4JN4A

Allosteric opening of the polypeptide-binding site when an hsp70 binds atp
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
600
structure length
600
Chain Sequence
SGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 192
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00012 HSP70 Hsp70 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jn4A05
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jn4A04
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jn4A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jn4A01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jn4A03
3WEEA 4BRFA 4H5VA 5BN8A 5BPLA 2BPRA 4FL9A 2E2PA 5AQFA 1TUYA 4XH4A 5AQTA 4EZTA 4JN4A 4JAXA 3SJHA 4FSVA 1E4GT 3LM2A 5AR0A 4H0XB 3D2EB 3U8XA 3L0QA 1J6ZA 4CZLA 5E84A 3L6QA 4XH1A 4FWRA 4EZOA 3DXMB 3R6MA 3H3OB 3VF6A 2D1KA 4JNEA 2IVPA 3AAPA 4BRDA 5EXWA 1K8KB 2HOEA 4BR2A 3KHYA 2UYTA 3CJ9A 4E1JA 3WQTA 5F2RA 2E1YA 4B9QA 4BVPA 1NM1A 3R9PA 3KZBA 4Z94A 5KPZA 2GWJA 1XC3A 5AQHA 1H1VA 1Z6RA 2FLOA 2P9UB 3C0BA 3MN9A 1GLLO 1G99A 3ZX0A 2Q0RA 4PKHA 5KQDA 4L3QA 4YDUC 4WQ5A 3WXKA 1NGCA 3C7NB 1TYQB 3QFPA 4M63C 5JLFA 3OHRA 4MLHA 5FPMA 3ATUA 1NMDA 4BR7A 4O5FA 3VF4A 5F0XA 5TKYA 1CZAN 3GG4A 1NGEA 3CIPA 4Y0WA 1JCEA 1C0FA 4JD2B 1BO5O 2IVOA 1RGIA 3EKSA 3ZEUB 5FPDA 5AZIB 1QQOA 2CGLA 3W0LA 4WV5A 5BR9A 3WXJA 4A62A 1BU6O 2ZWHA 1TUUA 4BG9A 5AQXA 5AQZA 4PL7A 3O5BA 3T4AG 4QS7A 2P9KA 3IUCA 2CH5A 2AA4A 2QWMA 1CKRA 3MCPA 5CE3A 4PL8A 3A8YA 3VEXA 1DKGD 3BF3A 5KPTA 3QBWA 2E1ZA 4BC5A 4BC3A 4CZHA 5BPMA 1WOQA 3GOIA 4HY9A 3ULEA 3VPZA 4GNIA 4M7XA 1BUPA 3U9ZA 3N8EA 1DKXA 3ENHA 3SMPA 3UKRA 4CD1A 2PAVA 3JS6A 5JICA 2YHXA 1GLAG 3WUHA 1BOTO 1MWKA 4FWOA 1GLBG 4EZSA 3MDQA 5AQQA 3WXLA 3ZETA 2HMPA 5AQRA 1ATNA 1SQKA 3RSEB 5BPNA 5AQPA 4DB3A 2CH6A 2YHYA 2ZGYA 1T6DA 4B1ZA 2BTFA 2DPNA 3CJCA 3MK6A 3FR0A 4R5IA 1ATRA 3O1WA 4FWQA 3D7EO 2QFFA 4MO5A 5LJWA 4RTFD 4PO2A 3QICA 2GUPA 2QWOA 2NRHA 2Q31A 2NZTA 5AQGA 3D2FA 3DOBA 3U9DA 4BQLA 4J8FA 3HM8A 3UKUA 3FZLA 4AM7A 3B8AX 4M7YA 3IMXA 3DAWA 2E8AA 2P9KB 4CZMA 1GLFO 1JCGA 5EY4A 5LY3A 4A2BA 5ELZA 2OANA 3T49A 4BRLA 1MA9B 1QZ5A 2Q36A 4XH5A 1QZ6A 4BGBA 4HTLA 4IZ9A 3FGUA 5EVZA 2HF4A 5BRDA 4F9OA 2GWKA 3M3ZA 4KBOA 4PKGA 3GBTA 5EOYA 3FFKB 3LDLA 3DPPA 4BR5A 3H1VX 2AP1A 3UE5A 3VENA 5BRHA 1KAYA 3CETA 4CZIA 1U2VB 3UKRB 1U00A 3LL3A 1ESVA 1V4TA 4WQ4C 3HTVA 3DJCA 3VEOA 2ZF5O 3H46O 2WUSA 3IDHA 2FSJA 3DPQA 5AQKA 3VOVA 2IVNA 4EZRA 5JMVA 2E2NA 4K25A 5AQOA 1JCFA 4BRAA 3HSCA 2P9IA 3VEYA 3SK3A 4BRNA 1S3XA 4IJAA 4IWVA 3GL1A 3FZHA 4H0OA 1ZBSA 4FWSA 4CZGA 4BRHA 2FF3B 2ASMA 4BR9A 4FPAA 2P9PA 5BREA 3J8AA 3L3OM 4ISEA 4CZFA 3FZKA 4BRQA 2CGKA 3LM9A 4JWIA 1HKCA 4JWCA 4A61A 4H0TB 1DEJA 1YVNA 1NBWA 2ASPA 1YXQA 3LDOA 3D2FB 2D0PA 2KHOA 2P9LB 3QB0A 4BRMA 4R5JA 1HLUA 2A41A 3UKUB 3VESA 1SZ2A 4BRIA 3MN5A 4QS8A 5AQMA 4CZJA 1NGJA 3WEEB 4BRPA 4FWKA 1X3MA 2F9TA 4CBUA 3U4LA 2A40A 3FE1A 1BWFO 4IJNA 1LCUA 5FPNA 4JWDA 2ZGZA 3UB5A 1GLEG 1GLJO 4EHUA 2FSKA 4EFHA 4R5LA 4A2AA 4K43A 2F9WA 3QFUA 5AFUA 5KPRA 2J4RA 2ASOA 2V51B 3LDQA 5AZJA 4H6IA 4EZWA 3MMVA 5AQVA 5AFUH 4CZEA 3OHXM 1KAXA 4FWLA 4JHDA 3BUZB 5I9EB 4WQ4A 4EZUA 3DXKA 3QMLA 4C23A 4EZQA 4CI6A 5B8HA 1EQYA 2P9SA 4BQZA 5AQLA 5AQYA 2D4WA 4YDUA 3QBXA 1BA0A 7HSCA 1OKJA 3AY9A 3FLCO 4DQ8A 2I7PA 3D2EA 3T47A 3TPQA 2EWSA 1NGAA 5KQ8A 3HBTA 1IG8A 4LC9B 2I7NA 1NGFA 2QWLA 5AQJA 2P9PB 3IFRA 4RCHA 3TU5A 1WUAA 4EZZA 1RFQA 3O6WA 1T44A 3T46A 4AM6A 4K41A 2D0OA 1YAGA 4K42A 3A0IX 3H6EA 1K8KA 4H0VB 2VWBA 4E81A 3A5LC 3H3NO 3LDNA 3WQUA 4BRKA 3ENOA 2VCPA 2NLXA 4I6MA 3H45C 1DKYA 4EIAA 2YJEA 4F00A 4BR4A 1P8ZA 4H5NA 1NGIA 4IXCA 3MN7A 3KVGA 3DQGA 4WV7A 4H5RA 4H5WA 3CJ7A 4ISGA 3CI5A 3VGMA 2FXUA 2V7ZA 3SLCA 4WYBA 1S22A 3DPOA 3H0XA 1Z05A 2VYPA 3QNJA 5AQIA 2QWPA 3M6GA 4MO4A 3VGKA 1YUWA 5AZJB 5FPEA 4CBXA 4JD2A 4BC2A 4JHDB 1ATSA 3ULEB 4DHYA 2OP6A 1RDWX 1NGHA 2QW9A 1GLCG 1ZC6A 3DXKB 1Q18A 3ZEUA 5LJVA 1NGDA 5AZIA 3F9MA 3GDQA 2P9SB 3GE1A 3O08A 3ATVA 3CHWA 4JWEA 3VERA 3BF1A 3CQYA 2Q1NA 1KAZA 3EO3A 4R5KA 4CD3A 1HPMA 3ZETB 2W41A 4R5GA 3I8BA 4CZKA 4H5TA 3CERA 3O8MA 2Q97A 3A5MC 4H03B 4BGAA 2E88A 3BEXA 1R59O 4BR0A 4EZYA 2Q0UA 4MLEA 1QQNA 3CJBA 4B1YB 5ADXA 2ITMA 4BC4A 2E20A 3ZX3A 3AAQA 4BRGA 4HYBA 4QS9A 5F1XA 4BROA 5ADXH 4I6MB 4B1UB 3DWLA 2QXLA 4NO7A 4FWMA 4EHTA 1HUXA 4RWTA 2PBDA 1LOTB 4XEIA 3ZX2A 4H0YB 2V52B 3LDPA 2YCHA 4PKIA 1QHAA 3VEZA 4BG8A 2GELA 1NGBA 2YHWA 3HI0A 1NGGA 4FO0A 4CBWA 3RSEA 2W40A 2H3GX 4EZNA 3FZMA 3JXUA 1MWMA 2E2QA 4H6HA 1IJJA 3EZWA 3VETA 1GLDG 1D4XA 1E4FT 4EAHD 3T48A 2YJFA 3EKUA 4HWIA 5EX5A 2A42A 2CGJA 2P9NA 1XUPO 2WINM 4B1VA 4BREA 1NLVA 1DKZA 1DGKN 3QDKA 1HKGA 4EZPA 4IO8A 5JLHA 1HJOA 1BPRA 3FZFA 3H1QA 5AQNA 3VEWA 4BRCA 3W3DA 1BDGA 4CJ7A 4EZVA 3CJAA 2Q2RA 2A3ZA 3WXIA 3R8EA 3BP8A 3CJ1A 3SMSA 5AQUA 2QWNA 2P9IB 2YI1A 1BA1A 3A5NC 4DCHA 4EZXA 4GY2B 2QWQA 4B1XB 4O8KA 2BUPA 4FOEA 2E2OA 1T6CA 3DXMA 2V7YA 1BG3A 3I33A 3VF2A 4B1WB 3CQXA 3EN9A 3HZ6A 4ISFA 1HX1A 4JNFA 1U2VA 1V4SA 3AARA 1NWKA 1X3NA 3O80A 2A6AA 2QM1A 4NB4A 2GTDA 3O4WA 4FWPA 3O1BA 4BVOA 1X9JA 1DG4A 1MDUB 5E26A 2P9UA 1C0GA 3VGLA 2HF3A 3M1FA 2IIRA 2GEMA 2QWRA 5BRFA 3EL2A 1Q5LA 2FF6A 1TYQA 3C7NA 4F01A 1Y64A 3ID8A 4WQ5C 2A5XA 2P9NB 4FWNA 3A5OC 4H0PA 3MN6A 5AQWA 5BN9A 3G25A 3P4IA 3L4IA 1ZXOA 1SAZA 1XQSC 2FSNA 5AQSA 1HKBA 4FOIA 1U6ZA 4FPBA 1QQMA 3WT0A 3VEVA 2P9LA 3S41A 1KXPA
chains in the Genus database with same CATH superfamily
3SUOA 1NK8A 4DTSA 4EP5A 4GV3A 1CXUA 4FL9A 2DFHA 2E2PA 2F8TA 1TUYA 4JAXA 3PIPL 4FZZA 1RT3A 1E4GT 1X03A 1FK9A 3LM2A 3TTCA 4HR1B 1GOAA 4CZLA 3LP0A 3L6QA 1NKBA 4BY9C 2HBJA 3C95A 3Q0KA 1N8RO 2F7RA 1HNVA 1WLJA 4GVMA 4JI2K 2IVPA 3VF6A 1W7AA 3IRXA 4JKEA 4BRDA 2OW6A 3NAEA 2HHSA 1QHTA 4NCGA 4E1JA 3WQTA 5F2RA 1Q9XA 4CF8A 3R9PA 2A1SA 4LF7K 5GIPA 5E41A 2P9UB 3DYAA 4KV8A 2GX9A 1I39A 3LZJA 4Q0BA 1VQLN 4NCBA 4M3YA 1NGCA 1TYQB 4O55A 3OHRA 5FPMA 3ATUA 4BR7A 3VF4A 1MJGA 1CZAN 3WXMB 3ZEDA 1SKRA 3HT3A 1B92A 4BNEA 4H8SA 5FPDA 4KHQA 1QQOA 3L2VA 1KTQA 1WB9A 2XO7A 5GAGP 1ZBUA 3O4QA 1HNWK 2Z8YA 3B6OA 2ZWHA 3THXA 1C1CA 1BISA 3L3PA 4AILC 1GN9A 1SL0A 4DV1K 3MCPA 4CJKA 4IG3A 3KD5E 3NFAA 1JLFA 3A8YA 1SU6A 3BF3A 1ZWWA 5KPTA 1K9MO 1RBTA 2E1ZA 4F4KA 3GOIA 3B51X 3ULEA 3K5NA 3VPZA 2D0CA 1NK9A 3AO5A 3MEEA 4GKJK 5HL7L 3U9ZA 1Q81O 3N8EA 3L4QA 3WNEA 4JK7A 1JLBA 3CQ8A 3SMPA 2O8DB 2N3KA 5JICA 3V1RA 1RDDA 3T7ZA 4IW0A 1Q7YO 3CFOA 3WUHA 1GLBG 3WXLA 1UAXA 1GNLA 1SU7A 5AQRA 1SQKA 1NOZA 2FYVA 3VQ6A 2JLEA 2ZGYA 4NPHA 2OYQA 4DSKA 1NJWA 4BE0A 3DDGA 4JRPA 2ND1A 3DLRA 4G9ZA 1QX1A 3PO4A 2YIAA 2HNDA 4FWQA 1VSJA 3QA8A 3D7EO 4DKWA 4MO5A 4RTFD 1CLQA 3KLHA 1C0UA 2EX3B 3SBTA 1S1WA 4YNQA 1RDBA 4RG8A 4G6QA 3LWLA 1SL2A 3UKUA 3B8AX 1EKEA 4CJUA 3SJJA 3L2UA 3OS2A 2D1LA 4M7YA 5EU7A 2E8AA 1K6YA 3VKHA 3J7AP 1D9FA 1GNTA 3HL8A 5LY3A 4AZ5A 5ELZA 3VQBA 4YY3K 2OANA 4CEBA 4XH5A 3O3NB 2XY7A 3THYA 1HRHA 2HF4A 3V81A 1HYVA 5BRDA 4CF0A 2G8KA 5DM6L 3ALYA 1C1AA 3HPOA 4FJJA 2LSNA 1U00A 1YITN 2UXBK 3C6UA 4WQ4C 3OA9A 4W5NA 3HTVA 3VEOA 3IDHA 1BQNA 4CE9A 3QERA 2A1RA 5T7BA 2IVNA 2QKKA 4NLCA 4C1NK 4DF8A 4BRAA 1W0HA 3BUBA 1FKPA 3BZCA 4IJAA 3AA2A 2OPRA 1EWQA 3CCUN 1J9AA 3IS9A 4BR9A 5FROA 4WPCA 3U6FA 4CZFA 5FLEX 2B5JA 3FZKA 2CGKA 4DG1A 4KRFA 1HKCA 4A61A 4CGGA 3RMCA 3QEPA 1YJNN 1NJIO 3D4ZA 3BVUA 1YXQA 3D2FB 3V9ZA 2C08A 3QB0A 4R5JA 2A41A 3ACOA 1SZ2A 1NGJA 2FBVA 5AJ3K 4FWKA 1IBMK 3U4LA 2VWJA 1RTDA 2A40A 1J5EK 1BWFO 3DRRA 4JWDA 3ULDA 3UB5A 4IBNA 2IDOA 2QI2A 3BZKA 2FSKA 4M42A 4IM3A 1TKZA 1NJYA 1EO1A 4A2AA 4K43A 4M3XA 3QEXA 1ASUA 3O3HA 1RBUA 4H6IA 4CZEA 4DFJA 3CFRA 1LW0A 2O0I1 4JHDA 4CCHA 3PSFA 5I9EB 3NGZA 5D3GA 3QMLA 4WFAL 2QA4N 1N32K 3SPYA 3TAPA 3CC4N 4JLHA 4JLCA 2D4WA 2YIBA 3EE9A 1VQ5N 3QBXA 1BA0A 2BDPA 3TTFA 1KD1O 3T47A 2W42A 5KQ8A 3RRHA 3HBTA 5FIGA 5M1NA 4J2BA 5AQJA 4H8KA 2B4JA 3G4SN 2YKTA 4K41A 2D0OA 3A0IX 3LZIA 3H6EA 3SPZA 1K8KA 3U3YA 3KIOA 4E7HA 3LALA 1JLQA 3LDNA 1Q8IA 3KWIA 3EEQA 3I0SA 2HHUA 4CEAA 3AO3A 5C0YA 1U49A 3DX1A 3HXMA 3THXB 1GOCA 4HUFA 1WBDA 3SQ4A 4MQDA 4ZTFA 5JVHL 4JKGB 4UQGA 4PHTX 3DPOA 1LWCA 3PLAA 4A59A 3C6HA 3OYIA 1EWRA 2QWPA 3QLHA 4FM3A 3MWPA 5GIOA 4OGEA 3P5JA 5HRNA 4CEEA 3ULEB 4JI3K 1RBVA 4C8MA 3CAZA 4CJRA 4KTQA 1GLCG 2X3VA 3SOGA 1ZC6A 2O8CA 4PQUA 2HHTA 1Q18A 4WE1A 5AZIA 4KHNA 3TR8A 2RPIA 2P9SB 1X9MA 1YWMA 1D9DA 3O08A 1Y2OA 2RAKA 4U7BA 3PO5A 3ATVA 1VSKA 3CQYA 3SV4A 1M90O 2QK9A 4DTXA 2YLLA 2NRXA 2YKNA 3NE6A 3PX6A 3CVRA 3VQEA 4DR2K 3I8BA 4CZKA 2HBMA 4CGDA 3CERA 3BVXA 2Q97A 3NH1A 4BR0A 3BEXA 5MLCQ 1TGOA 3AV9A 2UU9K 1QVFM 3UIQA 4DV6K 4OLAA 1JLCA 2E20A 4W5RA 1RT4A 5SZTA 3ASMA 4KKOA 4ILHA 4FLWA 2F7PA 1C1BA 4NO7A 3D52A 3TAGA 3SQ1A 4FWMA 5CYQA 3AVKA 1LOTB 2HHVA 2E6MA 2VG5A 3DLGA 4BWJA 2KFNA 2YHWA 4CHOA 2I5JA 4AZ7A 4CBWA 4WPEA 4HVJA 1P90A 2XY5A 1BQMA 4FW2A 3JXUA 5KI6A 3HM9A 3DX0A 4L8RB 2YJFA 1WAFA 2A42A 2P9NA 3JSMA 2WINM 1NJXA 4CERA 2Y1JA 4OX9K 1VQ4N 1DGKN 3QDKA 1HKGA 3THWA 3L8BA 1NK0A 2ZJRL 4DFPA 1HJOA 3KLEA 4CJ5A 3H1QA 2RAJA 1QWNA 3AVFA 4AH9A 3CMEN 4PA1A 3LP1A 2YNIA 4RW4A 3O9SA 2NRWA 2QWNA 4JI7K 3VTIA 1HMVA 4DCHA 3TSUA 2BUPA 1VQ7N 4LFAK 2HMIA 4DSFA 4CGIA 1T6CA 3LAMA 3LPTA 1VQMN 3AO2A 3VF2A 1BCOA 3NH0A 3OYKA 4C8LA 3HK2A 1R34A 3NBPA 4JNFA 4JI6K 1NWKA 1B9DA 4B3TK 2A6AA 4DV5K 2GTDA 3O4WA 4FWPA 1YI2N 4I1QA 4N56A 4OKEA 1A5XA 4FZYA 2P9UA 2OPQA 2AJQA 4OKKA 3ERCC 3MX2A 5BR8K 2GEMA 3MEGA 5BRFA 1Q5LA 1TYQA 5C5BB 1Y64A 4MDAA 4OGCA 5C25A 2FC0A 5KGWA 4FLTA 4H0PA 2YHAA 3OW2M 2YNGA 1JXEA 1XC9A 3OBWA 1HKBA 1JLGA 1EXQA 3VEVA 3ZSQA 2KKZA 2P9LA 3NF7A 2QXFA 1IO2A 4CJPA 1KXPA 4IFVA 3OYLA 3AVBA 3LDSA 3WNGA 4YOXA 5FRNA 5BN8A 4NYNA 5BPLA 4UDXX 2XY8A 4XH4A 5AQTA 3SJHA 3D0PA 4K8XA 1HNIA 4FJHA 4FSVA 4B9VA 4IO9L 3U8XA 3ZYYX 2KQ2A 3CCLN 3VA0A 3PY8A 3OYCA 1QQCA 3DXMB 3R6MA 4KHPK 4JNEA 4AZGA 5C42A 1NK6A 4CJEA 1VQKN 3TAMA 1XI1A 1VQ6N 1K8KB 2HOEA 4KI6A 4LF8K 1HQEA 1LW2A 3MEDA 1WSFA 3KZBA 4CF9A 2GWJA 4CJLA 3KK7A 3ITHA 2O8DA 1HXKA 1H1VA 4C8NA 2F7QA 3C0BA 3ZX0A 4AVMA 4L3QA 3NMUA 4YDUC 4FM0A 3C7NB 5JLFA 4M63C 3LVTA 1U47A 2X74A 3TABA 1VSFA 5F0XA 4DR1K 4CJ4A 3GG4A 2C1IA 3MCAB 3OYDA 4IG0A 4IKFA 4IOAL 4Y0WA 2RAIA 3T1HK 3AVCA 1TVRA 2Z0VA 1KC8O 3EYZA 3QNOA 2O8CB 3JYTA 1SUFA 1QE1A 4DTJA 3C94A 1IKXA 5AZIB 2EX3A 4WV5A 3CYGA 3WXJA 4FLYA 2Z0NA 5JVGL 1TQUA 4DCNC 4BG9A 1CXQA 3L2QA 4PL7A 2RE2A 3O5BA 3DLHA 4QS7A 1S1TA 2NCZA 4FJLA 2AA4A 3RR7A 2OCEA 2WFBA 4PL8A 3LWMA 4E3SA 3D50A 3QBWA 4BC3A 4CZHA 2YL8A 1WOQA 4NQIA 4NYFA 2HHQA 3DLBA 1IG9A 4FJMA 3E01A 1HTYA 1QWUA 4LF4K 3M8PA 2NRZA 4E7IA 1DT9A 4CD1A 1BCMA 1WSEA 4KIKB 1WSHA 3OS0A 3CKDA 1GLAG 3AVNA 3V4IA 1REVA 3V1OA 2LM0A 3N4PA 3QIOA 4FZSA 2HMPA 2P5GA 3NGIA 5BPNA 5C10A 3CZNA 2ALWA 1T6DA 5C24A 3RVCA 1O7DC 2HBLA 4RW9A 4FJKA 5KRSA 1BI4B 1TKTA 4FM1A 5I42A 4DTRA 1L3VA 3O1WA 5HROA 5LJWA 2OTLN 3K5OA 2GUPA 1A5WA 2G8HA 1N5YA 3EJQA 3HYFA 1JJ2M 3NH2A 3D2FA 3DOBA 5I3UA 3S3NA 3HM8A 4B9NA 1VSHA 4MDBA 1N36K 5HRRA 1L3UA 3IMXA 2MI7A 2JNSA 3MECA 4JRQA 1URUA 1LV5A 1L5UA 4X65K 4M0MA 4BRLA 1G15A 5HBMA 5HLFA 5HP1A 4HTLA 4KAZA 4IZ9A 5EVZA 3LMFA 4YFUA 3M3ZA 4KBOA 5M1QA 2UXDK 5EOYA 1S72N 4M3WA 3CZSA 3DPPA 4BR5A 3UE5A 1RDUA 2IGIA 2HHHK 4DV2K 4DYLA 4F2RA 1Q9YA 3UKRB 4IM0A 1LAWA 1XHZA 4FJ7A 3BUIA 3SQ0A 3AVIA 5AQKA 1OH5A 4EZRA 4K25A 5AQOA 3VQQA 3VEYA 1S3XA 1QVGM 3FZHA 4AZBA 3K9JA 2ASMA 4LSNA 3ZSZA 1RNHA 1YJWN 1T7PA 3K5MA 1RBSA 3HAHA 4BRQA 3LM9A 4JWIA 4JWCA 3KK2A 1DEJA 1A5VA 1YTAA 4KHSA 3LDOA 2KHOA 2P9LB 2X3XA 3ER8C 1TAQA 2E6LA 1T3VA 3I0RA 1HNXK 4BRPA 1XMQK 1KFDA 4F3OA 2F9TA 2D5RA 4Y1CA 3PX4A 3B52X 3VQCA 5FPNA 2UXCK 5C2DA 3T1AA 3CPEA 4W5QA 4DF4A 2F7OA 1YTUA 2Z0OA 4JKGA 2YNHA 4R5PA 4DTPA 4ELUA 1QSSA 5TKWA 3TARA 2OZMA 2OW7A 3EJRA 3Q7BA 3SNNA 5AQVA 3S3MA 1QSLA 4FWLA 2X6NA 2X78A 3BDPA 1VQPN 1DLOA 3OY9A 4HHTA 5B8HA 1EQYA 1WAJA 2Z1HA 3CYMA 3IAYA 1SKSA 2YNFA 2Y1IA 2P9SA 1KLNA 4FZOA 3ISNC 3VTHA 5AQLA 2X3WA 5AQYA 3QEWA 2HHWA 2O8BA 2JGUA 1T05A 3AA5X 4YDUA 4CK2A 4DU4A 3M5RA 7HSCA 3AY9A 4DQSA 4DQ8A 3QEVA 3D2EA 1KCFA 2I7NA 1RDCA 2ELBA 3PX0A 1GOBA 4EZZA 2ATQA 2XRIA 1DTTA 1RFQA 4KPYA 4DTOA 5JS1A 2KFZA 2D0AA 1HQUA 2OA8A 3NF9A 4H0VB 3BGRA 3TAQA 4E81A 1IKWA 1YT3A 3H3NO 1ZBLA 3SQ2A 2EWFA 1QS4A 4BRKA 5SWMA 2GA9D 2NNWA 3ENOA 3H45C 1DKYA 4EIAA 2YJEA 4BR4A 4H5NA 4GV6A 1S9EA 3MN7A 3F7WA 1S1UA 3KVGA 4H5RA 1C0TA 4H5WA 1MU2A 3DI6A 4ZHRA 4DLGA 3PV8A 2V7ZA 1T8EA 5FRMA 4CESA 3E9OA 3SLCA 2QKBA 4WYBA 4PY5A 3V1QA 1S22A 4I7FA 2ZD1A 1Z05A 3KD1E 2VYPA 4EZ9A 1S5JA 5AQIA 5CZ2A 4B08A 3VGKA 3VEBA 1YUWA 4W5OA 5AZJB 2F7TA 4CBXA 1ATSA 4DHYA 4BDZA 1NGHA 3ZSWA 5LMUK 4OPKA 3GE1A 1IH7A 3SCXA 3K58A 4O5BA 3CHWA 4JWEA 4CVNE 3BF1A 2Q1NA 3PUFA 3S3OA 1FW6A 4R5KA 1HPMA 3J7YP 4CIFA 4GKKK 2W41A 4FJ8A 4H5TA 4AKVA 3OWGA 4H03B 4NLBA 4CEQA 3PIOL 2E88A 1R59O 2HB5A 1VHXA 3DX3A 4MLEA 1RTHA 1QQNA 4CJVA 1I4LA 4B1YB 1JXBA 4LFBK 4BC4A 2F1AA 3AAQA 4HYBA 4OO1J 4BROA 3P39A 1RTIA 4E3CA 4I6MB 4F8RA 3DWLA 3HOSA 2QXLA 1EX4A 4KFBA 4RWTA 3TWHA 1UA0A 2PBDA 3HO1A 1X1PA 4DV0K 2V52B 1S1XA 1ITGA 3AA3A 3ZSYA 4W5TA 1YIJN 3HSTB 1NGBA 3HI0A 5HRSA 4BDYA 3AVJA 4E0DA 2YHBA 4JKDA 2W40A 2H3GX 4EZNA 1WDZA 4HUGA 2VG6A 2QEXN 1NOYA 2E2QA 1IJJA 1NG9A 1D4XA 3MX5A 5C5BA 3T48A 4EAHD 5J2QA 1OH8A 1XUPO 1NLVA 2HVIA 1DKZA 4EZPA 5GINA 3CCRN 1J5OA 4QAGA 2YLAA 1HNZK 1BPRA 3Q84A 4ICLA 3S5TA 1U48A 5AQNA 2E4LA 2JNKA 1WN7A 3VEWA 4BRCA 4CF1A 4E72A 3W3DA 4CJ7A 4EZVA 2A3ZA 4CHYA 3E66A 3VA3A 4J2AA 1IKVA 3L3UA 3SMSA 3CM6A 3E9PA 1RT6A 3OYBA 3PLTA 3G6EN 3CCQN 3I01A 2YI1A 4FVMA 1TKDA 4WFBL 4GY2B 4B1XB 3SZ2A 3RMDA 4O8KA 3C65A 3QEIA 3F73A 4X66K 2E2OA 4KI4A 3DXMA 2OBMA 2V7YA 3QNIA 3I33A 3OYEA 2E5LK 4CJ3A 4FLVA 1RDAA 2F18A 1U2VA 4E7LA 3AARA 1X9WA 3QWEA 4FZPA 2QM1A 3NF6A 2UUAK 4BVOA 1X9JA 1JLAA 2OZNB 3N4QA 1IV0A 4AHUA 4DV7K 3CPWM 5E26A 4KH6A 3SUQA 5KTQA 2Z1GA 5CY4A 2HF3A 5C2FA 1LWEA 2QWRA 3EL2A 1K8AO 3C7NA 4FWNA 3V9UA 1W9MA 1XQSC 2ETJA 3VN5A 5AQSA 4FOIA 1U6ZA 4FPBA 1QQMA 3WT0A 1BL3A 5DK5A 4CJWA 3KLGA 1TKXA 4F3TA 1HYSA 1I3AA 2EFKA 1TK0A 3EZWA 1KVCA 3RV1A 3M8RA 4B9LA 4JI4K 5AQFA 2O8BB 2IS3A 4JN4A 4BE2A 2ZJPL 3V6DA 2VG7A 5AR0A 3D2EB 3VQAA 3L0QA 3K2PA 3OYFA 2JWKA 4DU1A 4DR7K 4FWRA 1E9VA 4EZOA 3H3OB 1NK5A 2D1KA 3MXJA 2YI9A 4JK8A 3ID6A 4IDKA 4Y1DA 3ZSRA 4BR2A 3KHYA 2UYTA 3CJ9A 3HVTA 5IT9O 4AZCB 4Z4EA 2E1YA 1ZYQA 2DY4A 4BVPA 2YI8A 3OYJA 1IBLK 1NM1A 1WSGA 4B3SK 2VQEK 2VGMA 4DQQA 3QETA 4KIKA 1G99A 3KLFA 4O0JA 3WXKA 3QFPA 2JWLA 4K8ZA 4GMJB 4FM2A 3VQ9A 2VQFK 4O5FA 2WTUA 1QTMA 3P31A 1NGEA 1VQ9N 3CIPA 3HVRA 4FK2A 1BI4A 4AF1A 1BO5O 2IVOA 3P1GA 4DQPA 3KTQA 4EZ6A 3EKSA 2P51A 1VQNN 2C1GA 2CGLA 2GF4A 4LH4A 5BR9A 4DLEA 1SUQA 1BU6O 5AQZA 4Z4IA 4IOXA 5GAHP 4I9LA 3HJFA 2NUBA 3O9QA 3EJUA 3D51A 3IUCA 1UPXA 2QWMA 2YL6A 4ILIA 4BC5A 2R7YA 4BWMA 4OLBA 5BPMA 1F21A 1SKWA 1CZ9A 4ZTJA 2QKWA 1HJRA 1HWWA 4GNIA 4DSIA 1BUPA 1SS6A 1VSMA 3QESA 2HSTA 1DKXA 2ZE2A 4CHZA 1PS3A 4DS4A 3UKRA 1ZBHA 2PAVA 3JS6A 2YHXA 4O8UA 1KQSM 3SUNA 3TTDA 4CFAA 1I94K 4FWOA 4EZSA 5AQQA 3VQ4A 4ATMA 4AZIA 4DTUA 5J2NA 1VRUA 2CH6A 2YHYA 3NCIA 1NKEA 1QSYA 3CJCA 3MK6A 1RILA 4OJRA 4LY7A 4YOWA 4FXDA 2IC3A 4LF5K 3TSQA 4IM2A 3V9WA 4R5IA 4BECA 4CHPA 5IWAK 4YOTA 3DLEA 4Z4FA 2KZMA 3MXIA 1HYZA 1C0MA 4DR3K 3Q7CA 3KKRA 4PO2A 3KLIA 3QICA 1U45A 4I2PA 3AVHA 2QWOA 2NRHA 3O9UA 5AQGA 4DV4K 3CCMN 2ZXQA 2FBYA 3ZSVA 4CIEA 3EY1A 4AM7A 3ZT3A 4H4MA 3BUPA 2P9KB 2BANA 4PUOA 2OPPA 5H1SQ 3NDKA 1R0AA 1TK8A 1RTJA 4A2BA 4J2DA 3KK1A 4DR6K 1MA9B 4KHUA 2Q13A 4BGBA 4R79A 1ASVA 2X5CA 3CCEN 4ILGA 4F9OA 2GWKA 4PKGA 3GBTA 4AHRA 1FJGK 3V9SA 2D4CA 3LDLA 2DFEA 2O4GA 2AP1A 4DWIA 3VENA 5BRHA 2V0OA 4A5BA 1U2VB 4HTUA 3LL3A 3DLLL 3EZ5A 2PY5A 1ESVA 1V4TA 3R1XA 3AVGA 3DJCA 3H46O 2WUSA 3EJSA 1L3TA 1UOCA 3VOVA 5JMVA 3EJTA 1JL2A 4NXNK 4CK3A 3HSCA 3V9XA 2KLAA 4BRNA 4CJTA 4XJXA 1SU8A 4IWVA 4OPJA 3C6AA 3GL1A 4H0OA 4CZGA 1ILYA 2FF3B 2ZQBA 4FPAA 1OVYA 3J8AA 3L3OM 4ISEA 3I55N 4KTWA 3S9HA 1WSIA 1O13A 4IDHA 3ZSOA 4H0TB 1YVNA 1NBWA 4E89A 2D0PA 3G9GA 2OTJN 4BRMA 2IOCA 4CGFA 3AVAA 4BRIA 3MN5A 4QS8A 5AQMA 3AA4A 3ZT2A 1XNRK 1O1WA 4JK9A 4ID1A 3CC2N 2OPSA 3FE1A 4CJFA 4IJNA 3O9RA 4CEDA 2Q12A 2ZGZA 5FDLA 1GLEG 3QE6A 3E9LA 4EHUA 2WOMA 2F96A 4EFHA 4E1MA 2UUBK 1BIZA 5AFUA 2J4RA 3VQ7A 2ASOA 2V51B 3LDQA 4LD0A 5AZJA 3MMVA 4K0KK 4FYDA 3OHXM 4DR4K 4AHCA 4U67L 3BUZB 3GI7A 4A5AA 3J80O 4IWPA 4E7JA 4FW1A 4C23A 3VEAA 4CI6A 3L2WA 3CXCM 3HAIA 4BQZA 3DRPA 4KHYA 3OYAA 4CECA 3I04A 3NHGA 4QOZB 3KDRA 1OKJA 4BE1A 3O4NA 2I7PA 3LP2A 4CFBA 1JKHA 1NGAA 2O8FB 4LC9B 2RHKA 1NGFA 2QWLA 2P9PB 5GADP 1WUAA 1OH6A 4CFCA 3O6WA 1T44A 3T46A 4AM6A 4DFKA 1Z25A 1YAGA 4K42A 4PWDA 3CMAN 2VWBA 3NVKA 4LH5A 3R3LA 4YOYA 2LXYA 4DQIA 2VCPA 2NLXA 4I6MA 2WC9A 3I39X 1OVQA 1WBBA 1VSIA 3AGRA 2O8EB 4ISGA 3VGMA 3CI5A 2FXUA 4O44A 1KLMA 2GV9A 3BLBA 4CJSA 3H0XA 2EHGA 4CJQA 1IKYA 2Z1IA 4JD2A 4BC2A 4E1NA 1FKOA 2WYIA 3DXKB 2RKIA 3T69A 3ZEUA 5LJVA 5A2QO 4C8KA 2Z1JA 3GDQA 2NRTA 3TAEA 3ZT4A 3KAWA 3TI0A 3OYNA 3F5TA 3VERA 2W6LA 4E19A 3EO3A 4CD3A 4CFDA 4HCBA 4DS5A 2O4IA 4O0IA 3O8MA 3A5MC 3ZCMA 4BGAA 3QNNA 1D8YA 2PY6A 4OPAA 5K14A 4B3RK 1UWBA 3WNHA 2ITMA 1TQSA 5ADXA 4JI8K 4B9MA 1ZYLA 3A2FA 4QS9A 5F1XA 4FZXC 4B1UB 1S6PA 4ID5A 1HUXA 1N34K 4XEIA 3NVMA 1VSDA 3LDPA 1KVAA 4JL9A 4DTNA 1QHAA 1KFSA 3VEZA 4DSEA 1ZBFA 4B8AB 4FO0A 4CGHA 2BE2A 3RSEA 1MWMA 4H6HA 3VETA 1GLDG 2KW4A 3AO4A 2PFUA 1VK0A 3EKUA 3OBYA 4HWIA 5EX5A 2CGJA 4OVLA 4ILGB 2F1BA 4B1VA 5CHIA 2QTDA 3M3WA 3OJSA 3M8QA 2HW3A 3LP3A 2YX6A 2W00A 4IO8A 5JLHA 4ELTA 3CCSN 1Q82O 3FZFA 3SBGA 4A57A 1LQ7A 3QINA 4KTZA 1BDGA 5HOOA 4XIUA 1NK7A 3R8EA 4DV3K 2DFFA 4M3TA 3ZSXA 1M1KO 1BIUA 3OYHA 1T03A 2QWQA 3SYZA 2P1JA 3O9TA 2XY6A 5C15A 1TK5A 2OO2A 2GBZA 4FLZA 1UA1A 3KWGA 3HZ6A 4ISFA 1HX1A 1V4SA 3C6TA 4DR5K 2BGGA 3O80A 3OYGA 1W97L 4AZCA 5M1PA 4KB0A 5J2PA 3F9KA 3LLLA 3CFPA 1MDUB 3LPUA 4N5SA 3B53X 1LWFA 1XNQK 3VGLA 1SL1A 2PYJA 3G71N 3DRSA 3IKMA 2FF6A 4QCLA 1XMOK 3ID8A 4CGJA 3DMJA 5JENA 2A5XA 1OA1A 1VQ8N 3D4YA 3QO9A 4DSLA 3A5OC 3MN6A 2OBLA 4DTMA 5BN9A 3G25A 3P4IA 2UUCK 3L4IA 1ZXOA 4JKCA 3RMAA 3SAHA 2EFLA 3CF5L 2ITGA 2HHIA 3S41A 3WEEA 4BRFA 4NSWA 4H5VA 4OKJA 4YORA 2BPRA 3KJVA 4EZTA 1JQKA 1U04A 4EP4A 1OH7A 4ELVA 2YL9A 4H0XB 2BH1A 1J6ZA 2W6KA 3CC7N 4BE7B 5E84A 4XH1A 3EE8A 4LF6K 2HBKA 3RV0A 3L3VA 4CEOA 3AAPA 1LAVA 5KGXA 3G0ZA 5EXWA 4HUEA 4KREA 4JYAK 4B9QA 4N76A 1BGXT 4B9TA 4Z94A 5KPZA 3SI6A 3LANA 3OK8A 1XC3A 4NXMK 1I49A 3BVTA 3FFIA 1Z6RA 2FLOA 5AQHA 3OTOK 2ZM6K 3MN9A 1GLLO 5CYMA 2Q0RA 4PKHA 5KQDA 4NCAA 3TAFA 1EETA 4WQ5A 4N41A 4MLHA 1NMDA 1RT2A 5TKYA 3I8DA 4X64K 1VSLA 3D45A 1EP4A 4Z0UA 1VRTA 4Z4GA 1TV6A 1JCEA 1C0FA 2FBXA 4JS4A 4JD2B 4CF2A 3SV3A 1OA0A 1RCHA 1WSJA 4G1QA 4CK1A 1RGIA 2G8WA 4M41A 3ZEUB 1S9GA 3W0LA 3ZT0A 5KRTA 4YOUA 1X9SA 4A62A 1TUUA 4AQYK 5DMRA 1R5EA 2YIVX 5AQXA 1N6QA 4KH5A 3T4AG 2P9KA 1YHQN 2CH5A 3OVNA 1IBKK 1CKRA 5CE3A 4JV5K 1HR0K 3VEXA 1BHLA 1DKGD 3DDFA 1NK4A 1JL1A 4V19S 4BDPA 2PMRA 3RMBA 4DU3A 4F2SA 4HY9A 3P83D 4ILJA 4M7XA 5M1KA 5C12A 5M1OA 3ENHA 1VAZA 1YJ9N 1KVBA 4IEIA 3LAKA 1ASWA 3TANA 1L3SA 4Z4HA 1BOTO 2YKMA 1MWKA 3ZETA 4IOCL 3MDQA 1ATNA 3RSEB 5AQPA 4DB3A 3K57A 4B1ZA 2BTFA 2DPNA 4B3MK 3JAMO 3FR0A 2DTUA 3HRGA 3BUDA 1YVUA 1ATRA 3MWTA 3RWUA 3O3GA 3TSPA 3CD6N 2QFFA 4JI0K 2NRVA 3ABHA 3I2WA 2Q31A 4M3RA 1Q86O 4BACA 2NZTA 1W2BM 3U9DA 4BQLA 3KK3A 3ZLJA 4J8FA 3CCVN 4CEZA 4FJGA 3FZLA 1X04A 4KHWA 1NJZA 3DAWA 4CZMA 4JKBA 1TL3A 1GLFO 1JCGA 5EY4A 4I2QA 4N47A 3T49A 2HNYA 1QZ5A 2Q36A 4LF9K 4O4GA 1QZ6A 2RN2A 4DMNA 4C1NI 2YL5A 4CHNA 3O3FA 3FGUA 4LSLA 3CV5A 4IWOA 3FFKB 4B9SA 3H1VX 1KAYA 3CETA 2HNZA 4JKAA 4CZIA 2X6SA 4AZ6A 2VWKA 1U4BA 1DTQA 3VQ8A 2ZF5O 3VQ5A 2FSJA 3DPQA 4CIGA 3BUQA 2FICA 2E2NA 1JCFA 4M45A 3WNFA 5CZ1A 4WF9L 2P9IA 3SK3A 3T1YK 1R33A 4GV9A 4Z4CA 1ZBSA 4FWSA 2P5OA 3DX4A 4BRHA 2O8FA 1NU0A 3KAVA 4FJ5A 4J2EA 1NMNA 2P9PA 3AVMA 3DOKA 3T19A 5BREA 3K0SA 4Q5VA 4B9UA 2OZSA 4I43A 1RT7A 3FD9A 1J54A 3SBTB 2ASPA 5KBPA 4YHHK 3BVWA 1Y97A 1HLUA 3SAFA 4FJXA 1NKCA 4D8JA 1I4DA 1RT5A 1E2UA 3UKUB 3VESA 2ZJQL 4CZJA 3WEEB 2KZZA 1X3MA 4FLXA 4CBUA 1LCUA 3E1YA 1TAUA 1CZBA 2O8EA 4JEPA 1GLJO 4CW7B 4GVEA 1SV5A 3THYB 4B3OA 4AHSA 3THVA 4R5LA 2FBTA 3BY5A 2F9WA 3QFUA 2B6AA 5KPRA 3O3MB 5CR4A 1ZBIA 4IWQA 3DOLA 4EZWA 5AFUH 4UDYX 5FLXO 4WCEL 1KAXA 3DLKA 4WQ4A 1FXXA 3J7ZO 4KO0A 1TQVA 3B6PA 4EZUA 3RRGA 3DXKA 4BEBA 4CHQA 2WBNA 1J53A 4EZQA 3L2RA 4DUYK 3J81O 3SYVA 3AGKA 5HRPA 4OPHA 3BVVA 1O7DB 3ZEFA 3FLCO 3TPQA 4HR1A 2EWSA 3A98A 4X62K 4DUZK 1IG8A 4RW6A 3IFRA 4RCHA 3TU5A 4FVUA 3M8SA 2NRRA 2G8IA 4B8CA 2XHBA 2GAFD 1NNEA 3IG1A 1KRPA 1XHXA 3NGYA 5JS2A 4JI1K 3A5LC 3WQUA 1S1VA 2GUIA 4DSJA 3HP6A 4FK0A 4F00A 3P38A 4IFYA 1P8ZA 1NGIA 4IXCA 5DM7L 3DQGA 4WV7A 2Q3SA 3T3FA 3CJ7A 1S6QA 3OS1A 2PZSA 4JI5K 4GW6A 1JLEA 3AO1A 4CEFA 3QNJA 4FJ9A 3M6GA 4MO4A 2IAJA 1RT1A 5FPEA 4AHVA 2RF2A 4JHDB 4IFEA 2WONA 3D6RA 3ER9B 3U3GA 2OP6A 5J1EA 1RDWX 2QW9A 4FJNA 3QIPA 3SAGA 2G8UA 1NGDA 1Z26A 3F9MA 3UITA 4AZHA 3VMFB 3RR8A 1I4TA 1HPZA 4E7KA 1KAZA 1TQWA 3ZETB 3CCJN 4R5GA 4FK4A 4JS5A 3SBSA 1E1DA 4JKHA 2WYHA 2F8SA 3O3OB 4EZYA 1XWLA 3HOTA 3CG7A 2Q0UA 3CJBA 1YF5L 4IEEA 4AHTA 3ZX3A 4BRGA 1K73O 3DX2A 5ADXH 3CM5A 1RBRA 2RT6A 4EHTA 2F4VK 3MAQA 2YV0X 2HVHA 3ZX2A 1D5AA 4H0YB 3NF8A 2YCHA 4PKIA 4LFCK 2KTQA 4BG8A 2GELA 3MXMA 1NGGA 3AVLA 3I56N 3KKSA 3FZMA 3K9KA 4KB1A 3OJUA 5M1FA 4M3ZA 2D0BA 3DYTA 2G8FA 1E4FT 3K5LA 4BREA 1VQON 4FCYA 4RW8A 1WNSA 1TQTA 2VGNA 1B9FA 2Q2RA 3CJAA 3WXIA 3HPGA 4I9QA 3F2KA 3BP8A 3CJ1A 4WFNL 4C8OA 1W9HA 5AQUA 1TL1A 1E3MA 2P9IB 3K59A 3ZT1A 1BA1A 3HPHA 3A5NC 3VQPA 3HP9A 4EZXA 4FOEA 3OYMA 4KH4A 5LL6Z 2HHXA 5GAEP 1BG3A 1N33K 4B1WB 4ILHB 3CQXA 3EN9A 3DM2A 3H08A 4MFBA 4M3UA 1X3NA 3ENBA 4FLUA 2G8VA 1VSEA 4H4OA 4NB4A 1OAOA 3O1BA 3HAJA 1DG4A 4DQRA 1KSPA 4RW7A 2ND0A 5J2MA 1C0GA 4UY8O 3M1FA 4JKFA 2IIRA 4TSXA 4MQ3A 4F01A 4DFMA 4WQ5C 2P9NB 4HCCA 3EJPA 3VQDA 3SUPA 5AQWA 5LMNK 4FJIA 1SAZA 2FSNA 3THWB 3PSIA 1C6VA 3G10A 4YOVA 3RPMA 2PYLA 3RTVA
chains in the Genus database with same CATH topology
3RV1A 3WEEA 4BRFA 4YOXA 4GV3A 4H5VA 5BN8A 4YORA 5BPLA 2BPRA 4FL9A 2E2PA 4UDXX 1TUYA 4XH4A 5AQFA 4EZTA 4JN4A 4JAXA 5AQTA 3SJHA 3PIPL 1JQKA 4FSVA 1E4GT 2ZJPL 3LM2A 5AR0A 4IO9L 4H0XB 3D2EB 2BH1A 3L0QA 1J6ZA 3TTCA 3U8XA 4HR1B 2JWKA 3CC7N 4CZLA 3ZYYX 4BE7B 5E84A 3L6QA 4XH1A 3CCLN 3EE8A 4BY9C 2HBJA 1E9VA 4EZOA 3DXMB 3R6MA 3H3OB 4FWRA 1N8RO 2HBKA 3RV0A 3VF6A 2D1KA 4JNEA 2IVPA 3AAPA 4JKEA 4BRDA 2YI9A 4JK8A 3ID6A 1VQKN 5EXWA 1VQ6N 1K8KB 2HOEA 4BR2A 3KHYA 2UYTA 3CJ9A 4E1JA 3WQTA 5F2RA 2E1YA 4B9QA 4BVPA 2YI8A 1NM1A 3R9PA 3KZBA 2VGMA 4Z94A 5KPZA 2GWJA 3KK7A 5GIPA 1XC3A 5AQHA 1Z6RA 4KIKA 1H1VA 2FLOA 2P9UB 3C0BA 3MN9A 1GLLO 1G99A 3ZX0A 2Q0RA 2GX9A 4PKHA 5KQDA 4L3QA 3NMUA 4YDUC 1VQLN 4WQ5A 3WXKA 1NGCA 3C7NB 1TYQB 3QFPA 4M63C 5JLFA 2JWLA 3OHRA 4MLHA 5FPMA 3ATUA 1NMDA 4BR7A 4O5FA 3VF4A 5F0XA 1MJGA 5TKYA 1CZAN 3GG4A 2C1IA 3MCAB 3WXMB 3P31A 1NGEA 3ZEDA 4IOAL 1VQ9N 3CIPA 4Y0WA 1JCEA 1C0FA 4JD2B 4AF1A 1OA0A 1BO5O 1KC8O 2IVOA 1RGIA 1VQNN 3EKSA 3ZEUB 1SUFA 5FPDA 2C1GA 5AZIB 1QQOA 2CGLA 3W0LA 4WV5A 5BR9A 5GAGP 3WXJA 4YOUA 4A62A 1BU6O 2Z8YA 2ZJQL 2ZWHA 1TUUA 5JVGL 4BG9A 2YIVX 5AQXA 5AQZA 4PL7A 2RE2A 4IOXA 3O5BA 3T4AG 4KH5A 4QS7A 5GAHP 2NCZA 3O9QA 1GN9A 2P9KA 3IUCA 1YHQN 2CH5A 1UPXA 2AA4A 2QWMA 1CKRA 3MCPA 5CE3A 2WFBA 4PL8A 3A8YA 3VEXA 1SU6A 1DKGD 4ILIA 3BF3A 5KPTA 1K9MO 3QBWA 2E1ZA 4BC5A 4BC3A 4CZHA 5BPMA 1WOQA 3GOIA 3B51X 4HY9A 4ILJA 3ULEA 3VPZA 4GNIA 4M7XA 1BUPA 1SS6A 5HL7L 5M1KA 3U9ZA 2HSTA 1Q81O 3N8EA 5C12A 1DKXA 3L4QA 5M1OA 3ENHA 4JK7A 2NRZA 1DT9A 1VAZA 3SMPA 3UKRA 4CD1A 2PAVA 1YJ9N 3JS6A 4KIKB 4IEIA 2N3KA 5JICA 2YHXA 4O8UA 1KQSM 1GLAG 3T7ZA 3TTDA 4IW0A 1Q7YO 3WUHA 1BOTO 2LM0A 1MWKA 3N4PA 1GLBG 4EZSA 3MDQA 4FWOA 5AQQA 3WXLA 1GNLA 2HMPA 1SU7A 5AQRA 1ATNA 1SQKA 3RSEB 5BPNA 5C10A 5AQPA 4DB3A 2CH6A 2YHYA 2ZGYA 4NPHA 1T6DA 4B1ZA 3RVCA 2BTFA 2DPNA 3CJCA 3MK6A 2HBLA 2ND1A 4YOWA 3FR0A 4G9ZA 3HRGA 4IM2A 3TSQA 2YIAA 4R5IA 4BECA 1ATRA 3O1WA 4FWQA 4YOTA 3MWTA 3QA8A 3D7EO 3TSPA 4DKWA 2QFFA 3CD6N 4MO5A 5LJWA 2NRVA 3Q7CA 4RTFD 2OTLN 4PO2A 3QICA 2GUPA 2EX3B 2QWOA 3SBTA 1JJ2M 2NRHA 2Q31A 1Q86O 3O9UA 2NZTA 5AQGA 3D2FA 3DOBA 3U9DA 4BQLA 4G6QA 3CCMN 1W2BM 4J8FA 3HM8A 3CCVN 3UKUA 3FZLA 4AM7A 3B8AX 4MDBA 4M7YA 3IMXA 3DAWA 2E8AA 2P9KB 4CZMA 3VKHA 2JNSA 5H1SQ 4JKBA 1GNTA 1JCGA 1GLFO 5EY4A 4A2BA 4M0MA 5ELZA 5LY3A 2OANA 3T49A 4BRLA 1MA9B 1QZ5A 2Q36A 4XH5A 1QZ6A 4BGBA 3O3NB 4R79A 4HTLA 4C1NI 4IZ9A 3FGUA 5EVZA 2X5CA 3CCEN 4ILGA 2HF4A 3LMFA 5BRDA 4F9OA 2GWKA 3M3ZA 4KBOA 4PKGA 3GBTA 5M1QA 4IWOA 5EOYA 3FFKB 1S72N 3LDLA 5DM6L 3DPPA 4BR5A 3H1VX 2AP1A 3UE5A 3VENA 1RDUA 5BRHA 1KAYA 4A5BA 3CETA 4JKAA 4CZIA 1U2VB 3UKRB 1U00A 3LL3A 3DLLL 4IM0A 1YITN 1ESVA 1V4TA 3OA9A 3R1XA 4WQ4C 3HTVA 3DJCA 3VEOA 2ZF5O 3H46O 2WUSA 3IDHA 2FSJA 3DPQA 5AQKA 3VOVA 2IVNA 4EZRA 5JMVA 2E2NA 4K25A 4NLCA 5AQOA 4C1NK 1JCFA 4BRAA 3HSCA 4WF9L 2P9IA 3VEYA 3SK3A 2KLAA 1S3XA 4IJAA 4BRNA 1SU8A 4XJXA 4IWVA 3C6AA 3GL1A 3FZHA 4H0OA 1QVGM 1ZBSA 4GV9A 4FWSA 3CCUN 4CZGA 4BRHA 1ILYA 2FF3B 3K9JA 2ASMA 3KAVA 4BR9A 4FPAA 2P9PA 1YJWN 5BREA 1OVYA 3J8AA 3L3OM 4ISEA 3I55N 4CZFA 5FLEX 3FZKA 4BRQA 2CGKA 3LM9A 4JWIA 4I43A 4JWCA 1HKCA 1O13A 4IDHA 3FD9A 4H0TB 4A61A 3SBTB 1DEJA 1YVNA 1YJNN 1NBWA 1NJIO 2ASPA 1YXQA 3LDOA 3D2FB 2D0PA 2KHOA 2P9LB 3QB0A 2OTJN 4BRMA 4R5JA 3ER8C 1HLUA 3SAFA 1T3VA 4D8JA 2A41A 3UKUB 1E2UA 1SZ2A 3VESA 3MN5A 4QS8A 5AQMA 4BRIA 4CZJA 1NGJA 4JK9A 3WEEB 4FWKA 1X3MA 2F9TA 4BRPA 4CBUA 3CC2N 3U4LA 2A40A 3FE1A 3B52X 1BWFO 4IJNA 1LCUA 3O9RA 5FPNA 4JWDA 2ZGZA 3E1YA 5C2DA 3UB5A 1GLEG 3E9LA 4JEPA 1GLJO 4EHUA 3CPEA 2QI2A 4GVEA 2FSKA 4EFHA 4IM3A 4R5LA 4JKGA 1EO1A 4A2AA 4K43A 2F9WA 3QFUA 5AFUA 5KPRA 2J4RA 5TKWA 2ASOA 3O3MB 2V51B 5CR4A 3LDQA 3Q7BA 4IWQA 5AZJA 4H6IA 4EZWA 3MMVA 5AQVA 5AFUH 4CZEA 4UDYX 3OHXM 4WCEL 1KAXA 4FWLA 4JHDA 4U67L 3BUZB 5I9EB 4WQ4A 3J7ZO 3GI7A 4A5AA 1VQPN 4IWPA 4EZUA 3DXKA 4BEBA 3QMLA 2WBNA 4C23A 4EZQA 3VEAA 4CI6A 4WFAL 5B8HA 1EQYA 3CXCM 2QA4N 3CC4N 2P9SA 4BQZA 3VTHA 3AGKA 5AQLA 5AQYA 4JLCA 2D4WA 2YIBA 3I04A 3EE9A 4OPHA 4YDUA 3QBXA 1VQ5N 3M5RA 1BA0A 3KDRA 7HSCA 3ZEFA 1OKJA 3AY9A 3FLCO 4DQ8A 3TTFA 2I7PA 1KD1O 3D2EA 3T47A 3TPQA 4HR1A 2EWSA 1NGAA 3A98A 5KQ8A 3HBTA 5FIGA 1IG8A 4LC9B 2RHKA 2I7NA 1NGFA 5M1NA 2QWLA 5AQJA 2P9PB 3IFRA 4RCHA 3TU5A 5GADP 1WUAA 4EZZA 4FVUA 1RFQA 3O6WA 1T44A 2NRRA 3T46A 4AM6A 3G4SN 4K41A 2D0OA 1YAGA 4K42A 2GAFD 3A0IX 3H6EA 3CMAN 1K8KA 4H0VB 2VWBA 3NVKA 4E81A 3A5LC 3ZETA 3H3NO 4IOCL 3LDNA 3R3LA 3WQUA 2EWFA 4YOYA 4BRKA 2GA9D 2NNWA 2VCPA 2NLXA 3ENOA 2WC9A 3H45C 3KWIA 4I6MA 1DKYA 3I39X 4EIAA 2YJEA 4F00A 3P38A 4BR4A 1P8ZA 4H5NA 4GV6A 5C0YA 1NGIA 4IXCA 3MN7A 5DM7L 3F7WA 3DQGA 4WV7A 3KVGA 4H5RA 4H5WA 3AGRA 3CJ7A 4ISGA 3CI5A 3VGMA 2FXUA 2V7ZA 3E9OA 3SLCA 4MQDA 4WYBA 5JVHL 1S22A 4JKGB 4PHTX 3DPOA 3H0XA 1Z05A 3PLAA 2VYPA 3C6HA 3QNJA 4A59A 5AQIA 2QWPA 3M6GA 4MO4A 3VGKA 4FM3A 3VEBA 1YUWA 3MWPA 5AZJB 5FPEA 5GIOA 2F7TA 4CBXA 4JD2A 4BC2A 4JHDB 1ATSA 3D6RA 4IFEA 3ER9B 3ULEB 2OP6A 4DHYA 1RDWX 1NGHA 2QW9A 1GLCG 1ZC6A 3DXKB 1Q18A 3T69A 3ZEUA 5LJVA 1NGDA 3SAGA 5AZIA 3F9MA 3UITA 3GDQA 2P9SB 3GE1A 2NRTA 3KAWA 3VMFB 3O08A 4U7BA 3ATVA 3CHWA 4JWEA 3F5TA 3BF1A 3VERA 3CQYA 2Q1NA 1M90O 1KAZA 2NRXA 3EO3A 4R5KA 4CD3A 1HPMA 3ZETB 3CCJN 2W41A 4R5GA 3I8BA 2HBMA 4CZKA 4H5TA 3CERA 3O8MA 2Q97A 3SBSA 1E1DA 4JKHA 3OWGA 3A5MC 4H03B 4NLBA 4BGAA 3PIOL 2E88A 3BEXA 1R59O 4BR0A 5MLCQ 2PY6A 3O3OB 4EZYA 4OPAA 3HOTA 1QVFM 2Q0UA 4MLEA 1QQNA 3CJBA 1YF5L 4B1YB 5ADXA 2ITMA 4BC4A 2E20A 4IEEA 3ZX3A 3AAQA 4BRGA 1ZYLA 4HYBA 4QS9A 5F1XA 4BROA 3P39A 1K73O 5ADXH 4OO1J 4E3CA 4I6MB 4ILHA 4B1UB 3DWLA 3HOSA 2QXLA 2RT6A 4NO7A 4FWMA 4EHTA 1HUXA 4RWTA 2PBDA 1LOTB 4XEIA 3NVMA 3ZX2A 4H0YB 2V52B 3LDPA 2YCHA 4PKIA 4JL9A 1YIJN 1QHAA 3VEZA 4BG8A 2GELA 1NGBA 2YHWA 3HI0A 1NGGA 4FO0A 4CBWA 3I56N 1P90A 4JKDA 2W40A 2H3GX 4EZNA 3RSEA 3FZMA 3K9KA 2QEXN 5M1FA 3JXUA 1MWMA 2E2QA 4H6HA 1IJJA 3EZWA 3VETA 1GLDG 1D4XA 1E4FT 2PFUA 3T48A 2YJFA 3EKUA 3MX5A 3OBYA 4HWIA 5EX5A 4EAHD 2A42A 2CGJA 2P9NA 1XUPO 2WINM 4ILGB 4B1VA 2QTDA 1NLVA 4BREA 5CHIA 1DKZA 1VQ4N 1DGKN 2YX6A 1VQON 2W00A 3QDKA 1HKGA 4EZPA 4IO8A 5JLHA 5GINA 3CCRN 3CCSN 2ZJRL 1Q82O 1HJOA 1BPRA 3FZFA 3H1QA 3SBGA 5AQNA 3VEWA 4A57A 4BRCA 2VGNA 3W3DA 1BDGA 4CJ7A 4EZVA 3CJAA 2Q2RA 5HOOA 3CMEN 2A3ZA 3WXIA 3F2KA 3R8EA 3E66A 3BP8A 3CJ1A 4WFNL 3O9SA 3SMSA 5AQUA 2NRWA 3E9PA 2QWNA 1M1KO 2P9IB 3VTIA 3CCQN 3G6EN 3I01A 1BA1A 2YI1A 3A5NC 4WFBL 4DCHA 3TSUA 4EZXA 4GY2B 2QWQA 4B1XB 3O9TA 4O8KA 3C65A 2BUPA 5C15A 1VQ7N 4FOEA 2E2OA 4KH4A 1T6CA 3DXMA 2OBMA 2V7YA 1BG3A 3I33A 3VF2A 5GAEP 1VQMN 4B1WB 4ILHB 3CQXA 3EN9A 3KWGA 3HZ6A 4ISFA 1HX1A 4JNFA 1U2VA 1V4SA 3AARA 1NWKA 1X3NA 3ENBA 3O80A 1W97L 5M1PA 2A6AA 2QM1A 4NB4A 2GTDA 3O4WA 4FWPA 1OAOA 1YI2N 3O1BA 4BVOA 1X9JA 1DG4A 1MDUB 3N4QA 3CPWM 5E26A 3B53X 4KH6A 2P9UA 2ND0A 1C0GA 3VGLA 2HF3A 4UY8O 3ERCC 3M1FA 3MX2A 2IIRA 4JKFA 5C2FA 3G71N 3IKMA 2GEMA 2QWRA 5BRFA 3EL2A 1Q5LA 2FF6A 1TYQA 3C7NA 4F01A 1Y64A 3ID8A 4MDAA 4WQ5C 1K8AO 2A5XA 1OA1A 2P9NB 1VQ8N 4FWNA 3A5OC 4H0PA 3MN6A 2OBLA 3OW2M 1W9MA 5AQWA 5BN9A 3G25A 3P4IA 3L4IA 1ZXOA 1SAZA 1XQSC 2FSNA 5AQSA 3OBWA 4JKCA 1HKBA 4FOIA 1U6ZA 4FPBA 1QQMA 3WT0A 3VEVA 4YOVA 3SAHA 3CF5L 2KKZA 2P9LA 3S41A 1KXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WEE A;  4BRF A;  4H5V A;  5BN8 A;  5BPL A;  2BPR A;  4FL9 A;  2E2P A;  5AQF A;  1TUY A;  4XH4 A;  5AQT A;  4EZT A;  4JN4 A;  4JAX A;  3SJH A;  4FSV A;  1E4G T;  3LM2 A;  5AR0 A;  4H0X B;  3D2E B;  3U8X A;  3L0Q A;  1J6Z A;  4CZL A;  5E84 A;  3L6Q A;  4XH1 A;  4FWR A;  4EZO A;  3DXM B;  3R6M A;  3H3O B;  3VF6 A;  2D1K A;  4JNE A;  2IVP A;  3AAP A;  4BRD A;  5EXW A;  1K8K B;  2HOE A;  4BR2 A;  3KHY A;  2UYT A;  3CJ9 A;  4E1J A;  3WQT A;  5F2R A;  2E1Y A;  4B9Q A;  4BVP A;  1NM1 A;  3R9P A;  3KZB A;  4Z94 A;  5KPZ A;  2GWJ A;  1XC3 A;  5AQH A;  1H1V A;  1Z6R A;  2FLO A;  2P9U B;  3C0B A;  3MN9 A;  1GLL O;  1G99 A;  3ZX0 A;  2Q0R A;  4PKH A;  5KQD A;  4L3Q A;  4YDU C;  4WQ5 A;  3WXK A;  1NGC A;  3C7N B;  1TYQ B;  3QFP A;  4M63 C;  5JLF A;  3OHR A;  4MLH A;  5FPM A;  3ATU A;  1NMD A;  4BR7 A;  4O5F A;  3VF4 A;  5F0X A;  5TKY A;  1CZA N;  3GG4 A;  1NGE A;  3CIP A;  4Y0W A;  1JCE A;  1C0F A;  4JD2 B;  1BO5 O;  2IVO A;  1RGI A;  3EKS A;  3ZEU B;  5FPD A;  5AZI B;  1QQO A;  2CGL A;  3W0L A;  4WV5 A;  5BR9 A;  3WXJ A;  4A62 A;  1BU6 O;  2ZWH A;  1TUU A;  4BG9 A;  5AQX A;  5AQZ A;  4PL7 A;  3O5B A;  3T4A G;  4QS7 A;  2P9K A;  3IUC A;  2CH5 A;  2AA4 A;  2QWM A;  1CKR A;  3MCP A;  5CE3 A;  4PL8 A;  3A8Y A;  3VEX A;  1DKG D;  3BF3 A;  5KPT A;  3QBW A;  2E1Z A;  4BC5 A;  4BC3 A;  4CZH A;  5BPM A;  1WOQ A;  3GOI A;  4HY9 A;  3ULE A;  3VPZ A;  4GNI A;  4M7X A;  1BUP A;  3U9Z A;  3N8E A;  1DKX A;  3ENH A;  3SMP A;  3UKR A;  4CD1 A;  2PAV A;  3JS6 A;  5JIC A;  2YHX A;  1GLA G;  3WUH A;  1BOT O;  1MWK A;  4FWO A;  1GLB G;  4EZS A;  3MDQ A;  5AQQ A;  3WXL A;  3ZET A;  2HMP A;  5AQR A;  1ATN A;  1SQK A;  3RSE B;  5BPN A;  5AQP A;  4DB3 A;  2CH6 A;  2YHY A;  2ZGY A;  1T6D A;  4B1Z A;  2BTF A;  2DPN A;  3CJC A;  3MK6 A;  3FR0 A;  4R5I A;  1ATR A;  3O1W A;  4FWQ A;  3D7E O;  2QFF A;  4MO5 A;  5LJW A;  4RTF D;  4PO2 A;  3QIC A;  2GUP A;  2QWO A;  2NRH A;  2Q31 A;  2NZT A;  5AQG A;  3D2F A;  3DOB A;  3U9D A;  4BQL A;  4J8F A;  3HM8 A;  3UKU A;  3FZL A;  4AM7 A;  3B8A X;  4M7Y A;  3IMX A;  3DAW A;  2E8A A;  2P9K B;  4CZM A;  1GLF O;  1JCG A;  5EY4 A;  5LY3 A;  4A2B A;  5ELZ A;  2OAN A;  3T49 A;  4BRL A;  1MA9 B;  1QZ5 A;  2Q36 A;  4XH5 A;  1QZ6 A;  4BGB A;  4HTL A;  4IZ9 A;  3FGU A;  5EVZ A;  2HF4 A;  5BRD A;  4F9O A;  2GWK A;  3M3Z A;  4KBO A;  4PKG A;  3GBT A;  5EOY A;  3FFK B;  3LDL A;  3DPP A;  4BR5 A;  3H1V X;  2AP1 A;  3UE5 A;  3VEN A;  5BRH A;  1KAY A;  3CET A;  4CZI A;  1U2V B;  3UKR B;  1U00 A;  3LL3 A;  1ESV A;  1V4T A;  4WQ4 C;  3HTV A;  3DJC A;  3VEO A;  2ZF5 O;  3H46 O;  2WUS A;  3IDH A;  2FSJ A;  3DPQ A;  5AQK A;  3VOV A;  2IVN A;  4EZR A;  5JMV A;  2E2N A;  4K25 A;  5AQO A;  1JCF A;  4BRA A;  3HSC A;  2P9I A;  3VEY A;  3SK3 A;  4BRN A;  1S3X A;  4IJA A;  4IWV A;  3GL1 A;  3FZH A;  4H0O A;  1ZBS A;  4FWS A;  4CZG A;  4BRH A;  2FF3 B;  2ASM A;  4BR9 A;  4FPA A;  2P9P A;  5BRE A;  3J8A A;  3L3O M;  4ISE A;  4CZF A;  3FZK A;  4BRQ A;  2CGK A;  3LM9 A;  4JWI A;  1HKC A;  4JWC A;  4A61 A;  4H0T B;  1DEJ A;  1YVN A;  1NBW A;  2ASP A;  1YXQ A;  3LDO A;  3D2F B;  2D0P A;  2KHO A;  2P9L B;  3QB0 A;  4BRM A;  4R5J A;  1HLU A;  2A41 A;  3UKU B;  3VES A;  1SZ2 A;  4BRI A;  3MN5 A;  4QS8 A;  5AQM A;  4CZJ A;  1NGJ A;  3WEE B;  4BRP A;  4FWK A;  1X3M A;  2F9T A;  4CBU A;  3U4L A;  2A40 A;  3FE1 A;  1BWF O;  4IJN A;  1LCU A;  5FPN A;  4JWD A;  2ZGZ A;  3UB5 A;  1GLE G;  1GLJ O;  4EHU A;  2FSK A;  4EFH A;  4R5L A;  4A2A A;  4K43 A;  2F9W A;  3QFU A;  5AFU A;  5KPR A;  2J4R A;  2ASO A;  2V51 B;  3LDQ A;  5AZJ A;  4H6I A;  4EZW A;  3MMV A;  5AQV A;  5AFU H;  4CZE A;  3OHX M;  1KAX A;  4FWL A;  4JHD A;  3BUZ B;  5I9E B;  4WQ4 A;  4EZU A;  3DXK A;  3QML A;  4C23 A;  4EZQ A;  4CI6 A;  5B8H A;  1EQY A;  2P9S A;  4BQZ A;  5AQL A;  5AQY A;  2D4W A;  4YDU A;  3QBX A;  1BA0 A;  7HSC A;  1OKJ A;  3AY9 A;  3FLC O;  4DQ8 A;  2I7P A;  3D2E A;  3T47 A;  3TPQ A;  2EWS A;  1NGA A;  5KQ8 A;  3HBT A;  1IG8 A;  4LC9 B;  2I7N A;  1NGF A;  2QWL A;  5AQJ A;  2P9P B;  3IFR A;  4RCH A;  3TU5 A;  1WUA A;  4EZZ A;  1RFQ A;  3O6W A;  1T44 A;  3T46 A;  4AM6 A;  4K41 A;  2D0O A;  1YAG A;  4K42 A;  3A0I X;  3H6E A;  1K8K A;  4H0V B;  2VWB A;  4E81 A;  3A5L C;  3H3N O;  3LDN A;  3WQU A;  4BRK A;  3ENO A;  2VCP A;  2NLX A;  4I6M A;  3H45 C;  1DKY A;  4EIA A;  2YJE A;  4F00 A;  4BR4 A;  1P8Z A;  4H5N A;  1NGI A;  4IXC A;  3MN7 A;  3KVG A;  3DQG A;  4WV7 A;  4H5R A;  4H5W A;  3CJ7 A;  4ISG A;  3CI5 A;  3VGM A;  2FXU A;  2V7Z A;  3SLC A;  4WYB A;  1S22 A;  3DPO A;  3H0X A;  1Z05 A;  2VYP A;  3QNJ A;  5AQI A;  2QWP A;  3M6G A;  4MO4 A;  3VGK A;  1YUW A;  5AZJ B;  5FPE A;  4CBX A;  4JD2 A;  4BC2 A;  4JHD B;  1ATS A;  3ULE B;  4DHY A;  2OP6 A;  1RDW X;  1NGH A;  2QW9 A;  1GLC G;  1ZC6 A;  3DXK B;  1Q18 A;  3ZEU A;  5LJV A;  1NGD A;  5AZI A;  3F9M A;  3GDQ A;  2P9S B;  3GE1 A;  3O08 A;  3ATV A;  3CHW A;  4JWE A;  3VER A;  3BF1 A;  3CQY A;  2Q1N A;  1KAZ A;  3EO3 A;  4R5K A;  4CD3 A;  1HPM A;  3ZET B;  2W41 A;  4R5G A;  3I8B A;  4CZK A;  4H5T A;  3CER A;  3O8M A;  2Q97 A;  3A5M C;  4H03 B;  4BGA A;  2E88 A;  3BEX A;  1R59 O;  4BR0 A;  4EZY A;  2Q0U A;  4MLE A;  1QQN A;  3CJB A;  4B1Y B;  5ADX A;  2ITM A;  4BC4 A;  2E20 A;  3ZX3 A;  3AAQ A;  4BRG A;  4HYB A;  4QS9 A;  5F1X A;  4BRO A;  5ADX H;  4I6M B;  4B1U B;  3DWL A;  2QXL A;  4NO7 A;  4FWM A;  4EHT A;  1HUX A;  4RWT A;  2PBD A;  1LOT B;  4XEI A;  3ZX2 A;  4H0Y B;  2V52 B;  3LDP A;  2YCH A;  4PKI A;  1QHA A;  3VEZ A;  4BG8 A;  2GEL A;  1NGB A;  2YHW A;  3HI0 A;  1NGG A;  4FO0 A;  4CBW A;  3RSE A;  2W40 A;  2H3G X;  4EZN A;  3FZM A;  3JXU A;  1MWM A;  2E2Q A;  4H6H A;  1IJJ A;  3EZW A;  3VET A;  1GLD G;  1D4X A;  1E4F T;  4EAH D;  3T48 A;  2YJF A;  3EKU A;  4HWI A;  5EX5 A;  2A42 A;  2CGJ A;  2P9N A;  1XUP O;  2WIN M;  4B1V A;  4BRE A;  1NLV A;  1DKZ A;  1DGK N;  3QDK A;  1HKG A;  4EZP A;  4IO8 A;  5JLH A;  1HJO A;  1BPR A;  3FZF A;  3H1Q A;  5AQN A;  3VEW A;  4BRC A;  3W3D A;  1BDG A;  4CJ7 A;  4EZV A;  3CJA A;  2Q2R A;  2A3Z A;  3WXI A;  3R8E A;  3BP8 A;  3CJ1 A;  3SMS A;  5AQU A;  2QWN A;  2P9I B;  2YI1 A;  1BA1 A;  3A5N C;  4DCH A;  4EZX A;  4GY2 B;  2QWQ A;  4B1X B;  4O8K A;  2BUP A;  4FOE A;  2E2O A;  1T6C A;  3DXM A;  2V7Y A;  1BG3 A;  3I33 A;  3VF2 A;  4B1W B;  3CQX A;  3EN9 A;  3HZ6 A;  4ISF A;  1HX1 A;  4JNF A;  1U2V A;  1V4S A;  3AAR A;  1NWK A;  1X3N A;  3O80 A;  2A6A A;  2QM1 A;  4NB4 A;  2GTD A;  3O4W A;  4FWP A;  3O1B A;  4BVO A;  1X9J A;  1DG4 A;  1MDU B;  5E26 A;  2P9U A;  1C0G A;  3VGL A;  2HF3 A;  3M1F A;  2IIR A;  2GEM A;  2QWR A;  5BRF A;  3EL2 A;  1Q5L A;  2FF6 A;  1TYQ A;  3C7N A;  4F01 A;  1Y64 A;  3ID8 A;  4WQ5 C;  2A5X A;  2P9N B;  4FWN A;  3A5O C;  4H0P A;  3MN6 A;  5AQW A;  5BN9 A;  3G25 A;  3P4I A;  3L4I A;  1ZXO A;  1SAZ A;  1XQS C;  2FSN A;  5AQS A;  1HKB A;  4FOI A;  1U6Z A;  4FPB A;  1QQM A;  3WT0 A;  3VEV A;  2P9L A;  3S41 A;  1KXP A; 
#chains in the Genus database with same CATH topology
 3SUO A;  1NK8 A;  4DTS A;  4EP5 A;  4GV3 A;  1CXU A;  4FL9 A;  2DFH A;  2E2P A;  2F8T A;  1TUY A;  4JAX A;  3PIP L;  4FZZ A;  1RT3 A;  1E4G T;  1X03 A;  1FK9 A;  3LM2 A;  3TTC A;  4HR1 B;  1GOA A;  4CZL A;  3LP0 A;  3L6Q A;  1NKB A;  4BY9 C;  2HBJ A;  3C95 A;  3Q0K A;  1N8R O;  2F7R A;  1HNV A;  1WLJ A;  4GVM A;  4JI2 K;  2IVP A;  3VF6 A;  1W7A A;  3IRX A;  4JKE A;  4BRD A;  2OW6 A;  3NAE A;  2HHS A;  1QHT A;  4NCG A;  4E1J A;  3WQT A;  5F2R A;  1Q9X A;  4CF8 A;  3R9P A;  2A1S A;  4LF7 K;  5GIP A;  5E41 A;  2P9U B;  3DYA A;  4KV8 A;  2GX9 A;  1I39 A;  3LZJ A;  4Q0B A;  1VQL N;  4NCB A;  4M3Y A;  1NGC A;  1TYQ B;  4O55 A;  3OHR A;  5FPM A;  3ATU A;  4BR7 A;  3VF4 A;  1MJG A;  1CZA N;  3WXM B;  3ZED A;  1SKR A;  3HT3 A;  1B92 A;  4BNE A;  4H8S A;  5FPD A;  4KHQ A;  1QQO A;  3L2V A;  1KTQ A;  1WB9 A;  2XO7 A;  5GAG P;  1ZBU A;  3O4Q A;  1HNW K;  2Z8Y A;  3B6O A;  2ZWH A;  3THX A;  1C1C A;  1BIS A;  3L3P A;  4AIL C;  1GN9 A;  1SL0 A;  4DV1 K;  3MCP A;  4CJK A;  4IG3 A;  3KD5 E;  3NFA A;  1JLF A;  3A8Y A;  1SU6 A;  3BF3 A;  1ZWW A;  5KPT A;  1K9M O;  1RBT A;  2E1Z A;  4F4K A;  3GOI A;  3B51 X;  3ULE A;  3K5N A;  3VPZ A;  2D0C A;  1NK9 A;  3AO5 A;  3MEE A;  4GKJ K;  5HL7 L;  3U9Z A;  1Q81 O;  3N8E A;  3L4Q A;  3WNE A;  4JK7 A;  1JLB A;  3CQ8 A;  3SMP A;  2O8D B;  2N3K A;  5JIC A;  3V1R A;  1RDD A;  3T7Z A;  4IW0 A;  1Q7Y O;  3CFO A;  3WUH A;  1GLB G;  3WXL A;  1UAX A;  1GNL A;  1SU7 A;  5AQR A;  1SQK A;  1NOZ A;  2FYV A;  3VQ6 A;  2JLE A;  2ZGY A;  4NPH A;  2OYQ A;  4DSK A;  1NJW A;  4BE0 A;  3DDG A;  4JRP A;  2ND1 A;  3DLR A;  4G9Z A;  1QX1 A;  3PO4 A;  2YIA A;  2HND A;  4FWQ A;  1VSJ A;  3QA8 A;  3D7E O;  4DKW A;  4MO5 A;  4RTF D;  1CLQ A;  3KLH A;  1C0U A;  2EX3 B;  3SBT A;  1S1W A;  4YNQ A;  1RDB A;  4RG8 A;  4G6Q A;  3LWL A;  1SL2 A;  3UKU A;  3B8A X;  1EKE A;  4CJU A;  3SJJ A;  3L2U A;  3OS2 A;  2D1L A;  4M7Y A;  5EU7 A;  2E8A A;  1K6Y A;  3VKH A;  3J7A P;  1D9F A;  1GNT A;  3HL8 A;  5LY3 A;  4AZ5 A;  5ELZ A;  3VQB A;  4YY3 K;  2OAN A;  4CEB A;  4XH5 A;  3O3N B;  2XY7 A;  3THY A;  1HRH A;  2HF4 A;  3V81 A;  1HYV A;  5BRD A;  4CF0 A;  2G8K A;  5DM6 L;  3ALY A;  1C1A A;  3HPO A;  4FJJ A;  2LSN A;  1U00 A;  1YIT N;  2UXB K;  3C6U A;  4WQ4 C;  3OA9 A;  4W5N A;  3HTV A;  3VEO A;  3IDH A;  1BQN A;  4CE9 A;  3QER A;  2A1R A;  5T7B A;  2IVN A;  2QKK A;  4NLC A;  4C1N K;  4DF8 A;  4BRA A;  1W0H A;  3BUB A;  1FKP A;  3BZC A;  4IJA A;  3AA2 A;  2OPR A;  1EWQ A;  3CCU N;  1J9A A;  3IS9 A;  4BR9 A;  5FRO A;  4WPC A;  3U6F A;  4CZF A;  5FLE X;  2B5J A;  3FZK A;  2CGK A;  4DG1 A;  4KRF A;  1HKC A;  4A61 A;  4CGG A;  3RMC A;  3QEP A;  1YJN N;  1NJI O;  3D4Z A;  3BVU A;  1YXQ A;  3D2F B;  3V9Z A;  2C08 A;  3QB0 A;  4R5J A;  2A41 A;  3ACO A;  1SZ2 A;  1NGJ A;  2FBV A;  5AJ3 K;  4FWK A;  1IBM K;  3U4L A;  2VWJ A;  1RTD A;  2A40 A;  1J5E K;  1BWF O;  3DRR A;  4JWD A;  3ULD A;  3UB5 A;  4IBN A;  2IDO A;  2QI2 A;  3BZK A;  2FSK A;  4M42 A;  4IM3 A;  1TKZ A;  1NJY A;  1EO1 A;  4A2A A;  4K43 A;  4M3X A;  3QEX A;  1ASU A;  3O3H A;  1RBU A;  4H6I A;  4CZE A;  4DFJ A;  3CFR A;  1LW0 A;  2O0I 1;  4JHD A;  4CCH A;  3PSF A;  5I9E B;  3NGZ A;  5D3G A;  3QML A;  4WFA L;  2QA4 N;  1N32 K;  3SPY A;  3TAP A;  3CC4 N;  4JLH A;  4JLC A;  2D4W A;  2YIB A;  3EE9 A;  1VQ5 N;  3QBX A;  1BA0 A;  2BDP A;  3TTF A;  1KD1 O;  3T47 A;  2W42 A;  5KQ8 A;  3RRH A;  3HBT A;  5FIG A;  5M1N A;  4J2B A;  5AQJ A;  4H8K A;  2B4J A;  3G4S N;  2YKT A;  4K41 A;  2D0O A;  3A0I X;  3LZI A;  3H6E A;  3SPZ A;  1K8K A;  3U3Y A;  3KIO A;  4E7H A;  3LAL A;  1JLQ A;  3LDN A;  1Q8I A;  3KWI A;  3EEQ A;  3I0S A;  2HHU A;  4CEA A;  3AO3 A;  5C0Y A;  1U49 A;  3DX1 A;  3HXM A;  3THX B;  1GOC A;  4HUF A;  1WBD A;  3SQ4 A;  4MQD A;  4ZTF A;  5JVH L;  4JKG B;  4UQG A;  4PHT X;  3DPO A;  1LWC A;  3PLA A;  4A59 A;  3C6H A;  3OYI A;  1EWR A;  2QWP A;  3QLH A;  4FM3 A;  3MWP A;  5GIO A;  4OGE A;  3P5J A;  5HRN A;  4CEE A;  3ULE B;  4JI3 K;  1RBV A;  4C8M A;  3CAZ A;  4CJR A;  4KTQ A;  1GLC G;  2X3V A;  3SOG A;  1ZC6 A;  2O8C A;  4PQU A;  2HHT A;  1Q18 A;  4WE1 A;  5AZI A;  4KHN A;  3TR8 A;  2RPI A;  2P9S B;  1X9M A;  1YWM A;  1D9D A;  3O08 A;  1Y2O A;  2RAK A;  4U7B A;  3PO5 A;  3ATV A;  1VSK A;  3CQY A;  3SV4 A;  1M90 O;  2QK9 A;  4DTX A;  2YLL A;  2NRX A;  2YKN A;  3NE6 A;  3PX6 A;  3CVR A;  3VQE A;  4DR2 K;  3I8B A;  4CZK A;  2HBM A;  4CGD A;  3CER A;  3BVX A;  2Q97 A;  3NH1 A;  4BR0 A;  3BEX A;  5MLC Q;  1TGO A;  3AV9 A;  2UU9 K;  1QVF M;  3UIQ A;  4DV6 K;  4OLA A;  1JLC A;  2E20 A;  4W5R A;  1RT4 A;  5SZT A;  3ASM A;  4KKO A;  4ILH A;  4FLW A;  2F7P A;  1C1B A;  4NO7 A;  3D52 A;  3TAG A;  3SQ1 A;  4FWM A;  5CYQ A;  3AVK A;  1LOT B;  2HHV A;  2E6M A;  2VG5 A;  3DLG A;  4BWJ A;  2KFN A;  2YHW A;  4CHO A;  2I5J A;  4AZ7 A;  4CBW A;  4WPE A;  4HVJ A;  1P90 A;  2XY5 A;  1BQM A;  4FW2 A;  3JXU A;  5KI6 A;  3HM9 A;  3DX0 A;  4L8R B;  2YJF A;  1WAF A;  2A42 A;  2P9N A;  3JSM A;  2WIN M;  1NJX A;  4CER A;  2Y1J A;  4OX9 K;  1VQ4 N;  1DGK N;  3QDK A;  1HKG A;  3THW A;  3L8B A;  1NK0 A;  2ZJR L;  4DFP A;  1HJO A;  3KLE A;  4CJ5 A;  3H1Q A;  2RAJ A;  1QWN A;  3AVF A;  4AH9 A;  3CME N;  4PA1 A;  3LP1 A;  2YNI A;  4RW4 A;  3O9S A;  2NRW A;  2QWN A;  4JI7 K;  3VTI A;  1HMV A;  4DCH A;  3TSU A;  2BUP A;  1VQ7 N;  4LFA K;  2HMI A;  4DSF A;  4CGI A;  1T6C A;  3LAM A;  3LPT A;  1VQM N;  3AO2 A;  3VF2 A;  1BCO A;  3NH0 A;  3OYK A;  4C8L A;  3HK2 A;  1R34 A;  3NBP A;  4JNF A;  4JI6 K;  1NWK A;  1B9D A;  4B3T K;  2A6A A;  4DV5 K;  2GTD A;  3O4W A;  4FWP A;  1YI2 N;  4I1Q A;  4N56 A;  4OKE A;  1A5X A;  4FZY A;  2P9U A;  2OPQ A;  2AJQ A;  4OKK A;  3ERC C;  3MX2 A;  5BR8 K;  2GEM A;  3MEG A;  5BRF A;  1Q5L A;  1TYQ A;  5C5B B;  1Y64 A;  4MDA A;  4OGC A;  5C25 A;  2FC0 A;  5KGW A;  4FLT A;  4H0P A;  2YHA A;  3OW2 M;  2YNG A;  1JXE A;  1XC9 A;  3OBW A;  1HKB A;  1JLG A;  1EXQ A;  3VEV A;  3ZSQ A;  2KKZ A;  2P9L A;  3NF7 A;  2QXF A;  1IO2 A;  4CJP A;  1KXP A;  4IFV A;  3OYL A;  3AVB A;  3LDS A;  3WNG A;  4YOX A;  5FRN A;  5BN8 A;  4NYN A;  5BPL A;  4UDX X;  2XY8 A;  4XH4 A;  5AQT A;  3SJH A;  3D0P A;  4K8X A;  1HNI A;  4FJH A;  4FSV A;  4B9V A;  4IO9 L;  3U8X A;  3ZYY X;  2KQ2 A;  3CCL N;  3VA0 A;  3PY8 A;  3OYC A;  1QQC A;  3DXM B;  3R6M A;  4KHP K;  4JNE A;  4AZG A;  5C42 A;  1NK6 A;  4CJE A;  1VQK N;  3TAM A;  1XI1 A;  1VQ6 N;  1K8K B;  2HOE A;  4KI6 A;  4LF8 K;  1HQE A;  1LW2 A;  3MED A;  1WSF A;  3KZB A;  4CF9 A;  2GWJ A;  4CJL A;  3KK7 A;  3ITH A;  2O8D A;  1HXK A;  1H1V A;  4C8N A;  2F7Q A;  3C0B A;  3ZX0 A;  4AVM A;  4L3Q A;  3NMU A;  4YDU C;  4FM0 A;  3C7N B;  5JLF A;  4M63 C;  3LVT A;  1U47 A;  2X74 A;  3TAB A;  1VSF A;  5F0X A;  4DR1 K;  4CJ4 A;  3GG4 A;  2C1I A;  3MCA B;  3OYD A;  4IG0 A;  4IKF A;  4IOA L;  4Y0W A;  2RAI A;  3T1H K;  3AVC A;  1TVR A;  2Z0V A;  1KC8 O;  3EYZ A;  3QNO A;  2O8C B;  3JYT A;  1SUF A;  1QE1 A;  4DTJ A;  3C94 A;  1IKX A;  5AZI B;  2EX3 A;  4WV5 A;  3CYG A;  3WXJ A;  4FLY A;  2Z0N A;  5JVG L;  1TQU A;  4DCN C;  4BG9 A;  1CXQ A;  3L2Q A;  4PL7 A;  2RE2 A;  3O5B A;  3DLH A;  4QS7 A;  1S1T A;  2NCZ A;  4FJL A;  2AA4 A;  3RR7 A;  2OCE A;  2WFB A;  4PL8 A;  3LWM A;  4E3S A;  3D50 A;  3QBW A;  4BC3 A;  4CZH A;  2YL8 A;  1WOQ A;  4NQI A;  4NYF A;  2HHQ A;  3DLB A;  1IG9 A;  4FJM A;  3E01 A;  1HTY A;  1QWU A;  4LF4 K;  3M8P A;  2NRZ A;  4E7I A;  1DT9 A;  4CD1 A;  1BCM A;  1WSE A;  4KIK B;  1WSH A;  3OS0 A;  3CKD A;  1GLA G;  3AVN A;  3V4I A;  1REV A;  3V1O A;  2LM0 A;  3N4P A;  3QIO A;  4FZS A;  2HMP A;  2P5G A;  3NGI A;  5BPN A;  5C10 A;  3CZN A;  2ALW A;  1T6D A;  5C24 A;  3RVC A;  1O7D C;  2HBL A;  4RW9 A;  4FJK A;  5KRS A;  1BI4 B;  1TKT A;  4FM1 A;  5I42 A;  4DTR A;  1L3V A;  3O1W A;  5HRO A;  5LJW A;  2OTL N;  3K5O A;  2GUP A;  1A5W A;  2G8H A;  1N5Y A;  3EJQ A;  3HYF A;  1JJ2 M;  3NH2 A;  3D2F A;  3DOB A;  5I3U A;  3S3N A;  3HM8 A;  4B9N A;  1VSH A;  4MDB A;  1N36 K;  5HRR A;  1L3U A;  3IMX A;  2MI7 A;  2JNS A;  3MEC A;  4JRQ A;  1URU A;  1LV5 A;  1L5U A;  4X65 K;  4M0M A;  4BRL A;  1G15 A;  5HBM A;  5HLF A;  5HP1 A;  4HTL A;  4KAZ A;  4IZ9 A;  5EVZ A;  3LMF A;  4YFU A;  3M3Z A;  4KBO A;  5M1Q A;  2UXD K;  5EOY A;  1S72 N;  4M3W A;  3CZS A;  3DPP A;  4BR5 A;  3UE5 A;  1RDU A;  2IGI A;  2HHH K;  4DV2 K;  4DYL A;  4F2R A;  1Q9Y A;  3UKR B;  4IM0 A;  1LAW A;  1XHZ A;  4FJ7 A;  3BUI A;  3SQ0 A;  3AVI A;  5AQK A;  1OH5 A;  4EZR A;  4K25 A;  5AQO A;  3VQQ A;  3VEY A;  1S3X A;  1QVG M;  3FZH A;  4AZB A;  3K9J A;  2ASM A;  4LSN A;  3ZSZ A;  1RNH A;  1YJW N;  1T7P A;  3K5M A;  1RBS A;  3HAH A;  4BRQ A;  3LM9 A;  4JWI A;  4JWC A;  3KK2 A;  1DEJ A;  1A5V A;  1YTA A;  4KHS A;  3LDO A;  2KHO A;  2P9L B;  2X3X A;  3ER8 C;  1TAQ A;  2E6L A;  1T3V A;  3I0R A;  1HNX K;  4BRP A;  1XMQ K;  1KFD A;  4F3O A;  2F9T A;  2D5R A;  4Y1C A;  3PX4 A;  3B52 X;  3VQC A;  5FPN A;  2UXC K;  5C2D A;  3T1A A;  3CPE A;  4W5Q A;  4DF4 A;  2F7O A;  1YTU A;  2Z0O A;  4JKG A;  2YNH A;  4R5P A;  4DTP A;  4ELU A;  1QSS A;  5TKW A;  3TAR A;  2OZM A;  2OW7 A;  3EJR A;  3Q7B A;  3SNN A;  5AQV A;  3S3M A;  1QSL A;  4FWL A;  2X6N A;  2X78 A;  3BDP A;  1VQP N;  1DLO A;  3OY9 A;  4HHT A;  5B8H A;  1EQY A;  1WAJ A;  2Z1H A;  3CYM A;  3IAY A;  1SKS A;  2YNF A;  2Y1I A;  2P9S A;  1KLN A;  4FZO A;  3ISN C;  3VTH A;  5AQL A;  2X3W A;  5AQY A;  3QEW A;  2HHW A;  2O8B A;  2JGU A;  1T05 A;  3AA5 X;  4YDU A;  4CK2 A;  4DU4 A;  3M5R A;  7HSC A;  3AY9 A;  4DQS A;  4DQ8 A;  3QEV A;  3D2E A;  1KCF A;  2I7N A;  1RDC A;  2ELB A;  3PX0 A;  1GOB A;  4EZZ A;  2ATQ A;  2XRI A;  1DTT A;  1RFQ A;  4KPY A;  4DTO A;  5JS1 A;  2KFZ A;  2D0A A;  1HQU A;  2OA8 A;  3NF9 A;  4H0V B;  3BGR A;  3TAQ A;  4E81 A;  1IKW A;  1YT3 A;  3H3N O;  1ZBL A;  3SQ2 A;  2EWF A;  1QS4 A;  4BRK A;  5SWM A;  2GA9 D;  2NNW A;  3ENO A;  3H45 C;  1DKY A;  4EIA A;  2YJE A;  4BR4 A;  4H5N A;  4GV6 A;  1S9E A;  3MN7 A;  3F7W A;  1S1U A;  3KVG A;  4H5R A;  1C0T A;  4H5W A;  1MU2 A;  3DI6 A;  4ZHR A;  4DLG A;  3PV8 A;  2V7Z A;  1T8E A;  5FRM A;  4CES A;  3E9O A;  3SLC A;  2QKB A;  4WYB A;  4PY5 A;  3V1Q A;  1S22 A;  4I7F A;  2ZD1 A;  1Z05 A;  3KD1 E;  2VYP A;  4EZ9 A;  1S5J A;  5AQI A;  5CZ2 A;  4B08 A;  3VGK A;  3VEB A;  1YUW A;  4W5O A;  5AZJ B;  2F7T A;  4CBX A;  1ATS A;  4DHY A;  4BDZ A;  1NGH A;  3ZSW A;  5LMU K;  4OPK A;  3GE1 A;  1IH7 A;  3SCX A;  3K58 A;  4O5B A;  3CHW A;  4JWE A;  4CVN E;  3BF1 A;  2Q1N A;  3PUF A;  3S3O A;  1FW6 A;  4R5K A;  1HPM A;  3J7Y P;  4CIF A;  4GKK K;  2W41 A;  4FJ8 A;  4H5T A;  4AKV A;  3OWG A;  4H03 B;  4NLB A;  4CEQ A;  3PIO L;  2E88 A;  1R59 O;  2HB5 A;  1VHX A;  3DX3 A;  4MLE A;  1RTH A;  1QQN A;  4CJV A;  1I4L A;  4B1Y B;  1JXB A;  4LFB K;  4BC4 A;  2F1A A;  3AAQ A;  4HYB A;  4OO1 J;  4BRO A;  3P39 A;  1RTI A;  4E3C A;  4I6M B;  4F8R A;  3DWL A;  3HOS A;  2QXL A;  1EX4 A;  4KFB A;  4RWT A;  3TWH A;  1UA0 A;  2PBD A;  3HO1 A;  1X1P A;  4DV0 K;  2V52 B;  1S1X A;  1ITG A;  3AA3 A;  3ZSY A;  4W5T A;  1YIJ N;  3HST B;  1NGB A;  3HI0 A;  5HRS A;  4BDY A;  3AVJ A;  4E0D A;  2YHB A;  4JKD A;  2W40 A;  2H3G X;  4EZN A;  1WDZ A;  4HUG A;  2VG6 A;  2QEX N;  1NOY A;  2E2Q A;  1IJJ A;  1NG9 A;  1D4X A;  3MX5 A;  5C5B A;  3T48 A;  4EAH D;  5J2Q A;  1OH8 A;  1XUP O;  1NLV A;  2HVI A;  1DKZ A;  4EZP A;  5GIN A;  3CCR N;  1J5O A;  4QAG A;  2YLA A;  1HNZ K;  1BPR A;  3Q84 A;  4ICL A;  3S5T A;  1U48 A;  5AQN A;  2E4L A;  2JNK A;  1WN7 A;  3VEW A;  4BRC A;  4CF1 A;  4E72 A;  3W3D A;  4CJ7 A;  4EZV A;  2A3Z A;  4CHY A;  3E66 A;  3VA3 A;  4J2A A;  1IKV A;  3L3U A;  3SMS A;  3CM6 A;  3E9P A;  1RT6 A;  3OYB A;  3PLT A;  3G6E N;  3CCQ N;  3I01 A;  2YI1 A;  4FVM A;  1TKD A;  4WFB L;  4GY2 B;  4B1X B;  3SZ2 A;  3RMD A;  4O8K A;  3C65 A;  3QEI A;  3F73 A;  4X66 K;  2E2O A;  4KI4 A;  3DXM A;  2OBM A;  2V7Y A;  3QNI A;  3I33 A;  3OYE A;  2E5L K;  4CJ3 A;  4FLV A;  1RDA A;  2F18 A;  1U2V A;  4E7L A;  3AAR A;  1X9W A;  3QWE A;  4FZP A;  2QM1 A;  3NF6 A;  2UUA K;  4BVO A;  1X9J A;  1JLA A;  2OZN B;  3N4Q A;  1IV0 A;  4AHU A;  4DV7 K;  3CPW M;  5E26 A;  4KH6 A;  3SUQ A;  5KTQ A;  2Z1G A;  5CY4 A;  2HF3 A;  5C2F A;  1LWE A;  2QWR A;  3EL2 A;  1K8A O;  3C7N A;  4FWN A;  3V9U A;  1W9M A;  1XQS C;  2ETJ A;  3VN5 A;  5AQS A;  4FOI A;  1U6Z A;  4FPB A;  1QQM A;  3WT0 A;  1BL3 A;  5DK5 A;  4CJW A;  3KLG A;  1TKX A;  4F3T A;  1HYS A;  1I3A A;  2EFK A;  1TK0 A;  3EZW A;  1KVC A;  3RV1 A;  3M8R A;  4B9L A;  4JI4 K;  5AQF A;  2O8B B;  2IS3 A;  4JN4 A;  4BE2 A;  2ZJP L;  3V6D A;  2VG7 A;  5AR0 A;  3D2E B;  3VQA A;  3L0Q A;  3K2P A;  3OYF A;  2JWK A;  4DU1 A;  4DR7 K;  4FWR A;  1E9V A;  4EZO A;  3H3O B;  1NK5 A;  2D1K A;  3MXJ A;  2YI9 A;  4JK8 A;  3ID6 A;  4IDK A;  4Y1D A;  3ZSR A;  4BR2 A;  3KHY A;  2UYT A;  3CJ9 A;  3HVT A;  5IT9 O;  4AZC B;  4Z4E A;  2E1Y A;  1ZYQ A;  2DY4 A;  4BVP A;  2YI8 A;  3OYJ A;  1IBL K;  1NM1 A;  1WSG A;  4B3S K;  2VQE K;  2VGM A;  4DQQ A;  3QET A;  4KIK A;  1G99 A;  3KLF A;  4O0J A;  3WXK A;  3QFP A;  2JWL A;  4K8Z A;  4GMJ B;  4FM2 A;  3VQ9 A;  2VQF K;  4O5F A;  2WTU A;  1QTM A;  3P31 A;  1NGE A;  1VQ9 N;  3CIP A;  3HVR A;  4FK2 A;  1BI4 A;  4AF1 A;  1BO5 O;  2IVO A;  3P1G A;  4DQP A;  3KTQ A;  4EZ6 A;  3EKS A;  2P51 A;  1VQN N;  2C1G A;  2CGL A;  2GF4 A;  4LH4 A;  5BR9 A;  4DLE A;  1SUQ A;  1BU6 O;  5AQZ A;  4Z4I A;  4IOX A;  5GAH P;  4I9L A;  3HJF A;  2NUB A;  3O9Q A;  3EJU A;  3D51 A;  3IUC A;  1UPX A;  2QWM A;  2YL6 A;  4ILI A;  4BC5 A;  2R7Y A;  4BWM A;  4OLB A;  5BPM A;  1F21 A;  1SKW A;  1CZ9 A;  4ZTJ A;  2QKW A;  1HJR A;  1HWW A;  4GNI A;  4DSI A;  1BUP A;  1SS6 A;  1VSM A;  3QES A;  2HST A;  1DKX A;  2ZE2 A;  4CHZ A;  1PS3 A;  4DS4 A;  3UKR A;  1ZBH A;  2PAV A;  3JS6 A;  2YHX A;  4O8U A;  1KQS M;  3SUN A;  3TTD A;  4CFA A;  1I94 K;  4FWO A;  4EZS A;  5AQQ A;  3VQ4 A;  4ATM A;  4AZI A;  4DTU A;  5J2N A;  1VRU A;  2CH6 A;  2YHY A;  3NCI A;  1NKE A;  1QSY A;  3CJC A;  3MK6 A;  1RIL A;  4OJR A;  4LY7 A;  4YOW A;  4FXD A;  2IC3 A;  4LF5 K;  3TSQ A;  4IM2 A;  3V9W A;  4R5I A;  4BEC A;  4CHP A;  5IWA K;  4YOT A;  3DLE A;  4Z4F A;  2KZM A;  3MXI A;  1HYZ A;  1C0M A;  4DR3 K;  3Q7C A;  3KKR A;  4PO2 A;  3KLI A;  3QIC A;  1U45 A;  4I2P A;  3AVH A;  2QWO A;  2NRH A;  3O9U A;  5AQG A;  4DV4 K;  3CCM N;  2ZXQ A;  2FBY A;  3ZSV A;  4CIE A;  3EY1 A;  4AM7 A;  3ZT3 A;  4H4M A;  3BUP A;  2P9K B;  2BAN A;  4PUO A;  2OPP A;  5H1S Q;  3NDK A;  1R0A A;  1TK8 A;  1RTJ A;  4A2B A;  4J2D A;  3KK1 A;  4DR6 K;  1MA9 B;  4KHU A;  2Q13 A;  4BGB A;  4R79 A;  1ASV A;  2X5C A;  3CCE N;  4ILG A;  4F9O A;  2GWK A;  4PKG A;  3GBT A;  4AHR A;  1FJG K;  3V9S A;  2D4C A;  3LDL A;  2DFE A;  2O4G A;  2AP1 A;  4DWI A;  3VEN A;  5BRH A;  2V0O A;  4A5B A;  1U2V B;  4HTU A;  3LL3 A;  3DLL L;  3EZ5 A;  2PY5 A;  1ESV A;  1V4T A;  3R1X A;  3AVG A;  3DJC A;  3H46 O;  2WUS A;  3EJS A;  1L3T A;  1UOC A;  3VOV A;  5JMV A;  3EJT A;  1JL2 A;  4NXN K;  4CK3 A;  3HSC A;  3V9X A;  2KLA A;  4BRN A;  4CJT A;  4XJX A;  1SU8 A;  4IWV A;  4OPJ A;  3C6A A;  3GL1 A;  4H0O A;  4CZG A;  1ILY A;  2FF3 B;  2ZQB A;  4FPA A;  1OVY A;  3J8A A;  3L3O M;  4ISE A;  3I55 N;  4KTW A;  3S9H A;  1WSI A;  1O13 A;  4IDH A;  3ZSO A;  4H0T B;  1YVN A;  1NBW A;  4E89 A;  2D0P A;  3G9G A;  2OTJ N;  4BRM A;  2IOC A;  4CGF A;  3AVA A;  4BRI A;  3MN5 A;  4QS8 A;  5AQM A;  3AA4 A;  3ZT2 A;  1XNR K;  1O1W A;  4JK9 A;  4ID1 A;  3CC2 N;  2OPS A;  3FE1 A;  4CJF A;  4IJN A;  3O9R A;  4CED A;  2Q12 A;  2ZGZ A;  5FDL A;  1GLE G;  3QE6 A;  3E9L A;  4EHU A;  2WOM A;  2F96 A;  4EFH A;  4E1M A;  2UUB K;  1BIZ A;  5AFU A;  2J4R A;  3VQ7 A;  2ASO A;  2V51 B;  3LDQ A;  4LD0 A;  5AZJ A;  3MMV A;  4K0K K;  4FYD A;  3OHX M;  4DR4 K;  4AHC A;  4U67 L;  3BUZ B;  3GI7 A;  4A5A A;  3J80 O;  4IWP A;  4E7J A;  4FW1 A;  4C23 A;  3VEA A;  4CI6 A;  3L2W A;  3CXC M;  3HAI A;  4BQZ A;  3DRP A;  4KHY A;  3OYA A;  4CEC A;  3I04 A;  3NHG A;  4QOZ B;  3KDR A;  1OKJ A;  4BE1 A;  3O4N A;  2I7P A;  3LP2 A;  4CFB A;  1JKH A;  1NGA A;  2O8F B;  4LC9 B;  2RHK A;  1NGF A;  2QWL A;  2P9P B;  5GAD P;  1WUA A;  1OH6 A;  4CFC A;  3O6W A;  1T44 A;  3T46 A;  4AM6 A;  4DFK A;  1Z25 A;  1YAG A;  4K42 A;  4PWD A;  3CMA N;  2VWB A;  3NVK A;  4LH5 A;  3R3L A;  4YOY A;  2LXY A;  4DQI A;  2VCP A;  2NLX A;  4I6M A;  2WC9 A;  3I39 X;  1OVQ A;  1WBB A;  1VSI A;  3AGR A;  2O8E B;  4ISG A;  3VGM A;  3CI5 A;  2FXU A;  4O44 A;  1KLM A;  2GV9 A;  3BLB A;  4CJS A;  3H0X A;  2EHG A;  4CJQ A;  1IKY A;  2Z1I A;  4JD2 A;  4BC2 A;  4E1N A;  1FKO A;  2WYI A;  3DXK B;  2RKI A;  3T69 A;  3ZEU A;  5LJV A;  5A2Q O;  4C8K A;  2Z1J A;  3GDQ A;  2NRT A;  3TAE A;  3ZT4 A;  3KAW A;  3TI0 A;  3OYN A;  3F5T A;  3VER A;  2W6L A;  4E19 A;  3EO3 A;  4CD3 A;  4CFD A;  4HCB A;  4DS5 A;  2O4I A;  4O0I A;  3O8M A;  3A5M C;  3ZCM A;  4BGA A;  3QNN A;  1D8Y A;  2PY6 A;  4OPA A;  5K14 A;  4B3R K;  1UWB A;  3WNH A;  2ITM A;  1TQS A;  5ADX A;  4JI8 K;  4B9M A;  1ZYL A;  3A2F A;  4QS9 A;  5F1X A;  4FZX C;  4B1U B;  1S6P A;  4ID5 A;  1HUX A;  1N34 K;  4XEI A;  3NVM A;  1VSD A;  3LDP A;  1KVA A;  4JL9 A;  4DTN A;  1QHA A;  1KFS A;  3VEZ A;  4DSE A;  1ZBF A;  4B8A B;  4FO0 A;  4CGH A;  2BE2 A;  3RSE A;  1MWM A;  4H6H A;  3VET A;  1GLD G;  2KW4 A;  3AO4 A;  2PFU A;  1VK0 A;  3EKU A;  3OBY A;  4HWI A;  5EX5 A;  2CGJ A;  4OVL A;  4ILG B;  2F1B A;  4B1V A;  5CHI A;  2QTD A;  3M3W A;  3OJS A;  3M8Q A;  2HW3 A;  3LP3 A;  2YX6 A;  2W00 A;  4IO8 A;  5JLH A;  4ELT A;  3CCS N;  1Q82 O;  3FZF A;  3SBG A;  4A57 A;  1LQ7 A;  3QIN A;  4KTZ A;  1BDG A;  5HOO A;  4XIU A;  1NK7 A;  3R8E A;  4DV3 K;  2DFF A;  4M3T A;  3ZSX A;  1M1K O;  1BIU A;  3OYH A;  1T03 A;  2QWQ A;  3SYZ A;  2P1J A;  3O9T A;  2XY6 A;  5C15 A;  1TK5 A;  2OO2 A;  2GBZ A;  4FLZ A;  1UA1 A;  3KWG A;  3HZ6 A;  4ISF A;  1HX1 A;  1V4S A;  3C6T A;  4DR5 K;  2BGG A;  3O80 A;  3OYG A;  1W97 L;  4AZC A;  5M1P A;  4KB0 A;  5J2P A;  3F9K A;  3LLL A;  3CFP A;  1MDU B;  3LPU A;  4N5S A;  3B53 X;  1LWF A;  1XNQ K;  3VGL A;  1SL1 A;  2PYJ A;  3G71 N;  3DRS A;  3IKM A;  2FF6 A;  4QCL A;  1XMO K;  3ID8 A;  4CGJ A;  3DMJ A;  5JEN A;  2A5X A;  1OA1 A;  1VQ8 N;  3D4Y A;  3QO9 A;  4DSL A;  3A5O C;  3MN6 A;  2OBL A;  4DTM A;  5BN9 A;  3G25 A;  3P4I A;  2UUC K;  3L4I A;  1ZXO A;  4JKC A;  3RMA A;  3SAH A;  2EFL A;  3CF5 L;  2ITG A;  2HHI A;  3S41 A;  3WEE A;  4BRF A;  4NSW A;  4H5V A;  4OKJ A;  4YOR A;  2BPR A;  3KJV A;  4EZT A;  1JQK A;  1U04 A;  4EP4 A;  1OH7 A;  4ELV A;  2YL9 A;  4H0X B;  2BH1 A;  1J6Z A;  2W6K A;  3CC7 N;  4BE7 B;  5E84 A;  4XH1 A;  3EE8 A;  4LF6 K;  2HBK A;  3RV0 A;  3L3V A;  4CEO A;  3AAP A;  1LAV A;  5KGX A;  3G0Z A;  5EXW A;  4HUE A;  4KRE A;  4JYA K;  4B9Q A;  4N76 A;  1BGX T;  4B9T A;  4Z94 A;  5KPZ A;  3SI6 A;  3LAN A;  3OK8 A;  1XC3 A;  4NXM K;  1I49 A;  3BVT A;  3FFI A;  1Z6R A;  2FLO A;  5AQH A;  3OTO K;  2ZM6 K;  3MN9 A;  1GLL O;  5CYM A;  2Q0R A;  4PKH A;  5KQD A;  4NCA A;  3TAF A;  1EET A;  4WQ5 A;  4N41 A;  4MLH A;  1NMD A;  1RT2 A;  5TKY A;  3I8D A;  4X64 K;  1VSL A;  3D45 A;  1EP4 A;  4Z0U A;  1VRT A;  4Z4G A;  1TV6 A;  1JCE A;  1C0F A;  2FBX A;  4JS4 A;  4JD2 B;  4CF2 A;  3SV3 A;  1OA0 A;  1RCH A;  1WSJ A;  4G1Q A;  4CK1 A;  1RGI A;  2G8W A;  4M41 A;  3ZEU B;  1S9G A;  3W0L A;  3ZT0 A;  5KRT A;  4YOU A;  1X9S A;  4A62 A;  1TUU A;  4AQY K;  5DMR A;  1R5E A;  2YIV X;  5AQX A;  1N6Q A;  4KH5 A;  3T4A G;  2P9K A;  1YHQ N;  2CH5 A;  3OVN A;  1IBK K;  1CKR A;  5CE3 A;  4JV5 K;  1HR0 K;  3VEX A;  1BHL A;  1DKG D;  3DDF A;  1NK4 A;  1JL1 A;  4V19 S;  4BDP A;  2PMR A;  3RMB A;  4DU3 A;  4F2S A;  4HY9 A;  3P83 D;  4ILJ A;  4M7X A;  5M1K A;  5C12 A;  5M1O A;  3ENH A;  1VAZ A;  1YJ9 N;  1KVB A;  4IEI A;  3LAK A;  1ASW A;  3TAN A;  1L3S A;  4Z4H A;  1BOT O;  2YKM A;  1MWK A;  3ZET A;  4IOC L;  3MDQ A;  1ATN A;  3RSE B;  5AQP A;  4DB3 A;  3K57 A;  4B1Z A;  2BTF A;  2DPN A;  4B3M K;  3JAM O;  3FR0 A;  2DTU A;  3HRG A;  3BUD A;  1YVU A;  1ATR A;  3MWT A;  3RWU A;  3O3G A;  3TSP A;  3CD6 N;  2QFF A;  4JI0 K;  2NRV A;  3ABH A;  3I2W A;  2Q31 A;  4M3R A;  1Q86 O;  4BAC A;  2NZT A;  1W2B M;  3U9D A;  4BQL A;  3KK3 A;  3ZLJ A;  4J8F A;  3CCV N;  4CEZ A;  4FJG A;  3FZL A;  1X04 A;  4KHW A;  1NJZ A;  3DAW A;  4CZM A;  4JKB A;  1TL3 A;  1GLF O;  1JCG A;  5EY4 A;  4I2Q A;  4N47 A;  3T49 A;  2HNY A;  1QZ5 A;  2Q36 A;  4LF9 K;  4O4G A;  1QZ6 A;  2RN2 A;  4DMN A;  4C1N I;  2YL5 A;  4CHN A;  3O3F A;  3FGU A;  4LSL A;  3CV5 A;  4IWO A;  3FFK B;  4B9S A;  3H1V X;  1KAY A;  3CET A;  2HNZ A;  4JKA A;  4CZI A;  2X6S A;  4AZ6 A;  2VWK A;  1U4B A;  1DTQ A;  3VQ8 A;  2ZF5 O;  3VQ5 A;  2FSJ A;  3DPQ A;  4CIG A;  3BUQ A;  2FIC A;  2E2N A;  1JCF A;  4M45 A;  3WNF A;  5CZ1 A;  4WF9 L;  2P9I A;  3SK3 A;  3T1Y K;  1R33 A;  4GV9 A;  4Z4C A;  1ZBS A;  4FWS A;  2P5O A;  3DX4 A;  4BRH A;  2O8F A;  1NU0 A;  3KAV A;  4FJ5 A;  4J2E A;  1NMN A;  2P9P A;  3AVM A;  3DOK A;  3T19 A;  5BRE A;  3K0S A;  4Q5V A;  4B9U A;  2OZS A;  4I43 A;  1RT7 A;  3FD9 A;  1J54 A;  3SBT B;  2ASP A;  5KBP A;  4YHH K;  3BVW A;  1Y97 A;  1HLU A;  3SAF A;  4FJX A;  1NKC A;  4D8J A;  1I4D A;  1RT5 A;  1E2U A;  3UKU B;  3VES A;  2ZJQ L;  4CZJ A;  3WEE B;  2KZZ A;  1X3M A;  4FLX A;  4CBU A;  1LCU A;  3E1Y A;  1TAU A;  1CZB A;  2O8E A;  4JEP A;  1GLJ O;  4CW7 B;  4GVE A;  1SV5 A;  3THY B;  4B3O A;  4AHS A;  3THV A;  4R5L A;  2FBT A;  3BY5 A;  2F9W A;  3QFU A;  2B6A A;  5KPR A;  3O3M B;  5CR4 A;  1ZBI A;  4IWQ A;  3DOL A;  4EZW A;  5AFU H;  4UDY X;  5FLX O;  4WCE L;  1KAX A;  3DLK A;  4WQ4 A;  1FXX A;  3J7Z O;  4KO0 A;  1TQV A;  3B6P A;  4EZU A;  3RRG A;  3DXK A;  4BEB A;  4CHQ A;  2WBN A;  1J53 A;  4EZQ A;  3L2R A;  4DUY K;  3J81 O;  3SYV A;  3AGK A;  5HRP A;  4OPH A;  3BVV A;  1O7D B;  3ZEF A;  3FLC O;  3TPQ A;  4HR1 A;  2EWS A;  3A98 A;  4X62 K;  4DUZ K;  1IG8 A;  4RW6 A;  3IFR A;  4RCH A;  3TU5 A;  4FVU A;  3M8S A;  2NRR A;  2G8I A;  4B8C A;  2XHB A;  2GAF D;  1NNE A;  3IG1 A;  1KRP A;  1XHX A;  3NGY A;  5JS2 A;  4JI1 K;  3A5L C;  3WQU A;  1S1V A;  2GUI A;  4DSJ A;  3HP6 A;  4FK0 A;  4F00 A;  3P38 A;  4IFY A;  1P8Z A;  1NGI A;  4IXC A;  5DM7 L;  3DQG A;  4WV7 A;  2Q3S A;  3T3F A;  3CJ7 A;  1S6Q A;  3OS1 A;  2PZS A;  4JI5 K;  4GW6 A;  1JLE A;  3AO1 A;  4CEF A;  3QNJ A;  4FJ9 A;  3M6G A;  4MO4 A;  2IAJ A;  1RT1 A;  5FPE A;  4AHV A;  2RF2 A;  4JHD B;  4IFE A;  2WON A;  3D6R A;  3ER9 B;  3U3G A;  2OP6 A;  5J1E A;  1RDW X;  2QW9 A;  4FJN A;  3QIP A;  3SAG A;  2G8U A;  1NGD A;  1Z26 A;  3F9M A;  3UIT A;  4AZH A;  3VMF B;  3RR8 A;  1I4T A;  1HPZ A;  4E7K A;  1KAZ A;  1TQW A;  3ZET B;  3CCJ N;  4R5G A;  4FK4 A;  4JS5 A;  3SBS A;  1E1D A;  4JKH A;  2WYH A;  2F8S A;  3O3O B;  4EZY A;  1XWL A;  3HOT A;  3CG7 A;  2Q0U A;  3CJB A;  1YF5 L;  4IEE A;  4AHT A;  3ZX3 A;  4BRG A;  1K73 O;  3DX2 A;  5ADX H;  3CM5 A;  1RBR A;  2RT6 A;  4EHT A;  2F4V K;  3MAQ A;  2YV0 X;  2HVH A;  3ZX2 A;  1D5A A;  4H0Y B;  3NF8 A;  2YCH A;  4PKI A;  4LFC K;  2KTQ A;  4BG8 A;  2GEL A;  3MXM A;  1NGG A;  3AVL A;  3I56 N;  3KKS A;  3FZM A;  3K9K A;  4KB1 A;  3OJU A;  5M1F A;  4M3Z A;  2D0B A;  3DYT A;  2G8F A;  1E4F T;  3K5L A;  4BRE A;  1VQO N;  4FCY A;  4RW8 A;  1WNS A;  1TQT A;  2VGN A;  1B9F A;  2Q2R A;  3CJA A;  3WXI A;  3HPG A;  4I9Q A;  3F2K A;  3BP8 A;  3CJ1 A;  4WFN L;  4C8O A;  1W9H A;  5AQU A;  1TL1 A;  1E3M A;  2P9I B;  3K59 A;  3ZT1 A;  1BA1 A;  3HPH A;  3A5N C;  3VQP A;  3HP9 A;  4EZX A;  4FOE A;  3OYM A;  4KH4 A;  5LL6 Z;  2HHX A;  5GAE P;  1BG3 A;  1N33 K;  4B1W B;  4ILH B;  3CQX A;  3EN9 A;  3DM2 A;  3H08 A;  4MFB A;  4M3U A;  1X3N A;  3ENB A;  4FLU A;  2G8V A;  1VSE A;  4H4O A;  4NB4 A;  1OAO A;  3O1B A;  3HAJ A;  1DG4 A;  4DQR A;  1KSP A;  4RW7 A;  2ND0 A;  5J2M A;  1C0G A;  4UY8 O;  3M1F A;  4JKF A;  2IIR A;  4TSX A;  4MQ3 A;  4F01 A;  4DFM A;  4WQ5 C;  2P9N B;  4HCC A;  3EJP A;  3VQD A;  3SUP A;  5AQW A;  5LMN K;  4FJI A;  1SAZ A;  2FSN A;  3THW B;  3PSI A;  1C6V A;  3G10 A;  4YOV A;  3RPM A;  2PYL A;  3RTV A; 
#chains in the Genus database with same CATH homology
 3RV1 A;  3WEE A;  4BRF A;  4YOX A;  4GV3 A;  4H5V A;  5BN8 A;  4YOR A;  5BPL A;  2BPR A;  4FL9 A;  2E2P A;  4UDX X;  1TUY A;  4XH4 A;  5AQF A;  4EZT A;  4JN4 A;  4JAX A;  5AQT A;  3SJH A;  3PIP L;  1JQK A;  4FSV A;  1E4G T;  2ZJP L;  3LM2 A;  5AR0 A;  4IO9 L;  4H0X B;  3D2E B;  2BH1 A;  3L0Q A;  1J6Z A;  3TTC A;  3U8X A;  4HR1 B;  2JWK A;  3CC7 N;  4CZL A;  3ZYY X;  4BE7 B;  5E84 A;  3L6Q A;  4XH1 A;  3CCL N;  3EE8 A;  4BY9 C;  2HBJ A;  1E9V A;  4EZO A;  3DXM B;  3R6M A;  3H3O B;  4FWR A;  1N8R O;  2HBK A;  3RV0 A;  3VF6 A;  2D1K A;  4JNE A;  2IVP A;  3AAP A;  4JKE A;  4BRD A;  2YI9 A;  4JK8 A;  3ID6 A;  1VQK N;  5EXW A;  1VQ6 N;  1K8K B;  2HOE A;  4BR2 A;  3KHY A;  2UYT A;  3CJ9 A;  4E1J A;  3WQT A;  5F2R A;  2E1Y A;  4B9Q A;  4BVP A;  2YI8 A;  1NM1 A;  3R9P A;  3KZB A;  2VGM A;  4Z94 A;  5KPZ A;  2GWJ A;  3KK7 A;  5GIP A;  1XC3 A;  5AQH A;  1Z6R A;  4KIK A;  1H1V A;  2FLO A;  2P9U B;  3C0B A;  3MN9 A;  1GLL O;  1G99 A;  3ZX0 A;  2Q0R A;  2GX9 A;  4PKH A;  5KQD A;  4L3Q A;  3NMU A;  4YDU C;  1VQL N;  4WQ5 A;  3WXK A;  1NGC A;  3C7N B;  1TYQ B;  3QFP A;  4M63 C;  5JLF A;  2JWL A;  3OHR A;  4MLH A;  5FPM A;  3ATU A;  1NMD A;  4BR7 A;  4O5F A;  3VF4 A;  5F0X A;  1MJG A;  5TKY A;  1CZA N;  3GG4 A;  2C1I A;  3MCA B;  3WXM B;  3P31 A;  1NGE A;  3ZED A;  4IOA L;  1VQ9 N;  3CIP A;  4Y0W A;  1JCE A;  1C0F A;  4JD2 B;  4AF1 A;  1OA0 A;  1BO5 O;  1KC8 O;  2IVO A;  1RGI A;  1VQN N;  3EKS A;  3ZEU B;  1SUF A;  5FPD A;  2C1G A;  5AZI B;  1QQO A;  2CGL A;  3W0L A;  4WV5 A;  5BR9 A;  5GAG P;  3WXJ A;  4YOU A;  4A62 A;  1BU6 O;  2Z8Y A;  2ZJQ L;  2ZWH A;  1TUU A;  5JVG L;  4BG9 A;  2YIV X;  5AQX A;  5AQZ A;  4PL7 A;  2RE2 A;  4IOX A;  3O5B A;  3T4A G;  4KH5 A;  4QS7 A;  5GAH P;  2NCZ A;  3O9Q A;  1GN9 A;  2P9K A;  3IUC A;  1YHQ N;  2CH5 A;  1UPX A;  2AA4 A;  2QWM A;  1CKR A;  3MCP A;  5CE3 A;  2WFB A;  4PL8 A;  3A8Y A;  3VEX A;  1SU6 A;  1DKG D;  4ILI A;  3BF3 A;  5KPT A;  1K9M O;  3QBW A;  2E1Z A;  4BC5 A;  4BC3 A;  4CZH A;  5BPM A;  1WOQ A;  3GOI A;  3B51 X;  4HY9 A;  4ILJ A;  3ULE A;  3VPZ A;  4GNI A;  4M7X A;  1BUP A;  1SS6 A;  5HL7 L;  5M1K A;  3U9Z A;  2HST A;  1Q81 O;  3N8E A;  5C12 A;  1DKX A;  3L4Q A;  5M1O A;  3ENH A;  4JK7 A;  2NRZ A;  1DT9 A;  1VAZ A;  3SMP A;  3UKR A;  4CD1 A;  2PAV A;  1YJ9 N;  3JS6 A;  4KIK B;  4IEI A;  2N3K A;  5JIC A;  2YHX A;  4O8U A;  1KQS M;  1GLA G;  3T7Z A;  3TTD A;  4IW0 A;  1Q7Y O;  3WUH A;  1BOT O;  2LM0 A;  1MWK A;  3N4P A;  1GLB G;  4EZS A;  3MDQ A;  4FWO A;  5AQQ A;  3WXL A;  1GNL A;  2HMP A;  1SU7 A;  5AQR A;  1ATN A;  1SQK A;  3RSE B;  5BPN A;  5C10 A;  5AQP A;  4DB3 A;  2CH6 A;  2YHY A;  2ZGY A;  4NPH A;  1T6D A;  4B1Z A;  3RVC A;  2BTF A;  2DPN A;  3CJC A;  3MK6 A;  2HBL A;  2ND1 A;  4YOW A;  3FR0 A;  4G9Z A;  3HRG A;  4IM2 A;  3TSQ A;  2YIA A;  4R5I A;  4BEC A;  1ATR A;  3O1W A;  4FWQ A;  4YOT A;  3MWT A;  3QA8 A;  3D7E O;  3TSP A;  4DKW A;  2QFF A;  3CD6 N;  4MO5 A;  5LJW A;  2NRV A;  3Q7C A;  4RTF D;  2OTL N;  4PO2 A;  3QIC A;  2GUP A;  2EX3 B;  2QWO A;  3SBT A;  1JJ2 M;  2NRH A;  2Q31 A;  1Q86 O;  3O9U A;  2NZT A;  5AQG A;  3D2F A;  3DOB A;  3U9D A;  4BQL A;  4G6Q A;  3CCM N;  1W2B M;  4J8F A;  3HM8 A;  3CCV N;  3UKU A;  3FZL A;  4AM7 A;  3B8A X;  4MDB A;  4M7Y A;  3IMX A;  3DAW A;  2E8A A;  2P9K B;  4CZM A;  3VKH A;  2JNS A;  5H1S Q;  4JKB A;  1GNT A;  1JCG A;  1GLF O;  5EY4 A;  4A2B A;  4M0M A;  5ELZ A;  5LY3 A;  2OAN A;  3T49 A;  4BRL A;  1MA9 B;  1QZ5 A;  2Q36 A;  4XH5 A;  1QZ6 A;  4BGB A;  3O3N B;  4R79 A;  4HTL A;  4C1N I;  4IZ9 A;  3FGU A;  5EVZ A;  2X5C A;  3CCE N;  4ILG A;  2HF4 A;  3LMF A;  5BRD A;  4F9O A;  2GWK A;  3M3Z A;  4KBO A;  4PKG A;  3GBT A;  5M1Q A;  4IWO A;  5EOY A;  3FFK B;  1S72 N;  3LDL A;  5DM6 L;  3DPP A;  4BR5 A;  3H1V X;  2AP1 A;  3UE5 A;  3VEN A;  1RDU A;  5BRH A;  1KAY A;  4A5B A;  3CET A;  4JKA A;  4CZI A;  1U2V B;  3UKR B;  1U00 A;  3LL3 A;  3DLL L;  4IM0 A;  1YIT N;  1ESV A;  1V4T A;  3OA9 A;  3R1X A;  4WQ4 C;  3HTV A;  3DJC A;  3VEO A;  2ZF5 O;  3H46 O;  2WUS A;  3IDH A;  2FSJ A;  3DPQ A;  5AQK A;  3VOV A;  2IVN A;  4EZR A;  5JMV A;  2E2N A;  4K25 A;  4NLC A;  5AQO A;  4C1N K;  1JCF A;  4BRA A;  3HSC A;  4WF9 L;  2P9I A;  3VEY A;  3SK3 A;  2KLA A;  1S3X A;  4IJA A;  4BRN A;  1SU8 A;  4XJX A;  4IWV A;  3C6A A;  3GL1 A;  3FZH A;  4H0O A;  1QVG M;  1ZBS A;  4GV9 A;  4FWS A;  3CCU N;  4CZG A;  4BRH A;  1ILY A;  2FF3 B;  3K9J A;  2ASM A;  3KAV A;  4BR9 A;  4FPA A;  2P9P A;  1YJW N;  5BRE A;  1OVY A;  3J8A A;  3L3O M;  4ISE A;  3I55 N;  4CZF A;  5FLE X;  3FZK A;  4BRQ A;  2CGK A;  3LM9 A;  4JWI A;  4I43 A;  4JWC A;  1HKC A;  1O13 A;  4IDH A;  3FD9 A;  4H0T B;  4A61 A;  3SBT B;  1DEJ A;  1YVN A;  1YJN N;  1NBW A;  1NJI O;  2ASP A;  1YXQ A;  3LDO A;  3D2F B;  2D0P A;  2KHO A;  2P9L B;  3QB0 A;  2OTJ N;  4BRM A;  4R5J A;  3ER8 C;  1HLU A;  3SAF A;  1T3V A;  4D8J A;  2A41 A;  3UKU B;  1E2U A;  1SZ2 A;  3VES A;  3MN5 A;  4QS8 A;  5AQM A;  4BRI A;  4CZJ A;  1NGJ A;  4JK9 A;  3WEE B;  4FWK A;  1X3M A;  2F9T A;  4BRP A;  4CBU A;  3CC2 N;  3U4L A;  2A40 A;  3FE1 A;  3B52 X;  1BWF O;  4IJN A;  1LCU A;  3O9R A;  5FPN A;  4JWD A;  2ZGZ A;  3E1Y A;  5C2D A;  3UB5 A;  1GLE G;  3E9L A;  4JEP A;  1GLJ O;  4EHU A;  3CPE A;  2QI2 A;  4GVE A;  2FSK A;  4EFH A;  4IM3 A;  4R5L A;  4JKG A;  1EO1 A;  4A2A A;  4K43 A;  2F9W A;  3QFU A;  5AFU A;  5KPR A;  2J4R A;  5TKW A;  2ASO A;  3O3M B;  2V51 B;  5CR4 A;  3LDQ A;  3Q7B A;  4IWQ A;  5AZJ A;  4H6I A;  4EZW A;  3MMV A;  5AQV A;  5AFU H;  4CZE A;  4UDY X;  3OHX M;  4WCE L;  1KAX A;  4FWL A;  4JHD A;  4U67 L;  3BUZ B;  5I9E B;  4WQ4 A;  3J7Z O;  3GI7 A;  4A5A A;  1VQP N;  4IWP A;  4EZU A;  3DXK A;  4BEB A;  3QML A;  2WBN A;  4C23 A;  4EZQ A;  3VEA A;  4CI6 A;  4WFA L;  5B8H A;  1EQY A;  3CXC M;  2QA4 N;  3CC4 N;  2P9S A;  4BQZ A;  3VTH A;  3AGK A;  5AQL A;  5AQY A;  4JLC A;  2D4W A;  2YIB A;  3I04 A;  3EE9 A;  4OPH A;  4YDU A;  3QBX A;  1VQ5 N;  3M5R A;  1BA0 A;  3KDR A;  7HSC A;  3ZEF A;  1OKJ A;  3AY9 A;  3FLC O;  4DQ8 A;  3TTF A;  2I7P A;  1KD1 O;  3D2E A;  3T47 A;  3TPQ A;  4HR1 A;  2EWS A;  1NGA A;  3A98 A;  5KQ8 A;  3HBT A;  5FIG A;  1IG8 A;  4LC9 B;  2RHK A;  2I7N A;  1NGF A;  5M1N A;  2QWL A;  5AQJ A;  2P9P B;  3IFR A;  4RCH A;  3TU5 A;  5GAD P;  1WUA A;  4EZZ A;  4FVU A;  1RFQ A;  3O6W A;  1T44 A;  2NRR A;  3T46 A;  4AM6 A;  3G4S N;  4K41 A;  2D0O A;  1YAG A;  4K42 A;  2GAF D;  3A0I X;  3H6E A;  3CMA N;  1K8K A;  4H0V B;  2VWB A;  3NVK A;  4E81 A;  3A5L C;  3ZET A;  3H3N O;  4IOC L;  3LDN A;  3R3L A;  3WQU A;  2EWF A;  4YOY A;  4BRK A;  2GA9 D;  2NNW A;  2VCP A;  2NLX A;  3ENO A;  2WC9 A;  3H45 C;  3KWI A;  4I6M A;  1DKY A;  3I39 X;  4EIA A;  2YJE A;  4F00 A;  3P38 A;  4BR4 A;  1P8Z A;  4H5N A;  4GV6 A;  5C0Y A;  1NGI A;  4IXC A;  3MN7 A;  5DM7 L;  3F7W A;  3DQG A;  4WV7 A;  3KVG A;  4H5R A;  4H5W A;  3AGR A;  3CJ7 A;  4ISG A;  3CI5 A;  3VGM A;  2FXU A;  2V7Z A;  3E9O A;  3SLC A;  4MQD A;  4WYB A;  5JVH L;  1S22 A;  4JKG B;  4PHT X;  3DPO A;  3H0X A;  1Z05 A;  3PLA A;  2VYP A;  3C6H A;  3QNJ A;  4A59 A;  5AQI A;  2QWP A;  3M6G A;  4MO4 A;  3VGK A;  4FM3 A;  3VEB A;  1YUW A;  3MWP A;  5AZJ B;  5FPE A;  5GIO A;  2F7T A;  4CBX A;  4JD2 A;  4BC2 A;  4JHD B;  1ATS A;  3D6R A;  4IFE A;  3ER9 B;  3ULE B;  2OP6 A;  4DHY A;  1RDW X;  1NGH A;  2QW9 A;  1GLC G;  1ZC6 A;  3DXK B;  1Q18 A;  3T69 A;  3ZEU A;  5LJV A;  1NGD A;  3SAG A;  5AZI A;  3F9M A;  3UIT A;  3GDQ A;  2P9S B;  3GE1 A;  2NRT A;  3KAW A;  3VMF B;  3O08 A;  4U7B A;  3ATV A;  3CHW A;  4JWE A;  3F5T A;  3BF1 A;  3VER A;  3CQY A;  2Q1N A;  1M90 O;  1KAZ A;  2NRX A;  3EO3 A;  4R5K A;  4CD3 A;  1HPM A;  3ZET B;  3CCJ N;  2W41 A;  4R5G A;  3I8B A;  2HBM A;  4CZK A;  4H5T A;  3CER A;  3O8M A;  2Q97 A;  3SBS A;  1E1D A;  4JKH A;  3OWG A;  3A5M C;  4H03 B;  4NLB A;  4BGA A;  3PIO L;  2E88 A;  3BEX A;  1R59 O;  4BR0 A;  5MLC Q;  2PY6 A;  3O3O B;  4EZY A;  4OPA A;  3HOT A;  1QVF M;  2Q0U A;  4MLE A;  1QQN A;  3CJB A;  1YF5 L;  4B1Y B;  5ADX A;  2ITM A;  4BC4 A;  2E20 A;  4IEE A;  3ZX3 A;  3AAQ A;  4BRG A;  1ZYL A;  4HYB A;  4QS9 A;  5F1X A;  4BRO A;  3P39 A;  1K73 O;  5ADX H;  4OO1 J;  4E3C A;  4I6M B;  4ILH A;  4B1U B;  3DWL A;  3HOS A;  2QXL A;  2RT6 A;  4NO7 A;  4FWM A;  4EHT A;  1HUX A;  4RWT A;  2PBD A;  1LOT B;  4XEI A;  3NVM A;  3ZX2 A;  4H0Y B;  2V52 B;  3LDP A;  2YCH A;  4PKI A;  4JL9 A;  1YIJ N;  1QHA A;  3VEZ A;  4BG8 A;  2GEL A;  1NGB A;  2YHW A;  3HI0 A;  1NGG A;  4FO0 A;  4CBW A;  3I56 N;  1P90 A;  4JKD A;  2W40 A;  2H3G X;  4EZN A;  3RSE A;  3FZM A;  3K9K A;  2QEX N;  5M1F A;  3JXU A;  1MWM A;  2E2Q A;  4H6H A;  1IJJ A;  3EZW A;  3VET A;  1GLD G;  1D4X A;  1E4F T;  2PFU A;  3T48 A;  2YJF A;  3EKU A;  3MX5 A;  3OBY A;  4HWI A;  5EX5 A;  4EAH D;  2A42 A;  2CGJ A;  2P9N A;  1XUP O;  2WIN M;  4ILG B;  4B1V A;  2QTD A;  1NLV A;  4BRE A;  5CHI A;  1DKZ A;  1VQ4 N;  1DGK N;  2YX6 A;  1VQO N;  2W00 A;  3QDK A;  1HKG A;  4EZP A;  4IO8 A;  5JLH A;  5GIN A;  3CCR N;  3CCS N;  2ZJR L;  1Q82 O;  1HJO A;  1BPR A;  3FZF A;  3H1Q A;  3SBG A;  5AQN A;  3VEW A;  4A57 A;  4BRC A;  2VGN A;  3W3D A;  1BDG A;  4CJ7 A;  4EZV A;  3CJA A;  2Q2R A;  5HOO A;  3CME N;  2A3Z A;  3WXI A;  3F2K A;  3R8E A;  3E66 A;  3BP8 A;  3CJ1 A;  4WFN L;  3O9S A;  3SMS A;  5AQU A;  2NRW A;  3E9P A;  2QWN A;  1M1K O;  2P9I B;  3VTI A;  3CCQ N;  3G6E N;  3I01 A;  1BA1 A;  2YI1 A;  3A5N C;  4WFB L;  4DCH A;  3TSU A;  4EZX A;  4GY2 B;  2QWQ A;  4B1X B;  3O9T A;  4O8K A;  3C65 A;  2BUP A;  5C15 A;  1VQ7 N;  4FOE A;  2E2O A;  4KH4 A;  1T6C A;  3DXM A;  2OBM A;  2V7Y A;  1BG3 A;  3I33 A;  3VF2 A;  5GAE P;  1VQM N;  4B1W B;  4ILH B;  3CQX A;  3EN9 A;  3KWG A;  3HZ6 A;  4ISF A;  1HX1 A;  4JNF A;  1U2V A;  1V4S A;  3AAR A;  1NWK A;  1X3N A;  3ENB A;  3O80 A;  1W97 L;  5M1P A;  2A6A A;  2QM1 A;  4NB4 A;  2GTD A;  3O4W A;  4FWP A;  1OAO A;  1YI2 N;  3O1B A;  4BVO A;  1X9J A;  1DG4 A;  1MDU B;  3N4Q A;  3CPW M;  5E26 A;  3B53 X;  4KH6 A;  2P9U A;  2ND0 A;  1C0G A;  3VGL A;  2HF3 A;  4UY8 O;  3ERC C;  3M1F A;  3MX2 A;  2IIR A;  4JKF A;  5C2F A;  3G71 N;  3IKM A;  2GEM A;  2QWR A;  5BRF A;  3EL2 A;  1Q5L A;  2FF6 A;  1TYQ A;  3C7N A;  4F01 A;  1Y64 A;  3ID8 A;  4MDA A;  4WQ5 C;  1K8A O;  2A5X A;  1OA1 A;  2P9N B;  1VQ8 N;  4FWN A;  3A5O C;  4H0P A;  3MN6 A;  2OBL A;  3OW2 M;  1W9M A;  5AQW A;  5BN9 A;  3G25 A;  3P4I A;  3L4I A;  1ZXO A;  1SAZ A;  1XQS C;  2FSN A;  5AQS A;  3OBW A;  4JKC A;  1HKB A;  4FOI A;  1U6Z A;  4FPB A;  1QQM A;  3WT0 A;  3VEV A;  4YOV A;  3SAH A;  3CF5 L;  2KKZ A;  2P9L A;  3S41 A;  1KXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...