A 4J3WA 4HTYA 1SZNA 1Q6EA 2G3NA 2YKKA 2WMKA 3FHQA 3AICA 1HX0A 4AD3A 1CPUA 5I24A 4AZGA 1XYFA 4AWEA 1EA9C 4HZ7A 1V6WA 4Z2HA 1CGWA 3CC1A 3L4ZA 4UZUA 2VNCA 5IFTA 4P8XA 2BY2A 4W8LA 4J3TA 1KQZA 3F4VA 3THCA 1KR0A 4AIUA 3CIVA 1WDSA 4CU8A 2J47A 4PTWA 2CIPA 1E72M 4WKFA 3N17A 5CJ5A 2G3MA 3TTYA 3ARPA 1FHDA 3WUEA 3VGFA 3ZMRA 1V02E 1E5NA 3MV01 4GINA 4UFKA 1JZ3A 3WEZA 1RD6A 1TE1A 1KGWA 1OBAA 1QNOA 1PEZA 2ZX8A 3EDJA 4W88A 4E8CA 3AZTA 2D24A 4QDMA 4V27A 4D71A 4QLLA 2DSKA 4XZWA 2DEPA 1OGGA 3BMVA 2J7GA 3EMCA 3WNOA 2FDMA 2VTFA 2DT3A 5C70A 1W3HA 2J8GA 4N0RA 1G5AA 5HPCA 3N12A 3VX1A 3ZIZA 4AXNA 5A6SA 4WSJA 4E4PA 2XM2A 1TQUA 2J7HA 2BHZA 5BXRA 3H55A 3U5UA 5ECUA 3OG2A 2F1BA 4DWSA 1EH9A 4DUXA 2PI6A 3SCQA 1MFVA 2EO7A 5I5RA 4CCCA 2OYMA 3WIJA 3ZO9A 3RJXA 1UH3A 3B8SA 3LXCA 2VZVA 4FNTA 3TTQA 4A3HA 1V02A 2PWFA 4GO9A 3GBDA 1K6AA 4IPNB 5A69A 2CESA 4OKDA 1E56A 4PMVA 3A4WA 3QR3A 2O92A 1JI1A 4UNIA 1E0XA 2F7OA 3S2CA 3OIHA 2G4FA 3CZJA 1M53A 3VDCA 3OGRA 4R27A 2V3GA 3IJ7A 3MUAA 1WNOA 4W5UA 4AD2A 5A3HA 3WF1A 1G01A 5A95A 1CIUA 4W5ZA 3GXPA 3VSTA 3MUY1 2UY3A 4QLKA 4HMCA 2WKGA 2DDXA 4DM2A 3VGHA 3PZGA 2WSPA 3GXNA 2GK1A 3VUPA 4PYSA 1VRXA 1XC6A 4D6CA 2XVNA 3E1F1 2NSXA 2XN1A 1UHVA 1OD0A 3EMZA 2IGTA 3TOPA 2G41A 3OZPA 4MNMA 4C7GA 1PAMA 3FY1A 3GM8A 1B3ZA 1V08A 5JIWA 1HXJA 1MYRA 2VL4A 3KL5A 2YIHA 4D6DA 1Q4NX 1EOKA 1V0NA 5ABEA 3CZ8A 4LYQA 1JZ7A 3DECA 2YDSA 2WAGA 1GQKA 1SYTA 2C8NA 1WZMA 1EGZA 3WH6A 3U57A 4AEEA 1SFSA 1XRVA 1UR9A 3GH5A 3K4DA 1JXKA 3MMWA 3ARXA 1WDRA 2V3DA 3EYPA 2VOTA 4GQQA 3EDKA 3DYMA 2EQDA 1VJSA 1EDTA 5A6JA 1K9FA 3BUDA 2IXVA 3LPPA 2V3FA 5CG0A 1GQJA 3W0KA 4J3XA 2WWDA 1B2YA 3VSUA 2FYVA 1QNQA 3HU7A 4LYRA 1QW8A 3VGBA 4OBRA 1NM9A 4P7OA 5BCAA 3WNKA 2WYSA 2O9PA 3PZNA 1C7TA 4Z2GA 4P7NA 4A4AA 1E73M 5I3DA 1GQIA 4MB4A 4ACZB 2WCSA 1KCKA 1VIWA 3GDBA 4FLQA 2VX6A 2CERA 1SMDA 4AZ5A 1ISVA 2V5DA 2O9RA 3KZSA 4D72A 1JIBA 4D6EA 3PTQA 3SCOA 5GQBA 1WAWA 1C8QA 3UG5A 3HG3A 4NX0A 2DT2A 4NSBA 3W82A 1HKIA 4Z2IA 4UR9A 1VB9A 3TTSA 2D22A 3EJUA 4PUDA 1KWGA 3O2LA 1JZ4A 1UKTA 4DUWA 1T0OA 1HJQA 3CHDA 1TQTA 1AQ0A 3BSGA 1E6QM 3AI0A 1U30A 4S3KA 3VD9A 4X0VA 3D4YA 4D6FA 5GNYA 2YL5A 4JHZA 4TXEA 1VBRA 4CCDA 1IZJA 1BQCA 1QX1A 3CUHA 1QHZA 3BC9A 2VI0A 3VNYA 2CBIA 8A3HA 4AEFA 5A6LA 2ZUWA 3D4ZA 1FA2A 5AC4A 6A3HA 4CN1A 3ARRA 5E09A 3OGVA 4AD5A 1J9YA 4HP5A 1W3JA 3IGUA 5A2AA 4AMXA 3L4WA 1H4PA 1O6IA 1TR1A 4ACZA 5A6KA 1KXVA 1UWTA 3NSMA 5A8MA 3HG2A 4PCTA 2Q8XA 5GNXA 2Y4SA 1B30A 3CHFA 4ACYA 3BLKA 3T0DA 3GNOA 1BYBA 3DX3A 2D73A 3FAWA 2JIWA 4K68A 2X2JA 3CHCA 1KB3A 3WFZA 1VAHA 2BVTA 1J10A 2YOCA 3AMKA 2XG9A 4NRRA 3ZJ8A 5BXTA 1CTNA 1ITCA 2FE0A 2DQXA 4AW7A 1GUVA 4OOZA 5CXPA 4B15A 3WF0A 3CZNA 2E9LA 1GOQA 3W26A 4XV0A 3K1DA 1KTBA 1QBAA 3AS3A 4M24A 1WDPA 2IXUA 2ZICA 1NP2A 1AMYA 3H53A 1D2KA 3HJEA 3PZVA 1OGBA 2OYLA 3MU7A 1UWUA 1WKYA 3WDPP 1JF5A 3ARVA 5DT7A 3VOCA 2VRKA 1TQSA 5KZ6A 1FP9A 3EJPA 1ODZA 1HNYA 1MW0A 1E40A 1GQLA 5A6AA 2WC7A 3FAXA 4PMQA 3RDKA 1HKKA 2YFOA 1UH4A 1VEPA 2X2YA 2FHCA 1B3VA 1CENA 4M80A 1BFNA 2EPLX 3ALGA 3WMSA 2EPKX 2VMFA 2WZHA 3NIYA 1BSIA 4UOJA 1VBUA 2WW5A 1R7OA 5A6BA 1WB0A 5A8QA 1HJSA 5FIPA 1BG4A 1C3FA 1Q6CA 1W9PA 1LWHA 1R85A 2RGMA 3T2PA 3AOFA 3A47A 5I77A 1EO7A 1ODUA 4BQ2A 3LMYA 1C92A 5I79A 3BAYA 4DO5A 5M5DA 4QCFA 3ARQA 3UESA 4A3YA 1DWIM 3CV5A 4MTVA 7CGTA 4PUEA 2VO5A 2YBTA 5JBFA 4B3KA 1UOKA 2XVKA 2UY2A 4QAWA 1DWJM 1S46A 5BWFA 3OLEA 1NARA 4RL3A 2DSWA 1A47A 5AY7A 1KCLA 3EDEA 2F7RA 1PBGA 2NT1A 2PWEA 1HJUA 3GXTA 3T2OA 1PPIA 2BV9A 2WK2A 1QWNA 2DSUA 3BUPA 3I3BA 5GNZA 4JFWA 3WUGA 4P7LA 1LQ0A 4D6JA 1SMAA 4WKHA 1ESWA 5FCZA 4ZE4A 3SURA 2WBGA 1C91A 2G8ZA 1GJWA 2CBVA 1NOFA 1MVYA 2D1ZA 2E40A 3L2MA 1V3JA 4JFTA 3ARTA 5FL1A 2YDQA 4OGZA 3WNPA 3CZGA 3L4XA 3CHEA 3SUSA 5JUVA 3WQ8A 3W27A 1Q6GA 2D0GA 1QNPA 2Y2WA 2WMFA 3WD4A 2DH2A 4PTVA 4TVUA 2VZSA 1HN1A 5CZKA 1YQ2A 1WO2A 4S3JA 2CCRA 4DM1A 3LPOA 1UH2A 4W93A 1GW1A 2OSXA 3IAPA 1V6VA 5A2CA 4QFUA 1MWOA 4GQRA 3T09A 1D3CA 5AYBA 4DUVA 1E70M 4OOUA 4UQCA 1OIFA 2WVUA 3A4XA 2XVGA 5I23A 1NWRA 1HTYA 4NXKA 1OSEA 1O7DC 3GZAA 4PN2A 3KWXA 1BLIA 3WMCA 1XH0A 3APGA 4EK7A 5LYRA 3VD7A 3RM8A 1YHTA 3MSDA 2EEXA 4Z2KA 3WQ4A 1UR2A 5A94A 2ZX9A 1KXHA 3U7BA 1BGAA 3CZSA 2JEQA 2GDUA 5HNNA 1KXQA 2BY3A 2WC3A 1UD4A 4JAWA 5CSUA 1HP5A 1GCYA 2YLLA 2CHNA 5CQ1A 3WD1A 5JIPA 1PZ3A 4HOWA 1GHRA 2VX7A 1V6UA 4DO6A 1JL8A 4B3LA 3VDBA 3W25A 1CLVA 2DPEA 3EJRA 5D9PA 2JF7A 2NW0A 3K8LA 1LL7A 3MUIA 4UQDA 1OM0A 4HU0A 3TA9A 1H0IA 1MQRA 3GXIA 1UR4A 2OWXA 3POCA 3PZUA 2DSVA 2VR5A 3SCTA 3LRKA 3IAQA 4Q7NA 4D6HA 3VNZA 1PX8A 3AS1A 5ABHA 3AHYA 1HT6A 2BY0A 2XFRA 1KXTA 3RCNA 1W3KA 4JKLA 3N15A 3OBAA 1UKPA 5IXEA 3VD3A 4PMUA 2F2HA 2QPUA 2BY1A 3PN8A 3HG4A 1EDQA 5D8WA 4BCEA 1VENA 4F9JA 4LX4A 1PS3A 1JAKA 2WLZA 5A1AA 4MPKA 3WD3A 4LPCA 3N1AA 2C7FA 1E4NA 2IUZA 4DWSB 4EANA 3GYCA 5DEZA 2J77A 2JIEA 5FKYA 4FMVA 3VIKA 1UASA 5E0CA 2BNJA 3QHMA 2X0HA 1WE5A 2X2HA 2V5CA 5IHSA 2BXZA 3W81A 4R5EA 5D4YA 1R33A 3O6AA 2GVYA 1IV8A 4KWUA 1HVQA 1UZ1A 3WL0A 2ZUNA 4AZ6A 3B9EA 5CLWA 4KGJA 4B9YA 3NYDA 3D51A 4GIAA 1QI2A 4OBSA 2PBOA 2WZEA 1HF6A 4HA3A 2VUYA 3MANA 2X2IA 3WNLA 4F8XA 2OYKA 1R86A 1UUQA 5BRQA 1XGZA 4FNUA 1PZ2A 4Z2JA 4AD0A 1K9DA 2J7BA 5D9OA 2GK1B 1EIBA 1DHKA 2WBKA 3CUFA 1GHSA 4W84A 1GOOA 2YA2A 3VGEA 3VD5A 4CN6A 4RE3A 1ZS2A 4GI9A 1E6PA 3VM5A 3TP4A 3WEMA 2QPSA 2X1IA 3VDAA 4EE9A 3UERA 3RIKA 3GTNA 1H41A 1I1WA 2A3BA 3OA5A 1AVAA 1J12A 3L4YA 3WQWA 4CD5A 4MAVA 2XGBA 4P8VA 1K9TA 2J62A 3BGAA 3RM9A 1HKMA 2ZE0A 3RJYA 3CUJA 1V3HA 2QHAA 2UWFA 2ZUSA 4HMDA 4FLRA 1JG9A 1CXLA 4BZYA 5CGMA 4NRSA 1M04A 5HBFA 4PTXA 2HISA 2VQUA 3KEHA 1E71M 3WH8A 3SIMA 4AYSA 4X9YA 3A3HA 1MXDA 3VIGA 3W53A 1UD6A 4JHOA 1KGXA 2WVTA 2F1AA 4HPHA 3NDYA 2ZXBA 4IM4A 4CVWA 4AD1A 1QNSA 2GDVA 2WSKA 5LA0A 1JNEA 2XM1A 1W9BM 2J4GA 2OW6A 4W8AA 2CBJA 2ZUVA 3UR8A 3NSNA 2WHLA 5E6ZA 1CGYA 1TA3B 2XUCA 3WEOA 1B3XA 1QW9A 1XH2A 3VKKA 3PZOA 2J74A 5AC5A 1JFHA 1E0WA 2WZIA 2Y8KA 2WM0A 5DMYA 2AOSA 3QGVA 1CNVA 1VFUA 1V0KA 1JZ8A 3PZTA 2OW7A 4L4PA 2A3EA 3N13A 3T2QA 3VIIA 2WCGA 3IJ8A 4MNJA 2EBNA 1FOBA 2W61A 3NCOA 2WHMA 1PIFA 3CZLA 5HXMA 1J0HA 4W7VA 1B0IA 1XD1A 5ABGA 3A6OA 2D23A 1QWUA 1RP9A 5A2BA 2GJRA 1V0MA 4CU7A 3CZEA 3G6MA 2XVLA 5EBAA 2OSWA 3PTKA 3DHPA 2F18A 2PC8A 3AIRA 3J7HA 1C90A 2XSBA 3O9NA 1TA3A 1NH6A 3DX1A 2W67A 1R34A 3AMCA 3VVGA 3WL1A 2X09A 2G3IA 1CXFA 4J3VA 2CITA 2HVMA 3KE0A 3H54A 4U3AA 4TVCA 4UQ9A 3CUIA 4QCEA 1JF6A 1BG9A 3WQ5A 1H3GA 5AYIA 4ZXOA 1JDDA 1TG7A 1GOWA 4PRWA 4B9ZA 3N9KA 3AISA 4V28A 5M17A 3WENA 4UFHA 1EDGA 4AZCB 1R46A 1XSKA 4FNSA 2NT0A 5F7UA 1E1EA 2D2OA 3S6TA 2VZUA 1Q6DA 2UY4A 2XN2A 1IT0A 3PZIA 3VIOA 1DWAM 1G94A 1HL8A 4M8UA 4GI8A 4PMOA 2WMHA 3VMPA 1J11A 1UA3A 3K4AA 1QHOA 3CTTA 2DIJA 3BAIA 3DHUA 3ARUA 4GZJA 3QHOA 3LXBA 3NDZA 1LG2A 1J0YA 2J75A 4XUYA 4NZFA 4UOZA 2Z1SA 3N11A 3WF4A 2WNWA 3VILA 1J0IA 1W9DM 5D8ZA 1D7FA 2JEPA 2XSAA 2PF0A 3CH9A 4H41A 3G6LA 3WSUA 3WH7A 3GBEA 5A8PA 3VD4A 2EXOA 2DIEA 3ARWA 2PB1A 3PTMA 2VZTA 2FHBA 5CPQA 2GUYA 3ZJ6A 2ESCA 5DO8A 2OWWA 2XN0A 1HIZA 3AXHA 4W8BA 5I0DA 1J01A 2C0HA 2X05A 2ZUMA 4E2OA 2W4XA 4AZCA 1W1PA 3VU2A 2JFEX 1E5JA 4J3SA 4UQBA 1HKJA 4DWSC 1UQZA 3WUFA 3EJTA 4NF7A 4UQEA 1JFXA 2D3NA 2OSYA 1H5VA 1V6YA 5DF0A 3GNRA 1XD0A 3BVTA 4MJ2A 4CD7A 1OD8A 2CYGA 3EBVA 1EHAA 4XX6A 4UFJA 3SUWA 2FGLA 4U2ZA 2Z1KA 1ISZA 2VZOA 2J7CA 2X8RA 1ZBWA 3HZ3A 4NZJA 1CXEA 4GZIA 4P8UA 1UD3A 1FH8A 3W6MA 3ZM8A 1JYWA 2A3AA 1GONA 1M7XA 3WBEA 1EHNA 1PX4A 1B3YA 1OGSA 4TX8A 2J8FA 3DDGA 1R87A 3I3EA 1ZBVA 2VJXA 3EMQA 4U31A 3WF2A 1VEOA 4H2CA 3WELA 2PWDA 2VR4A 3VGDA 1VEMA 2MANA 1CGTA 3FN9A 4YN5A 4ZE5A 3ZR6A 4KRTA 3WH9A 4AZ7A 1E0VA 4CD6A 1V3KA 1QHPA 1U33A 2VURA 1E1FA 5IFPA 4X0NA 1E4MM 3WY4A 3SCNA 4U5IA 2XWDA 1N82A 4OUEA 1BVNP 3ZOAA 3CMGA 1H1NA 3B9DA 3AHXA 2VRQA 2E9BA 2F7PA 1H2JA 1CBGA 1CGVA 5EFFA 5DFAA 1P6WA 2E0PA 1C93A 4PMXA 4IPLA 1QBBA 2DT1A 4TX6A 3BH4A 3VX0A 3WY2A 4L4OA 2Y8VA 2QLYA 4H8HA 2XPKA 4F9DA 4PMRA 2FGZA 1Q6FA 3WUBA 1V03A 1UKSA 3ZT7A 1ZBKA 1XH1A 2XFYA 2YDRA 2BHUA 3W38A 1B9ZA 3BAKA 3S5ZA 3SCUA 2XFFA 2WCAA 3NSXA 2BXYA 3A22A 2X0YA 3DC0A 3F5JA 4ZENA 1MW1A 3K8KA 1OIMA 1W9UA 2J78A 3NJ3A 4W89A 3WMBA 3WBAA 2BHYA 3UETA 1KBBA 1M01A 2EACA 2ZXAA 2UY5A 1B31A 5BROA 1UD5A 4ATLA 1QOXA 2XIBA 4CN4A 1WZAA 4HOXA 1J18A 1WZLA 4YPJA 3T0BA 3TONA 2XJ7A 1JAEA 2JALA 3OB8A 2DT0A 4PMNA 2QV4A 2ALWA 5JBDA 4FNQA 1US2A 3RILA 3WDIA 2ZOXA 1H0GA 3VMOA 4XB3A 4J7RA 4GO8A 4GPNA 2YL9A 1O7AA 3ALFA 1FP8A 1CYGA 4CCEA 1V0LA 1SR0A 3UR7A 2BVDA 2BVYA 1KGUA 2DH3A 1BYDA 2GJPA 2XTKA 5BRPA 1GZJA 3WQ6A 3WDHA 2OLHA 3WQVA 1UQYA 2WANA 5LA1A 2VCCA 2BS9A 3SEPA 1J0JA 2QF8A 1V3IA 1B1YA 4KGLA 4TTGA 1E43A 1XV8A 1QI0A 4TUFA 1QI5A 4JFSA 1MW2A 2OWCA 4D6GA 3CMJA 2VVNA 2EPOA 1DWFM 2YL8A 3OGSA 5HOSA 4WIWA 2B31A 2J25A 4V2XA 2W66A 3VTRA 1C8XA 5EFDA 3HN3A 3AIQA 4JFUA 3CUGA 2E9MA 1PIGA 2EJ1A 1ISWA 3EDFA 3AIVA 4M81A 3M07A 1C8YA 4XZBA 4KRUA 1MW3A 3F5LA 1E6ZA 4JIEA 2YBUA 2FHFA 4LGXA 1CXKA 1GJUA 2D20A 3WDRA 1FFQA 1L0PA 3BCDA 1LL6A 4AZHA 4P8WA 1QVBA 3W4RA 3EDDA 2WXDM 1OWQA 1J0KA 3JUGA 2WC4A 4H8VA 2ZX6A 1KTCA 3AXXA 3VINA 3WF3A 1GVYA 3AHTA 3BVUA 5GPRA 2J7DA 1WZKA 2WVSA 3MV11 2XWEA 2YA0A 1UR1A 3PZ9A 2PBGA 4CUCA 4MB3A 4MDPA 3AS2A 1XHGA 4NI3A 2JF6A 2V3EA 3MUZ1 1W2PA 5DT5A 1UKOA 1MFUA 4HPGA 3ARYA 1QI4A 2VRJA 2YJQA 1TVNA 2VCAA 2EPNA 4PCSA 1F4AA 1EOMA 2WPGA 1IZKA 4U3CA 3ZSSA 4LXFA 5JBEA 5CPSA 3BAXA 2ZX5A 1NQ6A 3AMGA 4GXPA 4TVDA 1GOIA 4H8UA 3VIMA 4D1JA 3B9AA 1ZL1A 3WNNA 1UWIA 1CWYA 1PJ9A 1AQHA 5D9NA 1LLOA 4AY1A 1DWHM 3QHNA 3A21A 3ZQ9A 1ZJAA 5CSYA 1L8NA 3VMNA 1JYXA 1JD9A 2A3HA 5TD4A 1K9EA 1B3WA 4U33A 6TAAA 4BS0A 3DDFA 3VO0A 3WDQA 3N04A 1CZ1A 4EKJA 1CGUA 1KBKA 4URIA 3BUIA 1R47A 1GOKA 4RE2A 4JL2A 2WKLA 3W6LA 3WN6A 1JDAA 5A8NA 4PSPA 5FOOA 1PX3A 1G0CA 1HJXA 2VQTA 3OLDA 2RGLA 1BYCA 1FH9A 1JI2A 2XGIA 4AIEA 2Y5EA 1JGIA 3W24A 1LJYA 3LPGA 3IANA 3LRLA 3DYPA 1ZBCA 3DX0A 3U5YA 1W1YA 1HWWA 2F61A 3BSHA 1X1NA 3M7SA 3BVWA 1UA7A 1CDGA 1CXIA 3AIEA 2YA1A 1U2YA 4WF7A 5CLTA 5C71A 4YHEA 1GPFA 4AIOA 1XSJA 4J27A 1EO5A 4M56A 1RH9A 1W1VA 3FXYA 4HA1A 4AYGA 3M6DA 4MAZA 1KQYA 2PWHA 4PSRA 2QMJA 5C8BB 4Z2LA 3UEQA 2ZXDA 1LG1A 3FHAA 4PMDA 1HJVA 1VF8A 1JYNA 4UQAA 1NWTA 1ECEA 4MADA 1AQMA 4BF7A 3AIUA 1E6SM 1H49A 1VFFA 1E6RA 2DSZA 3LXAA 1UKQA 2JE8A 3IJ9A 3PZQA 1BVZA 3WY3A 3MMUA 1TCMA 4ATWA 3UG4A 3WD2A 3A5VA 3ZJKA 4BA0A 1E9LA 1HL9A 4FF5A 1XCWA 1R75A 5EMYA 2ZWZA 3FW6A 3QOKA 1DTUA 2GSJA 2CXGA 3AJ7A 4JL1A 8CGTA 4PMZA 1F4HA 1B90A 4CD8A 1JZ5A 1CXHA 1MQPA 1UR0A 1V6XA 4UFMA 4YHGA 2CKRA 3RPMA 1H09A 3GXMA 3MS8A 1UD8A 4NZCA 1E4IA 1HP4A 1E15A 3AMDA 2O9TA 1E6NA 3PHAA 3VIHA 1G9HA 1EQCA 3WFLA 1BPLB 1WCGA 3AFBA 1E3ZA 3CBWA 1NOUA 1E6XM 3VPLA 3BAJA 2CBUA 2VC9A 4WK9A 2CKSA 2CETA 1FFRA 3WY1A 1VJZA 4U2YA 3ZT6A 1UYQA 3L4UA 3VIPA 3WKZA 1TZ7A 4ZXLA 2AMGA 1W2VA 3K8MA 3SUTA 3AZRA 3LRMA 3MI6A 3BCFA 3SUUA 1GNXA 2O9OA 2F7QA 1Z32X 2J7EA 3GH7A 1DEDA 5IDIA 3U7VA 4QP0A 1TQWA 1TQVA 2WB5A 1WP6A 3AZSA 3BLPX 4MB1A 1DP0A 2D0HA 1TUXA 3AYRA 1I1XA 5FL0A 3SUVA 3LX9A 2W92A 2TAAA 3EJSA 4WLCA 1BGGA 4OJYA 2WLYA 2E8YA 5BXSA 2V38A 2VX5A 5D9MA 7A3HA 1TVPA 1UZ4A 1VFOA 4DWSD 2W63A 3MMDA 3L4VA 5E6YA 4LQ1A 4MNKA 1RP8A 2VX4A 1UWSA 3K46A 3OZOA 3AIWA 3D52A 4W85A 1CGXA 2G3JA 3AHVA 4OZOA 4C7FA 3AHZA 5E70A 2BFGA 2Y24A 1R7AA 1JNDA 1I75A 4ZEPA 4HZ6A 3SCVA 4Y7EA 3POHA 4DO4A 4EAMA 1W1TA 2CPUA 1C7SA
chains in the Genus database with same CATH superfamily
4WI6A 2VDIA 4LYPA 3NSFA 1IAII 1ZAJA 15C8H 4QRUA 2A3TA 3OHXB 1MCBA 4UTBA 2NSOA 4WY0A 4HNTA 3GBLA 4S1QL 5JR1L 1OXYA 4XI5C 4JPGA 4WKAA 4BQ5A 4R96B 3CU2A 5J9PA 1HW6A 1YG9A 2F9BT 1N9PA 2AJXH 1HH6A 2FH8A 2NLJA 4Y16A 3QIWD 4KKAD 4KKPA 1EV2E 3D18B 1KGYE 4UCFA 4CD4A 3TAKA 3TJ4A 2MIZA 3WKNA 2WHKA 3OO2A 2MTPA 2R9HD 1JD7A 5KS9F 1JTPA 1XCXA 1MOEA 3V7MA 3W37A 2YEZB 4OD2B 3OG4B 1ZJBA 4M48H 1WXJA 2Z1PA 4JY9A 1KO0A 3MLYL 4Q97A 3TYGL 3FLUA 5EFIA 4LT7A 5E23A 1F6AB 3WD0A 4JD4A 2R2HA 2OBGA 4JZJA 1Z9PA 5KVDL 3FSZA 1I3UA 1H11A 1FBIL 3OGOE 2ZZ3A 3BH8A 2FQGA 2ERJC 4ZPTA 1KRCC 4EN3B 3SCPA 1B2WL 2QULA 5EUKA 1ND0B 3ENEA 5AQ0A 4EN2A 5T1KB 2H26A 3NZRA 3AAZB 5EOQL 4QNEA 4R4FL 5I2UA 3GVQA 2JV6A 4I13B 3LRHA 4C1LA 5D7IE 1Q38A 1U95A 4L9LC 1A3WA 3KTSA 1G5GA 5KTEL 1VFBA 1SJMA 4NX5A 2TRHA 5CUSH 2PDCA 2X4OA 4MD0B 2XHYA 1NEZG 1A6UL 1D6EA 5D96B 4DAGH 5M3WA 3QV6A 2WW8A 4OLVL 2PKDA 5D38A 1K72A 2FDSA 1RJYA 2FMNA 2CLEA 5DZJA 5E2VL 4IRSB 3SCSA 5DRWA 4LL1A 1HCYA 2LAAA 5FW8A 2VFEA 1WDWA 3FJ6A 2PTWA 4JZ5A 2VC7A 4FNLH 4AQ1C 1H0DA 4AY0A 2CHRA 3D69A 3BYYA 3BDBA 1US3A 5HR7A 3ZDXB 3A4AA 4EBQH 2OCCB 3GVRA 2AXFA 1SU5A 2O4QA 3WHE1 4DSYA 2H1LM 3VYLA 5CPTA 4DZ5A 4V1DE 4CQ8A 4ODHH 3QFEA 4FLSA 5DCDA 1T1WB 3B04A 2YPVL 4BFRA 4ZUVB 1NKRA 4K94H 3URNA 1A6VL 43C9A 2E4TA 4NFBA 1YN6A 2AF2A 6FABL 3ZMEA 1NGZB 4Q8TA 2DZBA 5EZJA 4HTYA 1SZNA 3K91A 3V1PA 4HIXH 2FTWA 4XO7A 1CPUA 4KHTH 2R8SL 3RY5A 4BR1A 3DHDA 5AN7A 2VNCA 2WJ7A 4AIUA 2I9EA 4TOYL 1T4KA 2I69A 4P46A 4LSPH 3IDNA 3IU3A 4AQEB 4GT7A 1YBQB 2UY6B 2IW0A 2OTUB 1A4CA 3B05A 3AZTA 5ESVB 2CMRL 5B1KA 4NBYB 3TYBA 3RBGA 3RAJH 4P23C 1XLJA 2DT3A 4WKZA 3W84A 4WI8A 5C70A 2FIKA 5E00B 1JUKA 5KVFH 4ONHB 4MQTB 1DLHB 2G75B 5IJDC 3MLRH 5KJRH 2ENJA 1H63A 3KCOA 3U0WL 1JXFA 2HVNA 3LXCA 4Y2DC 5F0JB 1GY1A 3ANYA 1JGUH 5HHNA 3S88H 5EC2B 4EX4A 5E93A 1KCRL 1CBJA 5JO5A 1UUMA 3N34A 1VGKB 5DJXB 3VW3L 1RQ5A 1YNTF 4L3FA 1E4HA 5FCSH 4GFTB 1RPQA 3CPLB 3E1F1 3WLWD 1U41A 4PJ7E 1JK8B 2YAMA 3U9PH 3FY1A 3MSRA 4WJ5A 2OPCA 3GMQB 4Y1SA 2K6YA 5IP4A 1P1ZB 2VL4A 3GSVB 2DQDL 3WU1A 5ABEA 2PPGA 5L4IA 3NAVA 4GP4B 1PD0A 4OKVA 4AITA 5AHIA 3HNTL 5F89A 4H25A 5DHDA 1FGVL 3ECBB 3IBEA 4WHTA 1IGYB 4JPSA 2V3FA 1YXDA 4NJHA 3EJZD 4UT7H 1QW8A 1TELA 1A0CA 2TPSA 2GSGB 4DVBA 4XG1A 1GZPB 1U3HC 3RUGA 3IS4A 3PZNA 1BVKB 5HQLA 2GSHA 3SDCB 4WK2B 1I8MA 2GHZA 3HPJA 4INFA 1E28B 1VRDA 3IJHA 5K9QI 1UWAA 1CLZH 4LHUB 1BRLB 5J12C 4DUWA 1HJQA 4LANA 2DZVA 4S3KA 4QRRB 4PLOB 4D6FA 4L1TA 3KOZA 4DJEC 3UAJC 3FOLA 3L5HA 3FT4B 3BC9A 3DGBA 3D4ZA 3EZJB 4H9YA 3OGVA 1J9YA 2HTKC 3OEXA 4D9QE 1UWTA 1G0DA 1T3FB 4U49A 3P60A 3L3OA 3G5VB 4ACYA 2JJTA 3VFRB 1RURL 3L5IA 3NVTA 1TSHA 3X12A 1O6TA 2PP9A 3K6FA 4Q89A 4F2BA 2N7SA 4M1CD 4NRRA 4QOKD 5SWUA 3PFQA 1KPRB 2P80A 3ZIMA 3SYAA 4I3SL 5HYIA 3ULVD 1WDPA 3RA7H 5T33H 4ZNEE 4Q8PA 5E6RB 3SE3A 3H53A 3FO9A 3QDME 2ZNWA 2DQUL 2W0FA 2DAVA 2ZZ6A 1UXLA 4AHPA 4HISA 2FHCA 5I07A 3PV6B 5FYLH 4GUPA 4M5ZL 3NIYA 7ENLA 5I9QB 2J56A 3C5ZA 2BB0A 3FQUB 1TPXB 5H8PA 4IOSA 1C92A 4UB0L 4LHQB 3LCWA 4S3EA 3SODB 4HWBH 3O4LB 1OAYH 1WISA 4F5CA 1DWJM 1IHIA 4PJGE 1MNSA 1UWGH 2EKCA 5H4ZA 2FBRA 4JUSA 3SO3C 2GK2A 2XC8A 1RXOB 3WFBL 2F9RA 5F9OL 2EZ0C 2A73A 3P0GB 1C91A 2NW3B 2GVEA 3PBVA 1S7SB 1MUMA 1MVYA 4YMZA 2DJ4A 2RBLA 1I1YB 1CLYL 3WCYA 1KXQE 3FK3A 4FFWC 4OGZA 3QDJA 3IDIA 2DLFL 5AW8B 3TTEA 1KLUA 2B77A 1H7WA 4HLJA 2CCRA 5EORL 2Z24A 1F45A 4KWSA 4XWGL 3LHZA 2OR7A 1V6VA 4JO5A 1XFCA 4OZFH 3F12A 5FJOA 4FXKA 1P1VA 3FRPB 3KHOA 4MAYA 3A4XA 4K9EC 4A7VA 4R3SA 1LUCB 2WZ0A 5F88A 3EH5B 4WW1A 3PBMA 1JVNA 5A94A 5IMMB 2V63A 1EERB 3E9AA 3BGFB 4N26A 5IHZA 2GDUA 5DTFB 4A7GA 2KDYA 2W07B 5FGRA 3TPUA 3IN2A 1V7NH 3WD1A 2FZDA 1NJ9B 2O0TA 4ZPVB 2P50A 1MG3C 2V8MA 2WXMA 5LQBH 2DPEA 4I0PA 1S78D 1J05A 1RZFH 2NW0A 4YUEL 1S7VA 2YZ5A 2ENSA 4JR9L 2BMKB 3L4CA 4XPHH 4IGSA 3CZFB 1YDPA 1EX1A 4GRMA 4N9BA 1J8HD 5CIPB 4X2RA 4XP5H 3TT3L 2WSRA 1VD6A 1GZHA 4MGGA 2WZ6A 3UO1H 4U6HA 5DMMA 2P10A 4BELD 3E0IA 2F2HA 4ADGA 1TO5A 2LGNA 4PRNA 1RXLA 3U2JA 2XFXB 5A1AA 2EECA 4IKKA 4FXTA 3N85L 1DQQB 1U91B 1Q94B 2BZCA 2KQNA 1J1XL 2CO7A 4XXDA 2PP3A 3WSQH 1FX6A 4AQ8A 4GX9A 3QPZA 4Y9AA 1RERA 1OOAA 3FUEA 1FZMB 4GZ7A 4NRYA 5BRBA 5IB3A 4N2LA 2NY3B 3KM1A 2VUYA 4JDVA 1Q6LA 2XZ7A 3LCLA 4LLUA 3OVPA 2X12A 1Y0LB 4KROB 4AF0B 1KGCD 1YPFA 2J9XA 4LVAA 3NZ8B 4JQ1A 1UJ3A 3HS8A 5GRUH 4LCCC 1P5UA 4Z7OB 4GIEA 2BH0A 4YAQA 4IGBB 4LCUB 2Y63A 2HRPH 3CN4A 1V7AA 3MYJA 5AYQA 4R0LA 1X9UA 4NZRL 4C6MA 3BE1L 1BWLA 2ZCZA 4KITB 3G1DA 4LZKA 1RJZB 3GJFA 4N8UA 4JHOA 1PDKA 2HVBA 2FJHB 3IJEA 2ZXBA 2J9ZA 2QW5A 3H12A 4JYDA 3DG3A 1A3XA 4K3DH 3KLQA 3H2PA 3FTWA 4M7SA 2YSSA 2D03H 4JTCA 3UR8A 8TIMA 2YYTA 4PC8A 3LN3A 2R14A 3TSDA 3WEOA 2A85A 1T20B 5HYJB 1QW9A 2O6DA 3B2DC 1TQCC 3ITOA 1D9KB 2X1XR 3FUHA 5EEVA 5DMYA 3QGVA 3LKQA 4GLRH 3QZWA 5HYSA 4XB8A 4XZUB 4E9TA 3SDXA 4FCHA 3IJ6A 2EIZB 3EZ8A 2AJZA 3IEBA 4AK2A 4P0DA 4JFFD 3RPKA 5EU6E 1XD1A 4GP5B 1SHWA 1L5GA 4M5SA 2ED6A 1MQKL 3FGCB 4DELA 5EBAA 2HWZL 3B2XA 2XSBA 3OJ2C 1PLBA 4U1NB 1UC4A 1X97A 4GX8A 1Z66A 1RZKH 4MJIE 3ERXA 2AQ3A 1X8FA 4N3UA 2B0SL 1O94A 5BUPA 1OW0A 3CUIA 3K6NA 2A7RA 3G0XA 2PCYA 1EC8A 5M17A 3NABL 2EG6A 3DUSA 3H4GA 1WJ3A 2GYSA 4U6YA 2ROYA 3ZHLA 1J5OH 1T5XA 4GSUA 5DRZB 3T6QC 4BZ1L 1IGTA 4NZ8A 3GLDA 3K4AA 4NLHA 2HFTA 1TPVA 3L5XL 5KAQF 1C9DA 1TO3A 4NAFA 2GJ6D 4FTVA 1CN4A 3PFMA 2JEPA 3N1GC 2WKJA 3QI9D 2ZAIA 4YFDB 3C8NA 3B5GA 4ERAA 3VJ6A 4ZNCD 2QCDB 3CSBA 1JN6B 3R43A 3RVXD 4JFEE 2ZUMA 3W7NA 3VU2A 2KZWA 4J3SA 4DWSC 4Z77A 3WJLA 3EJTA 3JVGA 1CR9L 3ML9A 3O3BB 1JFXA 1ME7A 1AFVL 3MODL 1A0QL 3THAA 3O11A 3DV4B 3MV8A 1CXEA 3QHFL 1UD3A 5IEKB 3KPLA 1T89C 3LVTA 4KUZL 3GMRA 5SWSD 4Y4KD 3W87A 3DIFA 3TIMA 3OMIB 4EXQA 4ZVJA 4P4RA 3HPXA 1ZLEA 2PPDA 3DVIA 1KC5H 3UVIA 2GTZB 3ZR6A 5CP3A 1FLRL 1E0VA 1NCWL 2X0UA 1FAIL 1KJVA 1LRNA 2NY2C 3TBYB 2ZKXA 5DD1L 2OK0L 2BM3A 4DJFC 1SOQA 3EADA 1P6WA 3TYFB 5K9OB 2BNRB 3WY2A 4L4OA 4IBSA 2WQAA 2O61A 2DI9A 4R7OA 3BZEB 2QCCA 4PMRA 2XWCA 4PJXF 1AZ1A 3CHSA 1E2WA 5BRZB 2XTJE 1SEQL 4EMZA 3D34A 2NZ9D 2J78A 5AB1A 4JY8A 1PYWA 4IBTA 1BFTA 2ZXAA 3PWNB 1E27B 3FPYA 2IALA 4EOWH 3U2CA 5HQEA 2RD0A 1KV7A 1Q9WB 1T80A 1CE1L 1ZAHA 2FO4B 4JN2A 3RZCB 3R06B 3AGVA 4KDTC 2V9UA 1WIOA 1NJJA 3IU4H 4WI5A 1SR0A 1YEEL 3IM1A 1PB0A 1JPGA 1KBIA 5LSMA 3QFJA 2WWKO 1UGKA 3RHWK 3VCRA 3QEHA 1QPQA 2CJSA 4ZUUB 3ZVHA 3RDTA 4FS9A 2YL8A 3IJDA 3SKUD 2ORBH 2HJKA 5EU5B 5AVWB 2OQJA 3GSOA 1W0YT 1QPXA 3P14A 5FYJU 4XZBA 3TN0D 1B9BA 4L9ZA 4AMKH 4QG9A 1F58L 2WCPA 3CTLA 4JTRA 2VDMH 1FFQA 3UP6A 4P8WA 2OXNA 1PXGA 4H88H 4XTRD 5F1NA 1Q6RA 4JPWH 5HYQB 4AVIA 2QSCL 4Q33A 2J7DA 2WVSA 2EKSA 3TIDB 3TYZA 1AOZA 5IKCB 3TH2T 2GY5A 2P42B 2F0CA 4GG9A 4NI3A 1UIPA 1MFUA 3GMOB 3F2LA 2YJQA 4OLWH 4R7DB 3OKOB 4G3YL 4PQXA 2YWYA 5D33A 4IIQB 4KTYA 5DRNA 3WNNA 3ZYOA 3JR2A 2FT7A 1AQHA 1BXNA 4XHJC 2PU1A 2V67A 1GKEA 3MNZB 1DN2A 5CSYA 3N44B 1UT2A 5KYXB 5TD4A 4U33A 3UOAB 4NGHL 4MZ2A 1TJIH 1S5NA 4GSQA 4LRTA 4F2MB 4LVGA 1PLCA 2K6WA 2DIBA 1Z5YD 2P46B 1JGDA 5EOCH 1J2WA 5DMKB 1HJXA 5D2LF 1I7RB 2P48B 3LPGA 2WLMA 1YHPA 2X6VA 4HVBA 4HJTA 4ZB5A 5CLTA 2X4RA 2REQA 2OP4L 4MWAA 5MI0B 1D7CA 1R3LB 3FB7A 5AVXB 3TIEB 3C5QA 4AMAA 2E27H 1G7QB 2AV1A 3UEQA 3QWOB 1MWAH 3SGZA 4XMUA 4HJEA 4X5RA 2R56H 1NWTA 2YD1A 3BKML 3KYMB 4P4KA 1YKWA 3MREA 1LDPH 4X5QA 1E6RA 1B0RB 3IUHA 5KUKA 2FB4L 1NC4B 1X4ZA 1E9LA 1HL9A 2DVXA 2YW3A 2AV7A 3EBIA 3H2NA 4WU7B 3FW6A 4ORIA 1RLBA 4Y9MA 4F2UA 2IANA 3MMTA 5LKYA 4KNSA 2J12B 1ZS8B 4B5TA 1HP4A 3SSZA 4DHLA 3VIHA 4TMCA 1QUMA 4V1DD 1AD1A 1A1NA 2H1PL 1E6XM 2J1ZA 2CETA 1ED3B 1FFRA 1UYQA 3APTA 4L5ZA 1TZ7A 4Z23A 4WFEE 4IZGA 1SJCA 2YARA 3AZRA 3TEXA 3LRMA 3LH2L 3QXWA 5CN3A 2ATSA 4L6DA 4B5ZA 3LLDA 4U1IB 5H8DA 4GY7A 2AQPA 2WWNA 5GZNA 2FJGA 3S96B 1S9XA 4EVNA 4LVDA 4Q8NA 1UZ4A 4LUIA 2X4PA 3EFOA 2ZONA 1ZEAL 4QSHA 4GW4B 3D08A 5ABTA 4NHUA 1EHLL 4Y1AB 1DIDA 4Y9OA 2EH7L 4HZ6A 2VW7A 1NANH 4QWWD 9CGTA 2KMWA 3O3DA 4MNHB 4DUOA 5B21A 1PY0A 1DXEA 1OT1A 3IPEA 3ZSTA 1OVZA 1VJIA 1A6AB 3JTBA 4KXCA 2YFNA 4C60A 2XA8H 5A7BA 1JPTL 2BINA 3WKPA 1HZHL 2F54D 3KWSA 5CILH 1CEOA 1FWRA 4OFQA 2DYPA 5EU3A 5BVJA 2AVFA 2B08A 3VDHA 4CJ0A 4Q0XH 2ZIDA 1PCSA 3E0WA 4AQAA 2GSMB 4U5KA 4KZ0A 2XWTA 1F90L 2FEJA 1PTAA 4OJAA 2E8ZA 4E68A 5FUCE 4Z7NB 1ZLPA 1LYXA 1NIEA 5E0FA 3MUGB 3I50L 4KFMA 4MCYB 3BQUC 3OODA 1IXOA 2FWLB 3LQMA 1KNWA 5TNVA 1MJ8H 5IM7B 3T1FB 1MAJA 3CSYB 1DJYA 3I9PA 3H9SB 4MMXB 4HJ0D 3VRIA 4G6MH 1GOMA 4LC8A 3W1AA 3O4OC 1SY6H 1DWGM 2I25N 3HW7A 4QS6A 3T8XA 5HGDB 3PBGA 4JHUA 3E3HA 4UTTA 2ZSWB 4LPUA 2H7WA 5KJ4A 3VSVA 1PDYA 1J86A 5CH9A 4IUGA 5HPOA 2ZCLH 3F8UB 1JFQL 5T5FL 4WW2F 3CV7A 1M03A 3P3BA 2QQLH 1TVHA 4LLDB 2AEPL 1FVDA 3CGTA 5LVEA 1O68A 4ZO8A 3EKLA 1A3HA 2ZPKL 2PDKA 3F05A 4DYEA 3H22A 3VXUE 1WIUA 4QPEA 3DWTA 3RO8A 1S2CA 4HUXA 3UJIL 3E5PA 1KJ3H 5B8CC 4R4BA 3GXFA 3THQA 2XOTA 4MJ6A 4LU0A 4D1IA 2BRRH 1BVNT 1ZA3B 4RLDA 4O58L 4A2LA 2E3ZA 4XBGB 4MY8A 1TETH 1TUPA 1ZTMA 3RX7A 5I6KA 4Q9BA 5KJ7E 5A8OA 4PEKA 4PJ8D 3G0SA 3KFTA 2Q7AA 3G3MA 1KBLA 2EO9A 3CXHJ 1MCPH 4TTDC 1ZENA 1SDDB 3B9KA 3FQWB 3S5LA 5DJ0B 5TDPB 4NENA 3TZFA 4WI7A 3B0XA 3EWDA 3G5WA 1KC7A 4C91A 3GD1C 1TU2B 1FSKB 4QYAA 1UG6A 2EC8A 2CSPA 1GGYA 3SIKA 3O2WL 2BC4B 3ZTJG 1UGNA 3QDMD 4HKXB 3AJXA 3E49A 4AZGA 1QPPA 5DEGA 4BSVB 5CZXD 4LBEA 1V6WA 5K3VA 4ZOBA 4LS1A 1GYCA 1MEHA 2WTPA 1EF3A 2M26A 2X2GA 1R3JA 1E1CA 1XZ0B 4PVBA 1TMCB 4UC5A 4QXIA 3UROR 5FYKH 2VDRH 2Z8RA 3WTUA 1INDL 5HHOA 1BIIB 1QNOA 5BV7B 1W1B1 2G4JA 2NDGA 2DQEH 2JJWA 4LSTL 1HHJA 4PJXE 1CT8A 1RCXB 4LK4A 3CLMA 3VUAA 3G1XA 5MHBA 2R4RL 3NCJL 4N0RA 5C09E 1DL3A 4HDIA 4MNGB 5KVGL 1P4IH 3NTCH 4JTKA 4XVOA 1UM6H 4R9XA 4AYFB 5BXRA 4DUXA 3G04B 2JCCB 4BUQA 2J4WL 4ICCX 4YVPA 3ZO9A 1N18A 1CU4L 2XQ0A 3E9TA 2A7PA 3OKNA 4XCCL 1YNKL 4LPXA 4MDRA 3EF4A 4HZLB 5A2FA 2G30A 4WWKD 5E2UL 4HXAL 1UJTA 3F7LA 1U8LB 4N24A 3L3KA 3VACA 1WZ1H 4AD2A 4PJ9B 1OAQL 1CIUA 1J4EA 3MUY1 2OXHA 5HJ3B 3MBEC 4YEEA 1L9SA 1EK3A 1KCWA 2FLRT 3UEZA 3UYCA 1FH2A 3UWZA 2G60L 5E4EB 1RCOB 2XNAB 1ZIAA 2F6XA 3QJRB 1TPC1 4GUOA 4HBQA 4P07A 4F7KA 3ID7A 4D6DA 1WUNT 2FPTA 3OC8A 3DIDA 1CK0H 4CQBA 2I9TA 2H9GB 3UZWA 2DUZA 3U57A 5GJTH 8PAZA 1UR9A 1MDLA 3DBXB 3ZXAC 4QEGA 1JJKA 2V3DA 3EF7A 4LCWA 3GMNA 1LO4L 2Z0UA 4NKOA 4Z7VB 2A1YA 2VFGA 4HJ1A 2Z7UA 4PJFA 3UNTA 5IMKB 4AH2B 4RGMC 2O5YH 2C3GA 3TW7A 2EINB 5BCAA 1I3RA 1C7TA 4AENA 3QIUA 2QGBA 1KCKA 4QR7A 4BYHA 5IG7A 3IYLW 3U2IA 4W9DC 3CFEB 3PTQA 1H50A 1NL0H 3N9GL 1HEJC 1DUZB 1RUML 2NUPA 5GJPA 1JUFB 4G1EB 1VCVA 1IEXA 2QSVA 2FBOJ 1PZUB 4X99B 4QE1A 3CVHH 3FTUA 4PBWD 1NFIA 5F0PB 1ASPA 4WTZA 4HKZB 4M9PA 2EXWD 4RMTA 5TQ2L 2C13A 2YL5A 5B22A 1OX4A 1EUAA 1VBRA 1IZJA 4ERSH 2X4SA 2DB8A 1VH7A 4FXFA 3QCVL 4ZX5A 3VNYA 8A3HA 1JGMA 1P0BA 1W3NA 3PTDA 4TO8A 3HG2A 1E5UI 3OF6A 4X7EC 4KI5E 1TO4A 3BP7A 4AAJA 4EI6A 4YNGA 2CLPA 4X61A 1XBVA 4ZMYA 1MRQA 1TJGL 3VWKA 1J8HE 3N73A 3R25A 3UGVA 2ZUXA 1RA5A 1ZHKA 3RHGA 2NX1A 2XG5B 2I7SA 3BZGA 5B7EA 3RDKA 4H8NA 3ULVL 5C2BH 3TZVC 1PL9A 2DWXA 4W4NA 3KW7A 2E6JA 2V2TA 4DVRH 1VBUA 1E50A 3FQ1A 3PBWA 1U22A 3P3UA 1QFWI 3WO3B 2P8PA 1QEWA 4ZS6C 2PYEE 5FF3A 1AHWB 3CDFA 1R3HA 4LS2A 3RTQC 1DEEB 1TVBA 2ZCKH 1UCBL 3UGXA 4PGZA 1EMTH 2OTDA 1QVOA 2HVKA 2YC1B 3QWNA 3PP4L 1YYCA 1XCFA 5J6GA 3O41B 4JREB 3R89A 3WUGA 1FTXA 2FYMA 2WO3B 1NBZB 2X6BA 2IMRA 1I1AB 4AJ0A 4DJMA 1ALDA 4MJID 1P0EA 1JRHH 3OJVC 3E2HC 1NMCB 5DQJB 4KEZA 5IB4B 3V7PA 2CU0A 1ZV9A 3U2OA 3DNKA 2HQAA 2YCIX 1HXMB 4LSSL 3U7YH 5D6CA 3ARBA 2KC0A 1S7WA 4URTB 3BP5B 3LDBB 3T09A 2OJZH 2JLPA 2W5PA 3FTGA 1DBTA 5DUJA 2NTFA 3RYSA 3U9UA 1OSEA 1TCDA 1O7DC 1OPOA 1KZYA 3MX0A 1JE6A 4XSMA 3TC3A 4AV0A 3WE6B 4Z2KA 3WFCL 3WQ4A 1HOCA 3BPCB 4K1GA 3W1RA 5A2LH 3QC5X 4LSQH 3VFMB 3UPRA 1A7OH 2FBJH 1UD4A 3THMH 1OSZB 4FEMA 1O5QA 3RVTD 3SYOA 1QDSA 3TWBA 4J6RL 5MENB 4B3LA 4JFED 1U8JA 5DMGD 2FJUB 4N2AA 2KLTA 4XNUH 1KXVC 3GXIA 1RY8A 2VR5A 2IH3A 5JOPD 1PX8A 3SDAB 3FB6B 1GGBL 5E1AB 1JERA 3RX3A 4LO9A 1ICPA 4GK8A 4Q9RL 1KXTA 3HGJA 5FLUA 4JFFE 3CJPA 3OBAA 4TSAH 4IBUA 1A3RL 1AD0A 4D9LL 4FXGB 2ICWA 2AQVA 1C9SA 2VR7A 4Z1DA 4NWTL 1U2CA 2QTEA 4L80A 1RZIA 4JFPA 5GZOC 2K0RA 4HS6A 4KIEA 5HJYA 5D7LB 3OX8B 2VL5A 2OMXB 1MEWA 2A4EA 4NQXA 2X2HA 4F7MA 5F4SA 3IRDA 4LSVL 4QTGA 2ZG2A 1MWAA 3WL0A 4DP9X 1OTSC 3MUCA 3PWPE 5JIQA 4LARL 4AWJC 5IFJA 2YUWA 5CSBA 3L1FA 2DQTL 1P4BH 3BWWA 1KB5L 1A21A 1N12A 1WITA 2X9WA 1GIGH 1OP4A 4OF7A 5BXFA 1MFBL 1DHKA 4G71B 3CUFA 2QEZA 1GHSA 3WFDH 2XTJD 4OV5A 5FIEA 3VM5A 1NC2A 4M43L 5B4MD 1R19A 1E67A 3CSGA 2NXYB 3OKLA 3OA5A 4YLWA 3IE4A 3DX6A 3KBFA 3WQFA 3WQWA 4JR5A 2VWEE 4PFHA 4BCXA 2IH1B 4N6RA 1CBVL 1R38A 2VAJA 1EC9A 1V3HA 2PW2A 2QHAA 4HMDA 4PI0A 3ITLA 2I32A 3CIAA 1ZWIB 2DMGA 4BXVA 3E6HA 3VIGA 1RBAA 1F61A 3UBXB 1FL6B 3FUJA 3HI5L 3EPOA 2J4GA 2CLZA 4OF6A 4J3OC 4BKSC 4GVFA 4U0RB 2YMOA 2XUCA 4OQ1A 2VRAA 1UJPA 1ZVYA 1CB2A 4ELME 1YEKH 3FT2B 1ICSA 4PJBF 1HO1A 3UJSA 4X5XA 3BE7A 4L29A 3T2QA 3P02A 3IJ8A 4XVJL 4LLYA 2GABA 4DP6X 1K4CB 4H5SA 5E7FA 4JO2L 3UCRA 2Z6IA 2EC9T 5AVSB 3ELFA 1ZGLP 1T66C 5IFHH 5B7YA 2Z31A 2D23A 3QXTA 1VIZA 3MVSA 3EB4A 3V0FA 2VXVH 4H00A 2BSDA 2NUTA 5E08L 4XNQB 2I57A 4FYTA 3AREB 1ZLUK 3UDWC 3QNXA 2EIBA 3RIAK 1C90A 1LGVA 5I1AA 1ZT4A 4BFKA 2R51A 4KC3B 5K5YA 4Z1CA 4RZ6A 3MSPA 1JUBA 3PWVB 4QCEA 5JQ6L 2Q0ZX 4XZHA 1TWIA 3O0KA 1Q8MA 4JMNA 4UMBA 2NT0A 2VLRA 2BWIA 3ULUH 4ADIA 4PE8A 1GAFH 2BXVA 4M8UA 1EGVA 1BZ8A 5LBSL 3GI8L 1J11A 3R4IA 1FO0H 1L6ZA 3STZA 1S7RB 4LKXB 3MJ8A 1B4EA 4L3CA 3MLZH 1D7KA 2IG2H 2CE6A 2ITEA 4UOZA 1E4JA 2ATKB 5I1LB 1AS6A 1EEXA 1W9DM 4QXTB 1MRDH 1FFNB 2AMXA 2NNAA 4PLNC 3V52H 1Q45A 4NM8L 4EWJA 3B40A 1SY6A 2K7QA 1XYAA 3FXIC 4G9DB 4YX2H 1J8KA 5IF0B 3NFPA 3U7WH 4OLYL 4IMDA 3BJTA 1UADC 4MJ2A 3CK0H 2FGLA 1VZIA 4Y4FA 5CPOA 3FZUC 3ZM8A 2OPJA 4TNVK 2NYYC 4CW1A 3LKOB 5AOLA 2J13A 3QC0A 4G6FD 3PWGA 1A9BB 2O6CA 4U1HA 4B9FA 1OSPL 1EUNA 2PWDA 1DZBA 1QO3A 2MQCA 1PLGH 3WE1A 4JJHA 4MS8D 3HG1B 1PSCA 4YDZA 2C5DC 3IMBA 3AYVA 3RLHA 1KFJA 2KBGA 4OUEA 4FQQA 3TF7C 4R7LA 1R2RA 3NFNA 3HI6H 2AK1H 2NQCA 4F0MA 4PJGB 4Y5XB 1MCDA 4WFED 3X3FL 1NBYB 2E7LA 2E0PA 1XLCA 4PMXA 3RRAA 4H9MA 3VX0A 1FN4A 2VITA 3DJZA 4C47A 3I7RA 4DN1A 4OCWL 1XH1A 3FUDA 1F11A 5I1CL 5F6HI 1QAWA 4YE4L 3SQLA 2Y1YA 3F5JA 1JTTA 3N1MC 3H2QA 3STEA 2B9BA 1O0VA 2EACA 5BW6A 2H2PC 1IBFA 2ZAHA 5D70L 4YPJA 3TONA 4C57C 1NCAH 2IH8A 4NNXA 4HJWA 2CFFA 3IUIA 3NJLA 2HYMA 1A14L 4PMNA 2MSPA 4XN1A 1ZK5A 4GO8A 5CP3H 1M56B 3WS6C 5BRPA 3LQLA 3OJGA 2QF8A 2V9TA 4PFMA 2HN7B 3L23A 1Q63A 1TR7A 4PD4J 1DWFM 2UZIL 3C5SA 1Q0YL 3WN5A 1G9ML 3AIQA 5EEWA 2E9MA 4TUOB 3D25A 3HPZA 3VH8B 4PB4A 1VHCA 3QPEA 4I88A 4HHAA 1BKHA 1CB4A 5KS9B 4K5MA 5LXGL 1J5TA 5DHYA 1UB6A 1QVBA 4YL9A 3R8QA 3DO4A 5GJMA 3FYPA 5I1DB 3VXSB 1G9NH 2RJHA 1KCXA 4K7PY 5MF5A 3PWJA 3WMQA 4X98B 4UR7A 4YE0A 1DHPA 1C5BL 3WGUB 3TJEH 5CSSA 1X5GA 3VXQA 4N3TA 1YECH 4Y4HB 2OMZA 1BVLA 1KTKE 2IWKA 4CAGA 2ADFH 1KELH 2OT1A 1C5CH 3CPRA 4KJYB 4AFYA 5DD5L 4IQJA 4WUUA 3RGBA 8RUCA 3W2MA 1RUSA 3OR6B 1IWBA 3URQA 4C65A 5IBTH 5LKNA 2CRYA 4HPOL 2H47C 5I1KL 4RE2A 2J6EH 3C8KA 1G7VA 3CQJA 1XIIA 4BK8A 3V0UA 2DBLL 1MUJA 1QNZL 3ITGA 1CVRA 4Y8DC 4QE4A 3MRFB 3VXUD 1CDGA 4HYWA 2YA1A 3I74A 2ZYHA 4XP9H 2F54E 5C71A 3VXRE 4XK2A 1QPRA 1FH5H 3GHSA 2DICA 5C8BB 4EXPX 3IJLA 1LG1A 5EA9A 3RPTA 1MJJA 3V4UH 3GG0A 4I0CC 3GS4A 4P5TC 3PZQA 2E5EA 1TCMA 5AAWA 4C4UA 1QTSA 3A5VA 1XCWA 4PB0L 3QOKA 1DTUA 3AJ7A 3F2CA 1OAUH 2K78A 1T0PB 1PKMA 5FI8A 5HDBF 3GXMA 2ZSVA 3CVHA 1BOGA 2CGZA 2IPKA 5EU6B 3EGSA 5AL8A 5FK9A 1NOUA 3H6OA 3C3UA 3R7QA 2CLOA 3KM2A 3VKAA 2AKRB 3MI6A 4LVHC 1O6SB 1SXAA 5G5DA 5I15L 5IDIA 2Z2BA 1UM4H 3ZE2B 1S9WB 2HUHA 4EPKA 4K8RL 3LX9A 1NIBA 3WLNA 4ZI8A 1RZJL 3AWEA 4FQXC 4HH8A 4A05A 3RFZA 3N29A 2V38A 3SN1A 2VX5A 4IHCA 1TVPA 3INUH 2YZRA 4EAYA 4M1DH 1ME9A 4G1KA 1A7PH 3CBKB 4A2EA 1XG4A 2G3JA 1E8YA 3HZKA 1SR9A 2BFGA 1G4TA 1AKJD 3NGJA 2UZXB 2DM2A 1P2CA 4EAMA 1SOSA 4UANA 4X8JA 2HPTA 5FD0A 4YLCA 5C09D 2WMJA 4YHPA 3RVWD 5C0CD 4B41A 3KOFA 3OPUA 3VTTA 2FNBA 1OF8A 1PY4A 4O2CB 4M1GL 1QPKA 1TTIA 3CLWA 4ELDA 2ZQ0A 4OLXH 5LCVL 1K8ZA 1X9LA 5KVEH 1LO5A 1MCIA 4IRJB 5DEJA 4MYPA 3MHZA 2CJTA 2X0SA 3VCLA 2RUSA 1YNTB 5D5MF 3RPIB 2YD8A 1WUFA 3CN0A 1EFQA 1QFUL 4IGMA 5BZDA 1G6RL 4HEMA 3L3DB 3UWYA 4R6UA 3ARDC 5D7SL 4C6OA 1COBA 3MRCB 3TCTA 2WSQA 2NY7L 4JDEB 3LY0A 3SBWC 2WP3T 2XKSA 1PZCA 1MELA 2RJMA 4KQ4L 4XT1C 1Y5WA 3L3HB 4PJBE 4JIRA 1OC5A 2HFEB 1ZY9A 4ZG1A 3QH3A 1IC5L 4LOUC 2BJML 4RWHA 2AEOA 5GGVH 1O75A 3DH7A 4M5YH 1FIEA 4KF1A 1R5WA 4OZGA 5FA4A 5D09A 4A2SA 1U8KB 3BUBA 1YO4A 4HZAA 1J2BA 1LLAA 1HZYA 3Q5OA 4M7KL 1QLRA 3KH4A 3II1A 2VIRA 1WD9A 4TTUA 4K3GA 2VEGA 3FUKA 4HUWA 4LU5L 1J9QA 1CL7H 4L4VA 2F53A 4FXLA 2WMIB 1ZLUH 2PD5A 3TR2A 4S1FA 4FG4A 3VKJA 1M1XA 3D2UB 3KVLA 5HMDA 3KJ6H 1JOIA 3B9OA 1SXCA 2YQBA 4FA6A 3VM7A 1P84J 4B9PA 2FVKA 4WI4A 4E41B 1EFXB 1SLVA 2ZZ2A 2UV3A 4MCMA 2CBPA 2J79A 3MO1A 5G1MA 3A4DA 1XYCA 2QVKA 2VLKB 4IXXA 3RM4A 2ZUTA 2CHOA 2F8QA 5E6ID 4FFTA 2OJPA 4TSCL 4QJ4B 3DX5A 4MZRA 1CLXA 1ES0B 3C6LB 1E6JL 4E9WA 4AXKA 2NLYA 4AD4A 2WQVA 1K77A 3WK2A 4KI5D 4PS3A 5REQA 4AZIA 3U0PB 1UACH 5F70A 2RKXA 3KZ8A 4YDLB 1A5OC 2LFEA 5F1SA 5KEZA 4LCQA 1UQSB 4GQGA 4S11A 1X6LA 4X4MA 2AJYL 5G2HA 3FQ2A 3AICA 1W72H 2WXLA 1EA9C 3EB3A 1YUKB 1Z9SA 1DLFH 4O2EA 5LG1A 4MWFA 1DYZA 3UGRA 4PS7A 5I30H 4GW1B 1BQ5A 1XIWA 2WAHA 3TNNB 2PYED 2Y1ZA 4UUJA 5DDHB 3GU2A 4YCPA 2H1XA 2G3MA 4JFZL 3KS6A 3PLYA 3IGLA 4R9HA 3KHDA 5SX4H 3UTTE 1XB8A 1PEZA 1KCUL 4BDVB 4HWEL 3KAAA 2AL2A 4OT1H 4LLVB 3DX9B 3DRQB 4D7PA 2ZADA 1NCUA 3OSVA 1YCSA 1HJCA 3BISA 5BOZG 3GRIA 3T81A 2YXWA 3GB7A 4WTXA 4MUZA 4MA7L 1HSAA 4RW3A 2CR3A 1UPPA 3O3AB 3QSTA 2MCPH 1V7ML 3VXPB 2AXWA 1EH9A 4HQQH 3QLLA 3PL6A 2DU2A 2CU9A 2EO7A 3GRGA 3GNMH 4WHCA 1RZ7L 1X5ZA 1UA6L 2DJLA 2GAZA 1JJUA 4XBEL 3QRHA 3QIWB 4L8DA 1CG9A 3OJMB 3SPIA 1XH3A 4L4JA 1EPXA 2BWDA 5I7GA 1ASQA 4YXLH 3QW4B 4HUUB 1KZQA 1A9VA 2OGJA 6XIMA 4O1FA 4OGAC 1LMKA 3QUZD 3I6GA 4YSDA 3KJ4B 3AXLB 1Y18A 2QADD 5B39G 4WDXA 3SE4C 5H8MA 2WSPA 3H2CA 2CQVA 3QYSA 1EBAA 4C7GA 3ETSA 3HTWA 3RX5A 1BZ9A 1MYRA 2VDQL 3CFDB 3GDTA 2AABH 3IJSB 4A55A 2IBGA 1FO0A 4AEEA 1XRVA 5C0BE 3F2BA 5CLYA 3EDKA 2UX7A 3B3IB 1ZPTA 4HKBB 5HTSA 1Q6OA 3W0KA 2VR2A 1B2YA 1OEZW 3PANA 1IL1A 3ES6A 4RMRA 3UFIA 2QJIA 4AEOA 5KSAD 4P48A 1UOVA 4MB4A 4UV4H 3QG7H 4ACZB 2VX6A 3GYEA 4HS8H 1YLBB 4YQXH 2K8QA 2WZAA 4L1DA 1MFDL 1D5XB 4D6EA 2PW1A 3NG5A 3UPAA 1WC7B 3J2PA 3DFOA 1VB9A 2CWXA 3PWPD 2D22A 2CCWA 4LF2A 3NPSC 4L2YA 3K6OA 1A65A 4YHMH 3ABZA 3H9YA 1AXSB 3BX7C 3L48A 2CO6A 4WNQB 1D3HA 2MTAA 1B4KA 3DGRA 3UBHA 4QLWA 5HWJA 1F3XA 4O02A 1SYVB 3GK8L 3BGGA 1H4PA 1QBML 3UYRL 4Z7UF 2WBJD 2WKOA 5DXXA 2D73A 3HKFA 1L6SA 2AQSA 3S3DB 1VYRA 2GUUA 1JF1A 1MLCB 2E6AA 1TFPA 4X5PA 5B1CA 1IMHC 3V0EA 1NAKH 5K33A 4XPGH 5EC1A 4POZD 1HXYA 2OMUB 5CXPA 3MZGB 4BWLA 1JXDA 1GOQA 3K1DA 1QBAA 3QS2A 4RFOL 3T4CA 4N0CD 1ZPUA 4PJEF 1ACZA 5I8CA 3STLB 3PULA 4PGBB 2IPTL 5JOPE 4GQ0A 1D2KA 3HJEA 1JPMA 3IDGB 1PQZB 3V6FA 4HV8A 5E4OA 3C60D 2WTRB 5FESA 3S37H 4QJ1A 1RIVH 2X4QA 3T4YB 2ICEC 3AUWB 5HDBE 1GKRA 5FIPA 1I1FB 4QIRA 2KPNA 3T2PA 4PR5B 3DC8A 3N40F 3NO3A 3U6XS 1RAKA 5I79A 1SF3A 3H2MA 4MTVA 4QDPA 4I2XA 3PDGA 4KKXA 4REQB 1NARA 1NBQA 3SQSA 1BMWA 2CO4A 5T3XH 2R29L 4Y5VA 4IXHA 4YGAB 3BUPA 4ZW7A 3A64A 3B06A 1YTKA 4P8QA 1GJWA 4HIQA 4S1RH 3L2MA 3WNPA 2DZSA 4F0HA 1ZOXA 3W27A 3TFKC 4JDYA 3HR5A 1PZ5B 3VQMA 5F1VA 5JMRA 4HK3N 4TVUA 1B4JL 2PDGA 1C12A 2E46A 4XR8C 4DN3H 2DEWX 2EXTA 2ZWNA 4OQTH 3LBMA 4LQFL 1UC6A 4GKOA 4MG4A 3HQNA 4BQ8A 3DKJA 5H2ZA 4FALA 2EEXA 1UR2A 3G6JB 1VYPX 4YLBA 2YD9A 4XBPA 3BEWA 1N19A 4A2DA 5JIPA 4DZAA 1X5LA 5HYFA 2APBA 4DO6A 4LAMA 1DQWA 1MRCH 2EDBA 1LP6A 3NAAH 1H3PH 4IOSD 5CJQH 1OM0A 3TA9A 4G1NA 3BJ91 3A13A 3MU3A 3NP3A 2PLJA 3SJVE 3I9GL 1E0UA 5D5ME 1XDLA 1XR9B 2J6EA 3KBEA 4L61A 4S3BA 3UD6A 4APXB 4GCXA 1BGXH 3AB0B 4P2QA 3T1WA 1XGTB 2CLIA 2BP5M 3HG4A 4O4YL 4B6ZA 2VLLB 5D1ZC 1JAKA 1AANA 2FUQA 4ZW3A 4OM1H 1TLKA 3WBYA 2EDYA 2CUHA 2A6JB 1S5HB 4WY0F 3MGAA 2FX9H 4ILSA 4BEQA 1M6OB 1WE5A 2A0LC 4R88A 2V5CA 3W7CA 4TULH 4OH2A 3NQIA 4BJHA 5DQDL 1UIOA 1UT1A 4KVCL 5C8JA 1Z7JA 1U8IB 4RISH 3NYDA 1UM5H 4C1NA 3BQ6A 1ZHBA 5TTRA 3H85A 2NV1A 3RY4A 1HF6A 5FUOH 2YEVB 1IAOB 5C1MB 4NDMB 1BYOA 4OLUL 5HULA 4ZL1A 3E12A 1WSST 1A1MB 1KEMH 3U2SA 3H3PH 5HWMA 5H94A 2WBKA 4BKLB 5C08A 1FAKT 5EYWA 1XRFA 2MFNA 3MLUL 1T21B 2GI7A 3HIZA 3QQDB 2QPSA 4CILA 1I1WA 1LDSA 3CH1A 1JMXA 3K30A 4L8CB 3ELQA 4KS0A 3NPVA 5TE7L 4QOKB 1A7RH 4LSUL 3VFPA 2ZE0A 2FJSA 4NRSA 1YUHA 3MNVA 2BOFX 4KI5F 1XBXA 2PTTA 2BSCA 2WVTA 3A6BH 1HUVA 2FJKA 3OIXA 2YRLA 2DEYX 4W4OA 1V8HA 5T3ZH 3CLFH 5AW3B 4K8EA 3L1GA 1EJUC 1Y65A 1LP9A 3ZVVA 3GO2A 4YIWA 2COQA 3WTTA 2JKSA 2NXZD 3GRWL 3T6ZA 2VERN 4ZFFB 5BPPA 1P6AB 3HC0B 5L2KE 5I8OL 5JDJA 3Q4DA 1QRQA 1MCRA 2HFGL 5FKPB 4W70A 1JWSB 3OMZA 3NCOA 1HL4A 5HXMA 4QRAA 3QFDA 1DQLH 3BHBB 1V5XA 1AD9A 2GITA 3DKLA 1JQVA 4K8RD 2WQUA 4PRHE 1V0MA 1AGDB 4KI1A 3VI3A 2HT4D 2AMUA 1KOAA 3PTKA 1L9QA 4Q8UA 3QYQA 3IMWA 2Q6WA 3UTSA 1FCGA 3L5AA 1XQKA 5LIWX 3AMCA 3VVGA 1EHKB 2G3IA 1LD9B 1JF6A 4BXSV 3S5NA 1H3GA 3FC8A 1MDAA 4LESA 5C07E 1TRIA 3VXTA 1BZ7A 3SSJA 3BSZA 2AK4E 2V2XA 2XN2A 1IT0A 3UX9B 1MFAL 1H51A 4LRNL 4ZBJA 5IJBC 4S3FA 3VWJD 4E5TA 3N2MA 1ZA6B 5D2LB 5TGBA 3AWFA 3DHUA 3FOMB 2ZRYA 1U92A 1BFVH 2A7NA 1KM6A 5DANA 2Z1SA 3K3QA 4XD4A 4A21A 4D2JA 2HV5A 5FF0A 1OM9A 1KIRB 3W5NA 3ARWA 2NNFA 1NFDE 2MOVA 2EF9A 1AZ2A 2GKIA 1CFSA 1DE4B 1YLVA 3VOGA 3VXRD 3WUFA 5DD0L 4XCEA 3B0VC 2YR1A 2F5BH 4Y9PA 4EO5A 1J8HB 4BH8B 3QNFA 4UFJA 1RIHL 1ISZA 3PGDB 4NZJA 5JH1A 3F65A 2VWTA 4Z7WB 4N9DA 5IVZA 1O60A 1EVUA 1LE5A 1OGSA 1O5KA 1XUUA 4YS4A 2R1YA 3DDGA 2PDMA 3KPRA 3ZYZA 2INEA 1BOYA 3M8OL 2PDBA 2XJLA 4YTQA 4DF0A 1KTDA 1NM4A 5AALA 1KB5B 1XVSA 3AM8A 3HE6D 4H4NA 1POKA 1W8NA 3RBSA 3VKCA 2ZQKA 1H1NA 4FZ8H 4XN2A 3AHXA 3UIZA 2F7PA 1IX2A 1QRNE 5EFFA 1JPFA 4DF1A 3UC2A 3NL2A 4NHCL 4NQEE 1CDIA 5JIHA 1NFPA 1R1CA 5GS0L 1ZAGA 3MNMA 2QHLA 1FGNH 1H1YA 2D31B 3VXNA 3A4JA 4KNTA 4P5UA 3RL2B 2IDFA 5JQ9A 2CUIA 5D93C 2DMKA 3FUFA 4TNEA 1N6QH 5C54A 1CB7B 5EN2A 1XGUA 5D1QA 1K02A 1MCSA 1P9MA 2DT0A 1KIQA 5D7KE 2BVOB 2UXFA 3W1NA 2ZOXA 4MX7B 1L2QA 3MCLH 4LCIH 1W72A 3AW5A 1NGXB 3BZ4B 4WVXA 1QSEA 2CHWA 5HI3D 1MW2A 4Z7UE 3OD3A 3DOPA 1FHGA 1IYXA 3F85A 4HIJA 5MERB 4G1MA 1UCTA 1PIGA 5DJCB 4YHLH 4MYWB 5IJVA 2DORA 3F5LA 4TR9A 3R58A 2D7TH 4ELMF 1M4KA 4PUJA 5DJYA 3GUTA 5GGSA 2QIWA 4LSRH 4PJEE 1OAZL 1X98A 3NM1A 3QUYA 4JFFB 1BEUA 3PM6A 1IGJA 3TWAA 2WC4A 4RV3A 3BQ5A 4TQHA 5DS8A 5GPRA 1EJVC 2GUOA 1N2VA 3BO8A 1AA1B 4M3KB 4WFGE 2VC2H 3FPXA 3TCLB 4JKWA 1QLEH 2CH8A 3GKWH 5DD6B 2EPNA 1F6FB 1I7TB 1J5CA 3P2DA 3L3JA 1NQ6A 3RGVD 3IGSA 4N2IA 4H8UA 3K80A 4DP0X 2QT6A 3HMXL 1JSYA 3V95A 4LBUA 3QY6A 4PV9B 2AAVA 1DWHM 1VCGA 3P2TA 2YAPA 5AOIA 5G4EA 5KYYA 4GLRI 5JPMA 3IMVA 1OV8A 4BS0A 3O2DH 1PMYA 2F08A 2NNRA 5B1JA 3DG6A 4XOEA 2GJ6B 2WKLA 3ME0B 5L88H 2P9RA 2V2WA 3MV9A 4LDEB 1QFHA 1OCJA 2XZCL 4G6KH 3QI9B 4IU3A 3SQRA 4AIEA 5C0CE 1JGIA 5FO2A 1XLBA 3G5ZA 4JRFA 4W9IC 1RPUA 2DZWA 4MD5A 1CXIA 3DO7A 4GPVA 3NQ8A 4HJGB 2VLJA 2Q3XA 5CD3B 1W1VA 4OCMC 4N2NA 1CFTA 4YHNB 3KYKL 4G6AC 4H1LG 1JNLL 5FAAA 2AKMA 4NQCA 3FHAA 4UQ2A 4AM0Q 1A5SA 4K5OA 3RITA 5SWSB 4Y4KB 1OKEA 1K5NB 3LEXA 3VTMA 1A8ZA 2R1XB 3RKDD 5KBPA 1K7FA 3RX9A 2NYZA 5AWNL 3T0TA 2Y1AA 4OWGA 5I0ZA 3RWHA 1RVFL 5EMYA 2ZWZA 1IB5A 1N5YH 4Y8FA 3R8GA 1C16B 3TVMC 1K7EA 3D39E 4Z0XB 3L8QA 3OPSA 2ITCA 3P81A 1YPXA 2HA1A 4GIYA 4BJLA 5L9DL 4NZCA 2ODIA 2O9TA 1T6VN 4I48B 1QKZH 3O2VL 4CVZB 4FYQA 5TF1L 3BKCH 2LLEA 5D2NC 4K39A 4TUKH 3EYUH 4MDIB 3KWWA 3QUXD 1UP2A 3MOQA 3WBWA 3K8MA 2ANUA 2HTLD 3BIKB 4MD4A 5L6UA 2YJLA 3HGSA 1Z32X 4KCTA 3U7VA 5ENWA 1TQWA 4WI0A 1XBYA 4Q8VA 5JYMA 4HGWB 2XBTA 3FSTA 3IBOA 3CQQA 2W92A 4R84A 2MQ0A 1T8QA 1S38A 3PWLB 3IDJB 1VFOA 1B4RA 3IDUA 4TPRL 3MMDA 1D6VH 1JGVH 4X6CA 1P43A 1AH4A 3Q37A 5JW5B 2K8MA 2VX4A 3K46A 3OZOA 4CMHC 1N4XL 4ZXBC 1L9NA 3PHSA 5IMOB 4GXVL 4IQLA 2Y24A 1S7TA 1H9DA 3UTTD 1A5KC 3LI1A 2DS4A 1YQVL 1OADA 3HRZB 1Q9LA 5EULV 5EO1A 4WZHA 1FCCA 3P9LB 2Z25A 3BURA 1H19A 2X1OA 1I4FA 1F42A 5CBEB 4AL8L 2OR9L 4X7TB 3O6FD 5IWLC 4O15A 5JZ7D 3MRBB 1UXSB 1XF2A 1GOXA 4KJQC 3EZ4A 3SD5A 4F37K 1UWXH 2XZQH 4ZAKC 3TN0B 1KA9F 3NN8B 5KSBA 4MF4A 1NIFA 1OB1A 4C90A 2R7EB 1SEBA 4UI2A 3RURA 3S97C 2JKJA 1PKNA 3S34H 2XIOA 2ZTJA 3KBMA 2A74A 3THDA 2NPLX 1BM7A 4DGVH 1KFGA 2W65B 3WJJA 4HG4K 5CBBA 2EH8L 3EFFB 2A9ML 1F3DJ 5BOJA 2FR4A 5CJOH 3EJYC 3ORJA 4PJCA 1ESOA 2Y06H 5I66A 4BRJA 3RXZA 3Q94A 3WDJA 2ZKWA 4ZTEA 1ZGDA 2I85A 4UTFA 2VN5A 5EIIA 4JIIX 4QRPD 4UTAH 4XO5A 2FLIA 4OQTA 1FG9C 3JZ7A 2VDPH 4DJDC 5C0BD 2VDOL 5TDNA 3NM3A 5LO7A 1P7HL 3GTXA 4UWQB 4MCZA 5JHMA 1HXKA 4WWPA 3TJHC 1KG0B 4JFYB 3QUHA 5DA4A 4PODA 2QMKA 2C1PB 4N9GA 2YLAA 3LQZB 3FTSA 1ZTXH 4Z76A 5D7HA 5D7IB 4F79A 3GSUB 3BH9A 4JJ5A 4WV1A 4GABA 2QT3A 2JXMA 5GIRB 3LPFA 5J7CC 4CKQA 2G9HA 4E36A 2Z92A 2R59A 3PGFH 2AJ3B 1O66A 5I2IB 2HSAA 2DYPD 1NCGA 5HY9B 4LYKA 3SDXF 2W62A 3V2AR 35C8H 2O4MA 3N4EA 1IAIL 1EJOH 2JKEA 3DUGA 3CN1A 3EGDA 4M6OL 5GVJA 3BDYH 2OSLB 3ABRA 4NJ9H 4PV1C 4Q8OA 2ZX7A 3VAEA 2QHRL 4JANB 4LEXL 2AQQA 5AZ2H 3NA8A 2FD6H 4JTGA 4N0YH 4V1DB 4N8CL 3MWCA 1SZEA 3F7JA 3BFQG 3P4OB 3UH8A 3ZK0A 4QNPF 3KTCA 4GMTH 2O55A 4CVUA 1D7BA 2L0DA 1HIML 4XCNA 1CE6A 4B60A 3EX2A 5DLLA 3PBYA 1HX0A 4IMKC 2WTOA 5DQ9A 4XWOC 3ABQA 4G7EA 4UTJA 1PWLA 1TTAA 5D71L 4P2YA 3CC1A 1IGCL 3WLOA 3O9WC 2APWA 1HKLH 4NJKA 3VFOB 1KR0A 4KJWD 3QZLA 2J47A 4NT6A 2CJUL 4WKFA 4AC4A 1AH3A 1NPNA 2QZRA 4LEBA 4FEZA 3VGFA 4P9HH 1EXGA 5TAOA 1FVPA 1OBAA 3ROOA 2CLFA 5EPMB 3MVIA 3P30L 5IW6A 3R0MA 4UIMA 3GS0A 3US1A 2DEPA 4A6GA 3ZKND 5EGRA 5DD3H 4GEIA 2QCHA 4RMWA 4XNXL 2VTFA 4NPYA 3O8XA 4Q4IA 1ZVSA 4XZLX 3KDMA 2AJUH 3FQ4A 4XMKL 4JDZB 4XC1L 1I45A 1MFEL 1NDWA 3QSKB 2F54B 4GRLC 3VXRB 3IGAB 5I5RA 1J8RA 4MS6A 4TV5A 4HX1A 4A3HA 3GBDA 4OV9A 4DZBA 2CESA 1G6RB 1UZGA 4UILH 5CGYD 1RCYA 1NBVL 1X5MA 5BOFA 2NQLA 4XZ4A 3CG8A 5DMNA 5LGXA 2P0IA 3C3NA 1GQNA 3MY9A 3IJ7A 3HNVH 1A6TA 5ICZA 3WLQA 1KY7A 4RAHA 4N2MA 1NANI 2G5UA 5C0FB 1TT6A 4PJ7B 2HUEA 3LQAL 4G8IB 1LL1A 3RUGE 1PAMA 4LF3B 5GGRB 2BNUA 2EDNA 5EEXA 5GS1A 1OABA 3AXKA 3M0LA 2YIHA 4B3VA 3KLAA 4MMYB 4ICXA 2X40A 1FBAA 3DECA 3I02B 4I9TA 4AJWA 5GRJL 2G9KA 3WH6A 2C1HA 3SJVD 3GH5A 1TXKA 3EOUA 4KRPC 4GYPA 2IS7A 4P3CL 4JPKL 3NESA 1FJ1B 3U6RA 2GJZA 1RULH 3T4WA 4F9PC 2BVQA 4PA8A 3FX4A 3KRBA 3P74A 1YJDL 3W11C 4JBRA 1TLMA 4JGDA 1FNSH 4OBRA 2GEEA 2EKGA 1MFNA 4GC3A 3NA9L 1U8PB 5CD5C 3FMGH 4GW5A 4KERA 3G1YA 3E8UH 1CX9A 1B4TA 3P2BA 2N01B 4W9GC 1UUOA 5I6XB 3N4FA 3VNLA 4DBUA 5TE6H 3UG5A 3HG3A 1HKIA 2FYYA 1GCFA 3TNMA 1R5VA 4RFEB 2V4LA 4Z6AT 3TLQA 3QT2A 2H0FA 4UDUB 1OAXL 5D7JA 1Q0XL 3NZ1A 1W80A 1R9FA 3CMOH 1YA5A 3FFDB 4PJ8B 3LHTA 5LIKX 4IP4A 4FMKA 3IGUA 5A8MA 3Q3GA 1TITA 3CHFA 1BYBA 4FX7A 4IIZA 2UUDK 3BG3A 4RAVB 3GIYA 5JXEA 5BXTA 3VFLA 1NEZA 1AMKA 1JV5A 3BP4B 2DQXA 1GUVA 4OOZA 3C86A 3D87B 4LCWD 2E9LA 3UABA 3ZZLA 3W56A 2XSXA 5C2CA 4BM7A 4F5CE 4GSDL 1NP2A 1HINL 1XXFC 4CLMA 5CC5A 4G5ZH 4LLMA 1TWSA 3QDMB 3O3EA 1HC1A 4PMQA 4A67A 2X2YA 1MNUH 1PCXA 2WZHA 2IAMD 1F8MA 3NQAA 4A3QA 1HSBA 1GGCL 1BAWA 2OCFD 3QDJE 1LWHA 4O02H 5LAPA 3F04A 1DE6A 3RWDB