4JN4A

Allosteric opening of the polypeptide-binding site when an hsp70 binds atp
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
600
structure length
600
Chain Sequence
b'SGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 192
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00012 HSP70 Hsp70 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jn4A05
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jn4A04
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jn4A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jn4A01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jn4A03
1NBWA 2ASPA 2YHWA 4EIAA 5JICA 1JCEA 2V52B 2HOEA 3FZMA 4EZNA 3ZX2A 4BRGA 3O1BA 3FLCO 4ISEA 3CI5A 3DPPA 4O5FA 4CD3A 1JCFA 3WT0A 4CJ7A 5E26A 3DAWA 4F01A 2GELA 3DPQA 1HKGA 2D1KA 2P9PB 1S22A 3EKUA 3MN5A 2P9KB 4JWDA 4B1ZA 4FWNA 1OKJA 3LDNA 5AQXA 2E1ZA 3ENHA 4H0OA 4B1UB 3UKRA 4HWIA 3ZETB 2FXUA 4B1WB 3H1VX 1ESVA 3A8YA 5F2RA 4JAXA 2BPRA 4BC3A 4FO0A 3FZFA 2P9UA 4BR2A 1RFQA 4H5VA 4BR5A 2P9LA 4B1YB 3AAPA 4BRQA 1NGJA 1U2VB 3T47A 3D2EA 4H5TA 4XEIA 3VGMA 1CZAN 2FLOA 1GLFO 2UYTA 3H6EA 3ATUA 4RCHA 3VEXA 2AA4A 3T46A 4KBOA 4EZXA 3BP8A 1QQOA 3CJAA 3T48A 4EZQA 4FWSA 5AQLA 3W3DA 4PL7A 2KHOA 1DGKN 1QZ6A 3MMVA 4JD2B 2WINM 5JLHA 2D4WA 1NGHA 3VPZA 3QICA 1XQSC 2E88A 1LOTB 2FSKA 1CKRA 1NLVA 3I8BA 4DB3A 1C0GA 1X3MA 3R9PA 4MO4A 1ZBSA 5BN9A 3LM9A 2D0OA 2YCHA 4M7YA 1G99A 4L3QA 4Z94A 3O8MA 2A6AA 3DXMA 3QBWA 4GNIA 4O8KA 1C0FA 3CJBA 3VEOA 4BRDA 5BR9A 3FR0A 3O1WA 3GG4A 3LDPA 4CZIA 3D2FB 5AQYA 3M3ZA 1K8KA 1ZXOA 3R8EA 2YHXA 7HSCA 3CIPA 2E2OA 3ZEUB 2A42A 2E8AA 5EVZA 2QWRA 2ZGYA 4XH1A 5AQGA 4H6IA 4PKHA 5EY4A 4R5IA 3SK3A 4WQ4A 2GWJA 3FZKA 2P9UB 4FOIA 3VETA 4JWIA 3RSEA 2P9IB 2CGKA 4A61A 4EZOA 3EO3A 4H6HA 2W40A 4B1XB 4F9OA 4A2BA 4JN4A 3KZBA 3DXKB 4CZFA 4H0TB 2QXLA 1Q18A 1KXPA 3SMSA 1E4GT 5BRDA 3VF2A 3C7NA 3IMXA 5AQSA 4BRLA 2E2QA 3BUZB 3GL1A 4PL8A 3UKUA 4CBWA 2ZWHA 2OP6A 1NGFA 4CZHA 3VENA 2GTDA 4H5RA 3ZX0A 4BR0A 5AZJB 1GLEG 1RDWX 2E1YA 4WQ4C 4R5GA 4H0XB 4R5KA 1NM1A 3TPQA 5LJVA 3U9ZA 4M7XA 2QM1A 1BUPA 1V4TA 3LDLA 4EZRA 3GOIA 5LY3A 3QNJA 4WV7A 5AQNA 1K8KB 1ZC6A 4B9QA 2FSJA 3CHWA 3FZHA 1J6ZA 4BROA 3L0QA 3MCPA 3A0IX 3I33A 4BC2A 4FWRA 5AQVA 5EOYA 2YJEA 2A3ZA 3H3OB 3WXLA 5CE3A 5AQPA 3A5NC 3CERA 4H5NA 4DQ8A 1SQKA 4ISGA 4YDUA 2A40A 4FPBA 3CJCA 4H03B 4WYBA 5FPEA 5AQHA 4EAHD 3FFKB 5ADXH 3A5LC 2CGLA 4DHYA 1BDGA 4JNFA 2PAVA 4BVOA 3C7NB 1T44A 3DJCA 3AARA 1HJOA 2F9TA 1X3NA 2E2PA 4J8FA 2QWMA 4BRNA 2V51B 5AQIA 1Q5LA 2QWOA 3FZLA 1Z6RA 1BO5O 4MLEA 2AP1A 3WEEA 5KPTA 1BU6O 3GE1A 1V4SA 2P9NA 3H0XA 4H5WA 3BF3A 3IUCA 3IFRA 4EZSA 2I7NA 4FOEA 5AZIA 3A5OC 2ZF5O 4R5JA 3EL2A 3LDOA 5EX5A 1QHAA 4CZEA 1RGIA 2OANA 4K41A 5KQ8A 4FWLA 5F0XA 3SMPA 4HY9A 4YDUC 3OHRA 2QFFA 1T6DA 2F9WA 1NGIA 4FWPA 1XUPO 3WQUA 2V7YA 1TUYA 2QWPA 3AY9A 5AQZA 3UE5A 1U00A 2CH6A 1GLJO 1NMDA 4K42A 3CQYA 2ASMA 3T4AG 4K25A 1HX1A 1DEJA 3L6QA 4B1VA 2QWQA 3DQGA 3CJ1A 4I6MA 3O80A 5AQRA 3W0LA 1YXQA 3UKRB 3CQXA 3WXKA 4A62A 3L4IA 5AQOA 5BPMA 4JHDA 1KAXA 3JS6A 2NZTA 3O5BA 5BPLA 3BEXA 2Q0UA 4CBXA 2ITMA 3H46O 3VEWA 4PKGA 3WUHA 3C0BA 3MK6A 4XH5A 4BG9A 2DPNA 1MWMA 3R6MA 5JLFA 1YVNA 3OHXM 4F00A 3UB5A 2FSNA 2P9LB 1BPRA 4RWTA 5FPDA 2P9SA 2ZGZA 3D2EB 3DPOA 1KAYA 4M63C 2IVOA 5BRHA 1GLCG 4HTLA 3MDQA 4EZWA 1Y64A 4BVPA 5AQQA 2HF3A 2BTFA 4EZZA 3ATVA 3FGUA 2VCPA 3ID8A 3QDKA 1WUAA 4DCHA 1ATRA 1MA9B 2P9PA 1KAZA 2P9KA 1SZ2A 1BA0A 3AAQA 2H3GX 2Q97A 1SAZA 3A5MC 3HM8A 5AQTA 4E81A 1BWFO 4PKIA 4IJAA 1X9JA 1HKBA 3O4WA 3VOVA 3ZETA 3DXMB 3WXIA 2A5XA 5BPNA 3LM2A 4A2AA 3KVGA 2HF4A 1T6CA 1HLUA 3DOBA 3O08A 3IDHA 1GLDG 1NGCA 2PBDA 5AFUA 3EZWA 4I6MB 1TYQA 3VERA 3VF6A 1BOTO 1U2VA 4JHDB 4BRPA 4K43A 4LC9B 3MN7A 4CZGA 5EXWA 1DKZA 3MN9A 1DKXA 3VEVA 3ULEA 4BR9A 3HTVA 3MN6A 1XC3A 3RSEB 4FWKA 2Q36A 3ZX3A 1H1VA 4BRFA 3H1QA 3EN9A 4NB4A 4EHTA 4JD2A 4WQ5A 3N8EA 3QMLA 3VF4A 4QS8A 4IO8A 2ASOA 4FWMA 4BRHA 4BREA 4BC5A 4BRMA 5LJWA 1DKGD 1EQYA 1NGGA 2IVPA 1GLAG 4EFHA 4EHUA 2V7ZA 2W41A 3LDQA 4BG8A 3TU5A 1BA1A 3O6WA 5AQUA 2QWLA 3HSCA 4BGBA 1MWKA 3UKUB 3BF1A 2NLXA 1JCGA 3EKSA 1YAGA 1DKYA 3D2FA 5BREA 2BUPA 2WUSA 4BR7A 5B8HA 2VWBA 4XH4A 4JWCA 1HPMA 3GDQA 3U8XA 1BG3A 1NWKA 3ZEUA 5AQJA 4H0PA 1NGDA 3HI0A 1TUUA 3F9MA 1P8ZA 2QWNA 4MLHA 4BQLA 1TYQB 4WQ5C 2YJFA 5TKYA 2HMPA 2Q2RA 5AQKA 2P9IA 4RTFD 3KHYA 2EWSA 4C23A 1IJJA 3HBTA 4R5LA 2Q1NA 3M6GA 2VYPA 4IZ9A 4E1JA 4CD1A 1YUWA 1NGEA 3ULEB 5FPMA 1WOQA 3QBXA 3DXKA 4NO7A 3U9DA 1NGAA 2FF3B 4FPAA 4H0VB 4MO5A 4FWQA 2E20A 1ATSA 5AFUH 4BRKA 4BRAA 3CJ9A 1HKCA 3JXUA 4ISFA 3VEZA 1QQMA 1Z05A 3CJ7A 4FL9A 2D0PA 4EZVA 3CETA 2GWKA 5FPNA 3P4IA 3WXJA 1DG4A 5AR0A 3QFUA 3S41A 4FSVA 1IG8A 1GLBG 4GY2B 4Y0WA 4IJNA 5AZJA 2Q0RA 3D7EO 3VESA 3WQTA 4CZLA 5F1XA 4HYBA 2IVNA 3H45C 1U6ZA 2A41A 3VGKA 1GLLO 5BN8A 3H3NO 5KPRA 5E84A 4IWVA 2NRHA 1E4FT 2YHYA 1MDUB 5AQWA 1QQNA 2FF6A 3L3OM 1HUXA 3WEEB 4BRIA 2CGJA 4CI6A 3U4LA 2P9NB 4BQZA 4BGAA 5ADXA 5ELZA 2Q31A 3B8AX 3M1FA 4CBUA 1LCUA 3VEYA 2J4RA 5AZIB 1R59O 3LL3A 3FE1A 3T49A 4WV5A 3SJHA 1QZ5A 2GUPA 4CZKA 4QS9A 4H0YB 2QW9A 2CH5A 4BRCA 4PO2A 3ENOA 4JNEA 2I7PA 1S3XA 1D4XA 4EZYA 1ATNA 4QS7A 3QB0A 4EZTA 2GEMA 4FWOA 3SLCA 5KQDA 3GBTA 1NGBA 2YI1A 2E2NA 3VGLA 5AQFA 2IIRA 3J8AA 4IXCA 4AM6A 3G25A 4EZUA 5AQMA 5KPZA 5I9EB 4CZJA 4BR4A 4CZMA 4EZPA 4BC4A 5JMVA 4AM7A 3HZ6A 3QFPA 4JWEA 5BRFA 3DWLA 2P9SB
chains in the Genus database with same CATH superfamily
2ASPA 1JCEA 4BDZA 2V52B 1SUFA 4OGCA 3ZX2A 3TWHA 3RWUA 4CJ7A 1U04A 2EX3B 3K9KA 4C8LA 4DFJA 2HNYA 2D1KA 4NXNK 4M3UA 3EKUA 1S6PA 3ZCMA 5GINA 3RVCA 1YF5L 4FZXC 4IWPA 1B9DA 3B52X 1BIZA 3QE6A 3HAHA 3AVNA 4B1WB 4GKKK 3H1VX 5DK5A 3KK3A 4JAXA 1J54A 1I94K 4FJMA 3KDRA 4LSNA 1RFQA 5GIOA 2LSNA 3AAPA 4OO1J 4UDYX 4DWIA 1RDDA 3VQ9A 3P39A 3QEIA 3KLEA 3B53X 1FKOA 3QEXA 3PLTA 3VEXA 3HOSA 4KBOA 3W3DA 1WSEA 4RW6A 3ZSRA 4I7FA 2HBKA 1Q9XA 2C1IA 2WINM 5KGWA 2D4WA 1N32K 1S1UA 1Q86O 1XQSC 3B6PA 3ZT1A 1LOTB 1YJ9N 1CKRA 1C0GA 3B6OA 1SL0A 1ZBSA 1SUQA 3OBYA 1XI1A 5JVHL 4PWDA 2O8DB 4L3QA 4ZTJA 1JL2A 3O8MA 4Z94A 3PX0A 2JNKA 3C95A 3O3MB 4DV5K 3NGZA 3VEOA 3IS9A 3KLGA 3HXMA 4G1QA 3O1WA 3LDPA 4DSFA 2FBYA 4UY8O 5AQYA 1HMVA 1LWFA 1OH5A 4G6QA 3MXIA 1ZXOA 4IDHA 3F2KA 2YHXA 3DDGA 7HSCA 2E2OA 4IFYA 3LPTA 1TKTA 4DR1K 2QWRA 4PKHA 3S9HA 5EY4A 4ZTFA 4I2QA 1Q82O 2P9UB 5J2MA 5BR8K 3QESA 4H4MA 1RBVA 4DTXA 4BE0A 1Q7YO 2Q3SA 3SJJA 3EO3A 4H6HA 3WNFA 4F9OA 4A2BA 3OYCA 4BE1A 3KZBA 3TAGA 1VSMA 3L2QA 5M1FA 3OW2M 4CZFA 4DTSA 4H0TB 2QXLA 4Q5VA 4CEAA 3VF2A 3ERCC 5GADP 3IMXA 2P5OA 2E2QA 3GL1A 1JLQA 1HNXK 4Z4CA 4JS4A 1KQSM 1A5VA 4BDYA 1GLEG 1RDWX 3MWPA 3AO3A 4FXDA 2YL9A 2IC3A 4M7XA 4MDBA 3ER9B 3U9ZA 3DYAA 1SU6A 3LDLA 1VRUA 2IAJA 3CVRA 4RW8A 3GOIA 5LY3A 1K8KB 1BI4B 1ZC6A 5M1PA 2FSJA 3SOGA 1J6ZA 3AA3A 4KHWA 3TAPA 3AVBA 1WB9A 4FJKA 1SKWA 4BC2A 4DQQA 3QEWA 2UUBK 5EOYA 2HBLA 3BUQA 3RTVA 2PY5A 5AQPA 2HW3A 4DQ8A 1R0AA 4DV7K 4FZPA 4IG0A 1SQKA 4FPBA 3AVHA 3CJCA 5MLCQ 2PZSA 3O4QA 3A5LC 2CGLA 5KGXA 1J5EK 1BDGA 3TAFA 4NYNA 3DLGA 1JLAA 3CG7A 4B9UA 2V51B 3OYIA 5M1OA 4LF4K 1Z6RA 3VQEA 4H4OA 3BVXA 5CZ1A 3LVTA 5HRNA 1TK5A 4H5WA 1D9FA 4CCHA 3B51X 1I4TA 3CKDA 1ZYQA 3BF3A 2UXBK 5JENA 4CEQA 2I7NA 4FOEA 3A5OC 1S1XA 2WTUA 1Q9YA 4K41A 3SAGA 2OA8A 1SU7A 3M8QA 1JLFA 2F9WA 3WQUA 1XUPO 4B3MK 2V7YA 1TUYA 2OO2A 4A5AA 4N47A 3UE5A 1U00A 4I9LA 3TTDA 1GLJO 4K42A 3ZT0A 3CQYA 4AZBA 2ASMA 1QE1A 1DEJA 3L6QA 4B1VA 2HVHA 2QWQA 3CJ1A 3KK7A 1NOZA 3O80A 2QA4N 3W0LA 3WXKA 5AQOA 4ILHA 2AJQA 4JHDA 3JS6A 2NZTA 4DUYK 4CGFA 3O9SA 3EY1A 3H46O 4JKBA 4O0JA 4XH5A 4BG9A 2RAJA 2Z0VA 5JLFA 1YVNA 3OHXM 4F00A 4PHTX 2O8CA 2PYJA 2O8BA 1SL2A 2YLLA 2BDPA 3LP1A 4AHRA 1JKHA 1LAWA 4KH6A 5GIPA 4F4KA 4OLBA 4EZWA 3CZSA 2UUCK 3ATVA 4I1QA 3E9OA 2GX9A 1NKEA 4JI4K 3OS0A 3V1RA 2F1AA 1L3TA 3Q0KA 2EWFA 4HR1A 5C5BA 1YJWN 2YIAA 2H3GX 4JI8K 4YOWA 4E0DA 3HM8A 5AQTA 4E19A 4E72A 3QO9A 3V4IA 4IJAA 1X9JA 2F8SA 1KFSA 2YL6A 4C8NA 3LM2A 3MEGA 1XHXA 3CCVN 1NGCA 4BE2A 3K2PA 3K9JA 4J2EA 4I6MB 4NLBA 3VF6A 3O9TA 4LH5A 4HUEA 1JXBA 3I8DA 4B3RK 3ZYYX 4FYDA 3L3PA 4CF9A 1DKXA 1VQ9N 3NHGA 4OLAA 2ALWA 5EU7A 1CLQA 1XC3A 3VQQA 4O8UA 4BRFA 2Q36A 1RDBA 3V81A 3EN9A 4EHTA 3N8EA 5GAGP 3VF4A 4E7JA 2G8IA 4IO8A 4BRHA 1Q8IA 3MWTA 3VQDA 4BRMA 4FM3A 2NNWA 4WCEL 2O4IA 4EFHA 4EHUA 2W41A 3BUBA 4KO0A 3LDQA 2JGUA 4BG8A 4U67L 3HSCA 1Z26A 2O4GA 3HK2A 3RRHA 4XJXA 1QVGM 3G0ZA 1XHZA 4M3TA 3D2FA 2YNGA 2WUSA 3QLHA 3DRPA 2VWBA 4JWCA 1VRTA 3U8XA 3OY9A 3NF6A 2OTJN 4OPKA 4F2SA 4WPEA 1P8ZA 1RT7A 4BQLA 1K73O 1TYQB 3AVFA 2A1SA 4FZSA 3BUPA 2O8FA 5AQKA 2Q12A 2Y1IA 4GKJK 3HBTA 4R5LA 2VG7A 3CMEN 4E1JA 1YUWA 3DXKA 4CK3A 2FF3B 2E20A 1QSYA 1ATSA 3IG1A 5AFUH 4CEFA 3JXUA 3PV8A 3CETA 4EZVA 1MJGA 4KHUA 2YL8A 4DTOA 5FPNA 3WXJA 5AR0A 3T69A 3ID6A 4H8SA 3IKMA 2UXDK 4HYBA 3M5RA 1GLLO 4FLYA 5E84A 3Q7CA 4DQIA 1QQNA 2FF6A 3P38A 1QS4A 3U4LA 4BQZA 4CESA 5ELZA 1M90O 3ULDA 3TSUA 3P31A 1U47A 1RDAA 2FBTA 2J4RA 3ER8C 4C1NI 5FRNA 3LL3A 2G8UA 1B9FA 3ZSWA 4PA1A 1YTUA 2GUPA 2W6LA 3VQ5A 3NGYA 5HL7L 1BIUA 2Z1IA 1D4XA 4WFBL 4EZYA 3SBTB 3OTOK 1NK7A 2PYLA 1RDCA 4DV6K 3SLCA 1Z25A 4KHPK 2F1BA 2RKIA 1NGBA 4AHTA 4FVUA 2QKKA 1RT4A 3HPGA 3VGLA 3V9ZA 3QEPA 2EFLA 3L2RA 3IRXA 4AM6A 4IM2A 1KVBA 4DG1A 5AQMA 5KPZA 3Q84A 3AVAA 2OBMA 4EZPA 2ELBA 2G8VA 3MEEA 2O8CB 3ZSOA 4W5NA 5BRFA 2O8BB 3DWLA 4CVNE 3M3WA 1ZBHA 4AZHA 2HOEA 5A2QO 4J2AA 3F7WA 4O0IA 3CI5A 1HNIA 1KSPA 4L8RB 2HHTA 3I01A 4B3OA 4R79A 1HRHA 3M8PA 3UITA 3DAWA 2GELA 1S1WA 5M1KA 4IBNA 3D52A 2O8DA 4X64K 3DPQA 3T1AA 4FJ9A 4OKEA 3KJVA 1LAVA 4HR1B 5C5BB 1ASVA 3ZSVA 4B1ZA 3VQ6A 3BUIA 2E1ZA 4Z0UA 2IS3A 2JWLA 4H0OA 4B1UB 3UKRA 2MI7A 2FXUA 1ESVA 2ITGA 3OYEA 2BPRA 3LANA 2F4VK 2P9UA 1YWMA 1K6YA 4RG8A 4H5VA 3ASMA 4CEEA 4C1NK 1L3SA 1NGJA 1U45A 3T47A 1HWWA 3CCQN 2GA9D 3VGMA 3PX4A 1QSSA 4M3RA 4KHQA 1ZYLA 4IM3A 3VQ4A 3H6EA 2W00A 1WAJA 1YT3A 2AA4A 2YX6A 4FWSA 4EZQA 4PL7A 3CFOA 1DGKN 1QZ6A 1B92A 4OKKA 1NKBA 2X3VA 2FSKA 5FLXO 3I8BA 3MEDA 4PQUA 3VQAA 1X3MA 3R9PA 5C2FA 5BN9A 3RV1A 4AZ5A 4B9TA 4CJ5A 3DXMA 4CW7B 4LFBK 3QBWA 3SQ4A 4BRDA 4NPHA 2G8WA 4CZIA 3D2FB 3MAQA 1K8KA 3R8EA 1IKXA 1JLEA 2BH1A 3LWLA 3CIPA 4IO9L 2NRWA 3DOLA 2ZGYA 4H6IA 1DLOA 2OZNB 3SK3A 4JI1K 1UOCA 4JWIA 4KH4A 2P5GA 4MDAA 2O8FB 4Z4IA 1X04A 1TQVA 1N6QA 3L2WA 3DXKB 3AVKA 1X9MA 2X5CA 2X3XA 1Q18A 4AHVA 2B6AA 5H1SQ 2G8FA 3PIOL 1JLBA 5AQSA 4J2DA 3DX4A 3PIPL 3UKUA 4CBWA 1NK4A 4CGDA 4CZHA 2A1RA 3AVMA 3ZX0A 1VQ7N 2HHQA 1NOYA 4O4GA 3SUQA 2RPIA 4I2PA 1BCOA 2E1YA 3OBWA 3DM2A 3I04A 4WQ4C 1U4BA 2QK9A 4JS5A 3VTIA 1LW2A 3K5NA 5LMUK 4EZRA 1LW0A 1W7AA 4WV7A 4FJ7A 4B9QA 3AV9A 4KIKA 4BROA 3A0IX 3LP3A 4FWRA 3NMUA 2YJEA 4O44A 5JS2A 3H3OB 3WXLA 3A5NC 1YITN 3LLLA 4ICLA 3K5OA 3C65A 4B08A 4BWMA 3C6UA 4W5RA 5FPEA 3SUPA 5ADXH 1TGOA 3SUNA 1F21A 4JNFA 1Y2OA 5C0YA 4LF7K 4BVOA 3C7NB 3CC2N 4X66K 2WYIA 5JS1A 4UQGA 1X3NA 3NF8A 2QWMA 4E7LA 3VN5A 5DM6L 1Q5LA 2QWOA 3FZLA 2HHHK 1HR0K 5KPTA 2F96A 3AO5A 4WE1A 3BZCA 4M3WA 4WF9L 4FM2A 2QKBA 4KAZA 4BDPA 3E01A 4B8CA 3QIOA 3HP6A 4JKCA 4F2RA 4ILIA 5AZIA 2ZF5O 4R5JA 4M3XA 1EWRA 5EX5A 3LDOA 3DLEA 3HVTA 1X03A 2KQ2A 1U48A 3SV3A 2RAKA 3SMPA 2YHAA 4HY9A 1BQMA 4YDUC 4LF9K 1T6DA 1NGIA 1M1KO 2QWPA 3AY9A 3I0SA 2WC9A 1R34A 4KREA 4IOAL 3T4AG 5AJ3K 1HX1A 3J80O 4OPHA 3EJTA 3TAQA 4I6MA 3NVMA 4W5TA 3UKRB 3VA3A 5BPMA 1LV5A 4IWOA 2R7YA 1KAXA 3ZEFA 2FYVA 4CBXA 2F7TA 3C0BA 2DPNA 1MWMA 1TK8A 3BLBA 3SYZA 2FSNA 4RW4A 4RWTA 3THYA 2P9SA 2ZGZA 3DPOA 4IOCL 1KAYA 4M63C 2IVOA 2OYQA 4DV0K 1NJIO 3KAWA 5C15A 5SWMA 2HF3A 3OYNA 4EZZA 3NBPA 2P1JA 2FBXA 1REVA 3VQCA 3ID8A 2D0CA 3QDKA 1KCFA 4JRPA 2P9KA 4C8KA 2Q97A 1SAZA 2EHGA 3A5MC 4ELTA 4BACA 4PKIA 4CK2A 1R5EA 4DQSA 1LWCA 1UPXA 2D4CA 3O4WA 3THWA 4JKHA 1JJ2M 3DXMB 1LQ7A 2A5XA 5BPNA 3KLIA 4A2AA 1T6CA 1HLUA 3DYTA 2ZJRL 3IDHA 5C25A 3D4YA 1SV5A 1TYQA 3R1XA 4DTMA 4FLVA 4BRPA 1NK8A 3ZT3A 4LC9B 3NH1A 4C8MA 4CZGA 1DKZA 1JLGA 2N3KA 3OJUA 4BEBA 4DLEA 3I39X 4FWKA 3DLKA 3H1QA 3L2VA 4A57A 4WQ5A 3NVKA 2O8EA 4Y1DA 3ZSXA 3LAKA 5LJWA 1DKGD 3ZLJA 1GLAG 4NLCA 4R5PA 3TU5A 5AQUA 2ND0A 4F3OA 3JSMA 2YNIA 4EP4A 1U49A 3BUDA 4BGBA 1O7DB 1RDUA 1RT6A 3O9QA 3UKUB 2WOMA 1JCGA 1EXQA 1WSFA 3ZT4A 4BR7A 3S5TA 3P1GA 4XH4A 3CFRA 4O55A 3ZEUA 5AQJA 4CJQA 2ETJA 2GF4A 2ZE2A 3K57A 2GV9A 1SKRA 3DX0A 4CFCA 3EYZA 1IO2A 5TKYA 3O9RA 2HMPA 3EZ5A 1TVRA 1IKYA 4HTUA 2VGNA 3T19A 1OH7A 4KIKB 3Q7BA 1NMNA 3PX6A 4CIFA 2OBLA 1IJJA 3KD5E 2Q1NA 3CYMA 2VYPA 1ZBFA 4AHUA 2JWKA 5C12A 3CV5A 5FPMA 2OW7A 3SBTA 3QWEA 3OYJA 2VG6A 1WN7A 1NGAA 3PO5A 3RMCA 4CFBA 5KTQA 5FRMA 1YJNN 1UAXA 4BRKA 3F73A 3DLHA 1HKCA 1QQMA 4ILGA 1Z05A 2W6KA 3HVRA 1VK0A 2GWKA 4FLTA 4E1MA 1NK0A 4K8ZA 1IG8A 4GY2B 3DI6A 5AZJA 2Q0RA 3VESA 3WQTA 2HMIA 5F1XA 1U6ZA 4RW9A 3H3NO 4IWVA 1HNVA 2OPPA 3ITHA 1SKSA 4CJWA 1HUXA 2CGJA 4CI6A 4IDKA 5HROA 1RT1A 1CXQA 3B8AX 4CBUA 4DYLA 1ZBIA 4QAGA 3VEYA 3HP9A 3BGRA 4CHQA 5AZIB 3FE1A 3T49A 3HRGA 5M1QA 2QW9A 2CH5A 4N5SA 3AVLA 4FJ8A 2I7PA 1S3XA 4ELVA 2OW6A 2XHBA 2D0AA 3CCLN 1PS3A 4DSEA 4NCGA 5C42A 4JI2K 2WONA 3DLLL 5KQDA 3P5JA 2ZM6K 2E2NA 4WFAL 1I3AA 3RMBA 5AQFA 3PSIA 1CZBA 5C24A 1IBKK 4EZUA 3K59A 3BY5A 3NH2A 2HHWA 3NCIA 1IBMK 1NJZA 3HZ6A 4JWEA 4GV9A 3RR7A 2RN2A 1VSJA 3TAMA 3THYB 1VQNN 2P9SB 1NBWA 4EIAA 1J5OA 3OYHA 2DTUA 4KI4A 3E1YA 4BRGA 3O3OB 3FLCO 4FW1A 4O5FA 4CD3A 4PY5A 1JCFA 3SBGA 4JK7A 3R3LA 4DR4K 3LZJA 1HKGA 3HAIA 3LPUA 2P9KB 1UA1A 4JWDA 2GUIA 4FWNA 4DTJA 5AQXA 3PY8A 3I0RA 2YKMA 1Y97A 3ENHA 4GV3A 4DR6K 2JLEA 3THWB 1T8EA 4HWIA 3LWMA 4XIUA 1S72N 2KFZA 5F2RA 2I5JA 4BC3A 3K58A 3AGKA 1P90A 4K0KK 3QERA 4BR2A 4CHZA 4JI7K 4BR5A 2P9LA 1NJYA 4I43A 1ASWA 1C0UA 3D2EA 1UWBA 4KB1A 5E41A 2B4JA 2ZD1A 4E7HA 1GLFO 1W9HA 4YY3K 4Z4EA 3VEAA 5I3UA 5CYQA 3T46A 4EZXA 3RV0A 3CJAA 3T48A 4CGIA 4CJPA 3G10A 1ITGA 4CEOA 1D5AA 3MMVA 2QXFA 1RT5A 3LDSA 2O8EB 1ZBLA 4CECA 1NGHA 2F7RA 2E88A 1NLVA 2D0OA 2KKZA 1S6QA 1G99A 4YOXA 5HRSA 3DLBA 3WNEA 2A6AA 4CJFA 4DS4A 3J7ZO 4JEPA 4O8KA 3CJBA 1KRPA 2ND1A 2HHXA 3GG4A 3VTHA 1TKDA 2OZSA 2XY5A 5GAEP 3M3ZA 4KPYA 2ATQA 3EE9A 3ZEUB 1GOAA 5EVZA 1EO1A 4XH1A 3OVNA 3DLRA 3VQBA 4R5IA 1MU2A 3LAMA 3FZKA 5J2NA 3QNOA 3VEBA 4DSKA 3QA8A 2CGKA 4JKEA 4ILJA 2ZJPL 2F7OA 3G71N 2NRZA 2GAFD 4B9VA 4IG3A 4AQYK 1SU8A 2HNZA 4JRQA 4CJTA 2BANA 1KXPA 2XRIA 3SMSA 3G9GA 4M3ZA 4AZCB 3J7AP 1JLCA 3C7NA 4KB0A 3K5LA 4JYAK 4BRLA 2HVIA 4AZGA 1KVCA 5IWAK 1KD1O 2HHVA 4E3SA 4ILGB 1TQSA 1VSDA 3HPHA 3T1HK 1RNHA 4CERA 1NGFA 1EP4A 1BCMA 1RT2A 1VSEA 4U7BA 4BR0A 5AZJB 4NYFA 4Z4FA 4CF2A 4KRFA 4DF8A 3MX2A 1URUA 1W97L 1QTMA 4H0XB 3TPQA 4J2BA 2PMRA 2QI2A 5LJVA 1V4TA 1OA1A 4JKFA 3NF7A 5CZ2A 1YVUA 3KKSA 2VWJA 1EKEA 3CHWA 3FZHA 3GI7A 3L0QA 2DFHA 4CGGA 5HBMA 1DT9A 1TKZA 1QX1A 1VQ8N 5CE3A 3MXMA 1FJGK 3CERA 5KRSA 3BVWA 4KI6A 3HM9A 3VKHA 4WPCA 1RILA 3EJQA 2Q13A 4H03B 5AQHA 4EAHD 3FFKB 2FICA 3E66A 4DHYA 3N4QA 3S3MA 4JV5K 1VSIA 1VHXA 2PAVA 5HOOA 1S1VA 1S9GA 4CHNA 4A59A 2RHKA 3E9PA 1T44A 3AARA 1YHQN 3MCAB 3ZSYA 3AA5X 4E7KA 4BRNA 2IDOA 3HJFA 5AQIA 2XO7A 2VGMA 1BO5O 3GE1A 3CAZA 1IH7A 1D8YA 1C1AA 1TK0A 4AH9A 3QEVA 3V9WA 4DQRA 2NRTA 3EL2A 3WNHA 4N76A 1QHAA 1RGIA 4ELUA 2VWKA 4FWLA 5F0XA 2YNHA 3OHRA 2QFFA 4FWPA 4K8XA 1BQNA 2HHUA 1IBLK 3V9SA 3C6TA 3O3GA 4M41A 4KFBA 1NMDA 2KZMA 1VSKA 3OS1A 3KD1E 1I4LA 2X6SA 1J9AA 4JKDA 1RTDA 1RTHA 4YOTA 5AQRA 1YXQA 4A62A 2E6MA 3L4IA 4JKAA 1DTTA 3RR8A 5BPLA 2Q0UA 2ITMA 3VEWA 2E4LA 4FVMA 1L3VA 3MK6A 3C94A 3UB5A 5C10A 3DX1A 2P9LB 4I9QA 4AKVA 3D45A 4JK8A 3FD9A 3D2EB 1VQMN 3V6DA 4AZ6A 2YI9A 5BRHA 4HTLA 1VQKN 3G4SN 3PUFA 3O3FA 1Y64A 2OTLN 5AQQA 3FGUA 2PFUA 1QVFM 4DF4A 3U3GA 1VQ5N 1TQUA 3LALA 4CJKA 1GN9A 1WUAA 2OPQA 1ATRA 1C6VA 1MA9B 1HQUA 2P9PA 4DCHA 1KAZA 1XMOK 1S1TA 1SZ2A 1BA0A 3C6AA 5HRPA 4FM0A 4B3SK 4V19S 4DV4K 3OYMA 3AO4A 3TANA 1ZBUA 1BWFO 3UIQA 4JLCA 2RF2A 2F7PA 3V1OA 3A2FA 4AHCA 3ZETA 4KV8A 3KLHA 4KKOA 2VG5A 3KVGA 2HF4A 4IEIA 1RBRA 1T3VA 3DOBA 3O08A 2PBDA 5J2PA 2D5RA 3CCMN 5CHIA 3EZWA 4ZHRA 4FLZA 4E89A 1TAUA 1U2VA 3BVUA 3T7ZA 2HHSA 4FJXA 3TTFA 2EFKA 3TI0A 4NCBA 5TKWA 1VQON 3WXMB 3HTVA 1T05A 3SV4A 1C1BA 4NB4A 4GVEA 4JD2A 4H8KA 4C8OA 2RAIA 3ABHA 1EQYA 5KRTA 1NGGA 3DDFA 2V7ZA 2HB5A 3NGIA 1XWLA 2YV0X 4KTZA 1BA1A 3O6WA 1Q81O 2D1LA 3SUOA 4DCNC 4QCLA 3AO2A 4E3CA 1RBSA 1IV0A 1WSHA 1MWKA 3SQ1A 3BF1A 2NLXA 4CJ4A 1N34K 5CR4A 2E6LA 3CM6A 5B8HA 1D9DA 3KTQA 4MQ3A 4NSWA 3CPWM 1WDZA 4LF8K 4OJRA 1O13A 4CEBA 1ASUA 3HOTA 3F9MA 5KI6A 4FLUA 1NJXA 4CHYA 4AZ7A 2QWNA 4MLHA 1WBBA 1NU0A 4LY7A 3I55N 1KTQA 3AVCA 4FK2A 2YJFA 2YNFA 1N5YA 2Q2RA 3KIOA 4DR3K 2P9IA 3KHYA 2EWSA 4JKGA 3FFIA 2GBZA 4FJHA 3J81O 1NK9A 4CK1A 1NKCA 2B5JA 4FJIA 1WSGA 4CD1A 3RPMA 1NGEA 3ULEB 4OGEA 1UA0A 4NO7A 4KHSA 4H0VB 4FPAA 4MO5A 4FWQA 3TARA 3HAJA 4BRAA 2DFFA 4AF1A 4ISFA 1CZ9A 4Q0BA 4FL9A 4HVJA 4BWJA 1WSJA 4CJSA 1E3MA 1QQCA 4FSVA 4FLXA 1TQWA 4Y0WA 3KLFA 2VQEK 1NG9A 1YTAA 2OZMA 1I4DA 2IVNA 2P51A 4A5BA 4DSJA 3HL8A 2A41A 4M45A 3OA9A 4CF1A 1IG9A 4F8RA 1GNLA 1E4FT 1OVQA 2YHYA 5AQWA 4YHHK 3L3OM 4X62K 3SPZA 4DS5A 4CHOA 4BGAA 5ADXA 3OYKA 3KK1A 4FZZA 4IFEA 4DMNA 1R59O 3CQ8A 4IFVA 1JQKA 2HNDA 4YOUA 2W42A 2YL5A 1QZ5A 3SCXA 4CZKA 3NFAA 4DV2K 4H0YB 1T03A 3CPEA 3OJSA 4BRCA 4E7IA 3ENOA 3I56N 5FIGA 3LMFA 1EETA 1RT3A 1VSHA 1EX4A 4YNQA 1ATNA 5JVGL 3C6HA 3D6RA 4QS7A 3CCJN 2GEMA 4FWOA 1JL1A 1SL1A 2YI1A 3PLAA 2WYHA 3O3HA 3VA0A 4IXCA 5FDLA 4DLGA 4MQDA 3F5TA 4KH5A 1NK6A 4KHNA 5I9EB 2Z8YA 4BR4A 4BC4A 2OPSA 5JMVA 3CZNA 3QFPA 4X65K 4QOZB 3L8BA 2BGGA 3SBSA 3KAVA 1I39A 1C0MA 5I42A 4Z4GA 2YHWA 1G15A 3BVTA 5JICA 1HTYA 3O4NA 4M0MA 3FZMA 4EZNA 2UXCK 4DR7K 4DSIA 3MXJA 3ZSQA 3O1BA 4ISEA 3DPPA 4CFDA 3WT0A 3KK2A 3SZ2A 5E26A 4YORA 4F01A 4CJVA 4LF6K 1XNRK 3G6EN 3CCEN 1NK5A 2P9PB 1S22A 3L3VA 4B9SA 3D0PA 3MN5A 3L2UA 4DQPA 1OKJA 3LDNA 4ID5A 4CF0A 3DX2A 4EZ9A 4IOXA 1C1CA 3AVIA 4DU1A 4CJUA 3QIPA 1E1DA 1QWNA 4YOYA 3ZETB 4FZYA 3A8YA 1CXUA 1W2BM 3DRSA 4FO0A 3FZFA 1L5UA 3TTCA 1HXKA 1KFDA 4FJNA 4N41A 3MECA 4M3YA 2RT6A 1NNEA 2YIBA 3EEQA 4JK9A 4B1YB 4BRQA 1U2VB 4H5TA 1RTJA 4XEIA 3THXA 4O5BA 1CZAN 1RBTA 3AGRA 2FLOA 5HRRA 3KWGA 3A98A 4LFAK 2LM0A 2UYTA 4NQIA 1L3UA 3ATUA 4RCHA 3OWGA 3BP8A 1QQOA 5AQLA 2KHOA 1BISA 4AZCA 3ACOA 4JD2B 4DFKA 1A5WA 4JI5K 2ZXQA 5JLHA 3K0SA 4HUFA 1X9SA 1IKWA 4FK0A 3NF9A 4B9MA 3VPZA 3QICA 4Y1CA 2X6NA 4DB3A 3V1QA 4Z4HA 3RMDA 4MO4A 1FXXA 2UU9K 3LM9A 2YCHA 4M7YA 4YFUA 4KHYA 1RCHA 1J53A 2ZJQL 3T1YK 2V0OA 4GNIA 4B3TK 1C0FA 5BR9A 1QSLA 5CY4A 1OVYA 3FR0A 4CIEA 3O3NB 2VQFK 2ZQBA 2DY4A 2A42A 2X78A 2E8AA 5AQGA 2XY7A 1TQTA 4WQ4A 2GWJA 4FOIA 3VETA 3NAEA 4UDXX 3RSEA 4CJLA 4FK4A 1HQEA 2P9IB 3VQPA 3SQ0A 4A61A 4JKGB 4EZOA 1NJWA 3P83D 4NXMK 1BHLA 5M1NA 3U6FA 2W40A 4B1XB 4JN4A 4GV6A 2JNSA 2NUBA 3OYFA 2UUAK 4IM0A 4JI3K 4AZIA 5LL6Z 1ILYA 3JAMO 4E1NA 2PY6A 4CEZA 4OPJA 2E5LK 1WAFA 1YI2N 1E4GT 2XY8A 5BRDA 1BGXT 3BVVA 4JI0K 3EJPA 1N36K 3BUZB 4PL8A 4CJRA 2ZWHA 2OP6A 1LWEA 3VMFB 3D51A 3ENBA 4FJJA 1X9WA 2QTDA 4D8JA 3VENA 2GTDA 3L3UA 4H5RA 4EP5A 3PO4A 3RMAA 3DOKA 1OH8A 3HO1A 4KTQA 4R5GA 4GMJB 4AILC 4R5KA 1NM1A 1KLNA 2QM1A 1BUPA 3S3NA 1W9MA 3QNJA 3HT3A 5AQNA 4HCCA 1N33K 3JYTA 4CF8A 2F8TA 3QNNA 2IGIA 3TSQA 2YHBA 3MCPA 3MX5A 3I33A 4LSLA 5AQVA 4DKWA 3RRGA 2A3ZA 2QEXN 3AA4A 3BDPA 2LXYA 4H5NA 1O7DC 2Z1JA 1OAOA 4ISGA 4YDUA 2A40A 2NRVA 4WYBA 1WNSA 4WFNL 1RTIA 2Z1HA 3AA2A 2D0BA 1ZWWA 3QNIA 3NE6A 5J2QA 4FLWA 1S5JA 3DJCA 1HJOA 5DM7L 2F9TA 2E2PA 4J8FA 3NDKA 1IKVA 3CM5A 1WLJA 4MLEA 2AP1A 3WEEA 1KLMA 1BU6O 3ZSZA 1V4SA 2HBJA 2P9NA 3H0XA 5SZTA 1SS6A 3CD6N 3L4QA 3TAEA 1KVAA 3IUCA 3IFRA 1KC8O 4DU4A 3HSTB 4EZSA 5CYMA 2NCZA 4B9NA 4CZEA 2OANA 5KQ8A 3VQ7A 1HYVA 3HPOA 1X1PA 2Z0OA 2NRXA 5AQZA 4W5QA 5J1EA 3AVJA 2CH6A 1HYSA 4DFMA 1QWUA 2WFBA 4K25A 1HJRA 2HBMA 4RW7A 3CFPA 3SQ2A 1K9MO 3DQGA 4CJ3A 3ISNC 1VQ6N 4CGJA 3CQXA 1QHTA 2O0I1 1O1WA 4HUGA 1TAQA 3O5BA 3ALYA 3BEXA 2NRRA 4IW0A 3OYAA 3OYBA 3WUHA 2X3WA 4PKGA 3QINA 1XNQK 3R6MA 4JLHA 4DR2K 1BPRA 5FPDA 3LZIA 4IWQA 3N4PA 3THXB 4LFCK 1RBUA 3CCUN 3CMAN 3IAYA 2G8KA 1GLCG 2HHIA 4M42A 3D4ZA 3V9XA 2C1GA 1FW6A 3MDQA 3NH0A 4DTNA 4BVPA 2BTFA 4EZ6A 4AHSA 3OK8A 2EX3A 3CXCM 2VCPA 3E9LA 5LMNK 2WBNA 3ZT2A 4DSLA 3TSPA 3AAQA 4CE9A 3SI6A 1EWQA 2FC0A 1JXEA 3CF5L 4OKJA 3PSFA 5DMRA 4E81A 1HKBA 4LD0A 4CIGA 3VOVA 4ID1A 3EE8A 3H08A 3WXIA 5T7BA 4LF5K 4BNEA 4DV3K 5C2DA 3V9UA 3U3YA 1TL1A 5AFUA 5GAHP 1GLDG 5K14A 1XC9A 3VERA 4FM1A 1BOTO 3KWIA 4ILHB 4JHDB 1TKXA 3AO1A 4K43A 2IOCA 3MN7A 5EXWA 3MN9A 4FZOA 3VEVA 3VQ8A 3ULEA 4BR9A 3I2WA 3MN6A 1FKPA 3RSEB 4DFPA 4JI6K 4IKFA 3ZX3A 1H1VA 1GOCA 2KLAA 3QMLA 5IT9O 4QS8A 2YKNA 2ASOA 4FWMA 4BREA 1R33A 3KKRA 4BC5A 4DV1K 2YKTA 3K5MA 1VAZA 2DFEA 5D3GA 1W0HA 2IVPA 4KTWA 2Z0NA 3O9UA 2KZZA 5FROA 4DR5K 3LP2A 3DMJA 2QWLA 1OA0A 5KBPA 1GNTA 1E2UA 3ZEDA 3CYGA 3T3FA 1TL3A 3EKSA 1OH6A 1YAGA 1DKYA 3TABA 5BREA 4CGHA 2BUPA 4OX9K 3CC4N 4LH4A 4N56A 4AVMA 4B9LA 3M8SA 1BL3A 5FLEX 1HPMA 3BZKA 3GDQA 4TSXA 4CFAA 4CJEA 1VQLN 2QKWA 2KTQA 3EJUA 1BG3A 1NWKA 4OVLA 4MFBA 1WBDA 4BE7B 3WNGA 4H0PA 3F9KA 2YI8A 1NGDA 3HI0A 1TUUA 3D50A 4ATMA 5HP1A 3OYLA 3CC7N 1VQ4N 4WQ5C 4NCAA 4DUZK 2KW4A 3CCSN 3M8RA 4RTFD 2OPRA 1C0TA 4C23A 3EJSA 1DTQA 2OCEA 3DRRA 3M6GA 4BECA 5HLFA 2HSTA 4IZ9A 4OPAA 2YLAA 1WSIA 3SAHA 4DTUA 1WOQA 3QBXA 3U9DA 3EJRA 4FJGA 4W5OA 4FW2A 3CJ9A 3SYVA 4CEDA 3VEZA 3CJ7A 2D0PA 3OS2A 4IEEA 3P4IA 1GOBA 4HHTA 1DG4A 1N8RO 3QFUA 3S41A 1GLBG 3AVGA 4IJNA 4FJLA 3D7EO 4CZLA 1HNZK 1S9EA 1HPZA 3H45C 4BY9C 3VGKA 5BN8A 4DU3A 3J7YP 5KPRA 1VSLA 1K8AO 2NRHA 4G9ZA 1MDUB 3WEEB 3HYFA 4BRIA 1BI4A 4YOVA 2P9NB 2F7QA 2Q31A 3M1FA 1LCUA 4B8AB 2KFNA 2RE2A 3QETA 2Y1JA 3TR8A 1TV6A 3THVA 1A5XA 2XY6A 3SJHA 4WV5A 1VSFA 1VQPN 2BE2A 4GVMA 3CCRN 1FK9A 4JL9A 4QS9A 4FCYA 3SPYA 1XMQK 4PO2A 1HYZA 4CHPA 4DTRA 4JNEA 3SNNA 4HCBA 4DTPA 1HNWK 4FJ5A 3QB0A 4EZTA 1T7PA 4GW6A 2G8HA 3GBTA 3OYDA 3OYGA 2IIRA 3J8AA 3S3OA 3G25A 4PUOA 4CZJA 3DX3A 4CZMA 1I49A 2Z1GA 4AM7A 1YIJN 3SAFA 2F18A 3LP0A 4F3TA 1E9VA 2X74A 2C08A 2FBVA 2YIVX
chains in the Genus database with same CATH topology
1NBWA 2ASPA 2YHWA 4EIAA 5JICA 1JCEA 2V52B 2HOEA 1SUFA 4M0MA 4EZNA 3E1YA 3FZMA 3W3DA 3ZX2A 3F7WA 4BRGA 3O1BA 3O3OB 3FLCO 3CI5A 3DPPA 4ISEA 4O5FA 4CD3A 1JCFA 3SBGA 3I01A 3WT0A 4R79A 4CJ7A 5E26A 4JK7A 2EX3B 3R3LA 3UITA 3DAWA 4F01A 2GELA 3K9KA 4YORA 5M1KA 3G6EN 3DPQA 1HKGA 2D1KA 3CCEN 2P9PB 1S22A 3EKUA 5GINA 4HR1B 3RVCA 3MN5A 1YF5L 2P9KB 4JWDA 1VQNN 4B1ZA 4FWNA 4IWPA 1OKJA 3LDNA 5AQXA 2E1ZA 4GV3A 3ENHA 2JWLA 4H0OA 4IOXA 3B52X 4B1UB 1E1DA 3UKRA 4YOYA 4HWIA 3ZETB 2FXUA 4B1WB 1S72N 3H1VX 1ESVA 3A8YA 5F2RA 1W2BM 4JAXA 2BPRA 4BC3A 3AGKA 1P90A 4FO0A 3KDRA 3FZFA 3TTCA 2P9UA 4BR2A 1RFQA 2RT6A 4H5VA 4BR5A 4C1NK 2P9LA 2YIBA 4B1YB 3AAPA 4JK9A 4BRQA 5GIOA 4OO1J 1NGJA 1U2VB 3T47A 4I43A 4UDYX 3CCQN 3D2EA 4H5TA 2GA9D 4XEIA 3VGMA 1CZAN 3AGRA 2FLOA 3P39A 1ZYLA 3A98A 3KWGA 2LM0A 4IM3A 1GLFO 2UYTA 2W00A 3H6EA 3B53X 3VEAA 3ATUA 4RCHA 3OWGA 3VEXA 2AA4A 2YX6A 3HOSA 3T46A 4KBOA 4EZXA 3RV0A 1QQOA 3BP8A 3T48A 4EZQA 3CJAA 4FWSA 5AQLA 4PL7A 2KHOA 1DGKN 1QZ6A 3MMVA 4JD2B 2HBKA 2C1IA 2WINM 5JLHA 2D4WA 1NGHA 1Q86O 3VPZA 3QICA 1XQSC 2E88A 1LOTB 2FSKA 1YJ9N 1CKRA 1NLVA 3I8BA 4DB3A 1C0GA 1X3MA 3R9PA 5C2FA 4MO4A 1ZBSA 5BN9A 3RV1A 3OBYA 3LM9A 2D0OA 2KKZA 2YCHA 4M7YA 1G99A 4L3QA 4YOXA 5JVHL 4Z94A 3O8MA 2A6AA 3DXMA 2ZJQL 3O3MB 3J7ZO 3QBWA 4GNIA 4JEPA 4O8KA 1C0FA 3CJBA 3VEOA 4BRDA 2ND1A 5BR9A 4NPHA 1OVYA 3FR0A 3O1WA 3GG4A 3LDPA 3VTHA 4CZIA 3D2FB 4UY8O 3O3NB 5AQYA 5GAEP 4G6QA 3M3ZA 1K8KA 1ZXOA 4IDHA 3R8EA 3F2KA 2BH1A 2YHXA 3EE9A 7HSCA 3CIPA 2E2OA 3ZEUB 2A42A 2E8AA 5EVZA 4IO9L 1EO1A 2NRWA 2QWRA 2ZGYA 4XH1A 5AQGA 4H6IA 4PKHA 5EY4A 4R5IA 3SK3A 4WQ4A 1Q82O 2GWJA 3FZKA 2P9UB 4FOIA 3VETA 4JWIA 4UDXX 3RSEA 4KH4A 3VEBA 4MDAA 1Q7YO 3QA8A 2P9IB 2CGKA 4JKEA 4ILJA 4JKGB 4EZOA 3EO3A 4A61A 2ZJPL 3G71N 5M1NA 4H6HA 2NRZA 2W40A 2GAFD 4B1XB 4A2BA 4JN4A 4F9OA 4GV6A 3KZBA 2JNSA 4IM0A 5M1FA 1SU8A 3DXKB 4CZFA 3OW2M 2X5CA 4H0TB 1ILYA 2QXLA 1Q18A 2PY6A 1KXPA 3SMSA 1YI2N 5H1SQ 1E4GT 5BRDA 3PIOL 3VF2A 3ERCC 5GADP 3C7NA 3IMXA 5AQSA 4BRLA 2E2QA 3PIPL 3BUZB 3GL1A 4PL8A 1KD1O 3UKUA 4ILGB 4CBWA 2ZWHA 2OP6A 3VMFB 3ENBA 1NGFA 1KQSM 2QTDA 4D8JA 4CZHA 3VENA 2GTDA 4H5RA 3ZX0A 1VQ7N 4U7BA 4BR0A 5AZJB 1GLEG 1RDWX 2E1YA 3MWPA 3OBWA 3I04A 4WQ4C 3MX2A 1W97L 4R5GA 4H0XB 4R5KA 1NM1A 3TPQA 3VTIA 5LJVA 2QI2A 4M7XA 4MDBA 2QM1A 3ER9B 1OA1A 1BUPA 1SU6A 1V4TA 4EZRA 3LDLA 4JKFA 3GOIA 5LY3A 1W9MA 3QNJA 4WV7A 5AQNA 1K8KB 5M1PA 1ZC6A 4B9QA 2FSJA 3CHWA 3FZHA 4KIKA 3TSQA 3GI7A 1J6ZA 3L0QA 4BROA 3MCPA 3MX5A 3A0IX 3I33A 4BC2A 4FWRA 3NMUA 5AQVA 4DKWA 5EOYA 2YJEA 2HBLA 1DT9A 2A3ZA 2QEXN 3H3OB 3WXLA 1VQ8N 5CE3A 5AQPA 3A5NC 3CERA 1YITN 4H5NA 4DQ8A 3C65A 3VKHA 1OAOA 1SQKA 4ISGA 4YDUA 2A40A 4FPBA 2NRVA 3CJCA 4H03B 4WYBA 5MLCQ 5FPEA 5AQHA 4WFNL 4EAHD 3FFKB 5ADXH 3A5LC 2CGLA 3E66A 4DHYA 3N4QA 1BDGA 4JNFA 2PAVA 5HOOA 5C0YA 4BVOA 3C7NB 4A59A 3CC2N 2RHKA 3E9PA 1T44A 3DJCA 3AARA 1HJOA 1YHQN 3MCAB 5DM7L 2F9TA 1X3NA 2E2PA 4J8FA 2QWMA 4BRNA 2V51B 5AQIA 5M1OA 2VGMA 1Q5LA 2QWOA 3FZLA 5DM6L 1Z6RA 1BO5O 4MLEA 2P9SB 2AP1A 3WEEA 5KPTA 1BU6O 3GE1A 1V4SA 2HBJA 2P9NA 3H0XA 4WF9L 4H5WA 1SS6A 3CD6N 3B51X 3L4QA 3BF3A 3IUCA 4JKCA 3IFRA 1KC8O 2NRTA 4ILIA 4EZSA 2I7NA 4FOEA 5AZIA 3A5OC 2ZF5O 4R5JA 2NCZA 3EL2A 3LDOA 5EX5A 1QHAA 4CZEA 1RGIA 2OANA 4K41A 5KQ8A 3SAGA 1SU7A 1VQMN 4FWLA 5F0XA 3SMPA 4HY9A 4YDUC 3OHRA 2QFFA 1T6DA 2F9WA 1NGIA 4FWPA 1XUPO 3WQUA 2V7YA 1M1KO 1TUYA 2QWPA 2NRXA 3AY9A 5AQZA 4A5AA 3UE5A 1U00A 3TTDA 2WC9A 2CH6A 1GLJO 1NMDA 4K42A 3CQYA 2ASMA 4IOAL 2WFBA 3T4AG 4K25A 2HBMA 1HX1A 1K9MO 4JKDA 1DEJA 3L6QA 4OPHA 4B1VA 2QWQA 3DQGA 3CJ1A 3KK7A 4I6MA 3O80A 3NVMA 1VQ6N 4YOTA 2QA4N 5AQRA 3W0LA 1YXQA 3UKRB 3CQXA 3WXKA 4A62A 3L4IA 4ILHA 4JKAA 5AQOA 5BPMA 4IWOA 4JHDA 1KAXA 3ZEFA 2NZTA 3JS6A 3O5BA 5BPLA 3BEXA 2Q0UA 2NRRA 4IW0A 4CBXA 3O9SA 2ITMA 2F7TA 3H46O 3VEWA 4PKGA 3WUHA 3C0BA 4JKBA 3MK6A 4XH5A 4BG9A 2DPNA 1MWMA 3R6MA 5JLFA 1YVNA 3OHXM 4F00A 3UB5A 4PHTX 2FSNA 5C10A 2P9LB 1BPRA 4RWTA 5FPDA 2P9SA 4JK8A 2ZGZA 3FD9A 3DPOA 4IWQA 3D2EB 3N4PA 1KAYA 4M63C 3CMAN 3CCUN 4IOCL 2IVOA 5BRHA 2YI9A 1GLCG 4HTLA 1VQKN 3G4SN 4EHTA 5GIPA 4KH6A 2C1GA 1NJIO 3MDQA 3KAWA 4EZWA 1Y64A 2OTLN 4BVPA 5AQQA 5C15A 2HF3A 2BTFA 4EZZA 3ATVA 3FGUA 2PFUA 1QVFM 1VQ5N 3CXCM 2VCPA 3E9OA 2GX9A 3E9LA 1GN9A 3ID8A 2WBNA 3QDKA 1WUAA 4DCHA 1ATRA 1MA9B 2P9PA 2EWFA 4HR1A 1YJWN 1KAZA 2P9KA 3C6AA 2YIAA 1BA0A 1SZ2A 3AAQA 3TSPA 2H3GX 2Q97A 4YOWA 1SAZA 3A5MC 3HM8A 3CF5L 5AQTA 4E81A 1BWFO 4PKIA 4IJAA 1X9JA 1HKBA 4JLCA 1UPXA 3O4WA 3VOVA 3EE8A 4JKHA 1JJ2M 3ZETA 3DXMB 3WXIA 2A5XA 5BPNA 3LM2A 4A2AA 3KVGA 4IEIA 1T6CA 2HF4A 1HLUA 5C2DA 1T3VA 2ZJRL 3DOBA 3O08A 3IDHA 1GLDG 1NGCA 2PBDA 5AFUA 3K9JA 5GAHP 3CCMN 3CCVN 5CHIA 3EZWA 4I6MB 1TYQA 4NLBA 3VERA 3VF6A 3R1XA 1BOTO 3KWIA 3O9TA 4ILHB 1U2VA 4JHDB 3T7ZA 4BRPA 4K43A 3ZYYX 4LC9B 3MN7A 4CZGA 5EXWA 1DKZA 3MN9A 1DKXA 3TTFA 1VQ9N 5TKWA 3VEVA 1VQON 2N3KA 3ULEA 3WXMB 3HTVA 3MN6A 1XC3A 4BR9A 4O8UA 4BEBA 3RSEB 3I39X 4FWKA 2Q36A 3ZX3A 1H1VA 4BRFA 3H1QA 3EN9A 4NB4A 4GVEA 4JD2A 2KLAA 3N8EA 3QMLA 4WQ5A 3VF4A 4A57A 5GAGP 3NVKA 4QS8A 4IO8A 2ASOA 4FWMA 4BRHA 4BREA 4BC5A 3MWTA 4BRMA 1VAZA 5LJWA 4FM3A 1DKGD 2NNWA 4WCEL 1EQYA 1NGGA 2IVPA 1GLAG 4EFHA 4NLCA 2V7ZA 2W41A 4EHUA 3LDQA 4BG8A 3TU5A 3O9UA 1BA1A 3O6WA 2ND0A 5AQUA 4U67L 1Q81O 2QWLA 1OA0A 3HSCA 4BGBA 4E3CA 1RDUA 3O9QA 4XJXA 1GNTA 1E2UA 1MWKA 3UKUB 1QVGM 3ZEDA 2NLXA 3BF1A 1JCGA 3EKSA 1YAGA 1DKYA 3D2FA 5BREA 3U9ZA 2BUPA 2WUSA 3CC4N 5CR4A 4BR7A 5B8HA 2VWBA 4XH4A 4JWCA 1HPMA 5FLEX 3GDQA 3CPWM 1VQLN 3U8XA 1BG3A 1NWKA 3ZEUA 5AQJA 4BE7B 1O13A 4H0PA 2OTJN 2YI8A 1NGDA 3HI0A 1TUUA 3HOTA 3F9MA 1P8ZA 2QWNA 4MLHA 3CC7N 4BQLA 3I55N 1TYQB 4WQ5C 1K73O 2YJFA 1VQ4N 5TKYA 3O9RA 2HMPA 2Q2RA 5AQKA 3CCSN 2VGNA 2P9IA 4KIKB 4RTFD 3Q7BA 3KHYA 2EWSA 4JKGA 4C23A 2OBLA 1IJJA 3HBTA 4R5LA 2Q1NA 3M6GA 4BECA 2VYPA 3CMEN 2HSTA 4IZ9A 4OPAA 4E1JA 3SAHA 2JWKA 4CD1A 5C12A 1YUWA 1NGEA 3ULEB 5FPMA 3SBTA 1WOQA 3QBXA 3DXKA 4NO7A 3U9DA 1NGAA 2FF3B 4FPAA 4H0VB 4MO5A 4FWQA 2E20A 1ATSA 5AFUH 1YJNN 4BRKA 4BRAA 3CJ9A 1HKCA 3JXUA 4AF1A 4ISFA 3VEZA 1QQMA 4ILGA 1Z05A 3CJ7A 4FL9A 2D0PA 4EZVA 1MJGA 3CETA 2GWKA 4IEEA 5FPNA 3P4IA 3WXJA 1DG4A 5AR0A 3T69A 1N8RO 3QFUA 3S41A 3ID6A 4FSVA 1IG8A 1GLBG 4GY2B 3IKMA 4Y0WA 4IJNA 5AZJA 2Q0RA 3D7EO 3VESA 3WQTA 4CZLA 5F1XA 4HYBA 2IVNA 3H45C 3M5RA 4BY9C 4A5BA 1U6ZA 2A41A 3VGKA 1GLLO 5BN8A 3OA9A 3H3NO 5KPRA 1K8AO 5E84A 3Q7CA 4IWVA 2NRHA 1GNLA 1E4FT 2YHYA 4G9ZA 1MDUB 5AQWA 1QQNA 2FF6A 3L3OM 1HUXA 3P38A 3WEEB 4BRIA 4YOVA 2CGJA 4CI6A 3U4LA 2P9NB 4BQZA 4BGAA 5ADXA 5ELZA 2Q31A 3B8AX 3M1FA 4CBUA 1LCUA 1M90O 3TSUA 3P31A 2RE2A 4IFEA 3VEYA 2J4RA 5AZIB 1R59O 3ER8C 4C1NI 3LL3A 3FE1A 3T49A 4WV5A 3HRGA 1JQKA 4YOUA 3SJHA 1VQPN 5M1QA 1QZ5A 2GUPA 3CCRN 4CZKA 4JL9A 4QS9A 4H0YB 2QW9A 2CH5A 3CPEA 4BRCA 4PO2A 3ENOA 3I56N 5FIGA 5HL7L 4JNEA 3LMFA 2I7PA 1S3XA 1D4XA 4WFBL 4EZYA 1ATNA 3SBTB 5JVGL 3C6HA 3D6RA 4QS7A 3CCJN 3CCLN 3QB0A 4EZTA 2GEMA 4FWOA 3SLCA 3DLLL 5KQDA 3GBTA 1NGBA 4FVUA 2YI1A 3PLAA 2E2NA 4WFAL 3VGLA 5AQFA 2IIRA 3J8AA 4IXCA 4AM6A 4IM2A 4MQDA 4EZUA 3F5TA 3G25A 4KH5A 5AQMA 5KPZA 5I9EB 2OBMA 2Z8YA 4CZJA 4BR4A 4CZMA 4EZPA 4BC4A 5JMVA 4AM7A 1YIJN 3SAFA 3HZ6A 3QFPA 4JWEA 3SBSA 4GV9A 1E9VA 3KAVA 5BRFA 3DWLA 2YIVX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBW A;  2ASP A;  2YHW A;  4EIA A;  5JIC A;  1JCE A;  2V52 B;  2HOE A;  3FZM A;  4EZN A;  3ZX2 A;  4BRG A;  3O1B A;  3FLC O;  4ISE A;  3CI5 A;  3DPP A;  4O5F A;  4CD3 A;  1JCF A;  3WT0 A;  4CJ7 A;  5E26 A;  3DAW A;  4F01 A;  2GEL A;  3DPQ A;  1HKG A;  2D1K A;  2P9P B;  1S22 A;  3EKU A;  3MN5 A;  2P9K B;  4JWD A;  4B1Z A;  4FWN A;  1OKJ A;  3LDN A;  5AQX A;  2E1Z A;  3ENH A;  4H0O A;  4B1U B;  3UKR A;  4HWI A;  3ZET B;  2FXU A;  4B1W B;  3H1V X;  1ESV A;  3A8Y A;  5F2R A;  4JAX A;  2BPR A;  4BC3 A;  4FO0 A;  3FZF A;  2P9U A;  4BR2 A;  1RFQ A;  4H5V A;  4BR5 A;  2P9L A;  4B1Y B;  3AAP A;  4BRQ A;  1NGJ A;  1U2V B;  3T47 A;  3D2E A;  4H5T A;  4XEI A;  3VGM A;  1CZA N;  2FLO A;  1GLF O;  2UYT A;  3H6E A;  3ATU A;  4RCH A;  3VEX A;  2AA4 A;  3T46 A;  4KBO A;  4EZX A;  3BP8 A;  1QQO A;  3CJA A;  3T48 A;  4EZQ A;  4FWS A;  5AQL A;  3W3D A;  4PL7 A;  2KHO A;  1DGK N;  1QZ6 A;  3MMV A;  4JD2 B;  2WIN M;  5JLH A;  2D4W A;  1NGH A;  3VPZ A;  3QIC A;  1XQS C;  2E88 A;  1LOT B;  2FSK A;  1CKR A;  1NLV A;  3I8B A;  4DB3 A;  1C0G A;  1X3M A;  3R9P A;  4MO4 A;  1ZBS A;  5BN9 A;  3LM9 A;  2D0O A;  2YCH A;  4M7Y A;  1G99 A;  4L3Q A;  4Z94 A;  3O8M A;  2A6A A;  3DXM A;  3QBW A;  4GNI A;  4O8K A;  1C0F A;  3CJB A;  3VEO A;  4BRD A;  5BR9 A;  3FR0 A;  3O1W A;  3GG4 A;  3LDP A;  4CZI A;  3D2F B;  5AQY A;  3M3Z A;  1K8K A;  1ZXO A;  3R8E A;  2YHX A;  7HSC A;  3CIP A;  2E2O A;  3ZEU B;  2A42 A;  2E8A A;  5EVZ A;  2QWR A;  2ZGY A;  4XH1 A;  5AQG A;  4H6I A;  4PKH A;  5EY4 A;  4R5I A;  3SK3 A;  4WQ4 A;  2GWJ A;  3FZK A;  2P9U B;  4FOI A;  3VET A;  4JWI A;  3RSE A;  2P9I B;  2CGK A;  4A61 A;  4EZO A;  3EO3 A;  4H6H A;  2W40 A;  4B1X B;  4F9O A;  4A2B A;  4JN4 A;  3KZB A;  3DXK B;  4CZF A;  4H0T B;  2QXL A;  1Q18 A;  1KXP A;  3SMS A;  1E4G T;  5BRD A;  3VF2 A;  3C7N A;  3IMX A;  5AQS A;  4BRL A;  2E2Q A;  3BUZ B;  3GL1 A;  4PL8 A;  3UKU A;  4CBW A;  2ZWH A;  2OP6 A;  1NGF A;  4CZH A;  3VEN A;  2GTD A;  4H5R A;  3ZX0 A;  4BR0 A;  5AZJ B;  1GLE G;  1RDW X;  2E1Y A;  4WQ4 C;  4R5G A;  4H0X B;  4R5K A;  1NM1 A;  3TPQ A;  5LJV A;  3U9Z A;  4M7X A;  2QM1 A;  1BUP A;  1V4T A;  3LDL A;  4EZR A;  3GOI A;  5LY3 A;  3QNJ A;  4WV7 A;  5AQN A;  1K8K B;  1ZC6 A;  4B9Q A;  2FSJ A;  3CHW A;  3FZH A;  1J6Z A;  4BRO A;  3L0Q A;  3MCP A;  3A0I X;  3I33 A;  4BC2 A;  4FWR A;  5AQV A;  5EOY A;  2YJE A;  2A3Z A;  3H3O B;  3WXL A;  5CE3 A;  5AQP A;  3A5N C;  3CER A;  4H5N A;  4DQ8 A;  1SQK A;  4ISG A;  4YDU A;  2A40 A;  4FPB A;  3CJC A;  4H03 B;  4WYB A;  5FPE A;  5AQH A;  4EAH D;  3FFK B;  5ADX H;  3A5L C;  2CGL A;  4DHY A;  1BDG A;  4JNF A;  2PAV A;  4BVO A;  3C7N B;  1T44 A;  3DJC A;  3AAR A;  1HJO A;  2F9T A;  1X3N A;  2E2P A;  4J8F A;  2QWM A;  4BRN A;  2V51 B;  5AQI A;  1Q5L A;  2QWO A;  3FZL A;  1Z6R A;  1BO5 O;  4MLE A;  2AP1 A;  3WEE A;  5KPT A;  1BU6 O;  3GE1 A;  1V4S A;  2P9N A;  3H0X A;  4H5W A;  3BF3 A;  3IUC A;  3IFR A;  4EZS A;  2I7N A;  4FOE A;  5AZI A;  3A5O C;  2ZF5 O;  4R5J A;  3EL2 A;  3LDO A;  5EX5 A;  1QHA A;  4CZE A;  1RGI A;  2OAN A;  4K41 A;  5KQ8 A;  4FWL A;  5F0X A;  3SMP A;  4HY9 A;  4YDU C;  3OHR A;  2QFF A;  1T6D A;  2F9W A;  1NGI A;  4FWP A;  1XUP O;  3WQU A;  2V7Y A;  1TUY A;  2QWP A;  3AY9 A;  5AQZ A;  3UE5 A;  1U00 A;  2CH6 A;  1GLJ O;  1NMD A;  4K42 A;  3CQY A;  2ASM A;  3T4A G;  4K25 A;  1HX1 A;  1DEJ A;  3L6Q A;  4B1V A;  2QWQ A;  3DQG A;  3CJ1 A;  4I6M A;  3O80 A;  5AQR A;  3W0L A;  1YXQ A;  3UKR B;  3CQX A;  3WXK A;  4A62 A;  3L4I A;  5AQO A;  5BPM A;  4JHD A;  1KAX A;  3JS6 A;  2NZT A;  3O5B A;  5BPL A;  3BEX A;  2Q0U A;  4CBX A;  2ITM A;  3H46 O;  3VEW A;  4PKG A;  3WUH A;  3C0B A;  3MK6 A;  4XH5 A;  4BG9 A;  2DPN A;  1MWM A;  3R6M A;  5JLF A;  1YVN A;  3OHX M;  4F00 A;  3UB5 A;  2FSN A;  2P9L B;  1BPR A;  4RWT A;  5FPD A;  2P9S A;  2ZGZ A;  3D2E B;  3DPO A;  1KAY A;  4M63 C;  2IVO A;  5BRH A;  1GLC G;  4HTL A;  3MDQ A;  4EZW A;  1Y64 A;  4BVP A;  5AQQ A;  2HF3 A;  2BTF A;  4EZZ A;  3ATV A;  3FGU A;  2VCP A;  3ID8 A;  3QDK A;  1WUA A;  4DCH A;  1ATR A;  1MA9 B;  2P9P A;  1KAZ A;  2P9K A;  1SZ2 A;  1BA0 A;  3AAQ A;  2H3G X;  2Q97 A;  1SAZ A;  3A5M C;  3HM8 A;  5AQT A;  4E81 A;  1BWF O;  4PKI A;  4IJA A;  1X9J A;  1HKB A;  3O4W A;  3VOV A;  3ZET A;  3DXM B;  3WXI A;  2A5X A;  5BPN A;  3LM2 A;  4A2A A;  3KVG A;  2HF4 A;  1T6C A;  1HLU A;  3DOB A;  3O08 A;  3IDH A;  1GLD G;  1NGC A;  2PBD A;  5AFU A;  3EZW A;  4I6M B;  1TYQ A;  3VER A;  3VF6 A;  1BOT O;  1U2V A;  4JHD B;  4BRP A;  4K43 A;  4LC9 B;  3MN7 A;  4CZG A;  5EXW A;  1DKZ A;  3MN9 A;  1DKX A;  3VEV A;  3ULE A;  4BR9 A;  3HTV A;  3MN6 A;  1XC3 A;  3RSE B;  4FWK A;  2Q36 A;  3ZX3 A;  1H1V A;  4BRF A;  3H1Q A;  3EN9 A;  4NB4 A;  4EHT A;  4JD2 A;  4WQ5 A;  3N8E A;  3QML A;  3VF4 A;  4QS8 A;  4IO8 A;  2ASO A;  4FWM A;  4BRH A;  4BRE A;  4BC5 A;  4BRM A;  5LJW A;  1DKG D;  1EQY A;  1NGG A;  2IVP A;  1GLA G;  4EFH A;  4EHU A;  2V7Z A;  2W41 A;  3LDQ A;  4BG8 A;  3TU5 A;  1BA1 A;  3O6W A;  5AQU A;  2QWL A;  3HSC A;  4BGB A;  1MWK A;  3UKU B;  3BF1 A;  2NLX A;  1JCG A;  3EKS A;  1YAG A;  1DKY A;  3D2F A;  5BRE A;  2BUP A;  2WUS A;  4BR7 A;  5B8H A;  2VWB A;  4XH4 A;  4JWC A;  1HPM A;  3GDQ A;  3U8X A;  1BG3 A;  1NWK A;  3ZEU A;  5AQJ A;  4H0P A;  1NGD A;  3HI0 A;  1TUU A;  3F9M A;  1P8Z A;  2QWN A;  4MLH A;  4BQL A;  1TYQ B;  4WQ5 C;  2YJF A;  5TKY A;  2HMP A;  2Q2R A;  5AQK A;  2P9I A;  4RTF D;  3KHY A;  2EWS A;  4C23 A;  1IJJ A;  3HBT A;  4R5L A;  2Q1N A;  3M6G A;  2VYP A;  4IZ9 A;  4E1J A;  4CD1 A;  1YUW A;  1NGE A;  3ULE B;  5FPM A;  1WOQ A;  3QBX A;  3DXK A;  4NO7 A;  3U9D A;  1NGA A;  2FF3 B;  4FPA A;  4H0V B;  4MO5 A;  4FWQ A;  2E20 A;  1ATS A;  5AFU H;  4BRK A;  4BRA A;  3CJ9 A;  1HKC A;  3JXU A;  4ISF A;  3VEZ A;  1QQM A;  1Z05 A;  3CJ7 A;  4FL9 A;  2D0P A;  4EZV A;  3CET A;  2GWK A;  5FPN A;  3P4I A;  3WXJ A;  1DG4 A;  5AR0 A;  3QFU A;  3S41 A;  4FSV A;  1IG8 A;  1GLB G;  4GY2 B;  4Y0W A;  4IJN A;  5AZJ A;  2Q0R A;  3D7E O;  3VES A;  3WQT A;  4CZL A;  5F1X A;  4HYB A;  2IVN A;  3H45 C;  1U6Z A;  2A41 A;  3VGK A;  1GLL O;  5BN8 A;  3H3N O;  5KPR A;  5E84 A;  4IWV A;  2NRH A;  1E4F T;  2YHY A;  1MDU B;  5AQW A;  1QQN A;  2FF6 A;  3L3O M;  1HUX A;  3WEE B;  4BRI A;  2CGJ A;  4CI6 A;  3U4L A;  2P9N B;  4BQZ A;  4BGA A;  5ADX A;  5ELZ A;  2Q31 A;  3B8A X;  3M1F A;  4CBU A;  1LCU A;  3VEY A;  2J4R A;  5AZI B;  1R59 O;  3LL3 A;  3FE1 A;  3T49 A;  4WV5 A;  3SJH A;  1QZ5 A;  2GUP A;  4CZK A;  4QS9 A;  4H0Y B;  2QW9 A;  2CH5 A;  4BRC A;  4PO2 A;  3ENO A;  4JNE A;  2I7P A;  1S3X A;  1D4X A;  4EZY A;  1ATN A;  4QS7 A;  3QB0 A;  4EZT A;  2GEM A;  4FWO A;  3SLC A;  5KQD A;  3GBT A;  1NGB A;  2YI1 A;  2E2N A;  3VGL A;  5AQF A;  2IIR A;  3J8A A;  4IXC A;  4AM6 A;  3G25 A;  4EZU A;  5AQM A;  5KPZ A;  5I9E B;  4CZJ A;  4BR4 A;  4CZM A;  4EZP A;  4BC4 A;  5JMV A;  4AM7 A;  3HZ6 A;  3QFP A;  4JWE A;  5BRF A;  3DWL A;  2P9S B; 
#chains in the Genus database with same CATH topology
 2ASP A;  1JCE A;  4BDZ A;  2V52 B;  1SUF A;  4OGC A;  3ZX2 A;  3TWH A;  3RWU A;  4CJ7 A;  1U04 A;  2EX3 B;  3K9K A;  4C8L A;  4DFJ A;  2HNY A;  2D1K A;  4NXN K;  4M3U A;  3EKU A;  1S6P A;  3ZCM A;  5GIN A;  3RVC A;  1YF5 L;  4FZX C;  4IWP A;  1B9D A;  3B52 X;  1BIZ A;  3QE6 A;  3HAH A;  3AVN A;  4B1W B;  4GKK K;  3H1V X;  5DK5 A;  3KK3 A;  4JAX A;  1J54 A;  1I94 K;  4FJM A;  3KDR A;  4LSN A;  1RFQ A;  5GIO A;  2LSN A;  3AAP A;  4OO1 J;  4UDY X;  4DWI A;  1RDD A;  3VQ9 A;  3P39 A;  3QEI A;  3KLE A;  3B53 X;  1FKO A;  3QEX A;  3PLT A;  3VEX A;  3HOS A;  4KBO A;  3W3D A;  1WSE A;  4RW6 A;  3ZSR A;  4I7F A;  2HBK A;  1Q9X A;  2C1I A;  2WIN M;  5KGW A;  2D4W A;  1N32 K;  1S1U A;  1Q86 O;  1XQS C;  3B6P A;  3ZT1 A;  1LOT B;  1YJ9 N;  1CKR A;  1C0G A;  3B6O A;  1SL0 A;  1ZBS A;  1SUQ A;  3OBY A;  1XI1 A;  5JVH L;  4PWD A;  2O8D B;  4L3Q A;  4ZTJ A;  1JL2 A;  3O8M A;  4Z94 A;  3PX0 A;  2JNK A;  3C95 A;  3O3M B;  4DV5 K;  3NGZ A;  3VEO A;  3IS9 A;  3KLG A;  3HXM A;  4G1Q A;  3O1W A;  3LDP A;  4DSF A;  2FBY A;  4UY8 O;  5AQY A;  1HMV A;  1LWF A;  1OH5 A;  4G6Q A;  3MXI A;  1ZXO A;  4IDH A;  3F2K A;  2YHX A;  3DDG A;  7HSC A;  2E2O A;  4IFY A;  3LPT A;  1TKT A;  4DR1 K;  2QWR A;  4PKH A;  3S9H A;  5EY4 A;  4ZTF A;  4I2Q A;  1Q82 O;  2P9U B;  5J2M A;  5BR8 K;  3QES A;  4H4M A;  1RBV A;  4DTX A;  4BE0 A;  1Q7Y O;  2Q3S A;  3SJJ A;  3EO3 A;  4H6H A;  3WNF A;  4F9O A;  4A2B A;  3OYC A;  4BE1 A;  3KZB A;  3TAG A;  1VSM A;  3L2Q A;  5M1F A;  3OW2 M;  4CZF A;  4DTS A;  4H0T B;  2QXL A;  4Q5V A;  4CEA A;  3VF2 A;  3ERC C;  5GAD P;  3IMX A;  2P5O A;  2E2Q A;  3GL1 A;  1JLQ A;  1HNX K;  4Z4C A;  4JS4 A;  1KQS M;  1A5V A;  4BDY A;  1GLE G;  1RDW X;  3MWP A;  3AO3 A;  4FXD A;  2YL9 A;  2IC3 A;  4M7X A;  4MDB A;  3ER9 B;  3U9Z A;  3DYA A;  1SU6 A;  3LDL A;  1VRU A;  2IAJ A;  3CVR A;  4RW8 A;  3GOI A;  5LY3 A;  1K8K B;  1BI4 B;  1ZC6 A;  5M1P A;  2FSJ A;  3SOG A;  1J6Z A;  3AA3 A;  4KHW A;  3TAP A;  3AVB A;  1WB9 A;  4FJK A;  1SKW A;  4BC2 A;  4DQQ A;  3QEW A;  2UUB K;  5EOY A;  2HBL A;  3BUQ A;  3RTV A;  2PY5 A;  5AQP A;  2HW3 A;  4DQ8 A;  1R0A A;  4DV7 K;  4FZP A;  4IG0 A;  1SQK A;  4FPB A;  3AVH A;  3CJC A;  5MLC Q;  2PZS A;  3O4Q A;  3A5L C;  2CGL A;  5KGX A;  1J5E K;  1BDG A;  3TAF A;  4NYN A;  3DLG A;  1JLA A;  3CG7 A;  4B9U A;  2V51 B;  3OYI A;  5M1O A;  4LF4 K;  1Z6R A;  3VQE A;  4H4O A;  3BVX A;  5CZ1 A;  3LVT A;  5HRN A;  1TK5 A;  4H5W A;  1D9F A;  4CCH A;  3B51 X;  1I4T A;  3CKD A;  1ZYQ A;  3BF3 A;  2UXB K;  5JEN A;  4CEQ A;  2I7N A;  4FOE A;  3A5O C;  1S1X A;  2WTU A;  1Q9Y A;  4K41 A;  3SAG A;  2OA8 A;  1SU7 A;  3M8Q A;  1JLF A;  2F9W A;  3WQU A;  1XUP O;  4B3M K;  2V7Y A;  1TUY A;  2OO2 A;  4A5A A;  4N47 A;  3UE5 A;  1U00 A;  4I9L A;  3TTD A;  1GLJ O;  4K42 A;  3ZT0 A;  3CQY A;  4AZB A;  2ASM A;  1QE1 A;  1DEJ A;  3L6Q A;  4B1V A;  2HVH A;  2QWQ A;  3CJ1 A;  3KK7 A;  1NOZ A;  3O80 A;  2QA4 N;  3W0L A;  3WXK A;  5AQO A;  4ILH A;  2AJQ A;  4JHD A;  3JS6 A;  2NZT A;  4DUY K;  4CGF A;  3O9S A;  3EY1 A;  3H46 O;  4JKB A;  4O0J A;  4XH5 A;  4BG9 A;  2RAJ A;  2Z0V A;  5JLF A;  1YVN A;  3OHX M;  4F00 A;  4PHT X;  2O8C A;  2PYJ A;  2O8B A;  1SL2 A;  2YLL A;  2BDP A;  3LP1 A;  4AHR A;  1JKH A;  1LAW A;  4KH6 A;  5GIP A;  4F4K A;  4OLB A;  4EZW A;  3CZS A;  2UUC K;  3ATV A;  4I1Q A;  3E9O A;  2GX9 A;  1NKE A;  4JI4 K;  3OS0 A;  3V1R A;  2F1A A;  1L3T A;  3Q0K A;  2EWF A;  4HR1 A;  5C5B A;  1YJW N;  2YIA A;  2H3G X;  4JI8 K;  4YOW A;  4E0D A;  3HM8 A;  5AQT A;  4E19 A;  4E72 A;  3QO9 A;  3V4I A;  4IJA A;  1X9J A;  2F8S A;  1KFS A;  2YL6 A;  4C8N A;  3LM2 A;  3MEG A;  1XHX A;  3CCV N;  1NGC A;  4BE2 A;  3K2P A;  3K9J A;  4J2E A;  4I6M B;  4NLB A;  3VF6 A;  3O9T A;  4LH5 A;  4HUE A;  1JXB A;  3I8D A;  4B3R K;  3ZYY X;  4FYD A;  3L3P A;  4CF9 A;  1DKX A;  1VQ9 N;  3NHG A;  4OLA A;  2ALW A;  5EU7 A;  1CLQ A;  1XC3 A;  3VQQ A;  4O8U A;  4BRF A;  2Q36 A;  1RDB A;  3V81 A;  3EN9 A;  4EHT A;  3N8E A;  5GAG P;  3VF4 A;  4E7J A;  2G8I A;  4IO8 A;  4BRH A;  1Q8I A;  3MWT A;  3VQD A;  4BRM A;  4FM3 A;  2NNW A;  4WCE L;  2O4I A;  4EFH A;  4EHU A;  2W41 A;  3BUB A;  4KO0 A;  3LDQ A;  2JGU A;  4BG8 A;  4U67 L;  3HSC A;  1Z26 A;  2O4G A;  3HK2 A;  3RRH A;  4XJX A;  1QVG M;  3G0Z A;  1XHZ A;  4M3T A;  3D2F A;  2YNG A;  2WUS A;  3QLH A;  3DRP A;  2VWB A;  4JWC A;  1VRT A;  3U8X A;  3OY9 A;  3NF6 A;  2OTJ N;  4OPK A;  4F2S A;  4WPE A;  1P8Z A;  1RT7 A;  4BQL A;  1K73 O;  1TYQ B;  3AVF A;  2A1S A;  4FZS A;  3BUP A;  2O8F A;  5AQK A;  2Q12 A;  2Y1I A;  4GKJ K;  3HBT A;  4R5L A;  2VG7 A;  3CME N;  4E1J A;  1YUW A;  3DXK A;  4CK3 A;  2FF3 B;  2E20 A;  1QSY A;  1ATS A;  3IG1 A;  5AFU H;  4CEF A;  3JXU A;  3PV8 A;  3CET A;  4EZV A;  1MJG A;  4KHU A;  2YL8 A;  4DTO A;  5FPN A;  3WXJ A;  5AR0 A;  3T69 A;  3ID6 A;  4H8S A;  3IKM A;  2UXD K;  4HYB A;  3M5R A;  1GLL O;  4FLY A;  5E84 A;  3Q7C A;  4DQI A;  1QQN A;  2FF6 A;  3P38 A;  1QS4 A;  3U4L A;  4BQZ A;  4CES A;  5ELZ A;  1M90 O;  3ULD A;  3TSU A;  3P31 A;  1U47 A;  1RDA A;  2FBT A;  2J4R A;  3ER8 C;  4C1N I;  5FRN A;  3LL3 A;  2G8U A;  1B9F A;  3ZSW A;  4PA1 A;  1YTU A;  2GUP A;  2W6L A;  3VQ5 A;  3NGY A;  5HL7 L;  1BIU A;  2Z1I A;  1D4X A;  4WFB L;  4EZY A;  3SBT B;  3OTO K;  1NK7 A;  2PYL A;  1RDC A;  4DV6 K;  3SLC A;  1Z25 A;  4KHP K;  2F1B A;  2RKI A;  1NGB A;  4AHT A;  4FVU A;  2QKK A;  1RT4 A;  3HPG A;  3VGL A;  3V9Z A;  3QEP A;  2EFL A;  3L2R A;  3IRX A;  4AM6 A;  4IM2 A;  1KVB A;  4DG1 A;  5AQM A;  5KPZ A;  3Q84 A;  3AVA A;  2OBM A;  4EZP A;  2ELB A;  2G8V A;  3MEE A;  2O8C B;  3ZSO A;  4W5N A;  5BRF A;  2O8B B;  3DWL A;  4CVN E;  3M3W A;  1ZBH A;  4AZH A;  2HOE A;  5A2Q O;  4J2A A;  3F7W A;  4O0I A;  3CI5 A;  1HNI A;  1KSP A;  4L8R B;  2HHT A;  3I01 A;  4B3O A;  4R79 A;  1HRH A;  3M8P A;  3UIT A;  3DAW A;  2GEL A;  1S1W A;  5M1K A;  4IBN A;  3D52 A;  2O8D A;  4X64 K;  3DPQ A;  3T1A A;  4FJ9 A;  4OKE A;  3KJV A;  1LAV A;  4HR1 B;  5C5B B;  1ASV A;  3ZSV A;  4B1Z A;  3VQ6 A;  3BUI A;  2E1Z A;  4Z0U A;  2IS3 A;  2JWL A;  4H0O A;  4B1U B;  3UKR A;  2MI7 A;  2FXU A;  1ESV A;  2ITG A;  3OYE A;  2BPR A;  3LAN A;  2F4V K;  2P9U A;  1YWM A;  1K6Y A;  4RG8 A;  4H5V A;  3ASM A;  4CEE A;  4C1N K;  1L3S A;  1NGJ A;  1U45 A;  3T47 A;  1HWW A;  3CCQ N;  2GA9 D;  3VGM A;  3PX4 A;  1QSS A;  4M3R A;  4KHQ A;  1ZYL A;  4IM3 A;  3VQ4 A;  3H6E A;  2W00 A;  1WAJ A;  1YT3 A;  2AA4 A;  2YX6 A;  4FWS A;  4EZQ A;  4PL7 A;  3CFO A;  1DGK N;  1QZ6 A;  1B92 A;  4OKK A;  1NKB A;  2X3V A;  2FSK A;  5FLX O;  3I8B A;  3MED A;  4PQU A;  3VQA A;  1X3M A;  3R9P A;  5C2F A;  5BN9 A;  3RV1 A;  4AZ5 A;  4B9T A;  4CJ5 A;  3DXM A;  4CW7 B;  4LFB K;  3QBW A;  3SQ4 A;  4BRD A;  4NPH A;  2G8W A;  4CZI A;  3D2F B;  3MAQ A;  1K8K A;  3R8E A;  1IKX A;  1JLE A;  2BH1 A;  3LWL A;  3CIP A;  4IO9 L;  2NRW A;  3DOL A;  2ZGY A;  4H6I A;  1DLO A;  2OZN B;  3SK3 A;  4JI1 K;  1UOC A;  4JWI A;  4KH4 A;  2P5G A;  4MDA A;  2O8F B;  4Z4I A;  1X04 A;  1TQV A;  1N6Q A;  3L2W A;  3DXK B;  3AVK A;  1X9M A;  2X5C A;  2X3X A;  1Q18 A;  4AHV A;  2B6A A;  5H1S Q;  2G8F A;  3PIO L;  1JLB A;  5AQS A;  4J2D A;  3DX4 A;  3PIP L;  3UKU A;  4CBW A;  1NK4 A;  4CGD A;  4CZH A;  2A1R A;  3AVM A;  3ZX0 A;  1VQ7 N;  2HHQ A;  1NOY A;  4O4G A;  3SUQ A;  2RPI A;  4I2P A;  1BCO A;  2E1Y A;  3OBW A;  3DM2 A;  3I04 A;  4WQ4 C;  1U4B A;  2QK9 A;  4JS5 A;  3VTI A;  1LW2 A;  3K5N A;  5LMU K;  4EZR A;  1LW0 A;  1W7A A;  4WV7 A;  4FJ7 A;  4B9Q A;  3AV9 A;  4KIK A;  4BRO A;  3A0I X;  3LP3 A;  4FWR A;  3NMU A;  2YJE A;  4O44 A;  5JS2 A;  3H3O B;  3WXL A;  3A5N C;  1YIT N;  3LLL A;  4ICL A;  3K5O A;  3C65 A;  4B08 A;  4BWM A;  3C6U A;  4W5R A;  5FPE A;  3SUP A;  5ADX H;  1TGO A;  3SUN A;  1F21 A;  4JNF A;  1Y2O A;  5C0Y A;  4LF7 K;  4BVO A;  3C7N B;  3CC2 N;  4X66 K;  2WYI A;  5JS1 A;  4UQG A;  1X3N A;  3NF8 A;  2QWM A;  4E7L A;  3VN5 A;  5DM6 L;  1Q5L A;  2QWO A;  3FZL A;  2HHH K;  1HR0 K;  5KPT A;  2F96 A;  3AO5 A;  4WE1 A;  3BZC A;  4M3W A;  4WF9 L;  4FM2 A;  2QKB A;  4KAZ A;  4BDP A;  3E01 A;  4B8C A;  3QIO A;  3HP6 A;  4JKC A;  4F2R A;  4ILI A;  5AZI A;  2ZF5 O;  4R5J A;  4M3X A;  1EWR A;  5EX5 A;  3LDO A;  3DLE A;  3HVT A;  1X03 A;  2KQ2 A;  1U48 A;  3SV3 A;  2RAK A;  3SMP A;  2YHA A;  4HY9 A;  1BQM A;  4YDU C;  4LF9 K;  1T6D A;  1NGI A;  1M1K O;  2QWP A;  3AY9 A;  3I0S A;  2WC9 A;  1R34 A;  4KRE A;  4IOA L;  3T4A G;  5AJ3 K;  1HX1 A;  3J80 O;  4OPH A;  3EJT A;  3TAQ A;  4I6M A;  3NVM A;  4W5T A;  3UKR B;  3VA3 A;  5BPM A;  1LV5 A;  4IWO A;  2R7Y A;  1KAX A;  3ZEF A;  2FYV A;  4CBX A;  2F7T A;  3C0B A;  2DPN A;  1MWM A;  1TK8 A;  3BLB A;  3SYZ A;  2FSN A;  4RW4 A;  4RWT A;  3THY A;  2P9S A;  2ZGZ A;  3DPO A;  4IOC L;  1KAY A;  4M63 C;  2IVO A;  2OYQ A;  4DV0 K;  1NJI O;  3KAW A;  5C15 A;  5SWM A;  2HF3 A;  3OYN A;  4EZZ A;  3NBP A;  2P1J A;  2FBX A;  1REV A;  3VQC A;  3ID8 A;  2D0C A;  3QDK A;  1KCF A;  4JRP A;  2P9K A;  4C8K A;  2Q97 A;  1SAZ A;  2EHG A;  3A5M C;  4ELT A;  4BAC A;  4PKI A;  4CK2 A;  1R5E A;  4DQS A;  1LWC A;  1UPX A;  2D4C A;  3O4W A;  3THW A;  4JKH A;  1JJ2 M;  3DXM B;  1LQ7 A;  2A5X A;  5BPN A;  3KLI A;  4A2A A;  1T6C A;  1HLU A;  3DYT A;  2ZJR L;  3IDH A;  5C25 A;  3D4Y A;  1SV5 A;  1TYQ A;  3R1X A;  4DTM A;  4FLV A;  4BRP A;  1NK8 A;  3ZT3 A;  4LC9 B;  3NH1 A;  4C8M A;  4CZG A;  1DKZ A;  1JLG A;  2N3K A;  3OJU A;  4BEB A;  4DLE A;  3I39 X;  4FWK A;  3DLK A;  3H1Q A;  3L2V A;  4A57 A;  4WQ5 A;  3NVK A;  2O8E A;  4Y1D A;  3ZSX A;  3LAK A;  5LJW A;  1DKG D;  3ZLJ A;  1GLA G;  4NLC A;  4R5P A;  3TU5 A;  5AQU A;  2ND0 A;  4F3O A;  3JSM A;  2YNI A;  4EP4 A;  1U49 A;  3BUD A;  4BGB A;  1O7D B;  1RDU A;  1RT6 A;  3O9Q A;  3UKU B;  2WOM A;  1JCG A;  1EXQ A;  1WSF A;  3ZT4 A;  4BR7 A;  3S5T A;  3P1G A;  4XH4 A;  3CFR A;  4O55 A;  3ZEU A;  5AQJ A;  4CJQ A;  2ETJ A;  2GF4 A;  2ZE2 A;  3K57 A;  2GV9 A;  1SKR A;  3DX0 A;  4CFC A;  3EYZ A;  1IO2 A;  5TKY A;  3O9R A;  2HMP A;  3EZ5 A;  1TVR A;  1IKY A;  4HTU A;  2VGN A;  3T19 A;  1OH7 A;  4KIK B;  3Q7B A;  1NMN A;  3PX6 A;  4CIF A;  2OBL A;  1IJJ A;  3KD5 E;  2Q1N A;  3CYM A;  2VYP A;  1ZBF A;  4AHU A;  2JWK A;  5C12 A;  3CV5 A;  5FPM A;  2OW7 A;  3SBT A;  3QWE A;  3OYJ A;  2VG6 A;  1WN7 A;  1NGA A;  3PO5 A;  3RMC A;  4CFB A;  5KTQ A;  5FRM A;  1YJN N;  1UAX A;  4BRK A;  3F73 A;  3DLH A;  1HKC A;  1QQM A;  4ILG A;  1Z05 A;  2W6K A;  3HVR A;  1VK0 A;  2GWK A;  4FLT A;  4E1M A;  1NK0 A;  4K8Z A;  1IG8 A;  4GY2 B;  3DI6 A;  5AZJ A;  2Q0R A;  3VES A;  3WQT A;  2HMI A;  5F1X A;  1U6Z A;  4RW9 A;  3H3N O;  4IWV A;  1HNV A;  2OPP A;  3ITH A;  1SKS A;  4CJW A;  1HUX A;  2CGJ A;  4CI6 A;  4IDK A;  5HRO A;  1RT1 A;  1CXQ A;  3B8A X;  4CBU A;  4DYL A;  1ZBI A;  4QAG A;  3VEY A;  3HP9 A;  3BGR A;  4CHQ A;  5AZI B;  3FE1 A;  3T49 A;  3HRG A;  5M1Q A;  2QW9 A;  2CH5 A;  4N5S A;  3AVL A;  4FJ8 A;  2I7P A;  1S3X A;  4ELV A;  2OW6 A;  2XHB A;  2D0A A;  3CCL N;  1PS3 A;  4DSE A;  4NCG A;  5C42 A;  4JI2 K;  2WON A;  3DLL L;  5KQD A;  3P5J A;  2ZM6 K;  2E2N A;  4WFA L;  1I3A A;  3RMB A;  5AQF A;  3PSI A;  1CZB A;  5C24 A;  1IBK K;  4EZU A;  3K59 A;  3BY5 A;  3NH2 A;  2HHW A;  3NCI A;  1IBM K;  1NJZ A;  3HZ6 A;  4JWE A;  4GV9 A;  3RR7 A;  2RN2 A;  1VSJ A;  3TAM A;  3THY B;  1VQN N;  2P9S B;  1NBW A;  4EIA A;  1J5O A;  3OYH A;  2DTU A;  4KI4 A;  3E1Y A;  4BRG A;  3O3O B;  3FLC O;  4FW1 A;  4O5F A;  4CD3 A;  4PY5 A;  1JCF A;  3SBG A;  4JK7 A;  3R3L A;  4DR4 K;  3LZJ A;  1HKG A;  3HAI A;  3LPU A;  2P9K B;  1UA1 A;  4JWD A;  2GUI A;  4FWN A;  4DTJ A;  5AQX A;  3PY8 A;  3I0R A;  2YKM A;  1Y97 A;  3ENH A;  4GV3 A;  4DR6 K;  2JLE A;  3THW B;  1T8E A;  4HWI A;  3LWM A;  4XIU A;  1S72 N;  2KFZ A;  5F2R A;  2I5J A;  4BC3 A;  3K58 A;  3AGK A;  1P90 A;  4K0K K;  3QER A;  4BR2 A;  4CHZ A;  4JI7 K;  4BR5 A;  2P9L A;  1NJY A;  4I43 A;  1ASW A;  1C0U A;  3D2E A;  1UWB A;  4KB1 A;  5E41 A;  2B4J A;  2ZD1 A;  4E7H A;  1GLF O;  1W9H A;  4YY3 K;  4Z4E A;  3VEA A;  5I3U A;  5CYQ A;  3T46 A;  4EZX A;  3RV0 A;  3CJA A;  3T48 A;  4CGI A;  4CJP A;  3G10 A;  1ITG A;  4CEO A;  1D5A A;  3MMV A;  2QXF A;  1RT5 A;  3LDS A;  2O8E B;  1ZBL A;  4CEC A;  1NGH A;  2F7R A;  2E88 A;  1NLV A;  2D0O A;  2KKZ A;  1S6Q A;  1G99 A;  4YOX A;  5HRS A;  3DLB A;  3WNE A;  2A6A A;  4CJF A;  4DS4 A;  3J7Z O;  4JEP A;  4O8K A;  3CJB A;  1KRP A;  2ND1 A;  2HHX A;  3GG4 A;  3VTH A;  1TKD A;  2OZS A;  2XY5 A;  5GAE P;  3M3Z A;  4KPY A;  2ATQ A;  3EE9 A;  3ZEU B;  1GOA A;  5EVZ A;  1EO1 A;  4XH1 A;  3OVN A;  3DLR A;  3VQB A;  4R5I A;  1MU2 A;  3LAM A;  3FZK A;  5J2N A;  3QNO A;  3VEB A;  4DSK A;  3QA8 A;  2CGK A;  4JKE A;  4ILJ A;  2ZJP L;  2F7O A;  3G71 N;  2NRZ A;  2GAF D;  4B9V A;  4IG3 A;  4AQY K;  1SU8 A;  2HNZ A;  4JRQ A;  4CJT A;  2BAN A;  1KXP A;  2XRI A;  3SMS A;  3G9G A;  4M3Z A;  4AZC B;  3J7A P;  1JLC A;  3C7N A;  4KB0 A;  3K5L A;  4JYA K;  4BRL A;  2HVI A;  4AZG A;  1KVC A;  5IWA K;  1KD1 O;  2HHV A;  4E3S A;  4ILG B;  1TQS A;  1VSD A;  3HPH A;  3T1H K;  1RNH A;  4CER A;  1NGF A;  1EP4 A;  1BCM A;  1RT2 A;  1VSE A;  4U7B A;  4BR0 A;  5AZJ B;  4NYF A;  4Z4F A;  4CF2 A;  4KRF A;  4DF8 A;  3MX2 A;  1URU A;  1W97 L;  1QTM A;  4H0X B;  3TPQ A;  4J2B A;  2PMR A;  2QI2 A;  5LJV A;  1V4T A;  1OA1 A;  4JKF A;  3NF7 A;  5CZ2 A;  1YVU A;  3KKS A;  2VWJ A;  1EKE A;  3CHW A;  3FZH A;  3GI7 A;  3L0Q A;  2DFH A;  4CGG A;  5HBM A;  1DT9 A;  1TKZ A;  1QX1 A;  1VQ8 N;  5CE3 A;  3MXM A;  1FJG K;  3CER A;  5KRS A;  3BVW A;  4KI6 A;  3HM9 A;  3VKH A;  4WPC A;  1RIL A;  3EJQ A;  2Q13 A;  4H03 B;  5AQH A;  4EAH D;  3FFK B;  2FIC A;  3E66 A;  4DHY A;  3N4Q A;  3S3M A;  4JV5 K;  1VSI A;  1VHX A;  2PAV A;  5HOO A;  1S1V A;  1S9G A;  4CHN A;  4A59 A;  2RHK A;  3E9P A;  1T44 A;  3AAR A;  1YHQ N;  3MCA B;  3ZSY A;  3AA5 X;  4E7K A;  4BRN A;  2IDO A;  3HJF A;  5AQI A;  2XO7 A;  2VGM A;  1BO5 O;  3GE1 A;  3CAZ A;  1IH7 A;  1D8Y A;  1C1A A;  1TK0 A;  4AH9 A;  3QEV A;  3V9W A;  4DQR A;  2NRT A;  3EL2 A;  3WNH A;  4N76 A;  1QHA A;  1RGI A;  4ELU A;  2VWK A;  4FWL A;  5F0X A;  2YNH A;  3OHR A;  2QFF A;  4FWP A;  4K8X A;  1BQN A;  2HHU A;  1IBL K;  3V9S A;  3C6T A;  3O3G A;  4M41 A;  4KFB A;  1NMD A;  2KZM A;  1VSK A;  3OS1 A;  3KD1 E;  1I4L A;  2X6S A;  1J9A A;  4JKD A;  1RTD A;  1RTH A;  4YOT A;  5AQR A;  1YXQ A;  4A62 A;  2E6M A;  3L4I A;  4JKA A;  1DTT A;  3RR8 A;  5BPL A;  2Q0U A;  2ITM A;  3VEW A;  2E4L A;  4FVM A;  1L3V A;  3MK6 A;  3C94 A;  3UB5 A;  5C10 A;  3DX1 A;  2P9L B;  4I9Q A;  4AKV A;  3D45 A;  4JK8 A;  3FD9 A;  3D2E B;  1VQM N;  3V6D A;  4AZ6 A;  2YI9 A;  5BRH A;  4HTL A;  1VQK N;  3G4S N;  3PUF A;  3O3F A;  1Y64 A;  2OTL N;  5AQQ A;  3FGU A;  2PFU A;  1QVF M;  4DF4 A;  3U3G A;  1VQ5 N;  1TQU A;  3LAL A;  4CJK A;  1GN9 A;  1WUA A;  2OPQ A;  1ATR A;  1C6V A;  1MA9 B;  1HQU A;  2P9P A;  4DCH A;  1KAZ A;  1XMO K;  1S1T A;  1SZ2 A;  1BA0 A;  3C6A A;  5HRP A;  4FM0 A;  4B3S K;  4V19 S;  4DV4 K;  3OYM A;  3AO4 A;  3TAN A;  1ZBU A;  1BWF O;  3UIQ A;  4JLC A;  2RF2 A;  2F7P A;  3V1O A;  3A2F A;  4AHC A;  3ZET A;  4KV8 A;  3KLH A;  4KKO A;  2VG5 A;  3KVG A;  2HF4 A;  4IEI A;  1RBR A;  1T3V A;  3DOB A;  3O08 A;  2PBD A;  5J2P A;  2D5R A;  3CCM N;  5CHI A;  3EZW A;  4ZHR A;  4FLZ A;  4E89 A;  1TAU A;  1U2V A;  3BVU A;  3T7Z A;  2HHS A;  4FJX A;  3TTF A;  2EFK A;  3TI0 A;  4NCB A;  5TKW A;  1VQO N;  3WXM B;  3HTV A;  1T05 A;  3SV4 A;  1C1B A;  4NB4 A;  4GVE A;  4JD2 A;  4H8K A;  4C8O A;  2RAI A;  3ABH A;  1EQY A;  5KRT A;  1NGG A;  3DDF A;  2V7Z A;  2HB5 A;  3NGI A;  1XWL A;  2YV0 X;  4KTZ A;  1BA1 A;  3O6W A;  1Q81 O;  2D1L A;  3SUO A;  4DCN C;  4QCL A;  3AO2 A;  4E3C A;  1RBS A;  1IV0 A;  1WSH A;  1MWK A;  3SQ1 A;  3BF1 A;  2NLX A;  4CJ4 A;  1N34 K;  5CR4 A;  2E6L A;  3CM6 A;  5B8H A;  1D9D A;  3KTQ A;  4MQ3 A;  4NSW A;  3CPW M;  1WDZ A;  4LF8 K;  4OJR A;  1O13 A;  4CEB A;  1ASU A;  3HOT A;  3F9M A;  5KI6 A;  4FLU A;  1NJX A;  4CHY A;  4AZ7 A;  2QWN A;  4MLH A;  1WBB A;  1NU0 A;  4LY7 A;  3I55 N;  1KTQ A;  3AVC A;  4FK2 A;  2YJF A;  2YNF A;  1N5Y A;  2Q2R A;  3KIO A;  4DR3 K;  2P9I A;  3KHY A;  2EWS A;  4JKG A;  3FFI A;  2GBZ A;  4FJH A;  3J81 O;  1NK9 A;  4CK1 A;  1NKC A;  2B5J A;  4FJI A;  1WSG A;  4CD1 A;  3RPM A;  1NGE A;  3ULE B;  4OGE A;  1UA0 A;  4NO7 A;  4KHS A;  4H0V B;  4FPA A;  4MO5 A;  4FWQ A;  3TAR A;  3HAJ A;  4BRA A;  2DFF A;  4AF1 A;  4ISF A;  1CZ9 A;  4Q0B A;  4FL9 A;  4HVJ A;  4BWJ A;  1WSJ A;  4CJS A;  1E3M A;  1QQC A;  4FSV A;  4FLX A;  1TQW A;  4Y0W A;  3KLF A;  2VQE K;  1NG9 A;  1YTA A;  2OZM A;  1I4D A;  2IVN A;  2P51 A;  4A5B A;  4DSJ A;  3HL8 A;  2A41 A;  4M45 A;  3OA9 A;  4CF1 A;  1IG9 A;  4F8R A;  1GNL A;  1E4F T;  1OVQ A;  2YHY A;  5AQW A;  4YHH K;  3L3O M;  4X62 K;  3SPZ A;  4DS5 A;  4CHO A;  4BGA A;  5ADX A;  3OYK A;  3KK1 A;  4FZZ A;  4IFE A;  4DMN A;  1R59 O;  3CQ8 A;  4IFV A;  1JQK A;  2HND A;  4YOU A;  2W42 A;  2YL5 A;  1QZ5 A;  3SCX A;  4CZK A;  3NFA A;  4DV2 K;  4H0Y B;  1T03 A;  3CPE A;  3OJS A;  4BRC A;  4E7I A;  3ENO A;  3I56 N;  5FIG A;  3LMF A;  1EET A;  1RT3 A;  1VSH A;  1EX4 A;  4YNQ A;  1ATN A;  5JVG L;  3C6H A;  3D6R A;  4QS7 A;  3CCJ N;  2GEM A;  4FWO A;  1JL1 A;  1SL1 A;  2YI1 A;  3PLA A;  2WYH A;  3O3H A;  3VA0 A;  4IXC A;  5FDL A;  4DLG A;  4MQD A;  3F5T A;  4KH5 A;  1NK6 A;  4KHN A;  5I9E B;  2Z8Y A;  4BR4 A;  4BC4 A;  2OPS A;  5JMV A;  3CZN A;  3QFP A;  4X65 K;  4QOZ B;  3L8B A;  2BGG A;  3SBS A;  3KAV A;  1I39 A;  1C0M A;  5I42 A;  4Z4G A;  2YHW A;  1G15 A;  3BVT A;  5JIC A;  1HTY A;  3O4N A;  4M0M A;  3FZM A;  4EZN A;  2UXC K;  4DR7 K;  4DSI A;  3MXJ A;  3ZSQ A;  3O1B A;  4ISE A;  3DPP A;  4CFD A;  3WT0 A;  3KK2 A;  3SZ2 A;  5E26 A;  4YOR A;  4F01 A;  4CJV A;  4LF6 K;  1XNR K;  3G6E N;  3CCE N;  1NK5 A;  2P9P B;  1S22 A;  3L3V A;  4B9S A;  3D0P A;  3MN5 A;  3L2U A;  4DQP A;  1OKJ A;  3LDN A;  4ID5 A;  4CF0 A;  3DX2 A;  4EZ9 A;  4IOX A;  1C1C A;  3AVI A;  4DU1 A;  4CJU A;  3QIP A;  1E1D A;  1QWN A;  4YOY A;  3ZET B;  4FZY A;  3A8Y A;  1CXU A;  1W2B M;  3DRS A;  4FO0 A;  3FZF A;  1L5U A;  3TTC A;  1HXK A;  1KFD A;  4FJN A;  4N41 A;  3MEC A;  4M3Y A;  2RT6 A;  1NNE A;  2YIB A;  3EEQ A;  4JK9 A;  4B1Y B;  4BRQ A;  1U2V B;  4H5T A;  1RTJ A;  4XEI A;  3THX A;  4O5B A;  1CZA N;  1RBT A;  3AGR A;  2FLO A;  5HRR A;  3KWG A;  3A98 A;  4LFA K;  2LM0 A;  2UYT A;  4NQI A;  1L3U A;  3ATU A;  4RCH A;  3OWG A;  3BP8 A;  1QQO A;  5AQL A;  2KHO A;  1BIS A;  4AZC A;  3ACO A;  4JD2 B;  4DFK A;  1A5W A;  4JI5 K;  2ZXQ A;  5JLH A;  3K0S A;  4HUF A;  1X9S A;  1IKW A;  4FK0 A;  3NF9 A;  4B9M A;  3VPZ A;  3QIC A;  4Y1C A;  2X6N A;  4DB3 A;  3V1Q A;  4Z4H A;  3RMD A;  4MO4 A;  1FXX A;  2UU9 K;  3LM9 A;  2YCH A;  4M7Y A;  4YFU A;  4KHY A;  1RCH A;  1J53 A;  2ZJQ L;  3T1Y K;  2V0O A;  4GNI A;  4B3T K;  1C0F A;  5BR9 A;  1QSL A;  5CY4 A;  1OVY A;  3FR0 A;  4CIE A;  3O3N B;  2VQF K;  2ZQB A;  2DY4 A;  2A42 A;  2X78 A;  2E8A A;  5AQG A;  2XY7 A;  1TQT A;  4WQ4 A;  2GWJ A;  4FOI A;  3VET A;  3NAE A;  4UDX X;  3RSE A;  4CJL A;  4FK4 A;  1HQE A;  2P9I B;  3VQP A;  3SQ0 A;  4A61 A;  4JKG B;  4EZO A;  1NJW A;  3P83 D;  4NXM K;  1BHL A;  5M1N A;  3U6F A;  2W40 A;  4B1X B;  4JN4 A;  4GV6 A;  2JNS A;  2NUB A;  3OYF A;  2UUA K;  4IM0 A;  4JI3 K;  4AZI A;  5LL6 Z;  1ILY A;  3JAM O;  4E1N A;  2PY6 A;  4CEZ A;  4OPJ A;  2E5L K;  1WAF A;  1YI2 N;  1E4G T;  2XY8 A;  5BRD A;  1BGX T;  3BVV A;  4JI0 K;  3EJP A;  1N36 K;  3BUZ B;  4PL8 A;  4CJR A;  2ZWH A;  2OP6 A;  1LWE A;  3VMF B;  3D51 A;  3ENB A;  4FJJ A;  1X9W A;  2QTD A;  4D8J A;  3VEN A;  2GTD A;  3L3U A;  4H5R A;  4EP5 A;  3PO4 A;  3RMA A;  3DOK A;  1OH8 A;  3HO1 A;  4KTQ A;  4R5G A;  4GMJ B;  4AIL C;  4R5K A;  1NM1 A;  1KLN A;  2QM1 A;  1BUP A;  3S3N A;  1W9M A;  3QNJ A;  3HT3 A;  5AQN A;  4HCC A;  1N33 K;  3JYT A;  4CF8 A;  2F8T A;  3QNN A;  2IGI A;  3TSQ A;  2YHB A;  3MCP A;  3MX5 A;  3I33 A;  4LSL A;  5AQV A;  4DKW A;  3RRG A;  2A3Z A;  2QEX N;  3AA4 A;  3BDP A;  2LXY A;  4H5N A;  1O7D C;  2Z1J A;  1OAO A;  4ISG A;  4YDU A;  2A40 A;  2NRV A;  4WYB A;  1WNS A;  4WFN L;  1RTI A;  2Z1H A;  3AA2 A;  2D0B A;  1ZWW A;  3QNI A;  3NE6 A;  5J2Q A;  4FLW A;  1S5J A;  3DJC A;  1HJO A;  5DM7 L;  2F9T A;  2E2P A;  4J8F A;  3NDK A;  1IKV A;  3CM5 A;  1WLJ A;  4MLE A;  2AP1 A;  3WEE A;  1KLM A;  1BU6 O;  3ZSZ A;  1V4S A;  2HBJ A;  2P9N A;  3H0X A;  5SZT A;  1SS6 A;  3CD6 N;  3L4Q A;  3TAE A;  1KVA A;  3IUC A;  3IFR A;  1KC8 O;  4DU4 A;  3HST B;  4EZS A;  5CYM A;  2NCZ A;  4B9N A;  4CZE A;  2OAN A;  5KQ8 A;  3VQ7 A;  1HYV A;  3HPO A;  1X1P A;  2Z0O A;  2NRX A;  5AQZ A;  4W5Q A;  5J1E A;  3AVJ A;  2CH6 A;  1HYS A;  4DFM A;  1QWU A;  2WFB A;  4K25 A;  1HJR A;  2HBM A;  4RW7 A;  3CFP A;  3SQ2 A;  1K9M O;  3DQG A;  4CJ3 A;  3ISN C;  1VQ6 N;  4CGJ A;  3CQX A;  1QHT A;  2O0I 1;  1O1W A;  4HUG A;  1TAQ A;  3O5B A;  3ALY A;  3BEX A;  2NRR A;  4IW0 A;  3OYA A;  3OYB A;  3WUH A;  2X3W A;  4PKG A;  3QIN A;  1XNQ K;  3R6M A;  4JLH A;  4DR2 K;  1BPR A;  5FPD A;  3LZI A;  4IWQ A;  3N4P A;  3THX B;  4LFC K;  1RBU A;  3CCU N;  3CMA N;  3IAY A;  2G8K A;  1GLC G;  2HHI A;  4M42 A;  3D4Z A;  3V9X A;  2C1G A;  1FW6 A;  3MDQ A;  3NH0 A;  4DTN A;  4BVP A;  2BTF A;  4EZ6 A;  4AHS A;  3OK8 A;  2EX3 A;  3CXC M;  2VCP A;  3E9L A;  5LMN K;  2WBN A;  3ZT2 A;  4DSL A;  3TSP A;  3AAQ A;  4CE9 A;  3SI6 A;  1EWQ A;  2FC0 A;  1JXE A;  3CF5 L;  4OKJ A;  3PSF A;  5DMR A;  4E81 A;  1HKB A;  4LD0 A;  4CIG A;  3VOV A;  4ID1 A;  3EE8 A;  3H08 A;  3WXI A;  5T7B A;  4LF5 K;  4BNE A;  4DV3 K;  5C2D A;  3V9U A;  3U3Y A;  1TL1 A;  5AFU A;  5GAH P;  1GLD G;  5K14 A;  1XC9 A;  3VER A;  4FM1 A;  1BOT O;  3KWI A;  4ILH B;  4JHD B;  1TKX A;  3AO1 A;  4K43 A;  2IOC A;  3MN7 A;  5EXW A;  3MN9 A;  4FZO A;  3VEV A;  3VQ8 A;  3ULE A;  4BR9 A;  3I2W A;  3MN6 A;  1FKP A;  3RSE B;  4DFP A;  4JI6 K;  4IKF A;  3ZX3 A;  1H1V A;  1GOC A;  2KLA A;  3QML A;  5IT9 O;  4QS8 A;  2YKN A;  2ASO A;  4FWM A;  4BRE A;  1R33 A;  3KKR A;  4BC5 A;  4DV1 K;  2YKT A;  3K5M A;  1VAZ A;  2DFE A;  5D3G A;  1W0H A;  2IVP A;  4KTW A;  2Z0N A;  3O9U A;  2KZZ A;  5FRO A;  4DR5 K;  3LP2 A;  3DMJ A;  2QWL A;  1OA0 A;  5KBP A;  1GNT A;  1E2U A;  3ZED A;  3CYG A;  3T3F A;  1TL3 A;  3EKS A;  1OH6 A;  1YAG A;  1DKY A;  3TAB A;  5BRE A;  4CGH A;  2BUP A;  4OX9 K;  3CC4 N;  4LH4 A;  4N56 A;  4AVM A;  4B9L A;  3M8S A;  1BL3 A;  5FLE X;  1HPM A;  3BZK A;  3GDQ A;  4TSX A;  4CFA A;  4CJE A;  1VQL N;  2QKW A;  2KTQ A;  3EJU A;  1BG3 A;  1NWK A;  4OVL A;  4MFB A;  1WBD A;  4BE7 B;  3WNG A;  4H0P A;  3F9K A;  2YI8 A;  1NGD A;  3HI0 A;  1TUU A;  3D50 A;  4ATM A;  5HP1 A;  3OYL A;  3CC7 N;  1VQ4 N;  4WQ5 C;  4NCA A;  4DUZ K;  2KW4 A;  3CCS N;  3M8R A;  4RTF D;  2OPR A;  1C0T A;  4C23 A;  3EJS A;  1DTQ A;  2OCE A;  3DRR A;  3M6G A;  4BEC A;  5HLF A;  2HST A;  4IZ9 A;  4OPA A;  2YLA A;  1WSI A;  3SAH A;  4DTU A;  1WOQ A;  3QBX A;  3U9D A;  3EJR A;  4FJG A;  4W5O A;  4FW2 A;  3CJ9 A;  3SYV A;  4CED A;  3VEZ A;  3CJ7 A;  2D0P A;  3OS2 A;  4IEE A;  3P4I A;  1GOB A;  4HHT A;  1DG4 A;  1N8R O;  3QFU A;  3S41 A;  1GLB G;  3AVG A;  4IJN A;  4FJL A;  3D7E O;  4CZL A;  1HNZ K;  1S9E A;  1HPZ A;  3H45 C;  4BY9 C;  3VGK A;  5BN8 A;  4DU3 A;  3J7Y P;  5KPR A;  1VSL A;  1K8A O;  2NRH A;  4G9Z A;  1MDU B;  3WEE B;  3HYF A;  4BRI A;  1BI4 A;  4YOV A;  2P9N B;  2F7Q A;  2Q31 A;  3M1F A;  1LCU A;  4B8A B;  2KFN A;  2RE2 A;  3QET A;  2Y1J A;  3TR8 A;  1TV6 A;  3THV A;  1A5X A;  2XY6 A;  3SJH A;  4WV5 A;  1VSF A;  1VQP N;  2BE2 A;  4GVM A;  3CCR N;  1FK9 A;  4JL9 A;  4QS9 A;  4FCY A;  3SPY A;  1XMQ K;  4PO2 A;  1HYZ A;  4CHP A;  4DTR A;  4JNE A;  3SNN A;  4HCB A;  4DTP A;  1HNW K;  4FJ5 A;  3QB0 A;  4EZT A;  1T7P A;  4GW6 A;  2G8H A;  3GBT A;  3OYD A;  3OYG A;  2IIR A;  3J8A A;  3S3O A;  3G25 A;  4PUO A;  4CZJ A;  3DX3 A;  4CZM A;  1I49 A;  2Z1G A;  4AM7 A;  1YIJ N;  3SAF A;  2F18 A;  3LP0 A;  4F3T A;  1E9V A;  2X74 A;  2C08 A;  2FBV A;  2YIV X; 
#chains in the Genus database with same CATH homology
 1NBW A;  2ASP A;  2YHW A;  4EIA A;  5JIC A;  1JCE A;  2V52 B;  2HOE A;  1SUF A;  4M0M A;  4EZN A;  3E1Y A;  3FZM A;  3W3D A;  3ZX2 A;  3F7W A;  4BRG A;  3O1B A;  3O3O B;  3FLC O;  3CI5 A;  3DPP A;  4ISE A;  4O5F A;  4CD3 A;  1JCF A;  3SBG A;  3I01 A;  3WT0 A;  4R79 A;  4CJ7 A;  5E26 A;  4JK7 A;  2EX3 B;  3R3L A;  3UIT A;  3DAW A;  4F01 A;  2GEL A;  3K9K A;  4YOR A;  5M1K A;  3G6E N;  3DPQ A;  1HKG A;  2D1K A;  3CCE N;  2P9P B;  1S22 A;  3EKU A;  5GIN A;  4HR1 B;  3RVC A;  3MN5 A;  1YF5 L;  2P9K B;  4JWD A;  1VQN N;  4B1Z A;  4FWN A;  4IWP A;  1OKJ A;  3LDN A;  5AQX A;  2E1Z A;  4GV3 A;  3ENH A;  2JWL A;  4H0O A;  4IOX A;  3B52 X;  4B1U B;  1E1D A;  3UKR A;  4YOY A;  4HWI A;  3ZET B;  2FXU A;  4B1W B;  1S72 N;  3H1V X;  1ESV A;  3A8Y A;  5F2R A;  1W2B M;  4JAX A;  2BPR A;  4BC3 A;  3AGK A;  1P90 A;  4FO0 A;  3KDR A;  3FZF A;  3TTC A;  2P9U A;  4BR2 A;  1RFQ A;  2RT6 A;  4H5V A;  4BR5 A;  4C1N K;  2P9L A;  2YIB A;  4B1Y B;  3AAP A;  4JK9 A;  4BRQ A;  5GIO A;  4OO1 J;  1NGJ A;  1U2V B;  3T47 A;  4I43 A;  4UDY X;  3CCQ N;  3D2E A;  4H5T A;  2GA9 D;  4XEI A;  3VGM A;  1CZA N;  3AGR A;  2FLO A;  3P39 A;  1ZYL A;  3A98 A;  3KWG A;  2LM0 A;  4IM3 A;  1GLF O;  2UYT A;  2W00 A;  3H6E A;  3B53 X;  3VEA A;  3ATU A;  4RCH A;  3OWG A;  3VEX A;  2AA4 A;  2YX6 A;  3HOS A;  3T46 A;  4KBO A;  4EZX A;  3RV0 A;  1QQO A;  3BP8 A;  3T48 A;  4EZQ A;  3CJA A;  4FWS A;  5AQL A;  4PL7 A;  2KHO A;  1DGK N;  1QZ6 A;  3MMV A;  4JD2 B;  2HBK A;  2C1I A;  2WIN M;  5JLH A;  2D4W A;  1NGH A;  1Q86 O;  3VPZ A;  3QIC A;  1XQS C;  2E88 A;  1LOT B;  2FSK A;  1YJ9 N;  1CKR A;  1NLV A;  3I8B A;  4DB3 A;  1C0G A;  1X3M A;  3R9P A;  5C2F A;  4MO4 A;  1ZBS A;  5BN9 A;  3RV1 A;  3OBY A;  3LM9 A;  2D0O A;  2KKZ A;  2YCH A;  4M7Y A;  1G99 A;  4L3Q A;  4YOX A;  5JVH L;  4Z94 A;  3O8M A;  2A6A A;  3DXM A;  2ZJQ L;  3O3M B;  3J7Z O;  3QBW A;  4GNI A;  4JEP A;  4O8K A;  1C0F A;  3CJB A;  3VEO A;  4BRD A;  2ND1 A;  5BR9 A;  4NPH A;  1OVY A;  3FR0 A;  3O1W A;  3GG4 A;  3LDP A;  3VTH A;  4CZI A;  3D2F B;  4UY8 O;  3O3N B;  5AQY A;  5GAE P;  4G6Q A;  3M3Z A;  1K8K A;  1ZXO A;  4IDH A;  3R8E A;  3F2K A;  2BH1 A;  2YHX A;  3EE9 A;  7HSC A;  3CIP A;  2E2O A;  3ZEU B;  2A42 A;  2E8A A;  5EVZ A;  4IO9 L;  1EO1 A;  2NRW A;  2QWR A;  2ZGY A;  4XH1 A;  5AQG A;  4H6I A;  4PKH A;  5EY4 A;  4R5I A;  3SK3 A;  4WQ4 A;  1Q82 O;  2GWJ A;  3FZK A;  2P9U B;  4FOI A;  3VET A;  4JWI A;  4UDX X;  3RSE A;  4KH4 A;  3VEB A;  4MDA A;  1Q7Y O;  3QA8 A;  2P9I B;  2CGK A;  4JKE A;  4ILJ A;  4JKG B;  4EZO A;  3EO3 A;  4A61 A;  2ZJP L;  3G71 N;  5M1N A;  4H6H A;  2NRZ A;  2W40 A;  2GAF D;  4B1X B;  4A2B A;  4JN4 A;  4F9O A;  4GV6 A;  3KZB A;  2JNS A;  4IM0 A;  5M1F A;  1SU8 A;  3DXK B;  4CZF A;  3OW2 M;  2X5C A;  4H0T B;  1ILY A;  2QXL A;  1Q18 A;  2PY6 A;  1KXP A;  3SMS A;  1YI2 N;  5H1S Q;  1E4G T;  5BRD A;  3PIO L;  3VF2 A;  3ERC C;  5GAD P;  3C7N A;  3IMX A;  5AQS A;  4BRL A;  2E2Q A;  3PIP L;  3BUZ B;  3GL1 A;  4PL8 A;  1KD1 O;  3UKU A;  4ILG B;  4CBW A;  2ZWH A;  2OP6 A;  3VMF B;  3ENB A;  1NGF A;  1KQS M;  2QTD A;  4D8J A;  4CZH A;  3VEN A;  2GTD A;  4H5R A;  3ZX0 A;  1VQ7 N;  4U7B A;  4BR0 A;  5AZJ B;  1GLE G;  1RDW X;  2E1Y A;  3MWP A;  3OBW A;  3I04 A;  4WQ4 C;  3MX2 A;  1W97 L;  4R5G A;  4H0X B;  4R5K A;  1NM1 A;  3TPQ A;  3VTI A;  5LJV A;  2QI2 A;  4M7X A;  4MDB A;  2QM1 A;  3ER9 B;  1OA1 A;  1BUP A;  1SU6 A;  1V4T A;  4EZR A;  3LDL A;  4JKF A;  3GOI A;  5LY3 A;  1W9M A;  3QNJ A;  4WV7 A;  5AQN A;  1K8K B;  5M1P A;  1ZC6 A;  4B9Q A;  2FSJ A;  3CHW A;  3FZH A;  4KIK A;  3TSQ A;  3GI7 A;  1J6Z A;  3L0Q A;  4BRO A;  3MCP A;  3MX5 A;  3A0I X;  3I33 A;  4BC2 A;  4FWR A;  3NMU A;  5AQV A;  4DKW A;  5EOY A;  2YJE A;  2HBL A;  1DT9 A;  2A3Z A;  2QEX N;  3H3O B;  3WXL A;  1VQ8 N;  5CE3 A;  5AQP A;  3A5N C;  3CER A;  1YIT N;  4H5N A;  4DQ8 A;  3C65 A;  3VKH A;  1OAO A;  1SQK A;  4ISG A;  4YDU A;  2A40 A;  4FPB A;  2NRV A;  3CJC A;  4H03 B;  4WYB A;  5MLC Q;  5FPE A;  5AQH A;  4WFN L;  4EAH D;  3FFK B;  5ADX H;  3A5L C;  2CGL A;  3E66 A;  4DHY A;  3N4Q A;  1BDG A;  4JNF A;  2PAV A;  5HOO A;  5C0Y A;  4BVO A;  3C7N B;  4A59 A;  3CC2 N;  2RHK A;  3E9P A;  1T44 A;  3DJC A;  3AAR A;  1HJO A;  1YHQ N;  3MCA B;  5DM7 L;  2F9T A;  1X3N A;  2E2P A;  4J8F A;  2QWM A;  4BRN A;  2V51 B;  5AQI A;  5M1O A;  2VGM A;  1Q5L A;  2QWO A;  3FZL A;  5DM6 L;  1Z6R A;  1BO5 O;  4MLE A;  2P9S B;  2AP1 A;  3WEE A;  5KPT A;  1BU6 O;  3GE1 A;  1V4S A;  2HBJ A;  2P9N A;  3H0X A;  4WF9 L;  4H5W A;  1SS6 A;  3CD6 N;  3B51 X;  3L4Q A;  3BF3 A;  3IUC A;  4JKC A;  3IFR A;  1KC8 O;  2NRT A;  4ILI A;  4EZS A;  2I7N A;  4FOE A;  5AZI A;  3A5O C;  2ZF5 O;  4R5J A;  2NCZ A;  3EL2 A;  3LDO A;  5EX5 A;  1QHA A;  4CZE A;  1RGI A;  2OAN A;  4K41 A;  5KQ8 A;  3SAG A;  1SU7 A;  1VQM N;  4FWL A;  5F0X A;  3SMP A;  4HY9 A;  4YDU C;  3OHR A;  2QFF A;  1T6D A;  2F9W A;  1NGI A;  4FWP A;  1XUP O;  3WQU A;  2V7Y A;  1M1K O;  1TUY A;  2QWP A;  2NRX A;  3AY9 A;  5AQZ A;  4A5A A;  3UE5 A;  1U00 A;  3TTD A;  2WC9 A;  2CH6 A;  1GLJ O;  1NMD A;  4K42 A;  3CQY A;  2ASM A;  4IOA L;  2WFB A;  3T4A G;  4K25 A;  2HBM A;  1HX1 A;  1K9M O;  4JKD A;  1DEJ A;  3L6Q A;  4OPH A;  4B1V A;  2QWQ A;  3DQG A;  3CJ1 A;  3KK7 A;  4I6M A;  3O80 A;  3NVM A;  1VQ6 N;  4YOT A;  2QA4 N;  5AQR A;  3W0L A;  1YXQ A;  3UKR B;  3CQX A;  3WXK A;  4A62 A;  3L4I A;  4ILH A;  4JKA A;  5AQO A;  5BPM A;  4IWO A;  4JHD A;  1KAX A;  3ZEF A;  2NZT A;  3JS6 A;  3O5B A;  5BPL A;  3BEX A;  2Q0U A;  2NRR A;  4IW0 A;  4CBX A;  3O9S A;  2ITM A;  2F7T A;  3H46 O;  3VEW A;  4PKG A;  3WUH A;  3C0B A;  4JKB A;  3MK6 A;  4XH5 A;  4BG9 A;  2DPN A;  1MWM A;  3R6M A;  5JLF A;  1YVN A;  3OHX M;  4F00 A;  3UB5 A;  4PHT X;  2FSN A;  5C10 A;  2P9L B;  1BPR A;  4RWT A;  5FPD A;  2P9S A;  4JK8 A;  2ZGZ A;  3FD9 A;  3DPO A;  4IWQ A;  3D2E B;  3N4P A;  1KAY A;  4M63 C;  3CMA N;  3CCU N;  4IOC L;  2IVO A;  5BRH A;  2YI9 A;  1GLC G;  4HTL A;  1VQK N;  3G4S N;  4EHT A;  5GIP A;  4KH6 A;  2C1G A;  1NJI O;  3MDQ A;  3KAW A;  4EZW A;  1Y64 A;  2OTL N;  4BVP A;  5AQQ A;  5C15 A;  2HF3 A;  2BTF A;  4EZZ A;  3ATV A;  3FGU A;  2PFU A;  1QVF M;  1VQ5 N;  3CXC M;  2VCP A;  3E9O A;  2GX9 A;  3E9L A;  1GN9 A;  3ID8 A;  2WBN A;  3QDK A;  1WUA A;  4DCH A;  1ATR A;  1MA9 B;  2P9P A;  2EWF A;  4HR1 A;  1YJW N;  1KAZ A;  2P9K A;  3C6A A;  2YIA A;  1BA0 A;  1SZ2 A;  3AAQ A;  3TSP A;  2H3G X;  2Q97 A;  4YOW A;  1SAZ A;  3A5M C;  3HM8 A;  3CF5 L;  5AQT A;  4E81 A;  1BWF O;  4PKI A;  4IJA A;  1X9J A;  1HKB A;  4JLC A;  1UPX A;  3O4W A;  3VOV A;  3EE8 A;  4JKH A;  1JJ2 M;  3ZET A;  3DXM B;  3WXI A;  2A5X A;  5BPN A;  3LM2 A;  4A2A A;  3KVG A;  4IEI A;  1T6C A;  2HF4 A;  1HLU A;  5C2D A;  1T3V A;  2ZJR L;  3DOB A;  3O08 A;  3IDH A;  1GLD G;  1NGC A;  2PBD A;  5AFU A;  3K9J A;  5GAH P;  3CCM N;  3CCV N;  5CHI A;  3EZW A;  4I6M B;  1TYQ A;  4NLB A;  3VER A;  3VF6 A;  3R1X A;  1BOT O;  3KWI A;  3O9T A;  4ILH B;  1U2V A;  4JHD B;  3T7Z A;  4BRP A;  4K43 A;  3ZYY X;  4LC9 B;  3MN7 A;  4CZG A;  5EXW A;  1DKZ A;  3MN9 A;  1DKX A;  3TTF A;  1VQ9 N;  5TKW A;  3VEV A;  1VQO N;  2N3K A;  3ULE A;  3WXM B;  3HTV A;  3MN6 A;  1XC3 A;  4BR9 A;  4O8U A;  4BEB A;  3RSE B;  3I39 X;  4FWK A;  2Q36 A;  3ZX3 A;  1H1V A;  4BRF A;  3H1Q A;  3EN9 A;  4NB4 A;  4GVE A;  4JD2 A;  2KLA A;  3N8E A;  3QML A;  4WQ5 A;  3VF4 A;  4A57 A;  5GAG P;  3NVK A;  4QS8 A;  4IO8 A;  2ASO A;  4FWM A;  4BRH A;  4BRE A;  4BC5 A;  3MWT A;  4BRM A;  1VAZ A;  5LJW A;  4FM3 A;  1DKG D;  2NNW A;  4WCE L;  1EQY A;  1NGG A;  2IVP A;  1GLA G;  4EFH A;  4NLC A;  2V7Z A;  2W41 A;  4EHU A;  3LDQ A;  4BG8 A;  3TU5 A;  3O9U A;  1BA1 A;  3O6W A;  2ND0 A;  5AQU A;  4U67 L;  1Q81 O;  2QWL A;  1OA0 A;  3HSC A;  4BGB A;  4E3C A;  1RDU A;  3O9Q A;  4XJX A;  1GNT A;  1E2U A;  1MWK A;  3UKU B;  1QVG M;  3ZED A;  2NLX A;  3BF1 A;  1JCG A;  3EKS A;  1YAG A;  1DKY A;  3D2F A;  5BRE A;  3U9Z A;  2BUP A;  2WUS A;  3CC4 N;  5CR4 A;  4BR7 A;  5B8H A;  2VWB A;  4XH4 A;  4JWC A;  1HPM A;  5FLE X;  3GDQ A;  3CPW M;  1VQL N;  3U8X A;  1BG3 A;  1NWK A;  3ZEU A;  5AQJ A;  4BE7 B;  1O13 A;  4H0P A;  2OTJ N;  2YI8 A;  1NGD A;  3HI0 A;  1TUU A;  3HOT A;  3F9M A;  1P8Z A;  2QWN A;  4MLH A;  3CC7 N;  4BQL A;  3I55 N;  1TYQ B;  4WQ5 C;  1K73 O;  2YJF A;  1VQ4 N;  5TKY A;  3O9R A;  2HMP A;  2Q2R A;  5AQK A;  3CCS N;  2VGN A;  2P9I A;  4KIK B;  4RTF D;  3Q7B A;  3KHY A;  2EWS A;  4JKG A;  4C23 A;  2OBL A;  1IJJ A;  3HBT A;  4R5L A;  2Q1N A;  3M6G A;  4BEC A;  2VYP A;  3CME N;  2HST A;  4IZ9 A;  4OPA A;  4E1J A;  3SAH A;  2JWK A;  4CD1 A;  5C12 A;  1YUW A;  1NGE A;  3ULE B;  5FPM A;  3SBT A;  1WOQ A;  3QBX A;  3DXK A;  4NO7 A;  3U9D A;  1NGA A;  2FF3 B;  4FPA A;  4H0V B;  4MO5 A;  4FWQ A;  2E20 A;  1ATS A;  5AFU H;  1YJN N;  4BRK A;  4BRA A;  3CJ9 A;  1HKC A;  3JXU A;  4AF1 A;  4ISF A;  3VEZ A;  1QQM A;  4ILG A;  1Z05 A;  3CJ7 A;  4FL9 A;  2D0P A;  4EZV A;  1MJG A;  3CET A;  2GWK A;  4IEE A;  5FPN A;  3P4I A;  3WXJ A;  1DG4 A;  5AR0 A;  3T69 A;  1N8R O;  3QFU A;  3S41 A;  3ID6 A;  4FSV A;  1IG8 A;  1GLB G;  4GY2 B;  3IKM A;  4Y0W A;  4IJN A;  5AZJ A;  2Q0R A;  3D7E O;  3VES A;  3WQT A;  4CZL A;  5F1X A;  4HYB A;  2IVN A;  3H45 C;  3M5R A;  4BY9 C;  4A5B A;  1U6Z A;  2A41 A;  3VGK A;  1GLL O;  5BN8 A;  3OA9 A;  3H3N O;  5KPR A;  1K8A O;  5E84 A;  3Q7C A;  4IWV A;  2NRH A;  1GNL A;  1E4F T;  2YHY A;  4G9Z A;  1MDU B;  5AQW A;  1QQN A;  2FF6 A;  3L3O M;  1HUX A;  3P38 A;  3WEE B;  4BRI A;  4YOV A;  2CGJ A;  4CI6 A;  3U4L A;  2P9N B;  4BQZ A;  4BGA A;  5ADX A;  5ELZ A;  2Q31 A;  3B8A X;  3M1F A;  4CBU A;  1LCU A;  1M90 O;  3TSU A;  3P31 A;  2RE2 A;  4IFE A;  3VEY A;  2J4R A;  5AZI B;  1R59 O;  3ER8 C;  4C1N I;  3LL3 A;  3FE1 A;  3T49 A;  4WV5 A;  3HRG A;  1JQK A;  4YOU A;  3SJH A;  1VQP N;  5M1Q A;  1QZ5 A;  2GUP A;  3CCR N;  4CZK A;  4JL9 A;  4QS9 A;  4H0Y B;  2QW9 A;  2CH5 A;  3CPE A;  4BRC A;  4PO2 A;  3ENO A;  3I56 N;  5FIG A;  5HL7 L;  4JNE A;  3LMF A;  2I7P A;  1S3X A;  1D4X A;  4WFB L;  4EZY A;  1ATN A;  3SBT B;  5JVG L;  3C6H A;  3D6R A;  4QS7 A;  3CCJ N;  3CCL N;  3QB0 A;  4EZT A;  2GEM A;  4FWO A;  3SLC A;  3DLL L;  5KQD A;  3GBT A;  1NGB A;  4FVU A;  2YI1 A;  3PLA A;  2E2N A;  4WFA L;  3VGL A;  5AQF A;  2IIR A;  3J8A A;  4IXC A;  4AM6 A;  4IM2 A;  4MQD A;  4EZU A;  3F5T A;  3G25 A;  4KH5 A;  5AQM A;  5KPZ A;  5I9E B;  2OBM A;  2Z8Y A;  4CZJ A;  4BR4 A;  4CZM A;  4EZP A;  4BC4 A;  5JMV A;  4AM7 A;  1YIJ N;  3SAF A;  3HZ6 A;  3QFP A;  4JWE A;  3SBS A;  4GV9 A;  1E9V A;  3KAV A;  5BRF A;  3DWL A;  2YIV X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...