4JLVA

Crystal structure of the chimerical protein capa1b1 in complex with adp-mg
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
239
structure length
228
Chain Sequence
DKRIKDEEDVEKELGLPVLGSIQKFTTLFVYEKPKSTISEKFRGIRSNIMFSKGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDSLLVIDNEKNDKNEVKKAKALMEKAGSNILGVILNKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-terminal fragment of Membrane protein CapA1, Putative unch
publication title Comparative analysis of the Tyr-kinases CapB1 and CapB2 fused to their cognate modulators CapA1 and CapA2 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 85
structure length 228
sequence length 239
ec nomenclature
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jlvA00
2F43A 1E0SA 3QE0A 2Z5FA 1S96A 4Q7MB 4RFSA 2IYWA 2J1LA 8OHMA 3KUCA 3CX8A 5KPJA 2ZAMA 2OFWA 1S3SA 4TL6A 1EFRD 1TUEA 3ZVRA 3ZIAD 2VHTA 3HR8A 3NIBA 3WBKA 3LDAA 3GJXC 1P9NA 5H8WA 1KY2A 1AK2A 2ODWA 1U9IA 4U7DA 3X1WA 1E9AA 2FSIA 1S9HA 2OV2A 5EXTA 5HKKA 5GJBA 5L3QB 2ZJAA 1QBKC 2OLKA 3GLHB 3MWLA 4HB4A 1ZM2A 1VCOA 2W2XA 4PC3A 1E99A 1SVOA 3MD0A 1OB5A 4XJXA 4BEJA 1IONA 2WSSD 1KK0A 5CIQA 5KSPA 2H18A 4M9ZA 1A5TA 2FU5C 2AK2A 5J4HA 2JLRA 2WWWA 5LD2B 2D4HA 5EP2A 1S9DA 1VCNA 2W2VA 2YKGA 1AGPA 2FWRA 2RAPA 4B6FA 1WBBA 2JLUA 1SZPA 4R2IA 1N6HA 3GJ7A 2JATA 3PUZA 2HCBA 4Q00A 4QHSA 3PXGA 4BRUA 3X1XA 2BMDA 3U3OA 3ASZA 4YDSA 2OLJA 1XMSA 4ZIRA 2FF7A 3K70D 3VR2A 1J7KA 3OEHA 3M1IA 2CL6X 1DEKA 4KFRA 4W5HA 2OCAA 4A1FA 1P61B 1TX4B 2FZLA 1U2RA 4P3YA 3QG5A 4ZPXA 5JSZA 3C15C 4GPTA 1WA5A 4GNKA 2C98A 2ORWA 4KSCA 1YZQA 5DGXA 3RS5A 2BV3A 4ACAA 4LJ6A 1OB2A 2GTPA 5C2JB 3TAHA 5IRCD 3THOA 1KZGB 4TZ0A 4QBIA 2JLVA 3SFZA 4WIAA 5DE3A 4A92A 4D0LB 1Z07A 1N25A 4UNQA 1VG8A 2QAGC 1UDWA 1W0KA 1N0WA 4GP7A 1Q1ZA 5CK5A 2BDTA 4BASA 4L8GA 2GCPA 4NPHA 3L8YA 3R9IA 4GL2A 4CYMA 5DO9A 5K8UA 1R2QA 2DCUA 1CR4A 3CR7A 3A6PC 4ZI2A 1MABB 1A82A 4JT4A 1NSFA 3TRFA 3VAAA 4D2IA 2OEPA 721PA 1JJVA 3EZFA 5HZKA 3TKLA 2H8KA 2Q9BA 3SC3A 1LY1A 3AVVA 3BBPA 1OIWA 5BYKA 2WZQA 1Q3HA 1D6JA 4M22A 5L3QA 3TK1A 4PC7A 1E9DA 3GLHA 2Z4SA 2QGNA 2FG5A 2H1LA 1NNEA 3BFXA 4PO9A 3U3JA 4IHQA 1E1QA 2BMJA 4DXAA 2IF2A 1OXTA 1GP2A 3DVLA 4UJ5A 1BYUA 4PQYA 2Q3HA 1D2EA 1ZNXA 2ORIA 3NG1A 1MO5A 4HYYA 3GP8A 1Z0AA 4J0QA 1TF2A 4KVGA 5KDDA 1UKZA 1E0JA 4TYNA 1SHKA 2HJVA 2ZRAA 2VBCA 3OHMA 1GWNA 1N2CE 3EWSA 4L15A 4M1SA 4TL9A 3KQHA 5GJCA 4US0R 3I32A 1YVDA 2VHQA 3AVTA 2WPDD 4C2UA 5EP4A 1HQCA 2FGJA 2XITA 3I4LA 4IKEA 4OHZA 2W6JA 3DZ8A 1JBKA 1KMQA 3TR0A 1DADA 3VR5A 2O0KA 2JEOA 3Q9LA 3L0PA 3UPUA 4KYUA 2XZLA 2AR7A 4O2LA 1VHLA 1ZCBA 1E2HA 1N0VC 5K8TA 1IAQA 3K9LA 3EZ9A 2L0XA 4HUQB 5GJVC 3UANA 1CS4C 1CLUA 2GK7A 5FUXA 3SR0A 3AVWA 4NYJQ 5EUMA 1AM4D 4P4TA 2FZ4A 1GRRA 4V0NA 1Q21A 1R8SA 3GQBA 3TR5A 1XJQA 4YMVA 4BLRA 3CF2A 2AKAB 4QC2A 1NVWQ 4MYUA 3W5JA 4XTRA 2IX3A 2J5XA 4HLQB 2GDJA 2YJTD 1P4SA 2RGEA 1LB1B 4KI0A 2DWOA 3A1VA 1MABA 3KKPA 1W49A 4TSFA 2R9VA 4EPTA 3ZVNA 1ZBDA 2WAYA 3ZDQA 2IHYA 5FTNA 2C04A 3B60A 2C78A 2WM9B 4AKGA 3VFDA 2WJVA 5H70A 2QN6A 3REFA 3OZXA 2VHCA 3I3SR 5IK2A 1VECA 4I81A 4PZZA 1OYYA 821PA 3QVVA 2DHRA 3PIRA 1OFUX 4RZUA 1N6NA 4Q9JA 1NLYA 1H8ED 4V0LA 2CL0X 3G5UA 5KSYA 3B1ZA 1RKBA 5KDOA 1ZCAA 3QXXA 3D31A 4G0NA 1XZPA 1G8PA 1NG1A 4EFMA 1WQ1R 1Z3IX 4DJTA 4ILEA 4JBWA 1VG0B 5CYOA 4YMTA 3BH0A 1OKKA 3AF4A 3H0KA 4H1VA 2FFHA 1E1RA 1G1MA 1KDRA 1RJ9A 2NPIA 3F5FA 4JSYA 3QG1A 3KFXA 2IYQA 4IDHA 4QBFA 2WBLC 1VYUA 2O8FB 1ETUA 1KMHA 2Z43A 4NCKA 2O8BB 5CM8B 3L43A 3UK6A 4ERNA 4Q01A 2DFTA 5FI1B 1E79D 2ZU6A 4P4SB 3WYAA 3QI2A 3ZD6A 3W34A 1TADA 3CRMA 4URUR 2ZRFA 2ZSEA 1IQPA 1YR9A 3FTQA 5JJIA 2QM8A 3LVRE 4B47A 2IK8A 4BUJA 3DPUA 1XTKA 1ODFA 1AA9A 2QY9A 2UZIR 3CRVA 1E96A 2ODNA 2ZRLA 2ZUDA 2D2EA 3IHLA 2FA9A 2VSFA 1KI2A 1TU4A 4HUQA 4US2R 5J4YA 3VNVA 3K0AA 3LBIA 3Q5EA 1ZM3A 4PAQA 2XJ4A 1FNNA 2XTMA 4OHVA 2VP6A 2FPMA 4C4PA 2P5TB 5CLQA 2QPOA 2A9KA 1N5JA 4A6XA 2O5VA 4WW0A 1B23P 1X3SA 2XSZA 4V0OA 1OFIA 5EZ6B 4B43A 5JCZA 3CF6R 2BMEA 1H8HA 2IYRA 3B6EA 4OQLA 4N0EA 1KYIA 3IIKA 2VHJA 4G1UC 4KCGA 4TYQA 4NMMA 3WHKA 1W2GA 2GXAA 1DBSA 4DVGA 1HE1C 4DDTA 4U00A 1G6OA 1YZKA 3SYKA 2V7QA 4PPNA 2V1UA 2J7PD 1MO4A 1MO3A 1K8RA 4JVNA 1R0XA 3I1FA 4AYTA 1VG1A 3BORA 3QOFA 4JJZA 1Z0DA 2NO9A 1T3SA 3IDQA 2ZJ8A 3LX8A 5E95A 5EUQB 3B85A 1P60A 4Q03A 4DLRA 1J70A 4GRAA 3IIJA 1XD9A 4HZUB 4B2IA 4B3GA 1M7BA 2J3EA 2GNOA 1BOFA 2VP2A 4P31A 5ELXA 3CH4B 1F3OA 4CZ2A 1KHTA 2QI9C 5JWOA 3GLFB 3A4LA 5HKKD 1U8YA 2C99A 2XNSA 2O8BA 1N5KA 5LBIA 3I92A 1E2PA 1J8YF 4JVSB 3OIWA 5FOSA 2G3YA 3QJYA 4D26A 4P4SA 2BJVA 1P5ZB 1FX0B 4PAOA 2R65A 1OLOA 4UXJA 4KXFB 5EE3A 1FW6A 4CT5A 2IXGA 2QUZA 4K81B 4TZ6A 2ZTSA 1KSFX 4TL8A 3TQCA 3THXB 2VIIA 3QKSB 4HLCA 3L0OA 2MSEB 2VQSA 3GFPA 1NY5A 2WMNB 4TWZA 4RVCA 2CHQA 2IYZA 5BWMA 5K8LA 4HZIA 3ZIAA 3RC8A 1UEJA 4LZZA 1NF3A 1GILA 4M1KA 4LHWA 3K0CC 3CLVA 1J2JA 1DAEA 3O8RA 3FYHA 2CXXA 1C4OA 2HEIA 3ASYA 5BYJA 3TUZC 3OEHD 1DELA 1GG2A 1ZMXA 3EW9A 4ABYA 4M9SA 4LBZA 4E22A 5KU1A 2XNDA 4D80A 2AXNA 3FWYA 5HR5A 4F4JA 4KV9A 3KZ1E 5M04A 3KB1A 2FNAA 1N0UA 2BC9A 2WSSA 2I1VB 2VHUA 1JPJA 4LYFA 4TQUS 4UXHA 3T12A 4DCUA 3DL0A 4PQRA 4IFBA 2RGCA 3FMFA 3WRXC 1M6NA 4LYAA 3W90A 1L2TA 1XJ0A 2ZEJA 3T35A 1Q3TA 4ZO4A 4ZI3A 2W83A 3ZS9A 1AQYA 4Q1CA 2X77A 4KITB 1W0KD 2Z83A 3AP1A 2B92A 1XBTA 4JBYA 4DEXA 2EYUA 5J40A 2QSZA 4HAVA 3TJZA 1IXSB 3MRSA 2GJAA 4G5OA 2WKRA 1HTWA 3A4MA 2EFHB 1ESNA 4HZUA 4YXWA 3N2EA 2WAXA 2WMOB 1WB9A 4FMCB 2CK3A 1KZ7B 2BCJQ 3VR3A 3G0HA 1ZC4A 2HLDA 3GLFA 2NZ8A 4EFNA 1NN3A 5FPKA 4JKYA 2JGNA 1G291 3PUXA 3U61B 2D62A 4FI3C 3PVSA 4QHYA 3S1AB 4BLTA 1QVAA 1QHHB 3ZH9B 1FX0A 4JZKA 4JLOA 3RS3A 4B3DA 4LCBA 2IXFA 3VR6A 4TLCA 3LW8A 4DT1B 2RCNA 1TUIA 4FMCF 2GBLA 4M1OA 3U7EB 4OBEA 3THXA 3GJ8A 4A2PA 4DC9A 3DDCA 2FPLA 4TLEA 1CR0A 3QKSA 1N6PA 1XP8A 1LS6A 4EPWA 3THYA 5H1YA 4A36A 1ZRHA 4Z54A 3CKLA 2OBLA 2O52A 4FN5A 2E87A 3EC2A 1IN4A 1LW7A 1ZNZA 1O87A 4QKQA 3RWMB 1RVDA 2WWIA 3VR4A 1Q0UA 2YWHA 1E2IA 5AUOB 2KI5A 1KDOA 2QROA 1NVVQ 1M34E 1Z6YA 2WICA 3BAFA 3PCRB 5FTKA 4F4IA 4M2LA 5L3RA 3T1TA 3CPJB 1CBUA 3BFKA 3U3MA 4LJ8A 1P2VA 2ZANA 4R71A 1CJKC 1DAKA 2BKUA 1YR8A 1G3RA 3Q7PA 3H86A 3PUYA 1SVIA 2YOHA 4KBGA 3GJ3A 1TQ6A 2REXB 4LJYA 2QGZA 1W36D 4M4SA 3QXJA 3ZVMA 3PQCA 3EA5A 1Z0JA 4XIGS 1CR1A 4FXPA 4A8JB 3I73A 3EASA 3QVUA 3D8BA 3QXHA 1II9A 4V0ME 1R4AA 2ZJ2A 2FSHA 2R2AA 4MGIR 4A15A 2RGNA 4C0BA 4Q9KA 4NKRA 5AK0A 1IXZA 3K09A 1NKSA 2C95A 5FUYA 4HDCA 3C41J 2XX3A 1E69A 2J0VA 2Q0HA 3EXAA 4URVR 2V8OA 1CF4A 3ECCA 3E70C 1IY2A 2ZETA 2WWYA 5JMTA 2D7DA 2J59A 1KI3A 4I4LA 4TLBA 4TSFD 4TMTA 2A5YB 2ZS7A 4AG5A 4X8HA 1E6CA 2A5FA 2ERYA 3W5IA 1KK3A 2W6ID 2X2FA 1SKYE 2F3TA 3SJCA 4DDWA 5IK2D 1F2UB 4E5UA 3S1AA 2BBSA 3RYTC 3VR1A 4BE7B 1QHHA 1W48A 2CE7A 4A0HA 1I2MA 1BH2A 1KNQA 1ZUIA 2X1VA 4R7ZA 2XZOA 3EX7C 4Q1FA 4BFUA 3CX6A 4JLMA 2ORVA 5DYGA 3U6KA 2MSCB 1VIAA 4DT1A 2Q21A 1E0AA 1YJ5A 3QKUA 1DG1G 3ADKA 4JVMA 2OBNA 3K0SA 1N5LA 4EJSB 4B3CA 2DWQA 3QPVA 2H5EA 1AZSC 4FWTA 1OKKD 1E1RD 1HE8B 4O2RA 2WKPA 3ICQB 1NMZA 2DFKB 3B82A 2ZI5A 4R98A 4MYTA 4XD7A 3WXMA 1F2TB 1EWRA 2Z4RA 1VIYA 1QHXA 1KJWA 2YYZA 3IKJA 3OAAD 3W6PA 1T9HA 1BO6A 2ZI4A 2QRNA 2ZIAA 4K8OA 1Z6AA 4UNNA 4MYHA 2PT5A 1DG3A 4L9WA 1OT3A 3E2IA 2A5JA 5EXPA 4DWJA 3DKPA 2CMKA 4NHOA 1ZJ6A 3LVQE 3U6BA 4G3XA 4WBSA 2ZRMA 5CIWA 3CB4A 1UADA 4A8JA 2C8VA 2RB4A 4M1WA 1RRCA 2G6BA 3A58B 4CEJB 5FR2A 4UNPA 2P0EA 3B5JA 2OG2A 3EAQA 5JEDA 4HAYA 5HE8A 3TE6A 2E1RA 2HV8A 1NLFA 3DMDA 4Q9LA 3SNHA 4AYWA 5B64A 4BQSA 3SI7A 1JXMA 2AKYA 5DHAA 1UM8A 1E79A 2AWOA 1UKVY 2BM1A 2XSZD 3AKYA 5DN6A 5C46F 2WTUA 3QSYA 3AQ4A 1KSGA 1H8HD 2OZEA 2GF9A 1UF9A 1Q44A 1ZNWA 5F3WB 2EFGA 3E5HA 2G9NA 2A7QA 1UBGA 2O8DB 2GEDA 1G7SA 1A4RA 1FPMA 1TAGA 3CONA 4LUCA 5D3MB 2V7QD 4LBYA 3AF1A 4Q1DA 2ZR7A 2GAOA 4RSGA 2IBMA 3CZQA 1D5CA 2IYYA 5HPYB 3GEIA 4XWAA 5DHFA 4TQAA 4HAZA 2ECKA 1G8GA 4KVAA 4XTCS 4YQFA 4EJSA 4XVQA 1E2MA 2YC4C 1ZVQA 2CLSA 3RS0A 4PXAA 3UG7A 2Z6VA 3P4XA 2OCPA 1G7TA 3BGWA 1SQ5A 3F0TA 3ZVLA 4PSAA 3NC0C 4LV6A 4Q1BA 3SE0A 5CK4A 4FWIB 1IXRC 1XXHB 1Q1EA 1F2TA 1QRAA 4S35A 2G83A 2QPAA 5JJKA 3SFVA 4P32A 3P4YA 4LV8B 1Z2CA 4GT1A 3Q7QA 1EK0A 1G4AE 2P3SA 5JI2E 4CEHA 4MA4A 3OF5A 2WIAA 2QMUA 5BW8A 2J7PA 3GLIE 3SJZA 4MRPA 1U9IC 4TLDA 3FHTA 3OIUA 3ZLJA 3B9QA 2C03A 1G3MA 4ZCLA 2VA8A 2WV9A 3E1SA 4LBWA 3O47A 3OFNA 4XVRA 3IBGA 5AR1A 4CEJA 2G0NA 4JLJA 4PFSA 2OM2A 421PA 2PMKA 4QFMA 1QVRA 3BE4A 2CNWA 4M53A 4LWZA 2HJGA 5AJZA 4QBGB 521PA 3FOZA 2QNRA 2RMKA 3RSOA 4ESHA 1BMFA 2ZYVX 3BOSA 4W5WA 3H1TA 2XNDD 1XJCA 1MKYA 1C9KA 3BXZA 2BKEA 1D2MA 2IYVA 5HZHA 1CJMA 1II0A 1YE8A 1HH4A 1XMJA 3MSXA 4CT4B 1I2DA 2QSYA 3WP0A 5TV2A 3EPKA 2BEKA 1ZYUA 2ZE6A 2IYXA 4HDQB 3RDPA 4BLQA 5AJYA 1RC8A 1DO0A 1FMLA 1AKEA 2O8DA 4ZCMA 1E2KA 5D3MA 3DHWC 4D4JA 4XSGA 2IUSA 4XWKA 1X8LA 1EXMA 3SJBA 3HYRA 4C0HA 3TGPA 3BFVA 2JDIA 3CRRA 1F6BA 2IEYA 3UXMA 1E2FA 2EFDB 1G7CA 5ANRB 1U0LA 5DI3B 2OXRA 1GSIA 2FH5B 1YU9A 4LSGA 4DUGA 5J4VA 1ZIPA 4F38A 2H92A 1G19A 5B2ZA 4JLBA 1ELOA 1B0UA 4YXWD 2NO0A 1KJYA 2YHSA 3ZGXA 2AN9A 1NSTA 3LBNA 2NGRA 4Q4AB 2CK3D 2JJ1D 1EX6A 5KPDA 1E98A 2HLDD 3JVUA 4M0LA 1XXHA 1GRNA 5KTYA 2O8CB 4PHFA 1W36B 5JJLA 1QHIA 2IUTA 4RZXA 4N3NA 3TSWA 4A82A 4AIIA 2ZRGA 3GJ4A 3QQ5A 4IVRA 4RD4A 4ARZB 2QQEA 2VF7A 2ZRPA 4Q9HA 1P7CA 5FBRB 1NVUQ 2P5SA 2PX0A 3GJ0A 4POAA 4B34A 1DAHA 3VX4A 1OF1A 2DFNA 1EFHA 2VLIA 2ERXA 4LHYA 4WA7A 4C0AC 3H84A 5TXGA 2QT0A 4GOKA 4YMSA 1E9BA 2KBEA 3PEVA 3FKQA 4GOJA 3QUSA 4BZPA 1E2LA 3CRQA 5JLJA 2F1IA 1G7RA 2ANCA 5CJ2A 3A8TA 1DO2A 1LNZA 1SVSA 2WJYA 1SVMA 3LQQA 3KXKA 2J41A 2ZJOA 2IWHA 3WMFA 4P0TA 5GJWC 4IDNA 4WAUA 3A4NA 4EPYA 2GEVA 1G4UR 3RRNA 2IYLD 4GFDA 4DLVA 5G53C 2RHMA 2PZFA 3CNLA 1PLJA 4EDHA 4OKSA 2WWGA 1XZQA 1KAOA 5EP3A 4D0NA 4M8NE 1W44A 5C4MA 1LF0A 4JT2A 1HT1E 3U5ZB 4JSTA 4OHYA 1P75A 2OBMA 4TN1A 5DYIA 4HUTA 1Z6GA 4NZYA 2KE5A 4QGHA 1KTVA 4Z8XA 4FIDA 1EFTA 3QF7A 1QG2A 3HU3A 5EXSA 2ZSFA 3NBFA 4H1UA 4LJ4A 5EZ5A 5GVRA 2C5LA 2ZAOA 4OJKA 4BGDA 1CIPA 4KLZA 3WYFA 3OIYA 1ESMA 2GETA 3MUFA 1XEFA 5DI3A 4Q4LA 3FMIA 4QGFA 1IM2A 3AF2A 3C5HA 5JWRA 1GM5A 4DLUA 2FEMA 1SXJB 1EFUA 2GEUA 1X8KA 2J0UB 4MGYR 1LV7A 2YWFA 4AYXA 4Q4AA 1PLKA 1DS6A 1XWIA 3MCAA 3QENA 4BFYA 2GZHA 4LBVA 2CHGA 1N6RA 1G16A 2VP9A 3T06B 1G8HA 2O8CA 1ZNYA 3BD9A 3SS8A 3I8XA 4KAXA 4OI0A 1NN1A 2GAAA 4JVLA 1OXSC 1G9XA 4X8LA 3R8CA 1XU4A 3VU9B 4ARZA 4EPRA 1OH6A 3SHWA 5E7MA 1SKYB 2A30A 3LY5A 2ZE5A 4NCHA 4Z1MD 2C9CA 1G18A 2PEZA 1G3QA 4EAQA 4ASUA 1EG7A 3V4RA 1OHHA 4JL6A 4Y0VA 2QENA 3NBXX 5SZIA 1T5IA 4PHGA 3KXIA 2P6UA 2FJUA 3TSZA 3KKOA 1NRJB 2ZITA 3TUJC 1D9ZA 2W6IA 3T5GA 3AF0A 4XD7D 3GMTA 3OEEA 1YR7A 3LLUA 2FV8A 1M2OB 2EVWX 3ZZUA 1BYIA 1BKDR 2HXYA 5FL3A 3R7WB 2XXAB 3R9XA 1TU3A 4E09A 2LKCA 4JIMA 4OHXA 3IQWA 4YONB 3OIVA 2HXSA 2ONKA 4QG7A 4IDPA 5CJPA 5DI9A 3WP1B 3K9HA 1U90A 3X1DA 3FGNA 4PZLA 3QPUA 1Q57A 1NJFA 4IFEA 4IEIA 1HV8A 4AKEA 4EQ6B 3T5DA 2E9SA 3RRMA 4QJ3A 1HEIA 4ACBA 2W0MA 1W46A 1WDTA 4QL3A 3HDTA 3HR7A 1AIPA 2JJ2A 3GLGE 4DLYA 4WXRA 3T1QA 3FHCB 3ICEA 3UATA 4QNRA 2VH5R 1P2SA 3HU1A 1YZNA 621PA 1SXJA 3KTAB 4RKEA 3OAAA 4MGZR 1KI9A 3I8SA 5DN6D 4BFSA 5KUTA 1X8JA 4WZ6A 3KFVA 2NG1A 3M4YA 2BJWA 4PANA 2F1JA 4Q48A 4GI7A 4DKXA 2IS6A 3RRZA 1TEXA 1FQKA 1FUUA 4IRUB 3J81k 1GITA 4A0RA 1XPOA 3EZ6A 1DARA 3TIFA 4TYWA 1JR3A 1NN5A 1GNPA 2WSMA 3VMFA 4BFTA 4NCIA 2IL1A 1E2NA 5JEEA 1YZTA 3LW7A 5HE9A 1N6KA 4LOAA 4MKFA 3VU9A 1FNMA 1E4YA 2CVHA 1GNRA 4RD2A 1G3IA 4M21A 2H16A 1D8TA 3EPLA 1DAMA 1L4YA 2HYDA 2XZPA 4HAWA 2R44A 3HYTA 4N0DA 4OQXA 4P33A 1W4BA 4NU0A 1F48A 2FSFA 4C9BA 4ITRC 1MO6A 2HCJB 5G3ZA 1ZW6A 3B1WA 3KB2A 3NHBA 4IOKA 2NTYC 4A9AA 4JYCA 1UKYA 4Q21A 2O0HA 5FTJA 3QEJA 3NH6A 4HSEA 4I1OA 4NYMR 3R7WA 2XXAA 1A1VA 2ZR9A 1E4VA 1GOTA 4AKHA 4V03A 3N5CA 5J47A 2RGXA 4NBSA 2D06A 5HCIA 4HLDA 4BFZA 4EPXA 2WOOA 3F3YA 2H17A 1R0YA 1K5GA 1SHZA 2GF0A 3OFND 4EQ6A 3THWB 3O8BA 4LJ7A 4HATA 1TF7A 3LO5A 2QU8A 1S2MA 2OHFA 2QEQA 3SHFA 1JAIA 4NDZA 3A1UA 3BWDD 3T15A 1XPUA 1Z83A 4GBMA 5FFMA 4CF7A 2CNWD 2O8FA 3CPHA 4HAUA 3REGA 2IUUA 4D81A 4DHEA 2N1BA 2ZSDA 1KGDA 2QTVB 5KNCA 2HT1A 1BMFD 3AM1A 5F98A 1R8QA 1FZQA 5HCNA 1N3BA 1OXUA 3KTAA 4LYHA 4CVNA 3IQXA 1RRPA 1YKSA 3IGFA 4PAMA 1CU1A 4TYPA 4ZKEA 3I72A 3M6AA 5JI3E 1IN6A 1GZSA 3VHXA 1NBMA 3BB1A 1TPZA 3KQKA 3KKQA 4PC1A 1P9RA 5AUNB 1Z0KA 1YRAA 5EQTA 2H7VA 4A2QA 2GXUA 1FMJA 3DZDA 2JDID 3GD7A 5TB5A 3I61A 4DUGD 4ZDKA 3FE2A 4GMDA 3NXSA 4WZBE 4DSNA 1DE0A 4GDFA 1M7GA 2REOA 2DB3A 2W00A 2RGAA 4MRRA 2PCLA 4F4CA 2FGKA 4L4UA 3DOFA 4OYHA 2RKOA 3VX3A 2ZRJA 3CM0A 4ZDIA 4KLNA 2SHKA 3GLHE 5DNYB 2FMXA 1L4UA 4RFVA 4E07A 2BMFA 3HPRA 1CRPA 3K70C 3DKVA 3LRPA 2Z0MA 3P32A 4Q4HB 1XEWX 4TT3D 1US8B 3CRW1 3L8ZA 1DTSA 3LBHA 1UEIA 2QORA 221PA 3GJ6A 2CL7X 4G5SA 2AD5A 3PJRA 1NG9A 2CCKA 1GUAA 2PEYA 4D4KA 1JQLB 3NDBB 1OFHA 1UAAA 4QM6A 3QEOA 4L16A 1RYFA 3NC1C 4RY2A 1RE0A 3IUYA 4Q02A 3K0CA 2VRWA 3THWA 2OO7A 4CGZA 1E2GA 4B32A 3IHWA 2JJ1A 5FPYA 4JS0A 1GIAA 1Z0IA 4US1R 3CWZA 4PPGA 4N1AA 1AQUA 4G5RA 1G6HA 1GKUB 3TLXA 1E2JA 4OQNA 1P62B 3P27A 3L82B 4IOLA 1L8QA 2EFEB 3L2OB 3K9NA 3NKVA 1MH1A 2GJSA 3AP3A 1T8TA 4HLUA 2AX4A 2RGDA 4PO8A 3KKNA 3KL4A 3SDZA 1ZAKA 3L0SA 3LH5A 4AKIA 1KIMA 3VKGA 3EIQA 4OL0A 4DRZA 2JLZA 1YZUA 5A0FA 4GSYA 1JR6A 1W0JA 2EFCB 1VDZA 1XD2B 2WOJA 2UVQA 1WRBA 1G17A 2YOFA 1RIFA 1HURA 4AK9A 4JLPA 3ZZTA 2PL3A 4ZV4A 4GZLA 4GMXA 4FMDB 2ZROA 4OK6A 1XD8A 4XWOA 3FKSA 2VSXA 4QGAA 3R8FA 1QHNA 2RGNC 2ZRBA 3K53A 4IXMA 3PFIA 5EJEA 1XPRA 1XTJA 1E2QA 1E9SA 2QPTA 1D9XA 2ZYWX 2V6JA 1GAJA 4A0FA 2ZJZA 3U7HB 3KJEA 4Q4HA 3AUYA 3V9PA 2F55A 4PPFA 3P1JA 2B8WA 3WNDA 3ZYCA 1US8A 1CRQA 3IPYA 4D4LA 4PR0A 4LPKA 121PA 1KDTA 4F92B 2HF9A 2QMHA 4URZR 5J4KA 1WCV1 2ODBA 4EKDA 4NP6A 3U2QA 4EIWA 2WJJA 4DLSA 2YOGA 2BIFA 3D6TB 4L9SA 4ASUD 2VL7A 2QTHA 3M0EA 1OHHD 4IVPA 2WJGA 1TMKA 3CF0A 3HPQA 1TEVA 1W2HA 5KHOC 5TY0A 2NO1A 5G3YA 4MKHA 4V0KA 2BEJA 1JB1A 2A5GA 3TSOA 4WXPA 1XB2A 2F3RA 1QHGA 4D25A 4JYBA 3IO3A 5CDFE 1V43A 1FFHA 4DCTA 3OEED 4JKIA 2KWIA 1MRNA 4W5JA 2G1JA 1VKJA 5KOYA 2D74A 1R6BX 2JJ8A 2PLRA 3RANA 1GDDA 1E2EA 2IYTA 1Z6TA 2XOKA 2ZS8A 3B1VA 4MKIA 3BK7A 4FINA 4Z1MA 1KI4A 1UBEA 2FDCA 2IWRA 2MMGA 2C9YA 1Q1QA 2IS4A 1YR6A 1IN7A 3OE7A 3MAAC 4KFSA 2IA5A 1XCPA 1P2TA 4L5BA 2NO6A 2A2ZA 1XD2A 4B75A 5L3VA 4BPBA 3CNNA 3QBTA 4C0KA 2JJ2D 3Q8XB 4ZDJA 1UFQA 1W4RA 1CXZA 2EYQA 2QE7D 5CM9C 3WYGA 3EIHA 1DPFA 1GFIA 1XF9A 4DZZA 2J0SA 3KUDA 4Q1AA 2ASEA 2JLSA 5L3SB 1KJZA 1VYTA 1VPLA 4TTPA 4A8JC 4WVFA 1SXJD 2DPXA 2YZ2A 4UQOA 5FH9A 4NCNA 3GLGB 4LGMA 1IJEA 1Z06A 1ZD1A 4G5GA 1TQ4A 4B35A 2QL6A 4NONA 2UZ3A 3AEZA 1ZM4A 2ZI6A 1RPZA 1Q1BA 2GJ8A 3H2YA 4LHXA 1QG4A 1JR3D 4C2TA 2ZRCA 4LV5B 2Q9AA 3RNLA 2O0JA 3FFAA 4B3FX 2OE2A 1BS1A 4FMBB 3QY0A 3IO5A 4MDFA 3SYLA 2QP3A 1P72A 4IVQA 3KDSE 3ND8A 3DOEA 4BLPA 1DOAA 2ZR0A 2KSQA 1UBFA 4C0SA 1PUIA 3V00A 3A1TA 2R6AA 1G3UA 2PT7A 1PV4A 1YZGA 4BEBA 2PLFA 4RFSB 3CWQA 5FBQB 3LXXA 5B30A 4F93B 2NPFA 2WIBA 2PJRA 4KHZA 1T3LA 1S4QA 1ZUNB 2C2HA 2WWHA 4RZ3A 3TUIC 1Y3AA 4BZQA 3VTKA 2W2TA 2XAUA 1F2UA 1JI0A 3NVAA 2AFIE 1J90A 1AJEA 3NBYC 2WWXA 1PZNA 4HAXA 1MRSA 1RYHA 2JLYA 4LJ5A 4EFLA 1XTSA 4DCNA 1UJ2A 4EUNA 3PUVA 2C9OA 3I5XA 2GK6A 2V4ZA 2QMOA 3Q85A 2BCGY 3L0IB 1COWA 1Q12A 3B1YA 3W8RA 3AH8A 1W5TA 4DB4A 2XGJA 1I4DD 3TW4A 2Y8EA 2TMKA 4BZXA 2QP4A 2BBOA 2QMEA 3WNCA 3W9YA 4OI2A 5E4FA 2D7CA 3AKDA 1TF5A 4LYJA 1KKLA 2LKDA 1T4GA 4YMUA 5L3SA 4AURA 4Z51A 4ZIRB 2CE2X 2ZUCA 3PITA 1KO8A 4M9XA 1OXVA 2YWGA 1F60A 1G21E 1N5IA 4AY2A 1MOZA 4K46A 2IS1A 5KDLA 1W4CA 2EW1A 2YWEA 5JZVA 4BRWA 1JJ7A 2OCBA 4C0QC 1HT2E 1M74A 3AGQA 5JSZB 1NBMD 3MMPA 4YMWA 2NOAA 4URWR 1NLZA 3AGPA 1XDBA 3B13B 1T6NA 4R9UC 4RJLA 2O8EB 3B1XA 4DLZA 2ZJ5A 1Z47A 4DLTA 1VCIA 2CJWB 4TTQA 2XJ9A 5LB4A 1X86B 2OILA 3U7FB 3H4MA 4LC1A 1KNXA 4TQ9A 1CJTC 3WMGA 1ZM9A 1AZTA 1XTQA 1OW3B 2G1KA 4NE2A 3NDPA 1IJFA 1KK1A 3W6OA 1S0UA 3CR8A 5G40A 2CVFA 3I5YA 4NYIR 4TMZA 3EWAA 3ZQJA 3GLFE 2ZYUX 2BWJA 3AB3A 1WBDA 2B21A 3AVOA 1U8AA 5JS8A 3BB3A 2NIPA 1Z22A 2QAGB 4CRWB 4RCZA 2HUPA 3P20A 2NO7A 4W7SA 3FB4A 4I1VA 2JLQA 5FBVB 3BERA 3V4FA 3W6NA 3LLMA 1AS0A 1OJLA 4QBHA 1G8FA 3MGCA 1GTVA 3BJIC 3TW8B 4AD8A 3ZQ6A 1U8ZA 3WY9A 1Z08A 2ZUBA 4X8OA 2OFXA 1W7AA 3CX7A 1IHUA 4Q7JB 4BWYA 5KYKA 2BBWA 1XEWY 5EE9A 3RHFA 2F6RA 2FPKA 4PHHA 3G82C 5C4GB 1E3MA 2JIZA 2YC2C 1ANKA 4I99A 3TNFA 4A2WA 4X8MA 1A2KC 1Q20A 2MSDB 4FCTA 2GCNA 4WZAE 4TT3A 4O3MA 1HUQA 2BM0A 1N6IA 1S1MA 3CUEF 1JXOA 4B74A 5C18A 2CLDX 4AWXA 1W47A 2ZSAA 4LY6A 5SZKB 3KJGA 4DLXA 4QM7A 1L7VC 2XTZA 2IT1A 2ZE8A 5IF9A 2QBYB 1XCGB 2AXPA 2ONJA 1KAGA 3QNUA 1S1CA 3AVPA 1T0HB 1N6LA 1E0KA 1KK2A 3AVYA 2O8EA 1W0JD 2VEDA 1NVXQ 2C96A 5JWHA 2AL7A 1JAHA 1O3YA 2VP0A 3O8DA 3RRYA 2OESA 2CJWA 4M1TA 5G41A 1OH7A 1XMIA 3VKWA 5LD2C 2CLCX 2F9LA 3O8CA 2XB4A 3BIFA 4B48A 1QHYA 1MT0A 1IY1A 4IEEA 2ZJYA 4RD6A 2G88A 4WOPA 4TLAA 5F9HA 3FKSD 3LD9A 5GADl 1A7JA 1XMVA 2R6FA 2HDNB 1HA3A 2FFAA 4Q5IA 4MRSA 1RZ3A 2JLWA 3SZRA 2YVUA 3JZAA 4TYYA 1GL9B 2QAGA 3UMFA 3NEYA 3AUXA 2DFLA 3HP1A 1KSJA 2FX3A 3KQNA 4U02A 4DLWA 3LAWA 1LFDB 2GCOB 3C4JA 5FL7A 5BN3A 4QOSA 4LRWA 1F5NA 3IILA 3RVBA 5B58C 2H57A 4OQFA 1W36C 3AVUA 3NHAA 4UJ3A 1CR2A 3GJ5A 1ZU5A 4IOMA 4LDJA 1OXXK 1NJGA 2Q9CA 2NMVA 1ZD8A 4D0GA 4DDUA 3ADCA 2GWHA 2QM7A 2P6NA 4RZ2A 1HYQA 2JCSA 2QRZA 3DM5A 2OT3B 1FOEB 2J46A 3LWNA 1RJ9B 3DM9B 5EP1A 3EPHA 2KBFA 4PTLA 5EE5B 5LDDC 4NYMQ 1KMHB 4MGKR 4QNMA 2QT1A 5BXQC 4LK2A 1SKQA 4LJ9A 3SOPA 5CLLA 2ATXA 3C16C 4DDVA 5F9FA 4TL7A 3LX5A 2XOKD 4GOXA 2ATVA 3MJRA 3X2SA 2GA8A 2OXCA 4RD3A 5JHGB 2QBYA 5AUPB 1R5OA 4OJQA 1SGWA 2QAJA 5AUQA 1R10A 3MWYW 5AJVB 1FP7A 2ZSBA 3OE7D 4OK5A 1M8PA 4OHWA 1OSNA 2RH5A 1CULC 1RRFA 1E32A 4KFUA 2P2LA 4H9GA 4TMVA 4Q47A 1EFCA 1RFLA 4TMKA 1X1SA 2D2FA 2GZAA 3U4QB 2RHDA 5FOUA 3K0AB 1G64A 1OYWA 4B3XA 3ZS8A 4I1UA 2ZREA 2J45A 1U0JA 4OI1A 2ODEA 4O25A 3SN6A 5H68A 3TAUA 1TL7C 3B2EA 3FHOA 4UKDA 3ADBA 3TH5A 2IC5A 1FTSA 3AV0B 4QHTA 3PEWA 4OQMA 4LC0A 1XTRA 4AI6A 2FFBA 1X1RA 4HB2A 2F9MA 2B7CA 2V55B 2GKSA 5LB2A 2OUKA 1EX7A 3PUWA 5KSOA 2BOVA 4PSKA 2R6GA 3HU2A 3U3KA 4B3BA 4QJ4A 3SU8A 1SXJC 1G41A 5FBLB 4AC9A 1JECA 3CIOA 2GCOA 1T0JB 4Q1EA 1OPXA 1YHNA 4ZDWA 3RS4A 5TDHA 1P9WA 2GZDA 2W58A 1R5BA 1SVKA 1WP9A 2ZJBA 4PC2A 3SQWA 3JVVA 4D82A 2R8RA 2QE7A 2IF0A 4ON9A 3AKEA 2V3CC 2B7BA 2ZPTX 2P6RA 2Q6TA 4PPQA 2B8TA 2V6IA 2I4IA 3QPWA 4V0MA 4DCVA 1C1YA 5JHHB 4FD2A 4IDOA 1NIPA 3KQUA 3HJNA 4Q19A 5HTKA 3RABA 3RC3A 3PG5A 1W4AA 2J0UA 2QZ4A 2P67A 2A5DA 2QP9X 2JLXA 1LVGA 4MUAA 3IEVA 2ZM5A 5AWFC 4RD1A 4DSOA 1KO5A 4KFTA 1R7RA 3B78A 4MH0R 1NKTA 2ZI9A 3KJIA 3RAPR 2F7SA 2YINC 3ONWA 3QF4B 2OFOA 4C0LA 2REBA 5CB6A 2J87A 1UBCA 2GVDC 4IJMA 3F8TA 1VCMA 3K0FB 2W0SA 1LTQA 4DSUA 2EWWA 2GILA 4JLVA 3WNBA 5A5GA 1ZM7A 1SVWA 4F91B 2A78A 2VPPA 5CDFA 5E7JA 3SEAA 3SBDA 1XNJA 2BBTA 3UIEA 1EWQA 3KXLA 4JLDA 1J8MF 1GKIA 3D7MA 1TQDA 2ZQ5A 1I4LD 1VTKA 1COWD 4QXAA 4MITA 5JS7A 4Q4JB 1J99A 1I4TD 1OIVA 3ETLA 3U3RA 1DAIA 1XTIA 3DO6A 3VHLB 1KDPA 2XTNA 1G5TA 1XCMA 2JASA 4QGGA 3CPEA 4B44A 2EWVA 3QXSA 3U4QA 4MDEA 4YLGA 2ZRNA 5FPTA 2V54A 5DISB 3VKHA 4IW3B 1W5SA 5FOTA 2QA5A 3FMPB 1AKYA 2EQBA 2ZRKA 1SULA 4JLKA 3RWOA 1M7HA 1BIFA 1CP2A 4URYR 4A4DA 1SVLA 1NN0A 2NQ2C 4S2EA 1H65A 4D6PA 1Z63A 2ZRHA 3GEHA 3HWSA 2DYKA 2OCYC 3FMOB 3T1VA 4DIDA 2AHOA 2VSOA 5B57C 2F1RA 2FOLA 2PH1A 4AG6A 4KODA 5FOXA 1P2UA 3GLIB 3BB4A 1NP6A 4R2HA 4C0JA 1GKYA 5KNDA 1P6XA 4O0MA 3LQRA 1EESA 4B2LA 1KO7A 3IPXA 5EXXA 2CHVA 4NYJR 1U81A 2DR3A 5SZJA 3KX2A 1GL6A 1AGRA 2GJ9A 3CO5A 2ZYTX 4PHTA 4BLSA 3K70B 2J7KA 4KBFA 5AJXA 3EA0A 1XXHE 3C5CA 3NWJA 1KI6B 3UWKA 2RGBA 3QF4A 2GVZC 1OH5A 2FN4A 2Q3MA 3K0FA 4Q9IA 5P21A 1HY3A 3WHLA 4JJKA 2AK3A 2ZU0C 1JEDA 1MV5A 5EE1A 4FCWA 3UKDA 4C3ZA 1KI7A 1DAFA 3UMRA 2XB2A 5AJWA 3ND9A 3K8YA 4PO1A 1FTNA 3R9WA 4Q4JA 1U98A 2AD1A 5TARA 2HYIC 2R6DA 3P26A 1GNQA 2I3BA 3EZ7A 2WWFA 3FPAA 3LA6A 4Q7LA 2N42A 1FL9A 3D3QA 3I62A 2FEOA 5JRZA 2JIZD 1ZU4A 3PEUA 1E9EA 1YRBA 3VQTA 3THYB 3GCGA 3K0EA 1EFRA 4OI4A 5DSZA 3QKRB 1T91A 2Q3FA 4KJZA 1IBRA 2MMCA 2QTFA 4GP6A 4LI0A 4M1MA 3U7GA 1PUJA 3SQXA 3MG9A 2RGGA 3ZD7A 2DBYA 4JL5A 4JLAA 5E3HA 5KSZA 1XEXB 3IIMA 4Y0AA 2VF8A 2VTKA 1ZINA 3QIAA 3T34A 5JCPA 1MR3F 2J9RA 3AVQA 4BLOA 3RS2A 2KJQA 1IOZA 4LPSA 1UDXA 4C7OB 2CCGA 4YC7A 2AFHE 1FUKA 1K6MA 1Z8FA 3BC1A 3CNOA 2PMDA 3WBJA 3WRYC 3U44B 1OH8A 1II8B 3GLIA 3FVQA 2IHBA 2IYUA 1DVRA 4KU4A 1G8YA 3CZPA 3OESA 4HI0E 4HLUC 4TMWA 2DWPA 3CW2A 2BHRA 1IN8A 1KKMA 1NMYA 1WF3A 2FE4A 2GBLC 3ZZ0A 2JA1A 2GXSA 3PEYA 3WMEA 2PCJA 2GJKA 1ZUHA 4LJAA 1TTTA 3A1SA 1KO1A 3SYNA 2PJZA 5CITA 1QHSA 1WMSA 2OSBA 2A3RA 3B8HA 4MKGA 1KI6A 3TMKA 3KJHA 4XOIA 3W3ZB 1LS1A 2X2EA 2B6HA 2UKDA 4MRNA 1R0WA 5FUVA 2VP5A 3R20A 2J0QA 3SBEA 1AN0A 5GVSA 4MYCA 5BQ5A 1R5NA 2CDNA 2QG6A 5FL7D 2V9PA 4G01B 5CYPA 2LWIA 1OFTA 1Z0FA 4ZKDA 1RW4A 1FQJA 1E1QD 3MWJA 4P4UA 1S8FA 2OAQ1 1QDEA 4B71A 4BECA 1T3HA 1YQTA 3PENA 1JEEA 3A1WA 2QQ0A 2GESA 3TBKA 4NTZA 3K9GA 1Z2AA 2G0TA 2ZRDA 3T1OA 1CJUC 1PLLA 3NEJA 1CKEA 1Q22A 3K09C 3NTUA 4OK3A 1HQYE 5FUWA 5BN5A 1U0HC 3MJHA 1CTQA 3QKRA 2D3WA 1G5RA 3FFBA 2YNMA 5J5CA 1KOFA 1WXQA 2I1QA 4YDHB 2HT6A 4QJ5A 5FBWB 3DEFA 4FMDF 4HDOB 1UKEA 1Z28A 2WKQA 1AS3A 2VO1A 5TVKA 1OE0A 1JNYA 1XEXA 2W6JD 4D4MA 3RLFA 4NCJA 1E9RA 1XX6A 2CEAA 4LHVA 5FPHA 2IW3A 4C7OA 1W1WA 4CEIB 4ZCIA 2YV5A 3BH6A 3FDIA 3NBZC 3U44A 1ZC3A 4B6EA 1II8A 3B9PA 1RRGA 1U94A 5KO2A 1ONBA 1KY3A 1N6OA 2NZJA 4C30A 2WJHA 3MWKA 1G20E 4W9MC 1X6VA 4B33A 1E9CA 3IEUA 4HB0A 1SXJE 1NIJA 1ZP6A 3GFOA 4RD0A 5SZHB 4DBLC 3AP2A 5TMPA 1D2NA 3UMSA 2EU8A 2WPDA 4E03A 5L8VA 2LCFA 1VYVA 2R6CA 2WJIA 3QXCA 3AF3A 2ZVPX 2CCJA 4IXNA 1R0ZA 5IHPA 1YZLA 1JR3E 1JALA 5FTMA 1CJVC 3NH9A 1XRJA 4TTRA 1VHTA 2ZVQX 4EPVA 1E94E 4BFWA 4DEYA 2IYSA 3GFTA 2P65A 1GVNB 2PZGA 4Q7KA 4Q66C 5E7IA 5EE0A 2XEXA 1FP6A 3SJAA 5CB8A 2PX3A 4PSVA 1NL3A 2FFQA 2WHXA 1E2DA 1G5PA 4JMPA 2HF8A 5JECA 4A0GA 1NMXA 4RKFA 4NH0A 5DIFA 4IOJA 2ANBA 4JBXA 3BH7A 3AVXA 1PJRA 4NYIQ 4FCVA 4BFXA 3IBYA 4RCYA 2GRJA 1K5DA 1Z29A 3LNCA 1V5WA 4A6PA 4XVUA 4CDGA 3ZJYA 1U99A 4Q18A 1PVOA 2VYFA 2X19A 4B2PA 4QRHA 2VP4A 3N2IA 3T61A 3A37A 2F1HA 3AKCA 3PV0A 3RSLA 1TNDA 1Z5ZA 1KI1A 4LHZA 1DAGA 3DMNA 4IDQA 4HEJA 4CEHB 1TQ2A 4CEIA 4B76A 4Z8YA 4G5QA 4DSTA 1P73A 2WVJA 3PR1A 4KO8A 3TQFA 1H8EA 1S3GA 3LV8A 3EZ2A 1CEEA 5FOWA 5IDVA 1P3JA 3GEEA 1T8UA 2DY1A 4NL4H 2ZI3A 4V02A 3UWOA 2F43B 3W3AA 1WE2A 1E9FA 1M1YE 3UG6A 3EIEA 5A4JA 3B7GA 5LPNA 5FPSA 4LX0A 4EJSC 3MLEA 4ESVA 5C1BA 4KYIB 4MRVA 2CBZA 3A36A 3TVDA 2GXQA 4KSBA 2N46A 3C8UA 1T5LA 2GHIA 3EC1A 5J4LA 2KB0A 3CBQA 5BN4A 3VNUA 2OAP1 1JQJC 3C14C 3LFUA 1NVVR 2FSGA 5JRJA 3GPLA 1EGAA 5K8IA 5D3QA 2PBRA 1NBME 1VG9B 2ZE7A 1GRQA 2ZS9A 1NY6A 4MQBA 3EPJA 2G77B 4GZMA 3BS4A 3EARA 3X1ZA 1JPNA 4CIDA 2ZXUA 4PZYA 1KSHA 1QF9A 4XH9B 2ZRIA 1XFAA 3QKTA 1OIXA 5FR1A 3N70A 1Z6XA 1A2BA 2X8AA 3Q72A 5DLQC 2IEZA 4PX9A 2R62A 3EG5A 4DCSA 2IS2A 1UPTA 3K1JA 3TVTA 2ZI7A 3LXRA 1VMAA 5FI0B 4CW7A 5DH9A 3KKMA 3Q5DA 2JAQA 4M9QA 4UXIA 2AWNA 5KNBA 2C77A 1KO4A 3MFYA 5F2EA 3GLGA 1IN5A 4TMXA 3U60B 4BFVA 3C7KA 4XSHA 4PQFA 2IXEA 4DIEA 1Y63A 2PZEA 4HB3A 5FTLA 4UNSA 5IT5A 4M1YA 4F7WA 4II7A 3RS7A 1GL7A 1ZD9A 3CH5A 4JL8A 5FOVA 2V1XA 6Q21A 3BRWD 1LF5A 1AS2A 2K5UA 5UKDA 3W8NA 4URXR 4B73A 3Q3JB 4UNRA 4DB2A 3QBVA 3ADDA 1IY0A 3X1YA 4MUBA 1NI3A 1QZXA 3JZMA 4U5XA 3KQLA 5JFGA 4JLNA 1KI8A 4I1SA 1ZIOA 2BVNA 4FW9A 1OV4A 4PC6A 5JBQA
chains in the Genus database with same CATH superfamily
3DL4A 3VKFA 3CZ9A 4V0SA 3JZIA 3WE7A 2J1LA 3PX7A 3D2CA 4FONA 1TUEA 2C2ZA 3ZIAD 3WBKA 3KEGA 3DCYA 5AXAA 3RBVA 1TXGA 3A3NA 2ODWA 1J8VA 1U9IA 4UNIA 4ZZ1A 3X1WA 2OV2A 4DIOA 2YTZA 5JSYA 1EX1A 3DPSA 5BRNA 3FCCA 4G1CA 5DXJA 4ZREA 3QEMB 2ZJAA 5CYGA 1AURA 2OLKA 3MWLA 1H5QA 4HB4A 2I9PA 4QOFA 5F35A 5E9WA 4L57A 2X6QA 2W2XA 1UKBA 3IDAA 1DBQA 1SVOA 2HO5A 3DE4X 5KQRA 4LOJA 2H7CA 3EXG2 3U9LA 3WQRA 1O77A 2G0AA 2YZKA 2H5JA 1SUAA 3IEIA 5JS1A 4DCUA 3GEBA 5CIQA 3MTAA 1A5TA 2PMWB 1OLXA 1Y8QB 1BEZA 2WWWA 3AERA 5F2NA 4P84A 1VCNA 2ID4A 1AGPA 2FWRA 3AUJB 3BJEA 2ZM6B 1DBRA 2JLUA 1X2EA 3ESBA 3GJ7A 1VLHA 2JATA 2DY0A 2Q07A 2VN8A 3PUZA 3N8DA 3QJ5A 4Q00A 4QHSA 1TUBA 4PX3A 4KR9A 3T3GA 3U1VA 1JX6A 4TV9B 3U3OA 4YDSA 4ZIRA 1JV2B 4KE9A 5LJLA 2QG9A 1RQXA 4YECA 1AXRA 1J7KA 1NE2A 2G80A 5U1PA 2ENUA 4MJLA 3JQAB 1SFRA 3I28A 4EI9A 1M8GA 3PC3A 4FE3A 1HETA 3I9JA 4WNCA 2FZLA 3SKXA 3W7BA 4US2R 3TB6A 2JH9A 4GNKA 1WCIB 2PGNA 4GOOD 1QPGA 3RS5A 2I6FA 2WF7A 5LC1A 2I3GA 4OHOA 1NQVA 1E92A 2OHHA 2QSUA 3OCYA 1UBRS 1ZAYA 1DJNA 1GXSA 4L8LA 3TAHA 1WV0A 3JW8A 5IRCD 4HX9A 2P6PA 1KZGB 4JSRA 2XY4A 2R60A 1MB9A 4XWTA 1WMBA 1Z07A 3PU6A 5JZMA 4UNQA 1TTQB 1VG8A 1UDWA 1EXNA 1GR1A 1W0KA 1YFKA 1M2EA 2QAGC 3LWBA 4XM1A 1N0WA 2JD0A 2YZGA 3OURA 3J81A 3GQBB 4FBLA 4CM4B 3D8RA 2BDTA 2BGMA 2QL7A 3S4YA 5JVDA 2WTEA 1BSVA 3WKCA 4MS1A 3SSMA 4BASA 3ODPA 4UE3S 1AGYA 4DV5B 5K8UA 1O8BA 3KSZO 2OBBA 3F6BX 1G66A 3A6PC 4ZI2A 9LDTA 3VYVA 4DDKA 1WDWB 3BXGA 1FDWA 3Q6IA 1A82A 3TRFA 4FFMA 4I4TB 3GJZA 3N3AC 3EZFA 1NXQA 5HZKA 5I7EA 1OIWA 1X9IA 3IQIX 1Q3HA 1W581 5FWYA 3TK1A 4PC7A 1I8TA 1W1IA 4G36A 4PLPA 3TSAA 2FG5A 2H1LA 2BGIA 2GB4A 1UPCA 2IHVA 1E64A 1ONOA 2Z09A 1V7CA 3IUJA 4MS3B 1Z15A 4UREA 3U3JA 4DBLE 4BGVA 4EKIA 1VKOA 3WLQA 4TSRA 5JARA 3OMWA 2VYVD 5TR9A 1CUYA 3K6KA 5B1SA 4DXAA 4KQXA 2DT5A 1GP2A 4I4TF 4P81A 3BEOA 4UJ5A 2OOSA 5LBUA 4FTWA 2Q3HA 1D2EA 4HYYA 2ORIA 1T2CA 3GP8A 4N18A 4HRXA 3E84A 3WYCA 4J0QA 3BKXA 4FC6A 4EGJA 1J97A 1UKZA 3GZTB 4EO9A 1E0JA 4RTMA 1WB5A 1G2PA 1QVVA 3EWSA 4M1SA 5IAEA 3UT0A 5B7PA 4C76A 2JHFA 4US0R 2V3VA 4FHCA 3R6WA 1M6HA 13PKA 3AVTA 2I2CA 2WPDD 4PVDA 4IZOA 3TJMA 2D1RA 4BUZA 5D5PA 1T8RA 5KB3A 2XITA 3I4LA 1X1BA 2OZLB 3Q6MA 8LDHA 2L2QA 1CIJA 3ZV7A 5BUSA 4RANA 1KVQA 4P9NA 1VPTA 2DPGA 2VWHA 3IEKA 3W5DA 1H0SA 4MQMA 2J6BA 4BQRA 4CUJA 2Z8YM 4MIOA 4PG8A 4OREX 2XZDA 3JASB 5GINE 3PTLA 5MFZA 3ZDFA 3PQ2A 1EXDA 4O2LA 1E6WA 1KEKA 1KFEB 1F6DA 3M83A 4OHCA 1IAQA 4BFLA 1H66A 1ZGBA 3NKLA 4MK4A 1NPDA 1RC0A 3TINA 5FUQA 4MUNA 5LQKA 3UANA 1Y4ZA 1WQ3A 3I1JA 1G9SA 1ADJA 2FZ4A 2R1TA 2DZDA 1SUDA 2HDWA 3QW2A 1KOLA 4TWAA 4OQQA 1WW3A 3CF2A 4FGUA 4QC2A 4BLRA 2FW1A 3G88A 1L7EA 1PR1A 4KIUA 4R1PA 4TMYA 1T3ZA 4COKA 4YMGA 1AV6A 1TVEA 4BYGA 4FGLA 2CUNA 2PA3A 5LOVA 1N7HA 1MABA 1FC0A 3KKPA 5ALJA 1D4AA 4JQCA 4MV7A 1L4BA 3ZDQA 1TYDE 2VAVA 3IQHX 3IPAA 3MCVA 4ENPA 3TSCA 4QRIA 1D2HA 2FF5A 3SF0A 1XU9A 2VHCA 3HSSA 4OFBA 2XA2A 4BMNA 1GGHA 4KO1S 3EGDB 3UA3A 4PZZA 1ZK3A 2O2JA 5I4CA 1ZISA 3PR3A 3PDIA 4F9FA 2G08A 3D43A 2DHRA 4X20A 3NJ4A 3DMRA 3PIRA 4HDMB 4G0ZA 3B6JA 1NLYA 3I9LA 3H2BA 2IU6A 2VUUA 5DIZA 1ZCAA 5IXSA 1G8PA 1NG1A 1ISGA 2YBEA 3ROGA 1UZLA 1R0KA 3P45A 2JIOA 2LD4A 1WQ1R 3R0ZA 1Z3IX 2CXSA 1XQVA 3E4DA 4ILEA 4JCOA 5E3IA 3S7ZA 4D8WA 5I3ZA 4RY0A 3TXYA 1WF6A 2FFHA 2M98A 1KDRA 4JSYA 3T0IA 4Y3UA 5HW0A 4RLQA 4Z0NA 3I9FA 4QBFA 5T8KC 2WBLC 3DYVA 1VYUA 5IFKA 2O8FB 2Z43A 2HY7A 2PUWA 3AESA 1WSBA 1VRWA 4UPVA 4LS3A 4WQMA 2ADOA 1HDIA 4MUFA 5HQTA 4B85A 1NP3A 5FI1B 1E79D 3QU2A 2ZU6A 4P4SB 5K8JB 5EXEA 1ZCFA 2DRIA 2VS1A 4CQJA 1XZNA 2VJNA 3O4IA 1G4HA 3OKAA 4K3VA 3TLGB 3W34A 3M89A 4DWVA 3TX6A 1YR9A 2FR8C 2HWXA 5JJIA 2DULA 1ZH6A 4N12A 1MV8A 3PQ4A 2C0QA 1V8ZA 4N9QA 4C21A 3TN7A 4I4NA 3C7CB 2J48A 2JJQA 2P9FA 4G0PA 1P1BA 1SA0B 3EB9A 4PG7A 4Q19A 4B3HA 5IKXA 1HSOA 1JHDA 2C59A 1F4LA 2QX7A 4GLOA 2QD1A 3EW7A 4UM9B 4RJJA 5D7BA 3A9RA 3K0AA 5BV2P 2XCTB 1Y4UA 3BXFA 4PAQA 1YL7A 3QTLA 3KBBA 3EZNA 4JEMA 4KQGA 3D1VA 1KJ8A 1RAHA 3GJTA 4QYIB 3UUEA 1MC1A 4ENWA 1Z6QA 5CLQA 5FF9A 4BO1A 2K7FA 2QPOA 5KYUB 3LSTA 1DLJA 2A9KA 4J07A 5EJGA 1N5JA 5AT1A 2O5VA 1RZVA 3UHOA 4AQ7A 1B23P 2WQ7A 4J16A 1OFIA 1X19A 1S7CA 2BP7B 2DKNA 4ZGBA 3QFRA 2VSYA 5JCZA 2C57A 4IQGA 1G8SA 2BMEA 1H8HA 2O59A 1CJSA 3F7MA 2ZYRA 4G1UC 2VHJA 4YAEA 5DM70 3PHIA 4NMMA 3HS3A 1A3CA 1HE1C 4XA8A 1NPTO 2F8TA 1G6OA 1AKWA 1MLDA 1YZKA 4WCFB 2GHQA 3WK5A 1UXIA 4LOHA 5DGDA 1ZH8A 3ROMA 2AFRA 4YMIA 5BPHA 1MO4A 1MO3A 3DTYA 1NULA 3KXDA 3M5CA 5EWJB 4AYTA 2F1KA 1Q17A 3JYPA 4L4YA 1VG1A 3BORA 3W4JA 3G7NA 5GZ1A 2XKBA 3DL7A 3HADA 3BREA 1DUIA 2P9TA 1ISHA 4DLRA 3V48A 1CV2A 1J70A 1U0SY 3ZGZA 4EW1A 3AIOA 2R96A 1FMTA 3JRXA 1WX1A 1V37A 1EB9A 2IHZA 1BJKA 3P9CA 1GFSA 1L7DA 3A4LA 4L0DA 4M9RA 2Z3WA 3K96A 2XNSA 4K6GA 4MAAA 1N5KA 2JBAB 5LBIA 2O8BA 1SUSA 1F8FA 3QJYA 2WD7B 1E77A 5HRCA 1I24A 1PP4A 1VRVA 1Y80A 2PMFA 4UTOA 4W8HA 1YFJA 2CGEA 4CIAA 4PAOA 1QE3A 1E3TA 1YBHA 2FZCA 3N75A 4E3WA 4EMBA 1IG0A 2H2AA 1FX1A 3WGMA 4BVKA 1P91A 4TZ6A 1KSFX 1E6EA 1R64A 3L7IA 5JAHA 1S8AA 2VIIA 1IRXA 4KH0A 3EIWA 3GFPA 1NY5A 4RA9A 4YV7A 1Y1RA 3I0ZA 4MS4B 4AS2A 5JNWA 1IAVA 1EYZA 1HZZA 2AEJA 3FTNA 1JMVA 3LNTA 3OF2A 5CAEB 4GWLA 1GILA 1L3IA 2A9JA 1NYLA 2ZULA 2TSYB 3Q40A 4YQZA 4U9HS 3I2YX 1Y6JA 3CLVA 2X1MA 1CF9A 3FYHA 2CXXA 1C4OA 2HEIA 3T7JA 1UM9B 1ZMXA 3EW9A 4MUGA 4QYSA 3THSA 4HZGA 4ZT4A 2JS7A 1NJ1A 2FTKE 4E22A 4J03A 1E5DA 2WUDA 3N0WA 2AXNA 1KRWA 3H5IA 1CK4A 3UWSA 4AZSA 3KZ1E 1Z18A 3IJ5A 3OA2A 5KOJA 4P83A 2WSSA 1MEOA 2YXDA 1BWQA 1O9BA 3B7WA 1K7EB 3D0RA 4TQUS 1O6FA 4DY4A 4MIYA 5A04A 4PLYA 3IPLA 4IS3A 4IFBA 2IHNA 3LJKA 2G63A 1XJ0A 5HIJA 3LYLA 4ZU6X 5AYVA 4UUMA 2VTEA 2HA5A 2W83A 1GY8A 2JIBA 3AYXB 1ZMOA 4BB5A 4CN9A 4B2YA 3NDJA 1KA9H 3VV2A 4A8PA 2X77A 2Y66A 4CTNA 4G4IA 4KITB 5AVVA 3AP1A 1V8FA 1DBIA 4MHSA 3WR5A 2ATCA 2CB0A 3TOCA 4F12A 1IBSA 1JZTA 2QSZA 1JPUA 2KQUA 4U2GA 4OAPA 2FW0A 2I6SA 2JFWA 2D5LA 4FYYA 3JR3A 4G5OA 4NEQA 5AKHA 1TAQA 3T4UA 3IAUA 2IYFA 1JYEA 3A4MA 1TT5A 2XMCA 2PUHA 4OXXA 4RPLA 4YXWA 3N2EA 4MWCA 3M4XA 4YR9A 3ER6A 2OYSA 4ZVLA 1C2TA 3DZKA 1QONA 3DO5A 2XMRA 4TSKA 5HJ5A 1E1DA 1WB9A 5D6OA 1DDOA 2CK3A 2XV1A 1YJXA 4P53A 3HKDA 3RTAA 1I6KA 3F97A 3L8GA 4DMCA 4ZA2A 4QO8A 2ZBVA 2PGLA 2QK4A 4R6XA 3CFYA 1B41A 2JGNA 1G291 2ZSUA 3BG5A 3EGCA 2D62A 5I48A 3EZYA 4MICA 3TTYA 4QHYA 3H3JA 1QVAA 5FYDA 4M0FA 1J0EA 3RS3A 4JLOA 2V97A 2GT1A 2YNMC 5DBOA 3DBHB 1ATIA 1LRLA 3O90A 1YJ8A 2NV6A 2VTVA 2RCNA 3D4BA 3Q1LA 2OLEA 4UVGA 4DT1B 3S68A 4H18A 4TWJA 3U7EB 4OBEA 4ZU3A 3GJ8A 1XDGA 3ROTA 4A2PA 5JCJD 3THXA 2XKJE 2FPLA 1IOLA 3NFYA 1Y1LA 4KX5A 3QKSA 1GJRA 4TLEA 3T7KA 2AF3C 4MPRA 5AK3A 4P4NA 4WA8A 3FKJA 1YC5A 3EE6A 1WPQA 2O52A 2E87A 3DCNA 1B0PA 3EC2A 3DXYA 3F46A 1BDJA 1LW7A 2ZTLA 1MOSA 5CHYA 2VXYA 3AI1A 3RWMB 1IZ7A 5IKPA 3ZV3A 4PIVA 2C4UA 4GS5A 1R50A 1Q0UA 3MWDB 3VR4A 5BN1A 2KI5A 3NWPA 4LZJA 3S8EA 4GP9A 4JYZA 3QEBZ 3DOUA 4Y1RA 1NVVQ 2WICA 5FTKA 1IBMB 1H5UA 4M2LA 3AOGA 4DLNA 4RJTA 2HC9A 1UPUA 5TT1A 3BFKA 3KSMA 4F9GA 1P2VA 3L84A 2LDBA 1P31A 5K0BA 1HPLA 1PGQA 1UP6A 2RAVA 1BH6A 4M0MA 5J5AA 5FPPA 4RSMA 3BK2A 3AJDA 5EZSA 3H86A 1ODTC 4KBGA 1SVIA 1T9GS 3LBFA 1ZGHA 1W87A 5DGTA 3FG9A 1KP2A 1T0BA 3QXJA 4RCVA 1XAHA 3EHDA 4HWGA 2HJSA 5GV8A 2GH1A 4IQ4A 1CR1A 3IX7A 4FXPA 5M29A 2DHEA 3NV9A 3QVUA 1YI8A 2C84A 3D8BA 1XCOA 2XF8A 3ETJA 1EGMB 1O95C 1R4AA 2HIHA 4V0ME 2JIPA 5HILA 5C1IA 4YHHB 3HDGA 4C0BA 3OX2A 4BBJA 4NKRA 3V4SA 2BUAA 2CYBA 2ALJA 2GBFA 1IXZA 3RTGA 1XIVA 4KR7A 5E6SB 3D6UA 4HJXA 1NKSA 2C95A 4MW0A 2UZAA 4B83A 1QV9A 3FPKA 2VJDA 5JAIA 1Q2UA 5CR9A 2Q0HA 5AM0A 4TV8B 4URVR 1CF4A 2D0IA 3O7WA 4AO6A 3F8WA 2WWYA 3L7CA 4YAWA 4KMSA 4TSFD 1EUDB 4GPIB 5I3CA 1PX0A 2A5YB 3ITDA 2B69A 4TMTA 3GQVA 4X6YA 2Q8NA 1N78A 4EAAA 1EE1A 3D9QX 2ERYA 4J0HA 1KK3A 4DLPA 2X2FA 1H6DA 2CMHA 3HBFA 1C1XA 3CEHA 2DFVA 3DFKA 4KOEC 1FP4A 4MWTA 1EIZA 4GUAA 3BGSA 2BBSA 2YYYA 1QHHA 1L6RA 2NU7B 1BH2A 3C3XA 2EP7A 4L8YA 4NNPA 1TUGA 4TV8F 3IULA 3RIXA 3UOAB 4DDUA 3CX6A 4JLMA 2ORVA 5DYGA 2P1ZA 4PGMA 3U6KA 2GN1A 4C7BA 2R1ZA 3QKUA 4RNDB 3ESXA 1XTTA 1AB5A 2B0JA 2Q5CA 3ZU3A 4EJSB 2ZDQA 1QRRA 2Y67A 4MVJI 3K4PA 1RYMA 1PF7E 1ZH2A 2H9IA 3I9OA 4EVSA 1I9GA 5IM4F 2CD9A 2H07A 4M8IA 3WVNA 1NMZA 4G0QA 1U7XA 2P4UA 2GYVA 2HWUA 1R74A 3WXMA 1S7GA 2WU4A 3Q9SA 4OGGA 4BMSA 3M6FA 1VIYA 4ODIA 2HX1A 1P2GA 1G38A 4BNNA 3GUCA 3WB1A 1ENZA 1NNI1 2JGKA 1VI6A 3QPCA 4RL6A 1BO6A 3UO8B 1HQKA 2PXAA 3PRYA 2V7EA 1E18A 5LQAA 4RVSA 5AI6A 5CDTA 1AZLA 5BMVB 3PD0A 2QUHA 3JQ7A 3IP1A 1XMOB 3AL0C 1YNOA 4BDSA 2IJGX 4WBSA 3H6HA 4WK0B 2OYCA 3S2ZA 2XNHA 3LUKA 4HDRA 3MUEA 3CB4A 4N3BA 4WI1A 3T0GA 3CZ4A 5BN4A 2C8VA 1RRCA 3ZKWB 3I1YA 3LC7O 4HDNB 3KSAC 3EOAI 4UC0A 2P0EA 3A2LA 5KZMB 2Q4TA 5HRAA 2Q0QA 4HAYA 4CLRB 3FNQA 3H7IA 1NLFA 2XUPA 4AYWA 1GQFA 3K9FC 2G5TA 2PGAA 5FT9A 3D0KA 3SI7A 1QFJA 4I4IA 4COOA 2ZP1A 2QV0A 4H4EA 2QL9A 3FGPA 1XLWA 2B61A 1JDBC 3T3HA 3A31A 2WTUA 4AFNA 5C46F 3QSYA 4G1FA 3WL8A 1OX6A 5B1EA 3LLVA 1Q44A 1TVCA 2B4RO 5K3EA 2XUAA 1JH9A 4QOIA 4S0XA 3KBOA 3TKAA 3MRXA 1FNBA 3T7EA 3D6AA 3CU5A 3SQOA 4KR3A 1IQUA 1OYOA 1V8DA 3FBWA 3N28A 4LRQA 2ZAGA 1UIMA 2P0YA 4LUCA 2W4IA 2VBGA 4D79A 1DBWA 4CMEC 3JS5A 4Q1DA 2GAOA 4KJXA 2Z4TA 1SO8A 5IMBA 3WYEA 1JKMA 2HV9A 2YL2A 4MVYA 2H11A 2Z9CA 1P1FA 3MB5A 3VYWA 4XWYA 5DHFA 4BX0A 4TQAA 4N5IX 1U6JA 1WEHA 1G8GA 2LBPA 3EXFB 1RKXA 2OCIA 1S2OA 4XVQA 1YTLA 3B9BA 4MVJE 3EAFA 3G2LA 1E9VA 1XTZA 1ZVQA 1RLTA 2CLSA 4K88A 3TG8A 2H2GA 3C6XA 4JYAB 1KQNA 3HZZA 3UG7A 2HBYA 2HDOA 2Z6VA 2ROQA 5B7NA 1SQ5A 3F0TA 3ZVLA 3CZAA 3SE0A 1K06A 1IXKA 1TM2A 2B20A 5FRDA 1GGNA 1LVUA 1CJBA 1F0PA 1R9NA 4LQDA 4XASA 5A6SA 1SBCA 5KNCD 4KWEA 5HZMA 2G83A 4HQOA 3CXRA 3N87A 4BJ3A 4GT1A 3ZHVA 2C3YA 3GLTA 2P3SA 3DLIA 2QG4A 4RK7A 3MERA 4MA4A 2QJFA 1PTKA 2CNBA 3H5RA 3LIIA 4NARA 1J06A 1U9IC 4BVLA 3FHTA 3LY7A 4H4DA 1U0EA 3S27A 3B9QA 4DMHA 3OD5A 2C03A 4JXJA 3TR6A 4LNHA 4BBZA 1G3MA 3JD0A 2VA8A 2WV9A 4FSXA 4OFZA 3F3SA 1P7ZA 2O14A 5EVCA 2FFRA 5IFLA 2HMUA 4PSCA 5D1HA 2YUTA 2B98A 3ILYA 2RGRA 2VH1A 2XUKA 1U5BB 1XRSB 2QQFA 1T5SA 2R4UA 4PFSA 3VNBA 3L3BA 4C7KA 4EHFA 3CLHA 421PA 5IWAB 1FSPA 2PMKA 1QVRA 4I50B 2C7BA 3MTIA 3UMMA 4QBGB 4P80A 2RMKA 2SKEA 2XGGA 4QOHA 1Q0SA 4JDUA 4BAUA 4E2FA 4PLCA 4WKOA 1ECGA 1OFUA 3RSOA 2DJ5A 5JD4A 2W93A 2ZYVX 3PC4A 3BOSA 3TZHA 4QTXA 4W5WA 4N7BA 4DM7A 1C41A 2XNDD 3H1TA 1BXGA 1Q77A 3QLTA 1CCWA 3JWPA 4EYKA 4LSMA 1CJMA 4IHJB 2XW6A 1I2DA 3FX2A 4G1BA 4B6SA 3PI6A 1MQSA 1TFUA 4HDQB 1KJIA 4Z4CA 2C7VA 4I50F 3V8RA 2HQBA 1DO0A 5DHRA 1E2KA 4YRNA 3OI7A 2JF0A 1WPGA 4XSGA 1FUEA 5D00A 4XWKA 2BL4A 3TL6A 3DUFB 1L7AA 1EXMA 3SJBA 3HYRA 4C0HA 3TGPA 3BFVA 5ILOA 1MQAA 2P91A 3W1VA 1E2FA 3FETA 4FD3A 1G7CA 4IHJF 1ECJA 5ANRB 4OI0A 4L9AA 1FNDA 2FH5B 1GL3A 1YU9A 2NUBA 4M9UA 4LSGA 5J4VA 4AJ1A 1T3TA 4JLBA 1X0VA 1NUPA 2FX2A 3DFMA 4W1PA 3RUHA 4AS3A 2Y05A 3ICPA 1S01A 1XTBA 4GWGA 4LRSB 1EHYA 4OLHA 3LBNA 1KZ9A 2A0WA 3PNOA 1VHDA 3CC8A 3IH5A 3LOQA 1GV0A 4LWOA 4QOEA 2OHIA 2Q9UA 2WWVD 1R8JA 2VDRB 3H1BA 4XQ0A 1J25A 4R8SA 3RUDA 5KOHB 5EG5A 4YNBA 1QVZA 3ZHRA 3DDUA 5JO9A 4JWKA 4XYLA 3K6SB 4IWNA 3ZWWA 3B2QA 2ZRGA 3O6VA 3GJ4A 4IVRA 4MWGA 3UMGA 4Y2SA 2QQEA 4QEKA 1VL2A 4P0PB 1NUQA 3LI2A 3OO0A 1GYQA 4D0SA 2P5SA 5LZ4A 3B6IA 3QYFA 2IW1A 4FU0A 4N41A 4RTPA 5EVJA 1ENOA 3C74A 4HQ6A 4RKWA 3PGKA 2EEZA 2OC4A 3AK4A 3H84A 4NV0A 5TXGA 4DJEC 3GHHA 5F7ZA 3G2HA 2OENG 2KBEA 2RJ3A 2Y6VA 3DZGA 2OPHA 4GOJA 3QUSA 4BZPA 2XUGA 1E2LA 4PZEA 1PYOA 3TEMA 2XGMA 3CRQA 5K4HA 1JN0A 1C3JA 3EIOA 3RR2A 4Y2YA 1BCSB 4MV9A 1LNZA 2I6XA 2WJYA 3JYNA 1U1FA 4IG9A 2J41A 2ZJOA 2IWHA 1XAIA 4QXRA 3ULKA 5KNLA 3QEMA 3EH1A 2R6ZA 5GJWC 3PQDA 1A8QA 3LHKA 4WAUA 2XIJA 3RVKA 2PD6A 5ALDA 1G4UR 2AEFA 1GPKA 5AM1A 1SN7A 2IYLD 4GFDA 3VZSA 3ZUPA 1QGZA 4HV4A 7ABPA 5TIIA 1G1AA 2RHMA 4K9OA 2PZFA 2X5JO 4EDHA 1KPHA 4AZ0A 3HDQA 5L95A 5KYVA 1YQWA 3EMDA 2CVOA 5COQA 1JIXA 1I7NA 4KYVA 5FLEX 3CLRD 3TOVA 3CNHA 4FW8A 3SYTA 4CMCA 1H1DA 2HAEA 4BNMA 3N0XA 1RAGA 1YUMA 3F6RA 4IFIA 1C8VB 1OX4B 1J2RA 4ZQIA 4Q6BA 4WERA 4H1UA 5GVRA 4A6EA 4LJ4A 1GNSA 2C5LA 2IQIA 2O06A 2ABWA 2XA9A 4OJKA 4WASA 3OIYA 1ESMA 1ZX1A 2GETA 1T9ZA 2R7KA 4X5OA 3WYFA 5JNSA 1W2WB 2VZLA 2TMYA 3OPVA 2E49A 3ZK8A 1UQTA 4CTKA 4LE1A 7MDHA 1OI3A 2VC2B 2XT6A 4DXHA 2EATA 2YWBA 1GN9A 3NGLA 4IQ8A 3ZWAA 1PNQA 1X8KA 3N07A 3E23A 4MGYR 2Y0EA 4QODA 5TQ2A 3F6CA 3FCSB 4KDRA 4AYXA 4EY6A 3NLLA 3NPMA 1WCIA 5D6NA 1D5WA 3OCVA 1YU6A 3F6YA 3K2IA 3D7NA 3QENA 5TF0A 4BFYA 4QTYA 1CY1A 3CCCA 4EA9A 5GIOE 1DBVO 4LBVA 5B6JA 2CHGA 2ZUVA 2VP9A 2CXQA 4KUEA 4N3AA 4KV7A 4NLLA 2O8CA 4TQGA 3FCAA 3SS8A 3DZBA 2FY8A 1SOVA 4Z4GA 1NN1A 1G9XA 4X8LA 2PZBA 3G0GA 2GHRA 4YMLA 2CV0A 4EPRA 4ALMA 3RC2A 3EIFA 3QA9A 5E7MA 1EFPB 1JIJA 1SUBA 2X5XA 3LK6A 1MENA 5DBIA 4AX4A 4TTTS 3ZDBA 1UPXA 2ZE5A 3DJFA 3HMKA 4CQLA 3M1YA 3WLMA 3RI3A 4Q4CA 5FTWA 5EKUA 4DQVA 5AVTA 3KR2A 1M2NA 3ORSA 4OATA 4ASUA 2N3ZA 4UCWA 1OHHA 3ED1A 4E6EA 5JQGB 3ID6C 4PHGA 1TD1A 2Y1WA 2P6UA 5ARDA 2Y2VA 4MJ7A 5JH7F 4NBTA 3WSVA 1VL6A 3LY8A 5A2QA 2VA9A 2PYZA 3IDFA 1TCAA 4QFBA 4U7JA 1CPYA 1G2OA 1WKBA 4XD7D 1BZYA 2JFHA 3U9SA 4CMJA 4AJKA 2IHUA 3D3EA 4RKYA 1M2OB 2P40A 3EQ2A 2O6LA 4G0WA 3ZZUA 1YJBA 5DMXA 3D3JA 5D51S 4M0UA 4MUKA 3AFMA 2GPJA 2QS9A 1QYIA 1SBTA 2C5HA 1WJGA 3RIEA 2Y1KA 5ELMA 3JQDA 3GAAA 5SYNA 2GYWA 5JQGF 1K2WA 3VYSB 1DOZA 2C4NA 3WP1B 4ED9A 2BZSA 3T7DA 5IYZB 1YB4A 2QM0A 4XIJA 3FGNA 5BSGA 4IO0A 4RTSA 2C7RA 1AMUA 2VHYA 3EIXA 3GG9A 1HV8A 1QQBA 1OMOA 2QN8A 2E9SA 3L4SO 4QJ3A 1HEIA 1P1KA 2W0MA 3ENWA 5IUKC 1IWBB 1W46A 2OKGA 3BE6A 3HDVA 3K72B 4FGJA 3K5PA 2O2ZA 5DTEA 1JWBB 4TRRA 2IOYA 3UCEA 3VPBA 3PE4A 3PUJA 1QP0A 4RMJA 3BMQB 3T4EA 1EA7A 2VZ0A 3NETA 4ITUA 3D0QA 2G4VA 4LI3X 2XCUA 3OJXA 4WXRA 4RXMA 1PJ3A 1YZNA 4OXKA 3CW9A 5E8JA 621PA 1SXJA 2FEWB 1UMDA 3OAAA 4R2XA 5DN6D 3UJ6A 4R1QA 3FRJA 2JGDB 4NJMB 4UEQA 1X8JA 4WZ6A 1O9GA 1YFZA 3MJDA 4MVJP 4QWMA 4UUQA 3SZGA 3TQHA 1X7YA 4PANA 4DKXA 2IS6A 3QK7A 1FQKA 2GM3A 4IRUB 4JFRA 4Z99A 1GITA 5BVGB 1ML4A 4TYMA 3MINB 3J81k 2GM4A 1PQWA 3EZ6A 3L01A 1RRVA 3E3MA 4W9RA 2WSMA 1LDNA 1NN5A 5LUBA 4BFTA 3HXLA 4R81A 2Y1DA 4CG2A 5JEEA 1KZ4A 4J16C 2OCLA 5HE9A 1N6KA 2NTVA 4G67A 1WUKS 4N8DA 3RD5A 4MIKA 5D5HA 4ZK2A 1Y3IA 4X3OA 4QT0A 4ER6A 5JNUA 1VE9A 2QYHA 1PX2A 1L4YA 4B6PA 4HAWA 1Q7BA 2R44A 3CN9A 1ATZA 1VYHA 5KTKA 4N0DA 5L4SA 1PTJA 4HNTA 2J3LA 2FSFA 2AOUA 4C9BA 4D8YA 2HCJB 2X3UA 3D5TA 3VVBA 5HIIA 3FPEA 4JLWA 5D3KA 5EMLA 1Z74A 4IOKA 4E1AA 2NTYC 4J9UE 2UUOA 4EX6A 4QVGA 3MJSA 1C1HA 3U5TA 1NV9A 3F6SA 4CKCB 2G9VA 5GIPE 3RB8A 2VDWA 2V58A 3G49A 3R0XA 1FXWA 5KKAA 5BSHA 3KQSA 4G26A 2GKGA 5F4BA 3EGDA 4I1OA 5B3JA 4KO3S 2IXTA 3R7WA 2XXAA 4GU5A 5EJ9A 3UMYA 3DBRB 4RTLA 1CE8B 3AEUB 1GOTA 5BV7A 2HF7A 5FHRA 4D0RA 4C6HA 1KRXA 1O96A 4MRMB 3B12A 4I5GA 4EPXA 3KPJA 1ZN7A 1B6SA 3U4MA 4UM8B 2MU1A 4UCFA 1K5GA 1TYBE 2GF0A 2WYIA 2XYVA 3OFND 1CUFA 4DM3A 1FQOA 1KVUA 3AJ9A 5MN5A 3O8BA 3THWB 4LJ7A 4HATA 4K6MA 3RG8A 3LO5A 3SLRA 2OHFA 4LKRA 2QEQA 1NF2A 3SHFA 2QYTA 3A1UA 3ONNA 2HGZA 1JTFA 1AKQA 2DKFA 2O8FA 3HKCA 4QEZA 1K7FB 1M1YA 2N1BA 3O1IC 1F8XA 1KGDA 3VR0A 4QARA 3KJFA 1CRWG 2DUWA 1FZQA 2XQJA 2MR5A 2P9CA 5REQB 2P35A 3O3CA 3RWBA 2F1OA 3E3AA 4KR0A 4ZEXA 1HZZC 5JAUA 1E8NA 1HT3A 1RJGA 3O4VA 4R68A 3TLGA 3WA7A 3IGFA 2BRUA 4PAMA 1U7OA 3L4BA 1EBBA 1Q11A 3M6AA 4U6SA 4LX8A 1IN6A 1V8BA 5FQOA 4NU8X 5FNZA 5EFOA 1TPZA 3I9V1 3NT2A 2H51A 4E21A 2WILA 2PFGA 4D9EA 5B6IA 3MJEA 1P9RA 2C3MA 4A6DA 1NNSA 1V5GA 3Q98A 3WDMA 2JDID 1THGA 2FQYA 3ACBA 1AQIA 1KEEB 2IZOA 3EQ6A 4GLJA 1YBVA 5AVYA 4HMQA 3DFFA 3JQ9A 3ENKA 4U0KA 4MTLA 4LRXA 1BFDA 4RSHA 1DE0A 5BR1A 4GDFA 3MELA 3C24A 1BD4A 1SBIA 2OCGA 3M49A 4OYHA 3TZEA 1MQ8B 2O0MA 2DJIA 5B55A 1FNCA 2ZIFA 3ADOA 4YIKA 1MRZA 4OOFA 1TIKA 3GJRA 4KLNA 2SHKA 5EQDA 1LZLA 5IAOA 2FMXA 4C87A 1L4UA 4IDCA 5JCOA 1B14A 1FU4A 1J9GA 3VAZA 3P32A 3WL6A 3K70C 3OWOA 1S6YA 1ZS9A 2PIAA 3W5BA 4AP5A 1RAIA 3P9IA 5JLAA 5CG1A 2VJMB 3KUXA 1IH8A 4F3RA 1AKNA 1JHVA 2JBHA 2O7RA 2VWGA 3NB0A 4G8DA 1GN8A 1XVVA 5B53A 3IAS6 3NONA 1E5QA 4LZNA 5ES3A 1GUAA 3IVRA 3IAHA 3AY6A 3MF4A 1NRIA 1OU0A 4FCCA 1UAAA 4QM6A 1FUYB 3B9RA 3IUNA 3JWGA 1D2GA 4L16A 3ZWCA 3NC1C 2GBIA 1O6CA 1D2CA 1OTHA 1RE0A 4J2HA 4BO5A 1P1CA 3FYUB 4EQZA 1O4WA 4OYYA 1E2GA 2NXJA 2OECA 2D1TA 4XRGA 5CA1F 4AMVA 3OTQA 3HCFA 2JJ1A 1TM7E 2TMGA 3IQGX 2H1CA 3R23A 3AHCA 3CWZA 3DYIA 4TTAA 4B7ZA 1XHFA 1AQUA 2EZ4A 2YFKA 4RM3A 3TLXA 2QTVA 1DC5A 4TS3A 2OP0A 1P62B 1OVGA 3LYHA 4NZNA 1T4CA 3HL0A 1L8QA 4D98A 2HU2A 5ER6A 2GOYA 5ITZB 4OHBA 4QLAA 4CL8A 4PGHA 3QV2A 4HLUA 2PQMA 4DCCA 4QULA 2ZYHA 3Q8LA 2RGDA 1MIHA 3TRKA 4FOPA 3KL4A 1QRSA 1GGKA 3JALB 4A27A 2WSLA 1KIMA 3A6LA 3IJRA 3EIQA 5CMLA 3RVNA 1YZUA 1TC2A 1LU9A 2FHPA 4GSYA 4RS3A 5A0FA 3T7RA 3RRFA 3TMYA 3D4NA 3EWNA 2AVNA 3ZGNA 1VDZA 1YZ3A 2GASA 3WMXA 2WOJA 4N3CA 1BDBA 1RQ2A 2FWBA 5CAEA 3BQNB 3S40A 1HI9A 2YOFA 3CKMA 1HURA 2O1WA 4Z4IA 4W5OA 3DKRA 4MW6A 5LP1A 5IJ9B 3CUYA 1JXAA 2XR1A 1DB3A 4FE4A 3TW6A 3EBOA 5IC4A 1BKYA 2GGSA 2CLLB 1S8OA 2E89A 1EFLA 2J3DA 4ALIA 3GH3A 3O31A 5KMGA 3R8FA 1J1ZA 1QHNA 4NG5A 3KL2A 4D02A 1XTJA 4G84A 1E9SA 2DH5A 4OXQA 4O63O 1L7MA 2ZYWX 2V6JA 3TTVA 1IUOA 4A0FA 3FOCA 5AVJA 5MF6A 1V9LA 3AUYA 2I3DA 3BILA 2F55A 3U48A 2C5EA 4L5AA 3PYMA 3C3CA 3B3QA 1DRJA 5FFFA 2NUAB 3IPYA 2OV3A 4PR0A 3F4BA 3EVZA 3MUNA 1N32B 2Y1XA 1UBSB 3AWDA 3NO4A 5CB4B 5IZ4A 4EKDA 4EEKA 3HI6A 3DDNA 2ZSKA 5EJIA 4BE9A 3D2LA 2VL7A 1A5BB 2PX8A 2QTHA 3EVAA 2AQ8A 3ZBUA 3PJFA 3CF0A 3ABOB 3HPQA 5KHOC 4NXMB 2IDKA 3GDFA 1RXEA 5TY0A 2IITA 1FSSA 2NO1A 3HA7A 2YHBA 2BEJA 2LPMA 2XZTA 4UUBA 3BWMA 3NNDA 3GI1A 2ZBUA 4WXPA 1LNSA 3FUVA 1XROA 4DCJA 4YRIA 5LUAA 4D25A 1L1RA 1JQBA 1E7QA 1G5HA 2ZBQA 1FFHA 2PJUA 1KQFA 3E8XA 1U3FA 1Y3HA 3KKZA 4XYMA 4OLBA 3EDRA 2VRCA 1RIIA 3LLSA 4MQ5A 5DTQA 3FDXA 1H0KA 1Y1KE 1X80A 4ZQCB 5LCXA 3R74A 3RANA 5A4MS 2IYTA 2XADA 2XE7A 3H4IA 5IH7A 5FEUA 3PEEA 2XOKA 2ZS8A 3B1VA 1D09A 1PWXA 1UMCB 2XYPA 4JR2A 3BK7A 1NC1A 2QTCA 4NOMA 4IIJA 4Z1MA 1DDGA 4UU1A 2AE2A 1UJ5A 3P8ZA 2FDCA 2MMGA 2C9YA 1Q1QA 2IS4A 1EVQA 3OE7A 3LPCA 2IA5A 2QMZA 4IJ6A 4MR8A 4IHAA 4PGFA 4H7JA