4JLVA

Crystal structure of the chimerical protein capa1b1 in complex with adp-mg
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
239
structure length
228
Chain Sequence
b'DKRIKDEEDVEKELGLPVLGSIQKFTTLFVYEKPKSTISEKFRGIRSNIMFSKGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDSLLVIDNEKNDKNEVKKAKALMEKAGSNILGVILNKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-terminal fragment of Membrane protein CapA1, Putative unch
publication title Comparative analysis of the Tyr-kinases CapB1 and CapB2 fused to their cognate modulators CapA1 and CapA2 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 85
structure length 228
sequence length 239
ec nomenclature
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jlvA00
2E1RA 3FFBA 2IEZA 1P2VA 5SZIA 2WOJA 3RNLA 5DN6A 3R20A 5AR1A 2CLSA 4YMTA 3A1VA 4JKIA 4B6EA 1F2TA 4IVQA 1A1VA 3X2SA 3MD0A 1M1YE 2X77A 1IN5A 1ZD1A 2R6DA 4RD3A 2AX4A 2EYQA 3PUVA 4DKXA 1EXMA 2IS2A 2GA8A 1U8ZA 5J5CA 4K81B 4TTRA 3QEOA 4DBLC 5FOVA 4US1R 4RZXA 4KJZA 4XSGA 2P2LA 1F2UA 3B9PA 4LJ7A 2G9NA 3E2IA 3T5GA 3OIUA 2MSDB 2BOVA 2Z5FA 4TQ9A 1S3SA 3RRZA 3MGCA 2RB4A 1FTSA 4IJMA 2VLIA 4TL8A 3FOZA 2DPXA 2YVUA 3RWMB 2QN6A 1GL7A 3QKSB 1X6VA 2XNSA 3CBQA 1AKEA 4LBZA 1MV5A 3T1OA 2GHIA 5AUQA 5B64A 2BJVA 3U4QB 3TQCA 1CR2A 1EX7A 1LF5A 1R5OA 1S9HA 3B1ZA 2R62A 3HP1A 4PC2A 5AJWA 5FUYA 3EPLA 3FPAA 1Z6AA 4TMXA 5EP2A 4PX9A 4DT1A 3CRMA 4M21A 3KFXA 2NPFA 3DMDA 5A4JA 5E3HA 4MRSA 4JLPA 4Q47A 4HZUB 4KFRA 3I5YA 4DB4A 2O8BB 2EU8A 3TQFA 5FUWA 4QGGA 3BS4A 2G77B 2UZIR 1IXSB 3QKTA 5FR2A 4BRUA 1AIPA 2LKCA 1Z63A 3WBJA 2F1JA 2OILA 4FXPA 1JI0A 5FL7D 4JJKA 3WNCA 3QNUA 3SHWA 3VR6A 1ZNYA 2YWGA 4XWAA 3WYFA 4C4PA 2NO9A 4GMXA 5DNYB 4QBHA 3CX8A 4DEXA 3I61A 1YZKA 5JI3E 4CEIA 3H2YA 3JVUA 1DBSA 3LBIA 1QF9A 1SVWA 4Q5IA 2QQEA 4TQAA 5CDFE 4D25A 4TT3D 3FKSA 1E99A 4NU0A 3VU9B 2ORWA 1ZJ6A 1FMLA 2VO1A 1QVAA 2C99A 3AKEA 4JVMA 4IEIA 2FZ4A 3ADDA 1GUAA 3GEHA 4CDGA 2AWNA 3FMOB 4YMUA 5H68A 4IHQA 5DHAA 4LPSA 1OH6A 3BFKA 3C14C 2IYVA 3HWSA 4V02A 1AM4D 1TX4B 3FDIA 3UKDA 2X19A 3IIKA 1C4OA 2JLZA 2RGNA 1E0AA 2NIPA 1G5RA 4PO8A 5JMTA 4LYHA 1RKBA 1R4AA 4L8GA 4URUR 4NYIQ 3VNVA 4X8LA 3RSLA 1S2MA 1XEWX 2IYLD 3TSWA 4TYPA 1COWA 2BM1A 2GEUA 2UZ3A 4LV5B 5SZKB 4JLOA 3ZZTA 1I2MA 2E9SA 5HKKD 2XZLA 2WM9B 5KSYA 2ZTSA 3CX6A 1PZNA 2ZR7A 1HQCA 4GI7A 5KOYA 1SVKA 4MYUA 2QI9C 3KFVA 1U0HC 4DSTA 2K5UA 2QTVB 5HTKA 4Q48A 3IGFA 2WAXA 2VYFA 3K0AB 4AD8A 1YKSA 1LS1A 1CJKC 2DY1A 5JSZB 1G19A 1FNMA 1OIXA 2ODEA 3K70B 4P4SB 1E1RA 3Q7QA 2FEMA 3Q5EA 3LFUA 4C0KA 1K5GA 2H16A 1VMAA 5EE9A 3OAAA 4ZIRB 2GF9A 1RZ3A 3AVQA 4B47A 5FBRB 2GXAA 1W36B 4NYJQ 4ACBA 3EASA 1LVGA 2CDNA 1KKLA 4PHHA 1DPFA 1E2HA 3K8YA 4KVGA 1OH8A 1SVSA 5FFMA 1LW7A 1KI7A 4HSEA 1TNDA 1XMIA 4DLVA 4ZDJA 1F5NA 4U00A 1JPNA 2GJAA 1DARA 3B13B 2O0KA 2W6IA 1YZNA 3CNLA 4EJSB 1G41A 4OK6A 4B75A 2F7SA 2Q21A 4P33A 4L9SA 3VR1A 2RGBA 3QBVA 1GM5A 1W2GA 1RE0A 4B3XA 2LCFA 3M4YA 1G3RA 2ZS8A 4I99A 3X1DA 3U7EB 2V1UA 3MWJA 4A0FA 3C7KA 4GNKA 1GFIA 4PPGA 2YWEA 2WWIA 4DLRA 4PHGA 2JLSA 4Q7KA 2J87A 4M53A 4UJ3A 2H18A 5DYGA 1NMXA 4C0HA 5BYKA 2PMDA 4OQMA 1NIJA 2W58A 3EW9A 1RFLA 1U9IC 1R7RA 1E2IA 1W4BA 4F92B 3U5ZB 3QPWA 3GQBA 3QE0A 4A0RA 2FJUA 2AHOA 2JIZD 1CXZA 1UM8A 1LNZA 2C5LA 2OG2A 4U5XA 2PH1A 3UG7A 2P67A 1CR1A 2W2VA 3IKJA 4OHWA 5AJXA 5IDVA 3TW4A 4LX0A 1J99A 5J40A 5KHOC 5FTJA 1JAIA 1FX0A 4JLDA 4N1AA 1YZLA 4B6FA 3RABA 3WRXC 1MRNA 4M9ZA 5FOXA 3OE7A 3BH7A 3H86A 4TWZA 4PSKA 2BMEA 4JVNA 1E4YA 3ZD6A 3ND8A 1BMFD 2OXRA 1YR7A 4C0LA 3LX5A 2VQSA 4QC2A 2V54A 3TRFA 4CEIB 3U7FB 4AWXA 2DWPA 4KFTA 3JZMA 4WAUA 1CTQA 2QL6A 3GLFA 2DFNA 4UXJA 1OV4A 2F3RA 4AKGA 2VBCA 1HYQA 2ZRNA 1KI2A 2VP9A 2B92A 3SBDA 1NN5A 5L3QA 2IWHA 3PCRB 2HV8A 2CJWB 3IHWA 3OEEA 5G3ZA 2V3CC 1IBRA 5BW8A 2RGCA 3U6KA 3RC8A 3A8TA 3WNDA 3H84A 1NN1A 2FF7A 1XJ0A 1GAJA 2V8OA 4BRWA 2CE7A 5EP4A 2ZE8A 5H70A 1UEJA 2UVQA 3I92A 3E5HA 4MRNA 1XD2B 3CB4A 2GJ9A 4TLDA 3GLGB 3KKMA 1NJFA 2ZSEA 3LA6A 5CJPA 1XMVA 2D2FA 2R44A 3EZ7A 1O87A 2BBOA 2HT6A 3UMSA 1E94E 1ZC4A 4QGFA 2OHFA 3DMNA 4Z1MA 3SJZA 4Q4JB 2AXPA 2R6AA 1L2TA 2VP4A 2QAJA 2QORA 2GWHA 3U3OA 4Q19A 3WNBA 1IM2A 4BFVA 1E2JA 1WBDA 5C46F 2GJSA 4AC9A 3ZYCA 1MABA 3QF4A 3A6PC 2VF8A 1KAOA 1GNRA 2O8FA 1KAGA 2FSGA 5EQTA 2J3EA 1UBCA 3D3QA 3KQNA 2REOA 4ZO4A 4V0KA 2ZE6A 1T6NA 4EQ6B 3PQCA 5EP3A 4JZKA 3UWKA 4RFVA 4O3MA 3DL0A 4TSFA 2JLXA 3CZQA 4LV8B 4Q21A 4B44A 2XZPA 1YR6A 5F9FA 3WYAA 1ONBA 2P6UA 4OI4A 5ANRB 3GLGE 1NVUQ 1CJMA 1E2FA 2A5JA 1JNYA 4DUGD 1G3MA 1JJ7A 1SXJB 3WHKA 2J9RA 1GVNB 1NBMA 4WBSA 1CKEA 1E9DA 4DSUA 3C41J 4B3DA 4PXAA 3GJ0A 4FI3C 4XIGS 4RD4A 4YXWA 2I1QA 2QAGA 4JLJA 2CMKA 4A4DA 4NL4H 3K9GA 1NSFA 4DLUA 4KSBA 1DO0A 1VYUA 1W4AA 2I4IA 2FDCA 3GJXC 3K53A 3FGNA 5LB2A 4AYWA 1AS3A 2BEJA 2RKOA 1UJ2A 2IBMA 4KLZA 3FVQA 4JYCA 4RKFA 4DZZA 1M6NA 4HDOB 2RHDA 2WIBA 1VCMA 1R5BA 1OB2A 2CVHA 4B3GA 2YOGA 1JR6A 1G5PA 2VIIA 3ZIAD 3KKOA 3EWSA 3RDPA 5KSZA 3TE6A 3TVTA 2JJ1D 3ICEA 4AURA 2IUTA 2OXCA 3W8RA 3REGA 2WWWA 1IXRC 4QG7A 2FNAA 2EWVA 3CX7A 3U3RA 3HR8A 5KSOA 1NF3A 3A1SA 4E22A 5GJCA 1OW3B 1EFRA 4XWOA 4KI0A 1NL3A 2BBSA 5TY0A 4QKQA 1KKMA 4RZUA 3VX3A 2FU5C 1CR4A 1GL9B 1WE2A 4O25A 1A82A 4BFUA 3HPRA 1UDWA 1UDXA 1M7GA 1KY3A 3G82C 1XEWY 3U61B 4CEJB 2ZI7A 4MITA 1E2NA 3T15A 2B8WA 2ATVA 5IRCD 3F8TA 3JZAA 1BH2A 3D7MA 1G4AE 4V0OA 1GKYA 2FA9A 3TJZA 3D6TB 3RS7A 1N6HA 1SQ5A 2HJGA 1VIYA 1Z6GA 2EFDB 2H57A 1P73A 4IDOA 4MUBA 3R9IA 3C5HA 5F98A 4MKHA 3B1WA 4MRPA 2VP0A 1KK1A 3RRNA 1ZUHA 3ZGXA 1JALA 3AVOA 4A0GA 1Z6XA 3UXMA 1ZC3A 2F43A 4AG6A 1NVVR 1K6MA 2YOHA 1OFIA 1II8B 2BMJA 4I4LA 2ZU0C 4IXMA 1VKJA 1JECA 1G7CA 3MRSA 4M9SA 1RYFA 3LAWA 4D81A 1RRPA 4B76A 1TUIA 4YDHB 5HCIA 4ZKDA 2OZEA 2ZRHA 4C0AC 4R2HA 4A36A 4MKIA 1BYIA 1TU4A 4ZDKA 3ZQ6A 1XXHB 4KODA 1DEKA 3IPXA 4PPQA 4QFMA 3WXMA 3R9WA 2IXFA 2O52A 4BUJA 1VG9B 4N3NA 1XCMA 2C9YA 4QNRA 5AJYA 3RS3A 1KK0A 5BN5A 4NDZA 5J4HA 3KX2A 3PUXA 3X1ZA 3PITA 3FMFA 5KPDA 1EESA 2RGDA 1GNQA 3VTKA 1WB9A 1SZPA 2DFTA 3V4RA 3E1SA 4F4JA 4XVRA 2R2AA 3EPKA 3PVSA 3VR5A 1ZD9A 4JT4A 1CP2A 3EC2A 2AKYA 2DFLA 3I4LA 1N0WA 4HAXA 4EDHA 4IEEA 2GZAA 4FCWA 3RYTC 3ADBA 3VHXA 5B30A 2HCBA 4DJTA 2NMVA 4UNSA 2PT5A 4EAQA 1R6BX 3QKSA 4Q1CA 5CDFA 1U0LA 3DVLA 2AKAB 1E9BA 5B2ZA 3LH5A 3N2IA 1YZUA 1KI8A 3U4QA 2Z4RA 1E9AA 2RMKA 3GLFE 1OF1A 1U98A 3LO5A 2OUKA 3OFNA 2G83A 5HE9A 3TBKA 3LQRA 4TSFD 3AF1A 1SKYB 1G17A 2IYXA 3CRVA 4GFDA 4HZUA 2O8BA 1KDPA 2WHXA 4II7A 1BKDR 2WMNB 3I72A 2FPKA 1DO2A 1TAGA 2IK8A 3CH5A 4NTZA 4ZKEA 4DDWA 4Z51A 5BN3A 1XNJA 2WKPA 2QENA 4GOJA 1P7CA 4OHYA 2ZYWX 1UEIA 4HB2A 5FBLB 5JWOA 4E03A 1E2MA 2F9LA 3K0FB 3V9PA 3GD7A 2OE2A 3DPUA 4FMCB 4FCVA 3HU2A 1TF2A 5E7MA 5FPYA 3B7GA 2FFHA 1E79D 2FZLA 2AL7A 2IYYA 2C96A 3VKGA 1ZM3A 1YR9A 1HURA 3SZRA 5GVSA 4X8HA 3QKRB 1KO1A 1GRRA 3FMPB 4NE2A 1JR3D 3N70A 2VTKA 2QE7D 2G6BA 2WKQA 4Q9IA 2PL3A 2J7PD 1W0JA 3VU9A 4V03A 2ZU6A 1T5LA 1OKKD 821PA 3I3SR 3AKYA 2JDIA 1DVRA 2QP4A 3SEAA 4XVQA 1TPZA 4B3CA 4AK9A 3ZVMA 1KI9A 2HF8A 4PQFA 3ZD7A 1PUJA 2BCJQ 1Q21A 2D7CA 2QP3A 4HEJA 2ONKA 3T1QA 4W9MC 3FFAA 1P6XA 1X8LA 2GXSA 4M9XA 1OE0A 2ORVA 2D3WA 4OJKA 2ODNA 2J7KA 3K0CC 4I1VA 4WXRA 4BLOA 3GJ5A 3KB1A 2V1XA 4D4LA 3KTAB 2J46A 2OAQ1 3EC1A 1OXSC 2KSQA 2OSBA 2GESA 2O0HA 1E69A 4LGMA 2A7QA 2EWWA 2A5FA 4OL0A 5HPYB 1B0UA 2QM7A 3TUIC 1SVOA 3PFIA 4MA4A 1A7JA 2P0EA 1QG4A 2IT1A 2QMOA 2RCNA 4HAZA 1GILA 4DVGA 3T1VA 1T3HA 4JL6A 3C15C 5KO2A 3THXB 1OT3A 2AK3A 4LUCA 3P32A 4BLQA 1KMQA 3ADKA 3GJ4A 5JSZA 3QI2A 3KXLA 3GLIB 1JB1A 3VR2A 4DLZA 4ESHA 4Q02A 4TLCA 1DADA 4GL2A 5KNBA 3KQLA 1AGPA 3K1JA 3X1XA 5FOTA 4ZIRA 1PLLA 3EZFA 2J0QA 2ERYA 3SHFA 4A8JC 1YRAA 4HATA 4DXAA 1E2GA 2ZYUX 1ANKA 3W9YA 3ZVNA 4FWIB 3GJ8A 1OXXK 3SBEA 4Z8XA 1Z08A 1S4QA 2WJYA 3IIMA 1N5IA 1OXTA 1ZD8A 2OFWA 2PJRA 2CCKA 4US0R 3MG9A 1ZM4A 2PX3A 3TMKA 5LD2B 4EJSA 1VCOA 1RC8A 3A4LA 2WJIA 5DH9A 1EFHA 3LDAA 3MWLA 1W46A 2R8RA 1I4DD 4HDCA 4PC1A 4WOPA 4MGZR 1RRCA 1IY0A 1RRGA 1FUKA 5G41A 1VCIA 4A8JB 1PLKA 1E4VA 1IY1A 1OHHA 1XF9A 4G0NA 4NYIR 1W47A 2WJJA 4LC1A 1XFAA 4M1YA 5FTNA 1RW4A 3FYHA 1Q22A 4HUQB 1VG1A 4OQLA 1DOAA 4JYBA 4AY2A 2FSHA 4NMMA 4KCGA 3CRQA 1Z0IA 2VSFA 2A5DA 2VSXA 3NG1A 3W5JA 5K8LA 5L3VA 4TYWA 3NH6A 2ZI5A 1G291 2OLKA 2N42A 3SDZA 4UNRA 1GKUB 4AKEA 4JJZA 1L8QA 3TAUA 1DAIA 1GKIA 4QBGB 4HI0E 3A4NA 3ZJYA 2WOOA 4NCKA 4K46A 3EZ9A 4D0NA 1DS6A 2OBMA 2CHVA 4KYIB 1A5TA 4QXAA 4XJXA 3NKVA 2AN9A 3CO5A 4B32A 1KO8A 2KI5A 4BZQA 3AVYA 1T3LA 4IDQA 3OESA 2REBA 4B2PA 4JLKA 4G5GA 1NP6A 1KDTA 3E70C 5EE1A 2PJZA 2DHRA 4C0BA 3LX8A 4C9BA 2A5GA 5GJBA 3SFZA 1Z0AA 1XTIA 4P4UA 2UKDA 2O0JA 4B35A 2RGEA 5EE3A 3SFVA 4P0TA 4LPKA 2G1JA 2GK7A 2HXYA 3LBHA 1KSHA 1YZQA 1CJVC 3PEUA 3AGQA 1NVWQ 4ZI2A 4F93B 4RCZA 4PAQA 2WBLC 5JCZA 4O2LA 4TYNA 4Q1DA 4JSYA 2IYRA 5JCPA 3ZVRA 4E5UA 4UJ5A 2CJWA 1AGRA 4B2LA 4MQBA 3V4FA 3F0TA 4HAYA 5J4VA 1ELOA 5E7IA 1ZW6A 4IFEA 4ZDIA 1AJEA 3PXGA 4CEHB 3UMRA 4QBFA 3W6OA 2XSZD 3RSOA 4D4KA 4A0HA 1FOEB 2MSCB 1FPMA 4R98A 5HZKA 4LZZA 1H8HA 2QU8A 2BEKA 1XD2A 4HAUA 3HJNA 2XNDA 3GLGA 1XJCA 3O47A 1NG1A 3CRW1 1WCV1 1U8YA 2JLRA 5KYKA 1ZIPA 1VPLA 1ZNWA 3CM0A 4A2WA 2FX3A 4M1KA 2WPDA 4ABYA 1XTQA 1IN8A 4Q4JA 4URVR 1ZM9A 4LC0A 3AF0A 621PA 4C3ZA 2HLDD 2DFKB 3P4YA 4M1TA 4YMSA 4FCTA 5ELXA 1EG7A 2TMKA 3ZDQA 3NBZC 4G01B 4MYCA 5CK5A 4X8MA 1Q20A 2H17A 2O5VA 5JRJA 4EPYA 3IBYA 3LLMA 4P4TA 2GVDC 1H8EA 2MSEB 3PEVA 3MWKA 4ASUD 2YJTD 5HR5A 4Q1FA 5DI9A 2IF2A 1NLYA 3CR7A 3WRYC 4EQ6A 2FFQA 4B34A 1NJGA 3DEFA 3DKPA 1BOFA 3OIVA 2C9CA 2NGRA 3OEHA 4OHZA 2JA1A 1L4UA 1A2BA 2J5XA 1CJUC 3B85A 3BE4A 2DWOA 4D4JA 4KFUA 4LDJA 1FZQA 2IS6A 5FTKA 1EFUA 1VG8A 2GBLA 2X2EA 3LQQA 1SXJA 1N6NA 3OIYA 4JLNA 4DCUA 2CLCX 4FD2A 1UBGA 1TU3A 5TMPA 5GJWC 2WSMA 4B43A 1Z07A 2ZXUA 1Z2AA 1RJ9B 3IQXA 3NTUA 4XD7A 2V4ZA 1MH1A 2XTNA 3MWYW 4C7OB 1KJZA 1S1MA 1T0JB 3Q5DA 4OJQA 1G3IA 3NBFA 3WMFA 2O8EB 5C4MA 2I1VB 2OCBA 4CIDA 1QZXA 1E0JA 3CIOA 5H1YA 2F1HA 1XTRA 2HUPA 5DI3B 3RS0A 3NDPA 1UF9A 3MMPA 4M4SA 4B33A 4BFZA 4OK5A 4LY6A 1TADA 1XBTA 2QMUA 3AB3A 4LJ9A 5SZJA 4P3YA 1QHHB 2H92A 721PA 1HA3A 2P5SA 1R0ZA 2PLFA 1J8MF 1G8FA 1Q0UA 4BLPA 1NIPA 1Z29A 1ZNZA 3FWYA 1EGAA 2ZUDA 1Z83A 3CKLA 1BS1A 2KB0A 1MOZA 2GJKA 2Q3HA 3ASZA 3IBGA 1XEXB 5EXTA 5DN6D 5FPKA 1BO6A 3MUFA 5EZ5A 2FMXA 4K8OA 4H9GA 4B73A 3P20A 3AF4A 5TVKA 4Q4HB 5A5GA 221PA 2KE5A 4HLUA 1BIFA 2C78A 4D82A 4CEJA 2OFOA 2QY9A 1QHSA 3GCGA 3QOFA 5IK2A 3CONA 1N6PA 3A1WA 2ZJYA 3QUSA 5FUXA 2QP9X 4YONB 3AEZA 4TN1A 4ZI3A 1E0SA 1Z6TA 1KSFX 3KB2A 1E0KA 5P21A 2IC5A 3A36A 2CK3A 2VHTA 4BFXA 2CNWA 2ZRJA 1XMSA 3C16C 3AVWA 2WIAA 2WWXA 1IQPA 3T06B 2A3RA 3DKVA 1G18A 1U99A 3BGWA 1N25A 1K8RA 4M1SA 1II8A 4WZAE 3KKNA 3KUDA 1TEXA 4V0MA 1U8AA 2F3TA 2A30A 2Z0MA 2ZJ8A 5EXXA 1EFTA 4PPNA 3M1IA 1AKYA 1KI6B 4BFTA 2A78A 1G8YA 2QGZA 3MJRA 5BYJA 2QPOA 1GZSA 3K09C 2BIFA 1QHNA 2F55A 1TMKA 4RY2A 4D0LB 1XXHA 4HB3A 2WWHA 3LVRE 2YINC 3NBXX 4RD0A 8OHMA 3T1TA 3LRPA 2BKUA 1N2CE 3UMFA 1XJQA 3IUYA 1YRBA 5EP1A 4DIDA 3SR0A 4G5QA 4NCNA 3SYLA 3LNCA 3Q8XB 3QEJA 2W6JA 2IYWA 1JPJA 1KO4A 2ODWA 2QT1A 4AYTA 2QPTA 1PV4A 3GPLA 1G3QA 4Y0AA 2IYQA 3ONWA 4D0GA 3L43A 5HCNA 2JLWA 3F5FA 1G8HA 5DLQC 4DDTA 1UAAA 3M0EA 3CH4B 1ZBDA 4PR0A 1R2QA 3D31A 4ACAA 1T3SA 3FKSD 1E2QA 5FTLA 3QPVA 4RKEA 4LI0A 3WHLA 1NVXQ 3AQ4A 3AM1A 3KZ1E 1E2PA 1FNNA 3U44B 2D4HA 4LHZA 3Q9LA 2FN4A 4KO8A 3U7GA 1CF4A 4DLYA 2B8TA 2ZR9A 3TGPA 1EK0A 1LTQA 3NH9A 4PPFA 4QHSA 2V7QA 4O2RA 1Z0FA 3GLHB 3P26A 4IW3B 4UNQA 3EX7C 1DAKA 2EYUA 1FP6A 4JL8A 5TARA 3VMFA 2XTMA 4OBEA 1W7AA 3G5UA 1COWD 2RGNC 3A37A 1P2UA 1W0KA 3TVDA 4S2EA 5JRZA 5CB6A 3FKQA 3RAPR 1D2EA 2IYZA 2WWFA 4URWR 2OV2A 3QY0A 3VR4A 1YR8A 3TUZC 2NO1A 1UKVY 4IOKA 2QMHA 4URYR 4Q03A 1RVDA 3EPJA 3PJRA 2O8DB 3AVVA 3K0FA 3RWOA 2VSOA 3BERA 1YZGA 2RAPA 1MO3A 3AP1A 3Q7PA 2OM2A 1TF7A 1UKYA 4DLTA 2YOFA 1NKTA 3QKRA 1DELA 1E9SA 1ODFA 1W1WA 3ETLA 2IYUA 2D06A 3AGPA 5CLQA 1TQ4A 3QXXA 1E1RD 4DWJA 5BXQC 3DHWC 2ZUCA 1XZQA 4ERNA 3BFXA 1Q1EA 2BBTA 4I81A 5EXPA 3TSZA 1RIFA 3GLHE 4F91B 3BBPA 3OAAD 5C18A 2GNOA 4TZ6A 2ZJZA 5A0FA 4GOKA 1D9ZA 1TL7C 3RS5A 1RYHA 4KBGA 3T35A 4LYJA 4UXIA 2DR3A 4TTQA 4AYXA 2N46A 3SN6A 1T91A 4E09A 5AJZA 3WMEA 4IOJA 2IHBA 4BZPA 3FE2A 3LBNA 2YYZA 2JJ2A 3NEYA 4UNPA 5EJEA 5DE3A 2W6ID 3H1TA 4C0SA 3CUEF 4EPWA 3WY9A 1QHXA 3B1YA 3QXHA 1EWQA 2FWRA 2OFXA 3TK1A 4BQSA 1ZCBA 3KTAA 4A2PA 4MDFA 2Q9BA 1E2LA 1AA9A 4MGKR 1P72A 2DCUA 1Y63A 2WSSA 3CNNA 3L0OA 4Q9JA 3B8HA 1AZSC 4NYMQ 4MYTA 2QROA 1SXJE 2GCOB 1YE8A 1G64A 5LBIA 5JECA 3QXSA 3KKQA 1BYUA 4TMKA 3THXA 5H8WA 1S9DA 4QJ4A 4CGZA 3UG6A 1Z6YA 2ZSBA 4PSVA 1C1YA 4HB0A 1N0VC 5EZ6B 2C9OA 3GLIA 4D80A 2PX0A 4FMDF 3MAAC 1GRQA 2QQ0A 2ZROA 3HPQA 2VHUA 4HDQB 1OFUX 1P9WA 2EW1A 2VHJA 2AK2A 3QG1A 1N6LA 2BM0A 2Z43A 3UWOA 4OYHA 4FMDB 4U7DA 4D2IA 3FTQA 1FQKA 2IXEA 3OE7D 2WJHA 1T9HA 3VAAA 1OYYA 1PUIA 4EPRA 4EPXA 2HF9A 3TIFA 2JJ8A 4LSGA 3W8NA 3UATA 4ZV4A 1G1MA 1NKSA 2AD5A 2ZAMA 5FBWB 2RHMA 4Q7JB 5EXSA 3TH5A 3IO5A 1S1CA 1J7KA 4BE7B 3G0HA 1HEIA 2CLDX 3DO6A 1FQJA 5FI0B 3AV0B 4P31A 4B74A 3K9LA 4B2IA 4A8JA 2ASEA 2JASA 4TLAA 3C5CA 2V6JA 3KJHA 1E6CA 4Q9KA 1W5SA 1P62B 2GILA 1E1QA 3OEED 4Y0VA 5CK4A 1FL9A 2MMCA 1IAQA 4HUQA 1EFCA 2ZRBA 4KFSA 5M04A 4PQRA 5F3WB 3AH8A 1XPUA 4YC7A 5AUNB 2ZRGA 1VHLA 5TXGA 4JVLA 3NHAA 2FV8A 421PA 2BVNA 4OK3A 5FI1B 2BMDA 5IF9A 3LXXA 4DRZA 3PEYA 1P2TA 2ZRIA 1G7RA 1NLFA 1HUQA 5EUMA 1OFHA 2GEVA 4PTLA 1Q12A 4M1MA 2XOKA 4JLVA 4ITRC 1J8YF 1KI4A 4LYFA 4Z1MD 3OF5A 2Q3FA 5DHFA 3FB4A 2ZUBA 3SI7A 4NPHA 1TEVA 1NRJB 1WF3A 4V0ME 1OXVA 3SQXA 1E3MA 1GOTA 2WMOB 5EE0A 1TF5A 5J4YA 3KJEA 2YV5A 3BC1A 5J4KA 3PEWA 1KOFA 1HE8B 2BHRA 2FE4A 1KDOA 1XXHE 3QXCA 1AK2A 2REXB 4I1UA 4MRRA 1HE1C 3ECCA 5FR1A 3VNUA 2C8VA 4L16A 2DWQA 2YWFA 2IEYA 4HAWA 3I8XA 4Q1BA 2ZYTX 5BN4A 4MDEA 5DIFA 2J0UB 1IY2A 4FMCF 3A58B 1UBEA 1OH5A 2J45A 1DAEA 3L0IB 3J81k 3A1TA 1QBKC 1US8B 4JVSB 2VL7A 4CEHA 2AXNA 4MGIR 1H65A 3EZ2A 1UKZA 2IUSA 1JQJC 1NN0A 2ZE7A 1NBMD 1LF0A 1XTSA 3NHBA 2BWJA 1IHUA 3CR8A 3IILA 5C4GB 4BLSA 1P61B 3U7HB 1E96A 1JAHA 4JL5A 4R2IA 1Q3TA 3LV8A 4XTCS 5JEDA 4Q01A 4YXWD 4GRAA 2G0NA 2J59A 3EA0A 4PC6A 3PUZA 3GJ6A 4CW7A 4GMDA 5L8VA 2XGJA 5TB5A 2ZEJA 3SC3A 1XEFA 4V0LA 3GEIA 2YZ2A 4Q4LA 1LB1B 2AFIE 3L82B 5KNCA 1X1SA 2JJ2D 2NZJA 2QAGC 2W00A 5AWFC 4EFLA 1OB5A 4HZIA 1Z22A 1NI3A 4PFSA 3IIJA 1SKYE 2BJWA 5DISB 4LHXA 1Q1ZA 4L9WA 1QHIA 2IXGA 2ANCA 5B58C 3CPJB 4OI2A 3A4MA 1M7BA 3BAFA 2VF7A 2CCJA 3IQWA 3I62A 4UKDA 5FL7A 4M0LA 5JJLA 2LKDA 4IVRA 1V43A 2C98A 2ZRKA 2Z6VA 2ZRPA 1VHTA 4BEJA 1II0A 1SGWA 3U3MA 2JLYA 5JJIA 1D5CA 3AKDA 4F4CA 3AVPA 4JIMA 4DCNA 5JFGA 3D8BA 2IW3A 4TMTA 1E9CA 2IF0A 1QRAA 2OLJA 2QAGB 2C04A 1W48A 521PA 1EFRD 1NMZA 3I1FA 4GT1A 4TT3A 2DBYA 2GCNA 4I1OA 1E9RA 3GFTA 3ASYA 2PEYA 1ZUIA 2CXXA 3DZDA 2EFEB 4OQNA 1Q57A 3AF2A 3K0AA 4QL3A 5FOSA 4D4MA 2O8CB 4YLGA 2ZIAA 2QMEA 1RJ9A 3W90A 1N6RA 3VQTA 4AI6A 4PZYA 4B71A 4P4SA 2YC4C 4N0DA 3FHTA 2GZHA 1NN3A 4C7OA 4CRWB 2Q9AA 1KO7A 4MKFA 2FEOA 3P4XA 4GDFA 2IA5A 4CYMA 2GF0A 3K0SA 4A92A 4Z54A 1U2RA 2WAYA 3W6PA 2O8EA 5IHPA 3Q85A 4JBWA 3R9XA 4BLRA 4RCYA 5FOUA 5JWHA 5DI3A 5CM8B 5KPJA 3QBTA 5HKKA 2B7BA 1NNEA 2QRNA 2SHKA 4EPTA 2KBEA 1QHHA 4Q4AB 1Q1QA 4MUAA 4EPVA 1X3SA 3CPHA 1JR3E 5HE8A 2CCGA 5K8IA 4ESVA 1OSNA 2CL6X 3H4MA 2QT0A 5AJVB 5DGXA 2OAP1 3DZ8A 3EA5A 5G53C 5D3QA 3AKCA 3QXJA 5TDHA 1VDZA 2WICA 2VPPA 1U0JA 2D62A 1QVRA 121PA 1XEXA 1ZP6A 1KK2A 3K0EA 3U3KA 1F60A 1XWIA 1ZM7A 3GLIE 1XD9A 3QVUA 1P3JA 4LJYA 1LFDB 2PCLA 4Q4HA 2ZR0A 3THWB 3M6AA 1OYWA 5HZHA 2BBWA 4LV6A 3SU8A 4OQXA 3ZLJA 4D26A 2XOKD 4LWZA 1P60A 2NZ8A 2ZRDA 1TQ6A 3AVTA 1P75A 4ZPXA 2XX3A 5KU1A 1OLOA 3QENA 3IHLA 3ZZUA 5LPNA 1HQYE 1Z3IX 3U60B 1Z47A 5L3SB 1KIMA 3SQWA 3I5XA 1C9KA 2JLQA 3L8YA 3PR1A 1Z5ZA 4QOSA 1P2SA 1U94A 4L5BA 1YJ5A 2ERXA 2H5EA 3ND9A 1IJFA 1HH4A 4PANA 2GXUA 2G0TA 2A9KA 5BQ5A 1DG1G 1P5ZB 4HUTA 2PCJA 2QTHA 1E2DA 1NSTA 1N5LA 1Z8FA 4R71A 1U9IA 1VYTA 4GP7A 3OFND 4NHOA 2ZSDA 4KBFA 4ARZB 4PC3A 2H8KA 4NYJR 4NCIA 2B21A 1X8KA 4H1VA 4NKRA 4RVCA 1G16A 1KI6A 4KV9A 1RPZA 4IDHA 3EPHA 4DC9A 1KTVA 4IKEA 1Q1BA 1VYVA 3KJIA 2ZJBA 1QDEA 1M2OB 4US2R 3SNHA 2XEXA 1G20E 1E2KA 2JIZA 3NC1C 2IS4A 3X1YA 2ZM5A 5SZHB 5FPSA 3DM5A 1KY2A 2WKRA 2XB4A 2C95A 2QG6A 5JHHB 1KSJA 2WJGA 4NP6A 3AP3A 3X1WA 3P27A 1X1RA 4WIAA 2C77A 3VR3A 2ZRFA 2RGAA 2QBYB 5GVRA 4CZ2A 3K9HA 4CVNA 4FW9A 3BH0A 4GZMA 1D9XA 5FPTA 2P6RA 3K09A 4QGAA 1W0JD 1AZTA 1BMFA 3R7WB 4FIDA 4BWYA 2Z83A 3BXZA 4IDNA 1AQYA 1MRSA 2HYDA 3HU1A 3U44A 3CLVA 4R9UC 4U02A 2JDID 2HEIA 4S35A 4W7SA 4I1SA 2NO6A 1IOZA 1OFTA 2NTYC 1OJLA 3BD9A 1GITA 2B6HA 1ZAKA 4KXFB 2GK6A 3GMTA 3QSYA 5CYOA 2YKGA 3NEJA 5E4FA 5JEEA 1S3GA 1N6KA 1ZINA 4PAMA 2PEZA 4Q9HA 1B23P 3GLHA 3KQHA 1XD8A 2XXAB 1GTVA 4Q18A 1G5TA 4EUNA 3IDQA 4TYYA 2VP5A 1ESMA 3B9QA 5G40A 4TL7A 1OPXA 1P9NA 4HYYA 2VP6A 1R0WA 1YHNA 3JVVA 3QVVA 3ZS9A 2ONJA 4TQUS 4XOIA 4BFSA 3U6BA 5DO9A 1W5TA 1HV8A 1N6IA 4ZDWA 3MFYA 2R65A 2JLUA 4XH9B 4WA7A 3UIEA 4A82A 1LY1A 2O8DA 2FFAA 4JT2A 2J1LA 2VRWA 3KXIA 3RANA 4JLBA 1XB2A 3Q3JB 3RRYA 3FHCB 1E2EA 1R0YA 3AUYA 3OZXA 2ANBA 4DSNA 4LBYA 1XPOA 2ZQ5A 1ETUA 3QKUA 4HB4A 5KNDA 3R8FA 1OXUA 5UKDA 3CRRA 3V00A 3K70D 4KAXA 4FWTA 1X8JA 3CZPA 1ZCAA 2C03A 3KJGA 3O8CA 3PG5A 3ICQB 3PUYA 3RRMA 1VCNA 1SVIA 4RJLA 3UANA 5JI2E 2YWHA 3NVAA 1W36D 1ZUNB 3EIEA 3K70C 3TSOA 2ZSFA 4TLBA 1XCGB 2BMFA 1KMHB 5J47A 1CR0A 4LHWA 4MKGA 4A6PA 4KITB 5D3MB 1XTKA 3A1UA 4MRVA 2EFCB 3AUXA 2DYKA 3VHLB 4A9AA 4RFSB 1W36C 1MO5A 3GJ3A 4F7WA 2P65A 2N1BA 4MH0R 4EKDA 5CLLA 1NG9A 4CT4B 4N0EA 3KQKA 1YVDA 3B2EA 1X86B 4LHYA 2FGJA 3THYB 1JXMA 1PVOA 1UADA 4EJSC 1KO5A 2WZQA 4JBYA 4DUGA 1KGDA 5JLJA 1OHHD 3EIQA 1E9FA 1KHTA 1OH7A 1S96A 2R6FA 1VG0B 2Q0HA 2QGNA 1CEEA 1ZRHA 2GCOA 3O8BA 4QHYA 2HXSA 4BFWA 5E95A 4AIIA 2FSFA 1NLZA 3LD9A 4A2QA 3W3ZB 2NQ2C 4BASA 4LOAA 2HJVA 4AKIA 1W4CA 2CL0X 2QA5A 1N5JA 3KXKA 3S1AB 3SS8A 4LRWA 2EQBA 3MSXA 4OQFA 3HYTA 1T0HB 3TR5A 2IX3A 1VTKA 4Q9LA 4GOXA 4YDSA 4QJ5A 4BPBA 3IEUA 1Y3AA 4W5JA 4DCSA 1S0UA 1W2HA 3WP0A 2BV3A 1E98A 4Q00A 1G21E 2G1KA 3BB4A 1TQ2A 3CWZA 1G6HA 3ZIAA 1T8TA 4TMWA 1UFQA 2B7CA 5KDDA 4C0QC 3KQUA 2JJ1A 4G5RA 1HTWA 3LXRA 4NZYA 5C2JB 2GTPA 4RZ2A 2GAOA 3SJAA 5FBVB 1J2JA 1SKQA 1Z0DA 1KZGB 3KUCA 3ADCA 1UKEA 1ZU5A 4YMWA 4DT1B 1WMSA 1M34E 2GETA 2FOLA 1IXZA 4XSHA 4C30A 3VFDA 3LW7A 3EAQA 1WRBA 1XMJA 4B3BA 4DDVA 5CITA 3FMIA 2IUUA 1KDRA 2GXQA 2J41A 4FMBB 5KDOA 1ZNXA 1F2TB 2XTZA 2IS1A 1UPTA 1N0UA 4DCTA 1KSGA 1WQ1R 1CU1A 1M74A 1MO4A 2G88A 2YHSA 3NC0C 1I2DA 2ZI3A 2ZRMA 3W6NA 4TZ0A 1KYIA 1TQDA 3NXSA 1YU9A 1J90A 2W83A 1FTNA 2D74A 4DEYA 1F2UB 3F3YA 1CULC 1GRNA 2XJ9A 2A2ZA 4JLMA 4OHVA 4URXR 4TMVA 4C2UA 3ZQJA 3EZ6A 4IFBA 2ZJOA 4NYMR 5KSPA 2QSYA 1SHKA 2NO0A 4X8OA 1SVMA 2ZJ5A 2AD1A 2QNRA 2CHGA 3RC3A 1H8HD 3SE0A 2XNDD 2ZITA 2OO7A 3AVXA 4LBVA 2ODBA 3BOSA 1II9A 2ZI9A 5CJ2A 1KI1A 2ZVPX 2C2HA 4QM7A 2WPDD 1G4UR 1XCPA 2OCPA 3C8UA 6Q21A 5FH9A 1DTSA 1XDBA 2PZFA 3U2QA 1AS0A 2XB2A 1WP9A 1GWNA 2ECKA 4NBSA 1GP2A 1Q3HA 3KL4A 2GCPA 3T12A 1CJTC 4DHEA 3ZH9B 1H8ED 3R8CA 2GDJA 3HU3A 1CRQA 2W0MA 3SOPA 4ON9A 2FSIA 4UQOA 2EFGA 3WBKA 3B60A 3QPUA 1JEEA 1Z0JA 4FN5A 4P32A 3BORA 3OEHD 1A4RA 4POAA 1T4GA 4KSCA 1IN7A 2AFHE 2J0UA 3B1XA 3L0PA 1FUUA 4M2LA 4OKSA 2IHYA 1M8PA 1F6BA 1XU4A 3CF0A 4J0QA 2GEDA 3B1VA 4JSTA 1E9EA 3BIFA 3GFOA 1KI3A 1US8A 3O8RA 4PHTA 3UK6A 4EFNA 5EE5B 1SXJD 2F1RA 3NBYC 1R8QA 5FBQB 5JS7A 4LJAA 4RSGA 3NDBB 1PJRA 2RGXA 4OI0A 2VEDA 3O8DA 5KDLA 3RS2A 1G7TA 1G3UA 1NMYA 3EG5A 4L4UA 4XVUA 2GBLC 4PAOA 1SXJC 1WBBA 2W2TA 1SULA 3EWAA 4XD7D 3CNOA 1ZYUA 3GEEA 4GSYA 5GJVC 5EUQB 5J4LA 2NPIA 2X8AA 2RGGA 4QJ3A 2ZI4A 2IWRA 2OESA 4GZLA 5F9HA 3QF7A 1SVLA 4HLQB 3GP8A 2ZRAA 4QHTA 1ZM2A 3DDCA 1EWRA 4LBWA 2Z4SA 2F6RA 4OHXA 2FPMA 3BB1A 4IOLA 1F3OA 1QHYA 2D7DA 3L0SA 3EARA 3TAHA 3KKPA 4DLWA 3TLXA 1ZIOA 2ORIA 4JKYA 5K8TA 2AWOA 1RRFA 3VKHA 1OIWA 2WTUA 5FTMA 1GDDA 4KU4A 5JS8A 4F4IA 1E79A 2E87A 3PV0A 4Q1EA 1OIVA 2ATXA 4LHVA 5JHGB 4ZCIA 1TUEA 4PHFA 5LB4A 1G6OA 4GBMA 1JR3A 3DM9B 3EIHA 2QE7A 2Q3MA 4TYQA 2GAAA 2VHCA 4IXNA 2J7PA 4HLCA 2GZDA 4NCHA 4NCJA 2PBRA 1JBKA 1GIAA 4PZLA 1O3YA 2ZSAA 1UBFA 1OKKA 3B6EA 3AP2A 4TTPA 2FFBA 4URZR 3N2EA 4WZ6A 5IK2D 2O8CA 2V9PA 4UXHA 4DLSA 2H1LA 2ZI6A 2JCSA 1M7HA 2CBZA 1DAHA 2MMGA 3K0CA 1G9XA 2DB3A 4HLUC 1R5NA 3LWNA 5IT5A 3U3JA 2P3SA 5G3YA 3DOEA 2CK3D 3SYKA 1A2KC 1VIAA 1ESNA 2ZAOA 1FMJA 2CNWD 2F9MA 3WP1B 1L7VC 4KLNA 3CF2A 1YQTA 1T8UA 4JMPA 1HT1E 1FFHA 3SJCA 1NY6A 4EFMA 1AQUA 4WVFA 1KJYA 3QIAA 4QGHA 1CS4C 4Q4AA 5TV2A 5FPHA 4JS0A 3LW8A 4W5WA 4BLTA 5FUVA 1N3BA 4LCBA 4BEBA 1WXQA 3BWDD 4DB2A 2BCGY 5CYPA 1QHGA 3MCAA 3UPUA 1CIPA 4C0JA 2OBLA 4ZCMA 5L3RA 5E7JA 1DE0A 3GFPA 3CPEA 3DOFA 2JATA 2W6JD 4Z8YA 1D6JA 3PENA 1FP7A 2WWGA 2D2EA 3MLEA 1SHZA 3TR0A 1FW6A 2BKEA 4BZXA 3THWA 2ZS7A 3SYNA 3WYGA 4AG5A 5JBQA 1DAMA 1IN4A 1MT0A 1FX0B 2KJQA 2W0SA 4BFYA 5DSZA 2ZS9A 1V5WA 1D2MA 2FPLA 4RZ3A 5BWMA 5DYIA 4YMVA 3KDSE 1Z28A 4M1OA 2OEPA 4BECA 4C2TA 2AR7A 2HCJB 3ZS8A 1IN6A 2VH5R 2CEAA 3LLUA 4W5HA 2OCAA 3IPYA 4G5SA 4LJ8A 4GP6A 4A6XA 2PZGA 5L3SA 4PSAA 4Q7MB 4TLEA 1I4LD 1GG2A 4LK2A 2QSZA 3TW8B 2JLVA 1J70A 3W5IA 3VX4A 3P1JA 1P4SA 5FOWA 3GLFB 1Q44A 1N6OA 3THOA 4QNMA 2V7QD 3I8SA 2ZRCA 1XRJA 4WZBE 1GL6A 2X2FA 2WVJA 5L3QB 5JWRA 4G5OA 2VHQA 4ARZA 4QM6A 1N5KA 4NH0A 2R9VA 1U90A 1W0KD 2GKSA 3BRWD 3RHFA 3HR7A 4NONA 1CLUA 4FINA 2NO7A 4M9QA 1QG2A 5CIQA 2XJ4A 1GSIA 4LJ4A 4B48A 4TL6A 4B3FX 3QJYA 2QRZA 1EX6A 1DAFA 2IYTA 3EXAA 2QZ4A 2PT7A 5AK0A 3I73A 1P9RA 1R10A 3QQ5A 5CM9C 1D8TA 2ZJ2A 3TUJC 5JJKA 2H7VA 4M1WA 3BK7A 1WDTA 4M8NE 4DIEA 2PLRA 1ZVQA 3H0KA 2QBYA 3LY5A 2L0XA 2CE2X 4V0NA 2G3YA 4ZCLA 1HY3A 4BGDA 3BB3A 5AUOB 3T61A 5F2EA 3REFA 1ZMXA 3R7WA 1MABB 3SJBA 4Q1AA 4Q7LA 1MR3F 3QF4B 3W3AA 4H1UA 2O8FB 2W2XA 2FH5B 1G7SA 3LVQE 1GNPA 2Y8EA 1Z2CA 2CL7X 4PZZA 4F38A 1KJWA 1D2NA 3MJHA 1L4YA 2BDTA 1G8PA 4LYAA 1G8GA 1XZPA 4IDPA 4XWKA 3CWQA 5C1BA 4A15A 4WW0A 3IEVA 4O0MA 1LS6A 2GVZC 2IL1A 1DAGA 2R6CA 3I32A 1Z06A 2XXAA 3GJ7A 4QRHA 4WXPA 3OHMA 2GRJA 1MO6A 2JAQA 4LJ5A 4D6PA 2F1IA 2LWIA 2ZYVX 4IRUB 2NG1A 1XPRA 1NY5A 3NIBA 4AKHA 1LV7A 2PZEA 2WSSD 4DLXA 2J0SA 2GJ8A 2XSZA 2YNMA 4G3XA 4RD2A 1MKYA 4E07A 3W34A 4DCVA 1DG3A 1E32A 1JJVA 2WJVA 2XAUA 1U81A 2J0VA 4UNNA 2QEQA 2ZETA 4OI1A 2EFHB 3TKLA 3PIRA 1W44A 1KK3A 1NVVQ 1S8FA 2ZPTX 3B5JA 3OIWA 3QG5A 4RD6A 2FG5A 2RH5A 1JXOA 1JQLB 4A1FA 2HLDA 1HT2E 2Q6TA 3Q72A 2V6IA 4TMZA 2HT1A 2VP2A 4DSOA 4QBIA 1TTTA 4ILEA 3ZZ0A 5AUPB 2BC9A 2KBFA 2V55B 1CRPA 1KMHA 3BH6A 4ASUA 1YZTA 1F48A 3K9NA 5D3MA 1ZU4A 4IVPA 2VA8A 3AVUA 2KWIA 4PC7A 2PMKA 4RFSA 4YQFA 1IJEA 4IOMA 1IONA 1AN0A 2XITA 2ZVQX 2YC2C 2P5TB 3RLFA 1NBME 3L2OB 3VKWA 5LDDC 1WA5A 2CHQA 4KHZA 2XZOA 4RD1A 1Z0KA 2JGNA 5JZVA 4PQYA 2ZE5A 2NOAA 4G1UC 2FGKA 3NWJA 2QM8A 4LJ6A 4R7ZA 4PO1A 3THYA 1W49A 1R8SA 2WV9A 3IO3A 2ZJAA 4CF7A 5LD2C 4M22A 4EIWA 3CW2A 2QPAA 4KVAA 3BJIC 2OT3B 4TL9A 4KYUA 3N5CA 3FHOA 4MYHA 1E1QD 4DDUA 1XTJA 5FL3A 4L15A 2A5YB 4XTRA 3B78A 1T5IA 2R6GA 5CB8A 2WWYA 2X1VA 1W4RA 2CVFA 2ZANA 2JEOA 3S1AA 5KUTA 3T5DA 4CT5A 1JEDA 4GPTA 4PO9A 1XX6A 2OBNA 4HAVA 1XP8A 4JBXA 2QUZA 2P6NA 3TNFA 1PLJA 3B82A 4JLAA 3PUWA 3ZVLA 2F43B 1KZ7B 3WMGA 1K5DA 3HYRA 3T34A 1R0XA 3HDTA 2OCYC 5K8UA 1KNXA 2ZREA 2Q9CA 3RVBA 4Q66C 2I3BA 1AS2A 1I4TD 2EVWX 2ZRLA 3C4JA 5CIWA 3RS4A 2QTFA 2IYSA 5GADl 2HYIC 1KNQA 3L8ZA 3AF3A 1VECA 3BFVA 3CF6R 4MGYR 2HDNB 4HLDA 1CBUA 5B57C 5KTYA
chains in the Genus database with same CATH superfamily
2Z5LA 5I7AA 5KI6A 1A3CA 4ID9A 3FTNA 2WAAA 3ZZMA 4Z0HO 1J09A 1LI4A 3RNLA 5EJIA 2CLSA 4YMTA 3A1VA 4MV1A 3ZZ1A 1TZBA 2PLWA 1Z16A 2P2DA 3A3OA 2JIDA 4FJ1A 4ZP1A 5JYBA 1ND5A 1RWXA 1RFGE 3F47A 4ZVQA 2R6DA 4YAIA 1R0SA 3GH3A 2XUPA 4F8EA 5KKNB 3VO1A 2GEKA 3L7KA 4K81B 3PHJA 5JVDB 4A8TA 1KR5A 2GBIA 3LKDA 2CMHA 4RZXA 2JCBA 3PDIA 4LJ7A 4IICA 3JQ9C 1QU2A 2HHLA 3VZCA 2Z58A 1JHPA 2BOVA 1L9XA 1NXPA 3M1AA 4FZ5A 2RB4A 4IJMA 4TVBA 1ZHOA 1VGVA 1CJSA 3NJ8A 3R7LA 2RARA 3FOZA 2DPXA 3GRCA 4WKPA 2CLHB 3M49A 5A4AA 3HB5X 2PRSA 2YH2A 1BXZA 1X6VA 4RX1A 2QMZA 2XNSA 3ANNA 4RW0A 4CIYA 1MV5A 4FGJA 4UBNA 3T1OA 3G2HA 5AUQA 2BJVA 3UMJA 3TQCA 3U4QB 3A9VA 3FROA 2XT6A 3T7DA 1XPJA 5BOSA 2AW5A 2QLMA 4PC2A 3HP1A 5FUYA 1Z6AA 3SIWA 3ELYA 4KQCA 4PX9A 1ORTA 1TM1E 4RYDA 1GPJA 4FT4A 1Y5NA 3HCDA 1KZHA 2O8BB 1OAOC 2UZ1A 2CYBA 4N3CA 3TQFA 4ENSA 5FUWA 1GYQA 2AJTA 2WJWA 3BS4A 2G77B 3WLEA 5U4QA 4DNQA 5BN3B 2VNHA 1DJMA 2OV3A 4MEAA 1IXSB 5FR2A 2C20A 5DJ5A 3N53A 4G4JA 4PZUA 1OFGA 1AIPA 3ZLVA 3WBJA 3H1GA 2F1JA 3WNCA 1JI0A 4JJKA 5KTPA 5LXTB 4BP3A 2YS7A 1ZL0A 4YCCA 4C4PA 2ZLBA 2II6A 4YBRA 3PHGA 4QBHA 1C3XA 3U3ZA 4BNJA 5DNYB 3LOPA 3N28A 2A9PA 1HX7A 3K1AA 5JI3E 3GLUA 4X20A 1DBSA 1S5PA 4FFNA 3PQ3A 1PG0A 3DWGA 4Q5IA 1HOTA 4EKEA 3CZMA 3IVXA 4TT3D 2YQ4A 1TVMA 2Q5LA 1UWVA 3VU9B 1ZJ6A 2HWKA 1SCUB 3WLPA 2AR0A 5B7NA 4GZ6A 3GOHA 2SCUB 2Q5JA 3OPYA 1X0XA 1W1UA 2XDYA 1UXKA 3AR9A 3EVEA 4XXHA 4YMUA 1PK9A 1TK2A 1PJSA 5H68A 3STHA 3O3NB 4I9HA 3A9WA 2IYVA 4G8BA 1AM4D 2ZDQA 3FDIA 1YC2A 1ZWKA 4AY4A 4A5OA 3I2HA 4JJIA 1E0AA 4NU6A 1P5HA 2QTWB 2LD4A 2POQX 4IV8A 4LYHA 4YMHA 5JMTA 3ESBA 3DBOB 2D2IA 3VNVA 3ROPA 2BONA 1XEWX 3B20A 3C6KA 3WJ7A 4HNVA 2QLLA 5JASA 1Z75A 1COWA 2GEUA 2GN6A 4BV2A 4NK4A 4JLOA 5D1NA 4HPWA 1I2MA 2E9SA 2R1TA 4R6XA 2ILTA 3DGEC 4MLZA 2ZTSA 1FFCA 3CX6A 2Z8XA 3LF2A 4R84A 4IQ0A 4GF5A 4IMJB 1Z2OX 4M36A 3DNMA 4U0KA 2XCOA 5KX5A 2JAWA 1FRVA 1JG2A 3PNQA 4RHUA 1RM4A 1Z74A 1V47A 2D5BA 2J9GA 1LDNA 3FH0A 3HVIA 4IVNA 4J91A 3QEMA 1LBTA 8ADHA 1JDBB 1OD6A 1WSDA 3LQ4A 5DGCA 3BMNA 1LS1A 1JA0A 1PJ3A 3HP7A 4KQGA 4EELA 5CX4A 4EG8A 1FNMA 2VJDA 1Y4AE 3UV6A 4P4SB 3Q7QA 3HJBA 3ZH2A 1QPBA 3ROFA 3LFUA 4FCCA 1OJ7A 2JGAA 5A7FA 1K5GA 2G70A 1VMAA 4P5DA 1KYYA 4QLBA 5K8JB 2DTXA 4IZIA 3JQ8B 3HA3A 4B47A 1W36B 1Q77A 1GG8A 1X7ZA 3IR6A 3WA6A 2C7QA 1QOQB 1B7GO 5T6MA 5I51A 2I2DA 4FFLA 3VAZA 1OH8A 1SVSA 4H18A 1KI7A 4AP9A 4HSEA 2PUBA 1XMIA 2GWRA 1QZTA 4QTZA 4ZZ0A 3TSYA 2BEVB 4ZANA 4GXTA 4AAYA 2P79A 4NFYA 4RTLA 3N2ZB 5IBCA 4X71A 2W6IA 4X6XA 4OK6A 5LWQA 2H59A 1JEQB 2Q21A 2YFKA 3BDIA 3L6RA 1QCYA 1WXDA 4QUJA 3VAYA 3QBVA 2CNOA 1YRHA 4KX3A 1FP4A 3D2BA 3MFQA 4B3XA 4DE5A 4J94A 1MXFA 3U7EB 2GAIA 3C7KA 1KRXA 2YWEA 4TX1A 1NULA 4DLRA 3CVYA 2BMWA 4RABA 4WK0B 4PHGA 1AH2A 3F49S 2J87A 4JFAA 1GNSA 3PFCA 1QIFA 2C9DA 4ZYYA 2YHUA 3RVLA 3T95A 4WCFB 1NMXA 1WHSB 3GA0A 4UM9B 4LF5B 1SHLA 2R7NA 1CF9A 4EB6B 3J80A 1T9DA 1QP0A 1U9IC 2CFTA 3DH0A 1SFRA 1NNLA 3NIDB 2P77A 3O94A 2FEWB 2R6R1 3U5ZB 4WZBA 5ECDA 3QPWA 1RR6A 2JAXA 4CM5A 3WL6A 2AHOA 3M2TA 4NBNA 3IURA 1PHRA 4U5XA 5KNDH 3EG9B 2P67A 3UG7A 4XGKA 4G24A 4JYZA 3IKJA 1JFFA 2YJGA 3LT1A 1HE5A 2A14A 3KV3O 3NCTA 4V2IA 2HSJA 3ZGNA 3ICWA 3R3WA 5J40A 5KHOC 1QIDA 1JAIA 3HRHA 3IAHA 4CQLA 2B9VA 1RWVA 2QRKA 4N1AA 1RQPA 3O03A 3Q1LA 1NQVA 3SKXA 1HG0A 5FOXA 1AMNA 3NTOA 4L27A 1J24A 1DQZA 1EE2A 1UXIA 2CNLA 1J42A 1NYLA 2PPLA 2VOJA 4ISCA 4JVNA 4PSKA 3BIXA 4DQVA 3MBOA 3FGPA 1YJCA 3UAVA 2DBVO 5AHOA 3V34A 1TEZA 3L84A 1Y1KE 1D7OA 5JZSA 3TW8A 5D1HA 4RK0A 3JZMA 4IIVA 1DJNA 3H87A 4YJFB 3RYIB 4UXJA 1GPKA 2OO5C 3LOQA 3QE3A 5THXA 2O4UX 4TKLA 1N2BA 5HFNA 4NU8X 3SBDA 5L3QA 2Q4OA 4W7HA 1VKOA 4KQWA 5G3ZA 5IDYA 1VPTA 3WV5A 4GRIA 3IR5A 2WWVD 3BXPA 3RC2A 2O2XA 2GPNA 3KWFA 4UEJA 1W9HA 4Q7EA 4FB5A 4UHCA 1ORHA 4QSHA 2FF7A 3A4TA 4MW5A 3IP8A 3ZIDA 5A1TA 4YCLA 5I9TA 4DV2B 5F9MA 2O7NA 4LS3A 3KEFA 4OMUA 3IDZA 5H70A 5CT6A 4C7VA 1T9GS 2QN7A 4HDNA 3NLLA 2NTEA 2ZT6A 3MWEB 5CJPA 1SWVA 3Q41A 4MR7B 4NAVA 4BDSA 2WVHA 2G82A 2R44A 1HM5A 1O87A 1P2DA 1L5LA 1PX2A 4GLFA 1T4CA 1ZC4A 1FNDA 4ZK2A 2OHFA 1PWHA 4ZVRA 2Y1LA 4Z1MA 3IQEA 1SHUX 3UWPA 2R6AA 5CM2Z 1FNCA 2XMPA 5J2TB 2VH1A 5EUCA 2QAJA 2QORA 4TXHA 5DTMA 3T0FA 4DYHA 4Q19A 4N0MA 3WNBA 4EI2A 3PF9A 3EXEB 3PGA1 3AIKA 1WBDA 2VNAA 4MQEA 1UBSB 4RV5A 1WZ2A 2V7BA 2F59A 5TC4A 1SUWA 4EGQA 3FZEA 3ANYB 5SYNA 1UPFA 5E7QA 2H54A 1GUBA 5CA0B 5I5EA 1UBCA 4KQ6A 3D3QA 3KQNA 3DZBA 4ZO4A 4UFOA 4Z86A 2ZE6A 2QIOA 1T6NA 4EK9A 4Q4CA 3UWKA 3G8CA 2XRYA 3ICVA 4JZKA 4O3MA 3DL0A 3IA2A 1LRJA 4GQIA 2XQKA 3U7IA 3PHLA 5DZSA 1EFPB 1ZAYA 2B3DA 1IPFA 2XZPA 2VH2A 3B51X 1YR6A 4G0QA 3PVZA 4RU1A 2P6UA 1P45A 3GLGE 4U2BA 1CJMA 1TI7A 5BRNA 2A5JA 1JNYA 1T43A 3GZNB 3T41A 1CSEE 2PGDA 4DUGD 1Y6QA 2V7PA 4B7XA 4ALLA 3QMWA 1I7SB 2ZSHA 3OQHA 1BWQA 5LQRA 2UYHA 2ZBDA 1Z5WA 3WL8A 2WM3A 4YXWA 2QTLA 3K73O 2CZGA 2NSJA 3R5SA 4R51A 1CV2A 4ZQBA 3N0VA 4MQ4A 4EHHA 3ASUA 1T1GA 4A4DA 1NSFA 2P5YA 3GLKA 5DYWA 2IH2A 3VYRB 2I4IA 2FDCA 5LB2A 3FGNA 2X13A 1J1ZA 3ACDA 5INTA 2BKAA 4OYRA 1PWYE 4OYLA 5BNIA 3FVQA 4RKFA 1XTVA 1QVZA 2C1ZA 1Y6RA 4MPPA 1J4AA 2P3QA 1TCUA 1D09A 2X1LA 1UJCA 3WLOA 1R5BA 1H6CA 3BBLA 3WLAA 4E46A 3KSAC 4B3GA 1SVNA 2EF1A 2HU2A 3FI9A 5JJCA 1U63A 4KR3A 4NFHA 2WD9A 3B3FA 2OCLA 2VTEA 1YOBA 3EFEA 4AY3A 3DLPX 3PDJA 1ICIA 1KU6A 3ICEA 2DKNA 1XZJA 1NKVA 1T0PA 1KVRA 5CXSA 3T99A 5EFZA 1DCKA 5D7NA 3TZEA 3GNQA 5CFLA 2JHPA 2VZEA 3G9TA 4I99A 2AEEA 3ZHBA 3JPYA 3AI1A 1Y37A 4HL6A 4E51A 3CX7A 2BRUA 2QD3A 3U3RA 2XKKA 3DAHA 1JQ3A 1KEEB 3HR8A 3VNSA 1NF3A 4TROA 5FWYA 5KSOA 3E4CA 5A2QA 3EY9A 5IVIA 5B1EA 4G67A 3S6JA 1JHAA 5CBKA 3FNFA 1EFRA 3MYRA 4MVJI 1ILWA 3REQB 1U2GC 3OUZA 2PO5A 2Q3CA 4QDOA 4NG5A 3DMGA 1XYGA 5TY0A 3SX2A 4QKQA 1Q0RA 1Z9BA 2FU5C 1S3FA 5DF1A 4I3GA 2AXEA 1WE2A 1SHJA 1SB8A 3HPRA 1UDWA 1UDXA 2BGUA 3V1UA 2HO4A 3LY7A 2KMLA 1QCDA 5DK6A 4QDUA 5IRCD 2DBQA 1K66A 2HBQA 2VYCA 3F8TA 1K8ZB 3KAPA 3FJOA 1RJFA 4MWTA 4Z9XA 5BN1A 1GKYA 4MPRA 2BMAA 5LQAA 3ZDAA 4KKVA 1A88A 4QU8A 3WO0A 3TJZA 3D6TB 3VNBA 1MC5A 4ZVOA 4H08A 2I29A 5BSUA 4LE0A 3GOQA 3ABRB 1GTSA 4M8SA 3I30X 1N36B 1JG7A 4MKHA 4IIFA 4MWCA 3I6YA 4WFJA 1BD4A 3E3MA 2HSWA 3GHHA 1KK1A 2PKQP 1VB3A 1ZUHA 3ZIUA 3RAFC 2Z2ZA 4BC1A 3UOGA 5D84A 1M3SA 5FT9A 3UXMA 4BVAA 1M5TA 1ZC3A 1WPGA 2EKZA 4I3FA 1NVVR 5CT8A 1E3WA 3S44A 3BEOA 1E63A 1II8B 2EOAA 5AVTA 4I4LA 2ZU0C 4PS1A 4IXMA 3GDWA 3VH3A 3OOHA 4E1BA 3R74A 3CVUA 2V3VA 4KI7A 3LYHA 4MPDA 2O2ZA 1A50B 1GZ4A 1ZJ4A 4R2HA 4IYJA 3WFJA 4BNDB 3PI7A 4KQXA 3TFQA 4ZDKA 2CDRA 4KODA 1JB9A 2DT8A 3IPXA 3KOZA 4QFMA 4DCOA 3R9WA 1UK8A 5H0IA 4CQMA 2P91A 2JGLA 1FRZA 3RS3A 4LNUB 4DC1A 2ZWVA 4B3TB 2I4OA 1A5SB 3LZCA 3PITA 2IP1A 3CNQS 3FMFA 1CE8A 1A9XA 3BQNB 1EESA 3Q3IA 2RGDA 3KHTA 4R8SA 1FSPA 4FYVA 1UK7A 1CS0B 2DFTA 3Q7SA 4O3FA 3C3DA 5FPQA 1RBZA 2K7FA 1G2IA 4IM7A 1QONA 3EC2A 4XFKA 5JANA 4R54A 3GP5A 4IO1A 2DFVA 5HA5A 4AO6A 2QQGA 1YDHA 3ESDA 2F3QA 4HAXA 5A5DA 1NW7A 1ST2A 1QS0B 3EEQA 3EGEA 3EK2A 3MGKA 4IEEA 4R2JA 3S2YA 3SYRA 1AUQA 4P54A 3WZLA 3WWZA 3UJCA 3VHXA 1W5FA 2HBRA 3FVTA 2DHDA 5AI9A 3TRJA 3D2LA 2OUIA 4RXMA 2PT5A 1JG3A 4UDYX 3DTVA 5K3FB 4B79A 1EUDA 2MYTA 3DVLA 3IQGX 4CN9A 4F06A 2VAVA 4RTKA 2P2ZA 4WASA 4DQKA 1U98A 3LO5A 3OFNA 4DIMA 4PZDA 4LF9B 5E9AA 1OTHA 3BWXA 5AKYA 4JI2B 4R83A 3AF1A 4Y2XA 1G17A 3MINB 2GO7A 2RJNA 4D79A 1G4HA 2RI0A 2E4YA 2FPKA 1DO2A 3CH5A 4FKZA 4R8MA 4RGVA 4ZT6A 4E5SA 3KOWA 5B58T 5BSGA 4JBGA 5HVNA 5JNUA 4OHYA 5SY4A 4L3VA 1CNEA 5CDTA 1J06A 3L6EA 4GGMX 2QB5A 1HWYA 1MENA 2Q2WA 3D59A 3I04A 5EMLA 3K0FB 4MS1A 2V3WA 3TF5A 1QZUA 2JK1A 4FMCB 3GWZA 4FCVA 3ZWBA 5FPYA 2JH9A 4HCJA 1W1IA 2PRYA 2R3SA 4G6ZA 1SOVA 2QUJA 3AFOA 4FDTA 4X5OA 2B98A 1XZDA 5FBHA 4X8HA 4XR4A 3TQSA 5C8VA 2ID7A 3LP8A 3UF0A 2XVMA 4ME6A 4CFSA 3R41A 4L28A 2CBXA 4NE2A 3EPPA 5JAOA 2WKQA 1DC3A 2J7PD 1W0JA 3K0HA 4UVDA 4YRDA 3B2QA 1KY4A 3MT8A 1O96A 2WA2A 2ZCUA 1ZSNA 5IKOA 1UMCB 3NM4A 4GM4A 3LOUA 1T5LA 1OKKD 1OGYA 3C5VA 5CFNA 3CX4A 3DFUA 2JDIA 4D8VA 3TLAA 4BQIA 1JLLB 2QM0A 4MPJA 2XWSA 2XMBA 1J2YA 3KHUA 1U7OA 2G08A 3ZGZA 2D7CA 1EK1A 2BCJQ 4J0GA 3OKFA 2ZYDA 4Q1VA 3EEBA 6GPBA 1N7HA 4DM4A 5LLDA 4W9MC 1RYDA 2I78A 1X8LA 2AOTB 3HKDB 3I28A 1K88A 1CERA 1UP7A 4OJKA 1LZLA 1INLA 1QQTA 1GEEA 4I1VA 4AO7A 2EFYA 3QX9A 4B4KA 4BLOA 2B69A 3ISTA 1GCIA 4Q6WA 5AT1A 1GZVA 1Z34A 3ZE2B 3R75A 4X3CA 3NW9A 2GESA 3RJ5A 1RHJA 4B9AA 1Y1SA 3ZEAA 1UXGA 2EWWA 2A5FA 4ND3A 1B0UA 3F9IA 2CFRA 4RNCA 3T9FA 4K26A 4Y9TA 3EFBA 3IBTA 5HJ7A 1HL7A 3PFIA 5IKMA 1EFDN 4MA4A 3PJGA 5CNKA 4OM8A 1H94A 1QG4A 2YFHA 4MCJA 4HAZA 2QMOA 4CKBB 3PX7A 3T1VA 4DA9A 2H7XA 2O8VA 4JL6A 4CL0A 4KXXA 3FUXA 4OOEA 4ZV7A 1KHHA 2Q6OA 2AK3A 1HYHA 4JU8A 3EULA 1IB0A 3PUKA 1I4EB 4BMZA 4EYOA 2BR4A 3A28A 4NPAA 3QI2A 4MJXA 4B17A 3VR2A 4X60A 4LZLA 2HDOA 2RHWA 4UEKA 4ESHA 4GEKA 1ZOLA 2ID4A 4Q02A 4ZYXA 2IOYA 4NMXB 5A9RA 5HJ5A 3FF1A 5D8DA 1IIBA 2QVYX 4JLWA 2QVBA 2QD4A 3X1XA 4X1OA 4CKEB 3WGIA 4KLAA 3G5AA 4ZIRA 3OEYA 3EZFA 3GBVA 4HQOA 1Z6QA 3IJPA 4WJZA 3SHFA 3HBMA 2C59A 4O59O 4DV4B 1FFEA 4Z99A 1W6RA 4M55A 5K0BA 1YMVA 3ZVNA 3L4SO 1QQ5A 3ZCTA 1Z08A 4ND6A 1C3OA 1Z88A 3IIMA 1OXTA 4J1QA 4D97A 5JY1A 3OPQA 2B1JA 1ODSA 2GPAA 4US0R 2BELA 5H80A 3AV3A 4CMIB 4E5NA 5D51S 4MWSA 2X8BA 4ETMA 5BYAA 3D5EA 1N7GA 1Y7TA 3FLAA 2X1MA 3B9BA 4FOTA 1G5QA 4KR9A 5MFZA 4WOPA 4ZT5A 5DNVA 5HF6A 5C35A 1E8DA 1WS6A 2I2AA 1FUKA 5FFNA 1KEZA 1CYEA 1MB9A 1VCIA 4UW9A 1PLKA 1OHHA 1IY1A 1NOJA 1NJ8A 1XF9A 4NYIR 4YVFA 4FK8A 3LG2A 1C30B 2NZVG 5HKAA 1WPRA 3KTOA 2MINA 3RIXA 2AN1A 3EGCA 1PGPA 3FYHA 4PONA 2I8LA 4HUQB 2OB1A 3PP8A 5A62A 3ABOB 1NDQA 1PNVA 1TKAA 2C7BA 1Q5PA 4U5QA 5DHTA 3EVCA 2O2GA 1VJ5A 3FNGA 2VDNB 3JS5A 2WUEA 4HXFB 2A5DA 2H4FA 4JR1A 2JKVA 2VSXA 2Z9CA 3NG1A 5HMMA 3QW4B 3TCKA 5HHTA 1X9IA 2J07A 4HGYA 5A5VA 1EP1B 3O38A 4M3NA 2GX6A 1GKUB 5ER9A 4QUBA 3QLEA 1XQXA 3FDZA 3BGIA 1L8QA 4JJZA 3FPBA 1QJCA 1GKIA 1SUEA 4QBGB 5C8ZA 3C3XA 2Z5VA 3NAQA 1AU9A 2WOOA 1UANA 3UMYA 3N76A 3BK1A 2R00C 3V7YA 1CUCA 4BIMA 1DS6A 2OBMA 2CHVA 1H22A 2X5JO 3GLTA 4MRMB 4OXYA 3NKVA 4QXAA 4Y9UA 5G1OA 3RGWS 5KJ1A 4BZQA 3FX2A 2FRDA 1T3LA 3AR7A 2PV7A 3JQ6A 3WR5A 4JLKA 4LA4A 1J7JA 1R12A 1JFLA 1XZAA 1KDTA 1C1XA 2UDPA 1MQSA 2YW9A 3RF7A 3JQAA 1V9CA 1XHEA 2A5GA 5K45A 4OA8A 1IM5A 2O0JA 4A1OA 3OKAA 4BVJA 5CA1B 2YZGA 3OCJA 2RGEA 4TV9F 5KOIA 4ARVA 3T5CA 2XXBA 4V0RA 1WUJS 2FPSA 2VYQA 1AKWA 3JQEA 3RVOA 3QU4A 1YZQA 1CJVC 1QFSA 1V8PA 3HH8A 1UBRS 1NVWQ 3TLMA 3KU4A 1Y9AA 2V59A 3A1FA 4RACA 4ZI2A 2JAHA 2WBLC 3G2LA 1RP1A 1ZMBA 2AUTA 1C0EA 4JSYA 1V9SA 2IYRA 5TPWA 4DLAA 5JCPA 4UJ5A 2CJWA 2FN3A 4B2LA 3DHYA 1AO0A 3Q7IA 5E3HA 2DQZA 2Q2OA 2Q1UA 2HDHA 1WETA 1RQRA 5E7IA 2F67A 5FI5A 1BE1A 5BP7A 3A4YA 5LKAA 2HN9A 4CEHB 1IZ8A 3FYUC 2XIJA 1NNUA 2L69A 1Y7IA 2O3SA 3ZCQA 3BJMA 4DLLA 1M0EA 4D4KA 2IHNA 1GCUA 3BRSA 4H1TA 1FPMA 3LIPA 2IFTA 4YXFA 1QGUB 4G4SO 5BRJA 1YQWA 3GLGA 4UCXA 4Y2UA 3O47A 1O0BA 1U8YA 4F3NA 2YNMC 3ANMA 3S2IA 2ZXFA 4A2WA 2FX3A 4YQYA 3W79A 3TLGA 4F56A 1IUOA 2NO5A 2WPDA 4KTTE 4KWIA 4LC9A 4Q4JA 3G8BA 3SZLA 5B2EA 3GAZA 5GONA 5B4VA 1ZM9A 4LC0A 1HETA 1Z38A 2PYZA 4HNGA 4JHXA 1SIUA 3N74A 4KDEA 2CB9A 4PYOA 4YMSA 1CUBA 1EG7A 3EEOA 2HNKA 1FMFA 3RFCA 3ZDQA 3WJAA 3WS7A 5PGMA 1QIMA 3JATA 4FKBA 3O8QA 1Q20A 3EGXB 4HVAA 5F21A 4TZKA 4L8LA 1GARA 1K7XB 1H8EA 4LOIA 5BT9A 1JS1X 4BJ1A 2XV1A 4EHNA 4LMBA 4Q1FA 1Y48E 2JIRA 1XKLA 2IF2A 5HW0A 5F33A 4EQ6A 1P0FA 1P3DA 1Q2XA 2JCGA 3KU1A 5E2AA 1NJGA 1OZGA 3F4LA 3MOSA 4YV7A 3OIVA 1C1DA 2OM6A 5IMSA 2JZNA 1WEKA 3JY6A 3TDKA 2DUUA 1E1DA 4RF3A 4JBNA 5FV7A 1L4UA 4D3ZA 5LWHA 1A2BA 1NVGA 1V35A 2J5XA 4H59A 3T38A 1ADGA 2OR3A 3GD5A 3P2KA 2G1PA 3LRTA 3WIDA 1SUBA 2QUAA 2VAXA 4KFUA 3TFOA 4JXXA 2FPIB 3PNPA 1U2QA 2ZW9A 4K9PA 5FTKA 2RCYA 3NQ41 1VG8A 3LQQA 4D8TA 2J9FA 3IAS6 2I8CA 5DCLA 4JI1B 1KMCA 1X7DA 4DCUA 4CKZA 2LW7A 5K99A 2CLCX 1H4SA 1TU3A 3D0OA 4S24A 5ALJA 1O94A 4ZOAA 3ZX4A 2JGDB 1L1FA 3VO8A 4FUQA 2WSMA 4B43A 3CSSA 1JMKC 3E8SA 1Z2AA 3AC0A 3HQ4O 3IQXA 4G1BA 2CXHA 4HBZA 3RAJA 1E60A 3WLRA 3DFIA 1BRTA 5K3EA 2V4ZA 4I3HA 1T5DX 4BUZA 4OG2A 2Z9BA 2NQTA 1D2RA 2YBDA 3S27A 3T1YB 1HKUA 4C7OB 4IX9A 3B7WA 4RLSA 4TZTA 4OJQA 4BVBA 3MJDA 4WNYA 4Y2QA 4L5JA 1IVYA 5AVQA 5C4MA 3I4FA 1NV8A 3ETJA 3CIOA 2B61A 5H1YA 2XD9A 2F1HA 3UYLA 1VL1A 2I3AA 2NZYA 2XVXA 2HUPA 3DMPA 4FDVA 3C7TA 3RS0A 4Y2JA 3NDPA 1UF9A 1Z4NA 1WLSA 3BILA 3GFBA 1V95A 5E38A 1PZXA 1EI9A 1XBTA 4QEKA 5I01A 4RH1A 2P3OA 3COYA 3DKRA 4U2CA 1HA3A 4X85A 1GPWB 2IZ7A 4OFZA 4RPHA 3SHOA 1R0ZA 2PLFA 4C05A 3WGVA 1FP2A 3HCOA 4CHTA 1NVEA 1VBFA 1KEVA 3JYNA 3JAKB 4N7RA 4CDNA 1JA1A 3IBFA 1ZNZA 1UDAA 2FEKA 3FDFA 3TE7A 3I1YA 3A10A 4K87A 4EY8A 3AK4A 1EXWA 2O14A 4FHFA 4KZPA 3CKLA 1NV9A 1TT7A 3P5SA 5HKLA 1RJEA 2KB0A 1GZDA 2ADFA 2I71A 3B52X 4UMVA 3IR7A 1SKBA 4I1RA 5FPKA 4TMFA 3DLIA 2O3UA 4FFOA 4BNVA 1CX9B 3LGAA 3HXOA 4UUBA 1AF4A 4PZ0A 1QAOA 4WJLA 5ETJA 3L04A 3RVRA 2O7VA 5JH7B 3AF4A 1EA5A 4OHOA 4RY8A 4GSLA 3LWZA 3MT7A 5E0KB 2VXCA 3F73A 2OFOA 2YYAA 1BEZA 3GA5A 5K05A 4FFRA 5IKEA 3OTHA 4ZOEA 1RYBA 5FUXA 4BU0A 2ZJYA 5J1SB 3VNAA 2QP9X 5CNIA 1PF7E 1W35A 2E3JA 4Y1EA 3AEZA 4TN1A 5BWCA 1DCMA 1JJIA 1AOXA 1OA0A 2Q6IA 3LP5A 1RKQA 1E0SA 4GMHA 4IJQA 5AXCA 1DBIA 2OENG 5BSEA 3M4ZA 1KSFX 5P21A 2PS1A 3NTXA 5AM5A 1JIXA 2BI8A 1WB6A 4L7VA 4YJHB 2CNWA 1NDUA 4URHA 2F8MA 2VCEA 1V37A 1XMSA 5GGXA 3UGJA 3AVWA 2WWXA 2ZT5A 2HA2A 2Q29A 1M6VB 3KSMA 5ALKA 5L7YA 2OD9A 4UDOA 2ONYA 4WZAE 1J5PA 3KKNA 1X9HA 2MYPA 2QTZA 2YUTA 4C7JA 2A30A 2HY7A 1HZZA 1GTG1 2BDEA 1WLYA 1EFTA 3AEXA 4RA6B 5CFPA 3DLHA 3K4HA 4YMLA 5DCWA 2A78A 1LD3A 3WK4A 1G8YA 1E7QA 3C1UA 1SY7A 3PXCX 4AJ4A 4W5TA 9ATCA 1GZSA 1TUBA 3BSYA 1NJ1A 3K09C 5ECGC 1R1DA 4HB3A 4K03A 4PEVA 3C3EA 3E9NA 3F5DA 4RD0A 8OHMA 2V5UA 3T1TA 3NWOA 4B4DA 2BKUA 3WL3A 2BGMA 2X42A 5C32A 1L7XA 4NCNA 4JI6B 3C98A 5JAQA 3RODA 3TNLA 4BBAA 3N5KA 4XX1A 1H2XA 3LVFO 4BNWA 2IYWA 5LU8A 1JPJA 2QT1A 1GG9A 1CUYA 2QPTA 1S2NA 1U0OC 3NGXA 5H81A 3SMVA 1G3QA 1JVSA 2B78A 1VBNA 1O54A 4Y0AA 1QORA 5WRFA 3PTLA 1W85A 1X2EA 5HCNA 1DC6A 1M8JA 3QA9A 3M0EA 1UMDB 2FPPA 2QW0X 5JAIA 2HW8A 1R2QA 3MTBA 1Y0BA 1T3SA 4ACAA 4CLEA 2FVYA 5MGNA 3ZU5A 3ESXA 4OMDA 3IALA 1M6WA 4HYQA 5EKUA 4TN5A 4LI0A 5GONF 2PAFA 1D6SA 3AM1A 1KAMA 4YBZA 3U44B 4JQYA 5EJFA 3EF3A 2FN9A 3OE1A 3A32A 2V0CA 3D6NB 3PGKA 3NRJA 4IHJA 4R0MA 1NXWA 1A9YA 1UPUA 5AK4A 5U9CA 4JCCA 1PR0A 3EGWA 5LZ4A 2BKLA 3U5TA 1VXRA 1ZD2P 2GFQA 1FP6A 1KYWA 3IELA 4Y1RB 3L7AA 5TARA 1ZOPA 4JUFA 5HS4A 4DV3B 2PDAA 3UT6A 2NU8B 1COWD 2X2OA 5A5EA 3A37A 2H11A 1D1QA 4H17A 4S2EA 4BMYA 3ET4A 1QH1B 3L4JA 1D2EA 2IYZA 5ALDA 3BL5A 1C7EA 3DLCA 3OJOA 1WOMA 1AXRA 5I8PA 1PWZA 1VCHA 4W5JA 3AVVA 3BERA 3RW9A 5AW4A 3OPYI 4DJJA 1CDDA 3IUJA 1U4NA 3W05A 2Q07A 4E94A 2XCTB 1I1OA 1MO3A 2EX4A 5DX1A 3AP1A 3Q7PA 3ZJVA 1AY0A 1I32A 4IS3A 4G2NA 3ISJA 2GF2A 1K2WA 2X0NA 3JQDA 4DLTA 3DDUA 1NKTA 1ODFA 2IYUA 4BQOA 2D06A 3AGPA 3W5HA 4X1IA 4DWJA 2DXIA 3DHWC 2RJ3A 2BCEA 2ZUCA 4UUAA 4OJTA 2JFUA 3G1WA 2WJAA 4QVIA 4C7KA 4F2WA 3RGGA 4Z4FA 2I6XA 2ZJZA 3ZJ4A 4TZ6A 2Y0PA 5F2KA 4KBGA 3T35A 3I39X 4G4IA 4LYJA 4BEVA 5B53A 1B93A 4TTQA 4MTCA 2N46A 3SN6A 2E7ZA 1NYRA 3A25A 3E8MA 5AJZA 1SUFA 4IOJA 5E4JA 3FE2A 2V9CA 2DHEA 3ZD9A 4FI3F 2EJBA 1HDYA 1X7YB 2PQ2A 2Q1YA 2Z1MA 3MBIA 3NEYA 4UNPA 3RTGA 3SC6A 2W6ID 4AJJA 5JALA 2X7XA 1Z4JA 3OMXA 2YW2A 1CEYA 2H2DA 1KRWA 1NUTA 1XDWA 4QTXA 4C29A 2IY7A 2VSNA 3QXHA 2QU7A 3TK1A 2YWJA 4BQSA 4F6CA 1ZCBA 1N8NA 4RXTA 5CGZA 3BQ9A 4CV1A 1SD5A 4PVCA 5JY6A 4MDFA 2EGUA 3CPSA 4WJKB 3ASVA 4IDDA 4MGKR 4QAJA 3OP1A 1UT6A 3BIWA 4GMGA 2WSSA 4MUYA 4XDYA 3DZCA 4D9JA 1R16A 1M2HA 2PANA 3AR6A 4XQGA 1AZSC 5A4FS 4DV6B 3C70A 4RS3A 1SXJE 1YE8A 2GN2A 1F17A 5HSGA 5JECA 4G0VA 1Z7YA 3WAKA 3RFUA 3WMWA 3MM4A 5AKEA 2YMLA 3A9UA 1UOOA 2XVYA 5LQSA 3QVJA 1R88A 1PNTA 1SJ9A 4CGZA 3UG6A 1H5NA 1SCIA 2ZSBA 3DZJA 2C9OA 3JTEA 5EZ6B 4D80A 2PX0A 1VI5A 4FMDF 4FBGA 1TW2A 3MAAC 5F5XA 4PLHA 1YQEA 4H6XA 1YACA 4CMHA 1UC8A 1UFOA 3RK0A 5JISA 4DCMA 1OFUX 1TAQA 2EX1A 3R0XA 1UPAA 2PS0A 2AK2A 2IIPA 3FPGA 1N6LA 3P2OA 1K9SA 1UINA 3RT9A 2Q2QA 2AMVA 1EVYA 3E22B 1EB9A 1FQKA 2C54A 2OKCA 4KQEA 1T9HA 1WB4A 4EPRA 4IFTA 5DWVA 5F4BA 2Y1XA 4TLMB 4BDTA 4EPXA 1SAYA 4LZNA 2NYAA 5CYFA 2W70A 1CFZA 4UAVA 1M2VA 4FR0A 1Y5IA 4QUDA 5LMCA 4OAPA 1DC4A 2RHMA 4M8LA 3TH5A 2FPGA 4CF5A 2Q2NA 7REQB 1E3LA 1H3EA 3EOBI 1HEIA 3E82A 4NDNE 5FI0B 1JU9A 1WU7A 3AV0B 4OKNA 4P31A 1EG2A 4IQ4A 2VAPA 4B74A 4BTLA 4OHFA 1U2SA 3D1JA 4TLAA 4CI9A 3C5CA 2C5BA 5EIXA 3ZE0B 3WICA 1FUIA 1WABA 3DE2X 3QVGA 1H85A 1NVMB 3M2PA 2O48X 4ML3A 4Q3DA 5CK4A 4E11A 4CPDA 1IAQA 2HQBA 1EUCA 1EFCA 1LC0A 2HPAA 5KYVA 3WSWA 2EP8A 3WLSA 3PX3A 4BNLA 5M04A 2CC2A 1TW3A 1HGXA 1XPUA 3ZBQA 5AUNB 5DGDA 1ZQ1A 2VDVE 4IG9A 7ADHA 3CVWA 4DV1B 3OQJA 4LZJA 3URKA 1IK4A 5B6JA 1UZNA 1ID1A 3OKPA 3TI9A 3OJ0A 5DXAA 4JB3A 3K4QA 2BMDA 1V6SA 4CF4A 1A7KA 4MOWA 1LI7A 1S7CA 2FW9A 3PEYA 1XRLA 3JVEA 2ZRIA 3A3KA 5EUMA 4B6GA 4M1MA 3M5CA 4PBRA 1GTZA 2OHOA 3ZW8A 5FO1A 3JALB 4JN6B 4JQOA 4UU0A 2GZ1A 4LYFA 4Z1MD 3KYJB 5DHFA 3FB4A 3PGLA 3PJEA 3SI7A 4JT8A 4KACA 1IB6A 3VOTA 1RYNA 4IUBS 4V0ME 3SQXA 4M0UA 4WUVA 3C7AA 4WGFA 1EAMA 2JIOA 4R9VA 5C80A 4J07A 5FADA 3W5SA 3GMSA 1X15A 4RPLA 1D4ZA 1KMMA 1H4VB 3T7IA 1Y9EA 4CDRA 1XXHE 1AK2A 2REXB 4NULA 5AI0A 4CKWB 4WLUA 3NEPX 4CM8A 3ONFA 5SYAA 2AZDA 4WY2A 4ZAWA 2C8VA 2IU4A 1RLOA 4S1WA 5E6RB 2IEYA 3RRBA 4Z1OA 4FYIA 1UFVA 3Q0IA 4PPYA 5FLEX 2X0FA 1U6JA 5EMMA 3ZHCA 3T5MA 1SZCA 4Z4IA 4FHCA 3PC4A 4HWPA 3NHRA 5DIFA 3G2KA 1GSAA 4OCZA 3MJSA 3NDJA 1T1JA 2POCA 3L0IB 3JR7A 4WGGA 1V8FA 3J81k 1Z4MA 4ZYWA 2HSEA 1CPYA 1JFRA 1YBVA 3R5JA 2AC7A 3ELUA 1KKUA 1XVVA 2AXNA 3R3JA 1NN0A 2AZXA 1LF0A 4BLSA 1IHUA 1AB5A 4HPXB 2VOEA 1NP3A 3R7SA 3ZVKA 1JAHA 1RQGA 1ULHA 3P9KA 1Q3TA 5I7UA 4UBJA 3UYKA 4YXWD 4GRAA 4WBNB 3M7IA 3OZGA 1OWOA 5B5SA 5LUAA 3GJ6A 3TEFA 2JLCA 4PR3A 1ZZGA 2I1WA 3BE6A 3NYWA 4LHSA 4MULA 2XGJA 4AECA 3U48A 4BC0A 1Q95A 4D45A 3L82B 1B8VA 3E15A 2JJ2D 4X0EA 5JR3A 1JW9B 5AWFC 3OLXA 4AS1A 3M6LA 4JK3A 5EC8A 1MEJA 1QTIA 5IJZA 1KIAA 1NI3A 1FQOA 4WXHA 2GFHA 3DV9A 3MS2A 3EGIA 1SKYE 2BJWA 4JT9A 4MUJA 4NRDA 3AUFA