4JM2A

Crystal structure of pgt 135 fab in complex with gp120 core protein from hiv-1 strain jr-fl bound to cd4 and 17b fab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
234
structure length
227
Chain Sequence
QLQMQESGPGLVKPSETLSLSCTVSGDSIRGGEWGDKDYHWGWVRHSAGKGLEWIGSIHWRGTTHYKESLRRRVSMSIDTSRNWFSLRLASVTAADTAVYFCARHRHHDVFMLVPIAGWFDVWGPGVQVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Supersite of immune vulnerability on the glycosylated face of HIV-1 envelope glycoprotein gp120.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
molecule keywords PGT 135 Heavy chain
total genus 36
structure length 227
sequence length 234
ec nomenclature
pdb deposition date 2013-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jm2A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jm2A01
1C16B 5IVXB 1OB1A 3PDOB 1JZ4A 4PLKD 4WHYH 1CFSB 1DANU 4DEPC 1QLRA 3MR9A 1QLRB 2N7AA 4M00A 2DM4A 4KGJA 5C07B 4OFVA 1K8IB 5L7XH 2ENYA 1I1AC 4TSBH 2EC8A 4RSVA 1LD9B 5E9DD 1CLZL 2HKHH 2A38A 1I3GL 3FN3A 2P1YA 3O4LE 5C0AB 4HWEH 5I1KH 1QEWA 1ACZA 3IDJA 1D9KC 3QG6A 4G6AD 4PBWD 4I3SL 1TQCB 3A6BL 2XN9E 3VXOB 4U0RB 4G43A 2V7NB 1D5MB 1MI5D 4UU9A 5IW3A 2IALA 4RIRB 3F62A 3U4BH 2AK4A 2ICWI 3D2UD 4HDIA 1ADQH 1Q8MA 1T04A 2ESVA 1KIRA 5K93A 1NFDF 3G6DL 4ZNEE 1OTTC 2YPLD 3HC3H 5DFTA 4OKVB 1ED3B 3UEZA 4ZUVA 3EJJX 2VXTH 1NAMA 1JZ6A 5MP6L 4L9LA 3RZWA 3TC9A 3S34H 5E6IC 1FZMA 4XP9L 4HWZA 4ODSL 2GT9A 3BWAB 1JHKH 2DLFH 5E5RB 4DN3H 2ZNWA 3CFJA 4JRXB 3QEGL 4QYOB 3MCLH 3AM8A 2AW2A 1YN7B 2FD6H 3O6KL 4S1QL 4ZPTB 3MV7D 5FB8B 3D69B 5BO1H 4GQPH 5DUBB 3MV8D 1TLKA 1QRND 1QSEE 1G7MA 4DEPB 1N0XL 1WCBA 5J11C 3RVXD 5IBTH 5CEXA 1CLYH 3I9GH 4OZGF 3FO9B 3E3QC 1FDLL 1IAOB 3BP4B 4LAQH 1QFPA 4V2CB 4OUUB 5T1LA 4JVWA 3BESR 1JNNL 3TA3B 3EDFA 1MRCL 3WFCH 1OD9A 3STBA 5I8EA 5EFIA 1BP3B 5HHXH 2APXA 4X9HA 1OLZA 2J88H 4PUBH 4F7MB 1IC4L 4JDZB 3R06A 1K4CB 4OZ4B 4LCCB 3QWRD 3PGFL 5JW3H 4MWFB 3VD4A 2R4SH 2VWEE 4OB5L 1FVDA 3B43A 2I25N 5FKAA 3KPNB 5IMMB 1VADB 1A6UL 4XAKD 5BS0A 4KTDH 5HSFA 3RVTC 2H9GA 1PY4A 5EN2B 2P8PB 3O3AB 1F8TH 3KPSB 1JGVL 1T03H 4NO5A 3HAEB 3RTQC 1DUZA 3T4YB 2R0ZL 3HE7C 2WIIB 4WTWA 2BSED 4XBEH 4N5ED 5TH2A 4E41E 2JJUA 1KBGL 2IG2L 3VGDA 5EORL 5A16A 4NRXB 4I3SH 4YZFF 1HSAA 1GZQB 1CT8B 1Q0YH 2AQ3A 4PV8A 5IW6B 4G42A 3O4LD 1LO4H 4LPVA 4FRWA 1IGJB 1K5NA 3GM8A 3VFOB 3OJVC 1IMHC 4HK0A 4ENED 3SDDD 5GS0D 1TJIL 1A7OH 1CDJA 3HLAA 3QHFH 1GJIA 2VLKE 4H8WC 2VDRL 4K94L 1RIVH 4WI4A 4X5WA 5C70A 4FQCH 1VFBB 2VLJD 1TVHB 2XQYK 43CAA 5F7EH 4EQ3A 5EB9A 3HI5L 1F6AB 2FL5A 4OIBA 3TBTA 1J0HA 1YMMB 4K2UL 4XNZB 3ARRA 3STLA 2EH8H 4POZD 2WIMA 1S7SA 2A6IA 2BMKB 4EBQH 2P7TA 4ELKA 3WIHA 5T3ZH 2WWKT 1HDMA 4WW2F 1CICB 4F57L 1BM3L 5DQDH 1ZOXA 2VE6A 2BY0A 3CVIL 1FFNA 4U2ZA 3ARGD 2IPUK 3V4VH 4JGUA 5C0GA 2EDRA 4JAMB 3TBWB 2AP2A 3IGAA 3VFWB 3PWJA 5M7QA 3EO9H 1PG7X 3B5HA 3P30H 5TJWK 3PL6D 2EDOA 5IVXF 3NCJL 4PFEA 3BHBB 1OPGL 4ZFGL 4QHNA 2BNUA 3DGGB 5EOCL 5INDB 2QBWA 2VR9A 2Y23A 1ZT1B 5IF0B 2GQHA 1GC1L 3RWEA 4U6VH 2I27N 4R8WL 2Y72A 2UZIH 2ICEA 4OLXL 1HCVA 4APQD 3O2VL 2NZ9C 1BJMA 1QO3A 3BQUC 5EG6C 3CC5A 4OFPA 1S9WB 4NN7B 4RGOH 1S9WA 1L7TL 2P45B 1OP3K 1UGNA 4DGYH 5I0ZA 3E6FA 1KNOA 3QG7H 5KVDH 1P7KB 3OB0H 5DHXB 3DURB 1VGEL 3CFKB 2DICA 3QFJA 2EYRB 2GJZB 1CIDA 2X6MA 2C7UB 3RY6C 3L3GB 1DQDH 4TVSa 2A74A 3G9VA 1VB9A 3LS5H 5EA0L 4NPYB 4QHNB 1U3HC 5A3IC 3CDFA 1FRGH 3NH7H 4PJGF 4QY8B 4L4TB 3QUXD 1WVZA 3M17A 1EGJH 3LQZA 2AGJL 3S88H 3I02A 2R2HA 1RFDH 1MLCA 2WQ8A 4HKBB 5E1HB 3D2UB 5TQ0L 1U6AL 3CC5B 2WWMC 1HH9B 4JKPL 1E6OH 3U4EA 5ISZE 3FKUS 3VI4F 1HZHL 3C5ZA 3PXHA 2YPLB 5C0JA 4NM4L 5C0JB 1XGUB 3SGJA 3FTGA 4R4FL 3UP1A 1LEGB 3FO2B 4Z7NF 4G9FA 4PJHA 4NN5C 2H32A 2NMSA 3ULUF 5DJ0B 1U3HD 3P4NA 5A3ID 1EMTH 4LSUH 3RVVD 1ETZA 3ULUE 3ARYA 3V5DB 1KBGH 3MC0A 2GEEA 1K2DB 4PY8J 4ZS6D 5CILH 1RUKL 4FOMA 2HT3C 1I8IB 2B39A 5DJXB 4G42B 2D4DA 1BOGB 2ZCLL 1HILB 4PGCA 1QRNB 4XAWH 4OCYH 2RQ8A 4XVSL 2WNGA 2Z31A 3CUPB 3GJEB 1MREL 5KBNC 1NBZB 4Q0XH 4R9HA 3FRPG 4QHLB 4Q97A 3E8UL 1VGEH 4P23D 3RVWD 4DZ8A 1NFKA 4GAGL 1VFBA 2ENSA 1ZLUK 3IKCB 1DL7H 1FZKB 5GISL 1WZKA 2ERJB 5I30L 3Q6GL 4XXCC 3TPUB 4PUBL 1A64A 1NUNB 3DYMA 3U2SB 3K80A 4ZFZA 3X11A 2L7UA 4KV5F 2ARWA 2VL4A 5SWSD 4U6TA 2VDKL 1N8ZB 2JJTA 4G8GD 1G7QA 5CZXC 4JRYE 3TT1H 3JV5A 4OLXH 3LPFA 4WFHD 1CT8A 5K9KA 4R8WH 1N0LA 2RJMA 4LF3B 3AXLB 1U6AH 3AVEA 4U6YA 4NHUB 4U49A 1INEL 1JWMA 3GZKA 4L8DA 1ES0B 4TQEH 5C6WH 1BVZA 1WITA 1AXTL 2AK4E 3EOAB 5J12B 2IG2H 4KK6D 5EUOF 1IM9A 5JQHC 1Y6MR 2VDLH 5IR1A 5IHUL 4DW2L 1IGTA 3FHQA 1VEMA 2B1HH 4M1GH 1NFDE 2AJVH 4O4YL 4LOUD 5E8PA 1U3HA 4ESKA 4X4YA 3HUJE 3LQMA 4LMQI 5ALBH 3PL6C 3SEPA 3NA4A 4PJHF 4NNXA 3WFEL 4K9EL 1OT2A 4KQ4H 1AGFA 4AM0B 1CVSC 3JWNC 4WO4D 5HPOA 1T89C 4JDTL 5DQJB 3VWJD 5AUMA 1IM9B 4N0RA 3ISWA 1TTUA 2HTKC 2M1KA 1QSFD 3KDMA 5DGRA 3F58L 5FYKD 3GI8L 3MACH 1ZXQA 3I84A 4KZDH 5CWSA 3VRJB 1GCFA 5T1DH 3ARGA 4YPGA 3S4SG 1KIRB 3MODH 1FNGA 1W72B 3QUZB 5E4EC 3ARFD 5E94A 2YRLA 1PKOA 4CL7A 4J4PD 1CICD 2BXYA 4XVJL 1IQWL 3BUTA 3QEQD 4KJQC 2SEBA 4Y1AE 5J9PB 4ZTPH 4FZEL 2B20A 2NYYD 2XOTA 1M71A 3X3GL 1HSBB 1G6VK 2DOCA 1ZLVH 3IDUA 1DQJA 2YC1A 3BJ91 2G60L 2J8HA 1B3JA 3V2AR 3G08A 1J8HE 3L95A 4QGYA 2GT9B 4A2MA 4HUXA 3PQYE 1R5IA 1RJLB 2DI9A 3SQOH 5JOEA 5J1TC 4LVOB 2A9MH 1RQ5A 4LCCA 2QQKL 5HGDA 4IOIA 5KZCB 3SDDA 1SJHB 3MGTB 3TESA 3RDTC 3MGTA 5D1XC 4JR9L 4KMTL 1ZANH 5DR5H 1BFTA 5IEHA 5EOTB 4KFZC 3HR6A 2YBRB 4WV1C 3LKPB 1N59B 4LCWD 5GRUH 3KG5A 5C6TL 3QDMB 1FC1A 3HNTH 2DM3A 2V2XA 4JM2C 4PP2A 2E7HA 1HI6B 4UOJA 3SDYH 4WW1B 5F97E 4MNQB 5IJKC 3L1OH 3C5SA 1KTDA 5HHOD 3FO2A 3GNML 1JGDA 4QF1A 1BF2A 1RFDL 4FQ1L 3B6SB 5FKPB 3S88L 3GDBA 1II4E 2DI8A 4B0MM 4LQ1A 4YC2C 5GGTL 1R3JB 3D39E 1JL8A 4ZQKA 5DHVA 1A7PL 1WT5A 3HZMB 1J1OH 3WNPA 4UT6H 3NGBB 4WWKD 4LLWA 5SWSE 2XTJC 1QLEL 1NLBH 3CMGA 2R2EB 5FECA 3LKSB 3IU4H 3QO1B 4JZNA 4IRZL 5DMIL 3RI5F 3ULSB 5BVJA 2VXVL 2J88L 4M3JA 4JFPA 4X7DC 2ZPKH 3UZQA 4PJXF 4X7SL 3ARED 5T1LD 3WO4C 1UB6B 5DK0A 4MJ5A 4EN3B 2ZUQC 5C08D 4ZTOH 2OK0H 3TZVD 4PBVC 4TVPH 5E6ID 4M7KH 3DV6A 3S37L 3ZHKA 2OR9L 4HQQL 1FLRH 3GSXB 2IPTH 3HE6C 3TBVA 2DD8L 4LLUB 3V6OC 4BH8B 4MJ4A 1N2RB 2DIBA 4MAYB 2MWCA 1CCZA 2APFA 3P77B 3Q6FA 5KJRL 4NHUA 4P46B 2WUCL 3PDGA 2MQ0A 1EFXD 5FDWB 3C60C 1QLFB 2XI9A 3HUJB 4XRCA 1OP3H 3SDCC 5E2WH 3ZE0E 1VDGA 1W0WB 4JEGB 4XHJC 5HYQA 2HFFA 4Y4FB 3TA3C 4P59L 5EZLB 1JMZA 2NY0C 2VE6B 4WHTA 4XCYB 3LH2H 3TO4C 4V1DD 4PJDF 3JV6B 1PVHA 3D2UA 4IIQA 4G6FD 4U3CA 4A6YL 2ADFH 4QRUA 2I9TA 5DRWA 1FGNH 4PYGA 2VSCA 4HT1L 3TVMD 2JELH 1BOYA 3G5VA 1S7UB 5DJCB 4LLAA 4XNXH 2ICWB 3CZFB 3V5HA 1CE6B 4KK9C 4HS3B 3U7WH 4UTBH 2XG5A 3KPMA 3QWOB 5IW1A 4L9LC 5EPMB 1GGIL 3VWKD 3FT2A 2FGWL 4Z7VB 5CEZE 4PJBB 4Z5RA 5MEQB 3ZDZF 4TRPL 2WBJA 5F1IB 4WW2A 4KU1A 2C1PA 4FQ2H 3CNKA 3WUWG 4HUKB 4UT9H 1G1YA 4XHQA 1BZ9B 5T3XL 3O45B 1CFVL 1NAKL 3Q1SL 3Q3GB 3I75A 1LEGA 1H3PL 5I73C 2Z35A 1DN2A 2YPLA 4JPVH 3VXPB 1I1YA 1QVOA 3VWJB 3OMZA 4JG1L 2HFGL 4XTRC 3RWFA 5L6YL 1YY8A 1J11A 2DBLL 3KS0H 3QO1A 1F11B 3PGFH 1PLGL 5IVNA 4PRBA 3RIAK 1FNSH 3T0ED 3I02B 3LQZB 1KPVA 4JHZA 1OGAE 5HHNB 4M1CD 1BEYH 4XAWL 3TYGH 1WEJH 4LRIA 4P3CH 4U1JA 2B0SH 1TVDA 1BREA 3T65B 4NZJA 2A73B 1ONQB 1W8NA 4RAUA 2A74B 2VDOL 1DLFH 1T3FB 1X9QA 4LAQL 1BQLL 3MLSH 3FQUA 1RUKH 4XBGA 3FTGB 1G7LA 2DQIH 4NFDA 4Q9CA 5DYOB 5DWUH 2OQJA 3GSOB 4HLZG 5ICZB 4BH8A 2BNRD 1A3RL 1EH9A 5IK3B 5C2BH 5KSVB 5IIEA 4JDVA 3CVHL 3GHBH 1MLCB 1QKZH 1LE5B 5J1SC 5ID0A 5DUPH 4FQPA 1KB5A 5IWLA 1A6TA 1MI5B 1WCBB 4H8WH 5ID1A 4GG6E 1TJGL 3DBXA 4X6BB 3RVUC 4PJCE 3RL1A 1CE1H 1Z9SA 2NXZC 1XEDA 5D7KE 3S34L 4DGVL 4JFDA 3QDMD 4MQ7A 4QYOA 1G7IB 4ZUSA 3HMWL 1NMCB 5CJBA 3TN0B 4B53A 1UJTA 5HJ3A 3A0OA 2PKDA 2W0PA 3CVHH 4NO5B 4O51B 2DAVA 4B5EA 4AQOA 3JV4B 1UCTA 1ULVA 1JTPA 2VZ1A 2J4WL 2IH1B 5HDLA 3UTQB 1G7HA 4W70A 3MBXH 1YNKH 5F89B 3QQ4B 1HXMA 4EXKA 2XWJB 1U8QB 4GAFB 2BFVL 4MXQC 4R96A 5I71C 2HN7A 4XMLH 2VITB 4LSUL 1UKSA 2NQCA 1VADA 5FKAB 4J3SA 5C0CB 1GGIH 5HVFB 4IRJA 2F58H 2HMID 3NOIA 3M8OH 4NKOB 4CAGA 3N50A 4G8FA 4WFFD 3L5WA 1FH5L 4W68A 3REWA 2W9DH 4P9MH 4XX1G 3WKML 3QQ9D 2XY2A 1KUMA 4HJJH 3FT4A 1DQML 4FQHA 1EHLH 2YSSA 1PLGH 4YBQD 5TQ0H 1KT2B 4LARH 5FIEA 1AO7D 3AM8C 3OAYH 5CGMA 4RGNB 4CVZA 4UB0H 1ZS8B 5C08B 5A2JH 1S7SB 2A6IB 3BEWB 4LF3A 1S9XA 3PDOA 5ICYB 4J12A 1KIQA 1J8HA 1DVFA 4ISVB 2AJZB 4UT9L 3O6LL 1U8PA 2RFXA 4I18C 3EJZC 4U2YA 4AG4H 4GG8A 1IEAB 3HKFA 4GKOA 5CZXD 1YECH 3PUCA 3LKSA 1IGTB 4MAYD 3D25B 1DEEA 3ZHDA 3KPSD 2FJFB 4P46D 5F8QC 3CFDB 3PNWA 3UJTL 2F53E 1JZ8A 2BJMH 3U7WL 4BKLA 3CMOH 1DE4A 5CHNB 3NACH 4XCCL 5EU4B 3TGXA 4PB0H 3GIZL 3O2VH 1TZHB 4PJ5E 5E1AA 5A16B 3MUZ1 4ALAL 4Z7OE 1EUTA 2BVPB 1OSPH 4NQCB 3WBDA 5ECJE 4KROB 1MJ7H 3D85A 3IFOA 3NABH 4KXZI 1P9MA 3RUGF 2EDKA 5MEND 4A6YH 3CPLA 1ZGLP 5I1GL 4M93B 4OM1H 2CGRH 1BQSA 2ATKB 5GRWA 3UXFA 1H3WM 3WFBL 5KW9L 1A4JA 4M7LT 1HINH 3BXNA 3RPIB 5D1ZA 1TETL 2NY1C 1JFQH 3VFUB 1P69B 1KJVA 1GPOH 1GAFH 4X4XB 5M94B 3DX6A 1IKNC 4GXUN 4HG4J 1DQQB 1GVIA 3FRUB 4N0UA 4HJJL 4OCLC 2I5YL 1PYWB 4ERSH 1UWEH 4G3YH 3DYOA 3VFVA 3UDWA 2NY2C 4YGVA 1U8LB 1JPGB 1H15B 3MOBH 1LD9A 4X6EA 1MUJB 4FG6C 3BPOB 3D6GA 2C3VA 1KIPA 3I2CH 4HAGA 4KDTC 4PJIE 3PIQA 4HIEB 1A4JB 1C7SA 3BN9C 4UBDD 5CILL 1AH1A 3BP6B 3QQ3A 4PLNC 3BWAA 1YNKL 4PJ7F 1X6LA 4M8QA 4HQQH 1SEQL 1MHEA 1QD0A 3W5NA 1R5VB 3BKCH 3L3KB 3V79C 4S10A 1R3KB 1N64H 3OF6A 3RWGA 4WENB 4G8EB 3PL6B 1MCOL 2OR8A 2X4PB 4XPBH 3BDYH 2NXYC 1SM3L 2X09A 4EIGB 3VXUE 3WJJA 4BKLB 4KHTL 3O6FD 4NO0B 1V3JA 5LWYL 1HIMH 5FGBA 5L9DH 1MIEH 4IMKA 3QNYB 3RTQD 3LZFH 3IU4L 4O5LH 4JY5H 4YAQA 1U3JA 1IRAY 2CK0L 2NZIA 3GGWA 2CDGA 3G6JF 3QXDA 3BD4A 4KI5D 5F7NC 3IDYC 5I8OL 1KJ3H 3QG6B 3IFNH 4HUUA 3DVIA 4XVSH 2DM2A 2ITDB 2BOCA 1YYML 3MRCA 3NPZB 1HEZA 2UWEF 3GRWH 1PZUB 5ICZA 3OJMB 3WIHH 2R56H 3D0VB 4JFHE 3O8XB 4F7TB 3VI4E 1KJ3L 4QWWD 3TIDB 1LO2L 4HPYL 5DJ6A 1ITCA 1NGZA 2BVOA 3GO1H 4DUWA 3RI5K 1DJSA 4JPWH 4JFOA 1CIUA 3QWOA 3KPMB 1BFSA 3ZT7A 4PTTA 3LZFL 3LN4A 4H8WL 2B4CH 1KB5B 5IKCA 3U6RA 1XGYH 3VG9B 3VRLE 1BBJB 4L3ED 2B1AH 1A7NH 3WO3B 5HVHB 3MRDB 2YK1L 3TEUA 3G6DH 1QKZL 1TJHH 4YGAB 4JY6B 4XPAL 3CGTA 4TOYH 5AD0A 3WE6A 1NCBH 2EC9T 1FNAA 1I85C 4XCYA 1H5BC 4IRSB 5HHQA 4PLJD 4Y16C 2VIRB 3X12B 4I2XE 5EO1A 4JPWL 1KB5L 5E00A 1MFAH 2X4RB 5EULV 3UYOD 3DO3A 4HJGA 1XGQB 5D6DA 3SQBA 4YXLL 1YNLH 2EIBA 2VH5L 2VDML 2EDFA 1BX2B 3MRLA 4NKMB 2ZOKA 4HPOL 5BV7C 3GBNH 4R97C 3RX7A 1NMBH 2X9YA 4NN5B 1RUML 1J10A 4OLYH 4UNTA 1U8MB 1BLNA 1JHKL 2J6EA 3PWLB 4GKNA 1GC1C 5GJSH 4G7VL 4PRIE 5DZNA 3VXRB 1LEIB 1EDQA 2P8LA 1S7UA 4XP1H 1B6UA 1I1RA 3K4DA 2XTLA 4NQCE 1UJ3B 5D9SB 1OGAA 4MJ5B 3C9NB 3MA7B 3ROOB 4C83B 3RWJB 4QCIA 4MA1C 1ERNA 4HW6A 4OF7A 5JZ7C 1JJUA 5ADPH 2WBJB 1KB9J 5EN2A 1Y6KR 4QHMB 2XQBH 3QISA 3DRQA 2W07A 5EIIA 3N1PC 1CBVL 3ZKXC 4RAUB 4Z0XA 2CLZA 3HZVA 2XRAH 4G8GB 5ADOH 1MFDL 3DTXB 1PEZA 1NGPL 4U1JB 2F74B 5T5NG 3IFPA 1MH5B 4PJ7A 1RK0A 4XP6H 4HXAL 1HQRA 3QJFA 5A40E 4PRAB 2BVTA 2FWOA 2W0KA 3BQUB 2AVGA 4J3WA 4MGXA 3T04D 4LHJB 4PJCA 3ARZA 1CGWA 3JVGA 1WC7B 2R15A 4X7TB 1GXEA 3JUZA 4MNGA 1AE6H 4QCIB 4Y19B 4HK3J 4HUVB 3BH8A 5I75B 1P4LB 4ODHH 4H88L 4NKIL 5JPMA 1P1ZA 3EFFB 5CEXB 4YR6B 5I1GH 3NA9L 3I75B 1FFQA 1DSFL 1NEZG 2J7LA 4XB8A 3LKNA 1IC1A 3BPLC 3PQYB 4AIZB 1OP5H 4ALAH 3CDYA 1G6RL 2AEPH 4P2OA 5B4MC 1MRDL 1CF8H 3EZ8A 5AYUL 3Q5YA 2YMXL 5DQ9B 3OXRB 1S5IL 2NXZD 3R4DA 3RZCC 4X83A 4I0PB 1DQTA 2VISB 3RVUD 3X14B 1A2YA 3GMPA 2GSIA 1I7ZB 3IJHB 3ILPA 3BP5B 5JO5A 4JQXA 3RWHA 5CJOH 1X4ZA 2VABA 3DO7A 1Y0LB 2A6JA 3OJ2C 1R5WA 4KK5D 1IGIH 5LVEA 5BO1L 1P1ZB 4PJDB 4X99B 2NTFA 1YUHB 5IB3B 1NGYA 4MQTB 3F65A 1E4JA 3H9SD 5FYKL 2DL9A 1CR9L 4U1NA 4F37K 3FL7A 4LSVL 4QGTA 3OGCB 4LLYB 5FGCE 4M6OH 3CH1B 4JKMA 1ZGLA 1ZEAL 4DKFL 5IHLB 1T21B 1PZ5B 3QG7L 2Y25A 2EEAA 5D7LD 3UYPA 4IDJL 3TJEL 2AABL 2BCKB 4LEXH 3QPXL 4KMQA 4YBLC 1OW0C 4G6KH 1GYAA 1XAUA 5KZCD 2DQJL 3RTQB 4YQXH 5I1DB 5DRXA 4KK6C 1CFQA 4I0KA 4J7RA 1N3NA 4X98A 4ZMAT 3EOTH 4ZUTA 3L5XL 5HHOE 1ZV5A 4RIRA 4OFIA 1D5BA 4KJYA 4ETQB 4OKDA 4ZOEA 2BY3A 3VFGH 4AK1A 4ZAKB 1KEGL 4PJ5A 4JZJC 1UWXH 2Y07L 5KSBE 2FZ3B 4MNQD 4IBLT 5DK0B 2ICCA 2VAJA 1YYMH 4IIQC 5C0BA 3VDBA 4K9EC 1RI8A 3OXSA 1N5AA 1WTLA 4LCCC 2BOBB 5DUBA 4LMQE 3QAZC 4ZOAA 4R90H 5F3HA 5D5ME 5IVOA 2CUHA 1K8IA 5BRZA 3GI9H 1WZMA 1CD0A 1RUQH 1CDIA 1WLHA 2PW2A 3SKMB 4U6YB 3VFPB 1U58A 4NOBA 4H20L 2GAZA 4L3EB 4PGBB 1C12B 3B9VA 2XRAL 4RFNB 3B3IA 3KPOB 1A9BA 4KZEH 1D9KA 3VDAA 3H3PL 4N0UE 1H3PH 1DUZB 3T4YA 2AJ3A 3DXAA 2AXGB 5L8KB 3GJFH 5H37H 3I6LE 5B21A 1P84K 1DEEB 3D25A 4OIIH 5HDBF 4ZSOA 2V17H 1YJDC 1DANT 5FDYA 2CKBL 4FQJH 3MZGB 3INUL 1H15A 1CGTA 2OI9B 1CL7I 4NJAL 2AK4B 4AJ0A 4B7IA 4QRPD 4UILH 1PQZB 1DVFB 5AG9A 1CD1B 1FIGH 1FNFA 3QFDA 3H9HB 2BHUA 3QEUA 2B2XH 2EXYC 3MRPB 1NCUA 3B5GA 2VERN 5GS1C 1U95B 2D7NA 1KJMA 4XNQB 4IMLA 2V2XB 1ZA6A 3CD4A 5E6IB 3LY6A 2OSLB 3GI8H 1OAUH 3ELAT 2X4UB 3VXUA 1X5HA 3O6FC 5L7XL 2R29H 4JG0L 3VGBA 2NXYD 3ZYOA 2A9NH 3ZE2F 1MWAH 3KHQA 4JG1H 1KGCE 1AKJB 3O8XA 4UOW0 2JIXD 5E1AB 4OGYL 3BGFC 1SQ2N 5HGGS 2WANA 3EW3B 3TBYA 1G0XA 1CTOA 4APQC 5HXMA 1BZ7B 2E7LC 4GRLD 4NQED 1A3LH 2H2SD 4HS6A 1IAKB 2F15A 4PJIF 4O9HL 4DTGH 4HZLB 3P9LB 2WBJD 3VRIB 5F7FA 2UY6A 1XZ0B 2EDNA 4QRTB 2LAAA 2XNAA 5IROC 3WLBB 2BDNH 1J18A 1OGTB 4JB9H 1RULL 5E2TL 2Q1EA 4V1DB 1A7NL 1G1CA 1RK1B 2C3WA 3QB7C 4QTHB 2QQNH 3VI3E 5M95B 2Y7QA 5IWLC 5HGBA 1IAIH 4Z77B 1MOEA 5IBUG 3R8QA 5I15L 2X4PA 2YZ8A 5JMOC 1MVUB 3TVMB 2YHGA 3TVMA 3BD3A 4OCXL 4OLUL 4W4OC 2AV7B 3KHOA 5I9QC 3ZTNL 4YHYC 3SDCA 1UXSA 3OKLB 4LHQB 3UTTB 3Q5TA 5H2BB 4HT1H 3BQUD 4KDTA 2DWEB 1ZHBA 5IJVB 1S9VA 5F44A 4LP4A 4P49A 3HAEH 2ZKHL 2YK1H 9CGTA 3FN0H 4JKLA 32C2B 3O3EB 2C3HA 5HHVL 4OM0H 4DN3L 1JWSA 3GSNL 2OTPA 4CADA 4EDXA 1FL3A 4K3JL 3BZEA 2F8OA 3VXSA 3T08A 4G9FB 4PJHB 4LSSL 5IK3A 2F8VA 2EDHA 4DVRL 1MCHA 4XT1C 5JHLL 4JFXB 5E8EA 4CUCA 2YN3A 3T77A 1R3LA 3BIBX 3ULVE 5F89A 1FFPB 4OCYL 3VGHA 4U1KB 4RGMC 4TYUA 2X4SB 2ATKA 1N6VA 1L0QA 2O5ZH 1FL6B 1SYSA 2H2SC 2VLLB 1P7HL 1T1YA 2PXYB 5CZKA 5DD5L 1U58B 3N1MC 1U2HA 3LEXB 4GLRH 3FHAA 4JFDB 2VDOH 5DJ0A 3GSVB 1E4WH 2PUQT 2YD2A 1VPOL 2ITCB 5I19L 4NUJB 4UTAH 2GHWB 2DLTA 4UV4H 4JB9L 4XWOD 1CLZH 2ZSVB 3MMEA 1BPVA 2CIKB 3I3DA 2GI7A 4G7YL 4Y2OA 2Z91B 5KS9B 2VXVH 3QHTC 4P4RA 5DVLA 2R0LH 3K7UA 4HIIB 3PHOB 1QBAA 1F3DH 4Z78A 4Y2DA 1WFOA 4Y2DB 5JO5B 4Y5YB 3ZKMD 4KI5E 2X4TB 3FFCE 1I8MA 4L4VA 1NBZA 1CFQB 4WNQA 2ILLA 3EHBC 5TDNA 5GSRA 2ADJA 5MHSD 4WI7A 3KYMA 3KYMB 4HXAH 5H94B 5GZOD 4KDWA 2Y9RT 2AEIT 3U48A 1EV2E 5TF0A 3ZTNH 2YSSB 2MQ3A 3MLUL 4ZYKB 3QIBD 1XH3A 2NX5B 4NM8L 3MLWH 5D7JC 4UIMB 2FEDC 2J5LC 1QP1A 2XN9D 4E41D 4OQTL 3OSKA 2X4TA 4HFUL 4QXWA 3VXMD 2Y1VA 3UPCA 2QQNL 1HOCB 3CSGA 3FAXA 3QDHA 4D0CA 3NIGE 4RBPK 3PHOA 3VD5A 3BPNB 5DJDB 3O3AA 2CKBH 4FQJL 2HN7B 5TGBB 1C5DA 1UZ6E 2I9LB 2VZTA 3WS3A 3MRMB 5IQ7L 4Z7WE 5KS9F 1SBBA 3DGGA 1J86A 3VFRA 1KSRA 3G9AB 4Z7UB 4ZOCA 5IMKA 1UYWL 5J1AB 4WWKC 2A83B 4XMPH 4XVUD 5JNYB 4ZYKA 3QUMH 4Z7WB 2V9QA 3CFCL 3C2AH 3AAZB 4TSAH 3OXRA 4XNMB 1K5NB 1BZQK 4TUKL 4RDQG 4ELMF 2VL5A 5DEGB 3GMLB 2AK4D 2EDLA 4LRIC 2QR0A 1I7UA 3CFKA 3NTCL 2EDWA 3RPKA 4Y7MA 4NC0B 4TPRL 4EKXA 1Y0LA 2A6JB 4K3DL 4D0BB 1TVBB 2B8OT 4XBPB 4HUUB 3F7PC 5F7EL 1FL3B 4LPCA 4X5WB 1W72L 3D69A 4OLZL 5DD5H 1IKFH 4PLKC 2IFFL 1W0YT 2E7MA 1S3KH 1YDPB 5AG8A 5DVOA 2XA8L 4QNPF 1GZPB 4JFFD 3GSUA 5GS0L 4HS8L 4LCIH 1KPUB 5IHZA 3VW3L 2F54B 4EI5B 3H3PH 1OAXH 4NQEB 5CMAB 4H1LA 3EGSB 3S37X 1J0ZA 1AGEB 4NQDE 4ONFL 3G5VB 2AKRB 2B4CC 4O2FA 3DX9B 3SE4A 4OB5H 2RBLA 4UIKH 4KROD 4M8QB 1GGYA 1I8KB 4P4KD 4HULB 5FGRA 1IM3B 4MCYB 4N1EA 3DVGA 1M6OA 2DTMH 3GRWL 3C5SB 3NZ8B 5JORB 5GZND 1FFPA 1V3KA 4MDIA 5E0QA 1D5MA 3UMTA 3HRZA 5F21B 4RFOH 3OHXA 3SJVA 2OTWA 1KTLB 5I18H 5IMMA 3ARFC 3U6RB 4DGVH 3OKKB 3P0VH 1OHQA 3EYOB 4G6JL 4MSWB 5ITFA 1UKTA 2IAMC 5FYLH 3DMMA 3ZHLA 1FPTH 5J89A 1Z0NA 2BC4A 1F42A 2DQFB 3PHQB 3HLAB 4OGXL 2R2BB 5LXGH 1G9NC 2Y36H 2VLME 4MJIB 4PJBF 3SDXF 4LNRA 4BSJA 2CRMA 2NY4D 5IBLD 4AMKL 5I1JH 3MREB 1R5IB 3ECBA 2D0HA 1S7TB 4C56A 3KXFA 4XXDA 4JQXC 2MHAA 3OKMA 4K3JH 5EO1B 3ARBA 3MLSL 1PQZA 1WICA 2APWA 4RZCA 1J1OL 4EZMA 3RAJH 4LPTA 4MB5A 2OL3H 2VLRB 5AZEL 4YDLC 4HBCH 4Z7QE 5E5MB 4E42B 4F37F 3MYJB 2AK1L 5FECB 1LDSA 4JANB 2PXYD 3P9LA 3HAEG 4WW1A 3VGAB 2VXQL 4ZAKA 2COQA 5ANMA 3DXAB 1U8JA 2WP3O 5FUCC 1BFOB 1KYOJ 1S78C 5BXFA 1D5XA 1LO3L 1L7TH 2VN4A 3ZDYE 4P5MA 5BRZB 1J9CT 3T1WA 1OAQL 4A6YB 1IT9H 1DFBL 3QT2A 4MD5A 3WL9B 2QEJA 1Z5LA 4DGIL 4UV7L 1KJMB 5D6CA 5GGSY 2IANB 5LCVH 5BVPL 1T21A 2P5EE 3REWB 2M26A 4U3XA 5C08E 5IB4B 1LMKA 1UM6H 4MCZA 4PG2C 4U6XB 4XC3L 3JSSA 5EZOL 4NO2A 5EC2B 5GJSL 3CSYB 3FQWA 4QRRA 2W0LA 8CGTA 4BSVA 1U8QA 4X8JA 3R8BB 4ERSL 4D94A 3GMQA 1XR9B 4EIZC 4RA0C 2BVPA 4NQCA 2MCPL 2X1WL 1U93A 5BQ7B 1MLBA 2VDLL 1EIBA 5C09E 2UV3A 5HDQL 3SDAB 2VZ3A 3AMKA 5FYJH 1I3RA 3VFGL 4UQ3A 4AYFA 2AEQL 5DO2C 1MCLA 2IPUG 4PGJA 1INEH 1C5BL 1RJYB 2AAVA 3LVEA 1KFAH 1GOHA 2Z8RA 1G9NH 1KLGA 1I8LC 1S9YA 5KSAB 2O26U 4PGDA 3BT2L 1T0NA 4Z0BL 1LWRA 1KTDB 4R3SB 5EOCH 4G43B 3SKNA 5ICYA 4PJ7E 1BVKA 4JJ5A 1CL7H 2YR3A 2OYPA 4GSDL 3H3KA 1EPFA 4NDMA 3TT3H 1RMFH 3GMLA 4BUHA 1TDQA 1FNEB 5HI4D 1KCKA 1NCAL 2J8UB 2J4WH 1JMXA 2NY5L 3MJ8B 4TVPL 5EOTA 3L3JA 5CAYB 3KYOA 1GIGH 3OR7B 4YHNB 5JZ7D 4FNLH 2DQEH 4XAKE 4P2OB 5HGDB 4CU8A 5D96B 5DMKB 2QHRL 3L5WB 2ICWJ 2F74A 5LGHH 5IVXA 3JBG7 2BERA 4Z7UA 3BAEH 5J3HC 1GIGL 4RAVB 3BEVB 4NZUH 1KPVB 4W6WB 2DLEA 4NKDB 1KCSL 3NFPB 2E5EA 4RA3A 3W11C 3GSUB 4XPGH 5CCKH 3SHSA 1WK0A 2VLKB 3PABA 2FBOJ 5HHPA 1F4HA 5C3LD 2NW3B 4N0CC 4KRNA 5DGQA 3JUYA 4JZJA 4FZ8H 4ONFH 5DZLA 1GSMA 2OZ4A 2LTQB 4X7TA 3VG0H 4AENB 4ZG1A 5LWYH 3RNQB 1Z2KA 3QUMB 3WEXB 2FIKA 2VRAA 4G6KL 2LQRA 1YUHA 2HFEA 1LP9B 1ND0B 2R4RH 5E2UL 1YPZE 1G6RH 1FL5B 2X4NA 4PGBA 5I6XC 3CUPA 1P4IL 3GJEA 1G7IA 5JHLH 4FQ1H 3UYRL 4PRHE 4P4KB 1KFAL 4JM2A 5D4QA 4NBXB 4LCWA 1KT2A 4GRWB 2QQKH 1CD8A 3S4SA 1PEWA 5ENWB 3B2VH 5GRYA 4ZFZB 5CP3H 3MGAA 1JGVH 1P7KA 4FTVA 4BSWB 5JUEH 3V6OE 4NQDD 4QO1A 5J6GA 1JI2A 2JJSA 2BY1A 3MA9L 1I9IH 3J8F7 3ZMRA 4LRNL 3O0RL 2BVQB 3EO0A 3U4AA 1M05A 4OT1H 1A6WL 2XACC 3QDJB 1N3NB 5GRJL 4HK3N 5L6YH 3W39A 3K3QA 3N1QC 4XP9H 4XVJH 2GSGB 3GSOA 1KPRB 3HRZB 4OFYD 1JGUH 1LEIA 4MJID 2EH7H 5BMFH 3RKPA 1IFHL 5CIPH 1T5WA 4JY4B 1M6OB 5L8JB 1VENA 2EDDA 2BCKA 1DQLH 3AAZA 4LHUD 3BDYL 4Y4FA 3EJYD 2LV4A 3WKNA 1PBYA 2IANE 3KVQA 5ESVA 3SO3B 4DFHA 1VGKA 3H3BC 1O7VA 4R4BB 5FUOL 1OF2A 1FFNB 4AQ1B 3GJFK 5D7KD 4FFYH 1F4XL 5EBWA 2VLRD 3FONB 4Z7OF 4JREB 3ZDZE 3K2UL 1QR4A 4BFIA 4HIHA 4PRDA 4N8PA 5BRZE 3VWJA 4NRYA 5T1DL 1K6QL 5J0BA 4JFXA 5I1KL 4RFOL 1MRFH 3JTTB 2A9NL 4RRPA 1WWWX 1MCWW 4JRXE 5KVGH 1ZAGA 1F6AA 2Z0BA 3E2HC 3CVIH 1YEFL 3A67L 3B2UD 4F9PA 3DXAE 4NC1E 4XXCA 3DHJA 1T6VN 4P48A 1QO3B 2HJKA 4OCWH 1ZVSB 2JIXA 4ZAKD 3N9GH 4WW2B 1N4XL 2YEZB 4PRPA 2Z31B 4UQ2A 3WFHA 1BIHA 1KLFA 3SDXA 1S9VB 4K23H 4U1LA 4ZS7H 3DX8B 1BLNB 1REIA 2ED9A 2A6KB 5I74B 4KY1L 4R2GC 1EAPB 1MCCA 2EYRA 4DAGL 3LEVH 1CDCA 3D85D 3SJVE 3AREC 3CZJA 2IAND 3TT1L 1OTUC 4BK5A 1EFQA 1S7QB 2ITDA 4DW2H 2PETA 5LBSH 1EHXA 3NACL 4XCCH 5CKAA 4GLRI 3CSPA 2Z8SA 5LAXA 2ZSWB 3MV11 3RBSA 5I8KH 4IRJD 5C0EA 3ME0A 4GS7B 2B7DT 4ZFFA 3H7BB 1UT9A 4M5ZL 3ZT6A 1U8IB 3I50L 4X7EC 4CGTA 1F4YH 5CP7B 3V4VL 3FZUD 5TE4L 5EU3B 3IFPB 2A73A 4XH2A 2FL5B 1EXUA 2VLJB 1A9EB 4C56E 2VZUA 1DVFD 4ETYA 5HI3D 5DMKA 3KXFE 4XNUL 5J6GB 2GY5A 3NBNA 3KR3L 4MJ6B 5JUEL 5AZEH 5DD6A 4YXLH 3NCFB 2DQGL 6CGTA 4LVHC 1PG7W 5E70A 4I2XB 2DMCA 4PJCF 1ZSDB 3IFLL 4PJBA 1D6EA 3B9KC 3LV3A 5D5MB 3VFTA 1NLBL 1XF2A 4YDVA 3S35X 5LGKA 3GMMB 2YD5A 4LBEA 3OKLA 1EHLL 1UXSB 2O61A 5IQ7H 3ZE0F 3ARGC 1XF3B 2HWZL 3AU1B 4YDKH 3ULVL 5I1JL 4U7MA 3MNWA 2W0FA 4P9HH 2AXJA 1LP9A 4YNYB 4M6NH 4HHAA 4GRLB 2XA8H 5GS1A 1T22B 3QXDB 4G8GE 4GBXB 4JFPB 4DJMA 4EVNA 5D1ZB 3ARDD 4GJTB 3OR6B 3V52L 3SE8H 2UUDH 2OR9H 4PBXA 5CBEA 3GM0A 4XBEL 1E4XH 4BFIB 3W9EB 1IGML 1L0YA 1NKRA 2I60L 3K4AA 4XZUB 4QKXB 3MXWH 5GS0C 4U1GB 1AR2A 3B83A 5B38G 3PJSB 1UEYA 1VGKB 1P7QD 3MCLL 4LLQB 4XCFL 3VFNB 2CDFA 3WN5A 3KJ4C 4M7LH 43C9B 1ZWIB 4MQSB 4GRWE 2V9RA 1NGQH 1JFQL 3HC4L 4JFZH 1X6NA 2DI7A 3FQRA 3X17A 5F9AC 1X44A 4MA8L 4OUUA 3ARDC 3FT4B 3TWCH 4NQVB 1JPFB 5BV7H 4MZ3A 5CD3A 1EHAA 1U8LA 4DOHE 3GMOA 3HZKB 3MCKA 5C09B 5C09A 4EXPX 3RGHA 1T0NB 1IZKA 3IS1X 1YPZF 1N59A 4JRYB 4K8RL 2WBKA 2FYYA 5FOBB 1NDGB 4FTVB 2FO1A 4PLOB 1HXMB 5DS8B 5IOPA 4P2RB 1CFSA 1BGXH 4FXKA 2B2XL 3MLPA 3MJGX 1CXLA 1X5XA 4GSDH 1JZ3A 4K7PL 3W0WB 1S5IH 3P30L 1C1EH 2AJ3B 3RX8A 5HTSA 3HZYB 4P5KA 5D71L 4O2CA 3D39D 3WFDH 3U1SL 2QHLA 3T0XA 2FD6L 3O6KH 4S1QH 6FABL 4L4VE 2GCYA 1AGBB 3BT2H 1KGCD 4Q6IC 1FSKC 1HSBA 4OD1H 4DTGL 1DSFH 1MCRA 8FABB 4RAHA 4JR9H 3LMJH 5CGYD 1G6RB 3CDGA 4HUWB 3H42L 4L3CB 1XMWA 3IFLH 4WI9A 1I3UA 3PGDA 3IF1B 2XFXB 3JWOC 4HFWB 1G7HB 3HNSL 1ZLWK 5HHPB 4UINL 1UA6L 2IADB 5JLZA 5D6CB 5F1SA 3IKCA 3QCUL 3ULUH 4YPJA 1F4AA 2VUYA 4P23B 3VJ6A 4Y2DD 4FZEH 3WL9A 4EOWH 1KYOK 3W0WA 1S7XB 2W9DL 3HTLX 3NCYP 4JLRB 1HYRC 2P5WB 3FCTB 4Q9RH 4MHHG 5AUMB 4APQA 2E7LA 2HJLB 3KJ4B 4X8JB 1VPOH 3QQNA 3V0WL 5DRZB 1W0VB 3P2TA 4WRLA 5F3HB 2IWGA 3ZZ1A 4OQTH 1MAJA 4YGVB 1FNLA 4FQCL 4OFDA 3W9DA 3AY4A 3ZE1F 3GB7B 5LBSL 5IQ9B 3QXAB 1UM4L 1URLA 4XB7A 5E6IA 2GFBA 3DVNB 5AYQA 5JPMB 4LPXA 1V3LA 4LL9A 5EO0B 1LILA 4ZXBA 1F6FB 4OZFG 2PTVA 4LCWE 1IFHH 3HMWH 5F6IC 4PG9B 1ZHLA 4JFEE 3ZTJG 3BRGC 3GSQA 4ZSOB 1NEZB 1EGJA 3DMMC 1ORSB 3IAQA 3VH8A 3C08L 1JTOA 4U1IB 5EUKB 4KTYA 5DT1H 4ZO6A 1Q72L 1N7MH 1D3CA 3QUYC 4OD1L 4QRSA 1BECA 4YFDB 5FYKE 1FCGA 4HKZA 1M7DA 3AUVA 4K3EL 4UDUA 3KLDA 5IHZB 4RWYH 1N8ZA 2ZCLH 5F1IA 5JLZB 3TNMB 1CGVA 2Y07H 3R0NA 4LHUG 5I76A 4NFCA 1FPTL 2P49B 5A2FA 5CJQL 4ZD3L 1WBZA 4LCUA 4PJ9A 5DEFB 4NWTH 4MSWA 3CFEA 3UTTE 5EC1A 4QHUB 4ISVA 2NR6D 3PXJA 4CJ1A 3V4UH 1KLUA 2VDQL 3CXHK 4QXTB 1SBSL 1MJJB 1UWGH 3LSOA 1KCVH 2NY3C 4MXWH 1CQYA 2HLFD 4MLSA 5HYSG 4YDKL 2ZUYA 5JA8B 5FHBL 4U4BA 4PJ9D 3VG0L 1NBQA 1TPXC 4J4PC 4L8BA 3KS0J 3O3UN 5HDBE 2HA1A 4I3RH 4YHKH 1WWBX 4YDIL 2GKIA 5IOPB 3BKJL 3WSQL 2QSQA 4L4JA 5CMAA 2D2OA 4AIZA 4GQ9H 2NZ9D 4EI5D 7FABH 3NCEB 4NKOA 5HYJB 3BIKA 3HZKA 1UADC 4GBXD 2DQEL 1PZ5A 2MSPA 1JGEA 2CJUH 4Q9BA 4WV1A 4PRPE 4IS6B 4NN6C 1KF9B 3MBEB 1QFUL 5FYLE 1UM4H 1ZGLM 4X7CC 3SDXE 3NAAH 5B39B 3FFDA 5I66A 2DQIL 4WGVB 2HLAB 2A6DB 3EO1B 2CKBB 3SGKA 3UC0L 3RHWK 1QNZL 1UZ8B 1LO5B 3O2DL 4WEBL 4OBRA 1R3IH 1B6DA 4HMEA 4RRPG 4KRPC 3TN0A 3AXLA 2FHBA 5L88L 4RFEB 43CAB 2N56A 1WFNA 2NY6C 1QSEB 2UZXB 1JHTB 5JXAL 2VXUL 1KG0B 3CAFA 1I4FB 3P4OA 4JFQB 3UAJC 4U1LB 4Z18A 3KPSE 5DT1L 5E8DH 4LNRB 3D9AH 1VESA 3QFJB 3LKOB 2DQHL 4O02H 3W81A 1AGCB 3LH2L 1JGLH 1ZK9A 1H5BA 3VMOA 4CW1A 4PJ8C 3WFEH 3HB3D 3I2CL 3ZL4H 4NQEE 3C5JB 4WEUD 4HJGB 5C09D 2AXFB 1F3JB 1OY3B 5FGSA 1S78D 3A6CH 5EU3A 2YKLL 4RCAA 1LGVA 1UXWA 3GIVB 5DQDL 3DWTA 2MQCA 2HT4D 6FABH 4JFED 3N0PB 4PJBE 1HYSD 1DUYB 1F45A 1T2XA 4GKNB 1IGFL 3HI6H 1T89A 3JWDL 5ADOL 1RMFL 3MBEA 3OKOB 1HQRB 4G8EA 4PS4H 5FA4A 5TE7H 2QTEA 5JNYA 4YFEA 5BVPH 2P5EA 1AQKL 1YC7A 3SCMD 2NX5A 4K94H 3MUGB 1A0QL 4KHXL 4KXZH 5GSVA 5IQ9A 1MJ7L 2YN5A 1TCRB 3FQXB 2UZIL 2FB4L 4G8GA 2R39A 2OK0L 4JFOB 4QRRE 1MVFA 3U9PL 4L8SA 1KPUA 2BK8A 4Z8FL 1DLHA 2D9CA 3RY5A 3UTZA 5CP7A 1KCRH 1YYLH 3DRTB 4I18A 4WO4A 4PJFE 1PG7H 5E2VH 3RY4A 5L2KE 1KNOB 2UY7A 4GXVH 1LK3H 1ZA3A 1EBPA 1P9MC 2X89D 4NQXA 1QSZA 1D9KD 3BP4A 5I1IH 4UOW1 4DKEH 1AHWB 5FK9A 1XF5B 4RQQA 4R90L 2P5WD 1YEFH 4NZRH 3OB0K 4R3SA 4YAQB 1P6FA 4X6CE 3KYAA 5EU6E 3L7FA 1Y18B 5J8OA 3BP7A 4UTAL 1F13A 5IEHB 4K7PH 4G6FB 2E6JA 2BSRA 4GW4A 4KKBD 1I9RL 1AD9B 4YPGB 5C0BD 3HHRB 5B8CB 3BHBA 1RZFL 1FZJA 4XVTH 3S3PA 4ODXB 3DURA 3FCTA 4WHYG 4AIOA 4WJ5B 3ZYIA 4PJ5D 1B4JL 1RUAH 3EBAA 4NUGH 2QV2A 4PPTA 4E0RB 3NZHL 3SGKC 3ZDXF 2DL2A 2NY2D 2ORBH 2YPVL 4RWHA 2F54E 1MY7A 4F7PB 1I7RB 3WMSA 3RWDA 3HG1E 3H0TB 3OAYK 5ICXA 2W1NA 3TBSB 4M7ZB 2XICA 3BKYH 4JO4L 4KPHL 1IAIM 3UBXB 4DVRH 2FYYB 1QQDA 4NKDA 3FFCD 5FOBA 1FNGB 1I75A 1W72A 1CXFA 3EOYG 1FVDB 1T20B 3FOLA 1HQ4B 4LGRB 3W2DL 1NC2A 1Z9OA 3O41A 2RIKA 3WIHL 4YHNA 3BN3B 3BXNB 3RPIA 1A7RL 4O2CB 3QDMA 1A7QL 1D5ZA 2FSEB 4LSPH 1ZVYA 1NGWB 2YA1A 2A0LC 2WINA 3H9SA 4MNHB 2YD7A 4P4KA 3DSNA 1J1XH 1QUNA 4YDJA 2BMKA 1MCIA 4NZTL 1MJJA 4UDTA 4YX2H 1YEJH 3VCLB 5IFAH 3PWNA 1BVKB 2AXHA 2GITA 4TVPD 1DLFL 2EE6A 5K9KB 4QEGA 4S2SA 1FO0L 3HR5A 4OGZA 3W9EA 1MEXL 4HH9B 3HMXA 3HPLA 2DMKA 4LCUB 1QBLL 4PJ9B 3LKRA 1OGTA 3UX9B 2EKJA 4PJEA 4XPBL 4R96B 4PJIB 4JANA 4GW5B 3LRSB 3HMXH 5EZIL 25C8L 2DDQH 5H37G 3V6OA 1S3KL 1IL1B 4C55A 4F7EA 2X2YA 4MAUH 3MNZB 4YO0B 1PKQB 3WXVL 3QIUB 5AZ2L 2Q6WB 4X6CB 1J1XL 3P0VL 4DCQB 3GO1L 4Q74A 4R26H 1V5JA 1QTYT 3MNVA 4I5BA 1XIWC 2JCCA 4NP4L 3R06B 3LDBC 2JE8A 1MCQA 2GTWA 2CUIA 3BZ4B 4BYHA 3MBED 5JW4N 2QKIB 1A1NB 3H6JA 3P40A 2CR6A 3VDCA 4O9HH 1KENL 4CKVX 5LG1A 5TE4H 2ZCKH 2BSSB 5EIQA 2VC2H 4UIKL 3GSWA 4GUPA 4XC3H 5DMGC 4RISL 4WFGE 4JM2F 4NN6B 4Q6IA 4EI6A 5MEPA 4HWNA 1PSKL 4KH2A 4X98B 5C0AA 1BQUA 4LSRL 4M6ML 4X4XA 4YDLB 3VCLA 1S7VA 2C4FU 4UUJB 4UMGA 4DUVA 4Z0BH 1FJ1B 1MFBL 4L8SB 2IH1A 4U3HA 3UTQA 3NPSB 1G0DA 4YDVB 4AEFA 1VCAA 3D18A 4WFED 1OB1B 3BMWA 4PJAF 4Z9KB 4JO2L 3FQXA 1CFNA 2XPGB 4OJFH 1OPGH 4J6RL 1FGVH 3UTTA 2EH7L 5BMFL 1ZLWH 1RUPH 4S1DD 3WDJA 5FO8B 4G7VH 1NFIA 1N4XH 4Q9RL 3U0PB 5D93C 4AG4L 4G8FB 1ED3A 1YY9C 1YEIL 4NFBA 3ARXA 4OT1L 1KCLA 1UWEL 4G3YL 4PRID 1YEKH 2E6QA 2FJGB 3MV8E 2DJUA 3OAUL 4CDGC 3QIWB 3UCRA 2KZ1B 4RGND 5B3NA 4ZPTA 1T7VA 2OP4L 4ZDHB 1YMHA 1T0MB 4BM7A 4N1HB 5D7SH 3JV4A 2XWTB 1UACL 4FP8H 3SCMB 5CS7A 1HK6A 3QO0B 2VLJE 3U0TB 5HHMD 3HZYA 2ATPA 4P5KB 4KKCD 4U1MA 1CE1L 1UC6A 1KC5H 3QWRA 5C0CE 2HVJA 4MD0A 3MUJA 1XF3A 4N68A 2IEPA 4KMLB 1G7LB 5CEZD 4PGCB 2Q86A 4F8QA 1H9VA 4GKZB 2EDQA 5J4MA 3DMMB 3EYUL 3EFDL 1NGWA 1KG0A 2YUZA 3ALXA 5IESH 3AMLA 1JBJA 4PJDE 3WUWB 3V7AE 4LNVA 4LKXB 4EI5C 2AJUH 2F5BL 5HHNA 2EDJA 5ID0B 4JAMA 3TBWA 1IAMA 3EO1A 4P5TC 3IB4A 1R6VA 5D7JD 2HJFA 3BZFB 5DRNA 3TO2A 1T83C 2NCMA 4IRJB 2X7LB 1J12A 12E8L 2AERT 1KXQE 1CFBA 1I1FB 5F96H 4ZXBC 3QQ9C 1TCMA 4MJIE 1NGYB 1DTUA 1KEML 4X7SH 5EBLA 5L2JA 4WI5A 4HIHB 4PRDB 3L7EA 1JK8A 3T4AA 2JJVA 4G5ZL 3V5KB 3VFSB 2DQDL 5HYJA 1A22B 1FAIL 1XGPB 1UH3A 5C6PB 2ID5A 4YWGH 4XP5L 5F1OB 5KN5A 1JF5A 1G7JA 5MP6H 4PJ8A 4IM8A 3SY0B 5IEKA 1IEBA 5F7YC 4WU7B 3MLZH 4NRZB 1T0PB 5I1CL 3L3OB 1RURL 2CO7B 3FQNB 2CMRH 2E7BA 4HS8H 5INCA 4ZXBD 2KL6A 3ARBC 2FR4A 2FLRT 1EO7A 3QR2A 3W39B 5EOCJ 4AY0A 3IVKB 5CJQH 5FV2A 3QEHB 3U7AA 1BIIB 1KCSH 2GW5A 1SMOA 1B0RA 2Q8AH 1WT5C 1FSKB 2IGFL 3CU7A 2NY4C 3GMRB 5IIEB 4YXKL 4TPRH 1IAII 3DGCR 4P9HL 1BEYL 3FQNA 1YN6A 5KVEL 2J1KA 5D2NC 3STZA 4TTGA 1JIBA 5FGCB 4PJFA 4Y5XB 5B38A 1W0WA 2AKRA 4L8CB 2GJ6A 5E5UB 5CSZA 3IDIB 1QSEA 2FEEL 4KKAC 1UACH 2IQAB 4FP8L 2HTLD 2CLZB 1JK8B 1NFDB 3BVNA 3O8XD 1FN4A 3HFML 4LVNB 5C0GB 1UVQA 2L0DA 3QUYD 3TZVC 1YN6B 1RU9L 3IS0X 1B9ZA 3UZVB 3QH3A 3U46A 5E9DB 1R24B 4PRHB 3NFNA 3GMRA 4N0YH 2IC2A 2RGSA 1A6VH 3OBAA 1U3ZA 5DURD 1B0GA 4RMVA 3MRKB 4LSRH 5GJTL 3FO9A 3MJ9L 4NWUL 1FE8L 4NQSB 4X6CF 2GFBB 2UWEA 3MRIB 3EGSA 3CX2A 3V0AC 5DSCA 3RGVD 3C5JA 3K81A 1I7ZA 4PP1C 2GJ6B 3DX8A 5FA3A 5CEYB 2F54A 4JRYD 3X13A 4P46A 2EEDA 4IRJC 3C6SA 5C86A 1BFVL 3FQTA 4P5TB 3I85A 5JQ6L 1VEPA 2VH5H 3PWPE 4LDEB 2DKSA 1WUNT 4IOSD 3D39B 4NRXA 3RAJL 1OTSD 4LASH 3THMH 4IRZH 1JGLL 4BQCA 3FB5B 5ITBL 2AS5M 1T7WA 3ZYZA 4ORGB 4HJ0C 3OAZH 4Y19A 1IC4H 4ONGL 2J8UE 4HPOH 4OZHB 4CVXB 1IT9L 1DFBH 1WF5A 3MV7E 3VXRD 2XNAB 2BNUB 5DFVD 1OAYH 1QA9A 2MJWA 3MOQA 3LEXA 1YEGL 1HI6A 1ZE3C 1AGBA 4HX1A 4PJ7B 3FO0L 1N6QL 1B4RA 4LVHB 4FFVC 1Q0XL 4CU7A 5ESAA 4PRIB 2BNQD 1CLYL 3I9GL 2R0WL 1FLTX 2W91A 4M7KL 4QXGH 1HDMB 3QIWD 4B7LA 5FYLD 1AJ7L 5DJ6B 3RUGA 3MQIA 2FBJH 2B0SL 1T04B 2ESVB 1A4KB 1WIPA 3QA3B 1KN4H 3HA0A 5I1EL 2X4UA 3VXUB 5DMYA 2HJFB 3GRWA 4P23A 2EYSB 4GS7C 2CLRA 3BW9B 3MRRA 3O9WC 1QLEH 2YPKB 2WAHA 3MYJA 1EEZA 1T0MA 1EVTC 4D9QE 1CLOH 4L1HA 4Z7QF 5D2LA 3SQOL 3D1MC 2XG4A 4O58L 1INDL 2WUBL 5IB5A 2F8XC 4YHML 3MOAH 1J7VR 4NUJA 4Y8AA 1G6RA 3CDGB 4HUWA 4Y19D 1U8NB 4JPIB 3L5IA 4FFWC 4N8VB 2H6PB 4F15B 4MNQE 2AV7A 5T5FH 5JIHA 4YHIB 2ZOKB 4I48B 4MD0B 2Y4SA 3BGFB 4UQ3B 3UBXI 4Y89A 3EDEA 1FZMB 3PQYD 3IXAA 2IPTL 3D0LB 1IZJA 4XVTL 1A8JH 2GAZB 3O4LB 5C0AE 1A6ZB 1HIML 1AIFB 3QRGH 3ULVD 3I6KB 1X5GA 2LU4A 3F7YA 4K71B 1W2KT 2HH0L 3T77B 3RA7H 3DSFL 1MELA 1M7IA 3WHXB 2H8PB 1FP5A 4QF1B 2PO6C 1S7RB 2CO6B 1XIWB 5ELIA 5GGVY 1RVFH 4LU5L 4RZCB 5CSBA 1DVFC 1KC5L 2GK2A 1CDBA 3VXOA 3QIUC 1S9XB 4XX1E 3C8KB 4M7JH 4BZ1L 4UDTB 5CCKL 1V05A 2DB8A 1MAKA 1AQDB 32C2A 3FN9A 1QFOA 3GUTA 5F88B 5J6HA 2DQGH 3WNLA 3KLAA 4PTUB 3C6LC 3KR3H 3VW3H 3EDKA 1H3XA 3PV6A 2P46B 2FB4H 2X44D 4ONOA 4P3DA 3BDBA 4X4ME 2IFFH 2AJYL 4OBSA 4KDVA 4P2QD 3SE4C 2WWKO 4HUXB 5F9WB 1CS6A 2IBGA 3LKQA 3MCKB 1RK1A 5HYJD 1AXTH 4PGDB 2C5DC 5E2VL 1EJ6A 4PY7B 3WFBH 5IESL 3U7YH 1U8IA 2XZAL 1K4DB 2LABA 4N8VG 3GSWB 5GJTH 1N5YL 4Y5VA 3O9WA 1HXYA 3U9PH 1K9TA 4F3FB 1MFEH 4PJEB 4QHKI 2HRLA 2R1WA 4JKWA 3O4LA 2UVFA 4JM2D 5B4MD 4PJDA 4X99A 3EOBA 1ZANL 1X5LA 2NYYC 2W0FB 3VXQA 4LCYB 1UA6H 5E24E 1QOKA 4P57A 2RCSH 1OAKL 2EH8L 1ZHKB 4H88H 4NKIH 2F9BT 2M8XA 3QZWB 4YHZL 2R1XB 4LHUA 4S1SL 3DIFA 1D6VL 1OM3L 4NPYA 2ZCHH 3S36H 4JQIL 1OTSC 4N0FA 3CSYA 4YBLB 3D18B 4XNMA 5HD8D 1JYNA 3N06B 1T2QL 4AIXA 1CK0H 1MCPL 5CUSL 5DURB 1T83A 5C7XH 3BPCB 5DHVH 3SPVA 1QFHA 5FUCE 3K0WA 3A6CL 2VDMH 4J3UA 4J23A 3SGEI 3EYOA 1TQBC 1T66C 2E27L 3SGJC 3S7GA 3O2DH 1FV1A 4WEBH 4D0BA 4JFYB 4HFUH 5EU7C 5T3ZE 2DD8H 4LPUA 4OLVH 3QNXB 1IBGH 3O2DA 1OSZA 3G5ZA 1KTKE 5C0FB 1CWVA 1MCDA 4P5TD 4JFEB 5H35A 2MPAL 3EIFA 4L9DA 1AHWC 3O6FA 5T3XE 3KPLB 2JCCF 3PWVA 2VWEC 3TLRA 1MFCH 5CINL 1I8LA 1TENA 5IMOB 4ZUUB 1U8KB 4Q9QL 3C60D 2W92A 3PJSA 3WLWD 3MLVH 1AGDA 1WFUA 1YEJL 5ALBL 4NZTH 3UZEA 4ZPVA 4J3XA 3OKYA 1NGXB 5E99L 5T33H 3BPLB 1V7NL 3WD5H 1AKJD 1CR9H 2R1YB 3WNKA 4EVNB 1A7QH 1FFOA 4UBDC 3MRRB 4NJ9L 3MXWL 3P11L 4MB3A 1ZT4A 4GW1B 4DVBA 4DVBB 1E6JH 5DZOA 5I75C 3V4UL 5F7UA 4GRMA 4F7CB 2IFGA 2PYFA 4BSWA 1HH6B 4OI8A 1FQ9C 5K9JH 1BAFL 2UVEA 1HHHA 2DF3A 1I7UB 3RTQA 4YHLH 4MQXC 2BC4B 1AO7E 2Q7NA 1BBDL 4KKBC 3ULVC 2ADGB 1G7PB 1RIHH 4YHMH 4OQ1A 3SY0A 5IEKB 4PJ8B 1XF5A 4O58H 4RQQB 4PJ5B 4F9PC 1HZHH 1YEEL 5FA4B 2Z8WC 5AWNH 4PGEA 5C9KA 4DAGH 1ZGLB 3KPLA 1EZVY 3UTTD 3WS6C 3ALPA 4J3TA 5KVFH 3VFRB 4NO3B 4JDTH 3FFDB 2WBJC 1JRHH 4KQ3L 5E00B 3U46B 1AC6A 2VQ1B 3H9SE 4G5ZH 4KKNA 4OM0L 5EZLA 5JIPA 4LSVH 2RR3A 5IB1B 4MA1B 5I1DA 2PO6A 3IDMA 5SX4H 2PO6B 3IDMB 3MLXH 5DJZA 4XBGB 2C3XA 1I1FA 5C71A 3JWDC 2ZUVA 3DX9A 3FT3B 4AEIH 4H26B 5IM7A 1HH9A 3HC0A 3PWPA 4W6XB 5AD0B 5KTEL 4GAYB 4OGAD 1PGRB 2HFTA 2AJVL 1CK0L 3DTXA 2JB5L 4JN2A 4DUXA 1GAFL 1OAUL 5L2KD 1UQSB 3ZSSA 2JB6B 4D2NA 1NLDL 1WAAA 3C6LB 3STZB 1MIEL 1WCQA 2I24N 1EMTL 3KPPB 1IM9D 3VGAC 4Z7VA 1FIGL 3MRQB 3QULB 3V7MA 4JY4A 5IW6A 1OCWL 4ELKB 3F5WA 3MUHL 1LK2A 2WW8A 2KPNA 1RZGB 5EZJA 4L4VB 2MPAH 1RZGA 5EZJB 1Z6JT 3EYQD 1UZ8A 3EOBB 3O45A 4X9BA 2FR4B 4DQOL 1JYXA 2EKSA 4P2CG 1TZIB 4UINH 3U36A 1M4KA 5GHWH 3QUZD 1S9YB 1JYWA 3N1GC 5E9DA 1H5BB 5SWSA 1XZ0A 4QRTA 1AD0B 4HMDA 2OMNA 5LQBH 3T3MF 3BN9D 3UTOA 3RUGE 2GYSA 1FRGL 2D31B 2MNUA 3HUJF 2Z9TA 3OG6B 4CVWA 3TF7C 3QIUD 3GEWB 5EU7E 3SKJL 1HSAB 4P2QB 4W4OA 2FH6A 2H45A 5I16A 4Y4KC 4QT5B 1OLLA 5TE6H 5JR1L 2LU3A 5KS9E 1F4WH 3L3JB 2YZ1A 4MX7A 2IGFH 1SYSB 2FX7L 1N2RA 1XFPA 2FIKB 1V8HA 5GHWL 4PTUA 3JV6A 3ZT5A 1FE8H 2KUTA 2X42A 2ZUXA 4NJAH 3L3HB 1UCBL 2PYEA 1DUYA 3LN9A 2O5XL 4LEOA 5IROA 1EAJA 25C8H 4C83A 4MNQA 5IJKA 3IDYB 3RY6A 2Y06L 3A6OA 4FN0A 3FB6A 4M61A 3VXMB 3CK0L 3K8LA 3CMOL 2ADGA 5EC1B 1U92B 1XIWA 4NM4H 3S96A 4V1DE 4BZ2H 3CLFL 5C07A 1ZKAA 3JWDH 5E8NA 4ZFOA 1CZ8H 3KPRA 3L3OA 1NSNH 5HBBA 3C5ZD 4PJAB 2JB5H 3FZUC 1A6WH 1I8MB 2K1MA 3GUTB 1KOAA 2R69L 3DIFB 5T3ZL 3NH7L 5D7LA 4RFEA 1A1MB 4V2BA 1CG9A 1SMAA 2ZPKL 5EUKA 4N90E 5F7MC 5J3HD 1FL5A 2X4NB 3OPZH 3HPJB 5T1KD 4S1RL 4WI2A 5E99H 5DVKA 3QNYA 2NY5H 4X4ZA 3BKJH 4M7JL 4BZ1H 1OQOA 1JGDB 5I66B 4F33A 5F8RC 1S7WA 3ES6B 1IGYA 1I9JL 5FUZL 1F58H 1AY1H 3U83A 5GGRB 1K85A 2H32H 1XF4B 3TZVB 3QDGD 2XXMB 1CDGA 1WISA 3MRNA 5GGQL 2DLGA 4X4MA 4UV4L 2IBZY 5DXWA 1JV5A 1INQB 3NFSH 4FQQA 4KJPD 3KPOA 4Q58C 4HKJB 1LDPH 3SOBH 1TTGA 4X0KB 2EIDA 4CN1A 3V5KA 3B9DA 2BNRA 2P8MA 3VFSA 4PLJC 3P77A 2Q86B 1UCBH 1JRHI 1ORSA 1OARL 1EUUA 3X12A 2H6PA 1SJHA 2FX8H 1U2CA 4HJ0D 2DM7A 5JTWA 4F7TA 4Y5XC 2A9ML 1OWWA 2K7QA 5EUOA 2F54D 4JRYA 5GS2H 5D2NB 2DQUL 4MCZB 2X7LA 1RAMA 3HE7D 1F8TL 4GXUM 3GMNB 2AI0L 2X4QB 3GBMH 4U05A 4TN9A 3GGWB 2WUBH 5D72H 5IP4A 5JW4Q 5F7KC 3SKJH 1KELL 3O41B 3QIBA 2LAGB 3MRPA 1BVLA 3QEGH 2EYSA 4Y4FD 1SEBA 5GPRA 2FO4A 2J5LB 5D7JB 3PWUA 5I1AA 4RMWA 1CGSL 1TETH 3SBWA 1FORL 3I6GB 2H8PA 3GSNH 5KVDL 1BQHB 3KJ6H 2H1PL 4HCRH 1JPTL 4OZFH 1FNHA 4E5XA 2GTWB 2CGRL 1KV3A 3WNMA 1DEDA 1ORQA 1RZKL 1YPZB 2G9HB 4P57B 1CFVH 1NAKH 1Z0MA 3V6BR 3RWHB 4EUPA 3LN5B 4WI3A 2VDPH 4MS8D 2PTTB 4R7NB 3GIZH 1RUAL 4OI9A 1KXVC 4F7EB 1JUFB 2WSKA 3NA9H 3IDGB 2PW2B 1DBBH 3SKMA 5TFSH 4OKVA 3MLYH 4P2RA 3VU2A 2V2TA 1KIPB 4GW5A 4PG2A 2NY4B 3BRFA 1BQHA 2OCFD 2XTJE 2FGWH 5E2JA 1AGFB 4K3DH 4K9EH 5C0DB 1PY9A 5E94B 4S1DC 3SGDH 3EO9L 4P3CL 2DQCH 1RIUH 4FFZH 1TITA 5EOQL 4ZXBB 1MHCA 2CIIA 5DTFA 2GTZB 4ELMB 4TVPE 3H9YA 3ARBB 2MCPH 3MLRH 4I0CC 3TJHD 5CGYC 2WQRA 3LPGA 3C6LD 4MDIB 2DBLH 3IJHA 4MDJB 4LLVA 3MFFB 5KG9B 4MA3B 2PXYC 1LK3L 2F5AL 4I0PA 3IJSA 1OAXL 4OFYA 1GH7A 3KPRB 3JXAA 2BXZA 4OCWL 1MUJA 4UV7H 4Z8FH 3SGEH 1GGCH 2YRZA 4ODWB 1NBVL 3LKNB 3Q5OA 3VXSD 3G6AA 4LFHG 1A9EA 4G7YH 3UROR 4XVUC 5MEPB 1EFXA 4CNIB 2DKUA 5ANMB 1FH5H 4N5UA 1A0QH 2MMXA 2VDKH 5FAAA 1TZGH 3B2UC 1TNMA 3OHXB 3SJVB 3B9KB 3BGAA 3MJ9A 4KWUA 1ACYH 3IDXL 4HUNB 1QZ1A 3RDTD 4HUVA 4MNGB 2B4CL 3H7BA 1IVLA 1FHGA 3VGGA 5IVZA 4RISH 2P43B 3CSBA 4D0CB 3MJ9H 4NWUH 2VOTA 2FWOB 1NBYB 3G5YB 4QXUH 4PRHD 2YS4A 3IXTA 5IBUB 3MRGB 3QCVL 4L8DB 4HIJA 2KQNA 3MV9E 3TNNA 1UENA 1NAML 2AV1B 1MF2L 2FCBA 2IAMA 2V5RA 3LEYL 4YHYB 2ADFL 5GGTA 4NHCL 4Y19E 4L29B 2D9QB 1V7ML 5MEOB 3MREA 2EIEA 3MV7A 3OKNB 2VKXA 4XMKL 4P5TA 1IGCH 1CFTB 1KTRL 2JB6A 1K2DA 3NPSC 1T4KA 1UFUA 3DUSA 4WWKA 3SCMC 1ZVHA 3BKYL 4JO4H 3SDAD 4HH8A 5F1NA 4NYLA 3MNWB 2XWBA 5FCUH 5I74C 3DSFH 4Y4HD 3VE0B 3QIWC 5L2JB 5CZVL 2FHCA 1L7IL 3BKMH 1YEHH 3QXVA 5DK3A 3C5ZB 1T2JA 1I9JH 2DIJA 5FUZH 5J57B 3ZLQC 4UNUA 1K3IA 5D93B 2FNBA 4YX2L 4J1UB 3BQUA 4LKCA 1D5ZB 4PB9L 5IT2L 2YWZA 4IS6A 1AFVH 4WU7A 3NFSL 1A6AB 1X4XA 4PR5A 5T1KB 4NOFA 3ARSA 2J2ZA 5C8JB 1I1CA 4PTTB 5D2LE 4ODTL 4L8SC 1QLFA 4WFHE 4IOFC 2X4SA 2DRUA 4MXQD 5HI3C 3L7EB 4DOHB 4KVNH 4JHAH 1F2QA 2H41A 2XWJA 3G6JA 1VSCA 3ZDXE 1UXWB 3QDGB 1J05A 4H0GA 3WE6B 2A1WL 3SO3C 3BD5A 2JK5A 1BZ9A 1IEHA 5FF6B 4RDQF 1YEDB 5FF6A 1H8SA 4CADB 4EDXB 2EKSB 1NJ9A 3GMPB 3LS5L 3F12A 1L4IA 2ICEB 3RNKA 4Z5RB 3QEQA 5HGAB 3RWIB 3K8MA 1DLHB 1IKFL 4OCXH 3LDBB 2OJZL 5MENA 5ACLA 2FX7H 3S5LB 5KSBB 4R4BA 5FO8A 3PGCB 4LLWB 2NNAA 4HWEL 1A6PA 4LCYA 1RULH 2BOCB 4QWWC 4X8XA 4RWYL 2R8SH 5DRWB 4QRUB 2I9TB 4MLIA 2VDNL 3KYNA 5GRUL 1CU4L 4JVPA 4OIIL 4TSCH 1R24A 2ZOLA 4TUKH 5JDSB 4OZGE 3RU8L 1CDHA 3JWOH 3LB6C 4PJ9C 1X5JA 3KPRE 3RWEB 1S7VB 2Q76B 2G75A 3THML 3OL2A 4J3VA 3BEVA 4TNVK 5FYJL 4BH7B 1M05B 4FQXD 1XIWD 4URTB 4ZUWA 2X1XR 2XKNA 1RUQL 2AXFA 3BO8B 3D9AL 4M5YL 5DJ2B 3VFMB 3K2MC 3TIEA 4EN3C 1QBML 1E4KC 2N1KA 5D1QA 3OAUH 1A5FH 4CN6A 4B41A 4R2GD 4F57H 1JWUB 2VDNH 4XTRD 5JXAH 1IQWH 4I1NB 3F7QA 1MCBA 2W9EL 1VERA 3NGBC 5H35B 4D9QD 4LHUB 3QZWA 4WCYL 5E8EB 2PF6A 4QXTA 1UB5B 4FQLH 2W9EH 1UJ3A 3ARPA 1UH2A 1GGBH 1MCNA 5EU4A 4NGHH 4MZ2A 2O5ZL 3VJ6B 2P24B 3BOVA 3ZTJH 3QUMA 4NO0D 1VFOA 4K3HA 5HYEA 4ZTOL 1RU9H 3V6FA 3T3ME 3GFUA 4HXBL 2BNRE 2V2WB 4LSTL 1KB9K 3JTTA 2V2TB 3KPRD 5CBAB 3IDNB 4YUEH 3QDJE 1U8HA 3MXVL 4CNIA 4WUKL 4JM2B 1MWAL 5KN5B 5ERWB 1ZEAH 1JHTA 4M7LL 1XCTB 2GITB 4PREB 4OFKA 1A3QA 3SJVD 2Z31D 5DI8A 3P9WB 5IMOA 4HC1A 4JO1H 3RDTB 5DHYA 5J06A 3RA7L 4YJZL 3ESUF 2H3NB 3E0GA 4M9PA 5BZWB 5MHSE 1AJ7H 2ESVE 1MSPA 2D7OA 3QUYA 1OAZH 2HP4A 4JFDE 5F93C 2G5BA 4KTEL 3SBWC 3QNXA 3FMGL 1IAOA 3OX8A 4MAUL 4I13B 1IARB 4WFFE 3QHZL 4R7DB 4R7DA 2NY1D 1HN1A 2MFNA 3VD9A 1MCWM 3L6FB 3E6HA 3NCBB 5FB8A 1DQLL 5D6DC 4IRSD 4J8RA 3CFIC 4X6DF 5DJYA 3TBSA 3REVA 4BQ8A 1YJDH 4XGZA 4HF5H 5LKNA 2ICES 1FNEA 4G6ML 3D0LA 4LLVB 3E3QE 1JV5B 3IKKA 1ES0A 4ZQKB 3P0YL 4LLQA 3B3IB 3VFNA 1F97A 2DWDB 4HX1B 4R6UA 3SGDI 3RVVC 2CD0A 4ZUSB 1WZ1L 2DQTH 1Q1JL 4YHPA 5I17A 2E9WA 2OP4H 2GTZA 4JPIA 5DD3L 1DN0A 4CMMB 2FBJL 4PV9B 1S7RA 3WD5L 4KUCF 3S5LG 1IL1A 1YEIH 3QQ4A 3L5XH 2OMBA 2WLYA 4KKLC 4KK8D 3OKMB 2MHAB 2M2DA 3B9KA 4ZD3H 4K07A 1AHWA 3KPNA 3MBEC 2YD9A 4J6RH 3HZMA 1KJ2A 4UILL 1YZZA 2IQ9H 2E9IA 3W9DB 2MCG1 4JCMA 4IHOB 3RIAF 3OJDB 4AEHL 1MCOH 3GJFA 4IDJH 3TJEH 3BSZH 5GRVK 5ETUB 5ETUA 1MCPH 5CUSH 3SKOB 3LEVL 3BWUC 2Y5EA 4XPTH 5KSBF 3QXUA 5B22A 3PP3K 1U8JB 4KRPB 1I8IA 1ZSDA 4S1SH 1OM3H 4EI6B 2VZSA 3D3VB 5FO7B 1JPSL 4TUOB 4E41A 1ODAA 2DLHA 4NCC1 3TZVA 4XI5C 3MRKA 4WHDA 2YD1A 4HSQA 4B50A 5HVHC 1F11A 1NH6A 3VG9C 4XH2B 1F90H 5EWIH 2PW1A 1JZ7A 3V6ZA 2X41A 5A2LH 2D7MA 2VN7A 3RDTA 1UVQB 4F15C 1KLGB 3WNNA 2A0LD 1MHHA 1Q9LA 3GSRB 1WSST 1JZ5A 5BXFB 1MQ8A 3T0BA 4XCEA 4O02L 5K9OA 2YMXH 4FFYL 3MUGA 4DGIH 5L2KB 3LRGA 4FTVD 1L9MA 1B2WL 5JOFA 4UAOB 5ALCH 1XR9A 5KSBA 4TUJA 4TOYL 4ZFOB 3DUUB 1UZ6F 5C0BE 1U8NA 1IE5A 1JNHB 4I0PD 4PJFF 1LO4L 1AQKH 5FA3B 2IPKA 2VMFA 4LSQL 3MV01 2JJWA 4FFWD 4HDIB 5I2IB 1JPTH 5ID1B 4KUCD 3OKKA 5DMIH 4OCNC 1HHJB 1IGFH 3BW9A 1EZVX 3GHEL 3IAGC 2IBZX 5IGXH 1NL0L 3WIFB 1YY9D 1QFUH 4JHWL 1NUDA 4XI5D 3H9SB 2EDTA 5KVGL 4HEME 4PRAA 1BWWA 4QTIL 3O11A 5DHYB 3CLEL 1E27A 2E7CA 3ROLB 1JGEB 1IGMH 1BWMA 4M48H 3MPCA 1H8OA 4PJEF 4ZSOE 3U9UB 3ZYJA 4LLDB 3FT2B 4PREA 3K2UH 1G9MH 2EIZA 4TQEL 5JW4M 4PB9H 2A77H 2WP3T 3UTSB 2XQBL 2XKNB 1T20A 3FOLB 3HC0B 3H2WA 2DDQL 4BZ2L 1C7TA 4YE4H 4ODBD 5FYKU 3D3VE 5T5FL 3JVGC 1MCEA 3RWCA 4E42A 3QEQE 2PYEB 1R3IL 4U1NB 5F7LB 1L6ZA 4ODVL 3VXPA 3RL2A 3WHE0 1IKNA 1OT1A 2IBBA 5D9SA 4JN1H 4UIMA 1CGSH 2D7TH 4OUOA 3T0EE 2Y6SD 3LN4B 3VXRE 4BK4A 5FCSH 1G9EA 1BOGA 1IC5H 4OCSH 2DJSA 4JM4L 3Q6FB 4JRXD 3BPNC 5TDNB 3K74B 2ADIB 2IF7A 2R2EA 4HK0B 4D9RD 3D0VA 1INDH 4K8RC 4I2XA 4L5FH 1DQDL 3MV7B 2V7HA 3UJIH 4HGMA 2Q8BL 3RVTD 3EYFB 5FEBA 5IGXL 2VLRE 4U33A 1NSNL 1IC7H 4H25B 1WQVT 1U92A 3MODL 4X9FA 1B0RB 3HE6D 1IAIL 2X4RA 3DROB 2VXTL 4HIJB 1P84J 3CFBB 1U36A 3AU1A 4H0IA 1D5IH 1XGUA 4BQ9A 1BJ1H 1N64L 4MCYA 1BQHG 1HOCA 1P2CB 1P7QA 4NWTL 1A3LL 1J1PL 4FXLA 1MH5A 3V0VA 1G7JB 1QR1A 5I1HH 3OKOA 1JN6B 5CKGA 1NCNA 1G9MC 4XCEB 4LAJH 1A1OA 3IYLW 1LO0H 4L8CA 1Q9OA 4NJ9H 1YNTB 2IH3B 2G60H 3NIDE 2G75B 5JOPE 3NCMA 1OTTD 1NCTA 1RZ7L 4JHWH 4L8BB 1OTUD 1U41A 3QDJA 1ZVSA 2JIXB 1MAMH 3BE1L 1ZMYA 4LOUC 5DJDA 3WJLA 5EU5A 2FECL 3U36B 3WIIL 4Y5YA 2HG5B 4JY6A 1TVHA 2ZCHL 3EZJB 3HE7B 3KYNB 3S8WA 4YHZH 1XGRB 1CBVH 5IG7B 5KW9H 1S7QA 1JRHL 1HHJA 5AZ2H 4MVBC 4G6AC 4C54A 1JHLH 2VZOA 3G5XA 2CIIB 1YMHB 5DTFB 3LS4L 4ELMA 1UB6A 3TV3H 4HIXH 3H7LA 3MMEB 3F5WB 4IOFD 3TN0C 5FO9A 2WK2A 5JDJA 2Y06H 5T3XD 2X9WA 4WU5A 4OV5A 4KRPD 4PV8B 4GMSH 4NCC2 1DZBA 8FABA 4U1GC 3TV3L 3IDGA 3IRZA 3VRJA 1PSKH 3OJDA 4PRPB 1TZHA 4K23L 4OLVL 1IEBB 1I3RB 2XZCL 3KLHC 3PWVB 3U0TA 1Z3GL 3MNZA 3V7AG 3INUH 1YMMD 3FFCA 3B5TA 4WTZA 3O3DA 3PIQB 5J9PA 4D9LL 3MRMA 1FJ1A 1F90L 1I85A 3GSQB 4GRLC 3QIWA 3L6FA 5EC2A 1AP2B 4JM4H 4HS6B 4NO0A 3MLXL 4XMPL 1J5OH 3L3IA 3FRUA 2FRGP 2R0KL 3ARGB 4UAOC 1Q9KB 2Q8AL 5BZDB 4WUUB 4PGEB 1R0AL 4H20H 4H1LH 2D7TL 4G6MH 3ULUC 2XKSA 1RIVL 1HKLH 1SYVA 3IGAB 4JY5L 3GB7A 4TULL 5F7DA 5L9DL 1CFNB 2XPGA 3CH8A 5BZWA 2BX5A 4TSCL 3LKPA 3EHBD 3WKMH 4Q9QH 1P6AB 1K8DA 5DQJA 1VACA 3O81A 1OSZB 1SBSH 3G5ZB 1ZA6B 5C0FA 4Y1AA 5I1CH 4APQB 5I19H 1U9KA 3QNZA 3MV9A 3VWJC 4EUPH 5FGBC 1C8PA 4OZGB 1KLUB 1Q9KA 1K3ZA 1XCQB 3NVQA 4P9HC 1SEQH 1MPAL 4KAQL 5HYSA 4FFVD 3VXSB 3V52H 4NZDA 3QIUA 5IBTL 1AP2A 5DF0A 1JI1A 5TQ2L 1PDKA 2VITA 2R1WB 1L0XA 4P4RB 4HG4K 4PP1D 3SPVB 5GGSA 1U91A 1EBAA 5GGSB 5SWZB 15C8H 2VLKA 3V6FB 1IGJA 3CU1A 3FQRB 4U0RC 5GS1B 2HVKB 1X5AA 3MO1B 4HHAB 3ZKNC 3UTSD 4UB0L 1D9KB 4YH6A 2V6HA 1XCQA 4L9LB 4KQ3H 3PL6A 4DN4L 1MVUA 3VFPA 4NQUA 1A1MA 1KXTB 4D0DA 1IGCL 3KNBA 4Y1AB 3TYFB 1MPAH 5GRXG 1S7TA 3B6SA 2WINB 1S5HA 4KI5F 1J0IA 4EEEA 3B9AA 1D6EB 3LV3B 5D5MA 3VFTB 3DBXB 4X6BA 4KUZL 4WW2C 3KWWB 5F3BB 5C0BB 1HXYB 3CK0H 4GOSA 1SYVB 3M8OL 4X6DB 3TO4A 1EHNA 3QIBB 1ADQL 4IJ3B 3UTPE 4JPKH 4Y4HA 4GBXA 3ESVF 4E41B 5I0DA 3GK8H 5DLMH 3HPLB 2YRPA 4OCRH 2O5XH 1VKXB 5EU5B 2EICA 5BOPA 4NNPH 2Z4QA 4NQDA 5F9OH 5JA9A 1T1ZA 3HI6L 4GFTB 3F7YB 5HDQH 3G6JE 3MZTA 3NTCH 3KWWA 5F3BA 1ROWA 3FFCB 1GOGA 4I4WB 4BFGA 4MAYC 3O3BB 2EC9U 2MKLC 1RY7B 3EOAA 2C26A 5GZNC 1S5HB 2PTTA 4PD4K 2CDEB 3K4ZA 3EJZD 3HE6B 2N7BA 3BZ4A 3C2AL 4TSAL 1EO5A 1C08B 1Y6NR 4QY8A 5D1QB 3T2NL 5I1LA 3QFJE 3GMQB 4OSUH 3ZKSD 5D1XD 1AD9A 1PG7L 4FHBD 2J6EL 3P3YA 1XGTB 5T5NF 5DK2A 3EYQC 5BCAA 5D8JL 2ZUQB 5DO2D 4DQOH 4RMSA 2XV6B 1KACB 3GHBL 5CGTA 3RP1A 1DQMH 2OL3B 2QJDA 5IB4A 3F12B 5SWSB 1G0YR 3DROA 4PY7A 4YHOH 4XXDB 1NJ9B 5L88H 4OLUH 3LS4H 4NQXB 4HWUA 2ZSWA 5DWUL 1FZOA 4RX4A 4UZGA 5KSVA 3KDMB 4MD5B 4CW1B 1N6QH 4OZGA 2BVYA 1JP5A 3NCJH 5AAMA 1F00I 1QPPA 4GMTH 4H0HB 3UTZB 1EAPA 3MLUH 4JFFB 2IJ0C 2B5IC 4F80A 3U0WL 3P4MB 3VGFA 5F88A 1P5VA 2APVA 3V5HB 1MQKL 3P9MA 2BP3A 3NIFF 4U1HB 4K94C 4ZS7L 4U1SB 1D7FA 4OIAA 1WBYB 5C0RH 2ZWLT 5ANME 4R26L 3KJ6L 3C87A 4KKLD 3UO1H 3NFNB 2YUWA 1WWCA 3NZ8A 1VFAA 2VO5A 3RWFB 3N9GL 4K7PX 2Q3AA 4PJCB 3FT3A 2FJHA 5JQ6H 4ZO7A 1WAAF 4WO4B 1C5DB 4LRNH 3CFBA 3WUZA 2R9HC 3T2PA 1R3HB 2C4FT