4JLRA

Crystal structure of a designed respiratory syncytial virus immunogen in complex with motavizumab
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
215
Chain Sequence
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRQPPGKALEWLADIWWDDKKHYNPSLKDRLTISKDTSANQVVLKVTNMDPADTATYYCARDMIFNFYFDVWGQGTTVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Motavizumab Fab heavy chain
publication title Proof of principle for epitope-focused vaccine design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 215
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jlrA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jlrA01
5E00A 3W39B 5MEQB 1DLHB 5DSCA 1MIEH 4NM8L 5E2WL 2ADFH 2FD6H 4K3DL 5L8JB 2EH8L 4OUUA 3M1BB 5CEZE 5FHAH 3KPNA 3PJSB 3NA9L 3BZ4A 2OCFD 5JQ6L 1YNTA 1RK1A 3QNXA 3O6ML 4HK0A 3ULVC 4XPFL 1Y0LA 5DRNA 4EQ2A 2LVCA 5DO2C 1F45A 1AQDA 3GSXA 5L7XH 5HHNB 3H7LA 3T3PF 2P1YA 3D69A 1OAUL 4PUBH 4BK5A 4MD4B 3FQWA 4JY6A 4ODUA 3DGCR 4IMKA 2AI0H 4XX1G 2BMKB 3QBTB 2C1PB 4LVOC 4MVBD 3T8XB 4ALAH 1CQKA 5IB1B 3RPIA 4MCYA 4LSPH 4QRSB 1G9EA 3F8UB 4P5TB 5A3ID 2NY6B 3GEWB 3MQIA 4L3EE 4LRNH 5DJDA 1KJ2B 3VRJB 1CGTA 4UV7L 4LLYB 2YXMA 1KFAH 4HGWA 3GJFH 1NCCL 1SM3H 1WWCA 2V2XB 4PRDA 1YUHA 1C12A 3FRPA 3ULUC 2WM0A 1HEZA 3ECBB 3HRZA 4P2RA 4GG8A 3T65B 4NQXB 3A67H 3P4NA 2YKLH 3V0AC 3VXNB 4ZUWA 4PRBA 5ADPL 4Q58C 3ILPA 5HXMA 1OAQL 2AVGA 1FNEB 1WICA 1KBGH 5D7JB 1NJ9A 2IJ0C 2VIRA 3WDJA 3TNNA 2JB6B 4JFFA 1I9JH 1LO3H 2H1PL 3TN0B 3MZGB 3IAGC 4Z7UB 4OLEA 3AFLA 1PSKL 3LKQB 2HT4C 3MV9E 1NFDE 5IM7B 1HSAB 1CFNB 5SWZB 2CLRA 5L2KB 4XPHH 4RMVA 1R3KB 5D5MA 2R1WB 3CCHB 4M61A 4ODHL 1JGLL 3STZA 3BP6B 1F2QA 3QPXH 4WEUD 4JRXE 1A6AB 2CDGA 3L6FB 2GAZA 2PW1B 1KOAA 5DZLA 2QKIB 1DQDH 3D0VA 5JMOC 1WAAA 3BPNC 5GSVB 3LHPH 1G7HB 2AV1B 4X98B 4P4KA 1JVKA 3KPRD 4Y4KC 2Q1EA 5C0CD 3D85D 5F9DC 5TDNA 4MXQD 5EU4B 5KVGH 4WI2A 4OI8A 1OM3H 4LCUA 5HGDB 3AB0C 1MCLA 1RUKH 3SGDI 4ZTOL 4KVCL 1TTFA 3LPGA 3RVVC 1MY7A 3VG9B 1M6OA 1D5BA 1F11A 1I8IA 3BESR 4D9RD 3H3KA 1CD1B 3GRWL 4K7PX 3W9EB 4AEFA 1J8HA 4R26L 1DLHA 1GL4B 3FO9A 4LCWB 2X1QA 4Y1AB 1YEEH 5FECB 3QXUA 2B4CL 3RRQA 1A02N 3LQZB 1T89A 5TQ0L 4Z7OF 1AXSB 2ZOKA 1KEGL 4GAYA 2R2HB 4DKAA 4NC2B 5A1AA 2L0DA 3IAPA 3HS0B 1RPQA 3MV7B 1ZT1B 2XWTA 1NEZG 1MCRA 1XGUA 2VKWA 4BQBA 3BAEL 1BJ1H 4P48A 1DLFL 2J5LC 5DD1L 3SKOB 2MQ3A 3QIBC 4KV5F 4GW4A 5E2WH 5C07B 4GXUN 1A5FL 1WK0A 5FYKL 1BLNA 3UZEA 3QNZB 5ALBL 2R8SL 3D3VE 2C1PA 5KS9A 1XEDA 5IB1A 3IDNB 5DZOA 1BOYA 4PB9H 4GKNA 3JWNC 2YUWA 4XPFH 1IGJB 5DURB 1CLZH 3BN3B 4GMTL 1LO0H 1H0DB 4LLQB 1EA9C 4LLYA 1T03L 3RY6C 5F3BA 4HF5H 2X1PA 1EJ6A 3AXLB 5CZXC 2XQYK 5DUMH 5IK3A 1FLRL 3FFCA 3L7EB 3G6DL 1EHAA 1QNZH 1BZ9B 3ECBA 3P40A 4FQHB 1EHNA 4X5WB 1VKXB 2WIIB 3CXHK 1JTTA 3DVFA 3GJFB 1X4YA 4APQC 5IJVB 3MRRA 4J8RB 1KULA 1UM5H 5L9DL 1C16B 1KLFA 3EYOB 5EZJB 5I1JL 4JFDE 3ILQD 3GSQB 1HOCA 1NCCH 1CU4L 3K8LA 5FK9A 3VG0L 5SX5K 1HDMA 4L4TE 3QCVL 3CLEL 2ZG2A 2QQKH 4GO6B 1P7HL 3CCHA 4PJIF 4TYUA 5ADPH 2I5YL 5EUKB 4RMSA 4QHKJ 5GGRY 5IB3B 2AERT 3P30H 4MXVF 3U4EB 1JHKH 5DHYA 4L8DA 5GZOD 4PJHA 3V0WL 4U3XA 2H1PH 1T1ZA 3L6FA 5DRWA 1PSKH 4LFHD 3CVHA 4JPKL 4LF3B 5AEAA 2QKIA 1TZGH 1EH9A 4M62L 1AGDA 3KXFA 4KDTA 1J1OH 3JBG7 1FFNB 1NLBH 5GSVA 5I19L 1G7HA 2AV1A 4U0RB 4X98A 1JF5A 3KPSE 5KJRL 1REIA 3MV8E 1GZPB 4YLQT 4OCWL 4ODHH 2NLJB 5I8EA 5EU4A 4PRPA 1CK0H 4KZDL 1LO5B 1H8OA 3QXVA 1NGYB 4OZGE 1AP2B 4J3TA 2ORBL 4JO2L 2ZPKH 3ARVA 5CSZA 1PYWA 5A16B 1XR9A 4R97C 1KLUA 1S7UB 2ARWA 1P7KA 5D96C 5I8KL 1JI1A 1XF5A 3H42L 4LCWA 1X44A 4Y1AA 2X1XR 3P77B 4K7PY 4GKSA 1IJ9A 4IRJC 1OY3B 4NC1C 4ZDHA 2YPLE 1MJ7L 4X6FA 1N8ZA 3IKCB 4ZTOH 2IALA 5A2JH 2EDEA 1FV1B 3PV6B 3HS0A 2H8PA 5JOPE 1YJDC 1N5AB 4WV1B 2CUHA 2BNRD 3GRWH 5LCVL 5KTEL 5GISH 1EERB 4R26H 3NZ8B 3JWOC 3D9AL 3KR3H 2FJHB 5HHPA 4OFKA 3MFGB 1A0QL 1EBAA 3KPMA 5FOBB 3ABZA 2JCCB 3U0TA 3IDNA 1DUYB 3BZFB 3MXWL 3JZ7A 1RHHB 2VZ1A 4YQXL 3K74B 2D7NA 3BPOB 3SGKA 1H0DA 4LLQA 1MY5A 3ARFC 1JMXA 4CUCA 1UJ3C 5TF1L 1M1SA 3T77B 1UH2A 5HSFA 1RZKL 3RWIA 1J12A 3L7EA 1NGPL 5IMMB 2AKRA 1X6LA 4JEGB 4FQHA 5FYKH 2E6JA 3B2VH 3DGGB 2R8SH 1KYOJ 2PF6A 1I1YA 1ZE3C 5EDXA 4RIRB 4JFYB 4ZFGH 4GKZA 4YUEL 1SHMA 4J8RA 1J86A 3RVTC 4GMTH 4HWEL 4HZLB 3LKSB 4HW6A 2O5ZH 4CJ1A 3ARBA 3P0GB 2JJTC 3OKMA 3C87A 1KLGB 5HYJE 3P0VL 2X7LB 4M93B 2FEEL 4YEEA 3MXVH 3HB3C 1CDGA 1EPFA 1FLRH 4IS6A 1ZS8A 3L3GB 4GG6E 2EDTA 4PJHF 3MGOA 2VE6A 1LK2A 2YEZB 3GMLA 3MUHL 3T3ME 4F33A 4OCXH 3U82B 1I8LA 3ZE2F 3BMVA 4PD4J 4F80A 4KY1H 5L9DH 2IFFH 4NRZB 3KHQA 4JQXC 3RWEA 2F54A 5FCSH 5K9JH 1T0MB 3QIUB 4ETYA 3GKWL 4MNQB 3U46A 3T04D 1OP3K 4XNMB 3CLEH 1RIHL 2ERJC 4LEOB 2HVJA 1JWMB 1FZJB 3WV0A 1GZPA 5IG7A 4C56E 4LVHC 2NLJA 1U93A 2NR6D 3FT4B 5FA4A 3WEXA 2DQUL 2P46B 3OAYK 3V5HA 2BCKB 2ICEB 2EEDA 2Z4QA 2GTWA 3WSQH 3GHEH 1Z5LA 4PJXF 4R7DA 4OT1H 4OCRL 3L1OL 1E4KA 5KJRH 1WFTA 5GS0D 4NBZB 1A6UH 1F13A 2BVQB 4OQ1A 4LIQL 1JHTA 4KZDH 2IPTL 1FC2D 3AM8C 5CEYA 4GT7A 2BY1A 3GMNA 4JANB 1A3RL 4WDIA 4JO2H 4Y2DB 1SVCP 4LSSL 2EYTA 4HUMB 5F44A 1T7XA 3PWJB 2BVTA 2AEWA 4PGEA 1R0AH 4CMHC 3WHE0 3H0TB 4MMXC 1QSFA 1GOGA 4BKLB 1MCBA 1PKOA 3QUYC 4IM8A 2VDOL 5FOBA 4NNYB 3RUGE 2Y6SD 3QIWC 1VFUA 2DD8H 1HYRC 5FGRA 5BW7C 3UYRL 2X40A 1NC4D 1V7NL 3DUHA 5K59E 2NY3B 1KUMA 5ENWB 2F8OA 5JUEL 4WO4D 5LCVH 3UTTA 2OBGA 3A6BH 3PDDA 3DI3B 3LRSA 1ZANL 4J4PD 4ZUTA 5IMMA 1A0QH 1FHGA 1Q8MA 4P3WA 4NOBA 1D5XA 2PW2B 3MBXL 3RAJH 4UT6L 3RL2A 1IAIM 4JQIL 2A74B 3MXWH 3BQUB 3BKJH 5INCA 4KJQC 5E03A 4LVEA 2NY2C 4HZLA 1QFWM 3MBEA 3FONA 5F1KC 4H8WC 4OQTH 4DK3A 4IRZL 4XXCC 4UOW1 2OX5A 3INUH 3OL2A 5FYLL 3TF7C 4PG9A 1NGPH 4ZFZB 2JK5A 3MRJB 4LSQL 2A73B 4CADB 2YSSB 5SV3A 1MCEA 5FGCB 4P46D 1FPTL 3PABB 1H15A 3TO4B 1GOFA 1YEIL 1ORQB 4HWEH 4FXGA 4MDIA 1DQLL 2CO7B 1U58A 4KPHH 4K8RH 4PJ7E 5TFSL 1BBJB 1HI6B 1II4E 5F6IC 4BUGA 3U36B 1RJZB 3CFEB 1AI1L 3UROR 4FQQA 5BZWA 2BNUB 2B1HL 3K8KA 2XQYG 3WIFB 2BY2A 1FLTX 3NZHL 1KACB 1P7QB 3HPJA 5DUPL 3T1FB 5FYKU 5IB2A 3MRCB 1TXKA 3KYKH 2ITCB 4G9DA 2MQ0A 2D9QB 1F5WA 5E4EB 3O8XD 2ICEA 5ILTL 4UI2A 1KN4L 4YK4B 4HS6A 1BD2B 4LLVA 5HPOA 2FR4B 4D9QD 5F72S 1MFEH 2AXHA 2LTQB 3VWJA 1G9MC 4OJFL 3ARGC 1RIHH 1S8DA 1WUNT 3BDXA 3RKDD 3EFFB 2EE9A 1YEJL 2BVQA 1FJ1B 1T22B 1KCSH 1YA5A 3DVNB 4I8DA 1KJVB 1NKOA 4F9LC 4ZD3H 1ZLVH 4DGVH 5C6WH 1CD9B 1A7OL 2E3VA 4I18C 1X5LA 4JANA 4KKAC 4RWYL 5HPMA 2FBJL 1CD8A 2XTJD 3O3UN 4H26B 5GS1A 2PXYD 5SWSE 2B8OT 3VXUE 5C7XL 4JFEE 3MRKA 3BGFC 3MV9A 3W5MA 3WIIL 1NFDA 2VUYA 4BKLA 3QUXA 3BZEB 4LIQH 3MNZB 4WFEE 4WJ5A 3BFOA 2HT2D 4QHNB 3GJFK 5IJKC 3GNMH 4DZ8B 3BH9A 1BHGA 1S9WB 1VFBB 3HUJB 2HAZA 2VAAA 5I1HL 3PV7A 3EFDH 3EYUL 1WIPA 4NT6A 5INDA 5C8JA 1XT5A 4JRXA 4U1LB 5HYIA 2WAHA 4PREB 1EO8H 1KB9J 1AD0B 1U92A 2MCPL 5BV7H 4F3FA 3JWDL 3HTLX 1WLHA 4R2GD 2R0KH 4U6YA 1CTOA 1QLEL 5MEPB 3WKNA 3BUYA 2VDOH 4Q74A 3NFNB 1AKJB 1EO5A 3VA2C 1PG7L 2IADB 2IGFH 5E8OB 2FZ3A 1A22B 3GSNL 4LNRA 4ETQA 1UC6A 5FA3A 4ZTPL 1A7RL 1KEML 3GI9L 4Z7VE 4M02A 2Z0BA 1YPZE 2Z8RA 4KKBD 5HHXH 4TVPE 3LS5H 1F4HA 3UAJC 5JHDD 5JO5A 5SWQB 1UA6L 3EOBA 4WCYL 3ZDXE 2XT1B 4XWGH 4K94H 3OKKB 4CMMB 5DA0B 3BKCL 4I0PC 2CRYA 3VFSA 1QTYT 4KZEH 1M71B 4U1GB 3AMKA 5FYJD 3VXPB 4CADA 2A6DA 3I3DA 4UT6H 2DL9A 4JQIH 4AM0A 5IWLC 2GITA 2PYEB 1J0YA 1IZJA 3PABA 2W92A 4HHAB 3FRPG 1A14H 1QBAA 4XMPL 3MUGB 2H2PD 1DJSA 1P1ZA 1SEQH 1IRAY 1G1CA 3RZCB 1NC2A 3QB7C 3RGVC 2ILLA 4WWKA 3HN3A 4RGMC 2GYSA 1MCQA 4S1QH 2IAMB 1IL1B 2FL5B 3U36A 4XNZC 5TJWK 4LSQH 4KQ3L 3RIAF 1ZTXH 3PNWA 4BSJA 4QRPD 4R0LC 2YPKB 5DS8B 3WIFA 3RHWF 1AXTH 1EIBA 3L3HB 2EDQA 1ZA6B 4G5ZL 3T1FA 1HWGB 1KPRA 5FKPB 2BVUA 1IEAA 3WS3B 3RNQB 1MOEA 5TFSH 5LVEA 1DVFB 1KCUL 2DJUA 1MJJA 2FR4A 2J4WL 3HNVL 4AEEA 4PRHB 3ZYJA 1AI1H 2B2XL 3TZVD 5IEKB 1XCTA 3QRFM 4A6YL 3LPWA 3EFFA 3STLB 1DFBL 3MLTB 3NZHH 4LKXB 1TVHB 1KJVA 4NO3A 5DUPH 3DX8B 4YE4L 1NAMA 5J1AB 2Q3ZA 4KVNL 1E6OL 1P5VA 1J1PH 1KN4H 3NN8A 5E70A 1KIPB 1OPGH 3VXMB 2RQ8A 5D1ZC 3ES6A 4OJFH 3EUUA 3FO0L 3U4BL 3QI9B 2VERN 5F7EL 5CD5D 2SEBB 3W5NA 1K4CA 2H32B 3FTGA 3LDBC 3OHXB 4R7NA 3TJEH 4I0KA 1GCFA 1RIUL 1YEJH 1L7TL 2ZOLA 3GB7A 3BZEA 4TSCH 1DCLA 4YHOH 1G9NC 3MRFA 4JQVA 2Q8BL 3SE9L 2Z8SA 3PHQB 5BRZA 2YD9A 1L0QA 2YC1B 5IVXB 2OL3H 3PWPE 1S9WA 3MRMB 1VFBA 4RWYH 2FBJH 3HUJA 4OF8A 3LEXA 1E4JA 3EJYC 5GGVY 1FNHA 1FO0L 5C7XH 2E6QA 1XGPB 3ZDYE 1JUFB 5F89A 3BWUC 1A6TA 3REWA 5GRWA 3O4OB 5ECJE 3JVGC 3KPSA 2R0WL 1AKJA 3MV8A 4JM2B 1S78D 3GSUB 3MCG1 2IADA 1HQ4A 4MLSA 1YQ2A 4KUCD 5I1HH 3UPAA 3NGBB 3F7QA 4OGAC 1DN2A 4OZGA 4Y89A 3SDXF 4DAGL 3MRLB 3S96B 3SDCC 3X12B 1YMMB 3IDIB 3BPCB 3OKKA 1WEJL 4KKCC 3SQOL 1QA9A 5DVOA 3PQYB 3CUPB 2P45B 1DBMH 3SDAB 2CK2A 1IEBB 3OTTA 4Z78B 3CU7A 1H5BB 2YD7A 5HBBA 3VXPA 3OKDA 1A7RH 4QY8A 2R0ZH 1UXSB 4EI5D 1MJUL 1IC5L 2HFTA 1JGVL 4NZTL 1UA6H 3OJMB 4MS8D 4ZFOA 4QNPE 5GZOC 1WCQA 3PWLB 1VESA 2XNAA 3BKCH 3Q0HA 4JHBA 3NCBB 4OF6A 1EFXA 3PHOB 5J57B 1OHQA 5T3XH 5GRZA 3TH2T 1CL7H 5HDLA 1RMFH 1LK3L 3L3HA 1ZA6A 4XMPH 4F7EA 5D6DA 2VR9A 5FM5O 1UB5A 3L3IA 5J56B 2DQHL 3B43A 1MH5B 3ULVF 4MYWB 2GW5A 3CAFA 1T3FB 4ZPTB 1DVFA 1C08A 4G8EA 1B4RA 1NL0L 2BSTB 2FX8L 3QG6B 5IEKA 5H94B 3QFJD 4LKCA 2H41A 5DHXB 3ZKQD 3CFJA 2XV6B 4K07A 3BP4A 1CDCA 3DUUA 2FO1A 3EKCA 3GZKA 3S9DB 1T6VN 1NDGA 4P59L 1CBVH 3WJJA 3W81A 1SBBA 2AV7B 2YR3A 3RL1B 3BUTA 4N8PA 3DVGA 1MCFA 3UZQA 4IJ3B 1KCUH 1UYWH 2J4WH 3VXMA 1K4DB 1FL3A 4M8QB 3RVUC 3KPRE 2H32A 4QXTA 3VE0B 2D03L 2GY5A 4A6YH 5MP6H 5I71B 3W0WD 1SJHA 5CP3H 1DFBH 4PJBE 4R4ND 4H20H 2VLRD 3EBAA 5MEND 1YEHH 1D6EB 1T0NA 5FV2A 3PHQA 4YE4H 4RGOH 3V8CA 5IVXA 4G8GB 3UO1H 4KVNH 1E6OH 5FB8B 2ADJA 5D1QB 1QQDB 2CMRL 4ZAKC 4D9RE 1KXVC 2NZ9C 3PXHA 1G6RL 5CJQL 5GIRA 1XGPA 3VFOB 5HD8C 5DI8B 3T2PA 3FO0H 4RRPG 5F96L 3FRUA 4OI7A 1F00I 4N1EA 3R4DA 1L7TH 2K7QA 3EGSB 1MIML 2NXZB 3LKOB 1FNAA 2Q8BH 3QXDA 3RGHA 1TVDA 1ZLUH 4JM2A 1AR1C 5KBNC 5CD3B 3BSZH 3NFPA 3VXSD 3B8YA 3SKUD 5FUCE 3TVMB 5JORB 4Z76B 4N0CC 3MRLA 4LCIL 1YMMA 1IGML 5GSRB 1DDHB 2BHUA 1ITBB 3I6KA 5ESQB 3PQYA 2VABB 3CNKA 3TYFA 3HLAB 3NIGE 4OLVL 2R0WH 4YXLL 2V5SA 4G42B 3QQ3B 4D2NA 2NY1C 4PJFA 5E4IA 4N9OB 5MI0B 3KPPB 3Q3GA 4YFLF 4BELD 1UXSA 3OJ2C 3N1MC 2GUOA 4DAGH 4F15B 2IH3A 3C09B 4CN6A 1NCWL 2PO6C 1RVFL 1WEJH 5EZIL 3W2DL 3RDTD 2O5XH 4NKMA 1MWAL 1UKSA 3MLPA 3I9GL 1G7MB 4G3YL 1FORH 4PR5B 4JN1L 2CDFA 3ZKMC 1MF2L 3PHOA 4O9HH 3MRQB 4OFYA 1MSPA 2W1NA 4QO1A 3GMPB 1GGBL 3NIFF 4Y5YC 2BFVL 1J87A 2DMKA 3RUGA 1PY9A 4HX1A 1FNLA 1YY8B 3ZYIA 3MRGB 5IHBA 3N06B 1JGVH 3RY5A 3OG6B 1PFCA 3SE3C 4AENA 3BXNB 2NPLX 2AK4D 5I66A 4ZPTA 4Q6IA 1VADA 1XGYH 4TRPL 3CFKA 3QDME 2BSTA 3QG6A 2I9LB 5HHQA 3BVNB 3HRPA 4P2OD 4E0RA 4P2YA 2X09A 1U3HA 5B8CB 4GG6F 2YHGA 3QUMA 5HGBA 2Y5TA 3ZT7A 3H7BB 1V05A 3C5SB 3S35L 1JJUA 3O4LD 5KSAB 4XVSL 1OARL 5D7IF 4O2EB 3JUYA 3G5VA 4G6JH 4LLMB 4M8QA 1U8IB 3CDFA 4EOWL 3LV3A 1OAKL 4M1CC 3PL6B 2FX9L 5L8KB 5T1LA 3FQRA 2IPUG 2HKFH 3IFNL 1E4XL 4P5TC 3KYOB 2NY6C 4G8GA 4P59H 4A6YB 3B5TA 4ODWA 5FB8A 4XCEA 3AS1A 3HMXA 2X89A 5HHVL 1WIUA 2EO1A 1KENL 2EIDA 3BIKB 3CXHJ 4FABL 5DI8A 2XG5A 3RA7L 3GBNL 4XMKL 4PJ7A 1OD9A 2EKJA 4X6CB 2ZG3A 2DICA 3EGSA 3OZ9L 3P73A 3E6HB 5JNYB 3DECA 3HE6C 5E95B 4B50A 2HVKA 4K9EC 4OFIA 4K23H 3C5ZB 4MD0B 4GW5B 3CH8A 3G6JB 4WHYH 5D7JC 4YX2H 4XPBL 2G9HA 1BM3L 5AYUH 5MERB 1NSNL 1AO7B 3TN0C 2ZUUA 4HKXB 1KTDB 1AD9A 3R0MA 2Z91A 2ATKB 4ZUUB 3W9DB 1R3HB 5T3ZL 3K80A 5BVPH 2VABA 3LEYL 2EDDA 3HLAA 4U1MA 4LLDB 2DLHA 1J5OL 4G42A 2Q6WA 3QQ3A 4F58L 1HILB 3VGGA 1HXMB 3MO1B 3KPPA 5JLZB 5CILL 3F58L 3C60B 1U91B 2N7AA 3QXAA 2VLME 4LCIH 5GRXG 4ZFFB 4PJ8B 1O7SA 2EC9T 3GSNA 2CIKA 1RUQH 5EIIB 3P3YA 4TVSa 5SWSA 2R2EA 3MNWB 4OZIE 1N3NB 5K59F 1HYSC 4YXLH 1YYLL 4M5ZL 3TYGH 3GMPA 5JPNB 4O2CB 4XMLL 4JY4A 5FO8B 3MRBB 4TNWF 5A2IH 1FYTB 1JMZA 2X4SA 4MLIA 3VG9C 3TBYA 5F7FA 1NCWH 2WMPA 2X42A 2A38A 4M03A 3O8XC 2XRAL 2EDFA 5EZIH 1CVRA 5H2BB 3M8OL 1A7QL 1KPVA 1FVDA 2ZKHL 4PV9A 5C0DA 3VFUB 3BP7A 5IKCB 4Y4HB 1ZLVK 2GT9A 4JN1H 4IRSA 3QEUB 4OD3H 5KVEH 3OKEA 2I9LA 5I16A 2D2OA 1RIVL 3RKDC 5ANME 4MA7H 4MJ5B 5AZEL 3ZE0E 2EDYA 3X3FL 2AJXL 5C0JA 3H7BA 4JFOB 4EEEA 3LKRA 4Z7VA 5JW4R 1LGVA 1YPZA 3CLFH 4JPWH 4LOUD 1JV5A 1ZKAA 4CNIA 2PXYC 3VWKB 1JN6A 3NPSB 3P4MB 1I7TA 2DLEA 3LSOA 1U8IA 1IQDA 1I1AB 3CJJA 2DBJA 4ODXA 4LRIC 1BFTA 3PL6A 5ICYB 5F7DA 2COQA 2JIXB 4MA8H 1HHKB 4WTWA 2HN7B 5C9JB 4KKLD 2VLKB 4JFQB 2HT2C 4HUNB 3MLXL 1T1WB 5C08D 2ATPA 1OARH 1NUGA 3TBVA 2R56L 4LSDA 1BZ7B 2N1KA 3SOBL 4ERSL 4UIKH 5E8EB 4EOWH 2NZIA 3T0DA 3U79A 5CS7A 1DEEA 4QYOA 1AGCB 2FX9H 4MB3A 4OSUL 4H1LA 4X6CA 5DR5L 1TZIA 2FO4A 4HDIA 4I77H 5H37G 1MI5B 4OLZH 5JNYA 1E4XH 2YS4A 1HE7A 5I1CL 4W6XB 4OM1L 5CEXB 1R5IA 4MD0A 2NQCA 1FG9C 4PS4L 1PEWA 1IBGL 3G6JA 4M4PA 4QGTA 5HHVH 1PQZB 1S9XA 1CIUA 3QP3A 1T83C 3VGAC 1KN2L 5IVOA 4X6DF 3TIDA 1QLRB 2BVOB 1RZJH 4X99B 5ADOH 4XMKH 4G6ML 2ATKA 3V6OC 2CIIB 1Z9LA 3T2NL 3OZ9H 1FO0A 4FXKB 3VGHA 3MR9B 3EHBD 3VDCA 1BF8A 4LLDA 5HYEA 2AJZA 4Y19D 1P6AB 1DBJL 1OSZB 2ZCHH 3MO1A 4QOKD 3D1MC 4YHPB 4AMKL 4S1DD 5CEZH 4XPBH 1BM3H 2OS7A 4ZYKA 1P4IL 4HUVA 3AREB 2ZCLH 2CKBH 5CINH 1CLCA 1U8KB 1LNUA 2XA3A 1ES0A 2VL5B 2I07B 4K3JH 3MNWA 4WW1B 1PEZA 2HJFA 3GFUA 4W4NA 5T3ZH 7FABH 3DURA 4U0RC 1FSKB 4DKEH 4XHJD 3MREA 3D48R 1WBYA 1F6LL 2YD8A 3WXWH 4NZDA 1FAKT 3H3BC 2WNGA 3CZFA 4O2CA 3C2SA 2JB5L 1IC7H 4HFWA 5FO8A 3MRBA 4CVZB 5FO7A 2X5PA 2EYSB 1BX2A 3ULVL 4YPJA 3IJYA 4HPOL 3LKPB 4YAQA 1BMGA 2IAND 4M8VA 5H2BA 5I1IL 4F9PC 4Z7VF 5GRUL 4Q9RL 3B9VA 2W0LA 1G6VK 1CICB 3I84A 5E6IB 3QEUA 1YYLH 3TZVC 3T4YA 4OM0L 5F9OH 5T1MB 1HXYB 2J12B 2GSGA 5ERWB 4MJ5A 4NCDA 2DTML 4PJDA 2H9GB 3KDMB 2GK0A 2E7CA 3C6LA 4HBQA 4PP1D 3PGFL 4TULL 3LKNA 4N1HB 1ZMYA 4WW2B 1CI5A 3BHBA 3GSWB 3P0YH 4WV1C 2ZKHH 3QFDB 2A6JB 4P5MB 3QH3A 3IVKB 2AJSL 3RBGA 1WQVT 2R1YB 1KIUA 3T09A 1KIRB 2HTLD 4AJ0A 4G7VL 1MRDL 3ULUL 3OPZH 2IQ9L 4MNGE 1JTOA 1ZHLA 3B9KD 5HI4D 5B4MC 2JIXA 3ROOB 1F58L 2ZUWA 4KTDH 1G1YA 3GMOA 2VLKA 4JFQA 2VDQL 4LSUL 3U9PL 1OGAD 4M48H 4N8VA 3HPLA 4F7CB 1KG0A 1I7ZA 2XY2A 5EU3B 4QWWC 1YC8A 4GAGL 3DARA 3TLRA 3ULSB 1MI5A 3QQ9C 2V2TB 5EBMB 4DFHA 3OXRA 4P2RD 4L4VB 3VMNA 4NO0B 5TDPB 1AHWC 1EEZB 2BDNL 2XTJE 1ND0A 2R56H 4MA1C 4M93C 3SOBH 2YA0A 4WI8A 3KS0J 3SKJL 2KBGA 2X2YA 5JOFB 4X99A 2HFGL 3E3QE 2OZ4A 1TCRA 1S9VB 4IHOA 5DR5H 3VW3H 3QULA 1H3WM 3GUTB 1ZGLP 4CBPA 3ESUF 1G6RA 2P44B 3O6KL 3SDDC 4HUUA 4ZS7L 5I1CH 1FGVH 1W0YT 4JM4L 1EVUA 2NTSP 4UDUB 1HHJA 4WNQB 3WKML 4P9MH 4EI5C 4X5XB 5HHOA 1KN2H 4MDJB 4FN0A 3WO3B 4NO2B 5IOPA 1U8KA 4G6MH 4WW1A 4X6EA 5AUMB 3EOAA 5B38B 3GMRA 4JO1H 4DCQB 4KH2A 4HWZA 4P57B 1A47A 4NOFA 1DBJH 1LO2H 1BIHA 4JO3L 3DMMB 5JXEC 4AMKH 1O0VA 1B9ZA 2UWEE 2VL4A 1ZLWK 1AXIB 4P4KD 2I27N 3VFGL 5JHDE 1P4IH 3N85L 4TQEH 2OI9B 1R3LA 4HKZB 4HS8L 4WFHE 1L4IA 4HXBL 1X5KA 4QHLB 4YDIL 5L6YL 1QFHA 2PCPA 4BA8A 5LXGH 5ESVB 1MHHB 3V4PL 1U42A 5E6IA 4Y4FA 3VCLA 3GMQA 3FAXA 3AVEA 3MJ8A 2NW3B 4XI5D 1DN0B 2JB5H 3SGEH 1MWAA 3Q5TA 4L3EB 1J8HD 2HLAA 4NN6C 3BD4A 4WW2A 3ULVH 4Y5VC 2EDJA 1UWEH 1J9CT 1IAKB 1MHEA 2V2WA 3I6GB 3X3GL 1NCAL 3O9WB 4Z7NF 1Z9OA 4UAOC 4N0YL 2R0LL 4DVRH 5I1IH 5LGHH 3QFDA 5K9OA 5GRUH 4Q9RH 2DQFA 3DIFA 4LSVH 3U9UB 4S1SL 3QEQA 2FGWH 1KT2B 4WI5A 4OM0H 1IC4H 2CO6B 2R4SL 1MCHA 2VTFA 1ACYL 1A3QA 5JW4N 4JZJA 4YIQA 4XVUD 1W0VB 3BW9B 3SKNA 4UBDD 4DVBB 4TULH 4IBLT 1SVZA 4Z18A 4RFNC 1QEWB 4IDJL 2NY3C 3V5KA 5I74C 4L9LA 4RNRA 2EDOA 2AJUL 4HD9A 4PGJA 1ZLUK 4KK9C 4XX1E 1KJMB 3DX6B 2O5YH 3C2AH 5I1DA 4NFCA 2BSRA 1OW0A 3F12B 2CXKA 3FFCD 3BQUC 2DN7A 3TP4A 2VDQH 5A43C 1ZA3B 5M7QA 1RJYA 4PG2C 1F4YL 4QLRA 3HC4H 4G9FA 5DUBA 3MUJA 2G75B 4KUZL 4KGJA 3L5WB 1NMAH 1K5NB 1CGWA 5KOVC 5IROC 3T0EB 3P9LB 5DEFA 4DFIA 5F8QC 2Y36L 1ACZA 3QDMA 4K71B 4KRLB 4RISH 1JPTL 3QZWA 1OWRM 1MQ8A 5EORH 4O2FB 2V7HB 2V9RA 4DN4H 4WNQA 5GZND 4PJBF 4YZFE 4EI6A 4X5XA 3SKJH 1SYSA 4MDJA 3ZT6A 3N1QC 3SDXB 3RWCB 3PWVA 4G6AD 4FQCL 2VXTL 4I3SL 2OQJA 3MRIB 1C5BL 1S7TB 4M7ZB 3O6KH 4ZS7H 4DCQA 3NH7L 4JM4H 4X83A 5C0BB 1IM9B 3KXFD 3I85A 3WKMH 3ESVF 3WLBB 3C9NB 1LEIA 4Y16B 1MRCH 4WI3A 5E4EC 5E8NB 5JDJA 4XCYB 1QBBA 3KJ6H 1YJDL 4O51A 1XF3A 2NYYC 1KCRL 4PRPD 1IQWL 5E2VH 3D3VB 2LTQC 3QJFB 3U83A 2M8XA 5ESVA 3MTRA 2CUMA 4PGBB 4Z6AT 1OTSD 4QTIH 3JWOL 4Z7WE 1N26A 4KJWC 1CXFA 4URTB 1BJ1J 4KHTH 3PDOB 5EU5B 1EVTC 1DN0A 5F88A 5C0FB 4YDKH 1C5DB 3JV5A 3OR7B 4Q9CA 4LCWD 3TV3L 1HCVA 1GIGL 3F5WA 3MACL 5GS3A 4Y1AD 3NIGF 4CU7A 3FB6A 4HS8H 4UMGA 3I6GA 2XZAL 5DF0A 3O9WA 1I3VA 3MMEA 5IVZA 1LILA 3H8NA 3V4PH 1DL7L 3S97C 5DMGC 3KLAB 3BKMH 1HH6B 4YBLC 1KT2A 1D5ZB 4DUXA 4XCCL 4OD2A 2EXYD 3GDBA 4JFDB 1DP0A 4FQXA 2YN5A 3ARUA 1KXTB 32C2A 4MAUH 4D0BA 5CFHA 3VFVA 4U1SA 2LAGB 4KK6D 1QEWA 2HYMA 1A6ZB 3FHAA 4PP2B 5JIPA 4YXHH 5CMAA 2OP4L 1NCAH 4ZNEE 4GBXC 4LVOB 4UB0L 5KSBF 5LGJA 4MB5A 1BWMA 4L4TB 4YHLL 4NM4H 4GQPH 1Y18B 4NQDA 4S1SH 4P5KB 5DURD 3DETD 4OZIA 3DSFL 1JHLL 3ZHKA 5HDOA 3IB4A 2FIRT 3LRHA 3G08B 3VD3A 1S7QB 5DDHB 3F12A 4PJCE 1FZKB 2BVPA 1ZA3A 1OCWH 2P5WB 3GIZH 1RZGA 3AY4A 2AJUH 1FZMB 4XNYL 5I1KL 3BPLC 4NRXA 2H26B 1OGTA 5ABDE 1NMBL 5CGYD 5IBTH 3TA3A 1N2RA 1SQ2N 3WDHA 3PWUB 3ARBD 3FT3B 5TPWL 3V6ZB 3W0WE 4NDMB 2GHWB 4LQFL 4XC1L 2RAMA 2Q7NA 3K3QA 2VLRE 4JAMA 1B0RA 1VPOH 4D9LH 4O2FA 1R5VA 2V7HA 3DV6B 3WFDL 2F74B 2HH0H 4HLJA 1W72A 2QV2A 3ARYA 4YWGL 4OZ4B 5EBWB 3QDAA 4HKBA 3RZCC 3S37L 2Y9RT 1D7FA 1RURL 2P7TA 4LEXL 5JZ7D 2IAMC 1S7RB 2HMID 2X9YA 2Y36H 2YPLB 1FL6B 3MRIA 2F54D 1JPTH 4EDXB 3HZVB 4ODSH 4K8RC 4XHQA 4HEME 3VXSE 3EYFB 4Y2OA 2DM4A 4NPYA 4S1RL 3BPNB 3WLBA 5L2JA 4BZ1L 3C9NA 2JELH 4ODVL 1ITCA 5CIPH 5IB4A 2FYYA 2RR3A 4JKLA 1E27B 4EDWL 1OAXL 3FB5B 5TQ2L 2CK0L 3QO0A 3OXSA 1Q38A 3B2UD 2IWGA 4FQCH 2VXTH 5JW5A 2W9DL 4LLAA 5IW3A 3AGVA 3U4AA 1QFWI 2IEPA 2YN3A 1ZVYA 3LY6A 4OKDA 2HG5B 3KNBB 3PDOA 4UTBL 3V4UL 3RWDA 4J6RH 3KWWA 4UNTA 3GO1L 4FTVE 3HI6H 3LQMA 5D1XC 5LAXB 4RGNC 3PGCA 4Z77B 3SJVB 1JWUA 2AGJL 1I8MB 3SKMA 5IHLB 4MMZC 4KK5D 3B4NA 2J8UB 3JSSA 1CZ8L 4TTDC 1N59B 3JWOH 1K9TA 4E41A 1R5WA 4JDTH 3KGRA 4WTXA 5HYJB 2C7UB 3E0GA 3QIBB 2DS4A 3GI8H 3SGJC 1QSFD 5I2IA 3BE1L 1J88A 4L5FL 43CAA 2VDPL 1QPXA 4FQ2L 4XGZA 1YEDA 4GG6B 2XZAH 4WO4A 1F02I 3K4DA 2R2BA 2ZNWA 2AK4E 3C5JA 4H8WL 1AQKL 2CRZA 8FABB 1KIQA 1YNLH 4G43A 4F2MA 4P5KA 4J4PA 5DD3L 5D7IB 4OV6F 2FB4H 4V1DE 4X7TB 1XIWB 2NTFA 3D39B 4ELME 3UTTD 1VENA 5BV7C 5EA0L 4EN3A 1S7QA 1LP9E 2P5EB 5KW9L 2FEDD 4H25B 1XZ0A 5I1LB 2VDKH 4KI5D 4PTUB 1JGUH 3O4LE 4FQJH 4MSWB 2NX5B 3Q6FB 4MAYC 4YHLH 5AYQA 3ZE0F 4APQB 2H26A 4R96B 4AYFA 4HIJA 3DX7B 1F3JB 4UQ3B 4QXWA 3ZSTA 2DLGA 5D2NC 3IU3A 3ZKSD 3MROB 3SDAC 1IGYB 4Y8DC 3FT3A 2CLZA 3MBED 2IFGA 4NDMA 4BFGA 3K2MC 3SO3C 5JMRA 3HNTL 2EZ0D 4K94C 3UC0H 4JR9H 1B3JA 2WBWB 2XY1A 3QPQC 4P46A 3TBWB 4N90D 4X7DC 2R15A 5GJSL 4X4YB 5DJAA 1G7IB 4RFEB 1XF2B 3OJDB 4JN2B 2EC8A 2XPGA 4GRMB 4IOFD 4Z5RA 1JIBA 4J12A 1MQKL 5J6GB 3QXWA 4GH7B 3LH2L 4UU9A 2HWZH 4JRWA 1KC5L 1T66C 1G9ML 4LQFH 3NIDE 3TIEB 1EV2E 1FNSL 5IQ9B 4MNGA 3QIUD 4JPIA 4NQEA 3WFDH 1HHHB 3ET9F 5J89A 3EYFA 4AG4L 2KQNA 4FZ8L 4U31A 3VA6A 3RIAK 3SY0B 2Z35B 3S37H 2X4QA 2E7LC 4Y4KA 2X4UA 1OTTC 1S9YA 3VXOB 5IMLB 3FB5A 3RHWK 3HE7A 1MUJB 1JNHB 1D3CA 5CIPB 3AUVA 4TUKL 3U0WL 4U1HA 3T4AB 3K4ZA 4P23B 2FH8A 3E8UL 2LQRA 4LSTL 4X9GA 4W4OC 1F4XH 3VJ6A 3GSOB 3KNBA 3O3EA 5FKAB 5IW6B 5D96B 3ALXA 2ARJB 3CVIH 3VWJD 2UZIL 2NY0B 3JV0A 1IGIH 4S0SD 5LAXA 3EYQD 2DYPB 4ODVH 4LK4A 4LGSB 1MFNA 3THML 1SY6L 5J1TC 2WBKA 1OAXH 1X5FA 1I8MA 2CK0H 2D7PA 4IRJB 1CDIA 4TVPH 4ORGB 5ISZE 3TBTA 2J8UA 5D70L 2DQIL 4Y2DD 5HI3D 1KCLA 1EO7A 2ZUQB 2ED8A 4HGKC 2HTLC 4HJGB 1MLBB 4UTBH 3MLSL 4ZQKB 3GO1H 3LPFA 3QCTL 3QIBA 3MV9D 4ONHB 4PLJD 3WIHA 2AGJH 2VO5A 3QUXD 1VEOA 4IMKC 1ZAGA 5D1QC 3SHSA 5ID1B 3EYSH 1RZFL 4BSWB 1RV6X 2ESVB 3UTZB 2W60A 5HGGS 1JK8A 4ZPVB 4M43L 4LLUA 5F3HB 4JRXD 3IXAA 4X7TA 3V7AG 2KUTA 3D39A 1LWRA 5EOTB 3MRDA 3ZHLA 5TH2B 1VEMA 1WBXA 2A6KA 4JFPA 4BFIA 3VXTB 2X4OA 1A7PL 4C58B 3TVMC 1FNGA 4OF7A 3WFEL 3BKYL 4QHUB 4X0KB 3D87B 2DOCA 4APQA 4H8WH 1AQKH 3L3DA 3F7YA 4UTAL 1M7DB 2J8OA 5KZCB 4NKOA 5DLML 5DD3H 5GGSA 1IEHA 4GRWE 3HA0A 1BOGA 1CT8A 3O11A 3S8WA 5KW9H 5F93C 5D2LE 2VXVH 3IFPA 3F65A 4PGDB 4X4YA 3FQXB 3HAEH 4HJ0D 2Z8VC 4OBRA 2AQ3A 4X8JA 3WJLA 5C3TA 3ARDC 4NO5A 2DQTH 4GRMA 4PJGF 4CRPA 2F5AH 1DBKH 5EU7E 4N5ED 1FP5A 5EU6B 4X6DB 4MZ3A 4HKJB 5CBAA 3HNTH 1UWGL 2Y7QA 1SMOA 4WWKD 3OKNB 5L88L 2PN5A 5EUOB 5GJSH 3FOLA 4PJ9A 3NPZB 5DJYA 3RVWC 3VXUB 1N5YL 3HNSH 3R06B 2ERJB 4JG1H 4WHYG 2P8LA 2Z35A 43C9B 5IQ7L 2A77L 4XRCB 1WCBB 1IM3B 1QHPA 5IMLA 3S4SB 1IMHC 4LVHB 4GRLC 3CFCL 4WEBL 5J9PA 1JNHA 2OTUB 5T5NG 2HTKC 4D3CH 3T4AA 1EEQA 4E42A 2YZ8A 3MYZA 1P2CA 2BNQB 3ZTJH 4Y19E 1U8MA 2LU3A 4PRNB 4M3KB 4NRYB 5B8CC 1Z2KA 1G9NL 5IW6A 4AG4H 2ARJA 4U6XA 4FZ8H 4L8BA 4XVJL 3UJTH 3D18B 4PLKC 2DYPA 1F8TH 4MXWH 2FATL 4WU7B 2DLTA 3A0OA 3GK8H 1JYWA 4GLRH 4YXKL 5I18L 4L8SB 2OMNA 4IRJA 1T89C 3K1KC 1NUDA 3FCTB 2YK1H 3U0WH 2MWCA 5D8JL 5I75C 5DRZB 3VFMB 4K7PL 2GY7B 3VH8B 4ZQKA 4XCFL 2UZIH 1CG9A 2IBBA 4OZHE 4CMHB 3MZTA 1V8HA 1JL8A 3THMH 1SY6H 5AAMA 3N1FC 4FQLL 4MJIB 3KVQA 2IANE 4U6HB 1MCOH 5DQJB 2HT3C 5BRZD 3QIWB 2V7NB 1YQVH 2UWEF 4I1NB 1ULVA 1A6VL 4UNVA 4NYLA 2KPNA 4ELKB 1P4LA 2RJMA 3ARFA 2G60H 3UBXI 2NXYD 1UJ3A 4NZRL 5DJZB 3KPQB 2WINB 3CDCA 5BXFB 3MJ9A 3TT1L 4L8CA 5LG1A 4QHUA 5CP7A 3KPSD 1AKJD 1WC7B 3MV8D 4X0KA 1X5IA 2NW2B 1RZFH 3SDYL 4U0QB 4HMDA 1L6XA 1M7DA 1YN6B 1GGIH 1T0PB 3MCKA 5JPMA 5FUZH 1RUPL 5EBLB 2AXGB 3B6SB 1J1XH 4XBEH 1K2DA 2YWYA 4Z7WA 2WBJA 4PY7B 4TNVF 3RTQC 2J3SA 2DWEB 3T2OA 2QADD 2UZYB 4OCSL 4P3DB 2DQGL 3WUWB 2VB5A 5IMOB 2XN9E 3BKYH 3FQXA 1OGAE 5BJTB 4FRWA 5HJ3A 2OR9L 5GZNC 1A3LL 2DIAA 5JW3L 4J2XA 2PYED 4U1JA 3FT2A 1J0KA 5DLMH 3N0PB 4G8IB 5E7BA 3BH8A 4FNLL 1WZKA 4JQXA 4G6AC 5E94B 4MNHB 1MFCH 1AH1A 1NLDL 5EUOA 5FHBH 3F7VB 2EXWD 5DTFB 5E99L 1PX4A 2NY5C 5F6IB 2MMXA 1I7RB 1Q0YL 2G2RA 1NEZA 1I9RL 1QSEB 4P3CH 5AD0A 5J0BA 4JG0H 2B1AH 2YZ1A 5AWNH 1B2WL 4EBQL 1YEKL 4ZXBB 3MYJA 4Y4HC 1V3LA 1S7SB 3IRPX 4S2SB 2OTUA 1UWGH 3PWPB 2Q7YA 4YBQD 2GCYA 1DVFD 3FO1A 1MAML 5GGTL 4YR6B 1WITA 1QR1B 3ARGB 2BZDA 5D5ME 3SCMC 2R23A 1LE5A 4NN5C 5B38G 1R24A 2B0SL 3QUZC 3VWKC 2Z31A 4MQXD 1QD0A 1IKFL 1OLLA 4GS7C 3QR2A 5FO9A 4I18B 5EC2B 3B9AA 2ICWI 2W9EL 1H3XA 3AM8A 3FCTA 4YZFF 3QDGB 4L3CA 4WI7A 3L95B 5DK0B 4HV8B 3W0WA 5C0ND 1EMTL 1FRGH 3VXMD 1A9EA 2EO9A 3KPOB 5DK2B 3L3OB 3UMTA 4ONGL 1NKRA 3O6LH 3QI9D 4LMQI 3C8KA 4RMRA 1U8PA 3HC3H 4KK6C 4NWUH 3ZSSA 2A0LC 5DQDH 3D0LB 4YXKH 4MJIA 5I18H 4TSBL 3MNVB 3QUYA 4KUCF 3QIWA 3CC5B 4PRAA 2VR5A 2G5BA 3TFKC 5BW7A 3TNMB 3NCFB 4YC2B 1MREH 3VFRB 5ITBH 3DETC 4CW1B 4K7PH 2OMBA 5T1DL 2Q8AL 4HAGA 2OR8A 2FBOJ 4XCFH 1J8HE 1U8NB 4LCCA 1T2QL 3HG1B 5DJZA 3S36L 5BXFA 3IETA 3I2CL 1TNNA 5ALCL 3WD5L 5HYFA 2C1OA 4NQCA 2VUOA 1INEH 2CJUL 2PYFA 4JM2D 2FLRT 4NNXB 1N64L 4E5XA 1G7QA 5EFIB 3GHBH 1BECA 1J18A 5EBLA 2AXGA 4QGYA 1RZ8B 4ONOA 1JE6A 2J6EA 3B6SA 1INQA 3S3SA 2Y07H 3ARBC 3CFDB 1YMMD 1L7IH 1I7UB 3SBWC 2BY3A 4QHMA 3MOQA 5D7KD 2B7DT 1AIFA 2GSIA 3WUWA 2VWEE 3HR5B 3PQYD 1M7IB 4FTVA 5IMOA 5BZDA 5DFVD 4I0PB 2DI8A 4L29A 5KS9E 3ZTNH 1IGFH 5IMKB 2QQLL 5IBUB 2Y25A 1MRFH 2XFXA 1YMHB 3SDYH 3Q1SL 4XP9H 3QCUH 5H35B 4Z8FL 4XBGA 3CSYB 3MX0A 1EGJA 4UDTA 1CDJA 3CDYA 3C8DA 3RIFF 4HC1L 5E94A 5IGXH 4FZEH 4LHUB 4PJ5B 3RNKB 3RGVB 3QEHB 4F57L 4OCSH 5ACLA 3F7VA 5AG8A 4HCRL 3IU4L 2DQDH 4TTGA 1QLFA 4XNZB 2OR9H 4WU5A 4GW1B 3DJ9A 1VGEL 4OFYD 1A3LH 1T21A 2DKUA 4DZBB 2QHRL 5FYLD 2EC9U 4D8PB 1XGTA 4HK3J 4PJCF 1U8HB 5C0CB 3D85B 2ZG1A 4TNWK 5DRXA 2AK4A 2Z93A 4UQ2A 1S7SA 3MA7A 4C54A 1UB6B 4C83B 2ITDA 5IF0B 4Z7UE 4V1DA 3BX7C 1NLDH 4Z7QE 4TPRL 1ZGLB 2D31B 4Q2ZB 5E99H 1BJ8A 1LP9A 2AEPH 4HBCL 5SWZE 1QR1A 4BJLA 1OAZL 1T1YA 3IJHB 1Q0YH 3FQUB 1GYAA 4YHIA 4CDGC 5J06A 1U3HD 3RP1A 4B0MM 4EBQH 5GGRB 1JTPA 4HH9A 2Y06L 2CD0A 4I18A 2X70A 3QDGA 3WNOA 1U8LA 1Y6MR 5IW1A 4WUUA 1L0YA 1P6FA 4XAWL 1MAMH 1MFAL 3KXFE 3L5IA 5D7SL 1HH9A 4U1IA 4FA8A 4AH2A 5I76B 3O3BA 4K9EL 1JZ7A 3LDBB 4OLWH 5ITFB 5T1LD 5IHUL 2AJ3B 2RCSL 3O3AB 4UINL 3WNPA 2B0SH 4PRPE 3MNVA 1NFIA 4K7FA 3G5ZB 4G8GD 4Z95H 5IJKA 2W9EH 2HFFA 2Z8WC 1PG7X 5CSGA 1FAIH 3VFRA 1A2YA 1GGCH 1FH5H 4AT6A 4KRPC 4F37F 1IVLA 5C6PB 3L5XL 1NBZB 3FN0L 4LCWE 4EVNB 1MVUB 1Z3GL 4Y1AE 1E6JL 1HCFX 3D5OF 6FABL 1QYGH 4NP4L 2M1KA 3VI3E 4HFUH 3G5XA 1T1XA 2AEQL 4UUJB 5MHSE 5HGHB 2H3NB 5EFIA 5F97E 3MV7E 1DQML 5KSBB 5FCUH 1DANU 2UY6A 1RZJC 3MBEC 1ORSA 2FGZA 1T2QH 4BH7A 4HIXL 3J7HA 5C07E 3WE6B 3I2CH 1G7LB 1A1MA 4OKVA 1TJIH 5DYOA 2CLVB 3ZYZA 1VB9A 2CJUH 2FECI 4RX4A 1N64H 2XWJA 2C3HA 2HFEB 5KN5B 5IWLA 3QWRA 1JPGA 4M5YH 4IMLB 5ISZA 2BXYA 2E6PA 3PIQA 4NFDA 4XP1H 3O2DL 1HZHL 2OTWA 5D6CB 4LHUA 2C3VB 4YDJA 5SWSD 2K7PA 3G04A 4M7LT 2V9TA 4B5EA 4KTEL 4OAWB 5KSVA 1H3GA 2PKDA 2J2ZA 4WTZG 3MGTA 1MIEL 5F1NB 5HVHB 3QDJA 2ADFL 2FD6L 2QQLH 4ELMF 1S5HB 5DMIL 3Q1SH 3IDXH 2QR0A 4KHXH 4D8PA 4R0LA 1NBYA 3CFIC 1FZOB 5JR1L 1UB6A 4HC1H 1T5WB 1K8IB 3DUSA 1T2JA 2E9BA 5GS0H 3SE8L 3TCLA 5BS0A 4Z0XB 1LQSR 2I60H 5D72L 1VGEH 3TCXA 3DRTA 12E8H 5EPMB 1KB5A 1NUFA 2QHRH 4JDVA 4ALAL 4NHCL 3IFOA 4ZUSB 5I8OL 1N0LA 1JZ6A 4KI1A 1U3YA 1BQUA 2F54E 2KDGA 2F5BH 4F7PB 5KSAD 1ROWA 5HI3C 4TPRH 1KFAL 3NBNA 1SM3L 1ODAA 2BNRB 4HBCH 4LCYB 4OBSA 4YPGB 5D1ZA 5DJXB 5I8CA 3H9HB 1ZLSL 3P4OB 3IGAB 3PL6D 3ISWA 3OMZA 2AJ3A 2YKLL 3BGAA 4NBYB 1OTUC 1B0GA 4LP4A 2HJLA 2Y06H 1NDMA 3G5ZA 5MEOB 4AIOA 3EDEA 3REVB 5HGAB 1KBGL 3VI4E 2X4TB 3N1PC 1IAOA 4NNPH 3V52L 4I48B 1I9JL 1LO3L 1MCWW 1ZHNB 3LN5B 3DHJA 5D7SH 1N7MH 1NBZA 1ZSDB 5FYJL 4EVNA 1MVUA 1T04B 3HI1A 3JTSB 3EZ8A 3SPVA 5IHUH 3AAZA 4MWFB 2RCSH 4FG6D 1GAFL 2EYRB 3FFDB 2XKUA 4XPHL 2WZPD 4AZ8A 2MHAB 5HDBF 5GGVL 2UYLB 4U6TA 2P8MA 3JVGA 3SO5A 4CKVX 1CXLA 2DMBA 2MPAL 3RWJB 1OB1B 5HY9A 5T5FH 3U7WL 3QPXL 5SX4I 5BVJA 3SDCA 4N5UA 4PJAA 4B41A 3FN0H 1Z3GH 3BWAA 1E6JH 1LD9B 1DQDL 1G7LA 2APBA 2R2CA 1I85C 1DSFH 4WFGD 3WNMA 3LHPL 2CLVA 2QBWA 4LMQE 4U1KA 3VFTB 4HJ0C 2JCCE 4P2QB 2AEQH 1JF1B 3DX9B 1I9IL 2NY1B 2BOCA 4JZOB 1XH3A 3EOYG 1XGQB 2IG2H 5JQHC 5AAWA 1JI2A 1DQMH 3D2UA 4H0GA 4JFXA 3C60D 5ANMB 2FDBP 5EH1A 3IFLH 5DD5L 1Y6NR 4M7ZC 1KNOA 2ADGA 4OLUL 1MAJA 2PO6B 4KJPD 4WWKC 2VDMH 4KGLA 4YDLB 2O61A 2V5YA 2XA8L 4KI5E 4OAWA 1HHIB 1YNKL 2Q76B 4S10A 4Y16C 5FUOH 5F1NA 3A6OA 3RWHA 3WNKA 1BVKA 1ZT4B 3TO2B 3GM0A 2PETA 2IBGA 3KYAA 2IANA 3NABH 4Q7DA 3FZUC 5C0IA 4KK8C 2OJZH 5ID0B 2Y72A 1KSRA 5E9DB 1WWWX 4N90E 4KTEH 5B3NA 1CLOL 4LBEA 4Z0XA 4NKDB 4C4KO 3TBSA 5JTWA 4J3XA 5DMIH 4KXZH 4X9HA 3GGWA 4QXGH 5D2LF 4MQSB 1NCBH 5EO0A 2XZCH 5I1AA 2X9WA 3C6LD 2GJZB 3JV6B 5JR1H 4PB9L 2X1WL 3G5YB 5GGUB 1CLZL 1LO0L 1S7XB 2QJDA 4ENEC 3B9KA 3SE8H 1S5IL 4MNQE 4WUKL 4YFLI 4QTHB 5DHVA 4HF5L 3O2VL 5DUML 4LCYA 1XAUA 3ZDZE 4K55A 5D72H 1I1AD 3P4OA 2VLJB 1QNZL 1PDKA 1LEKB 2XN9A 2DMCA 1A21A 1OGAA 8CGTA 5I0ZA 2VDLH 3WIHH 2JIXD 4NHCH 5JOEA 5GGTA 5I8OH 3L3JA 4JQVC 1UXWA 2VLKD 4MJ6A 5DVNA 5MEOA 1TMCB 1UM5L 3BRDA 2ED7A 3WLWD 1CYGA 3REVA 1NC4B 3NCJH 2X4TA 5ICXB 4ZAKA 4ZS6C 1LDPL 1Z9SA 4I48A 1XR8B 5CGMA 1ZLSH 3S98A 1SYVA 4YHKH 4DW2H 3JTSA 5FF6B 3O6FC 5E56A 1MLCB 1MI5D 5TE4H 2QQKL 2MHAA 5BQ7A 3DO7B 3ZKNC 3EO1B 2DRUA 3HE6B 4FMFA 3MJ6A 4I4WB 3HHRB 2VDRH 3P30L 2XIDA 1JHKL 2R29L 1KGCD 4J1UB 3V52H 1AGEA 5GXBB 5IFAH 3QQ4B 4YNYA 5FYJH 3L7FB 1S7WB 4XXDA 1TZGL 3FB7B 3RU8H 4XH2A 2ADIB 4UT9H 1J1OL 2LV4A 1NLBL 1GAFH 4QRRB 3BIBX 1T4KA 1ADQA 5GGVH 2BP3A 4GFTB 4I13B 5IV2A 1CR9H 1GGUA 4OZHF 4XWOC 1LO4H 2MPAH 3D25B 1U3ZA 1TENA 2VLLA 3R8QA 1GXEA 1BFOA 3WNLA 1HNFA 1CK0L 3EDFA 3U7WH 3K1DA 5HHOD 3U2SA 3MV11 1YY9D 4OLXH 2ZPKL 3ARED 1KCKA 2PO6A 1UCBL 2EEAA 2XZQH 2XYCA 1E28A 1N0XH 4FFVD 3BDYL 1EZVX 3BI9X 3RVXD 1U6AL 5B39B 4UT7H 1OF2A 4H5SA 4PBWD 2ZNXA 5E1HB 4UILL 1YEGH 1I9IH 4QT5B 3H9SA 3TO2A 1GC1C 4Y5YA 3EJZD 5FYKE 2ZCKL 3HZMB 5JW4Q 1MPAL 1HHGA 2W91A 5DD5H 1EAPA 2OLDA 2FHBA 1V5JA 5D6DC 5ID0A 4M1GL 4PJGB 4OLUH 2WIMA 1A8JH 3VFNB 1TITA 3BRGC 2X4NB 1BEYH 3SE3A 5E9DA 3O8XB 3S35X 4ZOBA 2XA8H 1YNKH 5GISL 3W39A 5MEQA 3KR3L 2XXMB 5E6ID 4Y4FD 4WI9A 3EO0B 3KYMB 4A2LA 1X7QB 3M1BA 3PJSA 4HCRA 1UEYA 3R0NA 4MQXC 1DBBH 1MCCA 3JV4B 1A1OB 5GGUA 4TN9A 5HHNA 1CLOH 4QTHA 3S4SG 2PXYB 1CN4A 4MD4A 5D93C 1TQCC 3QEQD 2X44D 1UJTA 3B2VL 2BMKA 3VD4A 3T8XA 3X17A 1DTUA 1FFOB 5EULV 4ZFGL 4QRSA 1T5XB 2HLFC 4P5TA 4N9GB 5A40E 5T1KB 4XPAH 1AC6A 1DE4B 3QWOB 2O5ZL 5DQ9B 4WIQA 1PLGH 1XIWC 1KJ2A 3VRJA 5KVFH 2XXCB 5ICXA 1S5IH 4GAFB 4WUKH 3MA9L 3O2VH 4ZSOB 2V2XA 3MXVL 1XR8A 1DQJB 2FECL 5B3JE 3T65A 3UBXB 4NQXA 5FF6A 3PP4L 4OCXL 1AE6L 4LU5L 3HE6A 3VXNA 3VH8G 4KY1L 3QG7L 5D5MF 15C8H 4L4VD 2IFFL 1OLZA 3S5LB 1FNEA 4G9FD 3WHXB 1I1FB 5D7JA 2VZOA 1TFHA 4J1UA 3ALWA 2JB6A 1LDPH 3VGAB 5K9JL 1ZK9A 3T08A 4OB5H 1AGFB 4RMQA 1JF6A 3TN0A 4Z7UA 4JKPL 3QQ4A 4FFWC 3HCVB 3LKQA 3H3PH 1B4JL 3FB7A 5IM7A 1MNUL 1EXUB 2ADIA 1HSAA 1CFNA 5SWZA 5L2KA 3QDMD 4NZUH 1R3KA 4KMLB 4QRTB 1X6NA 4JGMA 2R1WA 5BRZE 4P4RB 1WAAF 3BEWB 2EDWA 3HUJE 3BP6A 1JZ2A 1KV3A 4MQ7B 4C4KT 2R29H 4J3WA 2NY7H 3NMEA 1A6AA 5J13B 2HRLA 4X9BA 3WSQL 1IAMA 1EK3A 2PW1A 3GHEL 5IESL 1H8SA 4U33A 1C1EH 3FQTB 4MA3B 4OT1L 4Q0XH 4X7CC 3N50A 4M6NH 3WFHB 1A6UL 2R1XB 5FM5M 3DMMD 3DBXB 1XCQB 2Q3AA 4QRPB 2VISB 5HGDA 1CL7I 3BN9C 3F7PC 4JY5H 3WUWG 3AU1B 1FNFA 1BGXL 1T20B 4P23C 2V5RA 4CU6A 1NAKH 4BZ2H 1UCBH 1QSZA 2X4NA 1CD1A 3HKFA 3BDYH 1I75A 2NY0C 4POZD 3W9EA 1R0AL 1U6AH 1WZ1H 4Q6IC 1I3GH 3HAEG 4ONFL 3MLUH 1TJHH 4UILH 2BX5A 5FECA 1I1RA 1M7XA 2VZ3A 3TZVB 1IKNC 2PYEE 3LQZA 5F7LB 5FYJU 4K2UH 4RRPA 1AXSA 5TDOB 2ZCKH 3UTQB 1MPAH 2FSEB 2DD8L 2R2HA 5KS9F 1J0HA 3O0RL 2BK8A 4M1GH 3JV4A 3MPCA 1A1OA 3MV7A 1ZT1A 3QT2A 1D6VH 2ZUQC 2ZSWB 3O9WD 2ICWB 3NVQA 1Q1JL 3SKOA 4FS0A 3A6BL 4OZFH 5C07A 1NGXB 4DWHA 5DJ6B 5D71H 2VMFA 3LB6D 3QNZA 4NQUA 4LRIA 4FQXD 3FJTA 2CGRL 1ZEAL 4NFBA 4X4XB 2A1WL 3RAJL 4BM7A 2YXFA 3BKJL 4N9GA 1A7BA 1TZHB 4PJEB 1IGJA 3JTTB 5T1KA 4NWTL 4YO0B 2PTTB 5F7UA 2VLMD 4OQTL 2MTPA 4J3UA 1HWHB 4NQDD 3AXLA 4ZSOA 3INUL 3U0PB 1FG2B 2MQCA 4RSVA 4BZYA 2Z9TA 2Q87A 4KROD 1VKXA 1BZ9A 4X5WA 2WIIA 1FFPB 3HI5H 3UBXA 2B5IC 5C0EB 2JJWA 3GJFA 4Z7QF 1UKTA 5IJVA 3RY4A 2UV3A 4WI4A 1BJMA 1MJ8H 5LKNA 1C16A 3EYOA 5EZJA 1AHWB 2LABA 5J3HC 3GSQA 1NBVL 4MA1B 3MA9H 1D9KC 2J6EH 3VXME 1T83A 2NY4C 4KPHL 5HI5D 3QJHB 1RFDH 3FKUS 3T0ED 4DN3L 3C8HA 3TA3D 4K8RL 2XQBH 5IT2H 3G6AB 4I2XB 3V6OA 1ZXQA 1EXUA 2L4OA 1CLYL 1OWWA 3PP4H 4QRTA 1U36A 2P42B 1AE6H 4LU5H 5DD0H 3SDDB 3V5DB 3FB8B 2FJGB 5IVXE 3PWNB 3QG7H 3BEWA 4KMTL 5EUKA 5IB3A 1ZWIB 1XF1A 3DTXB 4HWBH 4LIQE 3U4EA 4EI5B 3KYKL 3ROLB 5K9KB 3W11C 3I02B 4JKPH 2YPVL 4JKWA 4LF3A 1B4JH 4P9HH 5IEHB 4BH8B 2BERA 1MFEL 2VITB 1J10A 1MNUH 5H8DA 1FFNA 1GGYA 3TJHD 3UTSB 4XPGH 2VJXA 2O26U 5LGKA 1KCSL 4ZD3L 1XCQA 4OIIH 4NHUB 4DGVL 1LO5A 1GJIA 4KMQA 4HT1L 1NGYA 4YHMH 1AP2A 1YMME 4DKDC 3M45A 1S3KH 1PW3A 5IBUG 5IESH 5A16A 2A6IB 5D7KE 5TE7L 1S7UA 3PQYE 4F9PA 4X4ZA 4NCC1 1TVBB 1VDGA 4IRSC 4HSQA 1DQTA 3P77A 4TUJB 2W0FB 4PJFE 4Y0GA 4PLOB 3QFJB 4L8SC 4LHUG 1BIIB 3IDYC 4NN6B 3V0VB 2LFGA 3GNML 5KOMC 3IKCA 4JPVH 3CK0H 1BGXH 4AY0A 3LN4B 1FV1A 1WBZB 3PV6A 4Y5VB 4RFOH 3EFDL 1N5AA 4JVUA 3Q5OA 4WY7L 2YD1A 4WV1A 2VAJA 4UAOB 1NANI 1QBMH 1EO8L 5BV7L 3NZ8A 4ONFH 4E41D 2FJHA 2R0KL 4CN1A 5DJ6A 5FYLE 4R8WH 5BOPA 2JCCA 3LN9A 1DUYA 3OKYA 2IGFL 1I3RB 4OZFB 2VLRB 3BZFA 5MENB 3O0RH 4RFNB 5BOZG 1RHHA 4PJEA 5HYSB 2LU7A 5I74B 5HHXL 4NQSB 3LS5L 1Q1JH 2AK1L 5HVFB 4XWGL 4K94L 4MD5B 5J11B 3T77A 4F7TB 3WNNA 4LAQH 4PB0H 1KPUB 3DGGA 4KZEL 2CGRH 4EN3D 1ZEAH 4RIRA 4JFYA 4YHZH 5DJ8B 3OAZK 2A1WH 5GHWH 3LVEA 4BFEA 5SX4H 3V2AR 4JJ5B 3ULUD 2P5WD 1A14L 1P69B 1K3ZA 3LKSA 4NWTH 3GSRB 1AHWA 1SEQL 3VXRB 1KLGA 4L4JA 5ESAB 4H0HB 2X7LA 4XB7A 3QJHA 2V5MA 5I30L 3L3GA 4S1QL 2YEZA 3MJ7B 1ZTXL 4OV5B 5F7KC 1HSBB 1RHFA 2IH1B 3SDDA 4G8GE 4AQOA 1AXTL 2HT4D 4NJ9H 4NRZA 3VGBA 3FHQA 4IIQB 4KTYA 4Z9KB 3DTXA 3X14B 1NBVH 3ROLA 3MLRH 2F53B 1MFBH 3DHMA 2WQ8A 4KKNA 3DV4B 1T0MA 4DN3H 2J7LA 3QIUA 3VXQB 4MNQA 5IEHA 3U48A 1JYVA 3RDTB 2X4RB 4XNMA 3VI4F 1CLYH 4LEOA 4RBPH 1E0OB 5E1AB 3UTSA 5I15L 1T7WA 1Z0NA 1WGOA 1JWMA 1FZJA 2OJEB 1DQQB 5IHZB 4NQED 5F6HJ 1BVLB 4KMTH 3UYPA 1IILE 5ACMA 5DEGB 4ZXBC 4CVXB 3FT4A 3MUZ1 1QP1A 5JXEA 4U7KA 1ZHKB 2XOTA 2BCKA 1UENA 4Y4KD 3S7GA 3CU1A 1J1PL 3LMJL 3NTCH 2EKSB 4PGZA 1BPVA 2YPVH 3HE7D 1OPGL 4JGJA 4TOYL 2CKNA 3TJEL 4IOIB 1TVBA 4LDLB 1Q9OB 2W0FA 4HIHB 4TSCL 4YHOL 3KLSA 1U8OB 5EWIH 5ACZB 5CHNB 4P2OB 1BIIA 2AXFB 5GRVL 3V0VA 3P11H 4HT1H 4LAJH 2OL3L 4LFHG 3DXAB 3SJVD 5HYQB 4Y2DA 3S3JA 4Y5VA 1RZIB 1U95B 1ZOXA 3PWJA 5TE7H 2VXSH 3A6CH 1OSPH 1OP9A 2I9TB 4HZAA 1TPXB 3V7MA 3H0TA 3FOMB 2BC4B 4YBLB 3GRWA 1VFAB 1OAYH 4MVBC 4NNYA 4KI5F 3QIBD 4M7LL 3TPKA 1CFSB 4N0UB 1YN7B 1G0DA 4YC2C 5A3IC 1YZZA 1NH6A 1X5ZA 5ENWA 5IB5B 4NQSA 4WY7H 3WLWC 5DMKB 4GBXB 2YUVA 3HZYB 3WHE1 1JGDB 4FMKA 4AIZB 4X9IA 4F7TA 1NBQA 4EXKA 1DBML 4M6MH 4QCIB 3D39D 5E08H 3ZL4L 3RWGB 2PW2A 1HQRB 2P5ED 5CZXD 1FCGA 3DLQR 1FL5B 2A74A 3BQUA 1E4XI 4NN7B 2R0ZL 3IT8D 1FQ9C 4I3RH 4KAQL 1FN4B 4MX7B 3GSRA 1UZ6E 2AK1H 3VXRA 4APQD 3PE9A 3BPLB 4WFHD 5KSUB 1NCUA 1P9MC 3SE4C 4ZFZA 4YDVB 5IFJB 5HHMB 2VR4A 3MRJA 2A73A 2NCMA 5F7HA 2YSSA 4NSKB 4BQCA 4TNVK 5T3XL 1FGNH 5DVKA 1CL7L 4LSRL 1A1NB 3TO4A 1RMFL 1F3DH 1ORQA 1CFVH 5CAYB 4U05A 1GPOH 4EUPH 3QA3B 3WN5C 5GJTL 3L5JA 4G80B 4HAFA 1PY4A 1EUUA 3VXQA 3FO2B 5I30H 2J8HA 1BBJA 1HI6A 4X6CE 4FFVC 1RJZA 3CFEA 1MFDL 3E1F1 3VRIB 2BNUA 2DQJH 4XP4L 5IHZA 2VSDA 3CZJA 2Z92B 4PJ9D 5ETUB 3C08L 1XF4B 4MXQC 6CGTA 1P7QA 3G6JE 5BMFH 3MRCA 1JYXA 1QHOA 2ITCA 1CBVL 2VN4A 1AO7E 3DNKA 2OK0H 3LIZH 1BD2A 1IAIH 1UYWL 4XNXL 4WFGE 2BJML 4FQ1H 5I15H 3KLDA 4R4BB 5MP6L 4ISVB 4Y4FC 1Q9OA 5I17B 4Y8AA 1FJ1A 1T22A 3DVNA 4H20L 1U8OA 1XGRB 1YEHL 1NFDF 4UIMB 1F90L 5D1XB 4RGOL 2DYPD 1E4WL 4Q6YA 3UO1L 3MLZH 4RGNB 5IIEB 4QRQB 3DXAA 4R6UA 1TQBC 3LMJH 4H26A 3H9YA 5FUCC 3MOAL 4MZ2A 1RK0B 1ZVSB 4IRJD 4LASH 4O4YL 1AFVL 1LMKA 2EEBA 4OD1H 4TOYH 3UZVB 2IC2A 3MFFB 2D7MA 1EFQA 1X3DA 4MCZB 4HUWB 5EC1B 4LPCA 1CDUA 1G0XA 5GGSY 2PR4H 3MNZA 1EEYB 1MELA 4K3EL 1TLKA 1FYTE 5BO1H 5I1EL 4QHNA 4JZJC 5ICZB 5KVDH 3ZE2E 4DZ8A 1J8KA 3BSZL 4N0UA 3EYVB 2R4RL 4U1LA 1XMWA 5C08B 2YD5A 4PREA 1WISA 1AD0A 4JKMA 4NKQB 4PRIB 2ESVD 3X13B 5KG9B 3DRQB 4HUKB 3DPBA 4G6KH 3SEPA 5MEPA 4YGVB 4QCIA 3ARFD 3NFNA 4PJDE 5C71A 5BV7B 2F9BT 4M7LH 5E8OA 3T2QA 1FL5A 4J7RA 2W65B 1I8KB 3I75B 3U30C 2FHCA 5C0GB 1TJGH 3I50H 4PTTB 4CVWA 4MAYB 4R3SB 3ILQC 5SWQA 3MODH 2MSPA 2AAVA 5KSUA 4CMMA 3WDIA 5KZCD 2R69L 4V2BA 2WWKO 1QRNB 5D2NB 2O5XL 3RVTD 4F8QA 3CVHL 5IFJA 1FORL 2NY5L 4Y5XC 1M71A 4OQTA 1JZ8A 2WBJD 3ZL4H 3SO3B 4O9HL 2RFXB 2N56A 5JIIA 1CFTB 3HB3D 4XCNB 2VLKE 2PYEA 1VCAA 3KJ4C 4HHAA 4KAQH 5AZ2L 4WGVB 3NACL 4HMEA 1CDHA 1PKQB 4QOKB 3MUGA 3QA3A 1SJEB 5C0AB 3RZCA 4G80A 4BUHA 2IPKB 2IAMA 1IL1A 2FL5A 4EUPB 5HVHC 1B6DA 3GKZA 3QISA 1XGYL 2DLFH 1MI5E 3RIFK 3B5HA 3ZYOA 5CWSB 3L9RB 4LSRH 2YPKA 5DS8A 1IFHL 1VGKB 2Z92A 1P4BH 1Z9MA 3O45B 1UACL 5GJTH 1VFMA 1KGCE 4OZHB 5FKPA 3WS3A 5F7WC 1Q94B 4PPTA 2HJKB 5F7YC 3RNQA 1NMCC 5JXAL 5HTSA 2ZSVB 4G6JL 4PRHA 4POZC 1ONQB 4HLZH 2DBLL 2M26A 1MFDH 4XP4H 5CJ8A 3STLA 3MLTA 2CRMA 5I17A 3C08H 2HKFL 4LKXA 1TVHA 4EZMA 3DX8A 3R1GH 5D1XA 3SGEI 3Q6GH 3OAYH 5HHOE 5B39G 5DSCB 5J1AA 3MRPB 3RX8A 2WUCL 5CJXA 4YBHA 1YECH 4OUUB 1KIPA 2Z31D 4QKXB 4X6BB 4UV4L 3HUJF 4XNXH 5C70A 3KPNB 2ZZUT 3BZ4B 3UYOD 3QI9A 2BJMH 1YNTB 1RK1B 2SEBA 3OHXA 3QNXB 4HUWA 1MCNA 4LGPB 2H6PB 2AJYH 1AQDB 1MCKA 3GSXB 5CSBA 1PZ5B 4FQXC 1F90H 1I1CA 2YC1A 5EOQH 1E4WH 2GJ6B 4JRYB 4JREB 4K23L 4LPTA 3TT3L 5ICZA 3D69B 3SGJA 3MRMA 1RU9L 4ODUB 3FQWB 2EIBA 4YX2L 4JB9H 3PXJA 3MOAH 4MJID 4XPTH 5AYUL 4AEIH 1WVZA 4O4YH 3QUYD 1AFVH 3QIWD 1JP5A 1KJ2H 2OL3B 1JUFA 3RPIB 1T7VA 1BQLH 4PV8B 4OZGF 4PRIA 3T1WA 2AEIT 3X13A 3MV01 5FGSA 5BVPL 3TESA 4YGVA 5DJDB 3G9AB 3DYMA 4F37K 4K3EH 3UDWA 5I1EH 3GSUA 4HGWB 4JVWA 4Q9QH 2YA2A 1YUHB 3CIQA 1C12B 4NQCD 2W65A 1JGEB 1HEZB 1I8KA 4P2RB 2R4RH 3OF6A 3AY4C 3S96A 3X12A 3IDIA 4XNUH 4RAUB 3BPCA 1RUQL 4ZUWB 4PRBB 4KJQD 1QRNA 3QEQE 2D4FA 5T33L 2VQTA 3ILPB 2NY2D 3CUPA 4PGCB 3SDAA 3LEVH 1IEBA 4Z78A 1H5BA 2VIRB 3TNNB 3TYGL 4OCNC 4JFFB 2C5DC 1V7MH 4FTVD 2VZSA 5GRJH 4GMSH 1PKQA 3WS6C 3UJJH 3ARDB 4OFVA 3UBXG 1X5JA 3E2HC 1QBLH 3MJGX 5D5MB 4HS3B 2R69H 3PWLA 4JO4H 4YDLC 1N6QH 4H88H 3CVHH 2NY5H 3ZZ1A 4UOJA 3S5LG 4OD3L 2VRAA 5KVEL 1CTNA 5CWSA 2CDGB 3L9RA 2L7JA 2GAZB 4MA7L 5FDWB 5AZ2H 3NACH 4L4VE 2NR6C 1BREA 4G9FE 3D0VB 4PJIB 1QSED 4P4KB 1X9QA 1MH5A 2DQEH 4ZOAA 2E7LA 3CLFL 4JPWL 5TDNB 4B7LA 1Q9LB 4GRLB 1T3FA 4DGIH 2ZSVA 4LCUB 1DBAH 4JLRB 5H94A 3AS0A 4V1DD 1EHLL 5GS0C 1M6OB 1D5BB 4JCMA 1IFHH 2X6MA 4O5LL 1F11B 1I8IB 4W4OA 4MA8L 5DC0A 5KAQF 2AABH 3ARGD 1J8HB 1UACH 3T3MF 1Z6JT 3FO9B 3IJSB 3MRPA 2AV7A 1NANH 5D7LB 3RL1A 5IVXF 5JXAH 3U1SH 4X6BA 3AC0A 2D0HA 1K4DA 4UIKL 2GTZB 2ZOKB 2DBLH 5LWYL 4GAYB 3QDGD 4KKAD 5FGBA 2E8YA 4WUUD 3VE0A 4I77L 1R6VA 3BD5A 2XWTB 5I75B 4ZUVB 2H6PA 3OSKA 4OLZL 1XGUB 3EZJB 5T3ZE 1D6EA 1PZ5A 3IS1X 2Y6SC 2WWKT 2GJ6A 4WHTB 4JRYA 4GW4B 3ZKXB 2WUCH 4JM2F 5D1QA 1QQDA 1BLNB 5J6HB 1UM4H 4G6FD 4UV4H 4WO4C 3GMMB 5KS9B 1P84K 1VEPA 3BJLA 3VFOA 1RZJL 2OL3A 5ADOL 4PV8A 5JIHA 4GKNB 3OV6A 4J4PC 3BP5B 2AJVH 3LKOA 2WSKA 2G5RA 5F3BB 4EN3C 4OCLC 3HG1D 5DD6B 2OXHA 5IK3B 2ZCHL 3FMGH 3IXTB 3LOWA 5C09B 3TT3H 5CD3A 1RU9H 3FFCB 3TVMA 5JORA 5CEZL 4PJFF 1JGEA 4TSAH 4Z76A 1JPFB 2OM5A 1WFUA 2RB8A 2ZCLL 2CKBL 5CINL 5GSRA 1DDHA 4RAUA 4X9FA 3VRLE 1GH7A 3MRRB 2QSCL 5DJCB 4K3JL 5ESQA 3ARTA 4GXVL 1JPSH 7FABL 5CLTA 4PGCA 3UAJD 4DKEL 2C4FT 3WXWL 1HOCB 2OTPA 1UCTA 3RTQB 1IC7L 4P46C 5FK9B 1YYML 4I0PD 1EUTA 4CL7A 1HDMB 1WTLA 3ARDA 1OQOA 4U3CA 3RUGF 4RX4D 4RBPK 1IARB 3QUKB 4NQDE 3TWCL 4HS3A 3QWRD 5T33H 5ISZD 1RAMA 1H3TA 1G7MA 3FQNB 4LDOB 4PR5A 3K2UH 2CR3A 2DDQH 1IC1A 3MRQA 4LHUD 4PJ5D 4L8DB 5DHYB 3LZFH 3RGVD 5F9OL 5I1GL 4JHZA 4PJHB 4YGAB 1T1ZB 5DRWB 5FDWA 3CVHB 4CVUA 1YY8A 3MRGA 1RJLB 3QDJD 4PJIA 1AGDB 3KXFB 4WVRA 3P0YL 4KQ4L 3ZO0A 3T0EE 4MJ4A 1P53A 3BXNA 1R3IL 5I8EB 1Q9LA 4GRLA 3HE7C 1RULH 4OTXH 2GFBB 4PRPB 4PBVC 4JLRA 2JJSC 4AL8L 3OPZL 3BVNA 2E7BA 5CSZB 2BY0A 5BS0D 1PYWB 3RWFB 1XR9B 4KTDL 5B8CA 1KLUB 1P7KB 3C5SA 1AY1H 1MHPL 1XF5B 2J88L 5F6HI 3IJSA 3SCMB 4NN5B 3Q2CA 5KSAA 5D7LA 4M7JL 2XTJC 4M48L 4U6VH 4GKSB 3QUZB 4O2EA 4M9OA 4ZDHB 3SDXE 2GTZA 4GS7B 4OCYH 4LLMA 1Q72H 1W0WB 4M6OH 1N8ZB 4X6FB 5F70A 2IALB 4PJXB 3E3QC 1EHLH 2H8PB 3HFMH 4HMCA 4O5LH 4ZUVA 4PJ7F 5LQBL 3D6GA 3QHFL 1N6UA 5C0BE 5D1ZD 3KYOA 4FFZL 2CPCA 4WHTA 2ZUSA 4NM8H 4A6YA 5CP3A 5HHPB 4K3DH 5EOCL 3TH4T 2EH8H 5J6HA 3BIKA 3KPMB 3GMMA 1MVFA 1QFPA 3U0TB 3NA9H 5LWYH 5JQ6H 4DUWA 3O6MH 1DANT 3VW3L 5FXCH 3EJYD 4R2GC 3BP5A 3EOTL 3E6HA 2IF7A 2E7MA 1FGVL 4YH6A 4LQ1A 5DD6A 3C5ZA 5C09A 3IXTA 4GW5A 1OAUH 4WEMB 3RWIB 3R8BB 4P9ML 2AKRB 1JFQL 5MERA 1O7VA 1JPFA 4KKBC 1AO7A 1I1YB 4I5BB 4HKXA 1KTDA 2N4IA 1QO3B 4GKZB 2E5EA 3ULVE 4E41E 4OZFG 5DJCA 4ZUUA 3W9DA 5DEZA 1R3HA 5DVMA 1ZHBB 4OGAD 3HZKB 5HYSG 2VZUA 3ARBB 3OKMB 3SDCD 2E9JA 4JO1L 4UV7H 2CDEB 1HILA 1HXMA 4KKCD 2V6HA 3RTQA 1LO2L 4IS6B 5JLZA 1ZS8B 3C60A 1U91A 3WJLC 1RD6A 3MGOB 5J13C 2VE6B 3KHOA 4TQEL 2B20A 1LK2B 4DKFL 3GMLB 4ZFFA 2H2PC 4PJ8A 5GS2D 4F33B 3QUKA 3VGEA 1HKLL 2QSCH 5EIIA 3D2UD 2O93L 2YOCA 4AQ1B 3OBAA 4GXVH 1N3NA 3IAQA 5LXGL 1OAQH 3FQNA 3RKPA 3RWEB 2F54B 5JPNA 3BJ91 1UG9A 2W38A 3ULUE 1YYMH 4PJ9C 2P5WE 3U46B 1FYTA 1RJLA 1WT5C 5DJ0B 1NPUA 1UWEL 1NAML 2HVJB 3TWCH 3F6IA 2BSED 4RAVB 5IG7B 4DVRL 5LGHL 4M4RA 5SV4A 3VFUA 1JGLH 1U93B 1IZKA 5IKCA 1YPZF 2GFBA 5FA4B 4Y4HA 4LSVL 3WEXB 2RIKA 1UZ6F 3ARRA 3VD7A 3V5HB 2FGWL 2WW8A 3ZDXF 1IC4L 5I1GH 4O58L 5L8LB 2EDHA 2Z4QB 2GTWB 4Q97A 4XNQB 3RWFA 1Z5LB 4R7DB 3NCMA 3UXFA 3QNYB 4JFOA 4KQ4H 3SCMA 3KAAA 2EE6A 5H37H 1R3IH 2APXA 3QUZA 4X4ME 1JHTB 3VWKA 1KF9B 3WMSA 3P4MA 5GRVK 1W0WA 5CEYB 2KL6A 1I1AA 3GMNB 4AL8H 5CD5C 4KVCH 4PJXA 4LVNB 4WDIB 2O5YL 3C2AL 4RDQG 2I24N 4NQEE 2EYTB 5ICYA 2AP2A 1F2XK 4NQTA 5C9JA 1HHKA 4DOHB 2HN7A 4X6CF 3EW3B 4PGEB 3RVUD 1MHPH 1W2KT 2J88H 5I9QC 2XN9D 1A9BB 1QSFB 1T1WA 3HC4L 5CCKL 3S36X 5IUSA 4M7JH 3MRHB 2B4CH 1U3JA 1BZ7A 1AR2A 1NMAL 5TQ0H 3G6JF 1TCMA 1KEGH 2IMNA 5E8EA 1SEBB 1B90A 3CFBB 1AGCA 2ENSA 1EBPA 4ZAKD 5LQBH 4RISL 2NZ9D 3LQAC 3QHFH 4LNVA 3CD4A 5HD8D 4KRPB 5EORL 3BAEH 3UTTB 4FFZH 1DLFH 1S78C 5DD1H 5DXWA 3NIFE 3SJVE 3P4LA 3BYTA 4UOW0 4DN4L 5CEXA 2OYPA 4O00A 3LRSB 5E8DL 2OXGA 4ZUTB 1A5FH 2BVEA 1PQZA 5EOCH 5ALBH 1D5XB 1QLRA 2J8UE 2BVOA 4I5BA 1AR1D 1QO3A 3RL2B 4ZFOL 4JGUA 5INCB 2CIIA 1H3VA 1WWAX 1ZHBA 4N0CD 4FXKA 3EOTH 3HZKA 3MR9A 1A7NL 3MBEB 3FONB 2WBJC 2CDEA 3SBWA 1T03H 4NIKB 1OSZA 3CMOL 4ZG1A 1GC1L 4YHPA 4PG9B 3G6DH 4XP6L 2JK5B 3QXTA 1JFQH 4HIIB 4P2QD 1MRCL 2ZUXA 2NY1D 3AREA 3KJ6L 4MS8C 5CZKA 5EO9B 2VL5A 3IS0X 2I07A 5E2VL 1H15B 5D7IE 4IDLA 3QHTC 3V8OA 4FXGB 4HEPG 3D39E 3I6LD 4MDIB 5I1JH 4QTIL 2CKBB 2PO6D 3ZDYF 1U58B 2P5EE 4KHTL 1JCKA 2FHFA 1CU4H 1VSCA 4JHWL 2E9WA 2YRPA 4YDKL 4UZGA 3RJQB 1CGUA 5KANG 4CVZA 3VG0H 2VKXA 2NX5E 2EYSA 3ZKMD 3QCVH 4DKFH 5DJ0A 1D5MB 4PJDF 4FQQB 3PHSA 3ZLQC 3H9SD 5BZWB 3LKPA 1HKLH 4WHDA 3DOSA 4RAVA 2DF3A 2I5YH 3ZHDA 3BMWA 2GEEA 4OLYL 4JCLA 1CICA 3VMPA 3HPJB 1U2CA 2V5TA 5IB2B 3BKML 3O81A 4G9DB 5E9DD 1QACA 5T1MA 3V0WH 1HXYA 1H8NA 5ERWA 3OKLB 4GUPB 4HS6B 4XNQA 4JPKH 4LLVB 4MAUL 2H9GA 3KDMA 2XACC 2FH6A 4M62H 3VWJB 2WANA 3QNYA 3GSWA 5I19H 1S8DB 1NAMH 4N1CA 4YXHL 2CQVA 4OCWH 2B39A 5DC4B 2A6JA 4P5MA 4NM4L 1PJ9A 3IVKA 2Z31C 4GLRI 4ZOCA 2R1YA 1KIRA