4JMQA

Crystal structure of pb9: the dit of bacteriophage t5.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
205
structure length
190
Chain Sequence
b'MRLPDPYTNPEYPGLGFESVNLVDNDPISAQYWGINISYPELFPDEYAFLDSRLLEYKRTGDYLDVLLPQYEAFRVRGDTKSVTIPAGQKGSQIILNTNGTLTGQPKAGDLFKLSTHPKVYKITNFSSSGNVWNISLYPDLFITTTGSEKPVFNGILFRTKLMNGDSFGSTLNNNGTYSGISLSLRESLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriophage T5 distal tail protein
molecule tags Viral protein
source organism Enterobacteria phage t5
publication title Crystal Structure of pb9, the Distal Tail Protein of Bacteriophage T5: a Conserved Structural Motif among All Siphophages.
pubmed doi rcsb
total genus 45
structure length 190
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.290 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4jmqA02
3.30.200.190 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4jmqA01
4JMQA
chains in the Genus database with same CATH superfamily
1F20A 3HDMA 4WBOA 3UPXA 1G7CA 2QO2A 4RWJA 5A14A 4UXQA 4BYJA 1N05A 5M44A 2DOGA 4Z4WA 2YIRA 3QKMA 4RX8A 2BROA 5JKGA 4Z1MA 3AVUA 3BCFA 1BKXA 4KKGA 3V5PA 3EN6A 4KRCA 2PSQA 3R21A 4CRSA 4YLKA 1YJNB 4LMUA 5KBQA 4DK1A 4L8MA 1TQMA 4FK3A 4BIDA 2E9UA 2W9ZB 4MXAA 5JZJA 3DDYA 3P5JC 5J1VA 2CNDA 2Y8OA 1Y6AA 1O6YA 5JZNA 3TG1A 2XNCA 3OZWA 2ITUA 1KOBA 1DAYA 4BDJA 4YURA 1WSVA 4XKWA 2QO9A 3QCQA 4QYGA 4GYIA 5FRIA 1ZOEA 1IB0A 5IYRA 2H6DA 3TYKA 2XNMA 4O7ZA 5EKOA 2VO3A 3EQDA 4F6SA 1ZZ2A 4DLIA 3C4CA 4X0MA 1WMKA 1ZLTA 1Q24A 4RX7A 4FEUA 2BHEA 3ORNA 4NKAA 4PGOA 3MN3A 2QLUA 1H1SA 2W1EA 1QUFA 3QZGA 3NIZA 3RNYA 4JQ7A 1U4DA 3FQHA 4GUBA 4H3PA 3PJCA 5FM2A 3ZXZA 1XR1A 3GXLA 4O0VA 1R5OA 2GS7A 2XB7A 1JLUE 5IDPA 4UAJA 3R9DA 2XK3A 4RVTA 2GPJA 3KK8A 4EHGA 2VN9A 2WEIA 4R71A 3CTQA 3OY1A 4FT0A 1FPUA 4GT4A 3DKOA 4YTFA 5CI6A 2JC6A 5IQHA 3E87A 5CLPA 3VO3A 2C3JA 3VQUA 3BX5A 5KNLA 5CASA 3FMDA 2ZJWA 1EXMA 2ITQA 3UG2A 3TUCA 4D5HA 3TUDA 4EOIA 3TKHA 4IIRA 3CPCA 4I23A 1N06A 5KZ0A 2V7WA 2X2MA 2X8KA 4FWTA 3IPHA 4LQMA 3SJPA 1UU3A 1NXKA 3GEQA 4MWIA 3K3IA 3Q5ZA 4MYGA 2GS2A 2XMYA 4PV0A 3HV4A 4FNYA 4IX3A 4IE9A 5IYNA 1OL6A 2OO8X 4D0WA 5FD2A 3S2PA 4NL0A 5FBOA 3QWJA 4TZRA 5CYIA 1SM2A 2PL0A 2C6OA 4G3FA 1KRHA 3OWPA 2Q6IA 3SLDA 2CLXA 4UYAA 5AP7A 4ZXTA 3LFAA 4MEDA 3SRVA 3ZDIA 4BDEA 5FO0A 2Z7RA 2QURA 4LM5A 2ZZQA 1ZWSA 5HIBA 4NM5A 5IK2A 1VQ9B 3Q4ZA 4CSVA 3QXOA 2FH9A 1Y0YA 3M1SA 4UWYA 1WOOA 3TWJA 2I1MA 4ZSJA 3TV4A 4ZSLA 1RDQE 3MY0A 3O5AA 2B54A 1UNGA 3K2LA 4FTAA 5DEWA 2VX1A 2X9FA 3JUHA 3HGKA 5AUZA 1CKIA 1DAWA 2XZOA 3C51A 2YISA 4R7BA 5IYWA 2QG5A 4B99A 3WE8A 2FA2A 4PTEA 5AUXA 1CMKE 4ZMFA 5IYPA 2J0IA 5E8WA 3COKA 1QCFA 5BVFA 2YM8A 1J7UA 3CY3A 4FIHA 1XH5A 2R5TA 5C4KA 4U7ZA 3TNQB 3G9LX 4NNJA 5TOZA 3ZBTA 2WMVA 4K33A 3E92A 3NRMA 1OUKA 4PL3A 2O64A 4TMWA 3RVGA 4BDIA 5J9ZA 3MBLA 4DH5A 4RPVA 1G5SA 1VYZA 5IUIA 3ONUA 2ZXIA 3W2FA 3QFRA 4GG7A 1BYGA 4HGTA 4YHFA 3CY2A 1JVPP 5GNKA 1V1KA 5HBJA 3C0HA 3G2FA 3VR6A 3KRXA 3QQLA 4NFMA 3SRVB 5EKNA 3W0QA 5CVHA 4EORA 4QP2A 2WTVA 3VF9A 3TJCA 3AKJA 1WZYA 3C13A 3R22A 3ZEPA 3WIKA 4AZVA 4M67A 2OTJB 4EJ7A 3OOCA 5M4UA 4RIYB 4L8JA 1LEWA 2YITA 4BDAA 4EH6A 2QNJA 3UDTA 5IH4A 5M51A 4BRXA 3L9PA 3Q38A 2ETMA 2I0EA 2WB8A 1OGYA 3BGPA 3QA0A 4O86A 3LQ6A 3P26A 5KMIA 4FKPA 3M42A 4MNFA 4NIFB 5ANDA 4Q2AA 4QNYA 2QG7A 2RG6A 2VO7A 4GS6A 2QOIA 4GFGA 3UOHA 3HMIA 4ASEA 3CCRB 2PK9A 4I6HA 4RX5A 4FEXA 3QRTA 2LZJA 2DS1A 2W5HA 3CQUA 3O8UA 2V31A 3SLNA 3CCNA 3QUDA 2YJSA 4ID7A 4GUEA 5AEPA 4NU1A 3SEJA 5DHJA 1UD2A 2B4SB 2YCFA 4MK0A 4O0SA 3SD0A 3AT4A 1KC8D 4P2KA 1T5EA 2PE0A 5ACKA 2HIWA 1M2PA 2VTOA 3EQPA 3V6SA 2Q6OA 1GIJA 1O9UA 3BLHA 4IW0A 2LGCA 5TT7A 4TNBA 2ITTA 2UUEA 2C5VA 4ZS4A 1CNEA 4FTMA 4C0SA 2QODA 5G1XA 3ASTA 4RDLA 3U54A 2Q6LA 1KMHA 2ZL7A 1OVEA 2XNBA 3SLSA 4CV9A 5AADA 1AIPA 2B9IA 4WSYA 2BM1A 1CM8A 3EJ1A 3MV5A 3E8NA 4OLIA 4ONAA 4R1YA 4U5JA 4WA9A 4B4LA 2V5QA 1BPLA 3PJ8A 2W9FB 1O6LA 3KMWA 4QDVA 4QEBA 2VWUA 2VWZA 5E8TA 2XA4A 3R1QA 2XGJA 1VQ8B 2CGXA 1B38A 4CTCA 3TCPA 5IEXA 2ITPA 3A61A 3R00A 5CU6A 3RWQA 4ZP5A 3SW7A 1FGIA 3LZBA 3QGWA 2H34A 4FIJA 1NB0A 2YM4A 4P1VA 5M07A 4DCEA 3WZDA 4R3PA 1G7RA 3QZIA 4FN5A 2X0GA 5JQ8A 4V05A 4I4FA 1PXKA 4QOXA 3IONA 3ASPA 1GIHA 3R8LA 3AD6A 3NDMA 4QMZA 2V7VA 4WNPA 2XEXA 1VZOA 2WJYA 3LLAA 5DN6A 3W0OA 3U6HA 4V01A 4RD4A 4FL3A 1SVGA 3CJFA 3SG8A 5A4TA 5HXBA 5A4EA 3W2SA 3BBTB 3PY1A 4GVAA 3MH3A 4Y9UA 2R3IA 3OTVA 2IW9A 4DEBA 4QHYA 4U40A 4WZLA 4DFLA 4U80A 3C50A 3KGAA 5IQAA 4Z4ZA 1XBBA 3BHUA 2OIDA 2YZLA 1J7IA 2R3OA 3BQCA 3PJ3A 2XIXA 2QEXB 1LPUA 4KINA 4YGAA 1PJ6A 4BC6A 2JBOA 4J96A 1BMFA 2IVTA 3D2IA 1ND4A 2VTTA 3KK9A 4X7DA 4JG7A 1GIIA 5E8SA 4F9WA 3ZCLA 4L42A 4Y72A 1PXPA 2YM7A 5THXA 4B7TA 3UPZA 4LUDA 4I6QA 4USEA 3FYKX 1E1VA 4DQKA 3VS6A 4C4GA 2Q0BA 4IBMA 2XAMA 4YC3A 1Y8GA 3OY3A 5M55A 2VBUA 1QFYA 3MCAA 3CR0A 4RQVA 4F1TA 3LE6A 4I20A 3FPKA 3UIMA 4BJJA 3AVYA 2JD5A 5AM7A 2RF9A 3GVUA 4FVRA 3RMFA 3PPJA 4DG3E 4WG3A 4AGDA 4QTBA 4FV7A 2GCDA 5JH6A 1PXMA 1U59A 1YI6A 4E5BA 3K5VA 1OBDA 1J3HA 1G8SA 4X7QA 3S1HA 3NGAA 5AA8A 3RINA 1ZYJA 2Z02A 2CNQA 3A1PA 2W1GA 2YCRA 5ANEA 2JKOA 2GU8A 4TYHA 4RDJA 4S34A 3GP0A 4JBPA 2QMUA 3UE4A 4DC2A 1M1KD 3TN8A 4II5A 1WVYA 3HMPA 2I0HA 3OEHA 1PMUA 3BL9A 2BZKB 5KHWA 4RD1A 4BDFA 1OIUA 4LBVA 3KU2A 1WCCA 2F9GA 3R01A 4RBLA 1H8HA 2O63A 2IW8A 4YZ9A 5JK3A 3PG3A 4MQ2A 3QX4A 4OOSA 4ZGNB 4PMSA 3RPYA 3WOWA 2OBRA 4PDPA 3HUCA 5DRBA 5EHOA 4CKJA 2B5OA 2YIXA 3KN5A 4FNXA 2A0CX 1AD5A 2VTSA 3KC3A 3O71A 3QTZA 4BI0A 3KRJA 3LFSA 2JAMA 2J4ZA 2BMWA 2G01A 2WZJA 4PC2A 3LMGA 4YELA 4W8DA 4YHTA 1YXXA 3R6JA 4IB1A 4J97A 4WG4A 4ASXA 1W98A 4D1XA 1VYWA 4MTAA 4FI1A 4RPBA 2C3IB 3PA3A 2ZTNA 4J53A 3OW7A 2EXCX 2UW4A 5HNBA 4AWIA 4TL0A 2ZV2A 3LXKA 3CMEB 1VQ5B 4C43A 4II3A 4KKSA 3JY9A 3QF9A 4FKUA 4C4HA 3AMBA 4OTIA 4ACDA 3CLYA 4U9UA 2P0CA 2YM3A 3CE3A 4IM2A 2J0JA 2W1HA 2XBJA 4NYEA 3Q6RA 2A4LA 4X3FB 3B8QA 3W10A 2R3LA 3I79A 4JI9A 5AJQA 4BCJA 4DA5A 3F3TA 4YNEA 5IZFA 5LVOA 4HGLA 4AT4A 1JBPE 1MRYA 4IMYA 1OB3A 3JYAA 4IAIA 4KABA 4EHZA 2E1BA 4HYHA 2NPFA 2G9XA 4NW5A 3UOLA 3UP2A 4A7CA 2OBJA 4QQJA 1YQJA 3A60A 3D5VA 3OXIA 3Q53A 3A8WA 2UZLA 2HK5A 4W4XA 3GB2A 4IJPA 4BCNA 4HW7A 1SYKA 1RQQA 2VNYA 4ZTNA 3F3WA 5T6KA 4DEDA 1DS5A 2ZV9A 2KTYA 1Q99A 4PDOA 4TWPA 2QN6A 3BZ3A 1GVHA 5CANA 3RAHA 2ONLA 3FI3A 4C61A 1EFRA 2YHVA 1OGUA 3Q6UA 2PWLA 4GJ2A 4IFGA 4NBSA 3KL9A 3BYMA 4YJTA 3IGGA 4CFWA 3F3UA 5J9YA 4H39A 3G05A 4HE5A 4GK3A 1EP2B 2B1PA 4PNKA 4MNEA 2PLFA 3PTGA 3ACKA 3RKBA 4FT9A 3UYTA 3P08A 4FL2A 2I0VA 3CPWB 2QO7A 3ZRMA 4A4XA 4MXCA 3CXCB 3CC4B 4M14A 3E62A 4IVCA 4J98A 3PWYA 3IO7A 4HVGA 3SG9A 2BGIA 3R1NA 2YDKA 3KY2A 3QUEA 4X2JA 4G6NA 1S9IA 5AWMA 5I9YA 3RM7A 4FNZA 1J9ZA 3UNZA 3ASSA 2XKEA 3SJZA 2X39A 2Z8CA 1PJKA 2CHLA 2ZZFA 3LCKA 3BELA 1AQ1A 3DFCB 3GUBA 4KIQA 2X53S 4ZY6A 1WBPA 4L44A 3T8OA 3O8TA 4XRLA 5LVPA 1SKYB 2BM0A 4P26A 3OG7A 4F99A 5A54A 1STCE 4UWBA 2C1BA 3NUNA 1K2PA 4L3JA 4B3GA 3DK7A 2XNGA 5CU0A 2I7QA 5AFVA 5IA4A 2JIIA 4FZFB 4BI2A 3FJQE 4IVBA 2C2WA 4QP7A 4FTNA 4TNDA 3SV0A 1FMOE 5L8KA 4IEBA 4P90A 5F4JA 4MYUA 2BRHA 2QOHA 2DYIA 2ERKA 3JU4A 2X4ZA 3NUSA 2X9EA 3DTWA 4QYHA 4XP0A 5EM7A 4CXAA 4CFUA 3MJ1A 2OG8A 5HNIX 5IQCA 4EKLA 3R7VA 4AXDA 3QBNA 3WZEA 1DDGA 3FKSA 1WBWA 1ZAOA 3QZHA 4YZCA 4BCKA 4AZEA 2GK7A 3EFWA 2R2PA 2P3MA 4ZLOA 4E7WA 4QQTA 4G9RA 3TUBA 1YDTE 1IRKA 3AGMA 4M8TA 5EMNA 2HZNA 2IN6A 2Z60A 3EFKA 3R1YA 3CP9A 3V51A 4X8IA 3U55A 4LC0A 3DTCA 4MD8E 4AZSA 3ASQA 4OP7A 3BU5A 3DAEA 2P33A 3CMAB 4FUYA 4MXYA 4QMMA 3ROCA 3QQFA 5HTBA 3R2YA 3A2CA 1Q4LA 2OK1A 2W4OA 1OKYA 3MPMA 4ITHA 1PF8A 2OSCA 4XG4A 3A4PA 5CS6A 5HVKA 5EHYA 4DQLA 3OD6X 4M15A 3VUGA 4GU6A 4LGGA 2XEYA 3GU8A 1OKWA 4O2ZA 2CJMA 5CZHA 4OBPA 3JVRA 2OXYA 4HZSA 4UZFA 1XQBA 5AV4A 2PUUA 4BHNA 3R9OA 1LP4A 4IX6A 5BMSA 4YNOA 3QD3A 5DT0A 3KFAA 3BRBA 3E7OA 4YC8A 5ETAA 3H3CA 5ANOA 1BL7A 3A99A 1YWVA 2NPQA 3BIZA 3AC2A 3FLSA 1OITA 3OFMA 3PSDA 4LYNA 4GIHA 4G6OA 4RD0A 3R8VA 3HP2A 3PXFA 3PSBA 2JJ2A 4NCNA 4PAAA 2YZAA 1YIJB 4UZHA 4U97A 5DR6A 2UZEA 4G31A 3G0EA 4U42A 2RIOA 4P3YA 4QVAA 3VO2A 1GAGA 3PP1A 5LWMA 3A7GA 1M17A 2OLCA 4QQ5A 4XP3A 4MCVA 1V0OA 4LV5A 4WD5A 1UA2A 2W4JA 3W0NA 3ZO4A 3PWDA 2D9RA 1YKRA 2IO6A 3G90X 4FV9A 4E1ZA 3MVLA 2ITNA 5FDXA 4BZDA 2WMRA 4F0GA 5AUVA 2UZVA 2G2HA 3LAUA 2JDTA 3QCXA 1SKQA 2QVSE 4K1XA 4DGGA 4CKRA 1B2RA 3RPRA 1K28D 2PZ5A 4WUNA 2OI4X 3HDNA 3UOJA 3GU6A 3KREA 1IAHA 1R0PA 2BZJA 3BU6A 2IJMA 3G5DA 3QD0A 4C4IA 5M4CA 4EZ7A 4LI5A 2QQ7A 2FUMA 3A7IA 1Q8TA 3PSCA 4BF2A 1QGZA 2VTQA 4LBZA 2RFDA 4RG0A 1UNHA 1F60A 1J7LA 3PLSA 4FIIA 3WYAA 2C78A 4PP9A 5HLWA 3P0MA 2ITVA 5EM6A 3R83A 4R3CA 4GW8A 3VNUA 1JA0A 3V5LA 2VTPA 1FRNA 4DHIB 1KWPA 1COWA 4G3DA 3FZTA 5BV3A 3MVMA 1UU7A 3R2BA 4QTDA 5DOSA 3ZM4A 4ARKA 3NS9A 4C37A 5E8XA 2PZYA 3UBDA 3C0IA 2VWWA 3FQEA 4WNOA 2X4FA 3H94A 4Y9RA 4FVQA 3DAJA 2XH5A 1N07A 3RAKA 5HO7A 2Q83A 3UQCA 5JQ5A 1WBOA 3AVTA 3KF7A 1WBVA 4H36A 3JQPA 3R73A 4C3PA 5HZNA 1H1RA 1G3NA 2F2CB 1BX6A 2R7BA 3P9JA 4YBKA 4BCPA 2J5EA 3UG1A 4EH4A 2BAKA 2PMOX 4L01A 5B7VA 3AGQA 4W4YA 4DAWA 2HLDA 3A7HA 3NCGA 5EI2A 3DV3A 1GZOA 1QFJA 3VS2A 2GHGA 3EN4A 3U6KA 3H0ZA 4FKTA 3E3PA 5DPVA 4AGUA 3PJ1A 3HV5A 5DSZA 2DETA 4LDTA 2OJGA 5FTQA 3VULA 4KBCA 5CI7A 4AGWA 5LMAA 3WF5A 4MYTA 4KKTA 3QLGA 4FKSA 4YLLA 2QTZA 1YJWB 1EH4A 3V6RA 4DCAA 4CLJA 4DEAA 5E91A 4D2SA 3OP1A 4FSTA 5DE2A 3R9HA 3RTPA 4PP7A 1NY3A 3VS0A 2GNGA 4BIBA 4YO4A 3NSZA 4Z4TA 2VD5A 5EI8A 5GJDA 2FGIA 3GVLA 3A8KA 1OM1A 4AP7A 3GOPA 5H8GA 3VNVA 3DY7A 5K5XA 3H9FA 3UJGA 4Y95A 3BYOA 4S32A 3V8TA 5K5NA 3LQ8A 4CNHA 4EH3A 1V0BA 2LAVA 3EWHA 4TWOA 3AMAA 5H9BA 3S0OA 3SGCA 3AGPA 1CTPE 5LMKC 2XAOA 4DNTB 5JGDA 2C6KA 2W99B 3OUKA 3QD4A 1ZY5A 4X2FA 4E6AA 3U6BA 3W2RA 4G7WA 4AXEA 4UX9A 3TV7A 1WU8A 3FZPA 1JKKA 3UVPA 2OIQA 4NH1A 4D4RA 4FTRA 4XS2A 3I0OA 2WTKC 3HZTA 4U8ZA 3UZTA 3LJ2A 2XYUA 2RKUA 3NNVA 4QMXA 3PP0A 5LMZA 3ZLWA 4AN9A 5HO8A 3JVSA 3MMPA 1OECA 3PXQA 3VBWA 3N4VA 4BCFA 5I4NA 2E9VA 3OJWA 5EOBA 1VQ4B 4FTCA 4PNIA 3NAYA 5EDQA 2OTLB 3NUUA 2RFEA 2DCUA 1MQBA 4I6FA 4Z4RA 4X6QC 5J5SA 3CCSB 4G34A 4BGGA 2W7XA 3RCJA 4Z3VA 2OH0E 3SQQA 1G8AA 3IDCA 4JIKA 5CT7A 1OL2A 3QU0A 1PKGA 4FKQA 5HQ0A 1E9HA 2QKRA 1B39A 2YM6A 3KB7A 3OS3A 5KKRB 3NAXA 3V7AA 2VGPA 1RW8A 3DT1A 3FZSA 4O21A 4P7EA 4U81A 5GHVA 3ZSGA 3BHVA 5I9WA 1H1WA 4XLFA 4GG5A 4O84A 3U87A 3HRBA 4OW8A 4FZDB 3FC2A 3F3VA 4WUAA 2VGOA 3DJ6A 3HAMA 3LLTA 3LQ3A 3R02A 4ZLZA 1PMVA 3WYXA 4F70A 5LARA 2CBXA 5I9XA 3PPKA 5EFQA 3CKWA 2HCJB 3KVWA 1WOSA 3E88A 3F5PA 4GYGA 3VONA 3UMWA 4AXAA 1QPCA 1VQLB 2CK3A 1U54B 2QC6A 2W0JA 3C4WA 1R39A 4IAFA 3ULIA 3PZEA 2XJ2A 3ZRLA 1H85A 4Z16A 3BYUA 3KRWA 5LJJA 2YAAA 4MD9E 4Y73A 4QV2A 2BR1A 2VTMA 4AXFA 2PMDA 3HUBA 5H8BA 2E1RA 3E8EA 5TR6A 4TMTA 4UALA 2HAKA 2EB3A 4RIXA 2OYNA 4N4SA 3NW6A 3C0GA 3TL8A 2JDIA 4G2FA 1H1PA 2Y6OA 1OMWA 2BAJA 1Z9XA 4IZYA 4PQNA 5HESA 3OJXA 3B8HA 1QPEA 2Y4PA 1QX4A 4XOPA 2ZDUA 3BCEA 3DBFA 1DI9A 3HNGA 3PFYA 3ZOSA 1H4LA 4P3IA 5KW9A 4XLHA 3Q60A 1PXOA 4HYIA 2IZUA 3QRKA 5CSWA 2C6DA 5F20A 1KK3A 3W2GA 2ESMA 4AUAA 3NYOA 3CKXA 4HJOA 4YJVA 5ANKA 5JFXA 3FMMA 4MNEB 3LFQA 5DH3A 2RGPA 4XG2A 3AC8A 5B0XA 2CF4A 1N08A 3S3IA 2OJIA 1XBAA 4FGBA 3RI1A 4ACMA 4C33A 4QTEA 4R1VA 4GFOA 5H5JA 5CWZA 4AXCA 1VQMB 3F7WA 4ZTHA 4XL9A 4A9UA 4Z55A 4XLEA 3W0SA 3H9OA 3K3JA 4U0IA 3DZOA 3CCLB 2BTRA 5CU2A 3WARA 4PDYA 1XMMA 4USFA 5L2WA 4P25A 4ZSEA 2BFYA 1E1RA 3LOKA 1UV5A 3O23A 3P5KA 2B7BA 3FE3A 1G7SA 2OXDA 3ET7A 4O91A 4ALWA 4E6QA 3L8XA 1T46A 4EBWA 1VHOA 4FT5A 2BF4A 2AC3A 4ZTLA 4ACAA 3VRYA 4ZSAA 3EL8A 5EW9A 2PUPA 4GVJA 1JSTA 4M1KA 5AUYA 2HW7A 5M09A 5IEYA 4PMPA 3KKVA 4N6YA 3MH1A 5IEVA 1I18A 5CY3A 2Y4IB 3SW4A 4GMYA 1KTVA 4PL5A 5BVWA 4M4SA 1IAJA 3KN6A 2PVRA 1Q62A 2VU3A 4HE6A 5FA6A 4NKSA 5ANIA 4JQEA 4S2ZA 1UVRA 4A9YA 4AX8A 4YMJA 4IADA 4K11A 5HE1A 4DGLC 3FC1X 2DERA 2WIHA 4DTBA 2BKKA 3NE5B 3ZO2A 3GOKA 2OICA 3QA8A 3FLWA 4LL0A 2X8EA 1XBCA 3VMFA 5BVNA 5IYQA 5KCVA 4FEWA 4NJDA 2YA9A 5LXMA 1U5RA 5F4MA 2VTRA 3FI2A 4FUXA 3TEIA 2FSLX 1PRYA 4RVLA 5LVNA 3HEGA 2J0LA 1BQEA 2VBVA 1B23P 3AQVA 4BDBA 3OPOA 3OBJA 3Q3AA 4Y46A 5HVJA 5C8MA 4XR6A 4EHEA 5IISA 2R3QA 4A06A 1H42A 5L2TA 5A6OA 3UO5A 4B6LA 3I6UA 1GJOA 3MW1A 4ACHA 2XCHA 2ZMDA 4X7CA 2XK7A 5CVGA 1VQOB 1OL1A 3HMMA 1W0XC 3E3BX 1E43A 4Y7CA 2UZOA 3IKAA 5HZBA 3KVXA 3QSYA 5C01A 3RPOA 3OXTA 4BCMA 2X8DA 3F6XA 4X6RA 5CAOA 1H24A 2PVMA 3FKNA 5D10A 3CD3A 4FSUA 5BPYA 5HKKA 2F2UA 3OBGA 2WEVA 3Q4UA 1OKVA 5CU4A 4ACCA 4E4XA 4YEJA 2X6DA 3BLAA 5I5ZA 4XQFA 3HA8A 2IZRA 4OGRA 4QDEA 1YLOA 4LRJA 2W1DA 3DNEA 2A19B 4FOBA 4KKHA 5DR9A 5EM8A 4DINA 2UW8A 3L8PA 5DFPA 2QDXA 4DFNA 4E4NA 5IA0A 4A9TA 2JN9A 5EOLA 5EI6A 4IAKA 5DEYA 4O6EA 4C58A 4RD3A 4TYEA 3VW8A 3ANQA 2W06A 1S0UA 2YWPA 1X8BA 3KRRA 3PE1A 4ZTMA 4TWCA 4FV8A 1H08A 2XKDA 2HZ0A 2HXLA 1EWYA 4FSQA 1KOAA 4LOPA 5FXRA 2HXQA 2R3PA 3LQEA 4ITIA 2J5FA 3CTJA 5LCKA 2CN8A 1QGAA 1N8RD 2X8IA 5HU3A 4UZDA 2OK8A 4FKIA 3BGZA 1R1WA 2ZM1A 4BN1A 5AM6A 4ZY5A 3F88A 2CPKE 3D9VA 3GFWA 4JX7A 5IG1A 4XKVA 4JAIA 3W18A 1ZM2A 1FMKA 3G4SB 4RJ6A 4PTCA 5AIRA 4JG6A 1I8DA 3E64A 4FZAB 1Q8WA 1XB2A 3LMHA 1RE8A 3QTQA 5A3XA 4CFXA 2C6TA 4NW6A 2UZDA 2RG5A 5AAFA 2HWPA 2D3LA 2BFXA 3R30A 4ZCIA 4TYIA 3EH9A 3LXNA 3NWWA 4O7WA 3FAAA 4IJ9A 3FLQA 3BQJA 1YOJA 3DAKA 4EK8A 3ORZA 3O7LD 4FV6A 2OIBA 4I93A 4X2KA 3G33A 4NM7A 4JOAA 3SA0A 3NUYA 3PVUA 4ANSA 4B48A 5D9HA 4D58A 2OJFE 3W32A 1JB9A 2W6IA 4QPAA 4G1VA 2PULA 3FHRA 3KIOC 5IA1A 1FNDA 2HENA 2VTAA 3NNXA 4RWKA 4AOIA 4ZLYA 5HU9A 3V76A 3R63A 4XUFA 3JPVA 5HEZA 4BDGA 5J8IA 3D26A 3T53B 4IB3A 4M0ZA 3ZSIA 4A9SA 3ALNA 4FA2A 3VO1A 3TV6A 3OEEA 4X07A 2UW0A 2QCSA 3A62A 4OTGA 3OT8A 2ZYBA 3RK7A 4YTCA 3CTAA 4QYEA 3BY2A 3I56B 3UDBA 1REKA 2UVZA 3RJCA 4DHJA 1AMOA 2PYWA 2GMXA 1SMHA 1VQKB 2BDFA 2PE1A 4IC7A 1SM4A 4OTHA 4USDA 2XOKA 4KB8A 5CSVA 1ST4A 1IJFA 2IPXA 2R7IA 4FKLA 4BICA 5AAGA 2BHHA 3F2RA 3VHKA 1H07A 5A4LA 4ZJVA 4XD7A 4X0CA 5M08A 3TDWA 4CRLA 2C30A 3DDPA 2J7KA 3JQRA 2W05A 4L00A 2C5YA 5JN2A 1OHHA 4RIYA 4U6RA 3LCOA 4J0QA 5FO1A 4CGAA 3V5TA 4M0LA 4EK4A 3CD6B 2Y7JA 2XNOA 4F4PA 4AGCA 1MP8A 3KMMA 1VQPB 4KKUA 3LFCA 4GCJA 3GCQA 2ZMCA 3DKCA 5DN3A 3OCTA 3QQGA 4BR3A 1FQ1B 4H3BA 5J1WA 2HW6A 4XH6A 3CS9A 4YZNA 3UZPA 1R5NA 3NFGB 5TO8A 4KS7A 4IW3B 3NVMB 4TT3A 4EOOA 2YABA 4XLAA 2VTIA 3A3BA 3WNBA 2ZV7A 4OBOA 4JS8A 4YSJA 3FPQA 5TV2A 3E8DA 3E1YE 4HNFA 5F4OA 4BBFA 4EHVA 1Q7YD 2XKCA 1FNBA 4EOLA 4OOVA 4YPSA 3NUAA 3LIJA 3ID6C 3HECA 4M84A 5BVKA 4EK6A 4IWOA 2JIZA 2X6WA 5GV8A 3HRCA 4O0YA 4WHZA 3VF8A 1XH8A 1QH0A 3ZDUA 3LVBA 5C8NA 5KMMA 4QMSA 5F1ZA 4AC9A 4BCOA 3TNWA 4I0TA 3MIAA 4I4EA 3J81k 4QNAA 2WQOA 5BYZA 2NO3A 4FMQA 2XRWA 4XOTA 3BL7A 3GC0A 3LFDA 5CNNA 4TKOB 5DLSA 4K6ZA 1VLOA 1V0FA 4JBQA 4O81A 5DIAA 3ULZA 3KRLA 2BALA 1NA7A 1V5VA 3UODA 4F9CA 1UNLA 1R0EA 4P22A 5KMJA 5DVRA 4EQMA 3GVJA 2ITZA 2W5BA 4M53A 4EQUA 4DK0A 5L3AA 4Z4YA 4ZZMA 4P5QA 4XMOA 4O7SA 1W83A 3ZRKA 3H4JA 3QFVA 3MGYA 2E9NA 4KIPA 3A4OX 4FSWA 2GTMA 2RFSA 3ZC6A 3DZQA 3FY0A 4FIGA 3WNCA 4KBAA 1PYEA 3PUMA 1TQIA 4QP9A 4IDTA 2WGJA 4U3ZA 3W0MA 3EHAA 1CDKA 4JQ8A 4C4FA 5FL7A 4KIOA 3UNJA 3VBQA 3TNPC 2C5OA 1O6KA 4O7LA 3VUDA 4AF6A 1VHEA 4IWDA 3I81A 4DF3A 4C2VA 2XNPA 2WZNA 2AYPA 5I9ZA 2GPHA 1ZY4A 4CFNA 5JFSA 1E1XA 2FB8A 4FIEA 4TYHB 2ZVAA 4YO6A 2WU7A 2ZITA 1XH7A 3ERKA 2PUIA 4KAOA 3NYVA 5HG9A 4IVAA 5L46A 2WMQA 3BBWA 3FYJX 2B9HA 3N51A 4YU2A 1UU8A 1PXIA 5HORA 4RRVA 2V7XA 1XJDA 3CESA 4X05A 2CNVA 3LCDA 2UZWE 3ORPA 3OHTA 5EDRA 3UQGA 4O0WA 3GIRA 4EWQA 4F7LA 4GIIA 4O38A 4Z7HA 3NNUA 1XH6A 3MDYA 3D2KA 4G1WA 4FV3A 5F4NA 4TN1A 1OGJA 5ACBC 2G2FA 1UD3A 2JIUA 2X81A 2CW5A 2XNDA 4WOVA 4YR8A 2ZM3A 1WTHD 4WRGA 2PMNX 2UVYA 3MSSA 1GR1A 3P79A 5DRDA 3BEGA 2VNHA 2ITOA 3KEXA 3MS9A 1F0QA 1BLIA 1KUTA 2ITYA 3MIYA 3PIZA 3VJNA 3PLAE 3R7IA 4AE6A 4EZ3A 3PIXA 4OT5A 1KK2A 4RLKA 1U54A 2V55A 2JAVA 3ZIAA 4FIFA 2ETRA 4FG9A 5CSHA 1L3RE 1YXVA 2O65A 4U44A 5HE0A 1J1CA 2WU6A 2UZNA 4AG8A 4DNRB 3QTIA 2ZL6A 4AQKA 4RDKA 1WP6A 2WPDA 3P1AA 4FE2A 2RC5A 1YHSA 2A1AB 2DUVA 5CXHA 3KXNA 5JGAA 2BV3A 5HBHA 2WPAA 3TACA 1OL7A 2YFXA 2GTNA 3MH2A 3QZFA 4ZIMA 2ZM4A 3DPKA 1W2BB 3BLRA 3UDZA 2R6HA 3QCSA 4CKIA 1M7QA 3EFJA 3R71A 1OUYA 4JBVA 4DEIA 4LV8A 3C9WA 2UW9A 3BQRA 4AW2A 4O83A 2ACXA 3DS6A 2YAKA 4BCIA 1UU9A 2BRBA 4M7IA 3TNHA 1VEBA 1A8PA 4WWVA 2JLDA 3HV7A 3ZXTA 4E8AA 1S4MA 2OF2A 1D8TA 4ACBA 3EN9A 2R64A 4I0SA 3MVHA 2PVNA 3OCGA 5BVDA 2BRMA 2C6MA 2F57A 1KK1A 5FNZA 3GQLA 5EW3A 4FKJA 1Q8ZA 4MWHA 3MY5A 4JAJA 3EYGA 4L45A 3V8WA 3QYZA 1YJ9B 1URWA 1YITB 3LQ5A 3FJOA 4CMUA 5IA3A 3T56B 4HOKA 2XKFA 3FI4A 1BI8A 2XEZA 1GZ8A 3DJ5A 4JDKA 3UMXA 4EOJA 3N9XA 3PVWA 3Q2JA 3AVVA 4QYYA 5EK7A 1M14A 1BUHA 1SNXA 3M2WA 4MF1A 4RVMA 4DGMA 3CBLA 4BHZA 3Q3BA 3WF7A 1VLRA 2WTJA 1TVOA 2R3FA 4FTLA 4QT1A 5FP5A 3EOCA 2XIYA 4FR4A 5CVFA 4A07A 3EQIA 4NM0A 1NRKA 1PKDA 3IDBA 3Q9XA 4PF4A 4B8LA 3BHTA 2CSNA 5FLFA 4JR7A 3RP9A 2X0KA 4AF7A 4C7TA 4DEEA 1GAQA 4DFXE 1URCA 4B43A 1KQSB 1KE9A 1PMNA 2W1FA 4YJQA 1OIYA 3GVKA 4RQKA 3ZLYA 1IASA 3WI6A 1WDTA 1I44A 3C1XA 2RFNA 1DDIA 3D5XA 2ITWA 3AT3A 3O50A 3BHHA 4IDVA 3FMJA 3CC2B 3ZC5A 5L2SA 3EQGA 4FV2A 2NRYA 4B4DA 1H01A 4XORA 2R3RA 3QQUA 3TZ9A 4DT9A 4R7HA 4YZMA 3QFCA 2F43A 4JRVA 5IU2A 3K5UA 5K3YA 3SXFA 3AKLA 2VBTA 2H96A 5ANJA 4KKEA 4YP8A 3ZS5A 3ZMMA 3I6WA 2PVFA 2G1TA 4FV0A 3V04A 3ZLXA 3GCVA 5CXZA 5DGZA 4NTSA 3HKOA 3WILA 4ANMA 2YEXA 5E4HA 1CKJA 3NVKI 3O7LB 5M56A 4I6LA 2XUUA 4UV0A 1U5QA 3TT0A 2R0IA 1E63A 4XLCA 2JDVA 3UO4A 4EOPA 3WQZA 1CQXA 2WELA 2XVDA 1YHQB 1YI3A 1BX1A 3AXWA 2YWEA 5GV7A 3DKGA 4K1BA 4C34A 4DEGA 3OZVA 1ZZLA 2AEGA 4RVKA 4F64A 1K9MD 2EU9A 4FKRA 2OF4A 2WAJA 2GQRA 4QMYA 3FI8A 5JSMA 2JFMA 3TKIA 2PMLX 1J1BA 1KE8A 3WY9A 1MRUA 4FK6A 3G6HA 4W4WA 5C27A 2QOKA 2OZOA 2VNIA 3PVDA 4L3LA 5KZIA 4RC4A 4Z7GA 4L67A 4ZMEA 3LM5A 2W1ZA 4FSRA 4V0GB 4IZ5A 2FSOX 1TUIA 2JJ1A 3GT8A 2VWXA 4ZTQA 1Q3WA 5IH5A 5TF9A 3VIDA 1KV2A 5A6NA 5A9UA 3MPTA 5E8ZA 2R3NA 4G5PA 4ZTSA 2HY0A 2QI8A 4J99A 3F9NA 4M12A 1H0VA 2VTNA 1UKIA 4L7SA 5BMMA 4CT1A 4Q9ZA 4QYFA 3UTOA 1JWHA 3W2CA 4GH2A 4G17A 1YHVA 4UN0C 5A89A 5CQWA 2ITXA 2VWVA 5CDFA 1J91A 2PY3A 4KSQA 5D1JA 5EW8A 5H59A 4MKCA 3SAYA 5BSXA 2R4BA 4LG4A 1OPKA 3MTFA 4ZEGA 4L43A 3OAAA 3DLSA 4XBRA 1DARA 1XKKA 4HNIA 4XCUA 1S9JA 4FT3A 5BUEA 3A3GA 5C26A 4IVDA 4D2RA 5IUGA 5EM5A 3BH4A 3IG7A 1APME 3DXQA 4FV5A 2F4NA 4RJLA 3CCJB 1JKSA 4NWMA 3ATTA 4K2RA 4P2NA 4TSFA 3FXXA 4R78A 4FTIA 5IQFA 4D9UA 4WQMA 3R6KA 3D7TA 4FV4A 4JX3A 4BBEA 4JT3A 5JGBA 3QYWA 3BCDA 3F5UA 4B3XA 3PY0A 3OT3A 2C4TA 1T6ZA 1YOMA 2JKQA 3MI9A 5D7VA 2R9SA 4EKKA 3MY1A 1YDSE 4I94A 3P86A 4RGJA 3PUNA 3I7CA 3N4UA 3NW5A 3ODYX 3WZKA 5IQDA 5B6IA 4E4LA 3FXZA 4CG9A 4FTUA 3POOA 4AACA 2WQBA 3AC1A 5HD7A 4FBXA 3LW0A 4ZCLA 4PWNA 4RD6A 4X06A 5D41A 5J87A 2YJRA 3T9TA 2XZLA 1FINA 3GC9A 4EUUA 3IW7A 5ETFA 4FC0A 1E3ZA 4ZV4A 4J8NA 4ZOGA 4APCA 2C69A 4UWCA 4UBAA 5E1EA 2ZZGA 3UVRA 5GIOE 3QQHA 4CVAA 3ROYA 5FG8A 5M4IA 3MB7A 5ANGA 3LXPA 4P6YA 1FGKA 1H27A 2VWIA 4Y83A 2V4DA 4I41A 4PMTA 4YZBA 2X3UA 2BVNA 3A8IA 4IACA 3F69A 1GZNA 3HYHA 2WNTA 2WKMA 1PYXA 4RCZA 1V0PA 2W4KA 4BKJA 3EQRA 4HVDA 3I7BA 4RJ7A 4IQ6A 4H05A 2X7FA 2WTKB 4J1RA 5L6WL 5BX0A 2XCKA 1XE1A 4A9RA 4PC3A 3ORIA 2QR8A 4BIEA 4NSTA 4F6WA 5HI2A 3MFRA 5HIDA 5LCJA 1QG0A 2VZLA 3CD8A 3ENMA 5K4IA 1VR2A 3OEFX 3FPPA 4Y5QA 2GFCA 3EZVA 3LCTA 2GHLA 2X7GA 3R8UA 2BZHB 3D94A 1NJID 3CP8A 3IW6A 3D15A 4PMMA 3UGCA 1FVTA 3NMUF 3NCZA 2QE7A 4XNFA 1HOWA 2EVAA 4BZNA 4IM3A 2XIRA 3ZZEA 4EC9A 2CNUA 2GQGA 3DCVA 2BAQA 3FLYA 4O2PA 3CMMA 4XYFA 4HIZA 4BDCA 2W1IA 3ORXA 5AP2A 2CGVA 3U2QA 4RFMA 3DNDA 3F2NA 3FKLA 3KMUA 5HVYA 5JFWA 1HCKA 2JFLA 3F61A 3QKLA 2JDRA 3C5UA 3NX8A 3HP5A 4JDJA 4X3FA 2NNWB 5GJFA 1GOLA 4D55A 4O96A 3LJ0A 4AZWA 3NPCA 1G7TA 3IOKA 3ZYAA 4XG9A 1YHWA 4K18A 3W16A 3HMOA 2XP2A 3E93A 4V04A 4EL9A 3MFUA 4QPSA 3VVHA 2XS0A 2YIQA 3G71B 2OGVA 3D5WA 3NZ0A 2WQMA 3ATSA 4WNKA 3VBYA 4TMXA 4JRNA 1FOTA 2V0DA 5F94A 4UZEA 4E0FA 3DA6A 4NK9A 3ZU7A 3P7BA 5CSPA 5BSYA 4IB0A 4OTFA 3RWPA 3UC4A 1M2QA 3ANRA 4I0RA 4PC7A 2CN5A 3KL8A 4GU9A 5LVMA 3G6EB 2P55A 2QU5A 3KF4A 2DEUA 3Q9YA 4Q5HA 2HWOA 2YIYA 1ELOA 5CENA 5HICA 3D4QA 3OF0A 4ENXA 3POZA 3O2MA 4O7TA 3IW5A 1Q9SA 1ZUNB 3E5AA 2B9FA 3G9NA 3I0QA 3A7JA 4FTOA 4XONA 3BV3A 3NIEA 5D12A 3W8QA 2C3KA 5CF4A 4QUZA 2AUHA 2Y9QA 3AG9A 3C4EA 1Q3DA 1ZRZA 4QMWA 1E64A 4LV7A 1OL5A 2WO6A 4MUQA 4O82A 3TTJA 4ORKA 4QMPA 3ZSHA 4F78A 5A88A 3QC9A 4Z4UA 3JQQA 3LNNA 2V7AA 2YWGA 3AT2A 4LMNA 1JA1A 4D1ZA 4DTKA 4ASZA 1H25A 1ZMUA 1M7NA 2QHNA 4OOXA 1QPJA 3W2IA 4PX6A 3FLZA 4ZJJA 2PZPA 3SX9A 4DEHA 3KXGA 2BPMA 2G2IA 1DI8A 3LFFA 2HDNB 5IPJA 2YWHA 1I09A 3R8PA 1KE6A 1PY5A 5FEQA 2GNIA 4A4LA 4C36A 4BPRA 3IOPA 3LMIA 4XHKB 1PMEA 3V8SA 4P6VF 3DDQA 4YZDA 3BHYA 3BKBA 5HKMA 2VNWA 4RWLA 3R7YA 5ETCA 2IWIA 1W84A 2FSTX 4QMTA 4QMVA 3GCPA 4FX3A 2Z7LA 2JGZA 3DXNA 5TKDA 2YWVA 2WMAA 4FEQA 4ZSGA 1YWRA 3A8XA 1PXJA 4F9BA 4WT6A 4F7DA 2UW6A 3D5UA 4DBXA 2XK6A 2C5HA 2Z6BD 4EOKA 3V5QA 2WTIA 4ASDA 1REJA 2F1LA 3QUPA 4CQEA 3MHPA 3OFNA 3LM0A 4FZ7A 4S33A 5E1SA 2WQNA 3HMNA 4HZRA 4EI4A 1IHMA 1KJZA 3FLNC 4B44A 4F0FA 4IANA 4XG7A 1Q81D 1WPCA 1BI7A 1KE5A 4J7BA 4TYGA 4EYJA 1YDRE 3K54A 3OCBA 4YJNA 3CJGA 5HCXA 2O0UA 1TVCA 5CEKA 3BY1A 2PVLA 2JKMA 4YBJA 1W34A 1WORA 1OPLA 3F5GA 3UIBA 4JL9A 2VAGA 4BTMA 3NNWA 3PA1A 3MJ2A 3PDTA 1ATPE 5BVOA 5FUTA 4YUQA 3O51A 2P2HA 1NVRA 1Q86D 1TTTA 2OU7A 3PRIA 3FKOA 3QAME 3QRIA 3ETAA 3ZUTA 2J7TA 4ENYA 5HLNA 4JBOA 3LHJA 4B47A 2FO0A 4L53A 2XANA 4HVHA 3CTHA 3FSKA 5DG5A 3ZUUA 4DN5A 5EQYA 1P4MA 2OK7A 1OBGA 3L8VA 3QHRA 1IJEA 3CXWA 4R6VA 3HV3A 1XHAA 3ASRA 3WF8A 1S72B 1QVFB 1M52A 1EFUA 1ZYDA 3MESA 3PA5A 4HYSA 4AU8A 4IM0A 2EIXA 1Y6BA 4FODA 3FEGA 5DWRA 2JBPA 3C4FA 3CSVA 4NFNA 4RJ8A 3E8CA 5AX3A 3DB6A 4XV3A 3DBEA 2B9JA 2O5KA 4KNBA 3TKUA 1H8FA 1VQ7B 3OP5A 3DOGA 3OW4A 3QGYA 2A27A 2BPOA 3W2OA 3GQBA 4XMYA 3ZUVA 3PFQA 3NR9A 2XBAA 3PENA 2QOLA 2GSFA 2QU6A 1ERKA 2BRGA 5HG5A 1V0EA 3WF6A 3VS3A 2UVXA 1FDRA 3CB4A 4RC2A 1ZYCA 4RJ3A 1T6YA 3RCDA 3QTXA 3ZEWA 3I1FA 2VTHA 5FEEA 3VBTA 2WIPA 1W9XA 4AVZA 1WVXA 1YWNA 3HV6A 3W0RA 1CNFA 1ZM9A 2W1CA 2XJ1A 5LMKA 3PXYA 1TKIA 1UKHA 2ZTGA 2SRCA 3Q5IA 3NYNA 5EYKA 3TZMA 2PE3A 2E9PA 1KZLA 5AIKA 2ZB0A 2C0TA 5EDPA 4DGOA 2UZTA 3DJ7A 4IWQA 3U9CA 3I55B 5TR9A 4W8EA 5HLPA 4M68A 4AFEA 4G5JA 4MXXA 1K3AA 3ZZ0A 4RCYA 1K9AA 2P3GX 3Q4TA 3GU7A 3JS2A 4XEYA 4J8MA 4AT5A 2IVUA 4F9AA 4ANLA 1ZM3A 2WMUA 5HHWA 3AGLA 3BU3A 3ORMA 5HCZA 3OWKA 4I5HA 4HGSA 3VS5A 4XG8A 5CF5A 4V0GA 4WBBB 2ZBUA 1H0WA 3I60A 3JR1A 3QHWA 3RAIA 3U9NA 2QTLA 2J2IB 2V7OA 4O27B 1K8AD 3ML1A 3W2PA 4E73A 2WYRA 1ZM4A 1T45A 2WQEA 2HELA 4AA5A 4J71A 4KRDA 5CT0A 3EFLA 4GRBA 3MWUA 4I6BA 3ZM9A 2CCHA 3PVGA 3QTRA 3VS4A 4DT8A 2QA4B 2BIYA 3H9NA 2OBTA 3P27A 2UW3A 4PRJA 4E93A 4EBVA 4EEVA 5BNJA 3DK6A 1W7HA 4RZVA 1HZEA 1P4FA 4F65A 5AP5A 5J3OA 1NVQA 1D2EA 2ZL5A 2PZRA 3PVBA 1W0KA 3PXZA 4WZKA 2CMWA 3EIDA 5LMBA 4GK2A 3THBA 3RPSA 4J52A 2CKEA 4RWIA 4YTHA 3SDJA 2CGUA 1Y0RA 3F2AA 4N57A 4BCHA 1Q61A 1RQRA 3FL5A 5EG3A 3AKKA 4YJSA 4PY1A 4DH3A 2VO6A 1H1QA 2F1MA 3ORLA 2NV4A 2WR8A 3D7TB 3L1SA 3DLZA 3QCYA 4KA3A 4Y8DA 1ZARA 2XK9A 2XIZA 5HCYA 5KE0A 1W0JA 1XH9A 2J6MA 3DGKA 4O6LA 5E8UA 3EQBA 5BYYA 3S00A 1JKLA 3GC8A 3ONYA 4I22A 4WKQA 3Q4CA 4GT5A 4YAFA 4RLLA 2EB2A 3DB8A 3FBVA 5EH0A 3UDSA 3ZO1A 3ZFMA 4JMQA 1QL6A 1QMZA 4BY9E 5E8YA 5AP3A 3GGFA 4EH9A 4MD7E 4U9AA 3RY8A 3ZZUA 2J50A 3OVVA 5EQEA 1GZKA 2GJPA 1YRPA 2DQ7X 4II2A 1Y8YA 3RHKA 1KE7A 1W8CA 2WHBA 4I24A 1NVSA 2YCSA 3O96A 3SC1A 3WIGA 5KHXA 4LBWA 2XRUA 3BV2A 2Q6KA 1VLYA 2RC6A 2CDZA 2VRXA 3FWQA 4MBIA 5JEBA 3VRZA 2WMXA 3QALE 3R8ZA 4OR5A 3R9NA 3EQHA 3DFAA 2R3HA 1MRZA 4NTTA 4QTAA 2I1LA 4DLJA 4M97A 4C4EA 2J0MB 4JNWA 2JKKA 4WRSA 4OPOA 2Q0NA 3WNDA 2QKWB 1UD5A 4H1JA 3TMOA 2NRUA 4WG5A 3EMGA 3SKCA 5CAVA 2XK4A 1H26A 2ETKA 2YM5A 2CKOA 4QO9A 1W87A 1YXUA 3BNWA 4G3EA 4O7YA 1FX0A 4R3RA 3VUIA 3FY2A 5CEOA 2BDJA 4X21A 4FK8A 1JOWB 2UZBA 5EYCA 4YHBA 3PA4A 4R7IA 2QOQA 5DR2A 5HG8A 2C4GA 4ROXA 4U43A 1IG1A 3OE7A 4GQNA 4K77A 3VC4A 2WOUA 1BL6A 3UIUA 4BI1A 4EWHA 5JMSA 2X85A 1R5BA 3PYYA 4RT7A 2EUFB 5HD4A 4P12A 4RJ4A 1R3CA 1OZ1A 2NP8A 3G0FA 3KXXA 3ZUGA 4AS0A 5IMEA 3ORTA 3REPA 3W0PA 3B2WA 4JVGA 4I5MA 5AA9A 4Q7JB 4H58A 2IVSA 5E8VA 5M06A 1BLXA 3ELJA 3W2EA 4RIOA 3GFEA 3WBKA 3OZUA 2GFSA 4LUEA 3ZC3A 2BZIB 4BTKA 1U46A 4I3ZA 2WOTA 5KSWB 2VJJA 1DG1G 5DNRA 4CFVA 5B2KA 5IQIA 4YAUA 4IAZA 3LCSA 5DT3A 5M4FA 1QVGB 3EN7A 5ETIA 4FNWA 1B6CB 2NYAA 1WBNA 4O0TA 3W55A 3BYVA 4TYJA 3SXSA 4JDIA 3ITZA 2B0QA 5KMLA 4EH5A 2XYNA 4XNEA 2YCQA 3T9IA 2YERA 3Q6QA 2IZSA 5AUTA 5C03A 1Q41A 2B7CA 4L68A 1OIQA 3OW3A 2VTJA 3R1SA 4JXFA 4U41A 4XV9A 2XF0A 1R78A 3FV8A 4EOMA 2YN8A 3L9NA 1CKPA 3PUPA 4FVPA 4GV1A 2X6XA 4DH1A 2J9MA 2Z7SA 2ERZE 4YXWA 4NM3A 3FUPA 3I5ZA 3EYHA 5FBNC 4XG6A 3SOCA 4CV8A 4DH7A 4DTAA 4CQJA 3BWJA 3F3ZA 4FJVA 4K0YA 3PZHA 2OJ9A 3TNIA 3P23A 2UV2A 3CP2A 4XOZA 5JRQA 1FNMA 2CGWA 2WMTA 3NW7A 4YLJA 4LOQA 4R77A 2M5SA 2V7TA 3D83A 5LVLA 4N70A 3PA2A 4M3QA 4GKHA 4TT7A 3CQWA 4U3YA 4XOYA 5GJGA 2DYLA 4C38A 3FQSA 3T51B 3ZHPC 3T3VA 5CEPA 3TZ8A 5HX8A 1T6XA 4XN3A 2XM9A 3Q6WA 3BE2A 4TXCA 1ST0A 3AC5A 1H28A 3Q9ZA 4G9CA 1FNCA 4L7FA 5KMKA 3LO8A 4YAOA 1XWSA 3EKKA 3PXRA 5F9EA 5KO1A 4I5CA 2JDSA 3Q96A 5AUWA 3DKFA 3QTWA 4U45A 3DU8A 2P2IA 3VUMA 2WZPP 2R3JA 4AA4A 5FDPA 3Q52A 3KXMA 3LFNA 5CQUA 4WIHA 2BGJA 3HLLA 5AN9A 4HCUA 4FTKA 3QD2B 4L3PA 4UB7A 4FGRA 2OH4A 2WTDA 2E9OA 2V7UA 4IWPA 2JEDA 4IH8A 4B8MA 1BX0A 1EFTA 2BTSA 4C2WA 3KA0A 3C7QA 3AC4A 4E5WA 3QL8A 3R04A 1FBNA 3VBVA 4EQCA 4FEVA 4YJRA 5L6PA 1KD1D 2BIKB 1RQPA 3EZRA 2VX0A 1P4OA 4OPSA 2QOFA 3MFSA 2CKQA 5G6VA 2F7EE 3D7ZA 4F7NA 4O22A 4F1OA 1VF7A 2C5BA 2O2UA 4RD2A 4L9IA 2EWAA 4OTQA 3LKMA 4O0RA 4DE4A 4H9GA 4FT7A 3F5XA 3GSIA 1JPAA 3HVCA 4OTDA 4OTRA 2YACA 5AV3A 2X6EA 3A7FA 5IA2A 1LR4A 3CC7B 3ZFXA 2JDOA 4IC8A 3KULA 4FZ6A 3PJ2A 5TRDA 2HY81 3GU5A 2PTKA 3R28A 4FYNA 2UW5A 5FXSA 1Z57A 5FTOA 1Q97A 3TM0A 3DBCA 3E7VA 2OBSA 3EKNA 3FHIA 2IZTA 3II5A 5AX9A 2R3GA 3BWFA 1FVRA 4CMTA 2BSAA 4DDGA 3QX2A 4PTGA 4RX9A 3FDNA 1YXTA 2OFUA 1JSUA 3H9RA 4XRJA 5FGKA 1QUEA 4D28A 3GBZA 1UD6A 3QQJA 4BGQA 3WZUA 3ORKA 4D4VA 4N3GA 3COHA 2CCIA 2B7AA 3WYYA 2GJKA 2DWBA 3W5VA 3VNTA 5A4QA 5K9IA 1ZMVA 2CLQA 3VW6A 4FV1A 3E20A 4EZ5A 1YVJA 5AMNA 1OB0A 4G6LA 4APPA 2QONA 1MABA 1YX2A 4F6UA 4MX9A 3CW2A 1KV1A 1NW1A 3IK3A 3AC3A 4FG8A 3I1AA 4EC8A 4AZFA 4F0IA 2VJIA 4F7JA 4E4MA 3DQXA 2JIVA 5D11A 2C5XA 3OC1A 5EHLA 5E92A 2D3NA 3QFTA 3QE2A 2XIKA 4K9YA 4BCGA 2OXXA 4AOTA 4IB5A 4MVFA 3I4BA 2GS6A 4XG3A 4F7SA 2BN4A 3I5NA 1NT2A 1ZMWA 4FL1A 2WD1A 4WZTA 3IQ7A 4LFIA 3CCVB 3HAGA 3FSFA 4QQCA 4JDHA 3NYXA 4ITJA 2GNFA 4X3JA 4ZK5A 4BZOA 4ZAUA 2XZSA 3NEWA 3PPZA 1EFCA 4ZGQB 1P5EA 2PZIA 4FICA 1M2RA 1ZXEA 3Q2MA 4OT6A 4ALUA 3WBJA 4FTQA 1TLLA 3G6GA 4YPDA 5I9VA 4DHZA 5DI1A 1JJ2B 2HOGA 3IDPA 2AHOA 2ONLC 1XFOA 2PHKA 3LJ1A 4UXLA 2O3PA 2GQFA 4WNMA 5HE3A 3F7ZA 4ZTRA 4TN6A 4WZEA 1Q5KA 2BDWA 4G16A 4CCUA 3AMYA 1MQ4A 3HL7A 4L46A 1YW2A 2XM8A 3VHEA 5C8KA 2QHMA 1GAWA 4TMZA 4GFMA 2ZFYA 4IZ7A 4L52A 5D7AA 5FXQA 3U51A 4RMZA 1WVWA 3BPRA 4E20A 2RL5A 4OPVA 4M0YA 2CKPA 2KULA 3OXZA 3OCSA 3QRUA 3TTIA 2VYQA 4C59A 3R6XA 4KS8A 4JR3A 1KSWA 2ZAZA 4NUSA 5BUIA 4YHJA 2REIA 5CAUA 3WXMA 5AUUA 4QMLA 2XNNA 4HCTA 1U2RA 4CZTA 3R7OA 5AP4A 4OBQA 3C4XA 4Z9LA 1YXSA 2F4JA 3NFFB 1RJBA 1OPJA 2W5AA 4GJ3A 3SOAA 3GI3A 5KMOA 5C4LA 4YALA 4HVSA 4HGEA 4NT4A 5CEIA 2OWBA 2C5NA 1VQ6B 2YDJA 5AV1A 3QKKA 2B55A 2HYYA 2Y0AA 3ZZWA 2X6YA 3Q39A 3E63A 3F66A 4CFFA 3GNIB 2QGGA 3HX4A 3LVPA 5HBEA 3VAPA 1FRQA 4DGNA 3TJDA 2PVJA 2Y4IC 3IECA 3OTUA 4NJ3A 4YJPA 4PUZA 3W1FA 2UZUE 4LBYA 2XALA 3OWLA 2HZ4A 4LL5A 5I9UA 1HCLA 4O7RA 3ZH8A 4FKGA 3U6IA 1GY3A 3GQIA 1JNKA 5GINE 3PIYA 4E6CA 4GSBA 2PVHA 2X2LA 3PY3A 4QFMA 4LOOA 1K73D 3B2TA 4QP1A 3W33A 4QTCA 4E26A 5HGIA 3FMLA 4ZJIA 5LOHA 3DQWA 5C9CA 2VNJA 3RAWA 2C6LA 1CSNA 3TIZA 4MQ1A 2FVDA 1QGYA 4FSNA 5H2UA 3AVXA 4ACGA 5DBXA 5L2IA 4YSMA 3UIXA 4BDHA 2PUNA 1PKVA 3FL4A 3PG1A 3BI6A 5FQDC 5M57A 5CU3A 3QTSA 2C6EA 2VTLA 3CEKA 2C6IA 3KCFA 4DFYA 4AF3A 1NB9A 5FM3A 3KQ7A 4AA0A 1E79A 4CD0A 1PHKA 3FZRA 4DG0E 5GIPE 2GNHA 3HRFA 3KXHA 3PRFA 2P4IA 3COIA 1ZOGA 2HCKA 3QC4A 4FSMA 3UOKA 4HVIA 3UC3A 4ZY4A 2GDOA 5AAEA 3U6JA 2BCJA 1DM2A 4FOCA 3VN9A 4C3RA 4I21A 3UVQA 4XLIA 1LUFA 2WTCA 4X7EA 2V7QA 4QP4A 4RC3A 4CTBA 3H0YA 1D1NA 2GNLA 3P7AA 4ANBA 4P5ZA 1OKZA 1AGWA 3AVWA 5E7RA 1G8KA 3IGOA 5CSXA 5J35A 4HYUA 3OROA 5FTGA 5H8EA 4AE9A 4LRMA 4UZUA 4MXOA 2C0OA 5KBRA 3Q9WA 3EB0A 4KWPA 2VX3A 2BKZA 5KX8A 1OI9A 1ZYSA 2PVYA 4GKIA 4FYOA 4I92A 4AW1A 1EP3B 2JITA 5IUHA 5HNGA 4B0GA 4TKSA 3W2HA 3OWJA 2H8HA 4QMOA 3CRZA 2DY1A 1WFCA 2YWFA 3BE9A 4C62A 1F5QA 4BYIA 1SZMA 1PJ7A 3IW8A 4DBNA 2GJRA 5J95A 2I6LA 1F3MC 5AV0A 5HG7A 5L8JA 2F7XE 4RPDA 4MHAA 5H3QA 3VUKA 4ZCMA 5CF6A 1WSRA 4IHPA 4PABA 1JQHA 2C0IA 3FXWA 5IQBA 4XX9A 3R8MA 1QFZA 4FXUA 3MVJA 5CEQA 2KVOA 3VWAA 3TIYA 5CAQA 4NCTA 1OGIA 4XJ0A 4GK4A 4JJRA 3ZFYA 5BUJA 3AD4A 3A8JA 4EH2A 2WTWA 4RIXB 4M13A 2PVKA 4N3NA 4PC6A 5TY0A 3F82A 4OTWA 3QTUA 5LWNA 1L8TA 5DS0A 2BMCA 3MA6A 3QXPA 5F95A 2FSMX 2OZAB 3RM6A 3ZLSA 2D74A 4DH8A 2OKRA 2OJJA 3UQFA 3O8PA 2PPQA 3BYSA 4J95A 2CC2A 2PIAA 3WE4A 3BGQA 3L9LA 5T68A 3WZJA 3ACJA 3MA3A 5AP1A 2PE2A 2VUWA 3VBXA 4EJNA 4XBUA 3DBQA 3UZRA 4CFMA 3COMA 4O0XA 4TRLA 3T3UA 3WF9A 4D5KA 4D0XA 2W96B 2WMBA 3W5UA 3ZBUA 4B3FX 1WBTA 3IW4A 3QWKA 2VWYA 3NUPA 4AW0A 4EH1A 1A06A 1Q8YA 5I0BA 2W6JA 3A35A 3S95A 4DFZE 4E6DA 4D1SA 4F09A 4C02A 4F9YA 2BVAA 2IW6A 3P78A 2XZPA 2WMSA 3DXPA 4BCQA 3FMEA 3MTLA 3W8LA 3CCEB 4FKWA 4D4YA 3RK5A 2WMWA 5ITAA 3KXZA 4AW5A 5CZIA 4CG8A 5KUPA 1SVHA 2QOBA 3RHXA 4QP3A 3U8WA 3JXWA 3RGFA 2VWBA 5KNJA 3MB6A 5J9LA 4ZS0A 2UW7A 4RZWA 2A2AA 3CGOA 2F7ZE 4QMUA 3V5JA 3HA6A 1Q8UA 1NDHA 2R9VA 2O8YA 3VJOA 5FEDA 3R7UA 2X7OA 5JT2A 1W35A 3ZZTA 3P4KA 4FKVA 3ZONA 4EOSA 2XNEA 3CPXA 3O17A 3FPMA 2OZAA 5IH6A 1WOPA 3CCQB 5AP6A 3ZTXA 4CLIA 4Z4VA 2J0KA 2W17A 5KKRC 3M11A 3OUNB 4H3QA 4G3GA 2R0UA 3QQKA 4TY1A 3D0EA 2GREA 3WBLA 4BVUA 1UWHA 2IG7A 3CPBA 3ZO3A 2VNKA 1I7PA 1NBMA 1M90D 4CT2A 4F1MA 4R5YA 1JKTA 4KUJA 1GJRA 3IS5A 3OMVA 1XH4A 3EQFA 2QOOA 3MFTA 3P7CA 4N6ZA 3OOMA 4TPTA 5DYJA 3Q32A 1QPDA 3MPAA 3L8SA 5BYLA 4D4SA 1G8JA 2QD9A 3FMKA 4U79A 4IZAA 3VQHA 3CGFA 4AT3A 4C35A 1Y91A 2C68A 4G3CA 2IVVA 3N4TA 4LRKA 4MBJA 3H30A 3ALOA 3O0GA 4O0UA 5CX9A 3UO6A 3OZ6A 5CNOA 1YOLA 2AC5A 1Q82D 1H00A 4HPTE 5B2LA 3PXKA 2QR7A 4RJ5A 1VJSA 4RFYA 3LPBA 3VS1A 4IAYA 4C3FA 5ICPA 1VJYA 4EK5A 3GCUA 4JG8A 3AOXA 3ES9A 3W5HA 1XMLA 4BBMA 2PMIA 1MUOA 1OB5A 4PL4A 4YJOA 4CZUA 4GT3A 5A46A 3Q04A 4FTJA 4S31A 4RM0A 5HZAA 2FVGA 5CAPA 1UD8A 4AN2A 4NCTC 3ISXA 3HAVA 4XN0A 3MYGA 4G5GA 1TQPA 4HCVA 1JAMA 3EQCA 3SXRA 2XK8A 4ANQA 2C1AA 3BEAA 3H10A 4QRCA 2HMAA 5CEMA 2EFGA 4EUTA 3KEWA 4ZZOA 3B8RA 5IQGA 4P9SA 4XP2A 3TDVA 2E2BA 3AD5A 3PE2A 3B78A 2ZB1A 3UNKA 2BUJA 4MBLA 5JFVA 5DT4A 3CIKA 4BDKA 2ZV8A 2J51A 3L9MA 4L6QA 1H8EA 4X7FA 4X2GA 3QLFA 5E9EA 5HE2A 4QVJA 3VS7A 3ZBXA 4TWNA 1YI4A 3B82A 1WAKA 2Y6MA 2Z7QA 5HIEA 4AZTA 2V22A 2B52A 3D14A 2WFYA 4QP8A 3TXOA 4OUCA 4PDSA 3VUHA 1JSVA 5L6OA 1VQNB 5IA5A 1N0VC 4IX4A 1PJ5A 4X2NA 4B9DA 4CMOA 4KBKA 2FX3A 4DG2E 3OW2B 4PC1A 3JY0A 5EQPA 2OFVA 4Q5EA 1IEPA 2FYSA 3KULB 4AAAA 2H9VA 4I5PA 4EH7A 4DFUA 4AQCA 3CCUB 1P14A 4HPUE 1SNUA 1UMKA 2YDIA 2YIWA 3FMNA 4XV1A 3RALA 4CEGA 4R5SA 3FZ1A 2I40A 4EH8A 1FVVA 4FG7A 2F49A 4EOQA 3GU4A 4Y85A 1TFFA 4UY9A 2GNJA 3U4UA 4W4VA 3LXLA 1UD4A 2I0YA 3NLBA 4I1ZA 4NZWB 5C1QB 4AN3A 2HZIA 4YC6A 5AP0A 4FSYA 4ALVA 1GNGA 4DHFA 1PW2A 1PXLA 5B2MA 5BVEA 3RNIA 4A4OA 3C4ZA 2VZ6A 4Q9SA 3TZ7A 4GEOA 3SVVA 3RZBA 4TTHB 4M2LA 2G15A 4MXZA 3ZBFA 5FP6A 4AOJA 4GL9A 1UWJA 3ZPNA 4Y5HA 4N0SA 2X1NA 3CC6A 1EP1B 4YAWA 2GQSA 3V01A 4IX5A 4C4JA 4QMQA 2C77A 3FZOA 5A8AA 3LFEA 2VO0A 5CF8A 2GK6A 3MH0A 2ZXHA 4C0TA 4XV2A 4JLCA 4E5AX 5M53A 4RFZA 1Z5MA 4AAYA 1GO2A 1KK0A 2OW3A 3C5IA 4ZZNA 4FKOA 4LGHA 4YJUA 1E3XA 4S30A 4QP6A 2R3MA 3R0TA 3UP7A 4DFBA 5EYMA 2VV9A 4TMVA 3GENA 1XO2B 4XLVA 5IQEA 3OEZA 3RPVA 5T3QA 2XNJA 2ZBVA 4M69B 2C47A 2J90A 2R3KA 3SHEA 4BGHA 5IMXA 4DDIA 4RA5A 5BQ0A 1Y57A 3W2QA 2ZZEA 4FTTA 3GCSA 5J7HA 5AV2A 4ASUA 2B53A 1WBSA 2C3LA 5CTPA 3R9RA 4KD1A 4O7NA 4X3FC 1BJKA 2ZOQA 4P4CA 2X2KA 4UYNA 1E62A 3G51A 1ZOHA 4RA4A 4RIWA 3EL7A 3R7EA 3CCMB 3OKXA 4EYMA 2WXVA 4WO5A 1P2AA 1LEZA 4JIAA 5K4JA 2C4UA 2XARA 1XQZA 4BDDA 4G7XA 5HTCA 1OB2A 4IAAA 2Z2WA 3DBDA 3FMHA 3RK9A 4CCBA 4DITA 4BJJB 4D9TA 5EYDA 1N0UA 3QFSA 3EN5A 5JRSA 4YTIA 1IA8A 2QLQA 2BRNA 3V5WA 5IF1A 2VBSA 4G6IA 1IA9A 3CQEA 3UYSA 4FSZA 4ERKA 3ENHA 1HA3A 4O7VA 4DYMA 1W82A 2V62A 2EXMA 4XM3A 2GHMA 2ZDTA 4F08A 3OOGA 5A4CA 5E90A 5CALA 1A9UA 5HX6A 3TI1A 3V3VA 2WJVA 1A48A 2XJ0A 4MH7A 1PXNA 1YI2B 1IR3A 4ERWA 5IDNA 1SVEA 5DA3A 1ZYLA 3PUFC 4K8AA 4EONA 3SKBA 3NUXA 1MRVA 4MAOA 4RLZA 2QOCA 3DK3A 4TW9A 2PU8A 5FIUA 3KCKA 2DIEA 5JBQA 3BLQA 3S4QA 4AFJA 5E6TA 4RIWB 4RSSA 5L8LA 1OIRA 3BC9A 3LFBA 4EK3A 3G15A 4G1BA 1HVXA 4H1MA 4Z4SA 4F63A 4IFCA 2BILB 3QRJA 4KSPA 3U4WA 2CRVA 1BMKA 4BB4A 4BTFA 5KMNA 2WSSA 1JNYA 5LQFA 4BTJA 4UEUA 3GC7A 1E1QA 3ODZX 4QMNA
chains in the Genus database with same CATH topology
3HDMA 4WBOA 3UPXA 2QO2A 4RWJA 5A14A 4UXQA 4BYJA 5M44A 2YIRA 3QKMA 4RX8A 2BROA 5JKGA 4Z1MA 4KKGA 3BCFA 1BKXA 3V5PA 3EN6A 4KRCA 2PSQA 3R21A 4CRSA 4YLKA 4LMUA 5KBQA 4DK1A 4L8MA 1TQMA 4FK3A 4BIDA 2E9UA 2W9ZB 4MXAA 5JZJA 3DDYA 3P5JC 2Y8OA 1Y6AA 1O6YA 5JZNA 3TG1A 4YURA 2ITUA 1KOBA 1DAYA 4BDJA 4XKWA 2QO9A 4QYGA 3QCQA 4GYIA 5FRIA 1ZOEA 2H6DA 3TYKA 2XNMA 4O7ZA 5EKOA 2VO3A 3EQDA 4F6SA 1ZZ2A 4DLIA 3C4CA 4X0MA 1WMKA 1ZLTA 1Q24A 4RX7A 4FEUA 2BHEA 3ORNA 4NKAA 3MN3A 2QLUA 1H1SA 2W1EA 3QZGA 3NIZA 3RNYA 4JQ7A 1U4DA 3FQHA 4GUBA 4H3PA 3PJCA 5FM2A 3ZXZA 1XR1A 3GXLA 4O0VA 5IDPA 2GS7A 2XB7A 1JLUE 3R9DA 2XK3A 4RVTA 3KK8A 4EHGA 2VN9A 2WEIA 3CTQA 4FT0A 3OY1A 4GT4A 1FPUA 3DKOA 4YTFA 5CI6A 2JC6A 5IQHA 3E87A 5CLPA 3VO3A 2C3JA 3VQUA 3BX5A 5KNLA 5CASA 3FMDA 2ZJWA 2ITQA 3UG2A 3TUCA 4D5HA 3TUDA 4EOIA 3TKHA 4IIRA 3CPCA 4I23A 5KZ0A 2X2MA 2X8KA 3IPHA 4MYGA 4LQMA 3GEQA 1UU3A 1NXKA 4MWIA 3K3IA 3Q5ZA 4PV0A 2GS2A 2XMYA 4BCNA 3HV4A 4FNYA 4IX3A 4IE9A 2OO8X 1OL6A 4D0WA 5FD2A 3S2PA 4NL0A 5FBOA 3QWJA 4TZRA 5CYIA 1SM2A 2PL0A 2C6OA 4G3FA 3OWPA 2CLXA 4UYAA 5AP7A 4ZXTA 3LFAA 4MEDA 3SRVA 3ZDIA 4BDEA 2Z7RA 2QURA 4LM5A 2ZZQA 1ZWSA 5HIBA 4NM5A 5IK2A 3Q4ZA 4CSVA 3QXOA 2FH9A 3M1SA 4UWYA 4F4PA 3TWJA 2I1MA 4ZSJA 3TV4A 4ZSLA 1RDQE 3MY0A 3O5AA 2B54A 1UNGA 3K2LA 4FTAA 5DEWA 2VX1A 2X9FA 3JUHA 3HGKA 5AUZA 1CKIA 1DAWA 2XZOA 3C51A 2YISA 4R7BA 2QG5A 4B99A 3WE8A 2FA2A 4PTEA 5AUXA 1CMKE 4ZMFA 2J0IA 5E8WA 3COKA 1QCFA 5BVFA 2YM8A 1J7UA 3CY3A 4FIHA 1XH5A 2R5TA 5C4KA 4U7ZA 3TNQB 3G9LX 4NNJA 5TOZA 2WMVA 4K33A 3E92A 3NRMA 1OUKA 4PL3A 2O64A 3RVGA 4BDIA 5J9ZA 3MBLA 4DH5A 4RPVA 1G5SA 1VYZA 5IUIA 2ZXIA 4GG7A 1BYGA 4HGTA 4YHFA 3CY2A 1JVPP 5GNKA 1V1KA 3C0HA 3G2FA 3VR6A 3KRXA 3QQLA 4NFMA 3SRVB 5EKNA 3W0QA 5CVHA 4EORA 4QP2A 2WTVA 3VF9A 3TJCA 3AKJA 1WZYA 3C13A 3R22A 3ZEPA 3WIKA 4AZVA 4M67A 4EJ7A 3OOCA 5M4UA 4RIYB 4L8JA 1LEWA 2YITA 4BDAA 4EH6A 2QNJA 3UDTA 5IH4A 5M51A 4BRXA 3L9PA 2ETMA 3BGPA 2I0EA 2WB8A 1OGYA 3QA0A 4O86A 5KMIA 4FKPA 3M42A 4MNFA 4NIFB 5ANDA 4Q2AA 4QNYA 2QG7A 2RG6A 2VO7A 4GS6A 2QOIA 4GFGA 3UOHA 3HMIA 4ASEA 2PK9A 4I6HA 4RX5A 4FEXA 3QRTA 2LZJA 2DS1A 2W5HA 3CQUA 3O8UA 2V31A 3CCNA 3QUDA 4ID7A 2YJSA 4EOQA 4GUEA 5AEPA 4NU1A 5DHJA 3SD0A 1UD2A 2B4SB 2YCFA 4MK0A 4O0SA 3AT4A 4P2KA 1T5EA 2PE0A 5ACKA 2HIWA 1M2PA 2VTOA 3EQPA 3V6SA 1O9UA 1GIJA 3BLHA 4IW0A 5TT7A 2LGCA 4TNBA 2ITTA 2UUEA 2C5VA 4ZS4A 4FTMA 5G1XA 3U54A 2QODA 4DITA 3SLSA 1KMHA 1OVEA 2XNBA 4CV9A 5AADA 2B9IA 4WSYA 3EJ1A 1CM8A 4R1YA 3MV5A 3E8NA 4OLIA 4ONAA 4U5JA 4WA9A 4B4LA 2V5QA 1BPLA 3PJ8A 2W9FB 1O6LA 3KMWA 4QDVA 4QEBA 2VWUA 2VWZA 5E8TA 2XA4A 3R1QA 2XGJA 4CTCA 2CGXA 1B38A 3TCPA 5IEXA 2ITPA 3A61A 3R00A 5CU6A 3RWQA 4ZP5A 3SW7A 1FGIA 3LZBA 3QGWA 2H34A 4FIJA 2YM4A 5M07A 4DCEA 3WZDA 4R3PA 5JQ8A 3QZIA 2X0GA 4V05A 4I4FA 1PXKA 4QOXA 3IONA 3R8LA 1GIHA 3AD6A 3NDMA 4QMZA 4WNPA 1VZOA 2WJYA 3LLAA 5DN6A 3W0OA 3U6HA 4V01A 3SG8A 4FL3A 1SVGA 3CJFA 5A4TA 5A4EA 3W2SA 3BBTB 3PY1A 4GVAA 3MH3A 3OTVA 2R3IA 4DEBA 2IW9A 4DFLA 4U40A 4U80A 3C50A 3KGAA 5IQAA 1XBBA 3BHUA 3PJ3A 2OIDA 2YZLA 1J7IA 2R3OA 3BQCA 4KINA 2XIXA 1LPUA 4YGAA 4C2VA 4BC6A 2JBOA 4J96A 1BMFA 2IVTA 3D2IA 1ND4A 2VTTA 3KK9A 4JG7A 5E8SA 1GIIA 4F9WA 3ZCLA 4L42A 4Y72A 1PXPA 2YM7A 4B7TA 3UPZA 4LUDA 4I6QA 4USEA 3FYKX 1E1VA 3VS6A 4C4GA 2Q0BA 4IBMA 2XAMA 4YC3A 1Y8GA 3OY3A 5M55A 3CR0A 4RQVA 4F1TA 3LE6A 4I20A 3UIMA 4BJJA 2JD5A 5AM7A 2RF9A 3GVUA 4FVRA 3RMFA 3PPJA 4DG3E 4WG3A 4AGDA 4QTBA 4FV7A 2GCDA 5JH6A 1PXMA 1U59A 1YI6A 4E5BA 3K5VA 1OBDA 1J3HA 1G8SA 4X7QA 3S1HA 3NGAA 5AA8A 3RINA 2Z02A 1ZYJA 2CNQA 2W1GA 5ANEA 2YCRA 4AOIA 2JKOA 2GU8A 4TYHA 4DC2A 4S34A 3GP0A 4JBPA 3UE4A 3TN8A 4II5A 1WVYA 3HMPA 2I0HA 3OEHA 1PMUA 3BL9A 2BZKB 5KHWA 4BDFA 1OIUA 3KU2A 1WCCA 2F9GA 3R01A 4RBLA 1H8HA 2O63A 2IW8A 4YZ9A 3PG3A 4MQ2A 3QX4A 4PMSA 3WOWA 3RPYA 4PDPA 3HUCA 5DRBA 5EHOA 4CKJA 2YIXA 3KN5A 4FNXA 2A0CX 1AD5A 2VTSA 3KC3A 3O71A 3QTZA 4BI0A 3KRJA 3LFSA 2JAMA 2J4ZA 2G01A 2WZJA 3LMGA 4W8DA 4YELA 4YHTA 1YXXA 4IB1A 4WG4A 4J97A 4ASXA 4D1XA 1W98A 1VYWA 4MTAA 4FI1A 2C3IB 3PA3A 2ZTNA 4J53A 3OW7A 2EXCX 2UW4A 5HNBA 4AWIA 4TL0A 2ZV2A 3LXKA 4II3A 4KKSA 3JY9A 3QF9A 4FKUA 4C4HA 3AMBA 4OTIA 4ACDA 3CLYA 2P0CA 2YM3A 3CE3A 4IM2A 2J0JA 2W1HA 2XBJA 4NYEA 2A4LA 4X3FB 3W10A 3B8QA 4BCJA 2R3LA 3I79A 4JI9A 5AJQA 4DA5A 5HBJA 3F3TA 4YNEA 5IZFA 5LVOA 4HGLA 4AT4A 1JBPE 1MRYA 4IMYA 1OB3A 3JYAA 4IAIA 4KABA 4EHZA 2E1BA 4HYHA 2G9XA 4NW5A 3UP2A 3UOLA 4A7CA 2OBJA 4QQJA 3A60A 1YQJA 3D5VA 3OXIA 3Q53A 3A8WA 2UZLA 2HK5A 4W4XA 3GB2A 4IJPA 4HW7A 1SYKA 1RQQA 2VNYA 4ZTNA 3F3WA 5T6KA 4DEDA 1DS5A 2ZV9A 2KTYA 1Q99A 4PDOA 4TWPA 3BZ3A 5CANA 3RAHA 2ONLA 3FI3A 4C61A 1EFRA 2YHVA 1OGUA 3Q6UA 2PWLA 4GJ2A 4IFGA 3BYMA 4YJTA 4CFWA 3IGGA 5J9YA 3F3UA 4H39A 3G05A 4GK3A 2B1PA 4PNKA 4MNEA 3PTGA 3ACKA 3RKBA 4FT9A 3UYTA 3P08A 4FL2A 2I0VA 2QO7A 3ZRMA 4A4XA 4MXCA 4M14A 3E62A 4IVCA 4J98A 3PWYA 3IO7A 4HVGA 3SG9A 3R1NA 2YDKA 3KY2A 3QUEA 4X2JA 4G6NA 1S9IA 5AWMA 5I9YA 3RM7A 4FNZA 3UNZA 2XKEA 2X39A 2Z8CA 1PJKA 2CHLA 2ZZFA 3LCKA 3BELA 1AQ1A 3DFCB 3GUBA 4KIQA 2X53S 4ZY6A 1WBPA 4L44A 3T8OA 3O8TA 4XRLA 5LVPA 1SKYB 4F99A 3OG7A 5A54A 1STCE 4UWBA 2C1BA 3NUNA 1K2PA 4L3JA 4B3GA 3DK7A 2XNGA 5CU0A 2I7QA 5AFVA 5IA4A 2JIIA 4FZFB 4BI2A 3FJQE 4IVBA 4QP7A 4FTNA 4TNDA 3SV0A 1FMOE 5L8KA 4IEBA 4P90A 2BRHA 2QOHA 2X4ZA 3NUSA 4FEWA 2ERKA 3JU4A 4QYHA 5EDQA 2X9EA 3DTWA 4XP0A 5EM7A 4CXAA 5HNIX 4CFUA 3MJ1A 2OG8A 5IQCA 4EKLA 3R7VA 4AXDA 3QBNA 3WZEA 3FKSA 1WBWA 1ZAOA 3QZHA 4YZCA 4BCKA 4AZEA 2GK7A 3EFWA 2R2PA 4ZLOA 4E7WA 4QQTA 4G9RA 3TUBA 1YDTE 1IRKA 3AGMA 4M8TA 2HZNA 2IN6A 2Z60A 3EFKA 3R1YA 3CP9A 3V51A 3U55A 3DTCA 4MD8E 4AZSA 3BU5A 3DAEA 2P33A 4FUYA 4QMMA 4MXYA 3ROCA 5HTBA 3QQFA 3R2YA 3A2CA 2W4OA 1Q4LA 2OK1A 1OKYA 3MPMA 4ITHA 1PF8A 2OSCA 4XG4A 3A4PA 5CS6A 5HVKA 5EHYA 3OD6X 4M15A 3VUGA 4GU6A 4LGGA 2XEYA 3GU8A 1OKWA 4O2ZA 2CJMA 5CZHA 4OBPA 3JVRA 2OXYA 4HZSA 5AV4A 2PUUA 4BHNA 3R9OA 1LP4A 4IX6A 5BMSA 4YNOA 3QD3A 5DT0A 3KFAA 3BRBA 3E7OA 4YC8A 5ETAA 3H3CA 5ANOA 1BL7A 3A99A 1YWVA 2NPQA 3BIZA 3AC2A 3FLSA 1OITA 3OFMA 3PSDA 4LYNA 4GIHA 4G6OA 3R8VA 3HP2A 3PXFA 3PSBA 2JJ2A 2YZAA 4UZHA 4U97A 5DR6A 2UZEA 4G31A 3G0EA 4U42A 2RIOA 1GAGA 3PP1A 5LWMA 3A7GA 1M17A 2OLCA 4QQ5A 4XP3A 4MCVA 1V0OA 4LV5A 4WD5A 1UA2A 2W4JA 3W0NA 3ZO4A 3PWDA 1YKRA 2IO6A 3G90X 4FV9A 4E1ZA 3MVLA 2ITNA 5FDXA 4BZDA 2WMRA 4F0GA 5AUVA 2UZVA 2G2HA 3LAUA 2JDTA 3QCXA 4DGGA 2QVSE 4CKRA 3RPRA 1K28D 2PZ5A 4WUNA 2OI4X 3HDNA 3UOJA 3GU6A 3KREA 1IAHA 1R0PA 2BZJA 3BU6A 2IJMA 3G5DA 3QD0A 4C4IA 5M4CA 4EZ7A 4LI5A 2QQ7A 2FUMA 3A7IA 1Q8TA 3PSCA 4BF2A 2VTQA 2RFDA 4RG0A 1UNHA 3PLSA 1J7LA 4FIIA 4PP9A 5HLWA 3P0MA 2ITVA 5EM6A 3R83A 4R3CA 4GW8A 3V5LA 2VTPA 4DHIB 1KWPA 1COWA 4G3DA 3FZTA 5BV3A 3MVMA 1UU7A 3R2BA 4QTDA 5DOSA 3ZM4A 4ARKA 3NS9A 4C37A 5E8XA 2PZYA 3UBDA 3C0IA 2VWWA 3FQEA 4WNOA 2X4FA 3H94A 4FVQA 3DAJA 2XH5A 3RAKA 5HO7A 2Q83A 3UQCA 5JQ5A 1WBOA 3KF7A 1WBVA 4H36A 3R73A 4C3PA 5HZNA 1H1RA 1G3NA 2F2CB 1BX6A 2R7BA 3P9JA 4YBKA 4BCPA 2J5EA 3UG1A 4EH4A 2BAKA 2PMOX 4L01A 5B7VA 4W4YA 4DAWA 3A7HA 2HLDA 3NCGA 5EI2A 3DV3A 1GZOA 3VS2A 2GHGA 3EN4A 4FKTA 3H0ZA 3E3PA 5DPVA 4AGUA 3PJ1A 3HV5A 3VULA 4LDTA 2OJGA 5FTQA 4KBCA 5CI7A 4AGWA 5LMAA 3WF5A 4CG8A 4KKTA 3QLGA 4FKSA 4YLLA 3V6RA 4DCAA 1EH4A 4CLJA 4DEAA 5E91A 4D2SA 4FSTA 5DE2A 3R9HA 3RTPA 4PP7A 1NY3A 3VS0A 2GNGA 4BIBA 3NSZA 5EI8A 2VD5A 5GJDA 2FGIA 3GVLA 1OM1A 4AP7A 3GOPA 5H8GA 3DY7A 5K5XA 3H9FA 3UJGA 4Y95A 3BYOA 4S32A 3V8TA 5K5NA 3LQ8A 4CNHA 4EH3A 1V0BA 2LAVA 3EWHA 4TWOA 3AMAA 5H9BA 3S0OA 3SGCA 1CTPE 5LMKC 2XAOA 4DNTB 5JGDA 2C6KA 2W99B 3OUKA 3QD4A 1ZY5A 4X2FA 4E6AA 3W2RA 4G7WA 4AXEA 4UX9A 3TV7A 3FZPA 1JKKA 3UVPA 2OIQA 4NH1A 4D4RA 4FTRA 4XS2A 3I0OA 2WTKC 3HZTA 4U8ZA 3UZTA 3LJ2A 2XYUA 2RKUA 3NNVA 4QMXA 3PP0A 3ZLWA 4AN9A 5HO8A 3JVSA 4BCFA 1OECA 3PXQA 3VBWA 3N4VA 5I4NA 2E9VA 5EOBA 4FTCA 4PNIA 3NAYA 3NUUA 2RFEA 5J5SA 1MQBA 4I6FA 4X6QC 4G34A 4BGGA 2W7XA 3RCJA 4Z3VA 2OH0E 3SQQA 1G8AA 3IDCA 4JIKA 5CT7A 1OL2A 3QU0A 1PKGA 4FKQA 5HQ0A 1E9HA 2QKRA 1B39A 2YM6A 3KB7A 3OS3A 5KKRB 3NAXA 2VGPA 1RW8A 3DT1A 3FZSA 4O21A 4P7EA 4U81A 5GHVA 3ZSGA 3BHVA 5I9WA 1H1WA 4XLFA 4GG5A 4O84A 3U87A 3HRBA 4OW8A 4FZDB 3FC2A 3F3VA 4WUAA 2VGOA 3DJ6A 3HAMA 3LLTA 3LQ3A 3R02A 4ZLZA 1PMVA 3WYXA 4F70A 5LARA 5I9XA 3PPKA 5EFQA 3CKWA 3KVWA 3F5PA 3E88A 4GYGA 3VONA 3UMWA 4AXAA 1QPCA 2QC6A 2CK3A 1U54B 3C4WA 2W0JA 1R39A 4IAFA 3ULIA 3PZEA 2XJ2A 3ZRLA 4Z16A 3BYUA 3KRWA 5LJJA 2YAAA 4MD9E 4Y73A 2BR1A 2VTMA 4AXFA 3HUBA 5H8BA 3E8EA 5TR6A 4UALA 2HAKA 2EB3A 4RIXA 4N4SA 3NW6A 3C0GA 3TL8A 2JDIA 4G2FA 1H1PA 2Y6OA 1OMWA 2BAJA