4JMQA

Crystal structure of pb9: the dit of bacteriophage t5.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
205
structure length
190
Chain Sequence
MRLPDPYTNPEYPGLGFESVNLVDNDPISAQYWGINISYPELFPDEYAFLDSRLLEYKRTGDYLDVLLPQYEAFRVRGDTKSVTIPAGQKGSQIILNTNGTLTGQPKAGDLFKLSTHPKVYKITNFSSSGNVWNISLYPDLFITTTGSEKPVFNGILFRTKLMNGDSFGSTLNNNGTYSGISLSLRESLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of pb9, the Distal Tail Protein of Bacteriophage T5: a Conserved Structural Motif among All Siphophages.
pubmed doi rcsb
source organism Enterobacteria phage t5
molecule tags Viral protein
molecule keywords Bacteriophage T5 distal tail protein
total genus 45
structure length 190
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.290 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4jmqA02
3.30.200.190 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4jmqA01
4JMQA
chains in the Genus database with same CATH superfamily
2BTRA 4ZCLA 2Z60A 2JIZA 3MB7A 3DT1A 2X8DA 1YWNA 1JSTA 4BCKA 3PA4A 4FGBA 3CD8A 4FKGA 4PQNA 4W8EA 3WI6A 5K5XA 2OIQA 4QMMA 5L2IA 3LXKA 4FWTA 4IB1A 3ZEPA 3ACJA 4GUBA 2YEXA 4WOVA 2CJMA 1OMWA 4DEEA 5CSHA 4B7TA 4M97A 3VF9A 1WVXA 4XMYA 4MBIA 4YLKA 3VUKA 5HU3A 4FV6A 3P08A 4QVAA 4ZXTA 4A9RA 2VWBA 3HZTA 2RFEA 5FEEA 4GT5A 1KSWA 2JITA 3F3UA 1FDRA 1VHOA 1E63A 4UXLA 4JOAA 3FZSA 2CK3A 4FSTA 3C0IA 4TT3A 3A8IA 1ND4A 1W8CA 4WNMA 1SM2A 4AXCA 2WQEA 2YA9A 5K4IA 2GHGA 3OAAA 2X53S 2O2UA 2GU8A 2G01A 4CMUA 4ERKA 1OKZA 2OJJA 2WQMA 3DLZA 3PUPA 4PRJA 4C4GA 3AVUA 3FL5A 2P3MA 4TL0A 3TI1A 4NCTC 3AQVA 2BDJA 3GVUA 4ALVA 1CQXA 2WOTA 3NFGB 5CTPA 2VTIA 1B39A 3GC7A 3I7CA 4KIOA 2E9NA 1KTVA 3MFUA 1W87A 1CDKA 3BX5A 4MUQA 4YJVA 4A9SA 1GO2A 3NUYA 4I92A 3CP9A 2WZNA 4BDFA 4B3XA 4HYUA 5EMNA 4FKTA 2LZJA 4WWVA 2Y7JA 4LBYA 2YAAA 5DI1A 1KK0A 2YM4A 3H0YA 5IG1A 3JY9A 1KK1A 3LVBA 4QFMA 3W10A 3LCSA 5J5SA 2H34A 1UD6A 1ZOHA 3GUBA 3R8UA 4X2FA 4HGLA 2GS6A 1F60A 2YWHA 4EK8A 4R78A 1G7TA 3I79A 5KZ0A 3HEGA 4JBVA 5THXA 4JDJA 2QI8A 3PXQA 4RD1A 3U9CA 4J7BA 1PXIA 4ANBA 4ZJVA 4QVJA 3LQ6A 3CCSB 2ZV8A 3LCDA 4G3GA 5IISA 2XIKA 3CW2A 3UIMA 3WZJA 5KUPA 1ELOA 4GKHA 2ZMCA 1REJA 4TMWA 3NCGA 2P0CA 3TZ9A 1MQBA 4IACA 3FKSA 3BQJA 4FSZA 4QEBA 2JIIA 3C4CA 4DNTB 1J91A 3NE5B 4RRVA 5L6WL 3RVGA 3FPKA 2C6EA 5CEQA 4UN0C 1Z9XA 3DDQA 3A3GA 2VJJA 1PJ6A 2G15A 3DFCB 4I24A 4XV2A 4J0QA 5JZJA 1Q4LA 2QO2A 4ZCMA 3BYOA 3IW5A 3W5HA 5J1VA 4CKIA 2M5SA 3OKXA 4NL0A 4TN1A 4C7TA 2WZJA 5CNNA 4DGNA 2DUVA 4O0VA 4RX5A 1VJYA 2PMOX 2VO6A 4B3GA 3FL4A 2WPDA 4GEOA 5AWMA 2J7TA 2GMXA 2YIRA 1QGZA 3I4BA 5L6OA 3Q39A 3IDCA 4U3YA 3R2YA 1E79A 4FTUA 3NS9A 4X21A 4KBKA 4ASEA 3FHIA 4MYUA 3FDNA 4DAWA 5JH6A 3KN5A 4FA2A 3HUCA 2R3IA 3H9FA 4FSNA 4TPTA 4ANQA 2J5FA 4M4SA 4G1WA 2YWVA 3PIXA 3QD0A 4CZTA 4DHIB 4BDGA 1PXJA 2EB2A 4FIHA 5E8TA 2VZLA 2YJRA 4LOQA 4QP4A 3DV3A 3AKLA 4BBEA 1W83A 4OPSA 3V01A 5E6TA 3A62A 4O91A 3LJ1A 5BVDA 3BHYA 2C1AA 1AD5A 4NTTA 2KTYA 3MFRA 1JBPE 4EEVA 3UYTA 4DFLA 2JKMA 3EQHA 2ZMDA 4EZ5A 4JG8A 5DIAA 4BDDA 3P27A 2ZL5A 3DB6A 1ZMUA 2IZRA 3R83A 4CFWA 2QG5A 3EQFA 5CF8A 2WTKC 2PVRA 1VF7A 2BZIB 2RFNA 3Q53A 4I6BA 2XZPA 4XKWA 3A60A 4YTIA 4TMZA 5HLNA 4RBLA 3W16A 3QU0A 4CFVA 1IA8A 3VJOA 3UMWA 3PVUA 4HW7A 2GDOA 5KX8A 1I18A 4HGEA 3QUDA 3T53B 2OF2A 3TNHA 3O8PA 4XLFA 1EP2B 3CMMA 5FEDA 1OPKA 2QD9A 5HHWA 2HXQA 2XS0A 3V6SA 3F2AA 2BM1A 1OIRA 3ZH8A 4MBJA 4RIXB 5HESA 5H8GA 2XNCA 5C4KA 3BIZA 5AV2A 2XZSA 1Q82D 1UD5A 1OB0A 2OBRA 2A27A 3FLYA 3LXNA 4FOCA 3D2KA 4MBLA 3UO6A 3IOPA 4EOQA 5M4UA 5CWZA 5AM6A 3BYVA 3CLYA 4GYGA 4P4CA 4U8ZA 4DLJA 1JB9A 5K9IA 3NVMB 4QMZA 4C38A 2VNJA 2XZLA 3UDBA 5M07A 1W0KA 4IX5A 4QMOA 3GFEA 3CPCA 4GJ3A 3CC7B 1Z5MA 3POZA 4OW8A 4MWIA 4AXDA 2EUFB 3TIYA 4BICA 2BKZA 4C35A 4EH9A 2GS2A 4X07A 5CU2A 3TV6A 2X85A 4KKTA 3GB2A 3KN6A 4AN3A 3QFVA 4EHEA 5I9WA 4MD8E 2W06A 1PXMA 5ANDA 3MV5A 4D0WA 4TWNA 4DTBA 3F5PA 5TT7A 2VJIA 2OK8A 4EH5A 3CD6B 4WZLA 1YHQB 1FMKA 2R7IA 3A7FA 3CXWA 3COKA 3D14A 3SKCA 3WYYA 4EK6A 4DA5A 3SC1A 5FBOA 5D12A 4F70A 3IK3A 1Y0YA 2QR7A 1W9XA 3DAJA 4XP2A 4M15A 2I6LA 4E6AA 1BX1A 2VBSA 4Z4ZA 3AVWA 4PC6A 2OZAB 1Q62A 3RAHA 3O23A 2CBXA 1XH6A 1W35A 4WG4A 2GTMA 3NUPA 4C02A 1E43A 2VRXA 5IEVA 3EFLA 3EQIA 4TYGA 3QRIA 3ALNA 4FEUA 1ZUNB 1SNXA 3R7OA 1DI9A 4M67A 4DFBA 3KGAA 2ZM4A 4Z4RA 4QTBA 4YZBA 3FKLA 4FEQA 4PMSA 4DG0E 2HW6A 2WYRA 2V7UA 4E4NA 5IQEA 2Q83A 4QP6A 3EQBA 1JKTA 3LVPA 4OOSA 3SXRA 4AZFA 1OECA 2YWFA 3E5AA 2W4KA 3KULB 4G3DA 3W0QA 4BRXA 4UX9A 4ZZNA 2BIYA 3KK9A 3OZVA 4S33A 2PVLA 1A48A 3GC9A 4FTAA 4IMYA 4Y83A 4BCOA 4H05A 3ORPA 5JSMA 4UB7A 2CW5A 1XHAA 3R0TA 2EB3A 1M7NA 2NP8A 2EFGA 4RGJA 3RI1A 2WELA 1JA1A 5E8YA 1E1QA 1I7PA 1AMOA 5D10A 5B0XA 1LP4A 3MJ1A 4R7IA 4XOYA 5JBQA 3MH0A 5F1ZA 1VQ5B 4X7EA 2DY1A 4F7DA 2W7XA 4FTLA 4FV7A 4L3PA 4FSWA 2CNVA 4QQCA 3MVLA 3O5AA 5HE2A 4DFZE 3ZO1A 2F43A 2VX3A 3DXQA 2QODA 3H9OA 3KXZA 4QYYA 2OTLB 3GENA 1H1QA 3AGLA 4RD0A 1TQIA 3KY2A 3F5GA 2UVYA 4CQEA 3R7UA 3ZOSA 5D11A 2XEZA 1XMMA 4JQ7A 5EG3A 3TT0A 4XQFA 2AC5A 3E87A 2SRCA 3G51A 3R00A 4JS8A 4OBQA 4WRSA 4Y46A 1WBVA 5E90A 3FJQE 5HZBA 4BF2A 4D1SA 3WZUA 4QMVA 4P25A 5DG5A 1NVSA 4TWPA 4FGRA 2WHBA 4RX8A 2IW6A 4I3ZA 3QWKA 4TMVA 4ZCIA 3CCNA 1BKXA 3E8DA 3QD2B 3FI2A 2BTSA 2VTJA 2JAVA 1QVFB 2BPOA 3FLZA 1URWA 3NDMA 4R7HA 2C3IB 4L42A 4OBOA 3GGFA 4AA0A 5CS6A 1GOLA 1BLXA 4CCUA 2BSAA 3AVYA 4DQKA 3ZIAA 1H27A 1XO2B 3A99A 3B8QA 4U45A 5ANKA 5DWRA 3VONA 3VMFA 2BUJA 3G0FA 4KKEA 4EL9A 4KD1A 5GIPE 2J2IB 4YEJA 3AVXA 3ULIA 4C3RA 4YU2A 4IVAA 4RIXA 5A4EA 5BUJA 1T46A 5IZFA 3AC1A 5GHVA 2GJRA 4OPVA 4FV3A 5FNZA 1H1RA 1U2RA 4A9YA 4IH8A 3VS7A 5A6NA 4P26A 3PJ2A 1KE6A 1U54B 4A4OA 3CP8A 2OIDA 2YN8A 3RPSA 3ZM4A 5IEXA 1W7HA 3EQDA 4J8NA 4UZDA 4W4WA 2O0UA 2GQGA 1FPUA 4RD4A 1UU3A 1PJ5A 3RWQA 4DEGA 3FLNC 2WPAA 4U80A 1Q8YA 4XRJA 4MX9A 3GU6A 1ATPE 3MIAA 3P78A 5DRBA 4EH6A 5BQ0A 2QE7A 1S72B 5KKRB 4PP7A 3HMMA 3NUUA 4GCJA 3RAKA 2JKQA 4P7EA 5EK7A 5A46A 2CMWA 2XANA 4AG8A 4WO5A 3GP0A 4FKOA 5M56A 1N0VC 2O5KA 3OS3A 5AUWA 4BTMA 3EN7A 3QFRA 3HV5A 2XIYA 4XOTA 1YJ9B 3F2RA 2J0JA 2QA4B 3VBYA 4DYMA 5AAFA 5HX6A 1Y8GA 3I1FA 2R3LA 2FO0A 5KBQA 4IB3A 2W05A 4BTKA 2JEDA 4FE2A 3C0HA 3LMHA 4PDPA 3TJDA 3PRFA 4LG4A 4LGGA 3ZC5A 4D4RA 5B6IA 3KULA 1HCKA 2EWAA 2JDSA 4O2PA 4Y8DA 1CKIA 2PHKA 3LFBA 4AW5A 4C4EA 5HZAA 4YAUA 3ONYA 4TZRA 3HMIA 4Q5HA 3PJ3A 3CS9A 4IZ7A 4FTIA 3IW6A 3QWJA 5AAGA 3NSZA 3DZQA 1VQ6B 3FZTA 2VBUA 2X4FA 2JN9A 4G7XA 3KCFA 3ZBFA 1ZYLA 1YXSA 1XMLA 4YALA 1WCCA 2V0DA 4CD0A 3W2PA 3U2QA 1MQ4A 3UMXA 1VQPB 3LE6A 3PFYA 1H42A 2OYNA 3ORNA 3F2NA 5FXSA 5J9LA 3V04A 4H3BA 4RJ7A 5CU3A 5AAEA 1QG0A 3V8WA 1H08A 2R0UA 2VWWA 3QD3A 3SLSA 4ACHA 4EJ7A 4ZJIA 3F9NA 3I6UA 2VU3A 4AW2A 2H96A 3W0RA 4LBZA 5CZIA 4PMPA 3ORMA 4KKGA 1UNHA 5CU0A 2C2WA 1VQ9B 1KMHA 4B0GA 1XH5A 2BZHB 3MY5A 4ZTNA 3DJ7A 3WYAA 3LCTA 5JEBA 1HZEA 4Y85A 4X7CA 1YOMA 3C4EA 3PVWA 2QR8A 2AC3A 4M1KA 2HYYA 4BIEA 5HX8A 4K0YA 5EQEA 4CTCA 4C4HA 4RDJA 4YLLA 2PE2A 3ZMMA 2XAMA 2OKRA 1WZYA 4YSJA 4XONA 3LZBA 4IAAA 3D7TB 3BBWA 3A7IA 3VUMA 5IA2A 4QYFA 2IZTA 4OT6A 3PUMA 4ITIA 4RPVA 1KE9A 2XCHA 1XQZA 1PW2A 4IAIA 5EQYA 4DITA 3OWLA 3R8ZA 2R6HA 1Q81D 3RM7A 3UBDA 4JQEA 2XK7A 4BTJA 1KWPA 4I4FA 2V7WA 3JVRA 2V22A 2IG7A 3I6WA 3CGFA 2WMBA 4L52A 2V7TA 2QQ7A 5LARA 3TKUA 4B8MA 4P2KA 3H0ZA 4ZY4A 3BEAA 3OEFX 3FEGA 4MTAA 4GUEA 3F7WA 4KWPA 4FK3A 3AGMA 4N3NA 4U97A 4XLHA 5CF6A 3QKLA 4QOXA 4IIRA 3VO1A 3FI3A 2E1RA 5CVFA 3FV8A 3H3CA 4RFZA 3C4ZA 5L8LA 1H24A 4XM3A 1P5EA 3HRCA 5KZIA 3EQCA 1ZM3A 3MIYA 4BN1A 5I9ZA 4TYHA 2EIXA 3BCEA 3WF7A 4OTHA 4YELA 3T8OA 5M4CA 3R22A 5A88A 3RMFA 4M68A 2BRHA 2WTJA 3ZZTA 5EI2A 5JGAA 5HORA 3LQ5A 4LV5A 5IA3A 2VX1A 4GVAA 4BCIA 4F9YA 5FRIA 1UV5A 2FUMA 1X8BA 2JKKA 4H39A 3UNJA 4PP9A 3QA0A 4EZ7A 1EFTA 3W2QA 2VNHA 3PY1A 4U5JA 1S9JA 1SMHA 4FIFA 4RJ3A 3MSSA 4EOLA 4RVLA 4XD7A 4O82A 4B4DA 1URCA 4I94A 3ZCLA 4FZDB 4RLKA 4AZSA 3U6JA 3OPOA 5AP6A 5A6OA 1M7QA 3KF7A 4XKVA 4EWQA 2XYNA 3FI8A 3LLTA 4PDOA 5ANOA 3WIGA 2P2HA 5HIBA 2X9FA 3TZ7A 2OXDA 2RFSA 4AA5A 4F08A 4ZZOA 4ONAA 3SV0A 2HWOA 4YJUA 2Z2WA 3EWHA 3HV3A 3KCKA 1M17A 2Y8OA 3OVVA 3PRIA 5EYMA 3TKIA 5BVNA 5DOSA 4JAJA 4XP3A 2HDNB 3EIDA 1CKPA 4YNEA 5J87A 3GBZA 4FKSA 3DTCA 5JKGA 4I0RA 5AUUA 5C1QB 2Q0BA 1DARA 4G7WA 3WY9A 2CCHA 3R30A 3VS4A 2ZZEA 4RQKA 1OGIA 1GY3A 5FLFA 1WMKA 3RZBA 2J4ZA 2PUIA 4J96A 3BQRA 2I0VA 3VJNA 3CEKA 4EYMA 3EMGA 3ASQA 1KE8A 4MXCA 5TOZA 4XOZA 4IW3B 4GRBA 2HMAA 2OGVA 3MA3A 3VUGA 3LW0A 1OPLA 3ATSA 1OGJA 4MNEB 5G6VA 4JG7A 5L3AA 4OTQA 1WDTA 4X8IA 1V5VA 5BSXA 3PWYA 2C5OA 4TXCA 4Y95A 1FNMA 5DGZA 3R1SA 3L9MA 3ZBXA 1U5RA 5BPYA 1WBPA 4TYHB 2W96B 3ETAA 5EFQA 1DG1G 4KS8A 5JGDA 2HZ0A 2PUPA 1YWVA 3TUCA 2R0IA 2ITZA 3GVKA 4QMLA 3KL8A 4C58A 3UPZA 2GQSA 3BH4A 3FSKA 4O38A 4AW0A 2F1LA 3HYHA 2XIXA 3Q2JA 4QHYA 4IW0A 2BDFA 2WO6A 5AP2A 4D2RA 1PF8A 4RVMA 3MCAA 2A4LA 4U44A 3VQUA 4C4JA 2XBAA 5F94A 3PLSA 3L8XA 4DT8A 4FZAB 3NGAA 4BCQA 5JFVA 1YKRA 4Y73A 4NM3A 5CQWA 4XCUA 4I0TA 3V76A 3CCRB 3BC9A 3QRJA 3BZ3A 5BYLA 3DJ5A 4B48A 4YTHA 2ZAZA 4B9DA 5KMKA 4L6QA 4EOSA 5E92A 2FYSA 2F7EE 3GIRA 4K33A 2VTLA 4FXUA 4P22A 3Q6UA 2XK4A 4K1BA 1CKJA 2DYIA 1K9MD 3BYMA 3ODYX 5E8VA 1TVOA 3SQQA 4FTKA 2DWBA 3ONUA 4FJVA 3FQSA 1G8KA 2R7BA 1KOAA 2HZNA 5IYPA 4FT3A 3FLSA 3RHKA 3UP7A 5IA0A 3DNEA 3CY2A 4FOBA 4X3FC 2QLQA 2VWUA 5KBRA 4RA5A 3Q6QA 4C37A 4N3GA 3UJGA 4NJDA 1CM8A 3FKOA 4R7BA 1KC8D 1JQHA 3OBJA 4AOJA 3FPMA 4E8AA 4FR4A 2XCKA 4HCTA 4LV8A 4TKSA 5CZHA 4DBNA 4F7SA 3T56B 4RIYA 2JIUA 4WNPA 1V0BA 1OGYA 3DK3A 4NW5A 1KV1A 3P26A 1RW8A 3AT4A 1VYZA 2V55A 1QPJA 4FIIA 1KK2A 4RFYA 4HE6A 1YHVA 5BNJA 3M11A 3K5VA 5LQFA 3RNYA 2VWVA 2H8HA 4QNYA 4V04A 2UZDA 3VNVA 3PG1A 5AP7A 4MNEA 1IJFA 4BDBA 5BSYA 3FC2A 3JXWA 4BDKA 5CEOA 2WTDA 2WMQA 4KKSA 5HNBA 1AGWA 2C6IA 4XEYA 1EFRA 3L9NA 4BVUA 4DE4A 1ZLTA 2X7OA 4QP9A 3AC5A 3HRBA 5E4HA 5H5JA 1NT2A 1CMKE 2R3QA 2X6DA 4OOVA 4FV2A 3KXMA 2E1BA 1Q8UA 2WSSA 2BAQA 3LXPA 4NFNA 4FK8A 4BY9E 3IW7A 3UOKA 5FUTA 4FC0A 3FPPA 3DB8A 1VQ8B 4IB5A 4TNBA 2GNJA 2WR8A 3D5XA 4II5A 5KSWB 5AX9A 2QG7A 2XM9A 1NW1A 3VBVA 4QV2A 2VN9A 4IJPA 3NNXA 5KMMA 5HIDA 2IZSA 4E4LA 5CAUA 3DBFA 3C4FA 4QYGA 3ZSGA 5L8KA 2XMYA 3VF8A 3BHVA 3GCSA 4M13A 4HVGA 3II5A 3QD4A 4D5KA 4OP7A 3EB0A 4MK0A 4NTSA 1OB2A 5KE0A 2W1CA 4AP7A 3WXMA 3TYKA 4FG9A 4EH2A 3I56B 5C8MA 1T45A 1WP6A 2XNJA 1YI6A 4G6IA 2GFCA 3FZRA 4GT4A 1NRKA 4RX7A 3FMMA 3K2LA 4EK3A 3LMGA 4AXEA 1Q86D 3VS2A 2H9VA 4DNRB 4ZS4A 4TMXA 1WU8A 3VRZA 3FXWA 4HCUA 1UMKA 2I40A 5J9ZA 4KNBA 5JGBA 4OT5A 3N4VA 1J7UA 4R1YA 3WBJA 4GK4A 4YC3A 4BI0A 3TUBA 4MVFA 3R1YA 5M55A 4RDKA 3ES9A 1Y57A 4PC3A 5DR9A 4B44A 3EN4A 5HG5A 5IQCA 3UDZA 3AC8A 4I22A 5J8IA 4FI1A 4DH3A 1QPCA 2ZM1A 4JR3A 4MEDA 4RZWA 2GNLA 3G15A 4JBPA 4V0GA 4B99A 5IH5A 4Z1MA 3OW7A 3H4JA 2YWPA 1PMUA 4DH8A 2PE3A 3A4OX 5IQGA 4RPDA 4F9AA 3R8MA 3R2BA 2ZZQA 1XH9A 3U4WA 3KEXA 4FTMA 4JQ8A 5TKDA 3TNPC 1YXTA 4MXAA 2WMUA 3OWJA 5EKNA 2HW7A 5AUXA 4HGSA 1H01A 1ZZ2A 2BDWA 1NJID 1D1NA 5CYIA 2XNMA 1E1RA 5AV4A 5M57A 3BNWA 4XJ0A 2VBTA 2D9RA 2I1MA 2FB8A 3PIYA 3PUNA 3FMNA 2VD5A 2WMRA 5CXZA 4XL9A 2QOQA 2DOGA 4IC8A 4FKPA 2X2MA 2W1EA 3PVGA 4UEUA 1HCLA 3F3WA 1JSVA 3DY7A 3H10A 2ZYBA 3SD0A 1GAQA 3ANQA 4BDHA 4GT3A 4Y5HA 1YOLA 5E8WA 1N05A 3FUPA 3H30A 1VJSA 4O6LA 4NM0A 2VTAA 1H25A 3D4QA 3QC4A 4NM7A 3VQHA 3BHTA 4RIYB 2ZFYA 5KMJA 2CKQA 2BVNA 3A61A 4PWNA 3IOKA 5CLPA 1R0EA 4L46A 2WTIA 2V5QA 5IPJA 5F4OA 1VQMB 2YDJA 4NKSA 2O63A 5DRDA 3UE4A 4CFNA 4BC6A 1TLLA 5IYQA 3GI3A 2X0KA 3W0PA 1FNDA 4DCAA 2YM8A 3PA2A 1ZYCA 3N9XA 5F95A 2C0IA 4E5BA 1G3NA 3AKJA 3P7AA 3HV6A 1PXPA 2CPKE 2WNTA 3E7OA 2XK9A 4GKIA 3AGQA 4E6CA 3S95A 4DEIA 4D9UA 3R21A 2OW3A 4MQ1A 1PKGA 3QQLA 2Z7SA 2DYLA 4AS0A 4DEAA 3HVCA 3ZBUA 2QOIA 2FX3A 4ORKA 5HKMA 3TNWA 3R7IA 3C5IA 2IN6A 2XNGA 5JRSA 2WGJA 3W2EA 2F2CB 2JJ2A 3ID6C 1XR1A 3L1SA 1W98A 3DNDA 4MCVA 4O7TA 2RKUA 3PP0A 1VEBA 4GIIA 4CTBA 5KO1A 4XLCA 2WTWA 2W1FA 1F5QA 4RG0A 4ZTQA 4E6DA 3BV3A 5DBXA 1KE7A 2ZM3A 4HCVA 3OJWA 3NUAA 1ZMVA 3I1AA 1BQEA 4WRGA 1EWYA 3A7HA 4X7FA 3G33A 5C8KA 2PUNA 4FIJA 3F3ZA 4CV9A 1KZLA 1H8FA 3PXRA 3QHRA 3WF8A 5KMNA 1QFZA 3LFSA 4EH4A 5K4JA 3FMJA 3LFDA 2XKFA 3TM0A 3NNVA 5E8SA 3GXLA 1VHEA 3EKKA 4DK1A 4GG5A 3F88A 1YHSA 5FDXA 5HGIA 1U5QA 4PTEA 4IVDA 4NFMA 5HNGA 2ITVA 2W5BA 4KINA 3IECA 1Q99A 3AMYA 4A9TA 4BPRA 2C3LA 1T5EA 3NUSA 4FTNA 4NT4A 3O8UA 3ZDIA 4JX7A 4O21A 4TSFA 1YJNB 2WEVA 1VQKB 4BBFA 4ACDA 1ST0A 3OZWA 2HWPA 1TQMA 3VNTA 2DQ7X 4UY9A 3RCJA 4GJ2A 4LOPA 3BCDA 3CCQB 3Q9ZA 3ZDUA 4C2WA 3EL8A 1ZOGA 2V7OA 4I6LA 3CIKA 4DTAA 3PE1A 1IHMA 5EHLA 2GSFA 2C4TA 3W2CA 4F9BA 1H4LA 1JA0A 1UWJA 5M53A 3E3BX 4MKCA 2A2AA 4AA4A 4HYHA 2R64A 3CB4A 4RX9A 2Z7LA 2RIOA 3EH9A 4WHZA 5AUVA 3RPOA 4J71A 2EVAA 3C50A 2PU8A 3QTXA 3SW4A 4A7CA 5KCVA 3W2OA 3ZLXA 3LKMA 3S1HA 5DR6A 4B4LA 1ZRZA 4O7ZA 3TZMA 5HNIX 3UODA 3SKBA 4N6YA 4I0SA 4ZP5A 1H0VA 4QTCA 5E1SA 2OK7A 4YNOA 4X2JA 2C6KA 5JN2A 4DH1A 2NV4A 4V05A 3EKNA 3ALOA 3FLQA 5AUZA 2IZUA 2C6OA 5D7VA 3R8LA 3O8TA 4Z4WA 1NBMA 1QFJA 2X1NA 3P86A 4GS6A 4LC0A 3PPJA 3EQPA 3LFEA 5E9EA 5AP3A 5EQPA 1OKVA 4EH8A 4RWLA 3AGPA 3R8PA 1OUKA 3BEGA 4Y72A 4NWMA 3QX2A 1PMEA 3SLDA 2BGIA 2BFYA 4XNEA 5DVRA 5H8BA 2WKMA 4BZDA 2PZ5A 5LWMA 4D4SA 4G1BA 3AD6A 3HECA 3VAPA 1MUOA 4FK6A 4OLIA 4RCZA 4XV3A 2G2HA 2C69A 2VNWA 3FMEA 4FV8A 3U6BA 4OBPA 4L8JA 3ZXZA 4DHZA 5HO7A 3F6XA 1O6KA 3JYAA 3U6KA 4HOKA 1NDHA 2P2IA 1DM2A 2XJ1A 2PL0A 4K9YA 5CSVA 4JAIA 5TV2A 1MRVA 3T9TA 4QMTA 4CFMA 4MD7E 3R8VA 5HO8A 5FD2A 3PJ1A 4F64A 5FM2A 3WNCA 3TEIA 3ZFYA 1N06A 4RPBA 4AZVA 3WNDA 4FUXA 3MH3A 4XOPA 4BI2A 4B3FX 4E5WA 4PTCA 4QRCA 5DA3A 5KKRC 3E7VA 3Q4UA 2B53A 1L8TA 2HY0A 3FZOA 3NYOA 4FICA 5M08A 1N07A 5AV3A 3W2IA 2BMWA 3PP1A 4FV5A 3QQHA 4FYNA 4ZTLA 5LMZA 3LHJA 3CCMB 4XG9A 3CCLB 1WBSA 4CEGA 2C4GA 5IH6A 3OCGA 4DCEA 4XG6A 4TTHB 1SNUA 3C51A 4J1RA 1T6ZA 2G2IA 3C0GA 3Q6WA 1FVVA 3QL8A 4W4YA 3OJXA 3HLLA 4FTRA 5CAOA 4ROXA 3HGKA 2WTKB 4N57A 5HCZA 3ORLA 1SZMA 1JKSA 4GQNA 3NWWA 4WKQA 4XG8A 2I0HA 4TYEA 3VWAA 2GS7A 4AF6A 3U87A 2IPXA 1TTTA 2VTSA 4L7FA 4QQ5A 4XP0A 1Q8WA 2X8IA 4TWOA 2WOUA 3HMOA 2QKWB 3WZDA 1WSRA 1GZOA 4FNXA 4TRLA 5A14A 3AKKA 2X7GA 2O64A 2WJYA 2X6XA 4FX3A 4I6FA 2OJFE 3OE7A 2OBSA 3BY1A 1OL2A 1KD1D 3OXIA 5CU6A 3SX9A 4JX3A 3OW2B 4U81A 1UU7A 3RAIA 4DN5A 2Y0AA 3KXGA 5A4LA 3NW7A 4EJNA 5K5NA 4Z4TA 3KXHA 4GMYA 1DAYA 4FT0A 4XNFA 3PJCA 4WZKA 2PK9A 3COIA 3FZPA 3R73A 1I44A 4FKVA 5ETFA 1R0PA 4F99A 2D74A 3B8RA 1KK3A 3LCKA 3E20A 3BI6A 3SRVA 3L9LA 4NCNA 4ZOGA 3QTSA 1SVEA 3ODZX 4OTIA 1QL6A 2C77A 4DT9A 2UZEA 2J0LA 1OKYA 2D3NA 2LGCA 4QT1A 4EK5A 4I41A 3G9LX 3AD4A 4HGTA 4XLVA 1BX0A 5JQ8A 4PL5A 1KOBA 4FKIA 2V31A 4XLAA 4FTTA 5BVFA 3A8XA 3G6EB 2HCKA 3NIZA 3P5KA 3QSYA 4H1JA 4RWJA 4UWBA 3R9DA 3W8LA 1UKIA 3DDYA 4OTWA 2I0EA 5TRDA 5EYDA 1CNEA 3DZOA 3NAYA 4KBAA 4LRKA 1RJBA 1FRQA 2YJSA 3KRXA 3DBDA 3BRBA 4G3CA 4YJTA 2PZIA 3EFKA 2BM0A 3UC3A 1YX2A 2OZAA 3OROA 4JIKA 3DKFA 4PL3A 3Q32A 3RJCA 2QEXB 3RAWA 3UIXA 2XKCA 2BROA 2IVVA 4DQLA 3K5UA 3Q3BA 4G17A 4KABA 5FIUA 5FDPA 5AP5A 3CQUA 3FC1X 5EDPA 2X6EA 4MWHA 2J5EA 5E1EA 3DGKA 3OF0A 4G5PA 4ENXA 1AQ1A 5CAQA 3PDTA 5IYRA 4IZ5A 2C6DA 1PXKA 3BYUA 3DTWA 5AA8A 2HK5A 2W4OA 2B1PA 2X3UA 2V62A 4WSYA 5CEPA 1STCE 4P6VF 3ASTA 2PPQA 4L3LA 2B9IA 3PE2A 5KNLA 4A07A 1WORA 3UC4A 2Y4PA 5GV8A 4BDIA 2GTNA 4EOMA 4FTCA 4UXQA 1Q7YD 3WF9A 4LUEA 3SXSA 4O27B 2PMDA 2CLQA 4YPDA 3ZLWA 4E20A 4F1TA 4AUAA 5M44A 5FL7A 4F7LA 4PX6A 5EW9A 3REPA 4RIOA 4XN3A 1Q41A 1K3AA 2R4BA 3PG3A 3UNZA 4EC9A 4QYEA 1GR1A 1M14A 2F57A 4I5HA 4YLJA 3BCFA 1OL7A 4FV9A 4HNIA 4RIWB 1U46A 3GQLA 1XE1A 2WB8A 3SRVB 3U51A 3CRZA 4PGOA 2X9EA 3BELA 3V5WA 5HQ0A 4G5GA 2ONLA 4K2RA 3ORZA 3GVJA 2W4JA 3Q9XA 5HG8A 5AP0A 1G8JA 5BUIA 3G6HA 1YWRA 4ZS0A 4EUTA 4E1ZA 3MY1A 2RG5A 4IJ9A 5BV3A 2R3NA 5DR2A 3PJ8A 5GINE 3B78A 2HCJB 1W0XC 3I81A 4EI4A 4JL9A 5C26A 4XORA 3G4SB 4HIZA 3B8HA 4IHPA 3MESA 4EBWA 4ZSAA 2XNEA 3NNWA 5HVJA 1R5OA 3PA5A 4BDEA 3FJOA 5FTQA 1OVEA 4O2ZA 4O0UA 4QMNA 3D7TA 4P6YA 2W1GA 3SHEA 1HA3A 2VGPA 5HE0A 2R3RA 4F0FA 2FSOX 4ZY5A 3MS9A 3ROYA 3COMA 2ETRA 3HUBA 1YXUA 4DTKA 4JVGA 2XZOA 3UVPA 4APPA 1WFCA 3QTUA 5ETIA 3VNUA 3IW4A 5GV7A 2PTKA 4FIEA 3DU8A 4NBSA 3VO2A 4XG4A 4USFA 4FN5A 1PYEA 3HAMA 3N4TA 4PNIA 4D4VA 1IA9A 1H0WA 3MN3A 2YHVA 1OUYA 2BRGA 3KF4A 4NIFB 4ASXA 4FKUA 3A3BA 5IU2A 4Z4SA 5IQIA 3E1YE 4PUZA 2ITXA 1BL7A 3UQFA 4GV1A 4ANMA 1JLUE 3NMUF 3TDVA 4EQMA 5B2LA 2BF4A 4DFYA 2QTLA 4GVJA 1YI3A 2WTVA 3QBNA 4H3QA 3I0OA 3MMPA 4I5CA 5CT0A 3U6IA 3HL7A 1TQPA 3W8QA 3CPXA 3TV4A 4OR5A 1ZM2A 4AZWA 4KUJA 5LVOA 3PVDA 1H8EA 1H8HA 3GU7A 3SEJA 3RTPA 2VTRA 3ZC3A 3K3JA 1WAKA 4F63A 2GQRA 4P2NA 1JKKA 4Q9SA 3RHXA 4AZTA 5BVKA 1BL6A 3DBEA 4RLLA 3W2GA 3OWPA 4TWCA 4AT4A 2PVMA 3MH1A 1V1KA 1N08A 4WZTA 4IADA 4NNJA 5KW9A 4V0GB 4B43A 4FG7A 4YC8A 3ZZWA 1RQPA 1RE8A 1R5NA 2J7KA 4E0FA 3BLAA 5ACBC 4YC6A 4EC8A 5AA9A 3JR1A 2O3PA 4X7QA 1Y0RA 4RDLA 3Q4TA 3MB6A 2VWIA 4O0SA 1T6YA 2UUEA 4RWKA 3D5VA 3D83A 3KRWA 3LAUA 4UZHA 3TTIA 2YCSA 2V7AA 5CX9A 5HTCA 3HMNA 5CEIA 4U9AA 5CANA 4WD5A 2UW8A 3V5TA 2BFXA 3U9NA 3FI4A 3KK8A 4NYEA 3S4QA 1IAHA 3RWPA 2OBTA 3DXNA 4RJLA 2XK6A 2XKDA 2W0JA 3NFFB 4RD3A 4JG6A 4WIHA 4IZYA 1B23P 4LFIA 4YJOA 3WBLA 4BGGA 4C4FA 2CNUA 3ZFXA 3CCVB 3Q38A 5TY0A 1E1XA 1R78A 4S34A 2WEIA 3CCJB 4DDIA 2VWZA 2QLUA 2WMAA 5HICA 4MHAA 3SAYA 4C0SA 1GNGA 3KMWA 2VNYA 5E91A 4BIBA 4E93A 1OBGA 4R77A 1DDGA 3Q9YA 1BJKA 1EP3B 2F4JA 2WU6A 4GK3A 4I6HA 4L8MA 5C01A 5T68A 1LUFA 2RGPA 3TV7A 2F7XE 3RGFA 5EKOA 3HP5A 5EM5A 1LEZA 5IQAA 1GVHA 1Q5KA 2VO3A 1V0FA 1MRUA 3E93A 5AEPA 2PMIA 4HPTE 4ZGNB 5AADA 2CGXA 4BYJA 4F65A 5CDFA 3BE9A 2PULA 1ZM4A 4KRDA 4EQCA 3UYSA 3PVBA 4D1XA 3MVJA 4K6ZA 5LCJA 4CQJA 4TY1A 2QHMA 4ASZA 4BJJA 5B7VA 5C4LA 2QC6A 3ZUUA 2QN6A 3D15A 2NNWB 2YCFA 1PKVA 3KC3A 3I0QA 3OC1A 2Q6KA 2ZVAA 4FZ6A 4O0YA 1Q97A 2X2KA 2CRVA 1RQQA 4YO4A 1OBDA 4JNWA 4N70A 3TJCA 2KULA 4U3ZA 5IUGA 2RG6A 4GU9A 5KHWA 4JT3A 1GZ8A 4U42A 1DAWA 3SOCA 4X0MA 2E9UA 1K2PA 4X3FB 4AAYA 4HVHA 2BV3A 5EW3A 5EYKA 3R7VA 3WBKA 4YBKA 3C4XA 2GQFA 1FGKA 4YZCA 3T9IA 1FNBA 3CC6A 4WUNA 4UWYA 1VYWA 2WZPP 2E2BA 4FKLA 2P33A 4L45A 1FX0A 3VS3A 4F0GA 2PVKA 3VS5A 2GCDA 4GG7A 4LOOA 3T3UA 1FGIA 3CMEB 4G1VA 3BLHA 4M14A 4O84A 1WBNA 5D41A 1KV2A 1JOWB 4FEVA 3CQEA 4IAZA 3SGCA 3F3VA 4Q7JB 3GC8A 3Q04A 2F7ZE 3DKOA 3TTJA 4FYOA 4MXYA 4QMXA 3MWUA 4RC2A 4L7SA 1H1SA 4JIAA 4DH7A 4TMTA 5LMKC 2YCRA 2EXMA 1F20A 5HCXA 1CNFA 2JDRA 4I93A 3Q9WA 4QQTA 3FKNA 3GCUA 3QFSA 1YDRE 3QTQA 4C59A 3OOMA 3JS2A 5T3QA 3OZUA 1OL6A 4EUUA 3MJ2A 4EHGA 2CGWA 2HOGA 4X7DA 3V3VA 3AOXA 3MDYA 4CG9A 2BILB 1LPUA 3UIUA 3F61A 3GU8A 5CT7A 3DXPA 3WOWA 5CI6A 5DN6A 4S30A 1S9IA 4RD2A 2ITWA 1JAMA 5HBEA 4FVRA 3SG8A 4AACA 2ACXA 2WFYA 2X4ZA 4FTJA 5AP4A 4D58A 1QPDA 3AC3A 2BAKA 3I5NA 3C5UA 4ZY6A 3EFWA 2AEGA 3D5UA 2QOKA 5HZNA 5CF4A 3OEZA 1OGUA 4E7WA 4AGWA 4FL2A 2O65A 4GIHA 4AC9A 3KVWA 3TZ8A 2GK7A 3P5JC 4U40A 3COHA 5A3XA 1G8AA 4M12A 3OW3A 2D3LA 5HE1A 2F49A 4CMOA 4Z4VA 5CVHA 2JDTA 1BMFA 3NYNA 3QFCA 3ENHA 4IB0A 4M0YA 4QTDA 3S2PA 4ASDA 5FEQA 2QDXA 1YI4A 4GFMA 1QPEA 2XNNA 3NYVA 1XBCA 4FKJA 5FM3A 5CAVA 2QU5A 5FXQA 1A8PA 2QOCA 1E3XA 3HAGA 4QQJA 2YM7A 4R5SA 5IDPA 4MAOA 5EOLA 3PPZA 2JC6A 4G6NA 4QPAA 3LQ3A 3KVXA 4BGHA 5M4FA 4DHFA 2Z8CA 3D7ZA 2NPQA 2GPHA 2UW5A 3LJ0A 3H9RA 2ZBVA 3EN9A 3ZZEA 3UQCA 4NKAA 3WZKA 3K54A 3LJ2A 4NZWB 2NRYA 2Y6MA 3OY3A 4R6VA 2B7CA 3HKOA 4XH6A 3R63A 4EKLA 4EH3A 4J97A 3LQ8A 2C30A 1WVWA 3FHRA 3PXKA 3VBTA 3O2MA 4CT2A 1FINA 3OBGA 2JD5A 4DEDA 3JQRA 2UVXA 3ZO2A 2UV2A 3IS5A 2PSQA 4K11A 3ITZA 2B9HA 1AIPA 4XV1A 5ETAA 2IVUA 4X2KA 3BKBA 4AZEA 4M7IA 4MXOA 1SM4A 1P14A 4CZUA 4DG2E 1XBAA 1JJ2B 2HXLA 5FTOA 4PMTA 4AQKA 5TR9A 2VO7A 3CP2A 5D9HA 1BYGA 4YHTA 2XBJA 3QCQA 2FH9A 3G2FA 3QQKA 5J35A 4XR6A 3C13A 4FNWA 4KAOA 2ZV9A 3Q6RA 2X6WA 3CMAB 2UZUE 5HCYA 3UOLA 4BCHA 4C3PA 5IMXA 1T6XA 4D5HA 1OIUA 1FRNA 4H58A 1FOTA 2R3HA 2R9VA 5LVNA 2WMWA 4BIDA 2UW9A 3QUPA 2CDZA 2BRNA 4Q5EA 2ZTNA 3GOKA 4I1ZA 4YJNA 4C36A 5HG7A 5A89A 1S0UA 1O6YA 1Q24A 4UYNA 1XBBA 3ENMA 3HRFA 3NZ0A 3ZTXA 3ACKA 2R3KA 2ZJWA 3O50A 2C3JA 4PDYA 3KIOC 4CSVA 2J0IA 2XAOA 1D8TA 3ZONA 3TKHA 3R02A 1COWA 3S3IA 4Z55A 4R1VA 5L6PA 2CKPA 4ZGQB 3LFCA 4JDHA 2HELA 2QOFA 5EHOA 2RFDA 3HX4A 3W5UA 2ITYA 2WJVA 2BIKB 3GCQA 1EFUA 5HD7A 2XJ0A 2OTJB 1TUIA 4BTFA 3MYGA 1NB0A 3WNBA 2YDKA 3N51A 1VQNB 4XUFA 3V5LA 2J50A 4F0IA 2XRUA 1KQSB 5J7HA 4EOOA 3VC4A 1F3MC 1OL5A 1BPLA 1QH0A 3TWJA 1U59A 2P4IA 1J7IA 3UZRA 5IEYA 4S31A 4BJJB 3RPVA 4IWOA 2NYAA 4YZMA 4AXAA 5B2MA 1YW2A 2CLXA 2GFSA 3G05A 2VGOA 3DKCA 4NU1A 3FXZA 4PC7A 1QCFA 2GHLA 2A19B 5DPVA 3QTIA 4GH2A 4BZOA 5K3YA 4UAJA 2OIBA 4ARKA 3R7EA 3BGPA 4DFXE 1V0PA 2CSNA 4BGQA 3FE3A 2OFVA 2ZV7A 2JJ1A 3HNGA 3BGQA 3PZHA 3QALE 4FEWA 3HA8A 5EDQA 5M4IA 3RK5A 1YJWB 2H6DA 2VTQA 2XNDA 1CSNA 3EFJA 3OHTA 2B5OA 4LMNA 4ZTHA 3R9HA 2FA2A 2XA4A 4TYIA 3GNIB 2OXXA 3IDBA 4FSQA 3AXWA 3FLWA 3DAKA 1WBOA 2XM8A 1TVCA 2E9PA 4C33A 3VUHA 1RQRA 2PE0A 5GJDA 3UVRA 5A4CA 3ZC6A 5KMLA 1QGAA 3EZVA 3HA6A 4NW6A 5HLPA 3BU3A 5DSZA 3AVTA 3PY0A 4Z7HA 2PMLX 3JY0A 3SVVA 4O7SA 4Z4YA 4FNZA 5FXRA 3SJPA 1Q8ZA 3CTJA 3FQEA 5EM6A 2IVSA 4AT3A 4CT1A 4XRLA 4LUDA 1PMVA 3B2TA 4X3FA 4QP3A 2VUWA 3OMVA 2B52A 3Q5IA 2A1AB 4PNKA 2Z7RA 1HOWA 2ERKA 3MPMA 5CSXA 4ANSA 2VWXA 4Y5QA 2W1ZA 5IK2A 2BVAA 2WTCA 4EONA 3ZSHA 5DFPA 5FP6A 3ASSA 4Q2AA 3PXFA 1KE5A 3P79A 4R5YA 1VZOA 4QMPA 5JFWA 3CD3A 2ITUA 5JZNA 4AFEA 1IRKA 3QHWA 4ZTSA 4UV0A 4RD6A 2C5XA 4YJQA 5IYNA 3CC4B 3VUDA 4AE9A 3QRUA 5J3OA 3CE3A 1JNYA 4EHZA 3I55B 4OGRA 3ZFMA 2BRMA 1XWSA 3OZ6A 3C9WA 3P9JA 3UO5A 1I09A 4CFFA 1XH7A 1XKKA 2VWYA 3OY1A 5H8EA 4G5JA 3WZEA 1I8DA 3QX4A 1Z57A 3GC0A 2XH5A 1VQ4B 3WF6A 4DHJA 4QMWA 1MP8A 4F1OA 2QONA 1YDSE 3ZHPC 3BE2A 4XBRA 1NB9A 3QAME 3U54A 4O0RA 3NVKI 2X81A 3UO4A 3U8WA 4S32A 5TF9A 1M1KD 1M2PA 4IX3A 2XK8A 1WPCA 4EBVA 3OP5A 4CRSA 5HIEA 1OPJA 4P3YA 2FSLX 2GPJA 3HDNA 3VS6A 5DEYA 3FYKX 1EH4A 3MVMA 3DJ6A 3QZHA 3ZLSA 1G7SA 4MH7A 4M0LA 3SJZA 4KKHA 3UTOA 3CJGA 1VLRA 2C3KA 2WIHA 1M2RA 3JVSA 5A54A 1PY5A 4R3RA 1VLOA 3PENA 5C03A 1EP1B 3EQRA 3D0EA 4YZNA 5EOBA 4QP8A 3A7JA 5BVWA 4AW1A 2JGZA 4H36A 4D28A 2OI4X 3BHUA 3G71B 5EYCA 4YAOA 3VW6A 2F2UA 3MH2A 4BR3A 4DGLC 4JBOA 1UD8A 5ITAA 1XFOA 3QCSA 5TO8A 4IE9A 1R1WA 1FVRA 4KKUA 2WQNA 4JJRA 4LL5A 4FVQA 5GJFA 2BZKB 3JUHA 4ZK5A 3RINA 2QURA 5F9EA 1U54A 4FSMA 3E64A 3EL7A 2CGUA 3AMAA 2J0MB 3RALA 1OIQA 4KIQA 1OB5A 1WBWA 4P12A 5F4MA 3GU4A 2G1TA 3R6XA 3IG7A 3PSBA 5EHYA 3WIKA 5BUEA 4ZZMA 3MVHA 4ZTRA 4IANA 4EWHA 1H07A 3QUEA 4CNHA 2NRUA 2V7QA 4ZSLA 2IJMA 4O81A 2ZITA 3ORIA 4YBJA 5CALA 3LFNA 3Q4ZA 3FZ1A 5LMAA 2JDVA 1IR3A 3BU5A 3O51A 3OCBA 3V6RA 4D1ZA 5CXHA 5A8AA 1WVYA 2C78A 3VBWA 1YXVA 2HENA 3QGYA 2W6JA 4NCTA 4II3A 3IW8A 1R5BA 3TACA 4QDVA 3ULZA 3Q5ZA 1K8AD 4FUYA 4DFUA 1A06A 4XLIA 5AX3A 2Y6OA 4AAAA 2ETMA 5C8NA 4M53A 4YJPA 2OLCA 2C6TA 1H28A 3O7LD 3IDPA 3QKKA 5M06A 3DQWA 3NAXA 3AG9A 4UZEA 3EN6A 4O0WA 3DKGA 2PMNX 1H1PA 4RMZA 2OZOA 5BMSA 2OO8X 3LXLA 1XJDA 2C0OA 5HG9A 4BBMA 1ZY5A 3GVLA 4F7JA 3QTZA 4CKJA 2C1BA 4L67A 4QP7A 4DGMA 3U4UA 2BAJA 3QZIA 5AM7A 3LFAA 4LYNA 4ZV4A 3DA6A 4N0SA 3ORKA 4H9GA 3CJFA 3W0SA 3PPKA 4ACMA 4YMJA 2QHNA 2XEYA 3P23A 4IAYA 4PL4A 2VTHA 1NY3A 4C62A 2XK3A 4F7NA 3UDTA 3IO7A 4XG3A 4CG8A 4ZTMA 2GNFA 4WBBB 5AP1A 3ISXA 4A4XA 3A1PA 2F4NA 5DT4A 5JMSA 4KIPA 2Q0NA 1QUEA 3W0MA 3EYHA 5HXBA 3LLAA 1ZWSA 5IA4A 2XRWA 2DEUA 1YI2B 2XIRA 2UZOA 1GZKA 4I23A 3M42A 4C2VA 4O7YA 3EOCA 3FMKA 2CKOA 1SKQA 4ZSJA 4ERWA 5KMIA 1BI8A 2E9OA 2IW9A 2WQOA 3FMDA 3LPBA 4NSTA 2WAJA 4IFCA 2QVSE 2R5TA 4X2NA 3TDWA 1ZOEA 4FKQA 2VTMA 2A0CX 3OT3A 1PJKA 5D7AA 5IUHA 2CGVA 3ET7A 3L8PA 4G6LA 4FZFB 3QE2A 1W2BB 3SLNA 4BCJA 4WNKA 1OM1A 4EOPA 3Q60A 2ZL7A 2ZXHA 3FMHA 4NUSA 3GFWA 4PDSA 2PE1A 1H1WA 3JPVA 2C5VA 3KMUA 1G5SA 4TN6A 4HVSA 1YIJB 5KMOA 2C6MA 2VBVA 4EHVA 1TFFA 3BBTB 4FEXA 1QVGB 4F9CA 4JMQA 2UW3A 2YDIA 2IW8A 3GCVA 3MI9A 3WARA 4XLEA 2XB7A 5H3QA 4DBXA 1IG1A 3C7QA 3G90X 3IPHA 4JDKA 1OITA 3E88A 2ETKA 5E8XA 5A9UA 3KB7A 3VIDA 5IQFA 4DK0A 3QCXA 1N0UA 1J1BA 2B55A 4FZ7A 4J53A 5L8JA 2R9SA 5ACKA 4F6SA 5LWNA 4I5PA 3U6HA 3QZGA 4ZSEA 5HBHA 4Z4UA 4QP1A 3RPRA 3ZUVA 4J95A 3CCUB 3IONA 4BI1A 2B7BA 4UYAA 3OEHA 4X05A 5JK3A 3ZEWA 4I5MA 4BHNA 2W9FB 4K18A 4O7NA 3AT3A 4RJ6A 5AV0A 3UGCA 3M2WA 3VULA 5CNOA 4O7RA 4ALUA 4DF3A 1IEPA 3W2FA 2BHHA 4IVBA 2YIXA 2WD1A 5IQBA 4O6EA 4BDAA 3ZRKA 5IQHA 4BHZA 2REIA 2B0QA 3DK7A 3ZRMA 4LL0A 3P0MA 3NUNA 3QYWA 3DPKA 4YHFA 4KA3A 4FODA 3UIBA 4B47A 5BYYA 3KKVA 3VO3A 4AX8A 2CNQA 3PIZA 4BDCA 3KA0A 5DE2A 5EM8A 3PFQA 4FKRA 2UW0A 2X7FA 4RM0A 5DH3A 1APME 3E63A 4YPSA 4AQCA 2I7QA 3ZS5A 4EH7A 5M51A 4Y7CA 4CLIA 3TUDA 1U4DA 2W17A 4P1VA 4YXWA 3D26A 2YZLA 3FXXA 4YHJA 2R2PA 2C68A 4QMUA 3L8SA 4GYIA 3W18A 2G2FA 2V7XA 4ITJA 4CFXA 3LM5A 4WG3A 4YR8A 4HZRA 5FG8A 2XF0A 4GSBA 1ZM9A 4C0TA 4CCBA 4G9CA 4XG2A 4PABA 5A4QA 2PVHA 4PF4A 4ACCA 1UA2A 3QQFA 3OD6X 1GIIA 4JI9A 2WU7A 2BR1A 3O7LB 2AYPA 1ZARA 5KNJA 2JBPA 4PTGA 2PY3A 3W2RA 1VR2A 2YZAA 3D2IA 3PXYA 1MRZA 4RSSA 1G7RA 4TT7A 5HI2A 4OTDA 4HE5A 3UP2A 4AU8A 4DLIA 4E6QA 2PZPA 3DS6A 2I1LA 1FMOE 5DHJA 5DYJA 1VQLB 2P3GX 3Q52A 4DINA 4HZSA 4UALA 3UG2A 1NVQA 4XX9A 4K1XA 4M2LA 4U79A 4BZNA 1IAJA 4HYSA 1BMKA 4II2A 1GIJA 1H00A 2VZ6A 2HY81 3QRTA 4I20A 4JXFA 1UU8A 4L53A 3Q4CA 2HLDA 3RNIA 4ZLOA 4H3PA 4PAAA 3FY2A 3P4KA 4LGHA 4OTGA 4W4VA 2W1DA 2ZBUA 3A7GA 3A8WA 3CPBA 3POOA 3CSVA 2V7VA 3PZEA 2X39A 1EFCA 5A4TA 3BL7A 4J8MA 3PSDA 4LQMA 4IZAA 5AV1A 3E3PA 1E3ZA 3A8JA 2J90A 3VHKA 1G7CA 2QOLA 1YLOA 2PLFA 2YFXA 3PUFC 4ENYA 3HV7A 3LFFA 3SXFA 2YITA 3NR9A 4YJRA 3VBXA 3CY3A 4CGAA 3IKAA 4FL1A 2PIAA 3I5ZA 4C61A 4EORA 2UVZA 4FBXA 3B2WA 3V5PA 4O96A 4ZIMA 4LV7A 5F4JA 4YAWA 2C5YA 1F0QA 4O86A 5FBNC 1FNCA 4MD9E 1VLYA 4IWDA 3EHAA 3GQIA 1JKLA 3ORXA 4K8AA 2OK1A 5H2UA 3JQQA 3CTHA 3A8KA 3WQZA 3F82A 3H94A 2WMXA 2QU6A 3G0EA 3I60A 4BCPA 2W5HA 4CRLA 2ZXIA 5T6KA 3ZLYA 4QMQA 1PHKA 3E62A 2VTPA 2OJGA 3OEEA 3SG9A 5IA1A 1FQ1B 1Y8YA 1G8SA 1Q61A 1Y91A 2R3MA 3NX8A 4OOXA 2C47A 1O9UA 3Q2MA 3P1AA 4F4PA 2DS1A 4WA9A 1UKHA 2X2LA 4JRNA 3RP9A 5DS0A 3ZBTA 3WYXA 4BYIA 3QYZA 4C34A 4LBWA 1YVJA 3WILA 5AFVA 5TR6A 4KS7A 1E9HA 2OICA 3BL9A 1JNKA 3HDMA 4FV4A 4AE6A 3T51B 3S00A 1V0OA 3LIJA 1GJOA 3W32A 3IGGA 4U7ZA 4E26A 4RVKA 3MFSA 5HTBA 2P55A 2QOHA 3K3IA 2DETA 1J9ZA 3CC2B 4ASUA 3QXOA 4G3FA 3VUIA 3TMOA 4ANLA 2IWIA 3LO8A 2BALA 2UZBA 4M0ZA 3BLQA 3NEWA 4O7LA 3W0NA 5E8UA 4LRMA 1P4FA 2J9MA 3DOGA 3ZZUA 3NW5A 2WQBA 1DS5A 4JBQA 5HLWA 3P7CA 2QGGA 2VAGA 2BMCA 3V7AA 3DAEA 4X0CA 3UPXA 1UD4A 3D94A 4L01A 4C3FA 4YUQA 4EQUA 1W34A 2B9FA 3KFAA 3NLBA 4FV1A 3LOKA 2UW4A 2OF4A 3BWJA 3QA8A 3ZSIA 3NRMA 4TYJA 5LCKA 4ACGA 5LVMA 4MQ2A 4U6RA 2R3OA 4UBAA 5I9XA 2X8EA 2OJ9A 2YM3A 3DBCA 5CQUA 2DCUA 2NO3A 4AGUA 4ZMEA 1XB2A 2VNKA 1YRPA 2OBJA 2XNPA 2XVDA 3M1SA 4JLCA 4ZJJA 2YIWA 3W55A 4GL9A 4D0XA 3R6KA 2B9JA 3HP2A 3OXTA 2VX0A 1VQOB 2YCQA 3QCYA 4MYGA 3T3VA 4B6LA 3JU4A 4L44A 5L2WA 2YM6A 4BCFA 4HPUE 4YTCA 2XGJA 3ZUTA 4X6QC 2HAKA 5LXMA 1W0JA 2QO7A 4YO6A 3VR6A 1GAWA 4IAFA 2DIEA 4L00A 3ZO3A 2R3PA 3JQPA 3GCPA 3S0OA 3ZZ0A 2YAKA 4O7VA 4P5QA 2JIVA 4IDTA 1PXNA 2CC2A 1J7LA 1WSVA 3ANRA 2LAVA 2PUUA 3RCDA 1YOJA 2RC5A 3ROCA 4QO9A 2PWLA 2Q6OA 3O0GA 1PYXA 3ORTA 3E8CA 1IB0A 4XN0A 2YABA 2BCJA 2OJIA 1BUHA 3PXZA 3OP1A 4Z7GA 5EH0A 1H26A 3ASPA 1OHHA 4J99A 4NM5A 2GNHA 1W84A 3UQGA 4AT5A 1K73D 4N6ZA 4P90A 2C0TA 4L43A 4PC1A 3ZUGA 3TL8A 2QO9A 1JVPP 3VVHA 5CSPA 4CLJA 3SW7A 4BCMA 2ZOQA 2Z7QA 3MY0A 4R3CA 4F9WA 3BPRA 3Q3AA 3DFAA 2W9ZB 4LM5A 5CY3A 1KJZA 2ZDTA 1SKYB 4P3IA 3OUKA 3EQGA 3TNIA 3TNQB 3VHEA 5M09A 4IFGA 2KVOA 3AC2A 3FQHA 3Q96A 4DG3E 3CTAA 4YP8A 1ZAOA 1ZMWA 3KRJA 4RC3A 2Y4IC 3RK9A 4AOIA 2YWEA 4D55A 1GJRA 5FTGA 1QX4A 3MFTA 4YAFA 3ELJA 3F66A 2CCIA 4ACAA 3A2CA 2XIZA 4Z16A 2X0GA 1UU9A 2UW7A 4RVTA 4ACBA 3C1XA 4IQ6A 4WBOA 4A4LA 3R1NA 3BYSA 4EYJA 2PVNA 2W6IA 1HVXA 2IVTA 5EM7A 3ZO4A 1LEWA 2GJKA 2NPFA 5IF1A 4KSQA 4PY1A 4QPSA 3GU5A 3W2HA 5AMNA 3PTGA 4IM3A 1DDIA 2YACA 3MW1A 2VO0A 1NA7A 4MYTA 4IM2A 2JFMA 4QTEA 2W99B 1XH8A 3AVVA 4AF7A 2CKEA 4AGCA 3AMBA 3GT8A 1UNLA 3PYYA 5LMBA 3CQWA 4FT7A 1Q8TA 2QOOA 5H59A 5BX0A 4A9UA 4G2FA 3QQJA 4LI5A 5B2KA 2BZJA 3UZPA 5HBJA 3LCOA 3QGWA 4L68A 4YZ9A 5CVGA 5HE3A 3RPYA 4DFNA 5IH4A 2CN8A 3BY2A 3NYXA 5D1JA 4WNOA 3W1FA 3ZU7A 2C5HA 2C5NA 3QQUA 4AN9A 4E73A 4BCGA 3DCVA 4USEA 1ZYJA 2WIPA 1Q9SA 2XP2A 2PZYA 3DBQA 1YHWA 1SYKA 3L8VA 2GNGA 3RKBA 3TG1A 3TN8A 4DDGA 4G9RA 2UZWE 3AT2A 1YDTE 4H1MA 2HIWA 2ZZGA 1ZY4A 2Z02A 3ATTA 5AIKA 5EI8A 4D4YA 4F78A 2Y9QA 4OTRA 4U41A 4GFOA 3IGOA 1K9AA 4XYFA 4ZLYA 4Z9LA 1PKDA 5I0BA 1E64A 4F6UA 4EH1A 3CKWA 3MTFA 3PY3A 5LVPA 3ERKA 2J6MA 2WMSA 3BU6A 4FV0A 2CHLA 3VN9A 3G5DA 3GQBA 2XARA 4IC7A 3DLSA 4WG5A 5EDRA 3UDSA 3OOCA 4DGGA 5C9CA 5GIOE 3FPQA 4O83A 3W33A 1ERKA 5IYWA 4GK2A 4PC2A 2JDIA 4FSYA 4OPOA 3H9NA 1WBTA 1QMZA 3V51A 2ESMA 4CVAA 4QMSA 4FNYA 3W0OA 5LMKA 3CBLA 5DT0A 2UZTA 3R7YA 4HVDA 3QC9A 2IO6A 3O71A 2JKOA 2WMTA 1CTPE 4J98A 3OOGA 4I6QA 4JRVA 1M90D 3GEQA 4IM0A 1MABA 2BPMA 5I9YA 4EKKA 2CN5A 4G16A 1ST4A 5DLSA 2FVGA 3OT8A 4J52A 3A35A 3BWFA 5J1WA 2Y4IB 4I21A 2QKRA 3LNNA 3HAVA 5ICPA 1B6CB 2YIQA 4M69B 4N4SA 2YIYA 2FSMX 4WT6A 5ANGA 4FTQA 2YWGA 3CCEB 2OH0E 3G6GA 1S4MA 1BI7A 3SOAA 3F3TA 3PLAE 5F4NA 2C4UA 2PYWA 3HMPA 2ZDUA 4HVIA 3V5QA 1WOOA 1SVHA 3R1QA 5ETCA 5G1XA 1GIHA 3THBA 2AHOA 5FO0A 2B7AA 4YHBA 4RJ8A 4IBMA 5DEWA 3TXOA 5CF5A 3EYGA 3UZTA 5HVKA 2ZZFA 1J1CA 1KRHA 3KXNA 4M3QA 3OFNA 5L2SA 3VBQA 2R3GA 5HKKA 2CNDA 3NIEA 3R71A 2XYUA 2JLDA 4ZAUA 3MPAA 2CF4A 3QLFA 4USDA 5HU9A 5AIRA 4EOJA 2EU9A 2OH4A 4L9IA 3FBVA 5JFSA 4IDVA 2WXVA 2E9VA 4NK9A 4KSPA 3C4WA 5E8ZA 4EOIA 2C6LA 5CI7A 3CESA 4OUCA 4UZFA 1Q3WA 2HZ4A 2I0YA 2XUUA 3HV4A 3R9RA 2QMUA 2F1MA 3KL9A 3V8SA 4AF3A 2YM5A 3E8NA 1A9UA 1GAGA 3PA3A 4IX6A 5CSWA 5CENA 2GNIA 2VV9A 3KMMA 4QYHA 3RK7A 3ZM9A 2OFUA 4RLZA 3FYJX 2ITNA 3LFQA 4BKJA 2GK6A 3FY0A 1ZXEA 4GFGA 2OU7A 2GHMA 4RIWA 1P4MA 3A4PA 4XG7A 1P2AA 3V5JA 4Y9UA 3P7BA 4V01A 4RQVA 1QFYA 4XMOA 3ML1A 4BB4A 4D2SA 3MHPA 4IVCA 5BMMA 5BVOA 4RFMA 4A06A 3MBLA 2UZLA 4IX4A 3D5WA 2ITPA 3OFMA 1UVRA 5C27A 3RY8A 3NCZA 4KRCA 1OZ1A 4YSMA 1PMNA 4RWIA 4OTFA 4M8TA 5LJJA 5F20A 4EK4A 4EOKA 5IUIA 4DEHA 3FAAA 1PXLA 5EW8A 2UZVA 3KRRA 3OWKA 4X2GA 1KUTA 3R28A 3CR0A 4XV9A 5DT3A 3KREA 3R01A 4LDTA 3NNUA 4RT7A 2OXYA 1ZZLA 1Y6BA 5HEZA 4Z3VA 4PV0A 4RCYA 2XNBA 4FL3A 5I9VA 2BKKA 3NW6A 4WZEA 4ZEGA 3OG7A 2UZNA 4S2ZA 5AJQA 3IQ7A 4ALWA 4WQMA 1XH4A 5L46A 2RF9A 3VW8A 2ITOA 3SA0A 4ID7A 1YITB 4CKRA 4W4XA 3R9NA 4AOTA 3ASRA 3E8EA 4TNDA 2FVDA 1PJ7A 2VNIA 4RJ5A 4IEBA 4UZUA 2DERA 1IJEA 4FMQA 3KEWA 4FKWA 3TIZA 5J9YA 4UWCA 2AUHA 4G3EA 4JR7A 4K77A 4QDEA 1RDQE 4DH5A 1L3RE 5EI6A 2VYQA 5ANIA 4YZDA 1IASA 2X8KA 5JQ5A 4U9UA 3MTLA 4CMTA 2ZTGA 2EXCX 3KQ7A 3EJ1A 3PA1A 1GZNA 5ANJA 4AVZA 1UWHA 2VTOA 4C4IA 3OTUA 2J0KA 2ZB0A 4IWQA 3FWQA 4WUAA 3OCSA 3G9NA 3QQGA 3FSFA 3QFTA 2ZB1A 3N4UA 4FTOA 1M52A 4HNFA 4EZ3A 1MRYA 3VS0A 2BRBA 2JFLA 2ITQA 3BV2A 4FVPA 4AWIA 5IA5A 4QTAA 4HJOA 5LOHA 2BHEA 2C5BA 2YISA 2R3JA 4F1MA 4CXAA 3PSCA 5CEMA 3ZYAA 4E5AX 4RZVA 2XALA 1W82A 1QUFA 2YERA 3ZRLA 4AXFA 5FGKA 3PWDA 5DN3A 2OG8A 4CFUA 2PVFA 4E4XA 2RC6A 1YQJA 1D2EA 2XKEA 1QGYA 2OWBA 4NH1A 4O0TA 4XHKB 5FQDC 5LVLA 3UNKA 1JSUA 4I4EA 3NPCA 4MNFA 4P5ZA 5FP5A 4BCNA 4YURA 1OKWA 2FSTX 2V4DA 2QCSA 5H9BA 4DGOA 4QMYA 1K28D 1JPAA 1N8RD 2PVJA 3EZRA 3O96A 5DNRA 4AFJA 3UVQA 3CXCB 1FBNA 4FIGA 1WOSA 4GU6A 3BGZA 4QP2A 4X6RA 4X06A 5CASA 4LBVA 2XNOA 4G6OA 4MXZA 1FVTA 3QLGA 4ZMFA 4YTFA 1V0EA 1NXKA 5JFXA 4C43A 1VQ7B 3KXXA 3BLRA 3KRLA 2ZL6A 3L9PA 3O17A 4L3JA 4PMMA 2PVYA 2JAMA 3F69A 2G9XA 1XQBA 1B38A 1EXMA 1UD3A 4R3PA 5GNKA 3RM6A 1OIYA 4QNAA 5J95A 5AN9A 5I9UA 5CAPA 4ZLZA 3NUXA 2ZV2A 4XS2A 4JDIA 1ZYDA 3VRYA 4D9TA 2PZRA 5AUYA 3QZFA 3QRKA 3CPWB 4O0XA 3QXPA 1BX6A 3J81k 3WF5A 2Q6LA 1P4OA 1R3CA 3D9VA 3F7ZA 2Z6BD 2VTNA 3OTVA 5BVEA 4DEBA 4F09A 2R3FA 3OW4A 4IWPA 2J51A 3I7BA 4MF1A 5GJGA 1E1VA 4U43A 1Y6AA 3R04A 3LM0A 1JWHA 2XEXA 3U55A 4Y9RA 2GREA 4X3JA 5BYZA 5L2TA 2VTTA 3QF9A 2Q6IA 3W5VA 2BGJA 1R39A 1WTHD 3OXZA 3AC4A 3BQCA 3KU2A 4Q9ZA 3CTQA 4P9SA 1PRYA 3DQXA 4FT5A 3FMLA 1B2RA 2ONLC 3QTWA 4TKOB 3EN5A 4FT9A 3F5XA 4G31A 4FG8A 3UOHA 2HZIA 5I4NA 1REKA 2UW6A 2QNJA 2XJ2A 3MA6A 4QUZA 1TKIA 3E92A 3MGYA 3QKMA 3WE4A 1H85A 4YJSA 4AN2A 1DI8A 1E62A 3BHHA 3QTRA 1BLIA 3ZPNA 4APCA 3OUNB 3GSIA 4E4MA 3GOPA 4O7WA 4ZSGA 1LR4A 4RC4A 4B8LA 3SDJA 2QOBA 2XOKA 4RA4A 1PXOA 4KBCA 4XBUA 3UOJA 4TW9A 4MXXA 2W1IA 3MPTA 3AD5A 1NVRA 4G34A 4LMUA 2B54A 2ITTA 3WE8A 4O22A 1UNGA 5HD4A 4IAKA 3R6JA 4RJ4A 3CGOA 1OL1A 4W8DA 4M84A 2ERZE 2OSCA 3W2SA 1OI9A 2JDOA 1SVGA 2QTZA 4R71A 4FSRA 2WMVA 4NJ3A 4ITHA 3VS1A 3V8TA 4DC2A 1WOPA 5IDNA 3B82A 2FGIA 1J3HA 4F6WA 5E7RA 2RL5A 3CKXA 1OB3A 3LQEA 5ANEA 5HVYA 4YGAA 3R9OA 4KB8A 4LRJA 1M2QA 2B4SB 4AGDA 5I5ZA 2O8YA 1O6LA 5JRQA 4U0IA 1Q3DA 2GJPA 1ZYSA 1UD2A 3LMIA 3ZXTA 4GW8A 4HYIA 5CU4A 2F9GA 5IQDA 2BN4A 2W1HA 3UG1A 4BDJA 5FA6A 5AUTA 3DK6A 3TCPA 3F5UA 5JT2A 3DDPA 2W5AA 4CV8A 2X6YA 2JBOA 5FO1A 3OCTA 5KHXA 5IMEA 4FSUA 5CEKA 1YXXA
chains in the Genus database with same CATH topology
2BTRA 2Z60A 2JIZA 3MB7A 3DT1A 2X8DA 1YWNA 1JSTA 4BCKA 3PA4A 4FGBA 3CD8A 4FKGA 4PQNA 4W8EA 3WI6A 5K5XA 2OIQA 4QMMA 5L2IA 3LXKA 4IB1A 3ZEPA 3ACJA 4GUBA 2YEXA 4WOVA 2CJMA 1OMWA 4DEEA 5CSHA 4B7TA 4M97A 3VF9A 1WVXA 4XMYA 4MBIA 4YLKA 3VUKA 5HU3A 4FV6A 3P08A 4ZXTA 4A9RA 2VWBA 3HZTA 2RFEA 5FEEA 4GT5A 1KSWA 2JITA 3F3UA 4UXLA 4JOAA 3FZSA 2CK3A 4FSTA 3C0IA 4TT3A 1ND4A 1W8CA 4WNMA 1SM2A 4AXCA 2WQEA 2YA9A 5K4IA 2GHGA 3OAAA 2X53S 2O2UA 2GU8A 2G01A 4CMUA 4ERKA 1OKZA 2OJJA 2WQMA 3DLZA 3PUPA 4PRJA 4C4GA 3FL5A 4TL0A 3TI1A 4NCTC 3AQVA 2BDJA 3GVUA 4ALVA 5CTPA 2WOTA 3NFGB 2VTIA 1B39A 3GC7A 3I7CA 4KIOA 2E9NA 3MFUA 4MUQA 1CDKA 4YJVA 3BX5A 4A9SA 3NUYA 4I92A 3CP9A 4BDFA 4HYUA 4FKTA 2LZJA 2Y7JA 2YAAA 5DI1A 2YM4A 3H0YA 5IG1A 3JY9A 5J5SA 3W10A 3LCSA 2H34A 1UD6A 1ZOHA 3GUBA 3R8UA 4X2FA 4HGLA 2GS6A 4EK8A 4R78A 3I79A 5KZ0A 3HEGA 4JBVA 4JDJA 4ANBA 2QI8A 3PXQA 3U9CA 4J7BA 1PXIA 4ZJVA 5IISA 2ZV8A 3LCDA 4G3GA 2XIKA 3UIMA 3WZJA 5KUPA 4GKHA 2ZMCA 1REJA 3NCGA 2P0CA 3TZ9A 1MQBA 4IACA 3FKSA 4FSZA 4QEBA 2JIIA 3C4CA 4DNTB 1J91A 3NE5B 4RRVA 5L6WL 3RVGA 2C6EA 5CEQA 4UN0C 1Z9XA 3DDQA 3A3GA 2VJJA 2G15A 3DFCB 4I24A 4XV2A 5JZJA 1Q4LA 2QO2A 3BYOA 3IW5A 5J1VA 4CKIA 2M5SA 4NL0A 4C7TA 2WZJA 5CNNA 4DGNA 2DUVA 4O0VA 4RX5A 1VJYA 2PMOX 2VO6A 4B3GA 3FL4A 2WPDA 4GEOA 5AWMA 2J7TA 2GMXA 2YIRA 3I4BA 5L6OA 3IDCA 4U3YA 3R2YA 1E79A 4FTUA 3NS9A 4X21A 4KBKA 4ASEA 3FHIA 5JH6A 3FDNA 4DAWA 3KN5A 4FA2A 3HUCA 2R3IA 3H9FA 4FSNA 4TPTA 4ANQA 2J5FA 4G1WA 2YWVA 3PIXA 3QD0A 4CZTA 4BDGA 1PXJA 2EB2A 4FIHA 5E8TA 2YJRA 4LOQA 4QP4A 3DV3A 3AKLA 4BBEA 1W83A 3V01A 5BVDA 3A62A 4O91A 3LJ1A 3BHYA 2C1AA 1AD5A 4NTTA 2KTYA 3MFRA 1JBPE 4EEVA 3UYTA 4DFLA 2JKMA 3EQHA 2ZMDA 4EZ5A 4JG8A 5DIAA 4BDDA 3DB6A 1ZMUA 2IZRA 3R83A 4CFWA 2QG5A 3EQFA 5CF8A 2WTKC 2PVRA 1VF7A 2BZIB 2RFNA 3Q53A 4I6BA 2XZPA 4XKWA 3A60A 4YTIA 5HLNA 4RBLA 3W16A 3QU0A 4CFVA 1IA8A 3VJOA 3UMWA 3PVUA 4HW7A 2GDOA 5KX8A 1I18A 4HGEA 3QUDA 3T53B 2OF2A 3TNHA 3O8PA 4XLFA 3CMMA 5FEDA 1OPKA 2QD9A 5HHWA 2HXQA 2XS0A 3V6SA 3F2AA 1OIRA 3ZH8A 4MBJA 4RIXB 5HESA 5H8GA 5C4KA 3BIZA 5AV2A 2XZSA 3FLYA 1UD5A 1OB0A 2A27A 3LXNA 4FOCA 4MBLA 3UO6A 3D2KA 4ENXA 4EOQA 3IOPA 5M4UA 5CWZA 5AM6A 3BYVA 3CLYA 4GYGA 4P4CA 4U8ZA 4DLJA 5K9IA 3NVMB 4QMZA 4C38A 2XZLA 3UDBA 5M07A 1W0KA 4IX5A 4QMOA 3GFEA 3CPCA 4GJ3A 1Z5MA 3POZA 4OW8A 4MWIA 4AXDA 2EUFB 3TIYA 4BICA 2BKZA 4C35A 4EH9A 2GS2A 5CU2A 3TV6A 2X85A 4KKTA 3GB2A 3KN6A 4AN3A 3QFVA 4EHEA 5I9WA 4MD8E 2W06A 1PXMA 5ANDA 3MV5A 4D0WA 4TWNA 4DTBA 3F5PA 5TT7A 2VJIA 4EH5A 3SKCA 2R7IA 1FMKA 3A7FA 3CXWA 3D14A 4EK6A 3COKA 3WYYA 4DA5A 3SC1A 5FBOA 5D12A 4F70A 3IK3A 2QR7A 1W9XA 3DAJA 4XP2A 4M15A 2I6LA 4E6AA 2OZAB 3RAHA 1Q62A 3O23A 1XH6A 4WG4A 2GTMA 3NUPA 4C02A 1E43A 2VRXA 5IEVA 3EFLA 3EQIA 4TYGA 3QRIA 3ALNA 4FEUA 1SNXA 3R7OA 1DI9A 4M67A 4DFBA 3KGAA 2ZM4A 4QTBA 4YZBA 3FKLA 4FEQA 4PMSA 4DG0E 2HW6A 5IQEA 2Q83A 4QP6A 3EQBA 1JKTA 3LVPA 3SXRA 4AZFA 1OECA 3KULB 3E5AA 2W4KA 4G3DA 4BRXA 3W0QA 4UX9A 4ZZNA 2BIYA 3KK9A 4S33A 2PVLA 1A48A 3GC9A 4FTAA 4IMYA 4Y83A 4BCOA 4H05A 3ORPA 5JSMA 4UB7A 1XHAA 3R0TA 2EB3A 1M7NA 2NP8A 4RGJA 3RI1A 2WELA 5E8YA 1E1QA 5D10A 5B0XA 1LP4A 3MJ1A 4R7IA 4XOYA 3MH0A 5F1ZA 4L3PA 4FV7A 4FTLA 2W7XA 4FSWA 2CNVA 4QQCA 3MVLA 3O5AA 5HE2A 4DFZE 3ZO1A 2F43A 2VX3A 3DXQA 2QODA 3H9OA 3KXZA 4QYYA 3GENA 1H1QA 3AGLA 3KY2A 1TQIA 3F5GA 2UVYA 4CQEA 3R7UA 3ZOSA 5D11A 2XEZA 1XMMA 4JQ7A 5EG3A 3TT0A 4XQFA 2AC5A 3E87A 2SRCA 3G51A 3R00A 4JS8A 4OBQA 4WRSA 4Y46A 1WBVA 5E90A 3FJQE 4BF2A 4D1SA 3WZUA 4QMVA 5DG5A 1NVSA 4TWPA 4FGRA 2WHBA 4RX8A 2IW6A 4I3ZA 3QWKA 3CCNA 1BKXA 3E8DA 3QD2B 3FI2A 2BTSA 2VTJA 2JAVA 3FLZA 3NDMA 4R7HA 1URWA 2C3IB 4L42A 4OBOA 3GGFA 4AA0A 5CS6A 1GOLA 1BLXA 4CCUA 3B8QA 3ZIAA 3A99A 1H27A 1XO2B 4U45A 5ANKA 5DWRA 3VONA 4EL9A 3G0FA 2BUJA 4KKEA 5GIPE 4KD1A 2J2IB 4YEJA 4YU2A 3ULIA 4C3RA 5A4EA 4IVAA 4RIXA 5BUJA 1T46A 5IZFA 3AC1A 5GHVA 2GJRA 4FV3A 1H1RA 4A9YA 4IH8A 3VS7A 5A6NA 3PJ2A 1KE6A 1U54B 4A4OA 3CP8A 2OIDA 2YN8A 3RPSA 3ZM4A 5IEXA 1W7HA 3EQDA 4J8NA 4UZDA 4W4WA 2O0UA 2GQGA 1FPUA 1UU3A 4DEGA 3RWQA 3FLNC 2WPAA 4U80A 1Q8YA 4XRJA 4MX9A 3GU6A 1ATPE 3MIAA 3P78A 5DRBA 4EH6A 5BQ0A 2QE7A 5KKRB 4PP7A 3HMMA 3NUUA 4GCJA 3RAKA 2JKQA 4P7EA 5EK7A 5A46A 2CMWA 2XANA 4AG8A 4WO5A 3GP0A 4FKOA 5M56A 2O5KA 3OS3A 5AUWA 4BTMA 3EN7A 3HV5A 2XIYA 4XOTA 3F2RA 3VBYA 2J0JA 4DYMA 5AAFA 1Y8GA 2R3LA 2FO0A 5KBQA 4IB3A 2W05A 4BTKA 2JEDA 4FE2A 3C0HA 3LMHA 4PDPA 3TJDA 3PRFA 4LG4A 4LGGA 3ZC5A 4D4RA 3KULA 1HCKA 2EWAA 2JDSA 4O2PA 4Y8DA 1CKIA 2PHKA 3LFBA 4AW5A 4C4EA 4TZRA 3HMIA 4Q5HA 3PJ3A 3CS9A 4IZ7A 4FTIA 3IW6A 3QWJA 5AAGA 3NSZA 3DZQA 3FZTA 2X4FA 3KCFA 4G7XA 3ZBFA 1YXSA 1WCCA 1XMLA 1ZYLA 2V0DA 4CD0A 3W2PA 1MQ4A 3UMXA 3LE6A 3PFYA 3ORNA 3F2NA 5FXSA 5J9LA 3V04A 4H3BA 4RJ7A 5CU3A 5AAEA 3V8WA 1H08A 2R0UA 2VWWA 3QD3A 3SLSA 4ACHA 4EJ7A 4ZJIA 3F9NA 3I6UA 2VU3A 4AW2A 2H96A 3W0RA 5CZIA 4PMPA 3ORMA 4KKGA 1UNHA 5CU0A 1KMHA 4B0GA 1XH5A 2BZHB 3MY5A 4ZTNA 3DJ7A 3LCTA 5JEBA 1HZEA 4Y85A 1YOMA 3PVWA 3C4EA 2QR8A 2AC3A 4BIEA 2HYYA 5HX8A 4K0YA 5EQEA 4CTCA 4C4HA 4YLLA 2PE2A 3ZMMA 2XAMA 2OKRA 1WZYA 4YSJA 4XONA 3LZBA 4IAAA 3D7TB 3BBWA 3A7IA 3VUMA 5IA2A 4QYFA 2IZTA 4OT6A 4ITIA 4RPVA 1KE9A 2XCHA 1XQZA 1PW2A 4IAIA 5EQYA 4DITA 3OWLA 3R8ZA 3RM7A 3UBDA 4JQEA 2XK7A 4BTJA 1KWPA 4I4FA 3JVRA 2V22A 2IG7A 3I6WA 3CGFA 2WMBA 4L52A 2QQ7A 5LARA 3TKUA 4B8MA 4P2KA 3H0ZA 4ZY4A 3BEAA 3OEFX 3FEGA 4MTAA 4GUEA 3F7WA 4KWPA 4FK3A 3AGMA 4U97A 4XLHA 5CF6A 3QKLA 4QOXA 4IIRA 3FI3A 5CVFA 5L8LA 3FV8A 3H3CA 4RFZA 3C4ZA 1H24A 4XM3A 1P5EA 3HRCA 5KZIA 3EQCA 3MIYA 4BN1A 5I9ZA 4TYHA 3BCEA 3WF7A 4OTHA 4YELA 3T8OA 5M4CA 3R22A 3RMFA 4M68A 2BRHA 2WTJA 5EI2A 5JGAA 5HORA 3LQ5A 4LV5A 5IA3A 2VX1A 4GVAA 4BCIA 4F9YA 5FRIA 1UV5A 2FUMA 1X8BA 2JKKA 4H39A 3UNJA 4PP9A 3QA0A 4EZ7A 3W2QA 3PY1A 4U5JA 1S9JA 1SMHA 4FIFA 4RJ3A 3MSSA 4EOLA 4RVLA 4XD7A 4O82A 1URCA 4I94A 3ZCLA 4AZSA 4FZDB 4RLKA 3U6JA 3OPOA 5AP6A 5A6OA 1M7QA 3KF7A 4XKVA 4EWQA 2XYNA 3FI8A 3LLTA 4PDOA 5ANOA 3WIGA 2P2HA 5HIBA 2X9FA 3TZ7A 2OXDA 2RFSA 4AA5A 4F08A 4ZZOA 4ONAA 3SV0A 2HWOA 4YJUA 2Z2WA 3EWHA 3HV3A 3KCKA 1M17A 2Y8OA 3OVVA 3PRIA 5EYMA 3TKIA 5BVNA 5DOSA 4JAJA 4XP3A 3EIDA 1CKPA 4YNEA 5J87A 3GBZA 4FKSA 3DTCA 5JKGA 4I0RA 5AUUA 5C1QB 2Q0BA 4G7WA 2CCHA 3R30A 3VS4A 2ZZEA 4RQKA 1GY3A 5FLFA 1WMKA 3RZBA 2J4ZA 2PUIA 4J96A 3BQRA 2I0VA 3VJNA 3CEKA 4EYMA 3EMGA 1KE8A 4MXCA 5TOZA 4XOZA 4GRBA 2OGVA 3MA3A 3VUGA 3LW0A 1OPLA 3ATSA 4MNEB 5G6VA 4JG7A 5L3AA 4OTQA 4DEAA 3PWYA 5DGZA 4TXCA 4BDEA 2C5OA 4Y95A 5BPYA 5HX6A 5IMEA 3R1SA 3L9MA 3ZBXA 1U5RA 1WBPA 4TYHB 2W96B 3ETAA 5EFQA 4KS8A 5JGDA 2HZ0A 2PUPA 1YWVA 3TUCA 2R0IA 2ITZA 3GVKA 4QMLA 3KL8A 4C58A 3UPZA 2GQSA 3BH4A 3FSKA 4O38A 4AW0A 3HYHA 2XIXA 3Q2JA 4IW0A 5AP2A 2BDFA 2WO6A 4D2RA 1PF8A 4RVMA 2A4LA 4U44A 4C4JA 3VQUA 2XBAA 5F94A 3PLSA 3L8XA 4DT8A 4FZAB 3NGAA 4BCQA 5JFVA 1YKRA 4Y73A 4NM3A 5CQWA 4XCUA 4I0TA 3BC9A 3QRJA 3BZ3A 5BYLA 3DJ5A 4YTHA 4B9DA 2ZAZA 5KMKA 4L6QA 4EOSA 5E92A 2FYSA 2F7EE 4K33A 2VTLA 4FXUA 4P22A 3Q6UA 2XK4A 4K1BA 1CKJA 3BYMA 5E8VA 3ODYX 5HCXA 3SQQA 1TVOA 4FTKA 2DWBA 4FJVA 3FQSA 1G8KA 2R7BA 1KOAA 2HZNA 4FT3A 3RHKA 3FLSA 3UP7A 5IA0A 3DNEA 3CY2A 4FOBA 4X3FC 2QLQA 2VWUA 5KBRA 4RA5A 4C37A 3UJGA 4NJDA 1CM8A 3FKOA 4R7BA 1JQHA 3OBJA 4AOJA 3FPMA 4E8AA 4FR4A 2XCKA 4HCTA 4LV8A 4TKSA 5CZHA 4DBNA 4F7SA 3T56B 4RIYA 2JIUA 4WNPA 1V0BA 1OGYA 3DK3A 4NW5A 1KV1A 1RW8A 3AT4A 1VYZA 2V55A 1QPJA 4FIIA 4RFYA 1YHVA 5BNJA 3M11A 3K5VA 5LQFA 3RNYA 2VWVA 2H8HA 4QNYA 4V04A 2UZDA 3PG1A 5AP7A 4MNEA 4BDBA 3FC2A 3JXWA 4BDKA 5CEOA 2WTDA 2WMQA 4KKSA 5HNBA 1AGWA 2C6IA 4XEYA 1EFRA 3L9NA 4BVUA 4DE4A 1ZLTA 2X7OA 4QP9A 3AC5A 3HRBA 5E4HA 1NT2A 1CMKE 2R3QA 2X6DA 4FV2A 3KXMA 2E1BA 1Q8UA 2WSSA 2BAQA 3LXPA 4NFNA 4BY9E 3IW7A 3UOKA 5FUTA 4FC0A 3FPPA 3DB8A 4IB5A 4TNBA 2GNJA 3D5XA 4II5A 5AX9A 2QG7A 2XM9A 1NW1A 3VBVA 2VN9A 4IJPA 3NNXA 5KMMA 5HIDA 2IZSA 4E4LA 5CAUA 3DBFA 3C4FA 4QYGA 3ZSGA 5L8KA 2XMYA 3VF8A 3BHVA 3GCSA 4M13A 4HVGA 3II5A 3QD4A 4D5KA 3EB0A 4MK0A 4NTSA 4AP7A 5KE0A 2W1CA 3TYKA 4FG9A 4EH2A 5C8MA 1T45A 1WP6A 1YI6A 2GFCA 4G6IA 3FZRA 4GT4A 2OXYA 1NRKA 4RX7A 3FMMA 3K2LA 4EK3A 3LMGA 4AXEA 3VS2A 2H9VA 4DNRB 4ZS4A 3VRZA 3FXWA 4HCUA 2I40A 5J9ZA 4KNBA 5JGBA 4OT5A 3N4VA 1J7UA 4R1YA 4YC3A 4GK4A 4BI0A 3TUBA 4MVFA 3R1YA 5M55A 1Y57A 5DR9A 3EN4A 5HG5A 5IQCA 3UDZA 3AC8A 4I22A 5J8IA 4FI1A 4DH3A 1QPCA 2ZM1A 4JR3A 4MEDA 4RZWA 2GNLA 3G15A 4JBPA 4V0GA 4B99A 5IH5A 4Z1MA 3OW7A 3H4JA 2YWPA 1PMUA 4DH8A 3A4OX 5IQGA 4F9AA 3R8MA 3R2BA 2ZZQA 1XH9A 3U4WA 3KEXA 4FTMA 4JQ8A 5TKDA 3TNPC 1YXTA 4MXAA 2WMUA 3OWJA 5EKNA 2HW7A 5AUXA 4HGSA