The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
116
|
structure length |
116
|
Chain Sequence |
MNPLYRAAIHQLFLALDLPTPNDEESVLSLQVGPHLCHLAEHPTDHLLMFTRLEGQGDATANEQNLFSQDPCKPILGRDPESGERLLWNRQPLQLLDRAQIHHQLEQLVAAAEELR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Toxin/chaperone
|
| molecule keywords |
Exoenzyme T
|
| publication title |
Interfacial residues of SpcS chaperone affects binding of effector toxin ExoT in Pseudomonas aeruginosa: novel insights from structural and computational studies
pubmed doi rcsb |
| source organism |
Pseudomonas aeruginosa
|
| total genus |
33
|
| structure length |
116
|
| sequence length |
116
|
| chains with identical sequence |
C
|
| ec nomenclature | |
| pdb deposition date | 2013-03-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF05932 | CesT | Tir chaperone protein (CesT) family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Yope Regulator; Chain: A, | Yope Regulator; Chain: A, |
#chains in the Genus database with same CATH superfamily 1N5B A; 2PLG A; 1K6Z A; 2BSI A; 1K3S A; 2BSH A; 3EPU A; 3KXY A; 4JMF B; 2BSJ A; 1TTW A; 1S28 A; 3CXJ A; 1JYO A; 4G6T A; 2XGA A; 1L2W A; 3TU3 A; 1JYA A; 2BHO A; 2FM8 A; 4GF3 A; 1XKP B; 1RY9 A; 1K3E A; 1XKP C; 4AKX A; #chains in the Genus database with same CATH topology 2P9P F; 4EBR A; 3VX7 B; 1N5B A; 2PLG A; 1K6Z A; 2LPU A; 2P9N D; 2P9U F; 4XEI F; 2BSI A; 3DXK F; 1K3S A; 3ULE F; 1K8K D; 2P9L D; 3DXM D; 2BSH A; 4GSL C; 4JD2 F; 2P9S F; 1U2V F; 2P9P D; 2BSJ A; 3DWL F; 1TTW A; 1S28 A; 2MQD A; 3EPU A; 3KXY A; 3CXJ A; 4H5B A; 2P9U D; 4XEI D; 1JYO A; 3DXK D; 3ULE D; 4G6T A; 4JD2 D; 2DYT A; 1L2W A; 2P9S D; 1TYQ F; 1U2V D; 2XGA A; 3DWL D; 4JMF B; 2KC5 A; 3TU3 A; 1JYA A; 3UKU D; 3UKR F; 2P9K F; 2P9I F; 2BHO A; 1TYQ D; 2FM8 A; 2OD0 A; 3RSE F; 3UKU F; 4GF3 A; 3UKR D; 1XKP B; 3VX8 B; 2P9K D; 1RY9 A; 1K3E A; 2P9I D; 3RSE D; 2P9N F; 1K8K F; 1XKP C; 2P9L F; 3DXM F; 4AKX A; #chains in the Genus database with same CATH homology 2P9P F; 4EBR A; 3VX7 B; 1N5B A; 2PLG A; 1K6Z A; 2LPU A; 2P9N D; 2P9U F; 4XEI F; 2BSI A; 3DXK F; 1K3S A; 3ULE F; 1K8K D; 2P9L D; 3DXM D; 2BSH A; 4GSL C; 4JD2 F; 2P9S F; 1U2V F; 2P9P D; 2BSJ A; 3DWL F; 1TTW A; 1S28 A; 2MQD A; 3EPU A; 3KXY A; 3CXJ A; 4H5B A; 2P9U D; 4XEI D; 1JYO A; 3DXK D; 3ULE D; 4G6T A; 4JD2 D; 2DYT A; 1L2W A; 2P9S D; 1TYQ F; 1U2V D; 2XGA A; 3DWL D; 4JMF B; 2KC5 A; 3TU3 A; 1JYA A; 3UKU D; 3UKR F; 2P9K F; 2P9I F; 2BHO A; 1TYQ D; 2FM8 A; 3RSE F; 3UKU F; 4GF3 A; 3UKR D; 1XKP B; 3VX8 B; 2P9K D; 1RY9 A; 1K3E A; 2P9I D; 3RSE D; 2P9N F; 1K8K F; 1XKP C; 2P9L F; 3DXM F; 4AKX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
