The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
85
|
sequence length |
239
|
structure length |
228
|
Chain Sequence |
DKRIKDEEDVEKELGLPVLGSIQKFTTLFVYEKPKSTISEKFRGIRSNIMFSKGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDSLLVIDNEKNDKNEVKKAKALMEKAGSNILGVILNKT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Comparative analysis of the Tyr-kinases CapB1 and CapB2 fused to their cognate modulators CapA1 and CapA2 from Staphylococcus aureus
pubmed doi rcsb |
molecule tags |
Transferase
|
source organism |
Staphylococcus aureus
|
molecule keywords |
C-terminal fragment of Membrane protein CapA1, Putative unch
|
total genus |
85
|
structure length |
228
|
sequence length |
239
|
ec nomenclature | |
pdb deposition date | 2013-03-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF13614 | AAA_31 | AAA domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |