The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
205
|
structure length |
190
|
Chain Sequence |
b'MRLPDPYTNPEYPGLGFESVNLVDNDPISAQYWGINISYPELFPDEYAFLDSRLLEYKRTGDYLDVLLPQYEAFRVRGDTKSVTIPAGQKGSQIILNTNGTLTGQPKAGDLFKLSTHPKVYKITNFSSSGNVWNISLYPDLFITTTGSEKPVFNGILFRTKLMNGDSFGSTLNNNGTYSGISLSLRESLE'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Bacteriophage T5 distal tail protein
|
molecule tags |
Viral protein
|
source organism |
Enterobacteria phage t5
|
publication title |
Crystal Structure of pb9, the Distal Tail Protein of Bacteriophage T5: a Conserved Structural Motif among All Siphophages.
pubmed doi rcsb |
total genus |
45
|
structure length |
190
|
sequence length |
205
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2013-03-14 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Elongation Factor Tu (Ef-tu); domain 3 | Elongation Factor Tu (Ef-tu); domain 3 | ||
Alpha Beta | 2-Layer Sandwich | Phosphorylase Kinase; domain 1 | Phosphorylase Kinase; domain 1 |