4JN4A

Allosteric opening of the polypeptide-binding site when an hsp70 binds atp
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
600
structure length
600
Chain Sequence
SGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords Chaperone protein DnaK
total genus 192
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00012 HSP70 Hsp70 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jn4A05
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jn4A04
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jn4A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jn4A01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jn4A03
1T6DA 2E2NA 3FZMA 3ULEA 2AA4A 1KXPA 4EFHA 4YDUA 4BRNA 4DB3A 2P9LB 4BRGA 4WQ5A 2W41A 1QHAA 2BUPA 1GLJO 3AARA 3WQUA 2IVOA 3GE1A 2H3GX 3L0QA 2D0PA 3VGLA 1BA1A 5EY4A 4H6HA 1TUYA 2Q0RA 3ZEUA 2OP6A 4IWVA 5JICA 5BRFA 4JN4A 2A41A 3GG4A 3DQGA 3FZFA 1WOQA 4Y0WA 4CD3A 3EO3A 3T4AG 3C7NA 2GWKA 3O80A 4H0VB 3ZX2A 3A5OC 5AQFA 2YCHA 4DHYA 2ZWHA 3L6QA 1C0GA 5EX5A 4CBXA 2E8AA 1HJOA 4J8FA 3U9DA 4FPAA 4WV5A 1QZ6A 1YXQA 4FWOA 1KAZA 4BC3A 2YHYA 1NGHA 3O4WA 3WUHA 1NGAA 4PKIA 4YDUC 2A6AA 2D4WA 1S22A 2ZGZA 3LL3A 1NGJA 1DKGD 2OANA 3JXUA 3TPQA 4H0XB 1G99A 5AQKA 3ENOA 4CJ7A 4PL8A 3H1QA 3H0XA 1V4TA 1GLBG 1X9JA 4B1XB 3BF3A 3AAQA 1T6CA 4JAXA 3DJCA 4CZEA 5BPNA 5AZJA 3QDKA 4BG8A 2I7NA 3WEEA 1K8KA 4JD2A 4BQLA 1MWKA 3L3OM 5AQGA 5AQMA 3ULEB 4R5IA 1NM1A 3DXMB 2Q0UA 3FZLA 3QBWA 1Q5LA 2VCPA 2FSKA 3LDLA 3N8EA 1SQKA 3WEEB 2HF3A 3IFRA 4BRDA 3VESA 1YAGA 4B1WB 4CZGA 5KPTA 4EZUA 2FF3B 2P9UA 3H46O 3I8BA 4HWIA 4EIAA 2QW9A 1C0FA 3CQYA 3SK3A 4BG9A 4FWKA 4CZKA 5LY3A 3VEZA 2E2OA 2ZF5O 4C23A 2YHWA 1BPRA 1CZAN 2E1ZA 3GOIA 4H5TA 5ADXH 2P9IA 3CIPA 1YVNA 3HBTA 5E84A 3ATVA 4EAHD 2E20A 3UKRB 5AQPA 5FPMA 3HTVA 3R6MA 2P9LA 3CJ1A 3H1VX 3W3DA 4EZRA 4E1JA 3QICA 3O1WA 2ITMA 1X3NA 2ZGYA 4BRAA 2P9KA 2GUPA 4R5LA 3VGKA 3A5MC 1HLUA 1QZ5A 3IMXA 2J4RA 2YJFA 3O1BA 5B8HA 1GLLO 5AZIA 4M7XA 3MCPA 4H0YB 3SMPA 1RFQA 3F9MA 3DAWA 4K42A 4BGAA 3DXMA 1T44A 3CQXA 3VF6A 4MLHA 3GDQA 5EVZA 5BPLA 3FLCO 3T46A 3A5NC 1BUPA 3ID8A 4JD2B 3WXJA 2KHOA 4FO0A 5BN8A 2YJEA 1RGIA 3O8MA 3EKSA 1HPMA 3H3NO 1Z05A 1YUWA 3WXLA 3CJCA 3ATUA 3FE1A 2A5XA 1DGKN 3CJ7A 3AY9A 3H6EA 4BROA 3O6WA 2E2PA 3P4IA 5JLHA 4WQ4A 1DG4A 1WUAA 4NB4A 1NGFA 4CZIA 4WV7A 4K41A 5TKYA 2I7PA 1HKBA 4H0TB 4IJNA 5EXWA 1Q18A 4IO8A 1HKGA 4JWDA 4EZNA 1XQSC 2V7ZA 4I6MA 3SMSA 5JLFA 4FL9A 3HM8A 2QWQA 2CGLA 5AQYA 4EZSA 2DPNA 1U2VB 4A61A 2QWMA 3FGUA 2F9TA 1HX1A 4JHDB 5FPDA 2IIRA 3DWLA 1TYQA 3KZBA 4QS9A 3MDQA 3VEXA 3A8YA 1GLEG 4CI6A 4BR5A 1HUXA 2IVNA 2A40A 2WINM 1GLDG 1GLAG 1BDGA 1NGBA 4BVPA 4EZTA 4M7YA 3QNJA 1DKXA 2P9UB 3A0IX 4WYBA 3BEXA 1QQNA 5LJVA 4FOEA 3VEOA 4EZPA 1Y64A 5BN9A 2P9SB 3HSCA 3VPZA 2WUSA 4E81A 4R5JA 3T49A 3OHRA 2GEMA 1ESVA 2P9KB 2UYTA 4KBOA 3U9ZA 4JWIA 2GWJA 3D2EA 3I33A 2W40A 3FZHA 5ELZA 3ZETA 1U2VA 4EHTA 1IJJA 3MN9A 4CZHA 3WQTA 1R59O 5ADXA 3D2FB 4BVOA 3VEYA 2NLXA 3UKUB 3GL1A 5AQZA 4DQ8A 4BR7A 3M6GA 4BRCA 5AQIA 3DOBA 4EZZA 3L4IA 4JNFA 4BRFA 4FWPA 5AQJA 4PL7A 4QS8A 4B1UB 3HI0A 4F9OA 3CJAA 4WQ5C 1NWKA 3R8EA 2E2QA 1BG3A 1Z6RA 2AP1A 2IVPA 3M3ZA 5F2RA 4CZMA 2ASPA 1GLCG 1HKCA 4EHUA 1NGEA 4I6MB 2QWRA 1OKJA 1NBWA 4FOIA 1U00A 3C7NB 4ISFA 5E26A 3CETA 4A62A 2NZTA 1BO5O 3FZKA 5FPNA 1X3MA 2P9SA 1NGIA 5AZJB 3VOVA 5AZIB 4K25A 3EKUA 4H5RA 2V51B 4PKGA 2FF6A 5BRDA 1ATSA 2P9NB 3EN9A 1KAYA 1LCUA 3UE5A 3WXKA 3LDOA 3S41A 5JMVA 2HOEA 1NMDA 3CHWA 3ZX3A 1QQMA 1D4XA 1J6ZA 2BTFA 4IJAA 2E88A 1BWFO 3MMVA 2CGJA 3T48A 4PKHA 1TYQB 3T47A 4EZYA 4XH5A 4ISGA 3O5BA 3ZETB 4BC4A 5BPMA 3LM9A 4R5KA 3JS6A 4BQZA 3SLCA 3J8AA 2VWBA 4QS7A 4HYBA 4BGBA 2P9PB 2V7YA 3QB0A 4RTFD 4A2BA 1MDUB 3VENA 1S3XA 2CGKA 4XH1A 4DCHA 4JWCA 2VYPA 3CJBA 1ATRA 4AM7A 4MO5A 4BRKA 4XH4A 1JCEA 3H3OB 2P9NA 3MN7A 2QWOA 3ENHA 3W0LA 1V4SA 1NGDA 3C0BA 2HF4A 3MN6A 3VETA 3KHYA 3O08A 4BR0A 3DPQA 4FWQA 3CI5A 3M1FA 4CZLA 3BF1A 1DKZA 2Q1NA 3U4LA 4CD1A 1MWMA 3R9PA 4B9QA 4A2AA 2E1YA 3EL2A 4IXCA 3D7EO 5KPRA 4BR2A 4FWMA 5AR0A 3CERA 4AM6A 1KAXA 4R5GA 4FWLA 3FR0A 4JWEA 4B1YB 5AQVA 4NO7A 2QM1A 1H1VA 1E4GT 2Q2RA 3VERA 4HTLA 4EZQA 1DKYA 3CJ9A 4HY9A 4B1ZA 1U6ZA 3EZWA 3ZX0A 4H6IA 1SZ2A 2HMPA 1E4FT 4IZ9A 2QWLA 5KPZA 4JNEA 4F01A 4L3QA 5EOYA 4JHDA 5AFUA 4EZWA 3A5LC 4PO2A 1MA9B 4BC2A 3MN5A 1BA0A 2D0OA 3DXKB 2EWSA 4H5NA 3LDNA 1EQYA 5F0XA 5F1XA 1CKRA 3DXKA 3D2EB 2QWNA 3VF2A 3WT0A 2QXLA 2Q97A 4O8KA 4MLEA 1TUUA 3QFPA 3HZ6A 3RSEA 1DEJA 5FPEA 4MO4A 5AQUA 3OHXM 4BRIA 3VGMA 1ZXOA 3GBTA 3SJHA 3D2FA 1GLFO 4ISEA 4FWNA 3B8AX 4BRQA 3UB5A 5AFUH 5I9EB 4RWTA 4Z94A 3LM2A 2P9PA 2Q36A 5AQLA 3WXIA 4H5VA 4FPBA 3BP8A 3TU5A 4H0PA 2QWPA 5AQNA 4CZFA 4K43A 2A3ZA 4WQ4C 2P9IB 3G25A 3BUZB 1RDWX 4EZVA 4BRHA 4CBWA 3QMLA 1BOTO 2YHXA 1K8KB 2FLOA 2YI1A 1JCFA 4BR4A 4CZJA 2ASMA 2PAVA 2CH5A 3AAPA 1NGGA 3DPOA 4BRMA 3ZEUB 4BREA 4RCHA 2FSJA 4H5WA 1NLVA 1ZC6A 2GELA 2D1KA 2ASOA 3RSEB 4FWRA 4M63C 5BREA 5LJWA 1ZBSA 5AQXA 2V52B 5KQDA 3MK6A 4CBUA 2F9WA 2NRHA 3UKUA 2QFFA 3H45C 5KQ8A 5BR9A 1JCGA 4XEIA 5AQRA 4BRPA 4BC5A 5AQWA 3DPPA 3UKRA 5CE3A 1P8ZA 5AQQA 3VF4A 4BR9A 4GY2B 1BU6O 3QBXA 4B1VA 2FSNA 5AQOA 4FSVA 3VEWA 5BRHA 5AQSA 4H03B 4F00A 1LOTB 2FXUA 2CH6A 1NGCA 4EZXA 4LC9B 5AQHA 5AQTA 1ATNA 3LDQA 1SAZA 3QFUA 3IDHA 2BPRA 3IUCA 1IG8A 3U8XA 3FFKB 4EZOA 7HSCA 4H0OA 3VEVA 4FWSA 4BRLA 2A42A 2GTDA 2Q31A 3LDPA 1QQOA 1XC3A 1XUPO 2PBDA 4O5FA 3KVGA 4GNIA
chains in the Genus database with same CATH superfamily
4IM0A 1T6DA 4CHZA 4DSJA 1HQEA 3FZMA 1KXPA 4PWDA 4W5RA 4CEZA 2X6NA 4C1NI 4BRGA 4WQ5A 4B8AB 4LF8K 3DX1A 1QHAA 2GF4A 3NVKA 4DU4A 4KIKB 2VG5A 2O8FB 3AO2A 2IVOA 3GE1A 1ZYQA 3L2VA 2MI7A 4H6HA 2OP6A 3CXCM 4AF1A 2A41A 4IM3A 1KLMA 3B52X 1WOQA 2IDOA 3SOGA 4JI3K 2BE2A 3ER9B 1W9MA 1XMQK 3O3OB 3C7NA 2GWKA 3A5OC 5AQFA 2YCHA 3CM5A 3U3GA 1X9WA 4X64K 2F8TA 1JLFA 1O7DB 3THWA 4CBXA 2E8AA 5FRNA 5BR8K 4FLZA 3BZCA 1YXQA 1TQWA 4FWOA 4Z4CA 1KD1O 2C08A 3CMEN 1XNQK 3P1GA 4EP5A 4H8KA 3VQAA 5FLXO 4DLEA 3TAQA 2W42A 1NGHA 3G9GA 4KO0A 4PKIA 1HTYA 1M1KO 2D4WA 3ASMA 4RW4A 2NRRA 2OANA 3JXUA 5AQKA 1G99A 4FJHA 4BE2A 4CJ7A 4CIFA 4I9LA 1V4TA 4B08A 3MCAB 3OYNA 3EJPA 2ZD1A 3BUIA 5BPNA 3DJCA 3QDKA 1SL0A 1JL2A 3F7WA 1Y97A 4DSEA 3NF8A 4CEOA 1C1AA 1RDDA 3SPYA 4IG3A 3NBPA 3T19A 4LFCK 3FZLA 2Q0UA 1JXEA 3LDLA 2VCPA 3CCRN 3WEEB 4BRDA 2FC0A 1YJWN 5KPTA 4GMJB 2FF3B 4HUFA 4HWIA 2BDPA 4E7IA 1C0FA 2OZSA 2R7YA 4BG9A 4DV1K 3CF5L 5LY3A 5KGWA 3CC2N 3CPWM 1BPRA 5CR4A 1L3SA 1LWCA 5C5BA 1NOZA 2P9IA 2NRWA 3J7YP 4E7JA 4LSLA 1TAQA 1DT9A 3FFIA 1HNXK 2O8DB 3AVLA 3W3DA 2NRVA 2XY6A 3BUQA 1A5WA 4BRAA 2GA9D 3EYZA 3CM6A 3HT3A 1OH6A 3P5JA 5HRPA 3C6UA 4DTNA 3SAHA 2J4RA 4JI2K 5DK5A 2YL6A 4AZBA 1YHQN 4UQGA 1QVFM 4YOXA 3QWEA 3L3UA 1NMNA 3VEBA 4OLAA 3GDQA 3NCIA 3G71N 2OPPA 4ZTFA 3ID8A 2LXYA 4JD2B 5LL6Z 4FO0A 3F73A 1RGIA 3H3NO 1RBSA 3ATUA 3I04A 5CYQA 1DGKN 1GOBA 1R33A 3HP6A 4CJUA 4XJXA 5J2MA 4KHNA 4E3CA 4WV7A 4K41A 1J5EK 3QEWA 2I7PA 5EXWA 2RAJA 1Q18A 3SQ1A 2ZJRL 2YNFA 4EZNA 4DFJA 2IOCA 3KLEA 3ZLJA 2PMRA 4CJEA 5AQYA 1DLOA 1ZBIA 2OPRA 2WYHA 2ZJQL 4I43A 2QWMA 3RRHA 3V4IA 1NK5A 3V9WA 2F9TA 4MFBA 3V1RA 3BVVA 1TYQA 4C8MA 3CCUN 1XMOK 1NK0A 1B92A 3K0SA 3NVMA 1NJXA 5JVGL 1GLEG 4BR5A 1RDBA 3AO5A 3AVFA 2A40A 1BL3A 1GLDG 2HB5A 4F8RA 3RV1A 3CCEN 1GLAG 1QS4A 3HAIA 1BDGA 3J7AP 4BVPA 3AVMA 1B9FA 4FXDA 3QNJA 3MEEA 3RMCA 1DKXA 3QEPA 4KHWA 3ACOA 2E6MA 2P9UB 3A0IX 4WYBA 4HUEA 5LJVA 1XHXA 3VEOA 4EZPA 1Y64A 2X3WA 1HRHA 1WB9A 4FCYA 2WUSA 4H8SA 4CJPA 2UYTA 1ESVA 4X66K 1CZ9A 1W9HA 3I33A 4YOVA 5ELZA 4NCBA 2B5JA 4EHTA 4ILGA 3ZSQA 2YL9A 3KD1E 1R59O 1GOAA 5ADXA 3VN5A 3D2FB 3PUFA 4CJ5A 3JYTA 4KH5A 4OKEA 3UKUB 1S6PA 2UUCK 3KWIA 5AQIA 2D1LA 3L4IA 4NCAA 4FWPA 5AQJA 1YWMA 3E9OA 5C25A 3SNNA 4WCEL 2YKTA 4WQ5C 4JI4K 1GNTA 3RRGA 2IVPA 4Z4EA 3E9PA 4EZ6A 3PO5A 1HKCA 1SKWA 4EHUA 3PIPL 2F7PA 3NGYA 2QWRA 1NBWA 2DFEA 4FOIA 4MDBA 4A62A 2NZTA 3AGKA 4WFNL 5CYMA 5FDLA 1X3MA 4NYFA 3LALA 4JKAA 3SQ0A 1CZBA 4JKFA 2O8CA 4H5RA 1ATSA 3EN9A 1LCUA 4FM0A 3OY9A 4C8KA 4CEAA 3S41A 4FJ8A 4OO1J 2X5CA 1NMDA 3ZX3A 2PFUA 3VQ4A 1J6ZA 4IJAA 3OVNA 2E88A 3JSMA 4PKHA 3T48A 3T47A 4EZYA 5GAEP 3O5BA 4JYAK 3PY8A 3OYGA 5TKWA 2NRTA 4CESA 4JS4A 3D51A 3QB0A 2V7YA 4K0KK 3VQBA 1VQMN 1JXBA 3RMBA 1RT3A 3BVWA 3I8DA 4BDPA 4BWJA 4F3OA 3NH0A 1ATRA 4CHNA 4MO5A 1RT1A 3EJRA 1NKCA 3W0LA 1RNHA 3NH1A 3A98A 3C0BA 1EWQA 1VHXA 3MN6A 4IM2A 3K2PA 2HSTA 4NQIA 3WNEA 2NCZA 2HNDA 1HR0K 3M1FA 3HXMA 4DYLA 4M3WA 5HLFA 4B9QA 4A2AA 2WONA 4IXCA 2HVIA 4KH4A 4FWMA 4AM6A 3CERA 1KAXA 5AQVA 3QNIA 1H1VA 1C6VA 1ZBLA 3VERA 1NJYA 5D3GA 1OA0A 4FJJA 1KFSA 1D5AA 4CVNE 4B1ZA 4IFVA 1E4FT 1TKTA 2F96A 1RT2A 4NSWA 3ZSYA 4KTWA 2NUBA 2HHUA 4OPJA 3TTDA 1BA0A 3DXKB 2PY5A 3T1HK 4WFAL 3LPUA 3DXKA 4CGDA 4FLXA 2KQ2A 4CK3A 4FJNA 3QEVA 1Q81O 3O9TA 1E9VA 4O8KA 3CMAN 1TUUA 1NK4A 4N47A 1T7PA 3J7ZO 3QFPA 3HZ6A 2YI9A 1X9SA 2VGMA 4MO4A 4E7LA 4LD0A 3V9UA 3VGMA 3GBTA 4H4MA 3D2FA 1BI4A 4ISEA 1K6YA 1JLCA 4JI0K 5HOOA 3CD6N 3LM2A 1N32K 1ILYA 4FZOA 2QWPA 4H0PA 4KRFA 3K59A 3EE9A 4ZHRA 4AHVA 3TSPA 4FJKA 4CBWA 3MX5A 4JRPA 2VGNA 3QMLA 2D0BA 3VQ5A 1IH7A 1K8KB 4BR4A 4CZJA 1B9DA 1SUFA 1X03A 3AAPA 2O0I1 3VQCA 3L2RA 4DQRA 3WNGA 2FSJA 4JK8A 1NLVA 2GELA 2ASOA 3LANA 3K9JA 5AQXA 4IFEA 3MK6A 4CBUA 1Z26A 3VQ7A 4CEEA 5GAHP 4PHTX 1S1TA 4CFCA 3G10A 4BRPA 4BC5A 5AQWA 4FJ5A 3SBTA 3N4QA 3PLAA 5AQQA 4BR9A 5JENA 1HPZA 4B1VA 2OO2A 4FSVA 5BRHA 1QE1A 4OKKA 4CEQA 5C5BB 4KHYA 2YIAA 2FXUA 3TAMA 1NGCA 2YKNA 4FLWA 3LDQA 4KH6A 3OYAA 3O3GA 2VG7A 1GN9A 1TKZA 5KGXA 7HSCA 3LP3A 3VEVA 4FVUA 3KLGA 1C1BA 4AZ5A 5C12A 2Q13A 1QQOA 2X3XA 2PBDA 3NFAA 1YI2N 4UDXX 2E2NA 5EU7A 2AA4A 4EFHA 4YDUA 3F9KA 4BRNA 5J2QA 4DB3A 2P9LB 2W41A 4OGEA 3WQUA 1F21A 1K8AO 3NGIA 4AHSA 3O9SA 2H3GX 3M8RA 3DLHA 1BA1A 1L3UA 4FK0A 1KCFA 3I56N 3MX2A 3GG4A 3FZFA 4Y0WA 4IWOA 2RHKA 2RAKA 3L2UA 1VSMA 1QQCA 4FJXA 1C0GA 5JS2A 3T1YK 4DTMA 1HQUA 4OVLA 4NYNA 4GKJK 4WV5A 4DS4A 1KAZA 4AHUA 4KHQA 1JLBA 1SL2A 3CZSA 3HJFA 4RW9A 4YDUC 1BQNA 1RBUA 1NGJA 1K9MO 1DKGD 3TPQA 4U7BA 3M5RA 3KJVA 4EZ9A 2UXCK 1U45A 4PL8A 2ELBA 3H0XA 4B1XB 1KVCA 2O4GA 3MEDA 4CZEA 1E2UA 3M8QA 3WEEA 1TK8A 3SPZA 1MWKA 5AQGA 5AQMA 3OYJA 3AGRA 3PSIA 4QCLA 1W7AA 2OPSA 4DTUA 1QWNA 1REVA 3QBWA 1X1PA 4DF8A 1SQKA 2HF3A 5A2QO 1U47A 4B1WB 1YAGA 3D4ZA 2DY4A 3Q7BA 1SU6A 1IKWA 3I8BA 4DUZK 4KV8A 2ETJA 4FWKA 4E1NA 2VWKA 3VQQA 4PQUA 2E2OA 2O8BA 3ZSOA 3QNOA 2G8UA 1YVUA 3GOIA 5SZTA 3IG1A 2F1BA 4B9MA 3HPOA 5HROA 1NKBA 3CIPA 2RAIA 1YVNA 3HBTA 5E84A 3ATVA 5HP1A 2A1RA 1FK9A 1NJIO 3AVNA 4AKVA 4EAHD 2E20A 3UKRB 2KFNA 5FPMA 3HTVA 5M1NA 4E1JA 3OJUA 4ICLA 4CJFA 3O1WA 1X3NA 4JKDA 1ZYLA 2GUPA 4R5LA 3VQ8A 2DFFA 3CVRA 3A5MC 1NK7A 1EP4A 3EJSA 3O1BA 5B8HA 2GX9A 1GLLO 3DLLL 5AZIA 4H0YB 3SMPA 1CXUA 1RFQA 4Z4FA 4Y1CA 4K42A 4BGAA 2ATQA 3SZ2A 5J2PA 3TABA 3D45A 5EVZA 5BPLA 3FLCO 3O9UA 3T46A 2Y1IA 1BUPA 4BY9C 4CJ3A 2YJEA 4I2PA 4CFDA 4ATMA 3EEQA 3EKSA 3T1AA 1Z05A 1YUWA 1UWBA 3FE1A 2YIBA 3H6EA 4NLCA 4LY7A 4OJRA 1TQVA 2E2PA 3P4IA 4CGJA 3CZNA 2E6LA 1L5UA 1JKHA 1T03A 1WUAA 3CYGA 1MJGA 1RDUA 4ID5A 1VSDA 5TKYA 1VAZA 3NE6A 4ELTA 4LF4K 4HCCA 4IO8A 2V7ZA 5JLFA 3U6FA 4FL9A 2QWQA 2CGLA 5GINA 3L2QA 1J54A 3E1YA 4EZSA 4J2AA 1VQPN 1QHTA 2OZNB 2QI2A 3FGUA 1MU2A 4JHDB 3DWLA 2RT6A 3KZBA 3C65A 3DI6A 5M1OA 2F18A 3MDQA 3N4PA 3VEXA 3NF6A 3SQ2A 3F2KA 3CCVN 1YT3A 3LPTA 3F5TA 5M1QA 2ZXQA 3OBYA 3CCJN 2EX3B 4CECA 3KAVA 3SUQA 4FZXC 1RTDA 4IOXA 2P9SB 4R5JA 3T49A 3OHRA 4KBOA 3DX4A 1EX4A 4FLTA 3AVKA 1OVQA 2VG6A 4JWIA 4JRQA 3MXMA 1LWEA 2QK9A 3Q0KA 3MN9A 1I94K 1LQ7A 4FJ9A 1IBMK 4HR1A 3PLTA 4M0MA 1UOCA 3GI7A 3GL1A 5AQZA 4DQ8A 3M6GA 2BANA 4HCBA 4N56A 3THXA 3DOBA 3HYFA 4AZIA 4EZZA 4CJSA 4QS8A 1RBTA 3AA3A 3MXJA 1J5OA 4O8UA 4B9LA 3ZSZA 4J2DA 2QKKA 4CHYA 1IG9A 4CZMA 4FZSA 2ZJPL 1GLCG 3PIOL 1FKPA 4ZTJA 3U3YA 4F2SA 4FVMA 1OKJA 4DQIA 3OYDA 4AILC 2DFHA 3CETA 4IO9L 4N76A 4WPEA 1S72N 4E89A 2HBKA 1N6QA 3DMJA 3TI0A 2XHBA 2EHGA 5AZIB 4K25A 2V51B 4UDYX 3TAEA 1IKYA 2B6AA 1C0MA 2P9NB 3VQDA 4V19S 3UE5A 2YI8A 4AZCA 5JMVA 1NJWA 3HPGA 4LF7K 1D4XA 3S3OA 1EXQA 2OTLN 3PX4A 4YFUA 4CK2A 3ZT4A 2CGJA 1PS3A 4BC4A 3M8SA 1VQ6N 2GBZA 4XIUA 4K8ZA 3J8AA 3I0RA 2VWBA 2G8VA 4DCNC 1VQ8N 4BGBA 1UA0A 2JNSA 4A2BA 3KLHA 3VENA 4YOWA 1VQ5N 1HNZK 2W00A 2CGKA 4XH1A 1R34A 3WNHA 5C42A 4IEIA 4JKGA 1ZBUA 3TANA 2WYIA 3S9HA 5FRMA 4BE7B 3QNNA 3TARA 3S3MA 4AZCB 1JCEA 3H3OB 4AHCA 1U04A 3QIOA 2P9NA 2QWOA 3ENHA 4DUYK 2HF4A 1QVGM 3VETA 4BECA 3AO4A 1RBVA 2JWLA 1L3TA 1NNEA 3VMFB 3AA2A 4CZLA 1XNRK 2Q1NA 3U4LA 4CD1A 4KI4A 1MWMA 1YIJN 5J2NA 1CLQA 3EL2A 3BLBA 3L3VA 2YNIA 2EWFA 4R5GA 3FR0A 4B1YB 2QM1A 3D50A 2FBVA 3QESA 1WLJA 3AVHA 4HTLA 1DKYA 2FYVA 4W5OA 3EY1A 3EZWA 2YLLA 4H6IA 1T3VA 2OCEA 4LH4A 1HNWK 4HTUA 5KRSA 1Q9YA 2Z1IA 3VEAA 1S1VA 1S1WA 4L3QA 2G8WA 4DMNA 3HL8A 4EZWA 3A5LC 4BC2A 1MA9B 3OYCA 3MN5A 2D0OA 1KLNA 4JS5A 3KDRA 4W5QA 4HVJA 1BIZA 1RDCA 4CGGA 3M8PA 1LW0A 1J9AA 1CKRA 4CJLA 4DV2K 1HXKA 2X6SA 2Q97A 4CW7B 4DWIA 2V0OA 4GKKK 4BDYA 2Z0NA 3RSEA 4KAZA 3KLIA 4YORA 3OHXM 4CHOA 3BUPA 3SV4A 4G1QA 1OVYA 1ZXOA 4KHUA 1YJNN 1JLAA 3DM2A 5AFUH 2Z0VA 5I9EB 3QIPA 5AQLA 3WXIA 3DRRA 3THYA 5AQNA 4DU1A 1JLEA 3ZCMA 2A3ZA 5KI6A 1RT7A 2P9IB 3G25A 4EZVA 2JNKA 3ENBA 1SL1A 4N41A 2WFBA 1Q86O 3DRSA 4B9SA 2F8SA 1BIUA 4W5TA 1HYZA 3BUDA 4ILHA 3CQ8A 3VTIA 1ZC6A 2D1KA 4FWRA 4M63C 2OBMA 5LJWA 4KTZA 2XRIA 3TSQA 4JI8K 2RKIA 2F9WA 2C1GA 3H45C 1RCHA 5KQ8A 3THYB 3Q7CA 4B8CA 3LWMA 5CZ1A 3V6DA 3DPPA 1P90A 3O9QA 2KW4A 4B3SK 4M3UA 1BU6O 2BGGA 3QBXA 2KZMA 2P1JA 2FSNA 5AQOA 3DYTA 4DR1K 3I01A 2CH6A 1WBBA 2O4IA 1LWFA 5AQHA 1ATNA 3O3HA 3KTQA 3IUCA 4K8XA 4CIEA 4FLVA 1VQKN 3ABHA 2A42A 1TVRA 4MQDA 1VSHA 4DFKA 4CF2A 1XUPO 1TKDA 4F3TA 1OAOA 3B51X 3WT0A 3THWB 3B53X 1DTQA 2OW6A 4DV6K 3ULEA 4HUGA 1NKEA 3DX0A 2HBLA 3OA9A 2BUPA 3DOKA 5FROA 4CJ4A 1SKSA 2ALWA 1I49A 3L0QA 2D0PA 3VGLA 4CERA 5EY4A 4FM3A 1JJ2M 1TUYA 2Q0RA 3ZEUA 3ITHA 1TK0A 4IWVA 5JICA 5BRFA 3TR8A 4DR7K 3R3LA 5H1SQ 4FW1A 4GVMA 4CD3A 3EO3A 2O8BB 3G0ZA 4Q0BA 4H0VB 3ZX2A 4DHYA 4WF9L 1VSKA 4O0JA 3VA3A 2P51A 5EX5A 4DQQA 4YOTA 3ISNC 4FPAA 1IV0A 4GVEA 1I4TA 4KKOA 4BEBA 2G8HA 1O7DC 4DTSA 5M1KA 1M90O 3O4WA 1TQSA 3WUHA 1A5VA 2B4JA 2A6AA 5GIPA 1S22A 2A1SA 2YX6A 3LL3A 3LZIA 4KREA 4H0XB 1U4BA 3ENOA 3KK2A 5IT9O 4BDZA 2FICA 1QWUA 1Y2OA 1GLBG 2G8IA 3VQEA 2XO7A 1T6CA 4JAXA 4BG8A 1QSYA 4JD2A 3LMFA 4CGIA 3D0PA 4FJ7A 1S1UA 4HHTA 3ULEB 2PYJA 3OYIA 1NM1A 4JKCA 4G6QA 3SYVA 3T3FA 3N8EA 3IFRA 1WSFA 4H4OA 3H46O 5C0YA 2Q12A 2QW9A 3SK3A 2F7RA 3L4QA 4DQPA 4CZKA 2E4LA 3KD5E 1JLGA 3I0SA 3VEZA 3BVUA 2KFZA 3O9RA 2ZF5O 2YHWA 4JI6K 1CZAN 1TQUA 2E1ZA 3ULDA 4C8OA 1I4LA 3IRXA 1SUQA 4FJLA 5ADXH 2VQEK 1OH8A 1FJGK 3ALYA 3QE6A 3NF9A 2O8DA 1W97L 3SAFA 3J81O 1WBDA 1RT5A 2P9LA 4AZGA 4FZZA 4IWPA 4BNEA 3QICA 4C1NK 1BGXT 2ZGYA 2NNWA 3PV8A 3AO1A 4G9ZA 1HLUA 1XC9A 3AVAA 3HO1A 1QZ5A 4FLUA 3IMXA 2BH1A 3D52A 2HNZA 4GV3A 1I3AA 4CGHA 1WAFA 2JWKA 2UUAK 1RT6A 4M7XA 4FZPA 1HJRA 2G8KA 3F9MA 3DAWA 1X04A 3VF6A 3CQXA 1VSFA 3OYEA 4DTOA 4RG8A 4FW2A 3ZEFA 1EWRA 4OX9K 1N33K 1VSIA 4Z0UA 4W5NA 4AZHA 3WXJA 3SBTB 3CCLN 5BN8A 4I9QA 4F4KA 3C95A 1HPMA 3NAEA 3WXLA 1WSJA 2A5XA 3BDPA 4DR6K 3O6WA 1TV6A 2F7OA 4U67L 3SBSA 1NK6A 2P5GA 1DG4A 1R5EA 4NB4A 1NGFA 4YOUA 3RWUA 1X9MA 1WAJA 2D0AA 3BVXA 1HKBA 4H0TB 4IJNA 4M3RA 3PO4A 5JS1A 1HNIA 1LAVA 2XY5A 4J2BA 4JWDA 4I6MA 2HHIA 4B9UA 1SU8A 1UAXA 3AVCA 3B6PA 1WSEA 2DPNA 3OYBA 1I39A 4A61A 3OBWA 4LH5A 3TTFA 4FZYA 5FPDA 1OH5A 1TAUA 3ZSWA 2VWJA 3A8YA 4QAGA 3KK3A 1LW2A 2WINM 3J80O 1NGBA 2QA4N 1VQON 4EZTA 4M7YA 2QTDA 1LAWA 4CEBA 5BN9A 5KBPA 3SAGA 1KC8O 4E81A 2KZZA 2QXFA 3VTHA 2GEMA 3H08A 3HSTB 2W40A 3FZHA 3LP2A 4E72A 4BACA 4TSXA 1YTAA 2LSNA 2IC3A 4CZHA 1BCOA 3WQTA 2O8EB 2OYQA 4GV6A 3VEYA 4B3OA 4DR3K 2DTUA 1ASWA 3P31A 1LV5A 1SKRA 4ELUA 5SWMA 4F9OA 4DTRA 3CJAA 1NWKA 1VSEA 2E2QA 2I5JA 2YHAA 3ID6A 1Z6RA 5F2RA 4DR2K 3VA0A 2WC9A 1Z25A 1W0HA 4CJKA 4E7KA 4HR1B 3RR7A 2AJQA 2YKMA 2RF2A 1NGEA 4DTPA 4I6MB 5HRSA 4JI1K 4ISFA 3DX2A 3C7NB 3DOLA 5E26A 4A57A 2E5LK 1VSLA 1BO5O 5FPNA 2G8FA 4DU3A 2P9SA 3RV0A 1NGIA 5AZJB 3T69A 1TGOA 1W2BM 2FF6A 1KAYA 3G6EN 5DMRA 3WNFA 2HOEA 3CHWA 4I2QA 3ZT2A 3HP9A 1NK9A 5GADP 1HWWA 2BTFA 3MMVA 3ZETB 3CFRA 4R79A 4ISGA 1URUA 3DDGA 3LM9A 3JS6A 3OK8A 3SLCA 3SYZA 4DSLA 1GOCA 4JKHA 3O4NA 4DSIA 4FJGA 1MDUB 3K5LA 3UITA 2Y1JA 1S3XA 4ID1A 2LM0A 5AJ3K 4KTQA 2ZE2A 4KB1A 5KTQA 4DCHA 2VYPA 2XY7A 2PZSA 4AM7A 2YL5A 3THXB 1ASVA 1TK5A 1VRTA 4M41A 3MN7A 2Z1GA 4NPHA 3TAPA 2GV9A 5CZ2A 3OWGA 3KHYA 1QSLA 3S3NA 1N5YA 2O8EA 3O08A 3DPQA 3PSFA 4FWQA 3CI5A 4Q5VA 2UU9K 3BF1A 3UIQA 1DKZA 2PYLA 2GUIA 5JVHL 3MWPA 3R9PA 5KRTA 3D7EO 4BR2A 4MDAA 4FWLA 3VQ6A 3I39X 3DDFA 3HAHA 4JWEA 3TAFA 1E4GT 4Z4GA 1ZBFA 4LF5K 1EO1A 4EZQA 2D5RA 5CHIA 1N34K 4B3MK 4NXNK 2UXDK 3OYKA 2QWLA 4OKJA 3HM9A 3B6OA 4F01A 4O44A 4KPYA 4J2EA 3NF7A 1D9DA 4D8JA 5AFUA 4AZ6A 1U48A 4PO2A 4DG1A 4M3XA 3AVBA 1QX1A 3NMUA 2EFKA 3LDNA 4IBNA 1KTQA 4CHQA 1FXXA 1RILA 1EQYA 5HL7L 5F1XA 1N8RO 4YY3K 2QWNA 3VF2A 1D9FA 2QXLA 3CV5A 1ZWWA 1VSJA 4MLEA 4CJWA 4YOYA 4PY5A 1DEJA 5FPEA 2C1IA 5MLCQ 1S6QA 2KKZA 3DLKA 2HHWA 5C2FA 4O0IA 3SJHA 1GLFO 4IDHA 1N36K 3OYMA 4FJMA 2QKWA 3NGZA 3V9SA 4Z94A 1QSSA 2P9PA 2Q36A 3KKSA 4H5VA 4FPBA 1VK0A 1IKVA 3TU5A 4CZFA 3AO3A 4K43A 3ZYYX 5C10A 1RDWX 4DV7K 2YHXA 4JI5K 5LMUK 4OLBA 4DV3K 4FM1A 2ASMA 2PAVA 2CH5A 4BRMA 3ZEUB 4BREA 3CKDA 1XHZA 3CCQN 3RR8A 4OPHA 3AV9A 4H5WA 2D4CA 1RTJA 2KLAA 2OBLA 3V1OA 4ELVA 1IKXA 2D0CA 2ZM6K 3EJQA 2XY8A 5KQDA 3ZT0A 2OW7A 4I1QA 2NRHA 1C0UA 3NHGA 1D8YA 5BR9A 1JCGA 4NCGA 4XEIA 3O4QA 5AQRA 1TL3A 4CCHA 3RPMA 3ZT3A 1P8ZA 3KK7A 3VF4A 4RW8A 4PA1A 4WFBL 5FLEX 4H03B 4AZ7A 1VQ7N 4DSFA 4B9TA 1SU7A 5AQTA 3O3NB 2WTUA 3MWTA 4DFMA 3S5TA 1VQNN 3FFKB 4EZOA 4JK9A 3SUOA 4H0OA 4O5BA 1S9EA 3BUBA 1JLQA 2Q31A 4M3YA 3LDPA 1RDAA 1U49A 1IBLK 1QQNA 4O5FA 3LAKA 3KVGA 4IWQA 4GNIA 2Z0OA 4A5BA 3CYMA 4DS5A 3R1XA 3D6RA 1JQKA 4NLBA 4IOAL 3E66A 3I55N 1WDZA 1GLJO 1BQMA 3AVGA 4MQ3A 3AARA 4FK2A 3C94A 3EE8A 2OTJN 1NJZA 4DF4A 1XWLA 4BWMA 1YJ9N 3ZSXA 5J1EA 2F4VK 2HHSA 4JN4A 2O8CB 4RW7A 3DQGA 4C8LA 3QLHA 1WSIA 1YF5L 2YNHA 3T4AG 3O80A 2HHQA 3KKRA 1BCMA 1TL1A 3AA5X 2ZWHA 3L6QA 1T05A 3OYLA 1HJOA 3ERCC 4J8FA 4X65K 3U9DA 3ZSVA 4CF9A 1QZ6A 3OS2A 3PX6A 4BC3A 2YHYA 4C8NA 4FK4A 1NGAA 4A59A 2ZGZA 3BZKA 3V81A 3CCMN 4JLCA 3H1QA 4AHRA 3MECA 1X9JA 1EKEA 3BF3A 4DR4K 3EJTA 3AAQA 4IDKA 3P38A 3MEGA 5AZJA 2I7NA 1K8KA 3DLRA 3KWGA 5HRRA 3C6HA 4BQLA 4E7HA 4DSKA 3L3OM 3HRGA 3K5NA 4R5IA 4JK7A 3NDKA 3BY5A 1NU0A 1KSPA 3DLBA 3DXMB 4O4GA 1Q5LA 2FSKA 3E01A 2F7TA 3VESA 4CZGA 4EZUA 4KFBA 2P9UA 4EIAA 5I42A 1UPXA 4X62K 4CK1A 4R5PA 1S5JA 3CQYA 2QKBA 3BVTA 1BI4B 4CF1A 1YITN 4GW6A 4KHPK 5C2DA 4C23A 2NRXA 3MAQA 4LFAK 3KLFA 4H5TA 2HMIA 1Q82O 1Q7YO 4M3TA 5DM6L 4L8RB 2ND0A 4KIKA 2O8FA 3HVTA 1T8EA 5AQPA 3RVCA 3O3MB 5GAGP 3R6MA 3CJ1A 4IW0A 4DLGA 1GNLA 2W6KA 4EZRA 3H1VX 2YV0X 2ITMA 2P9KA 3AVJA 3VGKA 2F7QA 2YLAA 5E41A 3ZSRA 3HAJA 4ILHB 2RE2A 2GAFD 3QA8A 4IEEA 2YJFA 1NK8A 1Q9XA 3LLLA 3MCPA 3K5MA 3HPHA 3P39A 3DXMA 1T44A 1E1DA 2YNGA 4MLHA 1O13A 1YTUA 4CJTA 3AVIA 2IGIA 4JKEA 3A5NC 4M42A 3E9LA 2KHOA 3VKHA 3O8MA 3P83D 2PY6A 1HMVA 3CJCA 2IAJA 1IBKK 3CJ7A 4B3TK 3AY9A 2NRZA 4BROA 1O1WA 2RPIA 3CC4N 5JLHA 4N5SA 4WQ4A 3L2WA 4CJQA 4CZIA 2Z1HA 5DM7L 4LF9K 4JL9A 3OS0A 4BE0A 4DTXA 3CCSN 1UA1A 3SCXA 4QOZB 1HKGA 1XQSC 3SMSA 3HM8A 4OPAA 2ND1A 3LP0A 1U2VB 3QEIA 3SUNA 3RMAA 1HX1A 2HBJA 3AA4A 3DRPA 2IIRA 1RTIA 3CFOA 3VQ9A 4A5AA 1R0AA 4QS9A 1K73O 2ITGA 5C15A 4CI6A 1G15A 2HHVA 4CFAA 1HUXA 2IVNA 4ILJA 1BISA 4CF0A 2HNYA 4Y1DA 4CHPA 2YHBA 5CY4A 3D4YA 3BEXA 3Q84A 4FOEA 4FJIA 3THVA 3HSCA 3VPZA 3K9KA 1L3VA 1WNSA 2P9KB 3U9ZA 2GWJA 3D2EA 4E3SA 5M1PA 3ZETA 1U2VA 4OPKA 1RT4A 1NG9A 2HW3A 1E3MA 1IJJA 3EJUA 3MXIA 3K58A 2WOMA 3KK1A 4BVOA 2HVHA 2NLXA 2HHHK 2X74A 4WPCA 4BR7A 4JLHA 4BRCA 4JKBA 4PL7A 4JNFA 4BRFA 3LZJA 4B1UB 3HI0A 3CPEA 3KAWA 3HOSA 1SS6A 4CEDA 4JKGB 4CJVA 3R8EA 4IFYA 1BG3A 2AP1A 4FYDA 1BHLA 3M3ZA 1WN7A 2OA8A 4ILIA 2ASPA 4YHHK 1KFDA 3V9ZA 1WSHA 2N3KA 3OYHA 4KI6A 1OA1A 1U00A 5GIOA 3TTCA 3I2WA 3OJSA 3FZKA 1C1CA 2FBYA 1XI1A 2HBMA 2FBTA 3EZ5A 1KQSM 2X3VA 3FD9A 1RTHA 4JV5K 3VOVA 3EKUA 1A5XA 2HHTA 3ZEDA 1TKXA 1HYSA 4YNQA 3K5OA 3DLGA 4PKGA 5BRDA 3SJJA 4AH9A 3WXKA 3LDOA 3TSUA 1QQMA 4DKWA 3IAYA 3OS1A 3OW2M 3IS9A 1ASUA 1BWFO 4LFBK 1TYQB 4XH5A 5BPMA 4OGCA 3SQ4A 4R5KA 1C0TA 4BQZA 4QS7A 4HYBA 2P9PB 1SV5A 4RTFD 3CC7N 3VQPA 4IOCL 3SUPA 3G4SN 1WSGA 3L8BA 4F2RA 4WE1A 4CJRA 4DV0K 5IWAK 3CG7A 4JWCA 1VQLN 3CJBA 1EETA 4BRKA 4O55A 4XH4A 4B9NA 1QTMA 1S9GA 2HHXA 2RN2A 4DR5K 3HVRA 1V4SA 1NGDA 3HOTA 4BE1A 5FIGA 3PX0A 1VQ4N 4PUOA 3SV3A 4RW6A 4BR0A 4M45A 1FW6A 4AVMA 3QETA 2OPQA 2UXBK 1IO2A 2E1YA 4DFPA 3LP1A 4CF8A 3RMDA 5KPRA 3TWHA 4JI7K 2IS3A 5AR0A 4B3RK 2JLEA 4NO7A 2Q3SA 2Q2RA 4FM2A 4CEFA 2EX3A 3CJ9A 4Z4IA 3QEXA 4HY9A 1U6ZA 3ZX0A 1SZ2A 1HNVA 2HMPA 3SBGA 5M1FA 2F1AA 3V1QA 4IZ9A 3TAGA 1ITGA 3L3PA 5KPZA 4JNEA 4NXMK 4FLYA 3O3FA 4AHTA 3LDSA 5EOYA 1S1XA 4I7FA 4JHDA 2W6LA 2FBXA 3KIOA 3K57A 1KVAA 2EWSA 3OYFA 4H5NA 4GV9A 4E0DA 5F0XA 4M3ZA 5HBMA 4LF6K 4CIGA 3D2EB 1VQ9N 3T7ZA 3HK2A 3M3WA 2YIVX 3C6AA 3LAMA 2ZQBA 3C6TA 3QO9A 3SI6A 3BGRA 4B9VA 5AQUA 4CE9A 4E19A 2VQFK 4BRIA 4KB0A 4FWNA 3B8AX 2Z8YA 3UB5A 4BRQA 1Q8IA 4DQSA 1KRPA 3RTVA 4E1MA 3LVTA 4RWTA 1RBRA 2WBNA 3BP8A 3ER8C 3LWLA 1OH7A 1HYVA 4IKFA 4WQ4C 4LSNA 2YL8A 3BUZB 4CFBA 3OTOK 4BRHA 1BOTO 2FLOA 2YI1A 1JCFA 4DV4K 1ZBHA 1NGGA 3DPOA 2UUBK 3DYAA 3A2FA 5HRNA 4DTJA 4RCHA 2P5OA 1J53A 4DV5K 2QEXN 2EFLA 3RSEB 5BREA 4UY8O 1ZBSA 1JL1A 2V52B 3QERA 4EP4A 3UKUA 3DLEA 2QFFA 4Z4HA 3DX3A 4IG0A 5K14A 1CXQA 1TQTA 3UKRA 5CE3A 4ILGB 1KVBA 2KTQA 3CAZA 4GY2B 3NH2A 4KHSA 4JEPA 3VEWA 5AQSA 5T7BA 1I4DA 4F00A 1LOTB 5LMNK 2OZMA 4EZXA 3QINA 4LC9B 1SAZA 3QFUA 4AQYK 3IDHA 2BPRA 1NOYA 1IG8A 2X78A 3U8XA 3IKMA 1DTTA 3V9XA 4CGFA 3JAMO 3ZT1A 1VRUA 5C24A 3WXMB 4FWSA 4BRLA 2GTDA 3CFPA 2JGUA 1XC3A 1FKOA 2Z1JA 5I3UA
chains in the Genus database with same CATH topology
4IM0A 1T6DA 3B53X 1YI2N 4UDXX 2E2NA 3FZMA 3ULEA 2AA4A 1KXPA 4EFHA 2HBLA 4YDUA 3R1XA 3OA9A 3D6RA 1JQKA 4BRNA 4NLBA 2P9LB 4BRGA 4WQ5A 2W41A 4C1NI 4DB3A 4IOAL 1QHAA 2BUPA 3E66A 3I55N 1GLJO 4BY9C 3NVKA 4KIKB 3AARA 3WQUA 2IVOA 1K8AO 3EE8A 3GE1A 3O9SA 2H3GX 3L0QA 2D0PA 3VGLA 2OTJN 1BA1A 5EY4A 4FM3A 4H6HA 1JJ2M 1TUYA 1YJ9N 2Q0RA 3ZEUA 2OP6A 3CXCM 4IWVA 5JICA 4AF1A 5BRFA 3I56N 4JN4A 4IM3A 2A41A 3MX2A 3GG4A 3R3LA 3DQGA 5H1SQ 3FZFA 3B52X 1WOQA 4Y0WA 1YF5L 4IWOA 3EO3A 4CD3A 3ER9B 1W9MA 3O3OB 2RHKA 3T4AG 3C7NA 2GWKA 3O80A 4H0VB 3ZX2A 3A5OC 5AQFA 2YCHA 4DHYA 4WF9L 2ZWHA 3L6QA 1C0GA 5EX5A 4YOTA 4CBXA 2E8AA 1HJOA 3ERCC 4J8FA 3U9DA 4FPAA 4WV5A 1QZ6A 4A5BA 1YXQA 4FWOA 4GVEA 1KAZA 1KD1O 3CMEN 4BC3A 4BEBA 2YHYA 5M1KA 1M90O 1NGHA 3O4WA 3WUHA 1KC8O 1NGAA 4PKIA 4YDUC 2A6AA 1M1KO 4A59A 5GIPA 2D4WA 1S22A 2ZGZA 2YX6A 3LL3A 1NGJA 1K9MO 2NRRA 1DKGD 2OANA 3JXUA 3TPQA 3M5RA 4U7BA 4H0XB 1G99A 5AQKA 3ENOA 4CJ7A 3CCMN 4JLCA 4PL8A 3H1QA 3H0XA 1V4TA 1GLBG 1X9JA 3MCAB 4B1XB 3BF3A 3AAQA 1T6CA 4JAXA 3DJCA 3P38A 4CZEA 1E2UA 3QDKA 4BG8A 2I7NA 5AZJA 3WEEA 1K8KA 3KWGA 3C6HA 4JD2A 4BQLA 1MWKA 3F7WA 3L3OM 3LMFA 3HRGA 5AQGA 5AQMA 3AGRA 3ULEB 4R5IA 4JK7A 1NM1A 4JKCA 4G6QA 3DXMB 2Q0UA 3FZLA 3QBWA 1Q5LA 2VCPA 2FSKA 3LDLA 3N8EA 1SQKA 3WEEB 2F7TA 2HF3A 3IFRA 4BRDA 3CCRN 3VESA 1YAGA 4B1WB 4CZGA 5KPTA 4EZUA 1YJWN 2FF3B 2P9UA 3H46O 1SU6A 3I8BA 1UPXA 3Q7BA 4HWIA 4EIAA 5C0YA 2QW9A 1C0FA 3CQYA 3SK3A 4BG9A 4FWKA 3L4QA 1YITN 4CZKA 3CF5L 5LY3A 3VEZA 2E2OA 3CC2N 3O9RA 3CPWM 2ZF5O 4C23A 2YHWA 5C2DA 1BPRA 1CZAN 2NRXA 2E1ZA 5CR4A 3GOIA 4H5TA 5ADXH 1Q82O 2P9IA 3CIPA 1YVNA 2NRWA 1Q7YO 3HBTA 5DM6L 5E84A 3ATVA 2ND0A 4KIKA 1NJIO 1W97L 4EAHD 2E20A 3UKRB 3SAFA 5AQPA 5FPMA 3O3MB 1DT9A 3RVCA 3HTVA 3R6MA 5GAGP 5M1NA 2P9LA 4IW0A 3CJ1A 1GNLA 2NRVA 4EZRA 4IWPA 3H1VX 3W3DA 4E1JA 3QICA 4C1NK 3O1WA 2ITMA 1X3NA 2ZGYA 4JKDA 2NNWA 4BRAA 2P9KA 1ZYLA 2GA9D 2GUPA 4R5LA 2PBDA 3HOTA 3VGKA 3A5MC 4G9ZA 1HLUA 1QZ5A 4ILHB 2RE2A 2GAFD 3QA8A 3IMXA 2J4RA 2BH1A 4IEEA 3SAHA 2YJFA 4GV3A 3O1BA 5B8HA 2GX9A 1GLLO 2JWKA 5AZIA 3DLLL 4M7XA 1YHQN 3MCPA 4H0YB 3SMPA 1QVFM 1RFQA 3F9MA 3P39A 4YOXA 3DAWA 4K42A 4BGAA 3DXMA 1T44A 3VEBA 3CQXA 1E1DA 3VF6A 4MLHA 1O13A 3GDQA 3G71N 5EVZA 3ZEFA 5BPLA 3FLCO 3O9UA 4JKEA 3T46A 3A5NC 1BUPA 3ID8A 4JD2B 3WXJA 3SBTB 2KHOA 3E9LA 4FO0A 3CCLN 5BN8A 2YJEA 3VKHA 1RGIA 3O8MA 3EKSA 1HPMA 3H3NO 2PY6A 1Z05A 1YUWA 3WXLA 3CJCA 3ATUA 3I04A 3FE1A 5BPNA 2YIBA 1DGKN 2A5XA 3AY9A 3CJ7A 2NRZA 3H6EA 4BROA 3O6WA 4NLCA 4U67L 4XJXA 3CC4N 2E2PA 3SBSA 3P4IA 5JLHA 4E3CA 4WQ4A 1DG4A 1WUAA 4NB4A 1NGFA 1MJGA 4CZIA 4YOUA 4WV7A 5DM7L 1RDUA 4K41A 4JL9A 5TKYA 1HKBA 1VAZA 2I7PA 4H0TB 4IJNA 5EXWA 1Q18A 4IO8A 3CCSN 2ZJRL 1HKGA 4JWDA 4EZNA 1XQSC 2V7ZA 4I6MA 3SMSA 5JLFA 4FL9A 3HM8A 2QWQA 1SU8A 2ND1A 2CGLA 4OPAA 5AQYA 5GINA 3E1YA 4EZSA 2DPNA 1U2VB 1VQPN 2ZJQL 4A61A 4I43A 2QWMA 2QI2A 3OBWA 3TTFA 3FGUA 2F9TA 1HX1A 2HBJA 4JHDB 5FPDA 2IIRA 3DWLA 1TYQA 4A5AA 3CCUN 2RT6A 3KZBA 3C65A 4QS9A 5M1OA 3NVMA 3MDQA 3N4PA 3A8YA 1GLEG 3VEXA 5C15A 4CI6A 4BR5A 5JVGL 1K73O 1HUXA 2IVNA 2A40A 2WINM 3F2KA 3CCVN 1GLDG 5CE3A 3RV1A 4ILJA 1GLAG 3CCEN 1BDGA 1NGBA 4BVPA 2QA4N 1VQON 4EZTA 4M7YA 3QNJA 2QTDA 3F5TA 1DKXA 5M1QA 3OBYA 3CCJN 2EX3B 2P9UB 3A0IX 4WYBA 3KAVA 3BEXA 5LJVA 4FOEA 3VEOA 4EZPA 1Y64A 5BN9A 4IOXA 2P9SB 3HSCA 3VPZA 2WUSA 4E81A 4R5JA 3T49A 3K9KA 3SAGA 3VTHA 3OHRA 2GEMA 1ESVA 2P9KB 2UYTA 4KBOA 3U9ZA 4JWIA 2GWJA 3D2EA 3I33A 2W40A 3FZHA 5M1PA 5ELZA 3ZETA 4YOVA 1U2VA 4EHTA 4ILGA 1IJJA 3MN9A 4CZHA 3WQTA 1R59O 4HR1A 5ADXA 4GV6A 3D2FB 4BVOA 3VEYA 2NLXA 4M0MA 4KH5A 3UKUB 3GI7A 3GL1A 5AQZA 4BR7A 3M6GA 4DQ8A 3P31A 4BRCA 4JKBA 3KWIA 3DOBA 5AQIA 4EZZA 3L4IA 4JNFA 4BRFA 4FWPA 5AQJA 4PL7A 3E9OA 4QS8A 4B1UB 3HI0A 3CPEA 3KAWA 3HOSA 4F9OA 3CJAA 1SS6A 4WCEL 4JKGB 4O8UA 4WQ5C 1NWKA 3R8EA 2E2QA 1GNTA 3ID6A 1BG3A 1Z6RA 2AP1A 2IVPA 3M3ZA 5F2RA 2WC9A 3E9PA 4CZMA 4ILIA 2ASPA 2ZJPL 1GLCG 4HR1B 3PIOL 1HKCA 4EHUA 3PIPL 1NGEA 2N3KA 4I6MB 2QWRA 1OKJA 1OA1A 1NBWA 4FOIA 1U00A 3C7NB 4ISFA 5E26A 3CETA 4MDBA 4A62A 2NZTA 3TTCA 4A57A 5GIOA 1BO5O 3AGKA 3FZKA 4WFNL 5FPNA 4IO9L 1S72N 1X3MA 2HBKA 2HBMA 4JKAA 2P9SA 3RV0A 1KQSM 3FD9A 1NGIA 5AZJB 3VOVA 5AZIB 4K25A 3EKUA 3ZEDA 3T69A 4JKFA 4H5RA 1W2BM 2V51B 4UDYX 4PKGA 2FF6A 5BRDA 1ATSA 2P9NB 3EN9A 1KAYA 1LCUA 3G6EN 3UE5A 2YI8A 3WXKA 3LDOA 3S41A 3TSUA 5JMVA 4OO1J 2X5CA 2HOEA 1NMDA 3CHWA 3ZX3A 2PFUA 1QQMA 4DKWA 1D4XA 1J6ZA 5GADP 2BTFA 3OW2M 2OTLN 4IJAA 2E88A 1BWFO 3MMVA 2CGJA 3T48A 4PKHA 1TYQB 3T47A 4EZYA 4XH5A 4ISGA 3O5BA 3ZETB 4BC4A 5GAEP 5BPMA 4R79A 3LM9A 1VQ6N 4R5KA 3JS6A 4BQZA 3SLCA 5TKWA 3J8AA 2NRTA 2VWBA 4JKHA 4QS7A 4HYBA 1VQ8N 4BGBA 2P9PB 2V7YA 3QB0A 4RTFD 3CC7N 2JNSA 4A2BA 1MDUB 4IOCL 3VENA 3UITA 4YOWA 1VQ5N 2W00A 1S3XA 1VQMN 2LM0A 2CGKA 3G4SN 4XH1A 4DCHA 4JWCA 4IEIA 2VYPA 3CJBA 1ATRA 4JKGA 1VQLN 4AM7A 4MO5A 4BRKA 4BE7B 4XH4A 1JCEA 3H3OB 2P9NA 3MN7A 2QWOA 3ENHA 3W0LA 4NPHA 1V4SA 1NGDA 3A98A 3OWGA 3C0BA 2HF4A 5FIGA 3MN6A 4IM2A 3KHYA 3VETA 1QVGM 2HSTA 1VQ4N 4BECA 2JWLA 3O08A 4BR0A 2NCZA 3DPQA 4FWQA 3CI5A 3M1FA 3VMFB 3BF1A 4CZLA 1DKZA 2Q1NA 3U4LA 4CD1A 5JVHL 3MWPA 1MWMA 3R9PA 4B9QA 1YIJN 4A2AA 2E1YA 3EL2A 4IXCA 3D7EO 5KPRA 4BR2A 4KH4A 4FWMA 4MDAA 3CERA 5AR0A 2EWFA 4AM6A 1KAXA 4R5GA 4FWLA 3I39X 3FR0A 4JWEA 4B1YB 5AQVA 4NO7A 2QM1A 1H1VA 1E4GT 2Q2RA 3VERA 4HTLA 1EO1A 1OA0A 4EZQA 1DKYA 3CJ9A 4HY9A 5CHIA 4B1ZA 1U6ZA 3EZWA 3ZX0A 4H6IA 1SZ2A 3SBGA 2HMPA 1T3VA 5M1FA 1E4FT 4IZ9A 2QWLA 3VEAA 5KPZA 4JNEA 4F01A 4L3QA 5EOYA 4JHDA 4D8JA 5AFUA 4EZWA 3A5LC 4PO2A 1MA9B 3TTDA 3MN5A 1BA0A 2D0OA 4BC2A 3KDRA 3DXKB 2EWSA 4H5NA 3LDNA 3NMUA 4GV9A 4WFAL 1EQYA 5F0XA 5F1XA 1CKRA 5HL7L 3DXKA 1N8RO 3D2EB 3B51X 2QWNA 1VQ9N 3VF2A 3WT0A 3T7ZA 2QXLA 1Q81O 1E9VA 2Q97A 3O9TA 2YIVX 3C6AA 4MLEA 4O8KA 3CMAN 1TUUA 4YOYA 3J7ZO 3QFPA 3HZ6A 3RSEA 1DEJA 5FPEA 2YI9A 2C1IA 2VGMA 4MO4A 5AQUA 5MLCQ 4YORA 3OHXM 4BRIA 2KKZA 3VGMA 5C2FA 1OVYA 1ZXOA 3GBTA 3SJHA 3D2FA 1GLFO 4IDHA 1YJNN 4ISEA 4FWNA 3B8AX 2Z8YA 3UB5A 4BRQA 5AFUH 5HOOA 5I9EB 4RWTA 4Z94A 3CD6N 3LM2A 2P9PA 2Q36A 5AQLA 1ILYA 3WXIA 4H5VA 4FPBA 2WBNA 3BP8A 3TU5A 3ER8C 4H0PA 2QWPA 5AQNA 4CZFA 4K43A 3ZYYX 2A3ZA 3EE9A 4WQ4C 2P9IB 5C10A 3G25A 3TSPA 3BUZB 1RDWX 4EZVA 4BRHA 4CBWA 3MX5A 2VGNA 3QMLA 1BOTO 2YHXA 1K8KB 3ENBA 2FLOA 2YI1A 1JCFA 4BR4A 2WFBA 4CZJA 1Q86O 1SUFA 2ASMA 2PAVA 2CH5A 3AAPA 1NGGA 3DPOA 4BRMA 3ZEUB 4BREA 3CCQN 4RCHA 4OPHA 2FSJA 4ILHA 4H5WA 4JK8A 1NLVA 2KLAA 3VTIA 1ZC6A 2OBLA 2GELA 2D1KA 2ASOA 2QEXN 3RSEB 4FWRA 4M63C 2OBMA 5BREA 5LJWA 3K9JA 1ZBSA 4UY8O 5AQXA 4IFEA 2V52B 3TSQA 3MK6A 5KQDA 4CBUA 2F9WA 2NRHA 5GAHP 4PHTX 2C1GA 3UKUA 2QFFA 3H45C 5KQ8A 5BR9A 1JCGA 3Q7CA 4XEIA 5AQRA 4BRPA 4BC5A 5AQWA 3DPPA 3SBTA 3N4QA 3PLAA 3UKRA 1P90A 4ILGB 3O9QA 1P8ZA 3KK7A 5AQQA 3VF4A 4GY2B 1BU6O 4BR9A 3QBXA 4B1VA 2FSNA 4JEPA 5AQOA 4FSVA 3VEWA 5BRHA 4WFBL 5AQSA 5FLEX 4H03B 4F00A 1LOTB 2YIAA 3I01A 2CH6A 2FXUA 1VQ7N 1NGCA 4EZXA 4LC9B 1SU7A 5AQHA 3O3NB 1ATNA 3LDQA 5AQTA 1SAZA 3QFUA 4KH6A 3IDHA 3MWTA 2BPRA 3IUCA 1IG8A 3U8XA 1GN9A 3IKMA 1VQNN 3FFKB 4EZOA 7HSCA 4JK9A 4H0OA 1VQKN 3VEVA 4FVUA 3WXMB 4FWSA 4BRLA 2A42A 2GTDA 2Q31A 4MQDA 3LDPA 5C12A 1QQOA 1XC3A 1XUPO 1QQNA 1OAOA 4O5FA 3KVGA 4IWQA 4GNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6D A;  2E2N A;  3FZM A;  3ULE A;  2AA4 A;  1KXP A;  4EFH A;  4YDU A;  4BRN A;  4DB3 A;  2P9L B;  4BRG A;  4WQ5 A;  2W41 A;  1QHA A;  2BUP A;  1GLJ O;  3AAR A;  3WQU A;  2IVO A;  3GE1 A;  2H3G X;  3L0Q A;  2D0P A;  3VGL A;  1BA1 A;  5EY4 A;  4H6H A;  1TUY A;  2Q0R A;  3ZEU A;  2OP6 A;  4IWV A;  5JIC A;  5BRF A;  4JN4 A;  2A41 A;  3GG4 A;  3DQG A;  3FZF A;  1WOQ A;  4Y0W A;  4CD3 A;  3EO3 A;  3T4A G;  3C7N A;  2GWK A;  3O80 A;  4H0V B;  3ZX2 A;  3A5O C;  5AQF A;  2YCH A;  4DHY A;  2ZWH A;  3L6Q A;  1C0G A;  5EX5 A;  4CBX A;  2E8A A;  1HJO A;  4J8F A;  3U9D A;  4FPA A;  4WV5 A;  1QZ6 A;  1YXQ A;  4FWO A;  1KAZ A;  4BC3 A;  2YHY A;  1NGH A;  3O4W A;  3WUH A;  1NGA A;  4PKI A;  4YDU C;  2A6A A;  2D4W A;  1S22 A;  2ZGZ A;  3LL3 A;  1NGJ A;  1DKG D;  2OAN A;  3JXU A;  3TPQ A;  4H0X B;  1G99 A;  5AQK A;  3ENO A;  4CJ7 A;  4PL8 A;  3H1Q A;  3H0X A;  1V4T A;  1GLB G;  1X9J A;  4B1X B;  3BF3 A;  3AAQ A;  1T6C A;  4JAX A;  3DJC A;  4CZE A;  5BPN A;  5AZJ A;  3QDK A;  4BG8 A;  2I7N A;  3WEE A;  1K8K A;  4JD2 A;  4BQL A;  1MWK A;  3L3O M;  5AQG A;  5AQM A;  3ULE B;  4R5I A;  1NM1 A;  3DXM B;  2Q0U A;  3FZL A;  3QBW A;  1Q5L A;  2VCP A;  2FSK A;  3LDL A;  3N8E A;  1SQK A;  3WEE B;  2HF3 A;  3IFR A;  4BRD A;  3VES A;  1YAG A;  4B1W B;  4CZG A;  5KPT A;  4EZU A;  2FF3 B;  2P9U A;  3H46 O;  3I8B A;  4HWI A;  4EIA A;  2QW9 A;  1C0F A;  3CQY A;  3SK3 A;  4BG9 A;  4FWK A;  4CZK A;  5LY3 A;  3VEZ A;  2E2O A;  2ZF5 O;  4C23 A;  2YHW A;  1BPR A;  1CZA N;  2E1Z A;  3GOI A;  4H5T A;  5ADX H;  2P9I A;  3CIP A;  1YVN A;  3HBT A;  5E84 A;  3ATV A;  4EAH D;  2E20 A;  3UKR B;  5AQP A;  5FPM A;  3HTV A;  3R6M A;  2P9L A;  3CJ1 A;  3H1V X;  3W3D A;  4EZR A;  4E1J A;  3QIC A;  3O1W A;  2ITM A;  1X3N A;  2ZGY A;  4BRA A;  2P9K A;  2GUP A;  4R5L A;  3VGK A;  3A5M C;  1HLU A;  1QZ5 A;  3IMX A;  2J4R A;  2YJF A;  3O1B A;  5B8H A;  1GLL O;  5AZI A;  4M7X A;  3MCP A;  4H0Y B;  3SMP A;  1RFQ A;  3F9M A;  3DAW A;  4K42 A;  4BGA A;  3DXM A;  1T44 A;  3CQX A;  3VF6 A;  4MLH A;  3GDQ A;  5EVZ A;  5BPL A;  3FLC O;  3T46 A;  3A5N C;  1BUP A;  3ID8 A;  4JD2 B;  3WXJ A;  2KHO A;  4FO0 A;  5BN8 A;  2YJE A;  1RGI A;  3O8M A;  3EKS A;  1HPM A;  3H3N O;  1Z05 A;  1YUW A;  3WXL A;  3CJC A;  3ATU A;  3FE1 A;  2A5X A;  1DGK N;  3CJ7 A;  3AY9 A;  3H6E A;  4BRO A;  3O6W A;  2E2P A;  3P4I A;  5JLH A;  4WQ4 A;  1DG4 A;  1WUA A;  4NB4 A;  1NGF A;  4CZI A;  4WV7 A;  4K41 A;  5TKY A;  2I7P A;  1HKB A;  4H0T B;  4IJN A;  5EXW A;  1Q18 A;  4IO8 A;  1HKG A;  4JWD A;  4EZN A;  1XQS C;  2V7Z A;  4I6M A;  3SMS A;  5JLF A;  4FL9 A;  3HM8 A;  2QWQ A;  2CGL A;  5AQY A;  4EZS A;  2DPN A;  1U2V B;  4A61 A;  2QWM A;  3FGU A;  2F9T A;  1HX1 A;  4JHD B;  5FPD A;  2IIR A;  3DWL A;  1TYQ A;  3KZB A;  4QS9 A;  3MDQ A;  3VEX A;  3A8Y A;  1GLE G;  4CI6 A;  4BR5 A;  1HUX A;  2IVN A;  2A40 A;  2WIN M;  1GLD G;  1GLA G;  1BDG A;  1NGB A;  4BVP A;  4EZT A;  4M7Y A;  3QNJ A;  1DKX A;  2P9U B;  3A0I X;  4WYB A;  3BEX A;  1QQN A;  5LJV A;  4FOE A;  3VEO A;  4EZP A;  1Y64 A;  5BN9 A;  2P9S B;  3HSC A;  3VPZ A;  2WUS A;  4E81 A;  4R5J A;  3T49 A;  3OHR A;  2GEM A;  1ESV A;  2P9K B;  2UYT A;  4KBO A;  3U9Z A;  4JWI A;  2GWJ A;  3D2E A;  3I33 A;  2W40 A;  3FZH A;  5ELZ A;  3ZET A;  1U2V A;  4EHT A;  1IJJ A;  3MN9 A;  4CZH A;  3WQT A;  1R59 O;  5ADX A;  3D2F B;  4BVO A;  3VEY A;  2NLX A;  3UKU B;  3GL1 A;  5AQZ A;  4DQ8 A;  4BR7 A;  3M6G A;  4BRC A;  5AQI A;  3DOB A;  4EZZ A;  3L4I A;  4JNF A;  4BRF A;  4FWP A;  5AQJ A;  4PL7 A;  4QS8 A;  4B1U B;  3HI0 A;  4F9O A;  3CJA A;  4WQ5 C;  1NWK A;  3R8E A;  2E2Q A;  1BG3 A;  1Z6R A;  2AP1 A;  2IVP A;  3M3Z A;  5F2R A;  4CZM A;  2ASP A;  1GLC G;  1HKC A;  4EHU A;  1NGE A;  4I6M B;  2QWR A;  1OKJ A;  1NBW A;  4FOI A;  1U00 A;  3C7N B;  4ISF A;  5E26 A;  3CET A;  4A62 A;  2NZT A;  1BO5 O;  3FZK A;  5FPN A;  1X3M A;  2P9S A;  1NGI A;  5AZJ B;  3VOV A;  5AZI B;  4K25 A;  3EKU A;  4H5R A;  2V51 B;  4PKG A;  2FF6 A;  5BRD A;  1ATS A;  2P9N B;  3EN9 A;  1KAY A;  1LCU A;  3UE5 A;  3WXK A;  3LDO A;  3S41 A;  5JMV A;  2HOE A;  1NMD A;  3CHW A;  3ZX3 A;  1QQM A;  1D4X A;  1J6Z A;  2BTF A;  4IJA A;  2E88 A;  1BWF O;  3MMV A;  2CGJ A;  3T48 A;  4PKH A;  1TYQ B;  3T47 A;  4EZY A;  4XH5 A;  4ISG A;  3O5B A;  3ZET B;  4BC4 A;  5BPM A;  3LM9 A;  4R5K A;  3JS6 A;  4BQZ A;  3SLC A;  3J8A A;  2VWB A;  4QS7 A;  4HYB A;  4BGB A;  2P9P B;  2V7Y A;  3QB0 A;  4RTF D;  4A2B A;  1MDU B;  3VEN A;  1S3X A;  2CGK A;  4XH1 A;  4DCH A;  4JWC A;  2VYP A;  3CJB A;  1ATR A;  4AM7 A;  4MO5 A;  4BRK A;  4XH4 A;  1JCE A;  3H3O B;  2P9N A;  3MN7 A;  2QWO A;  3ENH A;  3W0L A;  1V4S A;  1NGD A;  3C0B A;  2HF4 A;  3MN6 A;  3VET A;  3KHY A;  3O08 A;  4BR0 A;  3DPQ A;  4FWQ A;  3CI5 A;  3M1F A;  4CZL A;  3BF1 A;  1DKZ A;  2Q1N A;  3U4L A;  4CD1 A;  1MWM A;  3R9P A;  4B9Q A;  4A2A A;  2E1Y A;  3EL2 A;  4IXC A;  3D7E O;  5KPR A;  4BR2 A;  4FWM A;  5AR0 A;  3CER A;  4AM6 A;  1KAX A;  4R5G A;  4FWL A;  3FR0 A;  4JWE A;  4B1Y B;  5AQV A;  4NO7 A;  2QM1 A;  1H1V A;  1E4G T;  2Q2R A;  3VER A;  4HTL A;  4EZQ A;  1DKY A;  3CJ9 A;  4HY9 A;  4B1Z A;  1U6Z A;  3EZW A;  3ZX0 A;  4H6I A;  1SZ2 A;  2HMP A;  1E4F T;  4IZ9 A;  2QWL A;  5KPZ A;  4JNE A;  4F01 A;  4L3Q A;  5EOY A;  4JHD A;  5AFU A;  4EZW A;  3A5L C;  4PO2 A;  1MA9 B;  4BC2 A;  3MN5 A;  1BA0 A;  2D0O A;  3DXK B;  2EWS A;  4H5N A;  3LDN A;  1EQY A;  5F0X A;  5F1X A;  1CKR A;  3DXK A;  3D2E B;  2QWN A;  3VF2 A;  3WT0 A;  2QXL A;  2Q97 A;  4O8K A;  4MLE A;  1TUU A;  3QFP A;  3HZ6 A;  3RSE A;  1DEJ A;  5FPE A;  4MO4 A;  5AQU A;  3OHX M;  4BRI A;  3VGM A;  1ZXO A;  3GBT A;  3SJH A;  3D2F A;  1GLF O;  4ISE A;  4FWN A;  3B8A X;  4BRQ A;  3UB5 A;  5AFU H;  5I9E B;  4RWT A;  4Z94 A;  3LM2 A;  2P9P A;  2Q36 A;  5AQL A;  3WXI A;  4H5V A;  4FPB A;  3BP8 A;  3TU5 A;  4H0P A;  2QWP A;  5AQN A;  4CZF A;  4K43 A;  2A3Z A;  4WQ4 C;  2P9I B;  3G25 A;  3BUZ B;  1RDW X;  4EZV A;  4BRH A;  4CBW A;  3QML A;  1BOT O;  2YHX A;  1K8K B;  2FLO A;  2YI1 A;  1JCF A;  4BR4 A;  4CZJ A;  2ASM A;  2PAV A;  2CH5 A;  3AAP A;  1NGG A;  3DPO A;  4BRM A;  3ZEU B;  4BRE A;  4RCH A;  2FSJ A;  4H5W A;  1NLV A;  1ZC6 A;  2GEL A;  2D1K A;  2ASO A;  3RSE B;  4FWR A;  4M63 C;  5BRE A;  5LJW A;  1ZBS A;  5AQX A;  2V52 B;  5KQD A;  3MK6 A;  4CBU A;  2F9W A;  2NRH A;  3UKU A;  2QFF A;  3H45 C;  5KQ8 A;  5BR9 A;  1JCG A;  4XEI A;  5AQR A;  4BRP A;  4BC5 A;  5AQW A;  3DPP A;  3UKR A;  5CE3 A;  1P8Z A;  5AQQ A;  3VF4 A;  4BR9 A;  4GY2 B;  1BU6 O;  3QBX A;  4B1V A;  2FSN A;  5AQO A;  4FSV A;  3VEW A;  5BRH A;  5AQS A;  4H03 B;  4F00 A;  1LOT B;  2FXU A;  2CH6 A;  1NGC A;  4EZX A;  4LC9 B;  5AQH A;  5AQT A;  1ATN A;  3LDQ A;  1SAZ A;  3QFU A;  3IDH A;  2BPR A;  3IUC A;  1IG8 A;  3U8X A;  3FFK B;  4EZO A;  7HSC A;  4H0O A;  3VEV A;  4FWS A;  4BRL A;  2A42 A;  2GTD A;  2Q31 A;  3LDP A;  1QQO A;  1XC3 A;  1XUP O;  2PBD A;  4O5F A;  3KVG A;  4GNI A; 
#chains in the Genus database with same CATH topology
 4IM0 A;  1T6D A;  4CHZ A;  4DSJ A;  1HQE A;  3FZM A;  1KXP A;  4PWD A;  4W5R A;  4CEZ A;  2X6N A;  4C1N I;  4BRG A;  4WQ5 A;  4B8A B;  4LF8 K;  3DX1 A;  1QHA A;  2GF4 A;  3NVK A;  4DU4 A;  4KIK B;  2VG5 A;  2O8F B;  3AO2 A;  2IVO A;  3GE1 A;  1ZYQ A;  3L2V A;  2MI7 A;  4H6H A;  2OP6 A;  3CXC M;  4AF1 A;  2A41 A;  4IM3 A;  1KLM A;  3B52 X;  1WOQ A;  2IDO A;  3SOG A;  4JI3 K;  2BE2 A;  3ER9 B;  1W9M A;  1XMQ K;  3O3O B;  3C7N A;  2GWK A;  3A5O C;  5AQF A;  2YCH A;  3CM5 A;  3U3G A;  1X9W A;  4X64 K;  2F8T A;  1JLF A;  1O7D B;  3THW A;  4CBX A;  2E8A A;  5FRN A;  5BR8 K;  4FLZ A;  3BZC A;  1YXQ A;  1TQW A;  4FWO A;  4Z4C A;  1KD1 O;  2C08 A;  3CME N;  1XNQ K;  3P1G A;  4EP5 A;  4H8K A;  3VQA A;  5FLX O;  4DLE A;  3TAQ A;  2W42 A;  1NGH A;  3G9G A;  4KO0 A;  4PKI A;  1HTY A;  1M1K O;  2D4W A;  3ASM A;  4RW4 A;  2NRR A;  2OAN A;  3JXU A;  5AQK A;  1G99 A;  4FJH A;  4BE2 A;  4CJ7 A;  4CIF A;  4I9L A;  1V4T A;  4B08 A;  3MCA B;  3OYN A;  3EJP A;  2ZD1 A;  3BUI A;  5BPN A;  3DJC A;  3QDK A;  1SL0 A;  1JL2 A;  3F7W A;  1Y97 A;  4DSE A;  3NF8 A;  4CEO A;  1C1A A;  1RDD A;  3SPY A;  4IG3 A;  3NBP A;  3T19 A;  4LFC K;  3FZL A;  2Q0U A;  1JXE A;  3LDL A;  2VCP A;  3CCR N;  3WEE B;  4BRD A;  2FC0 A;  1YJW N;  5KPT A;  4GMJ B;  2FF3 B;  4HUF A;  4HWI A;  2BDP A;  4E7I A;  1C0F A;  2OZS A;  2R7Y A;  4BG9 A;  4DV1 K;  3CF5 L;  5LY3 A;  5KGW A;  3CC2 N;  3CPW M;  1BPR A;  5CR4 A;  1L3S A;  1LWC A;  5C5B A;  1NOZ A;  2P9I A;  2NRW A;  3J7Y P;  4E7J A;  4LSL A;  1TAQ A;  1DT9 A;  3FFI A;  1HNX K;  2O8D B;  3AVL A;  3W3D A;  2NRV A;  2XY6 A;  3BUQ A;  1A5W A;  4BRA A;  2GA9 D;  3EYZ A;  3CM6 A;  3HT3 A;  1OH6 A;  3P5J A;  5HRP A;  3C6U A;  4DTN A;  3SAH A;  2J4R A;  4JI2 K;  5DK5 A;  2YL6 A;  4AZB A;  1YHQ N;  4UQG A;  1QVF M;  4YOX A;  3QWE A;  3L3U A;  1NMN A;  3VEB A;  4OLA A;  3GDQ A;  3NCI A;  3G71 N;  2OPP A;  4ZTF A;  3ID8 A;  2LXY A;  4JD2 B;  5LL6 Z;  4FO0 A;  3F73 A;  1RGI A;  3H3N O;  1RBS A;  3ATU A;  3I04 A;  5CYQ A;  1DGK N;  1GOB A;  1R33 A;  3HP6 A;  4CJU A;  4XJX A;  5J2M A;  4KHN A;  4E3C A;  4WV7 A;  4K41 A;  1J5E K;  3QEW A;  2I7P A;  5EXW A;  2RAJ A;  1Q18 A;  3SQ1 A;  2ZJR L;  2YNF A;  4EZN A;  4DFJ A;  2IOC A;  3KLE A;  3ZLJ A;  2PMR A;  4CJE A;  5AQY A;  1DLO A;  1ZBI A;  2OPR A;  2WYH A;  2ZJQ L;  4I43 A;  2QWM A;  3RRH A;  3V4I A;  1NK5 A;  3V9W A;  2F9T A;  4MFB A;  3V1R A;  3BVV A;  1TYQ A;  4C8M A;  3CCU N;  1XMO K;  1NK0 A;  1B92 A;  3K0S A;  3NVM A;  1NJX A;  5JVG L;  1GLE G;  4BR5 A;  1RDB A;  3AO5 A;  3AVF A;  2A40 A;  1BL3 A;  1GLD G;  2HB5 A;  4F8R A;  3RV1 A;  3CCE N;  1GLA G;  1QS4 A;  3HAI A;  1BDG A;  3J7A P;  4BVP A;  3AVM A;  1B9F A;  4FXD A;  3QNJ A;  3MEE A;  3RMC A;  1DKX A;  3QEP A;  4KHW A;  3ACO A;  2E6M A;  2P9U B;  3A0I X;  4WYB A;  4HUE A;  5LJV A;  1XHX A;  3VEO A;  4EZP A;  1Y64 A;  2X3W A;  1HRH A;  1WB9 A;  4FCY A;  2WUS A;  4H8S A;  4CJP A;  2UYT A;  1ESV A;  4X66 K;  1CZ9 A;  1W9H A;  3I33 A;  4YOV A;  5ELZ A;  4NCB A;  2B5J A;  4EHT A;  4ILG A;  3ZSQ A;  2YL9 A;  3KD1 E;  1R59 O;  1GOA A;  5ADX A;  3VN5 A;  3D2F B;  3PUF A;  4CJ5 A;  3JYT A;  4KH5 A;  4OKE A;  3UKU B;  1S6P A;  2UUC K;  3KWI A;  5AQI A;  2D1L A;  3L4I A;  4NCA A;  4FWP A;  5AQJ A;  1YWM A;  3E9O A;  5C25 A;  3SNN A;  4WCE L;  2YKT A;  4WQ5 C;  4JI4 K;  1GNT A;  3RRG A;  2IVP A;  4Z4E A;  3E9P A;  4EZ6 A;  3PO5 A;  1HKC A;  1SKW A;  4EHU A;  3PIP L;  2F7P A;  3NGY A;  2QWR A;  1NBW A;  2DFE A;  4FOI A;  4MDB A;  4A62 A;  2NZT A;  3AGK A;  4WFN L;  5CYM A;  5FDL A;  1X3M A;  4NYF A;  3LAL A;  4JKA A;  3SQ0 A;  1CZB A;  4JKF A;  2O8C A;  4H5R A;  1ATS A;  3EN9 A;  1LCU A;  4FM0 A;  3OY9 A;  4C8K A;  4CEA A;  3S41 A;  4FJ8 A;  4OO1 J;  2X5C A;  1NMD A;  3ZX3 A;  2PFU A;  3VQ4 A;  1J6Z A;  4IJA A;  3OVN A;  2E88 A;  3JSM A;  4PKH A;  3T48 A;  3T47 A;  4EZY A;  5GAE P;  3O5B A;  4JYA K;  3PY8 A;  3OYG A;  5TKW A;  2NRT A;  4CES A;  4JS4 A;  3D51 A;  3QB0 A;  2V7Y A;  4K0K K;  3VQB A;  1VQM N;  1JXB A;  3RMB A;  1RT3 A;  3BVW A;  3I8D A;  4BDP A;  4BWJ A;  4F3O A;  3NH0 A;  1ATR A;  4CHN A;  4MO5 A;  1RT1 A;  3EJR A;  1NKC A;  3W0L A;  1RNH A;  3NH1 A;  3A98 A;  3C0B A;  1EWQ A;  1VHX A;  3MN6 A;  4IM2 A;  3K2P A;  2HST A;  4NQI A;  3WNE A;  2NCZ A;  2HND A;  1HR0 K;  3M1F A;  3HXM A;  4DYL A;  4M3W A;  5HLF A;  4B9Q A;  4A2A A;  2WON A;  4IXC A;  2HVI A;  4KH4 A;  4FWM A;  4AM6 A;  3CER A;  1KAX A;  5AQV A;  3QNI A;  1H1V A;  1C6V A;  1ZBL A;  3VER A;  1NJY A;  5D3G A;  1OA0 A;  4FJJ A;  1KFS A;  1D5A A;  4CVN E;  4B1Z A;  4IFV A;  1E4F T;  1TKT A;  2F96 A;  1RT2 A;  4NSW A;  3ZSY A;  4KTW A;  2NUB A;  2HHU A;  4OPJ A;  3TTD A;  1BA0 A;  3DXK B;  2PY5 A;  3T1H K;  4WFA L;  3LPU A;  3DXK A;  4CGD A;  4FLX A;  2KQ2 A;  4CK3 A;  4FJN A;  3QEV A;  1Q81 O;  3O9T A;  1E9V A;  4O8K A;  3CMA N;  1TUU A;  1NK4 A;  4N47 A;  1T7P A;  3J7Z O;  3QFP A;  3HZ6 A;  2YI9 A;  1X9S A;  2VGM A;  4MO4 A;  4E7L A;  4LD0 A;  3V9U A;  3VGM A;  3GBT A;  4H4M A;  3D2F A;  1BI4 A;  4ISE A;  1K6Y A;  1JLC A;  4JI0 K;  5HOO A;  3CD6 N;  3LM2 A;  1N32 K;  1ILY A;  4FZO A;  2QWP A;  4H0P A;  4KRF A;  3K59 A;  3EE9 A;  4ZHR A;  4AHV A;  3TSP A;  4FJK A;  4CBW A;  3MX5 A;  4JRP A;  2VGN A;  3QML A;  2D0B A;  3VQ5 A;  1IH7 A;  1K8K B;  4BR4 A;  4CZJ A;  1B9D A;  1SUF A;  1X03 A;  3AAP A;  2O0I 1;  3VQC A;  3L2R A;  4DQR A;  3WNG A;  2FSJ A;  4JK8 A;  1NLV A;  2GEL A;  2ASO A;  3LAN A;  3K9J A;  5AQX A;  4IFE A;  3MK6 A;  4CBU A;  1Z26 A;  3VQ7 A;  4CEE A;  5GAH P;  4PHT X;  1S1T A;  4CFC A;  3G10 A;  4BRP A;  4BC5 A;  5AQW A;  4FJ5 A;  3SBT A;  3N4Q A;  3PLA A;  5AQQ A;  4BR9 A;  5JEN A;  1HPZ A;  4B1V A;  2OO2 A;  4FSV A;  5BRH A;  1QE1 A;  4OKK A;  4CEQ A;  5C5B B;  4KHY A;  2YIA A;  2FXU A;  3TAM A;  1NGC A;  2YKN A;  4FLW A;  3LDQ A;  4KH6 A;  3OYA A;  3O3G A;  2VG7 A;  1GN9 A;  1TKZ A;  5KGX A;  7HSC A;  3LP3 A;  3VEV A;  4FVU A;  3KLG A;  1C1B A;  4AZ5 A;  5C12 A;  2Q13 A;  1QQO A;  2X3X A;  2PBD A;  3NFA A;  1YI2 N;  4UDX X;  2E2N A;  5EU7 A;  2AA4 A;  4EFH A;  4YDU A;  3F9K A;  4BRN A;  5J2Q A;  4DB3 A;  2P9L B;  2W41 A;  4OGE A;  3WQU A;  1F21 A;  1K8A O;  3NGI A;  4AHS A;  3O9S A;  2H3G X;  3M8R A;  3DLH A;  1BA1 A;  1L3U A;  4FK0 A;  1KCF A;  3I56 N;  3MX2 A;  3GG4 A;  3FZF A;  4Y0W A;  4IWO A;  2RHK A;  2RAK A;  3L2U A;  1VSM A;  1QQC A;  4FJX A;  1C0G A;  5JS2 A;  3T1Y K;  4DTM A;  1HQU A;  4OVL A;  4NYN A;  4GKJ K;  4WV5 A;  4DS4 A;  1KAZ A;  4AHU A;  4KHQ A;  1JLB A;  1SL2 A;  3CZS A;  3HJF A;  4RW9 A;  4YDU C;  1BQN A;  1RBU A;  1NGJ A;  1K9M O;  1DKG D;  3TPQ A;  4U7B A;  3M5R A;  3KJV A;  4EZ9 A;  2UXC K;  1U45 A;  4PL8 A;  2ELB A;  3H0X A;  4B1X B;  1KVC A;  2O4G A;  3MED A;  4CZE A;  1E2U A;  3M8Q A;  3WEE A;  1TK8 A;  3SPZ A;  1MWK A;  5AQG A;  5AQM A;  3OYJ A;  3AGR A;  3PSI A;  4QCL A;  1W7A A;  2OPS A;  4DTU A;  1QWN A;  1REV A;  3QBW A;  1X1P A;  4DF8 A;  1SQK A;  2HF3 A;  5A2Q O;  1U47 A;  4B1W B;  1YAG A;  3D4Z A;  2DY4 A;  3Q7B A;  1SU6 A;  1IKW A;  3I8B A;  4DUZ K;  4KV8 A;  2ETJ A;  4FWK A;  4E1N A;  2VWK A;  3VQQ A;  4PQU A;  2E2O A;  2O8B A;  3ZSO A;  3QNO A;  2G8U A;  1YVU A;  3GOI A;  5SZT A;  3IG1 A;  2F1B A;  4B9M A;  3HPO A;  5HRO A;  1NKB A;  3CIP A;  2RAI A;  1YVN A;  3HBT A;  5E84 A;  3ATV A;  5HP1 A;  2A1R A;  1FK9 A;  1NJI O;  3AVN A;  4AKV A;  4EAH D;  2E20 A;  3UKR B;  2KFN A;  5FPM A;  3HTV A;  5M1N A;  4E1J A;  3OJU A;  4ICL A;  4CJF A;  3O1W A;  1X3N A;  4JKD A;  1ZYL A;  2GUP A;  4R5L A;  3VQ8 A;  2DFF A;  3CVR A;  3A5M C;  1NK7 A;  1EP4 A;  3EJS A;  3O1B A;  5B8H A;  2GX9 A;  1GLL O;  3DLL L;  5AZI A;  4H0Y B;  3SMP A;  1CXU A;  1RFQ A;  4Z4F A;  4Y1C A;  4K42 A;  4BGA A;  2ATQ A;  3SZ2 A;  5J2P A;  3TAB A;  3D45 A;  5EVZ A;  5BPL A;  3FLC O;  3O9U A;  3T46 A;  2Y1I A;  1BUP A;  4BY9 C;  4CJ3 A;  2YJE A;  4I2P A;  4CFD A;  4ATM A;  3EEQ A;  3EKS A;  3T1A A;  1Z05 A;  1YUW A;  1UWB A;  3FE1 A;  2YIB A;  3H6E A;  4NLC A;  4LY7 A;  4OJR A;  1TQV A;  2E2P A;  3P4I A;  4CGJ A;  3CZN A;  2E6L A;  1L5U A;  1JKH A;  1T03 A;  1WUA A;  3CYG A;  1MJG A;  1RDU A;  4ID5 A;  1VSD A;  5TKY A;  1VAZ A;  3NE6 A;  4ELT A;  4LF4 K;  4HCC A;  4IO8 A;  2V7Z A;  5JLF A;  3U6F A;  4FL9 A;  2QWQ A;  2CGL A;  5GIN A;  3L2Q A;  1J54 A;  3E1Y A;  4EZS A;  4J2A A;  1VQP N;  1QHT A;  2OZN B;  2QI2 A;  3FGU A;  1MU2 A;  4JHD B;  3DWL A;  2RT6 A;  3KZB A;  3C65 A;  3DI6 A;  5M1O A;  2F18 A;  3MDQ A;  3N4P A;  3VEX A;  3NF6 A;  3SQ2 A;  3F2K A;  3CCV N;  1YT3 A;  3LPT A;  3F5T A;  5M1Q A;  2ZXQ A;  3OBY A;  3CCJ N;  2EX3 B;  4CEC A;  3KAV A;  3SUQ A;  4FZX C;  1RTD A;  4IOX A;  2P9S B;  4R5J A;  3T49 A;  3OHR A;  4KBO A;  3DX4 A;  1EX4 A;  4FLT A;  3AVK A;  1OVQ A;  2VG6 A;  4JWI A;  4JRQ A;  3MXM A;  1LWE A;  2QK9 A;  3Q0K A;  3MN9 A;  1I94 K;  1LQ7 A;  4FJ9 A;  1IBM K;  4HR1 A;  3PLT A;  4M0M A;  1UOC A;  3GI7 A;  3GL1 A;  5AQZ A;  4DQ8 A;  3M6G A;  2BAN A;  4HCB A;  4N56 A;  3THX A;  3DOB A;  3HYF A;  4AZI A;  4EZZ A;  4CJS A;  4QS8 A;  1RBT A;  3AA3 A;  3MXJ A;  1J5O A;  4O8U A;  4B9L A;  3ZSZ A;  4J2D A;  2QKK A;  4CHY A;  1IG9 A;  4CZM A;  4FZS A;  2ZJP L;  1GLC G;  3PIO L;  1FKP A;  4ZTJ A;  3U3Y A;  4F2S A;  4FVM A;  1OKJ A;  4DQI A;  3OYD A;  4AIL C;  2DFH A;  3CET A;  4IO9 L;  4N76 A;  4WPE A;  1S72 N;  4E89 A;  2HBK A;  1N6Q A;  3DMJ A;  3TI0 A;  2XHB A;  2EHG A;  5AZI B;  4K25 A;  2V51 B;  4UDY X;  3TAE A;  1IKY A;  2B6A A;  1C0M A;  2P9N B;  3VQD A;  4V19 S;  3UE5 A;  2YI8 A;  4AZC A;  5JMV A;  1NJW A;  3HPG A;  4LF7 K;  1D4X A;  3S3O A;  1EXQ A;  2OTL N;  3PX4 A;  4YFU A;  4CK2 A;  3ZT4 A;  2CGJ A;  1PS3 A;  4BC4 A;  3M8S A;  1VQ6 N;  2GBZ A;  4XIU A;  4K8Z A;  3J8A A;  3I0R A;  2VWB A;  2G8V A;  4DCN C;  1VQ8 N;  4BGB A;  1UA0 A;  2JNS A;  4A2B A;  3KLH A;  3VEN A;  4YOW A;  1VQ5 N;  1HNZ K;  2W00 A;  2CGK A;  4XH1 A;  1R34 A;  3WNH A;  5C42 A;  4IEI A;  4JKG A;  1ZBU A;  3TAN A;  2WYI A;  3S9H A;  5FRM A;  4BE7 B;  3QNN A;  3TAR A;  3S3M A;  4AZC B;  1JCE A;  3H3O B;  4AHC A;  1U04 A;  3QIO A;  2P9N A;  2QWO A;  3ENH A;  4DUY K;  2HF4 A;  1QVG M;  3VET A;  4BEC A;  3AO4 A;  1RBV A;  2JWL A;  1L3T A;  1NNE A;  3VMF B;  3AA2 A;  4CZL A;  1XNR K;  2Q1N A;  3U4L A;  4CD1 A;  4KI4 A;  1MWM A;  1YIJ N;  5J2N A;  1CLQ A;  3EL2 A;  3BLB A;  3L3V A;  2YNI A;  2EWF A;  4R5G A;  3FR0 A;  4B1Y B;  2QM1 A;  3D50 A;  2FBV A;  3QES A;  1WLJ A;  3AVH A;  4HTL A;  1DKY A;  2FYV A;  4W5O A;  3EY1 A;  3EZW A;  2YLL A;  4H6I A;  1T3V A;  2OCE A;  4LH4 A;  1HNW K;  4HTU A;  5KRS A;  1Q9Y A;  2Z1I A;  3VEA A;  1S1V A;  1S1W A;  4L3Q A;  2G8W A;  4DMN A;  3HL8 A;  4EZW A;  3A5L C;  4BC2 A;  1MA9 B;  3OYC A;  3MN5 A;  2D0O A;  1KLN A;  4JS5 A;  3KDR A;  4W5Q A;  4HVJ A;  1BIZ A;  1RDC A;  4CGG A;  3M8P A;  1LW0 A;  1J9A A;  1CKR A;  4CJL A;  4DV2 K;  1HXK A;  2X6S A;  2Q97 A;  4CW7 B;  4DWI A;  2V0O A;  4GKK K;  4BDY A;  2Z0N A;  3RSE A;  4KAZ A;  3KLI A;  4YOR A;  3OHX M;  4CHO A;  3BUP A;  3SV4 A;  4G1Q A;  1OVY A;  1ZXO A;  4KHU A;  1YJN N;  1JLA A;  3DM2 A;  5AFU H;  2Z0V A;  5I9E B;  3QIP A;  5AQL A;  3WXI A;  3DRR A;  3THY A;  5AQN A;  4DU1 A;  1JLE A;  3ZCM A;  2A3Z A;  5KI6 A;  1RT7 A;  2P9I B;  3G25 A;  4EZV A;  2JNK A;  3ENB A;  1SL1 A;  4N41 A;  2WFB A;  1Q86 O;  3DRS A;  4B9S A;  2F8S A;  1BIU A;  4W5T A;  1HYZ A;  3BUD A;  4ILH A;  3CQ8 A;  3VTI A;  1ZC6 A;  2D1K A;  4FWR A;  4M63 C;  2OBM A;  5LJW A;  4KTZ A;  2XRI A;  3TSQ A;  4JI8 K;  2RKI A;  2F9W A;  2C1G A;  3H45 C;  1RCH A;  5KQ8 A;  3THY B;  3Q7C A;  4B8C A;  3LWM A;  5CZ1 A;  3V6D A;  3DPP A;  1P90 A;  3O9Q A;  2KW4 A;  4B3S K;  4M3U A;  1BU6 O;  2BGG A;  3QBX A;  2KZM A;  2P1J A;  2FSN A;  5AQO A;  3DYT A;  4DR1 K;  3I01 A;  2CH6 A;  1WBB A;  2O4I A;  1LWF A;  5AQH A;  1ATN A;  3O3H A;  3KTQ A;  3IUC A;  4K8X A;  4CIE A;  4FLV A;  1VQK N;  3ABH A;  2A42 A;  1TVR A;  4MQD A;  1VSH A;  4DFK A;  4CF2 A;  1XUP O;  1TKD A;  4F3T A;  1OAO A;  3B51 X;  3WT0 A;  3THW B;  3B53 X;  1DTQ A;  2OW6 A;  4DV6 K;  3ULE A;  4HUG A;  1NKE A;  3DX0 A;  2HBL A;  3OA9 A;  2BUP A;  3DOK A;  5FRO A;  4CJ4 A;  1SKS A;  2ALW A;  1I49 A;  3L0Q A;  2D0P A;  3VGL A;  4CER A;  5EY4 A;  4FM3 A;  1JJ2 M;  1TUY A;  2Q0R A;  3ZEU A;  3ITH A;  1TK0 A;  4IWV A;  5JIC A;  5BRF A;  3TR8 A;  4DR7 K;  3R3L A;  5H1S Q;  4FW1 A;  4GVM A;  4CD3 A;  3EO3 A;  2O8B B;  3G0Z A;  4Q0B A;  4H0V B;  3ZX2 A;  4DHY A;  4WF9 L;  1VSK A;  4O0J A;  3VA3 A;  2P51 A;  5EX5 A;  4DQQ A;  4YOT A;  3ISN C;  4FPA A;  1IV0 A;  4GVE A;  1I4T A;  4KKO A;  4BEB A;  2G8H A;  1O7D C;  4DTS A;  5M1K A;  1M90 O;  3O4W A;  1TQS A;  3WUH A;  1A5V A;  2B4J A;  2A6A A;  5GIP A;  1S22 A;  2A1S A;  2YX6 A;  3LL3 A;  3LZI A;  4KRE A;  4H0X B;  1U4B A;  3ENO A;  3KK2 A;  5IT9 O;  4BDZ A;  2FIC A;  1QWU A;  1Y2O A;  1GLB G;  2G8I A;  3VQE A;  2XO7 A;  1T6C A;  4JAX A;  4BG8 A;  1QSY A;  4JD2 A;  3LMF A;  4CGI A;  3D0P A;  4FJ7 A;  1S1U A;  4HHT A;  3ULE B;  2PYJ A;  3OYI A;  1NM1 A;  4JKC A;  4G6Q A;  3SYV A;  3T3F A;  3N8E A;  3IFR A;  1WSF A;  4H4O A;  3H46 O;  5C0Y A;  2Q12 A;  2QW9 A;  3SK3 A;  2F7R A;  3L4Q A;  4DQP A;  4CZK A;  2E4L A;  3KD5 E;  1JLG A;  3I0S A;  3VEZ A;  3BVU A;  2KFZ A;  3O9R A;  2ZF5 O;  2YHW A;  4JI6 K;  1CZA N;  1TQU A;  2E1Z A;  3ULD A;  4C8O A;  1I4L A;  3IRX A;  1SUQ A;  4FJL A;  5ADX H;  2VQE K;  1OH8 A;  1FJG K;  3ALY A;  3QE6 A;  3NF9 A;  2O8D A;  1W97 L;  3SAF A;  3J81 O;  1WBD A;  1RT5 A;  2P9L A;  4AZG A;  4FZZ A;  4IWP A;  4BNE A;  3QIC A;  4C1N K;  1BGX T;  2ZGY A;  2NNW A;  3PV8 A;  3AO1 A;  4G9Z A;  1HLU A;  1XC9 A;  3AVA A;  3HO1 A;  1QZ5 A;  4FLU A;  3IMX A;  2BH1 A;  3D52 A;  2HNZ A;  4GV3 A;  1I3A A;  4CGH A;  1WAF A;  2JWK A;  2UUA K;  1RT6 A;  4M7X A;  4FZP A;  1HJR A;  2G8K A;  3F9M A;  3DAW A;  1X04 A;  3VF6 A;  3CQX A;  1VSF A;  3OYE A;  4DTO A;  4RG8 A;  4FW2 A;  3ZEF A;  1EWR A;  4OX9 K;  1N33 K;  1VSI A;  4Z0U A;  4W5N A;  4AZH A;  3WXJ A;  3SBT B;  3CCL N;  5BN8 A;  4I9Q A;  4F4K A;  3C95 A;  1HPM A;  3NAE A;  3WXL A;  1WSJ A;  2A5X A;  3BDP A;  4DR6 K;  3O6W A;  1TV6 A;  2F7O A;  4U67 L;  3SBS A;  1NK6 A;  2P5G A;  1DG4 A;  1R5E A;  4NB4 A;  1NGF A;  4YOU A;  3RWU A;  1X9M A;  1WAJ A;  2D0A A;  3BVX A;  1HKB A;  4H0T B;  4IJN A;  4M3R A;  3PO4 A;  5JS1 A;  1HNI A;  1LAV A;  2XY5 A;  4J2B A;  4JWD A;  4I6M A;  2HHI A;  4B9U A;  1SU8 A;  1UAX A;  3AVC A;  3B6P A;  1WSE A;  2DPN A;  3OYB A;  1I39 A;  4A61 A;  3OBW A;  4LH5 A;  3TTF A;  4FZY A;  5FPD A;  1OH5 A;  1TAU A;  3ZSW A;  2VWJ A;  3A8Y A;  4QAG A;  3KK3 A;  1LW2 A;  2WIN M;  3J80 O;  1NGB A;  2QA4 N;  1VQO N;  4EZT A;  4M7Y A;  2QTD A;  1LAW A;  4CEB A;  5BN9 A;  5KBP A;  3SAG A;  1KC8 O;  4E81 A;  2KZZ A;  2QXF A;  3VTH A;  2GEM A;  3H08 A;  3HST B;  2W40 A;  3FZH A;  3LP2 A;  4E72 A;  4BAC A;  4TSX A;  1YTA A;  2LSN A;  2IC3 A;  4CZH A;  1BCO A;  3WQT A;  2O8E B;  2OYQ A;  4GV6 A;  3VEY A;  4B3O A;  4DR3 K;  2DTU A;  1ASW A;  3P31 A;  1LV5 A;  1SKR A;  4ELU A;  5SWM A;  4F9O A;  4DTR A;  3CJA A;  1NWK A;  1VSE A;  2E2Q A;  2I5J A;  2YHA A;  3ID6 A;  1Z6R A;  5F2R A;  4DR2 K;  3VA0 A;  2WC9 A;  1Z25 A;  1W0H A;  4CJK A;  4E7K A;  4HR1 B;  3RR7 A;  2AJQ A;  2YKM A;  2RF2 A;  1NGE A;  4DTP A;  4I6M B;  5HRS A;  4JI1 K;  4ISF A;  3DX2 A;  3C7N B;  3DOL A;  5E26 A;  4A57 A;  2E5L K;  1VSL A;  1BO5 O;  5FPN A;  2G8F A;  4DU3 A;  2P9S A;  3RV0 A;  1NGI A;  5AZJ B;  3T69 A;  1TGO A;  1W2B M;  2FF6 A;  1KAY A;  3G6E N;  5DMR A;  3WNF A;  2HOE A;  3CHW A;  4I2Q A;  3ZT2 A;  3HP9 A;  1NK9 A;  5GAD P;  1HWW A;  2BTF A;  3MMV A;  3ZET B;  3CFR A;  4R79 A;  4ISG A;  1URU A;  3DDG A;  3LM9 A;  3JS6 A;  3OK8 A;  3SLC A;  3SYZ A;  4DSL A;  1GOC A;  4JKH A;  3O4N A;  4DSI A;  4FJG A;  1MDU B;  3K5L A;  3UIT A;  2Y1J A;  1S3X A;  4ID1 A;  2LM0 A;  5AJ3 K;  4KTQ A;  2ZE2 A;  4KB1 A;  5KTQ A;  4DCH A;  2VYP A;  2XY7 A;  2PZS A;  4AM7 A;  2YL5 A;  3THX B;  1ASV A;  1TK5 A;  1VRT A;  4M41 A;  3MN7 A;  2Z1G A;  4NPH A;  3TAP A;  2GV9 A;  5CZ2 A;  3OWG A;  3KHY A;  1QSL A;  3S3N A;  1N5Y A;  2O8E A;  3O08 A;  3DPQ A;  3PSF A;  4FWQ A;  3CI5 A;  4Q5V A;  2UU9 K;  3BF1 A;  3UIQ A;  1DKZ A;  2PYL A;  2GUI A;  5JVH L;  3MWP A;  3R9P A;  5KRT A;  3D7E O;  4BR2 A;  4MDA A;  4FWL A;  3VQ6 A;  3I39 X;  3DDF A;  3HAH A;  4JWE A;  3TAF A;  1E4G T;  4Z4G A;  1ZBF A;  4LF5 K;  1EO1 A;  4EZQ A;  2D5R A;  5CHI A;  1N34 K;  4B3M K;  4NXN K;  2UXD K;  3OYK A;  2QWL A;  4OKJ A;  3HM9 A;  3B6O A;  4F01 A;  4O44 A;  4KPY A;  4J2E A;  3NF7 A;  1D9D A;  4D8J A;  5AFU A;  4AZ6 A;  1U48 A;  4PO2 A;  4DG1 A;  4M3X A;  3AVB A;  1QX1 A;  3NMU A;  2EFK A;  3LDN A;  4IBN A;  1KTQ A;  4CHQ A;  1FXX A;  1RIL A;  1EQY A;  5HL7 L;  5F1X A;  1N8R O;  4YY3 K;  2QWN A;  3VF2 A;  1D9F A;  2QXL A;  3CV5 A;  1ZWW A;  1VSJ A;  4MLE A;  4CJW A;  4YOY A;  4PY5 A;  1DEJ A;  5FPE A;  2C1I A;  5MLC Q;  1S6Q A;  2KKZ A;  3DLK A;  2HHW A;  5C2F A;  4O0I A;  3SJH A;  1GLF O;  4IDH A;  1N36 K;  3OYM A;  4FJM A;  2QKW A;  3NGZ A;  3V9S A;  4Z94 A;  1QSS A;  2P9P A;  2Q36 A;  3KKS A;  4H5V A;  4FPB A;  1VK0 A;  1IKV A;  3TU5 A;  4CZF A;  3AO3 A;  4K43 A;  3ZYY X;  5C10 A;  1RDW X;  4DV7 K;  2YHX A;  4JI5 K;  5LMU K;  4OLB A;  4DV3 K;  4FM1 A;  2ASM A;  2PAV A;  2CH5 A;  4BRM A;  3ZEU B;  4BRE A;  3CKD A;  1XHZ A;  3CCQ N;  3RR8 A;  4OPH A;  3AV9 A;  4H5W A;  2D4C A;  1RTJ A;  2KLA A;  2OBL A;  3V1O A;  4ELV A;  1IKX A;  2D0C A;  2ZM6 K;  3EJQ A;  2XY8 A;  5KQD A;  3ZT0 A;  2OW7 A;  4I1Q A;  2NRH A;  1C0U A;  3NHG A;  1D8Y A;  5BR9 A;  1JCG A;  4NCG A;  4XEI A;  3O4Q A;  5AQR A;  1TL3 A;  4CCH A;  3RPM A;  3ZT3 A;  1P8Z A;  3KK7 A;  3VF4 A;  4RW8 A;  4PA1 A;  4WFB L;  5FLE X;  4H03 B;  4AZ7 A;  1VQ7 N;  4DSF A;  4B9T A;  1SU7 A;  5AQT A;  3O3N B;  2WTU A;  3MWT A;  4DFM A;  3S5T A;  1VQN N;  3FFK B;  4EZO A;  4JK9 A;  3SUO A;  4H0O A;  4O5B A;  1S9E A;  3BUB A;  1JLQ A;  2Q31 A;  4M3Y A;  3LDP A;  1RDA A;  1U49 A;  1IBL K;  1QQN A;  4O5F A;  3LAK A;  3KVG A;  4IWQ A;  4GNI A;  2Z0O A;  4A5B A;  3CYM A;  4DS5 A;  3R1X A;  3D6R A;  1JQK A;  4NLB A;  4IOA L;  3E66 A;  3I55 N;  1WDZ A;  1GLJ O;  1BQM A;  3AVG A;  4MQ3 A;  3AAR A;  4FK2 A;  3C94 A;  3EE8 A;  2OTJ N;  1NJZ A;  4DF4 A;  1XWL A;  4BWM A;  1YJ9 N;  3ZSX A;  5J1E A;  2F4V K;  2HHS A;  4JN4 A;  2O8C B;  4RW7 A;  3DQG A;  4C8L A;  3QLH A;  1WSI A;  1YF5 L;  2YNH A;  3T4A G;  3O80 A;  2HHQ A;  3KKR A;  1BCM A;  1TL1 A;  3AA5 X;  2ZWH A;  3L6Q A;  1T05 A;  3OYL A;  1HJO A;  3ERC C;  4J8F A;  4X65 K;  3U9D A;  3ZSV A;  4CF9 A;  1QZ6 A;  3OS2 A;  3PX6 A;  4BC3 A;  2YHY A;  4C8N A;  4FK4 A;  1NGA A;  4A59 A;  2ZGZ A;  3BZK A;  3V81 A;  3CCM N;  4JLC A;  3H1Q A;  4AHR A;  3MEC A;  1X9J A;  1EKE A;  3BF3 A;  4DR4 K;  3EJT A;  3AAQ A;  4IDK A;  3P38 A;  3MEG A;  5AZJ A;  2I7N A;  1K8K A;  3DLR A;  3KWG A;  5HRR A;  3C6H A;  4BQL A;  4E7H A;  4DSK A;  3L3O M;  3HRG A;  3K5N A;  4R5I A;  4JK7 A;  3NDK A;  3BY5 A;  1NU0 A;  1KSP A;  3DLB A;  3DXM B;  4O4G A;  1Q5L A;  2FSK A;  3E01 A;  2F7T A;  3VES A;  4CZG A;  4EZU A;  4KFB A;  2P9U A;  4EIA A;  5I42 A;  1UPX A;  4X62 K;  4CK1 A;  4R5P A;  1S5J A;  3CQY A;  2QKB A;  3BVT A;  1BI4 B;  4CF1 A;  1YIT N;  4GW6 A;  4KHP K;  5C2D A;  4C23 A;  2NRX A;  3MAQ A;  4LFA K;  3KLF A;  4H5T A;  2HMI A;  1Q82 O;  1Q7Y O;  4M3T A;  5DM6 L;  4L8R B;  2ND0 A;  4KIK A;  2O8F A;  3HVT A;  1T8E A;  5AQP A;  3RVC A;  3O3M B;  5GAG P;  3R6M A;  3CJ1 A;  4IW0 A;  4DLG A;  1GNL A;  2W6K A;  4EZR A;  3H1V X;  2YV0 X;  2ITM A;  2P9K A;  3AVJ A;  3VGK A;  2F7Q A;  2YLA A;  5E41 A;  3ZSR A;  3HAJ A;  4ILH B;  2RE2 A;  2GAF D;  3QA8 A;  4IEE A;  2YJF A;  1NK8 A;  1Q9X A;  3LLL A;  3MCP A;  3K5M A;  3HPH A;  3P39 A;  3DXM A;  1T44 A;  1E1D A;  2YNG A;  4MLH A;  1O13 A;  1YTU A;  4CJT A;  3AVI A;  2IGI A;  4JKE A;  3A5N C;  4M42 A;  3E9L A;  2KHO A;  3VKH A;  3O8M A;  3P83 D;  2PY6 A;  1HMV A;  3CJC A;  2IAJ A;  1IBK K;  3CJ7 A;  4B3T K;  3AY9 A;  2NRZ A;  4BRO A;  1O1W A;  2RPI A;  3CC4 N;  5JLH A;  4N5S A;  4WQ4 A;  3L2W A;  4CJQ A;  4CZI A;  2Z1H A;  5DM7 L;  4LF9 K;  4JL9 A;  3OS0 A;  4BE0 A;  4DTX A;  3CCS N;  1UA1 A;  3SCX A;  4QOZ B;  1HKG A;  1XQS C;  3SMS A;  3HM8 A;  4OPA A;  2ND1 A;  3LP0 A;  1U2V B;  3QEI A;  3SUN A;  3RMA A;  1HX1 A;  2HBJ A;  3AA4 A;  3DRP A;  2IIR A;  1RTI A;  3CFO A;  3VQ9 A;  4A5A A;  1R0A A;  4QS9 A;  1K73 O;  2ITG A;  5C15 A;  4CI6 A;  1G15 A;  2HHV A;  4CFA A;  1HUX A;  2IVN A;  4ILJ A;  1BIS A;  4CF0 A;  2HNY A;  4Y1D A;  4CHP A;  2YHB A;  5CY4 A;  3D4Y A;  3BEX A;  3Q84 A;  4FOE A;  4FJI A;  3THV A;  3HSC A;  3VPZ A;  3K9K A;  1L3V A;  1WNS A;  2P9K B;  3U9Z A;  2GWJ A;  3D2E A;  4E3S A;  5M1P A;  3ZET A;  1U2V A;  4OPK A;  1RT4 A;  1NG9 A;  2HW3 A;  1E3M A;  1IJJ A;  3EJU A;  3MXI A;  3K58 A;  2WOM A;  3KK1 A;  4BVO A;  2HVH A;  2NLX A;  2HHH K;  2X74 A;  4WPC A;  4BR7 A;  4JLH A;  4BRC A;  4JKB A;  4PL7 A;  4JNF A;  4BRF A;  3LZJ A;  4B1U B;  3HI0 A;  3CPE A;  3KAW A;  3HOS A;  1SS6 A;  4CED A;  4JKG B;  4CJV A;  3R8E A;  4IFY A;  1BG3 A;  2AP1 A;  4FYD A;  1BHL A;  3M3Z A;  1WN7 A;  2OA8 A;  4ILI A;  2ASP A;  4YHH K;  1KFD A;  3V9Z A;  1WSH A;  2N3K A;  3OYH A;  4KI6 A;  1OA1 A;  1U00 A;  5GIO A;  3TTC A;  3I2W A;  3OJS A;  3FZK A;  1C1C A;  2FBY A;  1XI1 A;  2HBM A;  2FBT A;  3EZ5 A;  1KQS M;  2X3V A;  3FD9 A;  1RTH A;  4JV5 K;  3VOV A;  3EKU A;  1A5X A;  2HHT A;  3ZED A;  1TKX A;  1HYS A;  4YNQ A;  3K5O A;  3DLG A;  4PKG A;  5BRD A;  3SJJ A;  4AH9 A;  3WXK A;  3LDO A;  3TSU A;  1QQM A;  4DKW A;  3IAY A;  3OS1 A;  3OW2 M;  3IS9 A;  1ASU A;  1BWF O;  4LFB K;  1TYQ B;  4XH5 A;  5BPM A;  4OGC A;  3SQ4 A;  4R5K A;  1C0T A;  4BQZ A;  4QS7 A;  4HYB A;  2P9P B;  1SV5 A;  4RTF D;  3CC7 N;  3VQP A;  4IOC L;  3SUP A;  3G4S N;  1WSG A;  3L8B A;  4F2R A;  4WE1 A;  4CJR A;  4DV0 K;  5IWA K;  3CG7 A;  4JWC A;  1VQL N;  3CJB A;  1EET A;  4BRK A;  4O55 A;  4XH4 A;  4B9N A;  1QTM A;  1S9G A;  2HHX A;  2RN2 A;  4DR5 K;  3HVR A;  1V4S A;  1NGD A;  3HOT A;  4BE1 A;  5FIG A;  3PX0 A;  1VQ4 N;  4PUO A;  3SV3 A;  4RW6 A;  4BR0 A;  4M45 A;  1FW6 A;  4AVM A;  3QET A;  2OPQ A;  2UXB K;  1IO2 A;  2E1Y A;  4DFP A;  3LP1 A;  4CF8 A;  3RMD A;  5KPR A;  3TWH A;  4JI7 K;  2IS3 A;  5AR0 A;  4B3R K;  2JLE A;  4NO7 A;  2Q3S A;  2Q2R A;  4FM2 A;  4CEF A;  2EX3 A;  3CJ9 A;  4Z4I A;  3QEX A;  4HY9 A;  1U6Z A;  3ZX0 A;  1SZ2 A;  1HNV A;  2HMP A;  3SBG A;  5M1F A;  2F1A A;  3V1Q A;  4IZ9 A;  3TAG A;  1ITG A;  3L3P A;  5KPZ A;  4JNE A;  4NXM K;  4FLY A;  3O3F A;  4AHT A;  3LDS A;  5EOY A;  1S1X A;  4I7F A;  4JHD A;  2W6L A;  2FBX A;  3KIO A;  3K57 A;  1KVA A;  2EWS A;  3OYF A;  4H5N A;  4GV9 A;  4E0D A;  5F0X A;  4M3Z A;  5HBM A;  4LF6 K;  4CIG A;  3D2E B;  1VQ9 N;  3T7Z A;  3HK2 A;  3M3W A;  2YIV X;  3C6A A;  3LAM A;  2ZQB A;  3C6T A;  3QO9 A;  3SI6 A;  3BGR A;  4B9V A;  5AQU A;  4CE9 A;  4E19 A;  2VQF K;  4BRI A;  4KB0 A;  4FWN A;  3B8A X;  2Z8Y A;  3UB5 A;  4BRQ A;  1Q8I A;  4DQS A;  1KRP A;  3RTV A;  4E1M A;  3LVT A;  4RWT A;  1RBR A;  2WBN A;  3BP8 A;  3ER8 C;  3LWL A;  1OH7 A;  1HYV A;  4IKF A;  4WQ4 C;  4LSN A;  2YL8 A;  3BUZ B;  4CFB A;  3OTO K;  4BRH A;  1BOT O;  2FLO A;  2YI1 A;  1JCF A;  4DV4 K;  1ZBH A;  1NGG A;  3DPO A;  2UUB K;  3DYA A;  3A2F A;  5HRN A;  4DTJ A;  4RCH A;  2P5O A;  1J53 A;  4DV5 K;  2QEX N;  2EFL A;  3RSE B;  5BRE A;  4UY8 O;  1ZBS A;  1JL1 A;  2V52 B;  3QER A;  4EP4 A;  3UKU A;  3DLE A;  2QFF A;  4Z4H A;  3DX3 A;  4IG0 A;  5K14 A;  1CXQ A;  1TQT A;  3UKR A;  5CE3 A;  4ILG B;  1KVB A;  2KTQ A;  3CAZ A;  4GY2 B;  3NH2 A;  4KHS A;  4JEP A;  3VEW A;  5AQS A;  5T7B A;  1I4D A;  4F00 A;  1LOT B;  5LMN K;  2OZM A;  4EZX A;  3QIN A;  4LC9 B;  1SAZ A;  3QFU A;  4AQY K;  3IDH A;  2BPR A;  1NOY A;  1IG8 A;  2X78 A;  3U8X A;  3IKM A;  1DTT A;  3V9X A;  4CGF A;  3JAM O;  3ZT1 A;  1VRU A;  5C24 A;  3WXM B;  4FWS A;  4BRL A;  2GTD A;  3CFP A;  2JGU A;  1XC3 A;  1FKO A;  2Z1J A;  5I3U A; 
#chains in the Genus database with same CATH homology
 4IM0 A;  1T6D A;  3B53 X;  1YI2 N;  4UDX X;  2E2N A;  3FZM A;  3ULE A;  2AA4 A;  1KXP A;  4EFH A;  2HBL A;  4YDU A;  3R1X A;  3OA9 A;  3D6R A;  1JQK A;  4BRN A;  4NLB A;  2P9L B;  4BRG A;  4WQ5 A;  2W41 A;  4C1N I;  4DB3 A;  4IOA L;  1QHA A;  2BUP A;  3E66 A;  3I55 N;  1GLJ O;  4BY9 C;  3NVK A;  4KIK B;  3AAR A;  3WQU A;  2IVO A;  1K8A O;  3EE8 A;  3GE1 A;  3O9S A;  2H3G X;  3L0Q A;  2D0P A;  3VGL A;  2OTJ N;  1BA1 A;  5EY4 A;  4FM3 A;  4H6H A;  1JJ2 M;  1TUY A;  1YJ9 N;  2Q0R A;  3ZEU A;  2OP6 A;  3CXC M;  4IWV A;  5JIC A;  4AF1 A;  5BRF A;  3I56 N;  4JN4 A;  4IM3 A;  2A41 A;  3MX2 A;  3GG4 A;  3R3L A;  3DQG A;  5H1S Q;  3FZF A;  3B52 X;  1WOQ A;  4Y0W A;  1YF5 L;  4IWO A;  3EO3 A;  4CD3 A;  3ER9 B;  1W9M A;  3O3O B;  2RHK A;  3T4A G;  3C7N A;  2GWK A;  3O80 A;  4H0V B;  3ZX2 A;  3A5O C;  5AQF A;  2YCH A;  4DHY A;  4WF9 L;  2ZWH A;  3L6Q A;  1C0G A;  5EX5 A;  4YOT A;  4CBX A;  2E8A A;  1HJO A;  3ERC C;  4J8F A;  3U9D A;  4FPA A;  4WV5 A;  1QZ6 A;  4A5B A;  1YXQ A;  4FWO A;  4GVE A;  1KAZ A;  1KD1 O;  3CME N;  4BC3 A;  4BEB A;  2YHY A;  5M1K A;  1M90 O;  1NGH A;  3O4W A;  3WUH A;  1KC8 O;  1NGA A;  4PKI A;  4YDU C;  2A6A A;  1M1K O;  4A59 A;  5GIP A;  2D4W A;  1S22 A;  2ZGZ A;  2YX6 A;  3LL3 A;  1NGJ A;  1K9M O;  2NRR A;  1DKG D;  2OAN A;  3JXU A;  3TPQ A;  3M5R A;  4U7B A;  4H0X B;  1G99 A;  5AQK A;  3ENO A;  4CJ7 A;  3CCM N;  4JLC A;  4PL8 A;  3H1Q A;  3H0X A;  1V4T A;  1GLB G;  1X9J A;  3MCA B;  4B1X B;  3BF3 A;  3AAQ A;  1T6C A;  4JAX A;  3DJC A;  3P38 A;  4CZE A;  1E2U A;  3QDK A;  4BG8 A;  2I7N A;  5AZJ A;  3WEE A;  1K8K A;  3KWG A;  3C6H A;  4JD2 A;  4BQL A;  1MWK A;  3F7W A;  3L3O M;  3LMF A;  3HRG A;  5AQG A;  5AQM A;  3AGR A;  3ULE B;  4R5I A;  4JK7 A;  1NM1 A;  4JKC A;  4G6Q A;  3DXM B;  2Q0U A;  3FZL A;  3QBW A;  1Q5L A;  2VCP A;  2FSK A;  3LDL A;  3N8E A;  1SQK A;  3WEE B;  2F7T A;  2HF3 A;  3IFR A;  4BRD A;  3CCR N;  3VES A;  1YAG A;  4B1W B;  4CZG A;  5KPT A;  4EZU A;  1YJW N;  2FF3 B;  2P9U A;  3H46 O;  1SU6 A;  3I8B A;  1UPX A;  3Q7B A;  4HWI A;  4EIA A;  5C0Y A;  2QW9 A;  1C0F A;  3CQY A;  3SK3 A;  4BG9 A;  4FWK A;  3L4Q A;  1YIT N;  4CZK A;  3CF5 L;  5LY3 A;  3VEZ A;  2E2O A;  3CC2 N;  3O9R A;  3CPW M;  2ZF5 O;  4C23 A;  2YHW A;  5C2D A;  1BPR A;  1CZA N;  2NRX A;  2E1Z A;  5CR4 A;  3GOI A;  4H5T A;  5ADX H;  1Q82 O;  2P9I A;  3CIP A;  1YVN A;  2NRW A;  1Q7Y O;  3HBT A;  5DM6 L;  5E84 A;  3ATV A;  2ND0 A;  4KIK A;  1NJI O;  1W97 L;  4EAH D;  2E20 A;  3UKR B;  3SAF A;  5AQP A;  5FPM A;  3O3M B;  1DT9 A;  3RVC A;  3HTV A;  3R6M A;  5GAG P;  5M1N A;  2P9L A;  4IW0 A;  3CJ1 A;  1GNL A;  2NRV A;  4EZR A;  4IWP A;  3H1V X;  3W3D A;  4E1J A;  3QIC A;  4C1N K;  3O1W A;  2ITM A;  1X3N A;  2ZGY A;  4JKD A;  2NNW A;  4BRA A;  2P9K A;  1ZYL A;  2GA9 D;  2GUP A;  4R5L A;  2PBD A;  3HOT A;  3VGK A;  3A5M C;  4G9Z A;  1HLU A;  1QZ5 A;  4ILH B;  2RE2 A;  2GAF D;  3QA8 A;  3IMX A;  2J4R A;  2BH1 A;  4IEE A;  3SAH A;  2YJF A;  4GV3 A;  3O1B A;  5B8H A;  2GX9 A;  1GLL O;  2JWK A;  5AZI A;  3DLL L;  4M7X A;  1YHQ N;  3MCP A;  4H0Y B;  3SMP A;  1QVF M;  1RFQ A;  3F9M A;  3P39 A;  4YOX A;  3DAW A;  4K42 A;  4BGA A;  3DXM A;  1T44 A;  3VEB A;  3CQX A;  1E1D A;  3VF6 A;  4MLH A;  1O13 A;  3GDQ A;  3G71 N;  5EVZ A;  3ZEF A;  5BPL A;  3FLC O;  3O9U A;  4JKE A;  3T46 A;  3A5N C;  1BUP A;  3ID8 A;  4JD2 B;  3WXJ A;  3SBT B;  2KHO A;  3E9L A;  4FO0 A;  3CCL N;  5BN8 A;  2YJE A;  3VKH A;  1RGI A;  3O8M A;  3EKS A;  1HPM A;  3H3N O;  2PY6 A;  1Z05 A;  1YUW A;  3WXL A;  3CJC A;  3ATU A;  3I04 A;  3FE1 A;  5BPN A;  2YIB A;  1DGK N;  2A5X A;  3AY9 A;  3CJ7 A;  2NRZ A;  3H6E A;  4BRO A;  3O6W A;  4NLC A;  4U67 L;  4XJX A;  3CC4 N;  2E2P A;  3SBS A;  3P4I A;  5JLH A;  4E3C A;  4WQ4 A;  1DG4 A;  1WUA A;  4NB4 A;  1NGF A;  1MJG A;  4CZI A;  4YOU A;  4WV7 A;  5DM7 L;  1RDU A;  4K41 A;  4JL9 A;  5TKY A;  1HKB A;  1VAZ A;  2I7P A;  4H0T B;  4IJN A;  5EXW A;  1Q18 A;  4IO8 A;  3CCS N;  2ZJR L;  1HKG A;  4JWD A;  4EZN A;  1XQS C;  2V7Z A;  4I6M A;  3SMS A;  5JLF A;  4FL9 A;  3HM8 A;  2QWQ A;  1SU8 A;  2ND1 A;  2CGL A;  4OPA A;  5AQY A;  5GIN A;  3E1Y A;  4EZS A;  2DPN A;  1U2V B;  1VQP N;  2ZJQ L;  4A61 A;  4I43 A;  2QWM A;  2QI2 A;  3OBW A;  3TTF A;  3FGU A;  2F9T A;  1HX1 A;  2HBJ A;  4JHD B;  5FPD A;  2IIR A;  3DWL A;  1TYQ A;  4A5A A;  3CCU N;  2RT6 A;  3KZB A;  3C65 A;  4QS9 A;  5M1O A;  3NVM A;  3MDQ A;  3N4P A;  3A8Y A;  1GLE G;  3VEX A;  5C15 A;  4CI6 A;  4BR5 A;  5JVG L;  1K73 O;  1HUX A;  2IVN A;  2A40 A;  2WIN M;  3F2K A;  3CCV N;  1GLD G;  5CE3 A;  3RV1 A;  4ILJ A;  1GLA G;  3CCE N;  1BDG A;  1NGB A;  4BVP A;  2QA4 N;  1VQO N;  4EZT A;  4M7Y A;  3QNJ A;  2QTD A;  3F5T A;  1DKX A;  5M1Q A;  3OBY A;  3CCJ N;  2EX3 B;  2P9U B;  3A0I X;  4WYB A;  3KAV A;  3BEX A;  5LJV A;  4FOE A;  3VEO A;  4EZP A;  1Y64 A;  5BN9 A;  4IOX A;  2P9S B;  3HSC A;  3VPZ A;  2WUS A;  4E81 A;  4R5J A;  3T49 A;  3K9K A;  3SAG A;  3VTH A;  3OHR A;  2GEM A;  1ESV A;  2P9K B;  2UYT A;  4KBO A;  3U9Z A;  4JWI A;  2GWJ A;  3D2E A;  3I33 A;  2W40 A;  3FZH A;  5M1P A;  5ELZ A;  3ZET A;  4YOV A;  1U2V A;  4EHT A;  4ILG A;  1IJJ A;  3MN9 A;  4CZH A;  3WQT A;  1R59 O;  4HR1 A;  5ADX A;  4GV6 A;  3D2F B;  4BVO A;  3VEY A;  2NLX A;  4M0M A;  4KH5 A;  3UKU B;  3GI7 A;  3GL1 A;  5AQZ A;  4BR7 A;  3M6G A;  4DQ8 A;  3P31 A;  4BRC A;  4JKB A;  3KWI A;  3DOB A;  5AQI A;  4EZZ A;  3L4I A;  4JNF A;  4BRF A;  4FWP A;  5AQJ A;  4PL7 A;  3E9O A;  4QS8 A;  4B1U B;  3HI0 A;  3CPE A;  3KAW A;  3HOS A;  4F9O A;  3CJA A;  1SS6 A;  4WCE L;  4JKG B;  4O8U A;  4WQ5 C;  1NWK A;  3R8E A;  2E2Q A;  1GNT A;  3ID6 A;  1BG3 A;  1Z6R A;  2AP1 A;  2IVP A;  3M3Z A;  5F2R A;  2WC9 A;  3E9P A;  4CZM A;  4ILI A;  2ASP A;  2ZJP L;  1GLC G;  4HR1 B;  3PIO L;  1HKC A;  4EHU A;  3PIP L;  1NGE A;  2N3K A;  4I6M B;  2QWR A;  1OKJ A;  1OA1 A;  1NBW A;  4FOI A;  1U00 A;  3C7N B;  4ISF A;  5E26 A;  3CET A;  4MDB A;  4A62 A;  2NZT A;  3TTC A;  4A57 A;  5GIO A;  1BO5 O;  3AGK A;  3FZK A;  4WFN L;  5FPN A;  4IO9 L;  1S72 N;  1X3M A;  2HBK A;  2HBM A;  4JKA A;  2P9S A;  3RV0 A;  1KQS M;  3FD9 A;  1NGI A;  5AZJ B;  3VOV A;  5AZI B;  4K25 A;  3EKU A;  3ZED A;  3T69 A;  4JKF A;  4H5R A;  1W2B M;  2V51 B;  4UDY X;  4PKG A;  2FF6 A;  5BRD A;  1ATS A;  2P9N B;  3EN9 A;  1KAY A;  1LCU A;  3G6E N;  3UE5 A;  2YI8 A;  3WXK A;  3LDO A;  3S41 A;  3TSU A;  5JMV A;  4OO1 J;  2X5C A;  2HOE A;  1NMD A;  3CHW A;  3ZX3 A;  2PFU A;  1QQM A;  4DKW A;  1D4X A;  1J6Z A;  5GAD P;  2BTF A;  3OW2 M;  2OTL N;  4IJA A;  2E88 A;  1BWF O;  3MMV A;  2CGJ A;  3T48 A;  4PKH A;  1TYQ B;  3T47 A;  4EZY A;  4XH5 A;  4ISG A;  3O5B A;  3ZET B;  4BC4 A;  5GAE P;  5BPM A;  4R79 A;  3LM9 A;  1VQ6 N;  4R5K A;  3JS6 A;  4BQZ A;  3SLC A;  5TKW A;  3J8A A;  2NRT A;  2VWB A;  4JKH A;  4QS7 A;  4HYB A;  1VQ8 N;  4BGB A;  2P9P B;  2V7Y A;  3QB0 A;  4RTF D;  3CC7 N;  2JNS A;  4A2B A;  1MDU B;  4IOC L;  3VEN A;  3UIT A;  4YOW A;  1VQ5 N;  2W00 A;  1S3X A;  1VQM N;  2LM0 A;  2CGK A;  3G4S N;  4XH1 A;  4DCH A;  4JWC A;  4IEI A;  2VYP A;  3CJB A;  1ATR A;  4JKG A;  1VQL N;  4AM7 A;  4MO5 A;  4BRK A;  4BE7 B;  4XH4 A;  1JCE A;  3H3O B;  2P9N A;  3MN7 A;  2QWO A;  3ENH A;  3W0L A;  4NPH A;  1V4S A;  1NGD A;  3A98 A;  3OWG A;  3C0B A;  2HF4 A;  5FIG A;  3MN6 A;  4IM2 A;  3KHY A;  3VET A;  1QVG M;  2HST A;  1VQ4 N;  4BEC A;  2JWL A;  3O08 A;  4BR0 A;  2NCZ A;  3DPQ A;  4FWQ A;  3CI5 A;  3M1F A;  3VMF B;  3BF1 A;  4CZL A;  1DKZ A;  2Q1N A;  3U4L A;  4CD1 A;  5JVH L;  3MWP A;  1MWM A;  3R9P A;  4B9Q A;  1YIJ N;  4A2A A;  2E1Y A;  3EL2 A;  4IXC A;  3D7E O;  5KPR A;  4BR2 A;  4KH4 A;  4FWM A;  4MDA A;  3CER A;  5AR0 A;  2EWF A;  4AM6 A;  1KAX A;  4R5G A;  4FWL A;  3I39 X;  3FR0 A;  4JWE A;  4B1Y B;  5AQV A;  4NO7 A;  2QM1 A;  1H1V A;  1E4G T;  2Q2R A;  3VER A;  4HTL A;  1EO1 A;  1OA0 A;  4EZQ A;  1DKY A;  3CJ9 A;  4HY9 A;  5CHI A;  4B1Z A;  1U6Z A;  3EZW A;  3ZX0 A;  4H6I A;  1SZ2 A;  3SBG A;  2HMP A;  1T3V A;  5M1F A;  1E4F T;  4IZ9 A;  2QWL A;  3VEA A;  5KPZ A;  4JNE A;  4F01 A;  4L3Q A;  5EOY A;  4JHD A;  4D8J A;  5AFU A;  4EZW A;  3A5L C;  4PO2 A;  1MA9 B;  3TTD A;  3MN5 A;  1BA0 A;  2D0O A;  4BC2 A;  3KDR A;  3DXK B;  2EWS A;  4H5N A;  3LDN A;  3NMU A;  4GV9 A;  4WFA L;  1EQY A;  5F0X A;  5F1X A;  1CKR A;  5HL7 L;  3DXK A;  1N8R O;  3D2E B;  3B51 X;  2QWN A;  1VQ9 N;  3VF2 A;  3WT0 A;  3T7Z A;  2QXL A;  1Q81 O;  1E9V A;  2Q97 A;  3O9T A;  2YIV X;  3C6A A;  4MLE A;  4O8K A;  3CMA N;  1TUU A;  4YOY A;  3J7Z O;  3QFP A;  3HZ6 A;  3RSE A;  1DEJ A;  5FPE A;  2YI9 A;  2C1I A;  2VGM A;  4MO4 A;  5AQU A;  5MLC Q;  4YOR A;  3OHX M;  4BRI A;  2KKZ A;  3VGM A;  5C2F A;  1OVY A;  1ZXO A;  3GBT A;  3SJH A;  3D2F A;  1GLF O;  4IDH A;  1YJN N;  4ISE A;  4FWN A;  3B8A X;  2Z8Y A;  3UB5 A;  4BRQ A;  5AFU H;  5HOO A;  5I9E B;  4RWT A;  4Z94 A;  3CD6 N;  3LM2 A;  2P9P A;  2Q36 A;  5AQL A;  1ILY A;  3WXI A;  4H5V A;  4FPB A;  2WBN A;  3BP8 A;  3TU5 A;  3ER8 C;  4H0P A;  2QWP A;  5AQN A;  4CZF A;  4K43 A;  3ZYY X;  2A3Z A;  3EE9 A;  4WQ4 C;  2P9I B;  5C10 A;  3G25 A;  3TSP A;  3BUZ B;  1RDW X;  4EZV A;  4BRH A;  4CBW A;  3MX5 A;  2VGN A;  3QML A;  1BOT O;  2YHX A;  1K8K B;  3ENB A;  2FLO A;  2YI1 A;  1JCF A;  4BR4 A;  2WFB A;  4CZJ A;  1Q86 O;  1SUF A;  2ASM A;  2PAV A;  2CH5 A;  3AAP A;  1NGG A;  3DPO A;  4BRM A;  3ZEU B;  4BRE A;  3CCQ N;  4RCH A;  4OPH A;  2FSJ A;  4ILH A;  4H5W A;  4JK8 A;  1NLV A;  2KLA A;  3VTI A;  1ZC6 A;  2OBL A;  2GEL A;  2D1K A;  2ASO A;  2QEX N;  3RSE B;  4FWR A;  4M63 C;  2OBM A;  5BRE A;  5LJW A;  3K9J A;  1ZBS A;  4UY8 O;  5AQX A;  4IFE A;  2V52 B;  3TSQ A;  3MK6 A;  5KQD A;  4CBU A;  2F9W A;  2NRH A;  5GAH P;  4PHT X;  2C1G A;  3UKU A;  2QFF A;  3H45 C;  5KQ8 A;  5BR9 A;  1JCG A;  3Q7C A;  4XEI A;  5AQR A;  4BRP A;  4BC5 A;  5AQW A;  3DPP A;  3SBT A;  3N4Q A;  3PLA A;  3UKR A;  1P90 A;  4ILG B;  3O9Q A;  1P8Z A;  3KK7 A;  5AQQ A;  3VF4 A;  4GY2 B;  1BU6 O;  4BR9 A;  3QBX A;  4B1V A;  2FSN A;  4JEP A;  5AQO A;  4FSV A;  3VEW A;  5BRH A;  4WFB L;  5AQS A;  5FLE X;  4H03 B;  4F00 A;  1LOT B;  2YIA A;  3I01 A;  2CH6 A;  2FXU A;  1VQ7 N;  1NGC A;  4EZX A;  4LC9 B;  1SU7 A;  5AQH A;  3O3N B;  1ATN A;  3LDQ A;  5AQT A;  1SAZ A;  3QFU A;  4KH6 A;  3IDH A;  3MWT A;  2BPR A;  3IUC A;  1IG8 A;  3U8X A;  1GN9 A;  3IKM A;  1VQN N;  3FFK B;  4EZO A;  7HSC A;  4JK9 A;  4H0O A;  1VQK N;  3VEV A;  4FVU A;  3WXM B;  4FWS A;  4BRL A;  2A42 A;  2GTD A;  2Q31 A;  4MQD A;  3LDP A;  5C12 A;  1QQO A;  1XC3 A;  1XUP O;  1QQN A;  1OAO A;  4O5F A;  3KVG A;  4IWQ A;  4GNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...