4JMPA

Crystal structure of the chimerical protein capa2b2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
235
structure length
226
Chain Sequence
TEEDVESQLGLPILGSIQKFSSLIVHEQPKSPISEKFRGIRSNIMFAPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative analysis of the Tyr-kinases CapB1 and CapB2 fused to their cognate modulators CapA1 and CapA2 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords C-terminal fragment of CapA, Protein tyrosine kinase
total genus 79
structure length 226
sequence length 235
ec nomenclature
pdb deposition date 2013-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jmpA00
3GJ8A 1G1MA 4I4LA 3Q5EA 1E2EA 1FNMA 3CX8A 5B2ZA 2EW1A 2JLWA 4LHVA 3SI7A 3VMFA 2QI9C 3GLHB 2G1JA 4LCBA 5EE5B 1CR1A 4PO9A 3EPJA 2VP9A 4P3YA 2XX3A 4TMTA 3C5HA 1QBKC 3B1WA 1KY3A 1S3SA 3FWYA 3LW8A 3U3MA 2E1RA 4Q4JB 1TEXA 2RGDA 3E1SA 1KSGA 1KHTA 4PAMA 2ZI7A 5JI3E 5DLQC 3L0OA 4ZDWA 1S0UA 3NBXX 4GZMA 3GD7A 4RY2A 4PANA 3ZYCA 2Z43A 5LB2A 4HDQB 1G3QA 4QBHA 4KYUA 5EUQB 4JVLA 5G41A 4E09A 1KY2A 2XNDD 1HQYE 1OYYA 4B3BA 4FMDF 2G0TA 2QAGC 5G3YA 3SQWA 4UNRA 3Q8XB 4TYPA 2GJ8A 3L0PA 3SEAA 1NKSA 1KO7A 3OIWA 1TF7A 1IY2A 1OH7A 1G3MA 4OJKA 3I5XA 1P2TA 3L82B 2RGXA 4LYFA 4EPTA 1EG7A 1KOFA 3U7FB 1QHHB 1E9RA 4D6PA 1IN6A 1OXSC 2NO6A 5HPYB 4IOLA 3ADBA 5KO2A 2GCPA 1E0KA 3DDCA 4TMWA 3NHAA 4LUCA 3X1YA 2PZGA 2DCUA 1OLOA 1U98A 2ASEA 4XTRA 3UK6A 2ZE7A 4BASA 1E94E 2A7QA 2ZQ5A 4DUGA 4BQSA 3X1ZA 2A9KA 3K1JA 2XOKD 4C7OA 5CIQA 1Z6YA 4B44A 4D26A 2PJRA 1JJ7A 2J0VA 1JJVA 1ZCAA 4YMVA 1SXJD 1JPNA 2PLFA 2RGAA 3UATA 1T91A 4DWJA 2QEQA 3GLHE 1OV4A 2FFBA 2REXB 2X2EA 2ZRJA 3IUYA 3K9GA 3U5ZB 1LS6A 2VF8A 3THYB 4BRUA 2K5UA 1M74A 2NPFA 2WM9B 3K53A 5DNYB 4NH0A 1FMJA 2WPDA 2IUTA 1HE8B 4EJSB 3MWYW 2IYTA 3NBFA 2XXAB 3ZZTA 3QE0A 1U8ZA 4MGYR 4P32A 2LKDA 1XDBA 4IFBA 3EC2A 1ZP6A 1EXMA 1OFTA 1ZUIA 4UQOA 3K9NA 4DLUA 2CXXA 3K8YA 4O25A 4ERNA 1G7SA 1Q44A 5LBIA 5J5CA 2ZSBA 3VHXA 2BM0A 4A92A 2C03A 4EJSC 3OEHA 4PTLA 3THXA 2IF0A 3KKMA 4K46A 1RW4A 2OFXA 3K0AA 1XB2A 3GCGA 4Z54A 1RC8A 1A2BA 1GNRA 1GKIA 1JXOA 1NJGA 1SVIA 4B3XA 1MO4A 5LD2B 1U8YA 4MUBA 2XZOA 1Q1EA 3VKGA 3CKLA 2Q0HA 1KDPA 1PV4A 1N6RA 1DAHA 1RRGA 4G5SA 4JKYA 4DEXA 1K5GA 4EPWA 1I2MA 2BEKA 1WQ1R 3QEJA 2ZUDA 2EYQA 3A6PC 3T35A 3QI2A 4G1UC 1PZNA 3IQXA 4B34A 4B32A 1C4OA 3GP8A 4NCNA 3KXIA 4OI2A 1RZ3A 4G5QA 3U3OA 2FPLA 2HJVA 3LVQE 2UVQA 3NC1C 5GADl 4N0DA 3T5DA 3U3KA 3LW7A 3ICQB 4RFVA 3OF5A 5FUWA 2ZM5A 2X77A 5JSZA 4PC2A 4B74A 3RS5A 2A5DA 5TVKA 1UDWA 5TXGA 5JCZA 3TSZA 1FL9A 1R8QA 3MD0A 1AM4D 1FOEB 1UKEA 2NMVA 3AVPA 5FTMA 3RC8A 1ZC3A 1VECA 4FCVA 3U7HB 2GXUA 3O8BA 4QNMA 1WBBA 1R4AA 3X1XA 1E2HA 2NGRA 1P9NA 3HPQA 2OCBA 2I1VB 4C7OB 4QJ5A 5CYPA 2YOHA 1E4VA 1M2OB 4C3ZA 4P33A 3WBJA 3WP0A 2O8FA 4YLGA 5FUYA 2SHKA 3NEYA 1J70A 3WXMA 1KAOA 3FVQA 3TAHA 1IN4A 1E2DA 3NHBA 2NO1A 1G3RA 5AUQA 3ZVRA 1XF9A 3I1FA 3O8RA 3Q9LA 3DZDA 3H84A 2ZJZA 4XD7D 4C0AC 4JLDA 4HAUA 4GOJA 1T5LA 3GJ0A 3TAUA 2QP9X 2CCKA 4KJZA 5JSZB 3GJ5A 4NCIA 3QKSB 4HB4A 3RABA 4CIDA 3HYTA 1A5TA 1YE8A 1XCPA 2WKPA 5DGXA 4HUTA 3PUYA 4A15A 4KAXA 1XD9A 2CJWB 3IDQA 4EQ6B 1TPZA 3K09C 3KXLA 4URZR 5CIWA 2ZSFA 3W5JA 5K8UA 3VKHA 4B2PA 4TN1A 1GNQA 1C9KA 1CJTC 1E2LA 5DN6D 3KQHA 4JBYA 4IXNA 3UG6A 1E9EA 1KO4A 3B8HA 4B33A 2RGCA 2OAP1 4E22A 1O3YA 3MWKA 1CJVC 4JL5A 3TUIC 3MAAC 4L16A 4BLSA 2JGNA 2ATXA 3T1VA 1G7TA 4P4SA 1PVOA 8OHMA 4LV8B 1LVGA 3KQLA 2FPKA 1NN3A 1F48A 1R7RA 1CS4C 2KBEA 2GEUA 3SHWA 4DSNA 3ASYA 3T1TA 1JECA 4NU0A 5F9FA 2YNMA 1SKQA 4M1OA 4DB4A 1EFCA 1BMFD 3DZ8A 2GK6A 5KSYA 4EJSA 1TQ6A 2OCAA 2QTVB 4Q9LA 2VHJA 3FFBA 3HWSA 1BKDR 3IEVA 4EFLA 1GWNA 1PUJA 2QGZA 2GCOB 1KO5A 2WJGA 2R44A 3T15A 3C5CA 4Q4JA 2W2TA 2V8OA 5L8VA 2IL1A 2Q9AA 2IYVA 1E79D 3KB2A 1E9SA 5AWFC 3IHLA 4TT3A 2ZR7A 5SZIA 3VU9B 4B6EA 3EC1A 3A8TA 3GLHA 5SZJA 4AYTA 2Q3MA 2RMKA 1SHKA 2N46A 1P62B 2BC9A 5EQTA 1BIFA 3M6AA 5E95A 2G83A 5KYKA 2ONKA 1RKBA 4JBWA 1U0JA 2VF7A 1ZAKA 4TQAA 1KKMA 1CR4A 3OE7D 4HATA 4DLVA 2YINC 4UNSA 4TL6A 3I4LA 2ERYA 3QPUA 2QMHA 4NYJQ 4QG7A 3LBNA 2XTZA 2MSEB 1GTVA 4AG5A 4LC1A 3ZQJA 2VHTA 1Z2CA 3Q3JB 4M22A 4KXFB 1KIMA 4ZCIA 4KLNA 5P21A 4U02A 1G4AE 3UMSA 2DBYA 2NQ2C 5KNCA 2ZRPA 4MRVA 4S2EA 3D31A 1V5WA 4Q9IA 1DG1G 1NVXQ 4E5UA 5EE9A 1IN8A 3GLGE 2O8FB 3DL0A 1OSNA 3U7GA 1Z2AA 5GJVC 3AVTA 1XTJA 3W9YA 2O8BB 3R8FA 1TX4B 1ODFA 2ZJAA 4RKFA 1SXJC 1Z6TA 3A4MA 1S9DA 3CM0A 3MWLA 2VTKA 1TU3A 3BIFA 1ZUHA 2HXYA 3U3JA 3AF0A 3AF2A 2FSHA 2GKSA 1VTKA 1GKYA 4HLCA 4C0HA 3I8XA 3N2IA 2IS6A 2VSXA 4OBEA 1JEEA 3OZXA 1N6HA 2CEAA 3PUZA 3OE7A 1G9XA 1TAGA 2AR7A 4R9UC 1FUUA 2ZE6A 1KK1A 1W4CA 3I92A 2ZAMA 4TQUS 1SKYE 2BKEA 5C1BA 2FPMA 1ZNYA 4NYMR 2FZ4A 1N0WA 3AGQA 5G53C 2BBTA 3A37A 4RKEA 1H8ED 4A2PA 3W5IA 1CR0A 1E0JA 2R6DA 5FBRB 2AFHE 2OXCA 5JWOA 1FPMA 1G6HA 3MSXA 1OKKA 1ZBDA 2AXNA 1YRAA 4IKEA 1W4AA 4MITA 1QHSA 2W0SA 3CONA 4PSAA 2KJQA 1PLLA 2QM7A 1NVVR 2XZPA 3CR7A 4FW9A 1RPZA 1LTQA 2X2FA 5L3SA 3TUJC 1Z63A 1CBUA 3KFXA 3DMDA 1KDTA 1ZU5A 3MWJA 1NBME 3ONWA 4JT4A 1W2HA 4AD8A 3THXB 4DCUA 4ASUA 1RVDA 3U4QB 2JIZD 2IF2A 4TWZA 5HE8A 3NVAA 3GFOA 1WE2A 1LV7A 1RYHA 4LWZA 4DT1B 3N2EA 1E0SA 4XIGS 3HYRA 3D7MA 4TT3D 4YMSA 4EPXA 2FSFA 3QG5A 5CYOA 4OK5A 4WOPA 1LFDB 4LPKA 1GUAA 1E98A 2CK3A 1P9WA 4RSGA 4M21A 1PLJA 5TB5A 3CRMA 3CRW1 4KU4A 4AC9A 2REOA 5A4JA 2WPDD 3GJ7A 3WNCA 3KQNA 1DVRA 1NNEA 4B6FA 3THWB 4RZXA 1C1YA 1YZUA 4LV5B 5H70A 3G5UA 4OHXA 2W0MA 1KI4A 2J59A 2ZXUA 1TMKA 4PQRA 1G291 4OI0A 2ZPTX 4GI7A 3RS2A 2H92A 1HURA 5JJKA 3WHLA 1YZNA 2CVFA 2PBRA 3D6TB 4J0QA 4MKFA 2D2EA 4PC1A 1XPRA 2ZVPX 5JZVA 3B1ZA 1XP8A 4FCTA 1ZM2A 1KI8A 2W6JD 4EFNA 3QPWA 4WZ6A 3IPYA 3FDIA 4BLPA 4DKXA 1SVKA 4W5HA 4Q1EA 2FF7A 1RRFA 3QEOA 4RZ3A 5B30A 2JLQA 4LJ6A 1YZKA 2P2LA 1OF1A 1W36C 5KTYA 2GCNA 3BFKA 2OXRA 4OI1A 2FE4A 2H16A 3SFZA 1U9IC 1ZJ6A 5E3HA 3AVQA 1Q57A 3PVSA 3ZS9A 4FCWA 4TTQA 3GEHA 2OT3B 1W0KA 1P3JA 2UZ3A 4JVNA 4B47A 1XTSA 1RJ9A 1IJFA 2A3RA 4IEIA 2B7CA 4RD1A 2J0UB 3P20A 3Q7PA 2YZ2A 1BYUA 1M7GA 1Z0IA 1P2SA 2R6GA 2ZRBA 4NL4H 3TK1A 4G5GA 4ZDIA 5B58C 2B8WA 3V9PA 1OFHA 3P32A 4M9SA 4BLOA 1W36B 2J41A 3K0AB 1M34E 5CB6A 4Q4HA 2YWGA 4BZPA 1M7HA 1WMSA 1YRBA 3L8ZA 2ZITA 2DPXA 2A5GA 1P2VA 1KK2A 4D4MA 5KDOA 2F43A 2W58A 3EA0A 3FKSA 1J7KA 4QGAA 3DOFA 4PQFA 5DISB 4R71A 2QAGA 4DB2A 1FX0A 1Z0KA 2G3YA 3E5HA 1Z5ZA 4A8JC 2ZVQX 4LJ9A 4CT5A 4M2LA 3AKYA 4PZLA 3OEEA 4F4IA 2AD1A 2CLCX 4ZIRA 3UWOA 1H65A 5BQ5A 5G3ZA 3BS4A 4ARZA 1EESA 2W83A 2XTMA 2GEVA 4L5BA 1HUQA 3DMNA 1OXVA 3SJZA 1W4RA 5FI0B 1L4YA 1YR9A 2IS4A 1Z0JA 2GXAA 1OYWA 5EZ6B 1Z83A 3RRNA 2V1XA 1XPUA 2G88A 3IO3A 4HLQB 3O47A 3OESA 3TR0A 2FFAA 3HDTA 3TNFA 2B7BA 4OI4A 2FNAA 4CGZA 2VP5A 4AKIA 2E87A 1FTSA 4HDCA 5K8TA 3T12A 2RGEA 1G4UR 1Q1QA 2F6RA 1QG4A 4YXWD 2XZLA 3BBPA 2ZRFA 3L2OB 4FWTA 2DFTA 1E32A 4KSCA 1JR6A 1AGRA 1IN5A 1RE0A 4X8OA 1NMXA 3NDPA 3K0FA 5HKKD 2AKYA 2WJIA 2CL6X 2CDNA 1KI7A 1FMLA 4OYHA 3DVLA 5AJWA 1ZD9A 3RRMA 3QOFA 2ZJ8A 5L3QB 2JLXA 3UWKA 1KI6A 3I5YA 1KAGA 1CR2A 1YHNA 4I1OA 3RANA 5KHOC 1XEWX 3PUWA 3BRWD 2NOAA 4DLYA 3KFVA 1GRNA 3DM9B 2ZTSA 4CF7A 4R2HA 1NN0A 4AWXA 2NZ8A 1UKYA 3KB1A 4CVNA 2A30A 4YC7A 5KSOA 3FB4A 1CLUA 4QGGA 2PH1A 3N70A 4WW0A 4MGKR 1AS3A 4V0OA 4FIDA 5FOUA 2ORIA 2ONJA 2D4HA 3L0SA 2Z0MA 4JYCA 1ZM4A 1MABB 3LLUA 4GZLA 2XGJA 1V43A 3QXJA 2YJTD 4KI0A 2CL0X 2WOJA 4M1MA 3LRPA 4RD6A 2I1QA 1R0YA 2GXQA 4MGZR 3AGPA 3KKNA 2HLDD 5DI3B 3I73A 2C96A 3SJAA 1GITA 3JZMA 1OE0A 3TUZC 1E2QA 2WIAA 2BM1A 5EXTA 1T4GA 3TW8B 2NPIA 2WICA 5FPKA 1QHNA 2Q3FA 3CF6R 5DSZA 1J99A 4IDHA 5FBVB 3CPJB 3CWQA 1HE1C 4PQYA 2ZANA 3MGCA 3QBVA 2WWFA 1T3HA 4MRPA 3LX5A 1LS1A 2BMFA 1OIWA 1B0UA 4GL2A 3IHWA 3GLFE 3K0SA 1IJEA 2JJ1A 2QT1A 1F2TB 3DOEA 4V0KA 1KJZA 3O8DA 4W9MC 1X3SA 1GIAA 3EASA 5FUXA 3KTAB 1ZUNB 2O0HA 4TMKA 4URVR 3CRRA 5EJEA 2DYKA 5FR1A 2HYIC 2FX3A 2ZYVX 3EIHA 4PPGA 4F92B 3QJYA 4EIWA 3KUDA 4JMPA 5E4FA 1SULA 3RS3A 4A8JA 2GZAA 5JHGB 1G7CA 1XJQA 1Z6XA 4LHYA 2WBLC 3C14C 2ZRHA 1ANKA 4A0HA 1QHXA 3MJRA 3G82C 3ZS8A 4KVAA 3MLEA 3VR5A 4KFRA 5BYJA 4BFVA 2AK2A 4LRWA 4QHYA 3QUSA 1GG2A 3QXSA 2H8KA 5KSPA 1NSFA 4Q7MB 3BERA 1OHHD 4HYYA 1XFAA 2JDIA 5BXQC 1G7RA 2ZS7A 3EZ2A 4IVQA 3V4RA 3P1JA 3Q85A 3Q72A 1WB9A 4A1FA 2R62A 2HF8A 2MSDB 3CLVA 5A5GA 4R98A 3LLMA 4ABYA 1WA5A 2B21A 4A4DA 4FMBB 2ZR0A 1WRBA 4QHTA 4KBFA 1IBRA 4G5RA 1BYIA 3TSWA 1YKSA 2DFNA 1ZNWA 5CITA 3WP1B 1G16A 1U0HC 1OXTA 1GDDA 4O0MA 4F91B 1W48A 2RCNA 4CRWB 5JRZA 1N6PA 2J87A 4P4TA 1XWIA 3X1WA 4M9QA 1OH8A 1CTQA 4OHVA 5IRCD 1CP2A 1SVMA 2C99A 4DDVA 1NVUQ 2Z5FA 4M1TA 3PG5A 1J8YF 2XB2A 3AVUA 1OKKD 3KJHA 2VP6A 5EUMA 4AY2A 4MRSA 2V55B 2IK8A 4BZXA 3NTUA 2VYFA 1E1QA 1YR6A 2CMKA 3SS8A 1Z22A 4IFEA 3EX7C 3ADDA 3C16C 1ZM7A 2ZRNA 3KJEA 1FZQA 1QHIA 1U94A 2F1IA 4GFDA 4UKDA 4TLDA 4KVGA 1T3LA 4JBXA 5AUOB 4NZYA 2GHIA 2O52A 3AKDA 1F5NA 5J4LA 2J7KA 1G20E 1KJWA 4RD4A 2QRZA 2W00A 4TYQA 1F2TA 5HZKA 4D4JA 1II0A 3KDSE 4JJZA 4WAUA 1EWQA 3K9LA 1U2RA 2ZJBA 4NYMQ 3ZJYA 1PJRA 1YR8A 4QBIA 4UJ5A 1D6JA 4V02A 5HZHA 1JBKA 3CPHA 4TTRA 2V3CC 5ANRB 1KK3A 4M53A 4E07A 1W5TA 1UADA 1UPTA 2ZJOA 3AUXA 3VTKA 1XBTA 3U3RA 4BWYA 3L0IB 3QQ5A 1G17A 3U2QA 1GL9B 4JIMA 1HYQA 4QXAA 4WZBE 4NMMA 4CZ2A 4ZIRB 4D4KA 4Q21A 1QHYA 1AK2A 5AK0A 3VU9A 2P0EA 3AF4A 2ZI4A 3AVWA 1NIPA 1SZPA 2J46A 2OBNA 3K09A 3OFND 4L9WA 3ZD6A 1RIFA 2A78A 1XX6A 4BGDA 821PA 3A4LA 1ZIOA 1ZM3A 4PX9A 1A7JA 1ZCBA 4CEIB 1DEKA 4PHTA 4HZUA 1ZC4A 1R10A 4XWKA 4Q4HB 2JA1A 2W6IA 4OL0A 3GLFA 4LJ7A 3K70B 2ZU0C 4NDZA 5AUPB 1SXJB 3FHOA 3P4XA 4B43A 3W34A 5J4KA 3AF1A 2QAGB 4B75A 2GAOA 1KNXA 3QVVA 5DYGA 5L3VA 1E1RA 2HF9A 3LAWA 1XMSA 5CM8B 2JDID 2J1LA 1MABA 2HYDA 4US0R 3A1WA 4B3CA 2GVDC 1EWRA 3U44B 1VG0B 1EK0A 2RH5A 2JEOA 3Q7QA 1FP6A 1KZGB 1DAMA 4IOKA 4JL8A 2O5VA 521PA 3AP2A 5G40A 4Z1MD 1MRSA 1D9ZA 3PEUA 1W7AA 4EQ6A 5KNBA 3BORA 1CRPA 1E2PA 2VHQA 3L8YA 3QF7A 2RAPA 4AYWA 2PX0A 2AHOA 2ANBA 3B1YA 4Q4AA 4RD0A 5FL7A 3RWMB 3RYTC 4ZKEA 4Q9JA 5JEEA 1OH6A 2QP3A 1JALA 2GZHA 4HAYA 3EZ9A 4LZZA 4KHZA 1NLYA 3R7WB 1JR3D 4EAQA 1U8AA 3NBYC 2C04A 1NSTA 2IWHA 3FHCB 4OQFA 4D4LA 1E9AA 3LY5A 4W5JA 2JATA 3CH5A 1E2IA 1I4TD 2OE2A 4PZZA 3IILA 4IDQA 4IJMA 2F55A 2QBYB 2YHSA 3UG7A 4OQNA 4FMCB 3THWA 4M4SA 2HT6A 1ZINA 4KV9A 4MH0R 3PEYA 3SJCA 3AQ4A 4P4UA 2O8DA 3KKPA 2VIIA 5CJPA 2PL3A 4HUQB 2ZRGA 3OIVA 3GLGB 1Z28A 1OB2A 2ZI6A 4G0NA 5KDDA 4D82A 121PA 5FTLA 1NN1A 4ZDJA 1Q3HA 3GJ6A 4LBYA 3RC3A 1DAGA 3LDAA 4BPBA 2NO0A 4QBGB 3NWJA 1AQUA 4D0GA 1GP2A 1XD2B 2QT0A 4ACBA 3ZD7A 3M1IA 2ODBA 4D25A 4GP6A 4NONA 2IXEA 1T0JB 1W36D 1WF3A 4DIEA 4TMVA 3RWOA 3I3SR 1P9RA 3U4QA 2PJZA 2IYRA 3X1DA 4FMDB 2JLUA 2VSOA 4IXMA 1XJCA 3LD9A 5FTNA 2J0UA 3B82A 1CEEA 4LBZA 2OESA 2DFLA 4XD7A 5J4YA 2Z4SA 3KL4A 1JR3A 3IKJA 1UDXA 2WSMA 4ASUD 4C0BA 1D2MA 2HDNB 2J7PD 4DCSA 4O3MA 1U90A 4BFSA 1NF3A 3W3ZB 2C9YA 2GJAA 4MKHA 3TH5A 6Q21A 2BDTA 2VEDA 3C41J 2QMUA 3CH4B 5FOTA 3B1VA 4XOIA 5DHAA 2IUSA 1CJMA 2QSYA 2N42A 1Q1BA 1JNYA 1D8TA 1RJ9B 2OAQ1 2WSSD 1XZQA 3A1TA 3GPLA 3H2YA 1X86B 4FXPA 4Q00A 2CCGA 3NH6A 4WIAA 2YC2C 5AUNB 1KYIA 2D2FA 2OCYC 1Z0AA 4HDOB 1GILA 4LGMA 3TQCA 4BEBA 5F9HA 4MDFA 4ZDKA 4TYNA 2XJ9A 1Y63A 2V6JA 1AQYA 3WYAA 3H1TA 1E2MA 2BMDA 4DLRA 5FBWB 4BE7B 5FPSA 2CK3D 4EKDA 1N2CE 2F9MA 3CNLA 4OQMA 4DDWA 2D06A 4QRHA 3EPHA 5CJ2A 1KI9A 3GQBA 3REFA 3B78A 5JEDA 4AKGA 1GFIA 1M8PA 2E9SA 2R9VA 1JAHA 2HV8A 3AF3A 4CW7A 2CHGA 1FNNA 4X8HA 1AIPA 3C7KA 2BCGY 3OAAD 4M1SA 5JECA 4MGIR 5TV2A 4B35A 1G8FA 2BEJA 2QRNA 3BWDD 4HLDA 2QAJA 2EVWX 1H8HA 4Q1CA 5F2EA 3F0TA 2RGNC 4V0LA 1E2GA 1G41A 1LF0A 4Q19A 4BZQA 1KI2A 2YVUA 4AYXA 2W2VA 1YZLA 1TL7C 1AN0A 1N5LA 3FFAA 3PENA 4PC7A 1JAIA 4PHFA 2IT1A 2FJUA 2XNDA 4EDHA 1T8TA 1GKUB 3DEFA 1VIAA 4X8MA 5BN4A 4UXHA 4XTCS 5H1YA 3ZGXA 4XSGA 2OBLA 3FPAA 4DEYA 1ZNXA 2ZR9A 2GA8A 3VR4A 3PCRB 4A2QA 1B23P 1F60A 1RFLA 4EFMA 3MG9A 5FOSA 3SDZA 2HEIA 5L3SB 3EWSA 3WYFA 1OHHA 1MR3F 4I1UA 4OQXA 1Q1ZA 1N6NA 4YQFA 1F2UA 5EZ5A 2WWGA 3H4MA 3M0EA 3E70C 1YQTA 2CL7X 2QSZA 3I32A 5KOYA 5CM9C 1Q3TA 4GMDA 1E2FA 3VAAA 2IS1A 4KO8A 2O0JA 2H18A 1KDOA 2PX3A 5FI1B 1M6NA 1JQLB 2GCOA 2ERXA 1X6VA 4V0NA 4HB0A 2HT1A 4B3FX 3KJGA 3LO5A 4JLMA 3HR7A 1RYFA 2C9OA 1QZXA 4Q47A 3EIQA 1XRJA 2VQSA 4NCHA 4QL3A 4A2WA 2LWIA 1DARA 3LQRA 2CE7A 2J3EA 1QHGA 2WSSA 3H86A 2OEPA 3QBTA 5JRJA 3FMFA 5D3MA 4CDGA 5DO9A 3QSYA 2XSZA 4C0KA 2C8VA 4RZ2A 1WP9A 4A82A 3WMFA 4GDFA 3PEWA 4HZIA 5HE9A 1GM5A 4HI0E 4Q1DA 2F1JA 1KSJA 2F3RA 1CRQA 4GT1A 1G8YA 4L4UA 1DTSA 1SHZA 2R6FA 3FE2A 4LJ8A 5FBLB 4PHHA 3CIOA 1ZD8A 4FN5A 1L4UA 5L3QA 4HLUA 3P26A 2CJWA 5F98A 3GMTA 4PAQA 1T3SA 3RS4A 3MRSA 3BAFA 2FOLA 2WWXA 5LD2C 4GP7A 4JL6A 4OK6A 2QUZA 2ZSEA 3QKRB 5JI2E 4LYHA 2GAAA 4TL8A 3VX3A 1G19A 1UEJA 1QVAA 2BMEA 1RRCA 4Q1BA 3AEZA 1P5ZB 1ESMA 1VKJA 3EG5A 3UIEA 4FINA 2A5YB 3T06B 4DVGA 4ZI3A 5JS7A 1ZD1A 1G8HA 1YZTA 3SYKA 2G1KA 3Q5DA 1BH2A 4AI6A 1DO0A 2OO7A 5GVRA 1EX7A 3DKVA 4BFTA 5M04A 5D3MB 1DAKA 4URXR 2IEYA 1XEFA 4NKRA 4WXRA 4DLWA 2EFHB 4OKSA 3CX7A 4YDSA 3QY0A 2OLKA 3WY9A 2YWHA 1DELA 2PMKA 5AJYA 2A5FA 5AJZA 2X19A 5J4HA 2FEOA 1WCV1 4D0NA 4LJAA 1D9XA 2QY9A 4OJQA 5DN6A 4NYIR 4C0SA 3QNUA 1DBSA 2MMGA 2VP0A 3QENA 3IPXA 3UXMA 3SBEA 1FQKA 4GOXA 2WWIA 3GEEA 3JVUA 4M1KA 1SKYB 3KQKA 2QENA 4Q02A 2JJ1D 4BRWA 2RHDA 2O8EB 2VP4A 3IQWA 2F1HA 2QE7A 1VG1A 3VHLB 2QMOA 1M1YE 2MMCA 1VHTA 4PR0A 4KSBA 1W5SA 3LBIA 4US2R 4PAOA 3LVRE 4JLJA 1XTQA 1XD8A 3QPVA 3SN6A 4P4SB 1ESNA 1OJLA 2C77A 3W6PA 1ZNZA 4KYIB 5AR1A 4BLTA 1F2UB 3CF0A 3RRYA 1S96A 3I8SA 1VIYA 3GJ3A 1KMQA 2GWHA 4JLNA 1WXQA 2HCBA 2YC4C 3IIJA 1UAAA 2P65A 3D8BA 1NG1A 3WBKA 4DLTA 3SZRA 3TGPA 2FFQA 3ZZ0A 2ODWA 3SHFA 4C0JA 1Q12A 2KE5A 5E7IA 3CUEF 2QTFA 1N25A 4I99A 4UNPA 3CW2A 3WRYC 2GRJA 4HAZA 4KBGA 5DI9A 3RNLA 5FH9A 1XMJA 4NBSA 4Q7KA 3GLIA 4WA7A 2ZJYA 5J40A 3RAPR 3ZQ6A 2Q6TA 1HT2E 4JYBA 1AKYA 2ORWA 2A2ZA 4NYJR 2XXAA 3BH0A 4F93B 3FOZA 3ECCA 2ZU6A 1OFIA 2X1VA 1OH5A 4LOAA 3FKSD 4DLSA 1KNQA 1FTNA 2IXFA 4Q7LA 1YR7A 5BWMA 1FQJA 2VLIA 5EP2A 2GETA 1IM2A 1ONBA 4RCYA 5TDHA 2EU8A 3QG1A 2QPAA 2QU8A 2H57A 1KI1A 4JSTA 3MUFA 3ZIAD 5D3QA 1TU4A 5IF9A 1E2JA 3J81k 3TW4A 2ZREA 4OK3A 1NG9A 3EPKA 2R8RA 3THYA 1A82A 1KMHB 1E1QD 1ZM9A 3TRFA 2V54A 4DCNA 2VO1A 4YMWA 2AKAB 1NLZA 4XVQA 4E03A 1SVSA 2CLSA 2BJWA 3CF2A 2UKDA 2PT7A 3FMOB 1SVOA 3CZQA 1QVRA 2J0SA 3VR2A 3BB4A 2TMKA 4KITB 4R2IA 5EXPA 2IC5A 1VPLA 1MO5A 4M9XA 3NBZC 4LX0A 4PPQA 3RVBA 2WJHA 4Q18A 2XB4A 2FGKA 1L2TA 2KBFA 1E69A 1GNPA 4GPTA 4JZKA 5CK4A 1NI3A 3PIRA 5L3RA 3SBDA 4ESHA 1XPOA 3ZLJA 1SGWA 3KXKA 2ZYUX 5FFMA 1VG9B 1XEXB 1BO6A 4O2RA 3UKDA 4DCVA 2IYSA 3GLIE 2V7QA 1JQJC 3KKOA 1X1RA 221PA 5JCPA 1IHUA 4DHEA 2NTYC 2O0KA 3U60B 3QXCA 5KPJA 1YZQA 4OQLA 2AWOA 3LNCA 2ZRMA 3SNHA 5JWRA 1ZW6A 1TQ2A 2BV3A 2WV9A 2XAUA 4DBLC 4NP6A 1X8LA 2F7SA 1QDEA 3TQFA 2GDJA 1SVLA 5SZHB 2IYZA 4C30A 3U6KA 2GJ9A 5CLLA 4BLQA 2BMJA 5LB4A 5ELXA 1CKEA 2FSGA 4URYR 2AK3A 4MYHA 3T1OA 2VBCA 1TEVA 4DCTA 4A36A 3UMRA 3U6BA 1XEWY 1U81A 2JJ2A 2GJKA 3ZVLA 1G5TA 3BFXA 4V0MA 4I1SA 4FMCF 1VCIA 1U9IA 3TKLA 3BK7A 1QRAA 3EARA 1IXZA 1KK0A 5BW8A 5EE0A 2OCPA 1XEXA 1XMVA 2CVHA 2WMOB 2GVZC 3A1SA 4U00A 1P73A 1UJ2A 3QKRA 2NG1A 4HUQA 2Q9CA 3I61A 5FPYA 2D7DA 2O8DB 2L0XA 1UBEA 2RGNA 2DB3A 3K0CA 1UF9A 4AK9A 4TL7A 5KUTA 4JS0A 3W6OA 621PA 4TL9A 3AKCA 1K6MA 2CNWD 4LYAA 1Z06A 1DAIA 5CDFE 3PV0A 1TF2A 5UKDA 1KJYA 4UNNA 4IRUB 5LDDC 3F8TA 3SR0A 3EXAA 2H7VA 4U7DA 2P3SA 5HTKA 3RS7A 2HUPA 1Z0DA 4O2LA 2ZAOA 4IVPA 3TIFA 1EGAA 3I72A 2EFEB 4M0LA 3IIKA 1GOTA 2ZSAA 5EE1A 3C15C 2C78A 4TTPA 4C4PA 4OHWA 4FI3C 4QFMA 1HQCA 2OBMA 4KFTA 3I62A 3CBQA 4Y0AA 3EZ6A 2BWJA 2IYLD 4LV6A 4QM7A 2IYWA 5FOVA 2KB0A 1IXSB 1AGPA 1HH4A 3QXXA 5TMPA 2ZUBA 1NY6A 2AFIE 3BOSA 1S1MA 1CJKC 1GL6A 1NKTA 3K0CC 3EPLA 1UBCA 4Y0VA 2JIZA 1XTRA 3EIEA 1YVDA 2OLJA 1LNZA 3FYHA 3MJHA 3R9XA 4KCGA 4Q01A 2H17A 2EQBA 3CZPA 3EZFA 3AVVA 1NBMD 4QHSA 3WNBA 2RGBA 5HCIA 1MV5A 2GF9A 4AKHA 1TQ4A 2GBLC 3MFYA 3GLFB 3NXSA 1NN5A 1N5JA 2CLDX 3A4NA 3QIAA 3GLIB 2PEYA 5C18A 5GJBA 1L7VC 3OHMA 4DXAA 4EPYA 3S1AB 2JLZA 5IK2D 2QMEA 5AJVB 3HPRA 1A2KC 2VH5R 2B6HA 3FGNA 2MSCB 5BN3A 4MKGA 2HXSA 4B3GA 2JLRA 4WXPA 3TBKA 4D0LB 4XVRA 1LW7A 4F4CA 3A36A 3AP1A 1KSFX 2OILA 1GRQA 3LA6A 4EPRA 3BE4A 3N5CA 2PZEA 1E9FA 3AV0B 1YU9A 1NMYA 4WVFA 2A5JA 3PUVA 4B76A 2QROA 5FBQB 1E6CA 2Z83A 2ZEJA 3QKSA 1CULC 1GAJA 1US8A 2C9CA 2B8TA 4LK2A 5DHFA 5IT5A 5KSZA 1XU4A 3BB3A 2H5EA 1DS6A 4P31A 2O8EA 4DLXA 1VCNA 4H1VA 3A1VA 2J7PA 3RDPA 5HCNA 3B7GA 1JXMA 1U99A 4US1R 3QKTA 1UBGA 4TYYA 2XITA 3CO5A 1TNDA 1XD2A 4UNQA 4F4JA 1UKZA 4Q1AA 1KMHA 2CBZA 5JFGA 4A0FA 1R2QA 1TQDA 1OIVA 2ZROA 2FWRA 3VNUA 1OT3A 3GJXC 3K70C 4GMXA 4H1UA 4W7SA 4CEHA 1NL3A 2IEZA 1DAFA 1XZPA 2PCJA 4NTZA 2ZE5A 2ZI3A 2Q9BA 1T9HA 4B2IA 2GJSA 1S8FA 4F38A 1X8JA 2RHMA 2QQ0A 4Q48A 4D2IA 4MDEA 1S2MA 3M4YA 3SE0A 2F1RA 3ZDQA 2QBYA 1GVNB 1N5KA 5FOXA 1QG2A 1YJ5A 4PXAA 4XWOA 3MCAA 4LJYA 3AVOA 4Q66C 2GILA 5DYIA 4QGHA 4OHZA 1N3BA 1Q0UA 4HAWA 3NDBB 3NC0C 5CK5A 4BFUA 1BOFA 1N5IA 1S1CA 4RVCA 4ITRC 1OB5A 2RGGA 3UMFA 2Z4RA 1J8MF 4MUAA 3E2IA 4URWR 1XMIA 4GBMA 3R9IA 4LSGA 2P6NA 2YYZA 4FD2A 4MRNA 4LJ5A 1COWD 2ODEA 4C2TA 2VP2A 3DM5A 2KSQA 2VL7A 1QHHA 4DC9A 2V9PA 5JHHB 1N6LA 2GNOA 1K5DA 4ZKDA 3U44A 5CLQA 2HLDA 1Z3IX 4ZPXA 2JLVA 2I3BA 3KUCA 4GRAA 1E9CA 1E0AA 4NYIQ 2I4IA 4I81A 4HLUC 3R9WA 2H1LA 3FTQA 4LHWA 1BS1A 2VA8A 4YXWA 4Z8YA 2DWQA 1G21E 4Q03A 1D5CA 2J9RA 2FFHA 1MH1A 4L15A 3B2EA 3ADKA 1NMZA 4AIIA 4H9GA 2R6CA 3BGWA 1G18A 4P0TA 3DO6A 1GZSA 1MOZA 2GBLA 3BFVA 4BUJA 2C5LA 3ASZA 3GEIA 4GOKA 2IUUA 4QNRA 3JZAA 2FG5A 5E7MA 3L43A 2WAXA 5EE3A 4XVUA 4LBVA 1GRRA 1Z08A 3TR5A 2ZIAA 2RB4A 3ZZUA 4BECA 3PJRA 2P5SA 1Z0FA 3NEJA 4MYTA 4G01B 2J5XA 2ZJ2A 4W5WA 2XNSA 4JVSB 3W90A 1FW6A 4XH9B 1AZSC 1G8GA 1JPJA 4HAXA 3THOA 3H0KA 3TVTA 2ZETA 1GL7A 1NRJB 2AWNA 4JKIA 1CJUC 1J2JA 1W49A 1T5IA 1VG8A 3B6EA 4BFYA 1N0UA 1TUIA 2ZYTX 3AKEA 4JT2A 2V6IA 4G5OA 4Q7JB 4EUNA 4RD2A 3P4YA 1X8KA 4MQBA 4K8OA 1M7BA 4JLOA 4AG6A 2QORA 2ZE8A 5TY0A 3EW9A 5EXSA 3RHFA 1U0LA 2YWEA 421PA 2XEXA 3R7WA 4B2LA 2IHBA 1EFTA 2PZFA 2IX3A 1XXHE 2F3TA 1MO6A 2ZRLA 4TZ6A 5DIFA 4DRZA 1Q21A 3B5JA 1E3MA 2ORVA 4QKQA 2WMNB 4TYWA 1HT1E 4WBSA 3TE6A 1KGDA 2BCJQ 1LB1B 2IYUA 4RJLA 2ZSDA 4N3NA 4TLBA 1L8QA 2XSZD 4POAA 2ZUCA 1VDZA 5GVSA 1Y3AA 2NIPA 1R0ZA 4DLZA 4TZ0A 4DUGD 1W2GA 1HA3A 2W2XA 1DPFA 4RFSA 3DPUA 3ZH9B 2XOKA 3KQUA 4HB3A 2XJ4A 2FDCA 1HTWA 4RFSB 4X8LA 2VSFA 1II9A 4IOJA 2QG6A 3WRXC 4PZYA 4TSFD 3AH8A 4LDJA 2OFOA 4PSVA 1II8B 1R0XA 4JVMA 3BJIC 1P2UA 1KSHA 2WZQA 4TMXA 2IYYA 1NP6A 3CX6A 4DZZA 2AX4A 3GFPA 4D80A 4YMUA 2C2HA 4IHQA 1DG3A 4IDPA 4C0LA 1DAEA 3CR8A 3VR6A 1ZYUA 5JJLA 3SU8A 3IBGA 2QZ4A 3HU2A 2VHUA 2WWHA 4LPSA 3NKVA 3ADCA 3ZVNA 1SXJA 1N6OA 3P27A 4Z51A 1P72A 2GXSA 3AUYA 5JS8A 3T5GA 4TLAA 3F3YA 4UJ3A 5TARA 3KX2A 4PO8A 1IXRC 2D3WA 4LJ4A 4QC2A 2O8CB 2AN9A 2BBSA 3K9HA 1S9HA 1I4LD 2QPOA 3PFIA 4DDUA 2V4ZA 1Q20A 3CNOA 4L9SA 4LI0A 4LC0A 4OHYA 3SYNA 1Z07A 4PPFA 1OW3B 2AXPA 2P6RA 1OXXK 3B13B 1P4SA 1K8RA 2EWWA 1TUEA 3PITA 4MKIA 721PA 5BYKA 1W44A 4Q9HA 4V03A 3WNDA 5DH9A 2CNWA 2IYQA 4G3XA 1XXHB 1G5RA 3BB1A 3EZ7A 1DE0A 2PLRA 4RCZA 1JI0A 3OEED 4TSFA 2CHVA 4XWAA 3HP1A 1YZGA 3F5FA 2WHXA 2N1BA 4JJKA 1VCMA 1PUIA 1JEDA 2ATVA 5AJXA 2FMXA 3NG1A 1US8B 1W4BA 3LXXA 5BN5A 3BXZA 2IWRA 4CEJA 4FWIB 3T61A 1CIPA 3DHWC 1VCOA 1OPXA 2G6BA 4A9AA 3KTAA 2ZRIA 3TSOA 1IN7A 2WWYA 1R5OA 1J90A 3BC1A 2PT5A 1T8UA 4KLZA 4L8GA 2GTPA 2VHCA 4HB2A 1KDRA 2GESA 4ZCLA 4CT4B 2YKGA 1NLFA 1HEIA 3G0HA 1VYUA 1EX6A 3VKWA 4TMZA 4IDNA 3T1QA 1UM8A 4BFXA 4URUR 4ILEA 1FP7A 4QJ4A 1UEIA 3OIYA 4HSEA 1AJEA 4PC3A 1CU1A 3ZIAA 5HKKA 3OIUA 4Q5IA 2EFDB 4QOSA 3ETLA 1G8PA 1KI3A 2YWFA 4V0ME 2FA9A 4CYMA 1ETUA 1P60A 2CCJA 3IEUA 4Z1MA 4Z8XA 2VPPA 4B48A 1P7CA 4BFZA 4NCKA 2ZJ5A 1IOZA 3LQQA 4PPNA 4DJTA 1UFQA 5J4VA 1E2NA 1G3IA 3IIMA 3KZ1E 5IK2A 3R8CA 1LY1A 4PO1A 2QTHA 3EA5A 2P6UA 2J45A 2JAQA 4MYUA 5DE3A 4DSTA 1Z6AA 3B85A 5FUVA 3FHTA 1G6OA 5EP1A 3IGFA 2B92A 2ZRKA 3QKUA 1EFRA 2NO9A 2REBA 4CEJB 2KWIA 2FV8A 2P67A 1NY5A 3AB3A 2PEZA 2IHYA 1II8A 2PMDA 2BIFA 4IDOA 3SJBA 3HJNA 1IONA 1UKVY 3WHKA 1A1VA 4N1AA 1W1WA 2ZRDA 2GEDA 2OM2A 3LWNA 2FU5C 1OIXA 3AVYA 4GSYA 3C4JA 1NIJA 3FMPB 3HU1A 2IW3A 2Q21A 2V7QD 1P75A 1ELOA 1SVWA 2Y8EA 3MMPA 5KNDA 1RRPA 2PCLA 3C8UA 2GZDA 3SFVA 3RRZA 2FSIA 4DT1A 5H68A 4ZO4A 2G0NA 3LX8A 1TADA 1IY1A 1E1RD 4QGFA 1A4RA 1SQ5A 2BBOA 2ZYWX 1KI6B 1X1SA 2C98A 4BFWA 4ESVA 5F3WB 1DOAA 1N6IA 5K8IA 2BVNA 1HY3A 3KJIA 3TJZA 3SOPA 2ZS8A 1T0HB 3GJ4A 2DWOA 2BKUA 5K8LA 3PEVA 1ZU4A 4B71A 2O8CA 2QPTA 3QVUA 3UPUA 4A6PA 4F7WA 2AL7A 4WZAE 4ZI2A 2EFGA 4I1VA 4DSOA 2LCFA 3RSLA 1OFUX 2ZI9A 4EPVA 3GLGA 1IAQA 2YOFA 1JR3E 1E79A 2XTNA 4RZUA 4KFSA 5IHPA 3RLFA 4JLAA 1DADA 1MT0A 4XJXA 1ZVQA 3W6NA 5JLJA 2WWWA 4IW3B 1KO1A 5KDLA 1KKLA 3S1AA 3T34A 4D81A 1ZRHA 3SYLA 1XTKA 1WBDA 2WOOA 1R0WA 5C4GB 1MKYA 1WDTA 5FPTA 5LPNA 1F3OA 1Z8FA 2QN6A 2UZIR 4M1YA 1W0JD 3LH5A 2QA5A 3IO5A 2WIBA 1G3UA 3W8RA 2JASA 2DY1A 1COWA 2P5TB 3A58B 3TMKA 5KU1A 3LFUA 2JJ2D 5E7JA 3VR1A 1PLKA 1FX0B 1N0VC 3HU3A 5H8WA 2QE7D 4Q4AB 4II7A 4YDHB 3HR8A 3CNNA 1Z47A 3QF4B 1EFHA 4A6XA 1LF5A 3BD9A 3FKQA 3B60A 4NHOA 1P6XA 4JLBA 5IDVA 3LV8A 3SQXA 3TVDA 1R5BA 2G9NA 2OSBA 2OG2A 4YMTA 5EP4A 1D2NA 2EYUA 3CRVA 1SXJE 1VYTA 1XJ0A 2HJGA 2QL6A 2QP4A 4K81B 3DKPA 4ON9A 3VNVA 2JLSA 5HR5A 1AZTA 3QF4A 2FEMA 3OAAA 2KI5A 5J47A 2D7CA 2GK7A 4IVRA 5A0FA 2WTUA 4LBWA 1AS0A 2BHRA 2WJYA 2FN4A 4YONB 3LBHA 4B3DA 4PHGA 1DO2A 2YV5A 3VX4A 4DDTA 1E4YA 2VRWA 5CDFA 3NH9A 2C95A 1VMAA 1EFRD 1KZ7B 1NVVQ 4HZUB 2ODNA 2WVJA 4C9BA 5JJIA 1QF9A 3K0FB 1EFUA 1Z29A 1T6NA 5FL3A 1Q22A 4CEIA 1GSIA 1XCMA 3UANA 1OXUA 2W6ID 4KODA 5GJCA 4HAVA 2OHFA 4BLRA 1KTVA 1MO3A 2QGNA 4M8NE 4BEJA 1XTIA 1IY0A 4MRRA 1XCGB 3V4FA 3AM1A 1VYVA 3CB4A 1E96A 3GFTA 5FR2A 3X2SA 4M9ZA 3V00A 4A0RA 1TTTA 1O87A 2OUKA 4N0EA 4PFSA 5EP3A 2ZI5A 1NBMA 5FOWA 2WJJA 5C46F 1ZIPA 2AD5A 1W46A 2F43B 4RD3A 2HCJB 4IOMA 5JMTA 4ARZB 2DWPA 2FGJA 4A8JB 5CB8A 5B57C 1E9BA 3U7EB 2ZRAA 4HEJA 1AKEA 4S35A 4B73A 2G77B 5FL7D 1FUKA 2RKOA 2V1UA 2BOVA 1P61B 2OV2A 1HV8A 2DHRA 2OZEA 3LXRA 1S3GA 4NPHA 3CWZA 4Q9KA 1H8EA 2R6AA 1XXHA 1E99A 2EWVA 2JLYA 5B64A 1H8HD 2BBWA 4R7ZA 5SZKB 1ZMXA 3OFNA 4ZCMA 4NCJA 4UXIA 1W47A 3W3AA 2JCSA 4PC6A 3BH7A 3VFDA 3SC3A 4IEEA 5FTJA 1NVWQ 4AKEA 1AA9A 3K70D 4C2UA 3WMEA 1W0JA 3R20A 4M1WA 4NE2A 3VR3A 2QM8A 3JVVA 3RS0A 4ZV4A 2GF0A 3CRQA 5C2JB 2J0QA 2WAYA 3A1UA 3RSOA 4QM6A 1FFHA 2DR3A 3K0EA 3AP3A 4LHXA 1KO8A 2BJVA 2DFKB 1NJFA 4U5XA 4TLCA 1R5NA 2CHQA 1CF4A 3PQCA 2FH5B 2CE2X 2NZJA 4AURA 5DI3A 4JLKA 2R65A 3EAQA 4JLPA 5FTKA 4XSHA 3U61B 2IYXA 2QNRA 4Q1FA 1E2KA 1F6BA 1XNJA 2JJ8A 3ZVMA 3REGA 2O8BA 1BMFA 2OFWA 2Z6VA 4LHZA 4LY6A 4UXJA 3O8CA 1JB1A 1I2DA 2ANCA 1S4QA 2W6JA 4PSKA 4JLVA 5GJWC 5JWHA 1N6KA 4CEHB 3B1XA 1E9DA 3ICEA 2ZS9A 4GNKA 2WKQA 1UBFA 2D74A 5C4MA 1Z6GA 1VHLA 5JBQA 3NIBA 4DSUA 3ND8A 2YOGA 3KKQA 3D3QA 3WMGA 2X8AA 2IXGA 2Q3HA 3PR1A 4MA4A 3EWAA 1W0KD 4TLEA 2ECKA 4QJ3A 2WKRA 2D62A 3AVXA 4MYCA 5FPHA 3W8NA 1MRNA 2EFCB 4A0GA 4JSYA 1I4DD 1G64A 5EXXA 2ZRCA 3B9QA 1TF5A 4ACAA 3PUXA 4KFUA 3WYGA 2QQEA 2WJVA 3ND9A 4TQ9A 3TLXA 2IBMA 1R6BX 3CPEA 2F9LA 2NO7A 1AS2A 2IS2A 1G5PA 2LKCA 4LYJA 4DIDA 4QBFA 3B9PA 1D2EA 3QXHA 3VQTA 4Q4LA 1CXZA 2R2AA 3IBYA 1IQPA 4C0QC 3BH6A 1R8SA 2FZLA 3OEHD 3PXGA 2IA5A 5KPDA 3FMIA
chains in the Genus database with same CATH superfamily
4L3OA 3GJ8A 1G1MA 1THZA 2BI4A 3RUCA 1QMGA 2RC6A 5HKBA 1FNMA 3CE6A 1X1QA 3IJRA 2P4SA 5HJ7A 5MFZA 3SI7A 3WMXA 2FUKA 1C4KA 1M0SA 2G1JA 2JHFA 1V39A 2Q49A 4PO9A 3MB8A 5J9FA 3EPJA 4GVPA 3L8EA 2EGUA 3I5AA 4RK4A 3B1WA 3P8ZA 3C2QA 4QTYA 1S3SA 4HG2A 4LMRA 3NYRA 2GPWA 3V4ZA 2E1RA 5JQGB 1TEXA 2RGDA 3IC5A 3E1SA 3OE1A 4MEJA 3CVWA 2ZI7A 3RO7A 1JHUA 5B1EA 5DLQC 3CUKA 1S0UA 1M1NA 2X9VA 3C3JA 3NBXX 5CEEA 1WG8A 4WWHA 3IP9A 1IWPB 1SUIA 1RNLA 2FOIA 3HADA 4HDQB 1G3QA 4JJGA 4QBHA 4KYUA 3O38A 3DFFA 3DTNA 1Y1KE 5G41A 4E09A 1OTXA 1HQYE 1OYYA 1U4SA 4JNCA 1MH9A 3O9ZA 1LDEA 2GPNA 5LJLA 2I91A 3IRUA 5KKCA 4QQKA 2BSXA 3SEAA 1UQUA 3AONB 5JSQA 2FEKA 2XRFA 5KYUB 4CG3A 4J16A 1VHQA 1VOTA 3CWCA 3PT5A 1XDUA 3I5XA 4XKJA 2EBUA 1Z17A 4EPTA 2XUGA 2MINB 3NOOA 5IG2A 5K0NA 1NR1A 1JU3A 1U7OA 2AOUB 2D2IA 4LW8A 4UUAA 2OO5A 3ADBA 2DR2A 4FLEA 1F1BA 4D02A 3KC2A 3JQ8A 1WCIB 1ZMRA 2OBFA 3WB9A 1ZFNA 4NU8X 4PW0A 2AMJA 2PM8A 1U98A 4X1OA 3AHJA 1W5EA 2PZLA 3UK6A 1KC3A 2ZE7A 1ULUA 3BWVA 4D99A 2NZUG 4QATA 4RULA 3N0VA 2YIMA 4RMNA 3DVAA 4OGFA 4NOJA 3INYA 5CRIA 1VFNA 6LDHA 1MNQA 3UUFA 2YJZA 4GGOA 1Z6YA 4AZSA 2PJRA 2RONA 3RGWS 3OFKA 4C3OB 2WPNA 4YMVA 1SXJD 4HYQA 2FUNB 3UATA 2H2DA 5HM6A 4OXYA 2QEQA 5BO5A 3B8EA 3DNMA 3K1TA 4CHTA 3U5ZB 1WUKS 1LS6A 4L28A 2GR9A 1YE3A 3HUTA 1RR6A 3OMWA 4RDCA 1SUEA 1VL0A 2AEFA 5DNEA 3QUQA 3PDWA 1NAIA 4FDVA 2IUTA 3TPZA 4B5LA 2Z4TA 2AEMA 1ADYA 2AB0A 3MWYW 3NIWA 2V8BA 1UT8A 3NBFA 1UXGA 5T4EA 2J3JA 4LNHA 3ZZTA 2XXAB 1U8ZA 4KK3A 2R1TA 1TJNA 3OWXA 1PWEA 3R5SA 4ZO7A 4P3XA 5FJJA 3TRKA 4FJ2A 2LKDA 3PEFA 2IP2A 2Y66A 4PRZA 1PZHA 5I47A 1MAWA 1V6SA 3PGLA 1ZUIA 4UQOA 5IKEA 3IA2A 4RA9A 1JEQA 2BGTA 2CXXA 3KUUA 3K8YA 1MORA 1Q44A 2WWRA 1NF8A 4R2LA 1XDSA 4GSKA 4O4HB 2JCXA 4RM2A 1S2NA 4HH3C 1QYIA 4F1KA 3H2JA 5BYAA 2C03A 1GXSB 5JBIA 3THXA 4KUGA 2CMFA 4L7VA 3GY0A 1OGJA 3Q2IA 3K0AA 2R5WA 1XB2A 3LUHA 3A9WA 3N2GA 1NJGA 5JAPA 2BGNA 1MO4A 4MW9A 4Q6WA 5LD2B 2YMQA 1RJWA 2MTBA 2XZOA 1FYFA 2AVNA 4Q24A 1E7MA 3GHYA 2PXCA 1V0JA 1H2BA 4PLWA 1R0KA 3OOEA 1PV4A 1N6RA 4UDNA 4B0PA 5TLSA 4NENB 1DWPA 4EGCB 3FBGA 3KZOA 4BLWA 2E3JA 2VDVE 1WQ1R 2BDEA 5EGNA 1UXHA 3I37X 2O3QA 5KYVA 2Z8ZA 3T35A 3JQCA 3UUWA 4J1TA 1FIUA 3MJSA 4B34A 4TTTS 4RJKA 3ZE1B 4F21A 4XX0B 2YJ6A 3H2GA 4LDPA 3KTDA 4O29A 1P9OA 2HJVA 3LVQE 2FQWA 3IKVA 1M76A 1TZJA 3T5DA 3EFHA 3JQDA 3OCVA 1JUDA 3ILHA 4JXJA 3ELBA 5BPFA 2EC5A 8LDHA 4GKVA 1U2PA 1XHEA 3DR3A 4O02B 3IERA 4B74A 1HX7A 3QX3A 2A5DA 4MKRA 5K0CA 3DEYX 3PU6A 1ACJA 2Z8XA 3IIIA 4FX2A 2HCTA 4KR3A 3JYNA 1H3EA 4YS6A 1D07A 3F96A 1FL9A 1R8QA 4WXYB 1JLLB 1G8MA 1AM4D 1FOEB 1HEUA 1UKEA 3ENVA 3TSAA 3ZU2A 3BDAA 5J2UB 2EW8A 3JAKA 3P2EA 2ZKIA 1ZC3A 3BMCA 1JDBB 1B1AA 2Z95A 3NWEA 3OY2A 1R4AA 3C3CA 1B93A 4QFCA 4UBNA 1UDBA 2B4AA 2HRZA 1FSFA 3L1UA 4CM3A 3I2JA 2YOHA 2C5AA 2V6BA 2E7ZA 1SC4A 3WBJA 5ALQA 1DKLA 3RREA 4D3ZA 5BQFA 1Y98A 1J70A 3HYCA 3R5KA 1ODIA 1JQEA 3ZE2B 4P38A 3FVQA 1IN4A 1E2DA 1W87A 2A0UA 2E5WA 2H2IA 2VVTA 3IMEA 3NHBA 1RM4A 3GGPA 4MINA 4OHFA 1G3RA 4WY5A 5B3JC 3NPAA 5DHRA 3P9SA 3L0BA 3S99A 3ELWA 5BV0A 1N9ZA 5FQNA 1U8FO 3Q9LA 4F3CA 1QYXA 4AIRA 3H84A 1USWA 1RPJA 4PYNA 4XX0A 2D13A 3S2IA 3WRWA 3SEZA 4JITA 3CLSC 3N7AA 4E32A 2QMQA 2RK3A 2F64A 1E3IA 1T5LA 3TG2A 3GJ0A 5GY7A 1TVCA 1GTJ1 3PD7A 4Y9RA 3TAUA 1P0MA 3RHSA 1CZOA 3RARA 5AD1A 3HYTA 5MGNA 1A5TA 3FRJA 2WKPA 1D4ZA 4HEQA 3IFSA 3PYLA 3PUYA 5DGXA 4CODB 2BHSA 1FSGA 5C8DA 3KYDB 3K09C 3BFJA 4MV6A 4URZR 5CIWA 3W77A 2UUCB 3GJZA 4B2PA 4EY6A 4J7UA 1N3LA 1CJTC 2J9XB 1XU9A 1OLSB 5CFMA 3HJUA 3V42A 4UTOA 1OLXA 1QLJA 1RDFA 1QSGA 2P11A 3QVMA 2H7XA 5C1PA 4B7AA 2Z9CA 2B35A 2RGCA 3SX2A 5AYVA 3OQNA 4MQUA 4PGFA 4GDMA 1H93A 3OM0A 2Z9DA 4ZQBA 2A94A 2W2LA 5TMEA 3P9NA 2XYHA 4RA9B 4DPMA 1ARZA 2ATXA 1NP7A 1XO1A 2WWTA 3RYFA 2O7SA 1G63A 3FCSB 3G9QA 1OPRA 2XUJA 3RR2A 1UZAA 4P4SA 3T1VA 3UXHA 3WK9A 3KQLA 5CDFE 1NN3A 2KBEA 4M1EA 1PR6A 4K8RB 4F4DA 3T1TA 1FP4A 1D1SA 1L1EA 4DB4A 2GK6A 1CQWA 1ZI9A 3KFLA 4OIFA 5ALOA 5KSYA 2OCAA 2QTVB 3QTBA 1R3DA 3N8GA 3HWSA 3GJRA 4KWTA 5ETJA 4EEXA 1D4OA 4RUKA 2NW6A 2GCOB 1KO5A 2WJGA 3OOSA 2BFFB 1W96A 2R44A 2XHZA 4G0MA 4MVJI 4CTMA 4EF6A 1CY1A 2W2TA 3OSUA 2CD9A 4RGYA 3D4PA 5K0ZA 2IL1A 5LZ7A 3KB2A 5AP9A 5SZIA 1JZQA 3IMGA 5KWIA 4RHFA 2WUEA 4NBTA 4UTRA 4AYTA 1EBUA 2AG6A 3O95A 2N46A 4UUNA 3D2LA 3H5NA 2BC9A 3DQQA 3BICA 4W99A 3HABA 5E95A 1F0NA 4ENUA 1YBMA 2BEVB 2XTJA 2PR2A 4AJHA 3EFBA 2OBYA 1KKMA 5KX5B 1MGOA 2R6JA 4KHPB 1UAYA 3LUFA 4TRJA 1HZJA 2C2OA 4JGIA 2Y1WA 4MMZB 3LBNA 2XTZA 4RHXA 3QK7A 2MSEB 4AG5A 1N9KA 1MPTA 1RTKA 1U7PA 2X4LA 3ANNA 4K40A 4LC1A 4KXFB 2UV8A 1C3JA 1KIMA 5P21A 3F7MA 1G4AE 4U02A 1UFOA 2BEUA 2DBYA 2VJCA 4MIYA 3AEKB 5F12A 1I14A 5KNCA 2XR1A 4KTVE 4I9GA 1QCCA 2AIRA 1DG1G 2ZUEA 1E2BA 2H4WA 4TTAA 5KC9A 1Y6FA 3GLGE 2H1CA 2H51A 2WMDA 3CMCO 4U2GA 3GRAA 2WM2A 2GH1A 1RXUA 3FVVA 1XL0A 1RWBA 4HQ6A 5FAXA 2Y1OA 1FVOA 3JRNA 1JAYA 3R3YA 3UT5B 3B5EA 4F56A 4N76A 2X8LA 3EQ9A 3Q2OA 4K9KA 3BZBA 1PD1A 5TGTA 3H9BA 4YAIA 1ODFA 3I9NA 3ZGZA 1C80A 1S9DA 3C97A 1LSOA 1YRYE 3EN0A 1A5AB 1ST3A 3MWLA 1LRLA 2VTKA 2X41A 3I04A 4FT4A 4FWBA 2IX9A 2ZWMA 4G4SO 5FX2A 4OOFA 4HMQA 2LVBA 4NBRA 4GZ5A 4BNHA 4RPIA 3EAFA 2PGAA 4X61A 3CRZA 3C3EA 3RSHA 3I8XA 4C0HA 5B5SA 3J7AC 2IS6A 2HLPA 4IRXA 1JEEA 1H6DA 3B3FA 5MDHA 1FLVA 3UZUA 2OAGA 3OLZA 3BE5A 4MHSA 1IAVA 3ZEAA 3WLIA 1FUUA 5CX1B 4AXXA 3I92A 1BWSA 3JYLA 1VKRA 3LP6A 4D96A 2JD2A 3KP1A 3ZK7A 1E7YA 1SKYE 2EKLA 3N8IA 4F71A 1ZNYA 2EP5A 5EJ6A 5IS2A 2HH9A 5JFTA 3UA3A 4EJ2A 2VATA 1X0VA 1MJFA 4QEKA 1E63A 2X9NA 3KR0A 4URFA 3UMVA 5JWOA 3L7JA 3MSXA 1G6HA 4P5EA 4Y30A 2ZT7A 4GMFA 1SIUA 1IM8A 5F76A 5EWJB 5F73A 3K0KA 1WMAA 4R2JA 2BGKA 2H0QA 3GYGA 2ZQYA 3V8MA 3PQFA 4MAMA 2Q2NA 2XE7A 1QIIA 2PSHA 2D8AA 2FR1A 1LTQA 2X2FA 3HWWA 3KQOA 4XDZA 3TUJC 3KFXA 3TVYA 3P7MA 3AXTA 3DMDA 1ZU5A 2F2TA 2PH7A 1NBME 2BDUA 4GKAA 4BC0A 3E27A 1ECBA 1RWKA 4GYJA 5LYJB 1OU0A 4B0OA 4JC4A 3DMFA 3L04A 3PXDA 3TNLA 3ABSB 1MEOA 2OLEA 5FP0A 4ZVPA 4QPCA 2R1UA 4U9HS 2XQGA 3CUSA 4UHFA 2XUZA 1ZJYA 2Q4TA 4RSRA 1G5HA 3QG5A 2O57A 2XGGA 4A03A 5CYOA 3RUDA 1Y4DE 1KTIA 4WOPA 3E9ZA 2ZSUA 4BVGA 1V2GA 1P9WA 3HYNA 1UJCA 3QBEA 1CUZA 1PLJA 3E5RA 4MUGA 3L92A 4IDBA 3T38A 5HDQA 1UIRA 1EP3B 3E3AA 1KU6A 4LEIA 1RWVA 4B6OA 3OZEA 1NNEA 2VYND 4IGFA 1J56A 4NQRA 4HNAA 4AO6A 5JCXA 5JANA 4LF4B 3Q1KA 2EV9A 3C6MA 3HFJA 3RLIA 5JVDA 5H70A 2G5PA 4OA5A 5DW3A 3VGJA 1IHPA 3DMTC 2ZXUA 2OECA 4PQRA 1N2SA 1ZMBA 2ISCA 3BRWA 3FDZA 3MZ0A 3OD5A 5AKJA 4JI7B 3AUJB 1U0NA 2ZPTX 3I01M 3RS2A 1JMKC 1HURA 1PR3A 4KFCA 1KVTA 2ERCA 1G2IA 2EDCA 1YZNA 2B78A 2FP4B 3AO0B 5G1PA 4FGJA 4J0QA 3V1YA 5C1OA 5JVDF 2VN8A 4MKFA 5K1ZA 2NUTA 5CITA 3GRKA 3OFSA 3AUUA 4ND5A 4Z53A 4WE3A 2J31A 3H65A 3OCZA 3RIHA 1XP8A 4ZANA 5FEUA 4TV9B 1KI8A 2W6JD 5LQKA 5B4VA 4RKRA 2WNSA 4W5HA 3B38A 2DCMA 2AJBA 1JF8A 3IUMA 5AJTA 4HDMA 2VNKA 1B8UA 1YZKA 1XZNA 4EUSA 5KTYA 4D98A 2GCNA 4RTKA 2O2HA 3G5MA 3EF0A 2OHJA 5IXYA 3ULKA 4MUNA 5E3HA 2GD0A 4R05A 1GAQA 3DD5A 4FCWA 3V4LA 3VTAA 2YS6A 4UHCA 4IAOA 1P3JA 4WLUA 1JSZA 1X7GA 1RJ9A 1XDDA 1BQEA 3ASUA 1CQZA 4BIMA 3QPCA 3OM9A 3GLRA 3PT9A 4G86A 4IEIA 5FDFA 3JQ9C 2C5SA 4NDNE 2YZ2A 1BYUA 1P31A 3SJUA 5ERGB 5B58C 2B8WA 3V9PA 3P32A 1W36B 4LIPD 2ECPA 4Q4HA 4P84A 1M7HA 1Y1TA 1YR3A 5YASA 2OAEA 3L8ZA 1SA0B 5DJ5A 4DR7B 1JIVA 2XE8A 4QVGA 1KK2A 1P2VA 1VE9A 2ZBEA 4JYPA 4N8SA 5TF0A 3ZWQA 2J6IA 4G0OA 4D4MA 4CKCA 4QGAA 1YBVA 2ZM6B 4IF4A 2QU7A 3K5WA 4PQFA 4RESA 1QH8A 1RHRA 1Y4UA 4YWJA 1Z0KA 3IP3A 2ZVDA 4Z7QB 3GRFA 4CT5A 1HOXA 2W48A 3F5QA 2P3OA 3KPYA 1XZHA 3VU3A 4QLBA 5A2GA 1WPQA 1PO7A 2I6XA 5PGMA 3CT6A 4MYDA 1IUNA 1RI3A 4F46A 1XOIA 2F8SA 4LTMA 1EK5A 2E4XA 3BS4A 3L1HA 4W9RA 5G3ZA 4ARZA 1CRWG 5HYVA 4L5BA 3DP7A 3SJZA 3WOHA 4AB1A 5FI0B 5IN4A 5T5QA 2QUAA 3EXG1 2GXAA 3O92A 1I3CA 2QVXX 5GP1A 3PRJA 3ZVKA 4NJMA 3RRNA 1R9NA 2CJFA 3RKRA 1XPUA 2P9HA 3K32A 2VSQA 1K97A 3A9CA 1SXPA 5SYNA 5F1YA 1WU8A 4OI4A 2FNAA 1UZLA 4OQQA 1SZJG 3BJRA 3OECA 2WTAA 3R0VA 3WKCA 4DQVA 5I9LA 2HWKA 4HDCA 3FYUB 4LMBA 3I4CA 2I7CA 2RGEA 5FPPA 3EDMA 1ETHA 4TVKA 4CCSA 4YXWD 2ZTLA 4YLEA 2ZRFA 5A3QA 3CVXA 4JOQA 4YYZA 1IVYA 3JU3A 1JR6A 3W8FA 1J0CA 1IN5A 1QC5A 1RE0A 3LUGA 4X90A 3HCBA 1DFIA 4PYKA 3NDPA 1KDZA 3TR6A 4ENQA 3UMMA 2WJPA 3MQ2A 3DVLA 1CIVA 1ZD9A 3QOFA 2ZJ8A 2NTVA 3LBYA 4Y2PA 4BHTA 1JU4A 3RANA 1K66A 3OT1B 1V9SA 4P93A 3PUWA 3BRWD 1R4ZA 1QU2A 1NPYA 3A6FA 2BN4A 5C7YA 3D3WB 3L84A 4N49A 4P4LA 3DM9B 4BLVA 5BSFA 3WL7A 1LUAA 1Q92A 3DUWA 4MV3A 3KB1A 5K3CA 4RZIA 3B7PA 1ENPA 2A30A 3GVPA 2YIVX 1A69A 2VJQA 2ZJ3A 4NV1A 4DBZA 4KWEA 2EERA 1X14A 4P7GA 5IBPA 1TQHA 3L0SA 4LTDA 4J9VA 4E1BA 4GXNA 4UTNA 1MABB 2I62A 4C03A 4EMUA 3PKZA 3K8OE 3LCJA 4GC9A 3GNQA 2NUAB 2I34A 5J3JA 6ADHA 1G2PA 3NAZA 2I1QA 1C9MA 3AGPA 4QXOA 5DYWA 3EVTA 3I73A 1YXMA 4X71A 4CKYA 1GITA 5EIBC 2X3YA 1YDMA 2Z1MA 4ZT7A 1JZTA 4RENA 4F3NA 1Q0ZA 2BM1A 1XFDA 2CMDA 1NJ5A 2OHIA 2VCEA 2WIAA 4HDSA 1DCMA 4WN3A 3W5HA 4AKTA 2C4UA 4LGVA 2CFCA 3H2SA 4EG3A 4R0VA 3MTBA 1RHUA 1JIXA 3V7FA 4ATNA 3M34A 3UK1A 3HY6A 4UEWA 5BV2P 4Y7CA 3W2IA 2OG1A 1PCXA 5CM2Z 2FSVA 3BCSA 1JAZA 3MGCA 4RSMA 1U6JA 4UPEA 4L85A 2X9LA 2C42A 5CGZA 3CVYA 1ZOPA 2I4NA 1LQUA 4L8VA 4QQNA 1ZG3A 3GDGA 3IHWA 4NI5A 4UCWA 3U09A 4IJQA 4WSOA 3E35A 1XCLA 4FDTA 2DMRA 3RFCA 3DOEA 2X15A 1B14A 4W9MC 3U4DA 4B6RA 3KTAB 1LLDA 1R9MA 2R11A 5AICA 1YGPA 4HF7A 2O0HA 1YH3A 2XKJE 4URVR 1XR3A 1RKVA 4GE3A 1VJRA 4KZPA 4V3BA 1VSUA 3ISTA 4NCBA 3U7IA 4C6TB 2YICA 2KM1A 3QJYA 3AZPA 1XMQB 5LNK6 4JMPA 5E4FA 3WIBA 2GZAA 5I9IA 1WW2A 3NGLA 2X7HA 1Z36A 4H60A 1M1ZA 2WQZA 4JUFA 2QUIA 1XQ6A 4KX3A 2WBLC 3C14C 2JG3A 5EKXA 1RLUA 4ZQIA 4A0HA 5D5HA 2G72A 1T4CA 2BYTA 2A9JA 4KVAA 3MLEA 3OQIA 3R3JA 4RCVA 2ZYSA 5B1HA 3LPDA 4GHWA 5AHRA 2ZYHA 1NUSA 3HRHA 4B8ZA 1GG2A 1BVHA 3OHSX 4WCFB 2OL4A 1KORA 4R0NA 2PUTA 2W2KA 4B9AA 3HKCB 4TOIA 4DCGA 5K0EA 3H19A 1TCBA 2YR0A 1AX9A 1B16A 3MTDA 5IAJA 5IEBA 3R44A 4W8HA 3T52A 3WKBA 3CJRA 4IVQA 5ER6A 1Z4QA 3ORHA 3L7KA 4EG5A 1EFPA 1ZXBA 5F52A 2HF8A 1EVZA 1F8GA 2P9FA 4XSVA 3N59A 4CMJA 2MSNA 4MYSA 2UUAB 2VJOA 2AC2A 2O54A 4RU1A 3PSHA 3KL2A 4ABYA 2GHRA 1FDSA 2V7TA 5ICSA 4FMBB 4L2IA 5TRTA 3R3VA 1K9SA 1HNNA 3I9JA 4FHFA 4UASA 2PQMA 4JB0A 3I2FA 3MMSA 4QHTA 3DFMA 4C1NA 1RXSA 4BMCA 2DFNA 4OJYA 2ZJ6A 3EOAI 5JNWA 2FPRA 2ID9A 1G16A 2JBWA 1OXTA 1GDDA 2ZTHA 3DXXA 3GIDA 3IPRA 4ILKA 4YQZA 1ZVKA 2RCNA 4UHBA 3TGLA 2J87A 3TZLA 1XWIA 2QW0X 3X1WA 4C2AA 2ZUSA 1FMFA 1EE9A 1N2BA 4R0MA 1SVMA 1PFGA 1NVUQ 1F4PA 3VI4B 4M1TA 4OGWA 4LZAA 4G8CA 5JO9A 3PUKA 4K5QA 5IYZA 1OKKD 2WINI 1G38A 3RUAA 4P7BA 5EUMA 4X95A 4PZ0A 3P71T 2I6SA 3KTFA 2BGGA 1PFVA 1E1QA 4PINA 2ZCVA 2WF7A 1YI1A 4GI1A 3S55A 1QB7A 1Z22A 2V65A 1W8IA 2GWRA 4IFEA 3R3SA 2B4TO 1EFVB 3SS8A 3C16C 1BE1A 1NDHA 4WCFA 4M6WA 3ZHBA 1U94A 4BWVA 3DQZA 4L4YA 4R5HA 5IM4F 2PUEA 1T3LA 1V5EA 4OUKX 5AUOB 4XPZA 5A7HA 4BX0A 1H2ZA 1YMQA 2J7KA 4HN4B 1G20E 2GHQA 2C7BA 3OZFA 1ZUNA 5E9QA 1JI3A 1UFRA 4BNUA 2W00A 4TYQA 4QXQA 3LFHA 2CF5A 4JJZA 1XTVA 2P9EA 4WAUA 5IEJA 1EWQA 4NYMQ 4AP5A 3MT7A 4D4IA 4LISA 5JJBA 1JT9A 4JZYA 1V9LA 5K0GA 2JARA 2VK2A 3CPHA 3TINA 3HA5A 4C6TA 5ANRB 4JOCA 4Z9BA 4YAKA 3ZQKA 3ETEA 4XRGA 2V3CC 1UPTA 2ZYRA 3AUXA 2AUNA 2HA3A 1VPEA 4XFJA 2ZWOA 2H2WA 1HDGO 3HB0A 2CNNA 1I7PA 2WP0A 3IBCA 2ISQA 2OOSA 3QQ5A 4RVGA 3R7AA 1L5WA 5IXSA 1K7XB 1M3SA 2VJDA 1MOPA 3H5IA 4WKOA 1HYQA 1JBQA 4QXAA 5CFRA 1FVHA 2W6OA 5LFAA 2V97A 4WZBE 4GH5A 4O2BA 4JU9A 1K98A 4ZIRB 4QREA 2QYSA 1AK2A 2P0EA 4NFHA 2ZI4A 5FFFA 3UTDA 1NIPA 4FDMA 4CQJA 2FFRA 1SZPA 2GN0A 1O6ZA 3ZHVA 1BDHA 4OX9B 1SN7A 4RGBA 1RIFA 4F5EA 3KYBA 1VC2A 1XX6A 1GPMA 1V5IA 1FFAA 4LOKA 3ZGLA 3A4LA 2C7RA 2JRLA 3S5JA 1RAHA 1ZCBA 3ZI7A 4PHTA 2GAJA 1R10A 4RXMA 5I7WA 4W9NA 1GU7A 2YXNA 3S70A 3CZRA 1DEHA 4E30A 3OJXA 1P7PA 2P69A 2W6IA 4QOJA 2ZU0C 2XUPA 2GD2A 3K9BA 3L40A 4XYBA 3QMVA 1VPTA 2A1TR 1X1AA 2ZJ0A 4B43A 2EW2A 3W34A 1E3QA 4C6RA 6YASA 2GZ1A 2MYNA 1UR5A 5L3VA 3RUHA 2H1RA 2DFPA 1UAGA 1GYPA 1DKMA 1XMSA 5CM8B 3ZZNA 4G85A 4IZ6A 1MABA 3DAOA 4I50B 2LD4A 2FPUA 4QXMA 5HS6A 4CCAA 3W5DA 3U44B 4OATA 3M4JA 1LI4A 2XMZA 5K03A 3D4OA 5DNAA 1C9EA 1KZGB 3WLEA 4JL8A 5ICGA 4OA8A 1OWLA 3FCUB 3AP2A 4ZREA 3VJMA 4EITA 4TTIA 1P1CA 3FNQA 3TTYA 4NEGA 2P4QA 1JILA 3KV3O 4EQ6A 5KNBA 3RJTA 3CLSD 3B6IA 3BORA 1E2PA 1PRYA 3A3OA 3RI3A 3L8YA 4E7OA 3BTSA 3TM5A 2PX0A 4KK4A 2ANBA 3B1YA 2VOEA 1NQAO 2P9YA 4Q4AA 5FL7A 3RYTC 1SPXA 1PDWA 2OCKA 3LDUA 3PXEA 4O5AA 2AXEA 1TLLA 2QP3A 5JEEA 2AVDA 1JALA 1JHQA 4QLOA 1U3FA 3O83A 5D01A 4YRZA 2Y2UA 4KHZA 1PT6A 3OQHA 1JR3D 2V3VA 3K05A 4QWWA 1NP3A 4IQ4A 4YCJA 3VZPA 4M36A 3T9BA 4I4TB 3FHCB 4UHEA 4X62B 1E9AA 3HO1A 1XG5A 4D79A 4EDFA 4EI9A 3IULA 3CH5A 3WNVA 1E2IA 1I4TD 2DEUA 4MA5A 3QMPA 5TEVA 3IILA 1L5SA 3Q0EA 4ZA2A 4EHFA 3AMVA 4OM7A 4Y1GA 3SVTA 1TT5B 4QOFA 4P3KA 1U2DC 2HT6A 2CLHB 1U0OC 3PEYA 3ESCA 1Y4SA 1LRJA 1Z7WA 1IEVA 3AQ4A 1CQXA 3PKJA 4P4UA 3EGCA 3HHEA 1EDEA 3OIVA 2J9FA 2QX6A 2NU9A 3N2ZB 1MA0A 2ZI6A 4P4NA 4EECA 3FMGA 3I01A 5EEHA 4ARSA 2QSUA 3DZHA 4BVLA 1DUSA 3LDAA 4BPBA 2XT6A 4EW6A 3NWJA 5CG2A 2V0NA 4JFAA 1XD2B 4NBUA 3STVA 4BBJA 1RQ7A 2R7NA 4DN6A 2FMTA 4Z86A 3KZVA 4IIYA 4W1QA 4NONA 2DE0X 2ZSIA 2IXEA 3DLPX 3PS9A 3QNMA 4DIEA 1TA4A 3RWOA 3LC7O 3AOEA 1QF6A 4LZJA 3MTAA 2JEZA 2PJZA 5KTNA 1WPGA 2BKLA 4QPNA 4TXNA 5KNBH 2I78A 4QT4A 1X1EA 1R4MB 2MT9A 2XODA 4IXMA 2O5EA 4QQ8A 1I51A 3USES 3G2JA 4O4JB 4LBZA 3WWYA 1RI4A 2DFLA 4XD7A 2OQRA 4EB8A 4ASUD 1BRTA 3ICWA 2JAOA 4J29A 2ZUTA 5BVGB 2J7PD 3WMWA 3MT9A 5ALGA 1RBMA 5AMXA 1Q6ZA 1J23A 1NF3A 4HH4A 3EUEA 2VG8A 3OQ6A 1EVYA 1PGOA 4MKHA 2VEDA 2YJNA 3DTVD 3L4EA 5T4HA 1DWUA 1QLHA 4U9IS 1PTJA 3B1VA 4Y2YA 1RLTA 4XOIA 4KQXA 2OD7A 1B8NA 5ECWA 1TLFA 2BELA 4EP1A 2J0EA 2PMBA 4CV0A 3S8EA 1IEWA 5C3MA 1PK9A 2XDQA 3BMNB 4MWCA 3ETJA 1Z88A 3TLYA 1RJ9B 2OAQ1 4HJRA 1EB8A 1VL1A 2Q27A 4GX1A 1DDIA 2VYNA 2XMGA 2FVXA 4QIHA 4EBFA 2VTBB 1KRXA 4FFBB 2CCGA 3K72B 1TA9A 2QT9A 4R51A 2DH5A 2YC2C 1LLFA 3M5DA 3RRBA 3DA8A 3QFTA 2YW9A 3RIGA 1QPZA 4GMGA 2OCYC 1XN1A 4TV9F 3RVNA 3X1KA 1Z0AA 4FE7A 4D3SA 2EKPA 1T8WA 1XRLA 2GLTA 1JG1A 3GEPA 4XLZA 4R1LA 4ZU3A 3GRCA 2XJ9A 5D7BA 3WYAA 2UYCA 1U04A 2P35A 3MMNA 1JFLA 4BY9E 4PYJA 5FBWB 2ZIVB 5FPSA 2CK3D 1N2CE 5MF6A 4DDWA 3D5EA 1SHJA 5TGZA 4TV9A 1DZ3A 3GQBA 1NYQA 2A3NA 2FR8A 3BULA 3DONA 4DJJA 1A8IA 2E9SA 2UXDB 5EMMA 4BKMA 2BGIA 4X8HA 1Z4IA 4NC9A 4QZVA 3IE0A 1M2OA 4GLJA 3B6ZA 3OAAD 3KHTA 1HPLA 3ED1A 4ND7A 3JY6A 3BA1A 3R8XA 1QG0A 2C0QA 3G8DA 3O03A 4Z4GA 1GGNA 4DXHA 1DTWA 3PB3A 1E2GA 3AK4A 1DJMA 2PSEA 2VKQA 4W1PA 4BZQA 5A5EA 3MWEA 2YVUA 3N2YA 1KGSA 1E7RA 4DLPA 1YZLA 1TL7C 3HCEA 5BT9A 1N7HA 1N5LA 4J75A 3SC2B 3E7DA 2M6KA 1BU8A 3NIFB 3HRIA 2JFWA 3JX9A 3CH6A 1L5VA 4MDHA 3GQVA 4YI3A 5I4IA 4KE8A 3B70A 5EJFA 3NHUA 2X4IA 1Z12A 1S89A 1WZNA 3WDMA 2ADOA 1VIAA 4DHWA 5JH7F 1CUXA 3S29A 1DPGA 1NQTA 5AKGA 1EUQA 4I1RA 3E15A 4EBBA 5KJFA 3K9FC 4Z7OB 5LMNB 3OX1A 4DEYA 2CDRA 2CEKA 3G2KA 4R8LA 2JGDB 4B3RB 3R7NA 3WIVA 4FYPA 4ZV9A 3W9SA 2IKQA 1RFLA 2M1ZA 4EFMA 5FOSA 5C5CA 5DCWA 4KQ1A 2EAUA 5KQGA 1ITZA 2QZJA 4EELA 4BX8A 3VYSB 1LCIA 2ZYAA 3DHVA 5B55A 1AF7A 4B3SB 1TCCA 3KT0A 3PJGA 1PR5A 4NZOA 5EZ5A 1BGWA 3T7AA 1NFFA 2BTQA 3NHRA 4OLBA 4IMRA 1M5TA 4U7TB 3JQ7B 1TK2A 4C87A 1A8UA 3CCFA 2QSZA 1E6MA 3QLTA 4DR4B 3IBTA 1Z7EA 1Q15A 4GWLA 1JEOA 1Q7EA 4WADA 1WDMA 3DBVO 3M6FA 3VAAA 2IS1A 1JSCA 2XA1A 2J33A 4OB8A 3N75A 1NUUA 4MWTA 1X6VA 4G0WA 2ZT6A 1OFVA 4HB0A 4RNDB 4CQNA 3KJGA 1YB6A 2EIXA 2Z2KA 1UBMS 1KPGA 4FXOA 4O8ZA 5DYYA 2O2SA 2YVLA 1RYFA 4DJEC 4YREA 4EHBA 4FR5A 5B58T 4ZYVA 2EX1A 4MQ4A 4Q47A 4RMHA 1R6TA 2VQSA 4NCHA 1RYZA 2J9ZB 4N12A 5FF9A 5IUKC 1FFXA 4ZAVA 4A2WA 4BNWA 3KPWA 4LRQA 4GSLA 2WB2A 2GA9A 2FOXA 5JRJA 3FMFA 5TJ9A 3TNJA 3C3AA 4CDGA 5CPFA 3P0IA 1BMQA 1JG3A 5BMVB 3IMKA 1WP9A 3UWPA 3DH0A 3WMFA 4A82A 1QVZA 2B5WA 4BNFA 3LBAA 5FBKA 5HE9A 1Q7CA 3V1KA 4BNNA 1QWOA 2IQ5A 1GM5A 2YMPA 1N2CB 1V1MB 1I3KA 2F3RA 3DEJA 1BCRA 3TBFA 1G8YA 1XQWA 1SHZA 3FE2A 3K2BA 4XW2A 3WHIA 4PHHA 2IVZA 4R81A 2I2XB 1ZD8A 4BVEA 3R7DA 1PDVA 1L4UA 3SSMA 4TWBA 2CXHA 2TMGA 1DRVA 1SWVA 2WK1A 2WSLA 4MLCA 3ROTA 3W4IA 2PA3A 1QV7A 3W5UA 4U8HA 1DAOA 1U1DA 2VPXA 3C5WP 3GMTA 4AWBA 3COJA 2GTIA 2M1XA 1U3UA 3RW9A 1LPBB 3BAFA 2A9QA 2WWXA 5DDIP 2ZBPA 4WK6A 4FYJA 4JL6A 4L95C 1J2TA 2P40A 3HXKA 3GOQA 3WLTA 4NARA 5BXYA 3VX3A 1G19A 3B1FA 4C4AA 2YV1A 1SBNE 2BMEA 2C3YA 1VE7A 4Q1BA 5I5EA 3T06B 1NUHA 4Q6BA 1E60A 3KVVA 4RPJA 1G8HA 2I55A 1INLA 4DTIA 4JX8A 1AKWA 5CVUA 4GIBA 3MCZA 4JCOA 1DO0A 1ENOA 1JPUA 4Y6OA 2OO7A 4AU1A 1L5NA 3UH0A 5A9RA 1GZ7A 3DKVA 3KEQA 3EMDA 4D3XA 4EVSA 4K9PA 2YL2A 4M8SA 4WXRA 5DX0A 4IO1A 4YV1A 4ZK2A 2P68A 1FQWA 4YDSA 1EWTA 3SMQA 4M0PA 5AJYA 5AJZA 5BNZA 2FEOA 1QP4A 1WCV1 4LRUA 1ZZGA 4D0NA 1D9XA 1KBZA 1Z73A 4LF5B 4RANA 2FETA 2DUUA 3CA8A 3GWZA 3HEMA 4UAGA 2VP0A 4C0SA 3SBEA 2EJTA 1C0PA 2W5UA 1SWWA 3KQKA 1NNI1 4A16A 2R3SA 2O8EB 2JAPA 3UK7A 4UE6A 5FNVF 3RFXA 1EUCB 3EC7A 5TMBA 3MTJA 1A77A 1GUYA 1VG1A 2OC9A 3PFNA 3Q7IA 3VHLB 4CDRA 4YUZA 4US2R 5ILOA 5ALVA 1W5SA 4J7AA 1XGKA 4PAOA 5FO1A 4AJLA 3LVRE 3KLPX 3NAQA 1XD8A 4PS0A 4Z99A 4JWTA 3KOOA 3QYJA 4P4SB 4F60A 5HRCA 1IXKA 5U4XA 4S1TA 4FKMA 3W6PA 4KYIB 2B4QA 3HEAA 3BWXA 4HS4A 3CF0A 5BWOA 3CKYA 2FJ0A 3WGGA 1A5ZA 3PC4A 4KQJA 1J0DA 3JVIA 5EI5A 1TEHA 3T41A 1RKUA 2QTWB 4KNWA 3IIJA 3A0RB 1JG6A 2P65A 2WRZA 5ICEA 4RC9A 2JCBA 5EMLA 3HNRA 2FFQA 5KYYA 4JP3A 4IDDA 3SHFA 2WHPB 2H2FA 1RPTA 2DPMA 1OLSA 4DBVO 3ITEA 5E7IA 2GYUA 3LC2O 2QTFA 1JA9A 1N25A 5JDIC 4UNPA 4PZDA 5IC5A 4BXOB 2QTAA 3T0GA 2GRJA 2ORED 4HAZA 2X7JA 2YQZA 2X13A 1V4VA 1T6XA 4BVBA 1QVVA 3GLIA 1XA3A 4J3NA 2XI4A 4II2A 3ZQ6A 4GM0A 2UZ1A 4OMUA 1QVWA 2H1OA 3NC4A 1TE2A 4NYJR 4YRDA 2XGSA 3NORA 5KS2A 2FFJA 5ARDA 2WYUA 2ZU6A 4CQMD 4CN8A 3FZGA 2C5BA 2HQRA 4LOAA 5FWXA 5AW2A 1O0SA 4X3CA 4PLGA 3KE8A 4PRLA 1GZUA 4DABA 3FI0A 3RBVA 1AK9A 4KR9A 1MB3A 3RC1A 3IAFA 1P33A 1XCOA 2V7UA 3QG1A 2QU8A 2QX9A 2IGBA 3H5WA 3BTUA 1KI1A 4ZOCA 3AU9A 5D3QA 2VNIA 4MYRA 4C4TA 4JOBA 2ZREA 2R5FA 1A2QA 5BUCA 2PZBA 3RSCA 2BH2A 3JZFA 2JVJA 3ICCA 3WYBA 1WD7A 2R8RA 3M6VA 1L5HA 1W5BA 4NESA 1E1QD 5JYEA 1BD3A 3G5