4JN4A

Allosteric opening of the polypeptide-binding site when an hsp70 binds atp
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
600
structure length
600
Chain Sequence
SGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 192
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00012 HSP70 Hsp70 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jn4A05
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jn4A04
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jn4A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jn4A01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jn4A03
4BRNA 2P9LB 3FZLA 5AQFA 5AQPA 5I9EB 1X3NA 2YHWA 3ID8A 3H6EA 5JMVA 4B9QA 3CJBA 2E1YA 4WQ5C 1HKCA 3DPOA 4BC3A 1WOQA 3BEXA 2Q2RA 4QS8A 4C23A 1SZ2A 2ASPA 4BROA 5AQVA 2PBDA 3SK3A 2KHOA 4H0PA 4BGBA 4BRFA 4WYBA 4H5VA 4E81A 2FXUA 2V7YA 3LM9A 3TPQA 3U9ZA 4JD2A 5ADXH 3L3OM 3DQGA 4IJNA 3VF2A 4ISEA 1HJOA 4FSVA 5AQMA 3QICA 3QFUA 2P9PB 1KAYA 4IWVA 3FZMA 4EZNA 1MWMA 4E1JA 2DPNA 4MLHA 4BC5A 2WINM 1ATNA 2A3ZA 2BPRA 5AQYA 1XC3A 2IVPA 2QWOA 5AQSA 5JLFA 3FFKB 3GE1A 4EFHA 5AZIB 4YDUA 1NGHA 2E20A 4H5NA 3U8XA 3ZX2A 3O1WA 3VENA 3DOBA 2P9UA 1NGDA 3I8BA 3MMVA 2QWRA 3HI0A 1NGBA 2HF3A 3MN7A 4MLEA 4BRPA 3VEZA 2QFFA 3CERA 3N8EA 3B8AX 5AFUH 3O1BA 5AZJA 1BO5O 2VCPA 4K43A 7HSCA 2GUPA 3WT0A 4BRHA 4EZUA 3WEEB 3FGUA 5BRFA 5AQZA 1RDWX 2P9LA 3UKRB 1NLVA 1BOTO 3CJ7A 1V4TA 3I33A 3IFRA 1MA9B 2ITMA 5BPNA 5BRDA 5AQKA 3VESA 1RFQA 2YJEA 2W41A 3WUHA 3MCPA 4EZTA 2Q0RA 5TKYA 1BA0A 3LDPA 3M3ZA 3WQTA 2IVNA 3FLCO 4FO0A 3WXIA 1QQMA 4BR5A 4H03B 1YUWA 1RGIA 3AAQA 1ATSA 3FZHA 3H1QA 3IUCA 3CJ1A 1U2VB 3VF4A 4BRKA 3VGLA 3HBTA 4CZIA 1QZ6A 3H0XA 5LJVA 1E4FT 3GG4A 4WQ4A 1NWKA 2QWMA 4FWOA 2P9PA 1D4XA 4CBWA 2NRHA 4HY9A 3M6GA 4BVOA 1XUPO 2ASOA 4F01A 5AZIA 2VWBA 4JNEA 1GLEG 2CH6A 4EZZA 3EN9A 4EZWA 4BQLA 3IDHA 1GLAG 5KPTA 1H1VA 1C0FA 1QZ5A 3KVGA 3ZETB 4YDUC 2EWSA 2P9IB 5ELZA 3ATUA 1J6ZA 4RWTA 4J8FA 4H6IA 1T6DA 2P9NB 4PKHA 3W0LA 2E2PA 3U4LA 3WEEA 1ZBSA 3LDOA 1WUAA 4FL9A 3UKRA 5AQHA 4BR4A 4CZLA 1Y64A 3FE1A 4FWQA 2F9TA 5AQGA 4FWSA 4BC2A 1KXPA 3EL2A 5AQTA 2Q1NA 3O80A 3LDQA 4K25A 1U6ZA 3CETA 2P9KB 2YCHA 5AQLA 3LL3A 4BRGA 2QWPA 5AFUA 4DB3A 3FZFA 4FPBA 5CE3A 4CJ7A 1KAXA 1U00A 1TUYA 1U2VA 4EZVA 3T47A 1IJJA 2A42A 5JICA 1E4GT 4HWIA 4CZKA 4R5KA 2A5XA 4QS9A 1LOTB 3VEVA 5LY3A 4WQ4C 3GBTA 2E1ZA 5EXWA 3T48A 5AQWA 1DG4A 2GTDA 5AQXA 3T46A 1HPMA 4M7YA 5AQRA 4CZHA 1NGCA 3P4IA 4BRDA 3D7EO 1MWKA 2E2OA 1TUUA 3BF3A 1GLCG 2HOEA 2BUPA 3ZETA 4M7XA 2P9IA 4O5FA 4JAXA 3DXKA 4CZMA 3F9MA 2V52B 5BREA 2D4WA 2E2NA 2P9NA 3T4AG 1CKRA 4R5JA 4CD3A 3SLCA 5AQJA 1ZC6A 4I6MB 4JWIA 2CGJA 3OHXM 1NGIA 4MO4A 2FLOA 3GL1A 3AARA 4BC4A 4H5TA 3LDNA 5AR0A 3SMPA 3QDKA 5KPZA 5E84A 2I7PA 2P9KA 3C0BA 2QM1A 2NZTA 3CJ9A 1GLJO 3O08A 3R9PA 3UKUB 4O8KA 4BR0A 3QFPA 4ISGA 2A41A 2H3GX 3H45C 4CBXA 4BRMA 1BPRA 3QBXA 2Q0UA 4BRAA 1DGKN 2IIRA 2QWQA 4BG9A 1NM1A 2UYTA 3FR0A 1NBWA 4LC9B 5JLHA 3ZX3A 3HM8A 1ESVA 4HTLA 4DQ8A 2AA4A 4K41A 4JHDB 2J4RA 3HZ6A 1BDGA 1QHAA 5BPLA 2WUSA 4FOIA 4A2BA 3LDLA 1NMDA 5E26A 3O5BA 4H0XB 3R8EA 4BRQA 4EZOA 2QWNA 2OP6A 4EHTA 5EOYA 2OANA 4JN4A 2HMPA 3ATVA 3HTVA 4BRCA 4ISFA 3QNJA 5FPDA 2YHXA 2D0OA 2PAVA 4CZEA 3DXMB 2ZWHA 3A0IX 4I6MA 1X9JA 4EAHD 4CZJA 5ADXA 3L4IA 1X3MA 5B8HA 2CH5A 2Q31A 3DXKB 4IZ9A 2P9SB 3D2EB 2CGKA 5AQQA 3BP8A 2FSNA 1MDUB 1TYQB 1CZAN 3QMLA 1C0GA 4BRIA 3S41A 3UKUA 2ZGZA 2FF3B 4H0YB 4XH1A 1DKGD 3EO3A 3A5MC 4BG8A 4GY2B 3JXUA 2HF4A 3ZX0A 3AAPA 3DPPA 5F0XA 1JCFA 2FF6A 3H46O 3VEWA 2V51B 4DHYA 1S3XA 3U9DA 5FPNA 3H3OB 3A5LC 2CGLA 4B1YB 4BRLA 1DKXA 4JHDA 2FSKA 4B1VA 4QS7A 4CD1A 4IXCA 1QQNA 3EKSA 4A61A 4FPAA 4JWDA 4XH4A 4XEIA 1NGJA 2AP1A 3VEYA 2E2QA 3BF1A 3HSCA 3WQUA 1DKZA 3H1VX 1BG3A 3G25A 4CBUA 3MK6A 4EZQA 1HX1A 4H5RA 1YAGA 1HLUA 3W3DA 4FOEA 1T6CA 3DXMA 1DKYA 3DJCA 3WXLA 3EKUA 3D2FB 2QW9A 2F9WA 1HKGA 3VF6A 4B1UB 4PKGA 4AM6A 4EHUA 3JS6A 1Q18A 3UE5A 2P9SA 1GLFO 3D2EA 3J8AA 3SMSA 1K8KB 1TYQA 2IVOA 2A6AA 4Z94A 1SAZA 3AY9A 4BREA 3WXJA 1DEJA 4DCHA 4IJAA 3ULEB 3EZWA 1Q5LA 3ENOA 3ZEUB 3O6WA 5KPRA 1ZXOA 5F2RA 3CQYA 2W40A 5BPMA 1P8ZA 1SQKA 3GDQA 1IG8A 3TU5A 1Z6RA 3DPQA 2ZF5O 3LM2A 4IO8A 4K42A 4JNFA 4BR9A 1HUXA 3A5OC 3CHWA 4CZGA 3A8YA 4EZXA 4L3QA 5EX5A 4KBOA 4EZRA 2ASMA 4FWKA 1GLBG 2GELA 5KQ8A 2GEMA 4PL7A 3QB0A 3C7NB 5BN9A 5AQOA 4B1ZA 3VETA 1NGEA 3ENHA 4JWCA 3CIPA 3CI5A 3DAWA 3VGKA 3O4WA 4BR7A 4BQZA 4EZSA 1BA1A 4CZFA 1YXQA 4BR2A 1OKJA 2E8AA 1BU6O 4PL8A 1XQSC 5BRHA 3OHRA 4R5GA 1JCGA 2QWLA 3L6QA 2ZGYA 3VPZA 1HKBA 3MN9A 4H5WA 1YVNA 4H0TB 2QXLA 4B1WB 5EY4A 3GOIA 3D2FA 3RSEB 5AQIA 4RCHA 5FPMA 2Q97A 1BWFO 3VGMA 1EQYA 4AM7A 4WQ5A 2BTFA 1K8KA 1KAZA 3M1FA 5F1XA 4EZYA 4PKIA 3CJAA 5EVZA 1NGAA 2A40A 3ULEA 2GWJA 1ATRA 4JWEA 1G99A 3ZEUA 1NGFA 2V7ZA 4XH5A 2YHYA 4F9OA 5LJWA 4WV7A 4RTFD 1Z05A 4R5IA 4EZPA 4FWPA 4B1XB 3CQXA 4CI6A 3O8MA 1NGGA 3KZBA 4PO2A 3MDQA 4BGAA 3MN5A 3DWLA 3L0QA 2Q36A 5BR9A 4BVPA 4R5LA 1GLLO 4FWLA 3WXKA 4H6HA 1R59O 4JD2B 2NLXA 1GLDG 1S22A 4NO7A 4Y0WA 1JCEA 2D0PA 2VYPA 3VERA 2D1KA 4NB4A 3C7NA 4A62A 2YI1A 1BUPA 3SJHA 2I7NA 4M63C 3VEOA 3T49A 4FWNA 4FWMA 5AQUA 3VOVA 5KQDA 1LCUA 1T44A 4H0VB 4MO5A 1V4SA 4HYBA 2FSJA 3BUZB 3FZKA 3KHYA 5BN8A 4EIAA 4A2AA 2P9UB 3A5NC 2YJFA 3H3NO 2GWKA 3CJCA 4F00A 4WV5A 3RSEA 5FPEA 4H0OA 3R6MA 3VEXA 5AZJB 3QBWA 4FWRA 3MN6A 5AQNA 3UB5A 2E88A 3IMXA 4GNIA 1QQOA
chains in the Genus database with same CATH superfamily
1TL1A 1FKOA 2BH1A 4ILGB 2ZJRL 3N4PA 4FZZA 4NXMK 4E3CA 3ID8A 1FKPA 5JMVA 4DV2K 4B9QA 4E7IA 2E1YA 1HKCA 4E7HA 3DPOA 1S1VA 2Q2RA 2QA4N 4QS8A 4DLGA 4C23A 5AQVA 4H0PA 2FBVA 4HUGA 4WYBA 4DR3K 2V7YA 2P5OA 3LM9A 3RMBA 3TPQA 4DR5K 2QI2A 2OBLA 1HNZK 2RAJA 3VF2A 4ISEA 1HJOA 4CHZA 4MFBA 3THWB 4EZ9A 1MWMA 4E1JA 2DPNA 1F21A 3L2RA 5AQYA 4I2QA 4DV7K 4PQUA 3U8XA 4BACA 2C08A 3DOBA 2BGGA 3HI0A 4MLEA 2YL8A 4FLVA 1HNIA 3CYMA 2D0AA 5AFUH 5TKWA 2O8EA 1I39A 2VCPA 4K43A 7HSCA 4M3UA 3MXMA 3NGYA 4QCLA 3FGUA 1C1AA 4LF8K 1RDWX 3OVNA 3UKRB 5JLHA 3IFRA 5BR8K 3NH2A 2KFNA 3CC7N 1RFQA 3I04A 2YJEA 4ILJA 3C65A 2W00A 5TKYA 4KHWA 3WQTA 2IVNA 4FO0A 4W5NA 3SQ2A 1QHTA 3QEXA 4DTUA 4JV5K 4H03B 3TAEA 1RGIA 2YHAA 3ZT0A 2XY5A 4CJ3A 1ATSA 3NFAA 3FZHA 3H1QA 3ER9B 3DDFA 3IUCA 3VF4A 5LL6Z 4G1QA 4KAZA 1W2BM 2Z0VA 1VRUA 3GG4A 4WQ4A 2NRVA 1HXKA 4FWOA 3PSIA 3O3GA 4AHUA 1D4XA 3CCUN 4B8AB 3OYDA 4DSLA 3DLEA 3M6GA 3L2WA 1HYVA 3DX1A 1IBLK 3TSQA 3VQ7A 4CEOA 3V1QA 2RAKA 4F01A 3V1RA 3OS0A 3AGRA 3CC4N 1GLEG 3QEWA 4EZWA 4AILC 3IDHA 3HO1A 4N76A 4BNEA 1HNXK 4IWOA 2EWSA 4NCBA 3ERCC 4OJRA 3K59A 4M3ZA 3S3NA 5LMNK 2F7PA 3O3OB 4DU3A 3BVVA 1N36K 2P9NB 1N5YA 2E2PA 2O8CA 4DFPA 4K8ZA 2RT6A 5HRNA 5I3UA 5AQHA 4AZ7A 4WE1A 4CZLA 4CJPA 4YY3K 3CXCM 4AZ5A 1Q86O 5AQTA 3EZ5A 1XI1A 2UXBK 4OGCA 2FC0A 4Z4IA 3EJPA 5KBPA 3SOGA 3LL3A 4CJSA 2QWPA 5AFUA 4FPBA 3K2PA 4AZBA 2YIBA 1W9HA 3CCVN 3KDRA 3K58A 1KFDA 1TKTA 4CJVA 2ZD1A 1E4GT 2OPSA 4HWIA 4R5KA 4HCCA 4CF0A 4IOXA 3VEVA 3EYZA 3I0SA 3OBYA 2VGMA 4WQ4C 5H1SQ 3GBTA 3MXJA 2WBNA 3RR7A 3T48A 2MI7A 2XY8A 5AQXA 3OK8A 1SUFA 2Z0OA 3P4IA 5M1NA 4JKHA 1MWKA 2HVIA 3BF3A 1LV5A 3SUQA 2VGNA 3TABA 3ZSQA 2ZJQL 4IOCL 4C8KA 3DXKA 4CZMA 1VQ6N 3B52X 3F9MA 1EWRA 1Q9YA 3RMCA 1RBRA 3TR8A 2BE2A 3T4AG 2RN2A 5KTQA 4YOYA 1YTUA 3KWGA 4FM2A 2CGJA 3OHXM 1VQPN 1S6PA 1RDUA 4BC4A 4NCAA 1XNQK 4JI2K 1R5EA 3SMPA 3QDKA 3AO5A 4B9LA 1S1WA 2P9KA 1ZYQA 4M3XA 3CJ9A 3O4NA 3O08A 3R9PA 5GADP 4ISGA 2A41A 1KCFA 4E7KA 3HOSA 3QBXA 1N6QA 1UA1A 4MQ3A 3RMAA 4KTZA 2O4IA 4A5AA 5SZTA 3QINA 3FR0A 4LC9B 3DDGA 3HM8A 4FJXA 3CPWM 3LWMA 3I39X 3AVFA 3O3FA 4AHCA 1NKCA 2NNWA 2KTQA 3VKHA 1WBBA 2WUSA 4A2BA 3KTQA 4JKDA 5J1EA 3CD6N 2XY7A 5E26A 4BRQA 3WNHA 1VQ4N 2OANA 3ATVA 2B5JA 4DS5A 3M3WA 3QESA 4KB0A 1OVQA 1O7DC 4ISFA 4CEFA 1C0UA 3M8PA 3D50A 1WAJA 4CZEA 3DXMB 1E2UA 3T69A 5A2QO 2HHVA 2GA9D 5B8HA 3BVXA 2CH5A 4JI0K 3Q0KA 4B3RK 4OPHA 3PLAA 2FSNA 4GV3A 4BRIA 3S41A 3UKUA 5HRRA 1XNRK 2VG7A 3A5MC 1S9EA 4I2PA 3ZX0A 2O8FA 1FJGK 5F0XA 3TAQA 2HBJA 2V51B 4DHYA 2DY4A 1KQSM 2N3KA 4BWJA 4KRFA 2F7OA 3AVKA 3VQAA 3DYAA 3OBWA 1B9DA 4UY8O 3VQ9A 4JL9A 3HVTA 3QERA 2NRZA 4IM3A 4FLUA 3A5LC 2CGLA 1DKXA 3L8BA 1SS6A 1BI4A 3LANA 4CD1A 2ZM6K 3EKSA 4A61A 3JYTA 3CF5L 4CHPA 3BUIA 2AP1A 3VEYA 2LM0A 4L8RB 1HMVA 4I7FA 3G25A 3G4SN 3IRXA 2NRRA 4IM2A 1HX1A 4FM3A 1QVGM 2OO2A 3W3DA 5KRTA 3M8SA 1T6CA 1XMOK 3DLGA 1TKZA 2OPRA 4HR1A 4FM0A 3QNNA 1HKGA 1SU7A 3CFOA 1VSDA 1JL1A 1JLQA 3D2EA 4GVMA 4FK2A 3HYFA 1RTJA 4F3TA 4RG8A 1M90O 2IVOA 3LAKA 2A6AA 4Z94A 3AY9A 4PUOA 4FJMA 1HRHA 1SKWA 2VWKA 4KHPK 1QE1A 2FBYA 2VG6A 5KPRA 4YOVA 3CQYA 4FK0A 1P8ZA 3GDQA 1IG8A 3CCSN 3TU5A 1VSLA 3CQ8A 4UDYX 4CGFA 3TTCA 3A8YA 3T1AA 4FLZA 5EX5A 4KBOA 3VTIA 2GELA 3V4IA 4DKWA 2EFKA 4DSIA 5MLCQ 4FLXA 3NCIA 3EJRA 1U4BA 3DRPA 5AQOA 1NGEA 3ENHA 4N5SA 2FBXA 4IOAL 1XHZA 4JKCA 1NK9A 4DQPA 4HTUA 3F73A 4ID5A 3KKRA 1XQSC 1K9MO 3VQCA 3TAGA 3EE9A 3PIPL 1ITGA 3KK1A 1KRPA 4YOUA 3O9UA 3RSEB 4WF9L 1EWQA 5AQIA 4RCHA 4CHNA 3BGRA 4C8LA 4DQRA 3VGMA 4JK7A 1HWWA 1Q81O 4AM7A 1GOBA 5HL7L 4E0DA 1GOAA 2DFHA 4W5TA 2UUBK 3CJAA 2A40A 3QEVA 3CM6A 1NU0A 1ZBLA 5T7BA 1BHLA 1EP4A 3NGZA 1I94K 1NGFA 4XH5A 1LWEA 5FROA 4F9OA 2G8WA 3AVJA 3SPYA 2X78A 2OW7A 3L3PA 4R5IA 1HNWK 3PSFA 4FWPA 2UXCK 3O8MA 1NGGA 3KZBA 4PO2A 4CF8A 1W97L 1HQUA 5BR9A 3O9RA 4R5LA 1ZBFA 3WXKA 5GAGP 1K8AO 4NO7A 4XIUA 1U49A 2VYPA 4H8SA 3VERA 2D1KA 1RDDA 2NUBA 3HRGA 4FJ5A 4IM0A 1XC9A 3DLLL 4EP4A 3K0SA 2ND0A 3DYTA 3VOVA 1LCUA 1T44A 3M8RA 3WXMB 3F7WA 3BUZB 4X65K 1VAZA 5FLEX 4EIAA 3K9JA 1KSPA 1VSFA 3O9TA 1JLBA 2E4LA 2P9UB 1YF5L 4CF2A 2A1RA 4LF4K 3V9WA 4WV5A 3LALA 3KD1E 5AZJB 4DS4A 3QBWA 4FWRA 2E88A 3IMXA 4ID1A 3F9KA 5I42A 4BRNA 2P9LB 5AQPA 4BECA 1X3NA 4E3SA 1NJIO 3H6EA 2IAJA 4AH9A 3GI7A 1TVRA 1WLJA 2B4JA 4Q5VA 3CZNA 1SZ2A 4BROA 3AVBA 1J53A 2ITGA 4CJ4A 1D9DA 4AQYK 4BGBA 4IFYA 4E81A 3D4YA 1EX4A 5ADXH 3LZIA 3L3OM 5C24A 4WFNL 2P5GA 3HPHA 4JKGB 1J5OA 3ZYYX 3QICA 3BVTA 2P9PB 4IWVA 3FZMA 3TTFA 4DR2K 4DR6K 2YX6A 5AJ3K 4BC5A 1NK5A 2WINM 1TQTA 2A3ZA 1QWUA 3LPUA 3ZSWA 3HT3A 2QWOA 5AQSA 2OCEA 3FFKB 5JLFA 3NF9A 5IT9O 5AZIB 4YDUA 3NH1A 4LD0A 3TAMA 3QNIA 3O1WA 3I2WA 1NGDA 2QWRA 1NGBA 2HF3A 3TAPA 4KI4A 4M3RA 4JK8A 2QFFA 1T05A 1UAXA 1BO5O 4AHVA 1TAQA 4CFDA 4BRHA 1R33A 2WC9A 3V9UA 2G8VA 2YNFA 4FJ9A 5BRFA 1NLVA 1BOTO 1QX1A 1ASVA 3KIOA 4EZTA 3V6DA 1TQUA 1VQMN 2G8UA 3M3ZA 3LDPA 2GV9A 3NMUA 4OKEA 1QQMA 3ITHA 1IO2A 1YUWA 2NRWA 2O8DB 5C42A 3QLHA 1U2VB 3HBTA 4WPCA 2HSTA 2GAFD 2XRIA 3H0XA 5LJVA 3IS9A 1OA1A 4CESA 2QWMA 3VQQA 5CYMA 3N4QA 3DM2A 1C1BA 3ZSZA 1OAOA 3KAVA 4IKFA 4RW9A 4K0KK 1SU6A 2JGUA 2WTUA 1VSIA 4DWIA 2ASOA 3VN5A 4O4GA 3SBTB 2CH6A 4EZZA 1LW0A 4KH5A 1GLAG 4KTWA 3AVAA 2HBLA 4CJLA 3LZJA 4YDUC 2P9IB 3OYKA 4KIKB 3O3MB 4M0MA 3ATUA 3U6FA 2O8BA 3AVLA 2Z1HA 2D5RA 4H6IA 3SUOA 1NJWA 3WEEA 3NDKA 1ZBSA 3LDOA 1XWLA 5CY4A 4CJWA 4AZIA 4DV6K 1Y64A 4FWQA 5KRSA 3KKSA 5CZ2A 4FWSA 1QWNA 5J2MA 3O80A 4K25A 2RPIA 1XMQK 2YL5A 3P38A 4JI6K 3K5MA 1NK7A 1OH7A 1U48A 2EHGA 3FZFA 4U7BA 4GVEA 5CE3A 1TKDA 3ALYA 1UPXA 3SAFA 2A42A 1NG9A 3CKDA 3ZSXA 4CZKA 4IG0A 2A5XA 4N41A 4OO1J 3DMJA 1ZBUA 4B9SA 4DSJA 2HHHK 1DG4A 1HPMA 5GINA 3P31A 3Q7CA 1NGCA 3QO9A 5C25A 4E7JA 3HL8A 1QQCA 2E2OA 2FYVA 3I01A 1GLCG 4KHUA 2BUPA 3Q84A 4M7XA 3ZETA 2X3VA 1YJ9N 2IOCA 3K5LA 4KB1A 4UDXX 2OZMA 4NSWA 4PWDA 1X03A 1CKRA 4R5JA 5DM6L 2JNSA 4AVMA 4I6MB 1YHQN 4MO4A 3EEQA 3R3LA 4FJHA 3LDNA 1VQ7N 4B9TA 4O55A 3VQBA 2QM1A 2NZTA 5SWMA 1GLJO 3HVRA 4OLAA 3QFPA 3OYEA 2E5LK 1RILA 3OA9A 4JI5K 4FJNA 4BRMA 2HW3A 3AVMA 4YNQA 4DUYK 4CGGA 3UIQA 2LXYA 1BIZA 2UYTA 3KK2A 1NBWA 2IC3A 3CCRN 1IBMK 4J2EA 1OH8A 1RTHA 4JHDB 2J4RA 1KLMA 3C6AA 5BPLA 1QSLA 3MWPA 3SYZA 4FOIA 5C2DA 3SV3A 3O5BA 4H0XB 2ZJPL 4EZOA 2OP6A 4DG1A 5HP1A 4BY9C 3O9QA 4BRCA 3BLBA 4M3WA 3QNJA 4CFBA 2D0OA 2YNHA 2WFBA 1DTQA 2VG5A 2ZWHA 1RT1A 3C95A 3CV5A 3DX2A 4JLCA 1X9JA 3L4IA 2IGIA 3F2KA 2P9SB 4FLWA 3NH0A 3CM5A 4DQQA 4J2BA 2PYLA 1TYQB 1DLOA 1NK4A 4KHQA 2OYQA 2FF3B 4XJXA 4DTPA 4XH1A 1GNTA 4ICLA 3EO3A 4CJ5A 4FCYA 4DSFA 3DPPA 3LWLA 3HSTB 4YHHK 1JCFA 2FF6A 3H46O 3VEWA 4G9ZA 2ZE2A 2KLAA 3K9KA 5C2FA 2Z1IA 3R1XA 5FPNA 3H3OB 2GX9A 1WBDA 2ELBA 3SQ0A 4CK3A 4B1VA 1D5AA 3KJVA 1RTDA 4QS7A 4KHSA 3TI0A 5FDLA 3WNGA 1U45A 1TQSA 4IXCA 4FPAA 4XH4A 1TK5A 4XEIA 4NLBA 3SQ1A 2E2QA 3BF1A 4ILHA 2F8TA 4CEDA 2Q12A 3MK6A 5C5BA 1YAGA 1N34K 1HLUA 1REVA 3WXLA 3D2FB 2QW9A 4CEQA 4NYFA 4B1UB 1QSSA 3RPMA 4AM6A 1CZ9A 2WYIA 5DM7L 1TV6A 3SMSA 4CGHA 1YITN 1VQ9N 4F3OA 2GF4A 4ELUA 3WXJA 1DEJA 3ZSVA 3ULEB 1JLAA 3ZEUB 1ZXOA 4X64K 1LWFA 2W40A 3QIPA 1ASUA 2YKNA 2ZF5O 2F96A 3LM2A 4NCGA 4K42A 1KFSA 4JNFA 4BR9A 4AZCA 1HUXA 3A5OC 3AVCA 4CZGA 5GIOA 3P1GA 1SU8A 4B9NA 2ASMA 4FWKA 5D3GA 1GLBG 4R5PA 2W6KA 2GEMA 3LAMA 3NHGA 3QB0A 3C7NB 2YNIA 3D45A 1PS3A 4M42A 4B1ZA 4HVJA 3CCLN 2KQ2A 3CI5A 3OYAA 3DAWA 3O4WA 4BR7A 4BQZA 1QS4A 4DFKA 3D52A 4NLCA 5HBMA 1S5JA 3OHRA 4OX9K 4R5GA 1JCGA 4BWMA 2W42A 2ZGYA 3THYB 3VPZA 4A5BA 4CJFA 1HKBA 3MN9A 4H5WA 1YVNA 1RT6A 3EJUA 2HNYA 3RMDA 4H0TB 2EX3A 3S3OA 2QXLA 4CF9A 3LP2A 5EY4A 4DTNA 3E1YA 1RT3A 4FYDA 1WDZA 5JVGL 4LSNA 1YJWN 4C8OA 2W6LA 5FPMA 2HBMA 2Q97A 4CEEA 1SL2A 4WQ5A 2BTFA 2OPPA 1K8KA 1KAZA 5F1XA 1NKEA 1KD1O 1T3VA 5EVZA 4B3SK 4JKEA 4WCEL 2GWJA 2AJQA 4JRQA 1X1PA 4CEBA 2YHYA 4OPAA 2NCZA 1VSKA 4WV7A 4JKAA 3BVWA 1Z05A 4B1XB 4EZPA 3H08A 3J7AP 2X5CA 3CQXA 4CI6A 4DSEA 4FVMA 3U3GA 3SAHA 3IKMA 4BGAA 3MN5A 3DWLA 2F7RA 2Q36A 3C94A 1BQMA 1GLLO 3FFIA 4G6QA 4BVPA 4W5OA 4KHYA 2KZZA 1GLDG 1S22A 5E41A 4CGJA 4FW2A 4JI8K 3AO3A 1QSYA 1I4DA 1BCMA 4IBNA 4A62A 2PMRA 4M63C 1J5EK 2Y1JA 3VEOA 3L2UA 3OWGA 3V9XA 4FWMA 2YKTA 4H0VB 4MO5A 3VQEA 1WSIA 1V4SA 4O44A 1JJ2M 2FSJA 1D8YA 2JWKA 5KGWA 5BN8A 3RVCA 5M1QA 4A2AA 3OYFA 1U04A 4H8KA 3G10A 1Q8IA 1WAFA 3H3NO 4BDPA 3OTOK 2ETJA 5FPEA 3I0RA 3QNOA 5GIPA 2O8EB 3MN6A 4EZ6A 3WNEA 2RKIA 3OYHA 1HJRA 3FZLA 4FJ8A 4NPHA 2X74A 1JLFA 2YHWA 1Z25A 3CJBA 4WQ5C 4CHYA 4D8JA 4BC3A 1WOQA 3OYGA 1O1WA 2ASPA 2PBDA 3SK3A 4ZTJA 2PFUA 1SKRA 2HNZA 1E3MA 3U9ZA 1RBTA 3T1HK 4JD2A 4GKJK 4WPEA 3DQGA 1A5WA 4IJNA 3DRSA 3OYBA 3VQ8A 5C15A 4FSVA 2HHXA 3AA5X 5AQMA 3QFUA 4FXDA 4IW0A 4F4KA 2HHTA 5HRPA 3S9HA 2A1SA 4KFBA 3PIOL 3F5TA 3IAYA 4LF7K 4MLHA 1ATNA 4CK2A 1EXQA 2F1AA 3T19A 1XC3A 2IVPA 4M41A 2G8HA 3IG1A 4EFHA 1NGHA 2RHKA 4H5NA 5J2QA 3ZX2A 4EP5A 4IEEA 2KFZA 4BE7B 4JKBA 4OPKA 3VQ5A 4BRPA 3MN7A 4DMNA 1MU2A 3OYIA 3SQ4A 1WSGA 3SBSA 3CERA 3B8AX 5KI6A 4AHTA 2G8IA 2O0I1 1RBSA 4FJIA 4MQDA 3NVMA 3TSUA 2GUPA 3WT0A 4W5RA 1IKWA 4EZUA 2O8CB 2FICA 4ILGA 4RW4A 4KV8A 3I33A 2ITMA 1MA9B 5AQKA 2UUCK 4C8MA 3J81O 4F8RA 3NGIA 4FLTA 1SL1A 3WUHA 5EU7A 2Q0RA 1WSJA 3HP9A 1BA0A 1NK8A 3PUFA 4KO0A 4JS5A 4CERA 2QEXN 4DV0K 3AAQA 3ABHA 1JXEA 3SAGA 2HB5A 3CJ1A 4BRKA 2XO7A 4CZIA 3MXIA 3RTVA 3KD5E 3THWA 2F8SA 4CBWA 4IFEA 4HY9A 3A2FA 3OYMA 2RF2A 4JI4K 5K14A 4CHOA 1XUPO 4CFCA 1IH7A 2Z1GA 1X9MA 5DK5A 4JNEA 2ZQBA 3EN9A 3DOLA 4BQLA 5KPTA 1H1VA 3LP0A 1O7DB 1QZ5A 3KVGA 3BDPA 2NRTA 5ELZA 2HBKA 3SJJA 1J6ZA 1HQEA 4RWTA 4J8FA 1VQON 1KC8O 4PKHA 4JS4A 3UKRA 1RDCA 4BR4A 4GV9A 3ZSRA 3M5RA 3KLIA 5AQGA 4BC2A 3HOTA 3EL2A 3PX6A 3THVA 1L3UA 3BUDA 3CETA 5GAHP 2P9KB 4FZPA 2X3WA 2YCHA 4BRGA 4KKOA 4DB3A 4M3TA 3SBGA 4CJ7A 2IS3A 2ALWA 4BDZA 2HVHA 3I56N 1U00A 1OH6A 4EZVA 3T47A 1L3SA 5JENA 1JXBA 3SUNA 1J54A 1I3AA 4DSKA 5M1OA 4IEIA 4CJQA 5IWAK 3ZEDA 4LH4A 4KH6A 2GTDA 3EJQA 3T46A 2BANA 2HHWA 4FJLA 1L3VA 4BRDA 3AO1A 3D7EO 1BISA 1RDAA 2PY5A 1VQKN 1NJXA 1ZBIA 1R0AA 1SL0A 4H4OA 3AVNA 2JWLA 5FRMA 4JAXA 4BE1A 4HUEA 4OVLA 3CCMN 4CGIA 2V52B 1C0MA 2Q13A 1DT9A 1WSFA 3D6RA 3I55N 3DLBA 4KH4A 2E2NA 2P9NA 2YL6A 3LPTA 3HAJA 1I4TA 4V19S 4CD3A 1WSEA 5AQJA 3PLTA 1LW2A 2GUIA 1ZC6A 4M45A 3OYNA 2F1BA 3BZCA 4RW7A 4UQGA 1VRTA 1L5UA 3GL1A 5JVHL 4BDYA 4I9LA 5AR0A 1C1CA 5E84A 3OJUA 4NQIA 4JI1K 3UKUB 4O8KA 4BR0A 4Z4HA 4FJJA 4RW8A 2JLEA 4CBXA 3S3MA 1BPRA 4AHRA 2Q0UA 4DTSA 4ATMA 2QXFA 4JK9A 4J2AA 5FIGA 1DGKN 2QWQA 1XHXA 3QA8A 1NM1A 3ISNC 4E1MA 2PYJA 4O8UA 3ZX3A 3HP6A 1E9VA 3BUBA 1ESVA 4HTLA 4B8CA 3WNFA 2HHSA 2AA4A 5CHIA 1RT4A 4K41A 3EJSA 1BDGA 4E19A 1BI4B 2G8FA 3V9SA 4CECA 2G8KA 4LH5A 3LMFA 3RV0A 1RCHA 3ZEFA 2OTLN 4ELTA 3CCEN 4KHNA 1NMDA 1G15A 2OZNB 3R8EA 4EHTA 1VHXA 2QWNA 4KI6A 3MECA 3L2QA 4FZSA 2KW4A 1E1DA 3G71N 1TL3A 3KK7A 4HR1B 3SPZA 5FLXO 4EAHD 5ADXA 1X3MA 2JNKA 3NBPA 3D4ZA 4IZ9A 3RWUA 3D2EB 1NK0A 3HK2A 3ENBA 5AQQA 1MDUB 3QMLA 1CZAN 1C0GA 3MAQA 4H0YB 1DKGD 3CAZA 4B08A 4NYNA 1VQ8N 1OA0A 3EJTA 2QTDA 4GY2B 1KLNA 3JXUA 4LF6K 3HJFA 4I1QA 3O3NB 4E7LA 3AA2A 3AAPA 1HYSA 3ZT2A 3SZ2A 5HLFA 2QKKA 4FZYA 3OS2A 2YIAA 1VK0A 4B3OA 1BL3A 1KVBA 3CCQN 1B9FA 4M3YA 5KGXA 3I8DA 3E9PA 4N47A 4B1YB 2P51A 4BRLA 4YORA 2FSKA 1GNLA 2Z1JA 5M1FA 1N32K 2X3XA 2YV0X 5GAEP 4E89A 4IG3A 1NGJA 4WFAL 3V9ZA 4CHQA 4Z4FA 3HSCA 3SNNA 3CFRA 3WQUA 1DKZA 4OKJA 1WSHA 4FOEA 3MCAB 3J7YP 3DXMA 3LP1A 4DTMA 3NVKA 4JEPA 4DFMA 2F9WA 4EHUA 3JS6A 2O4GA 4CJEA 1GLFO 3OYLA 2UXDK 4FJKA 3J8AA 3PX4A 4DQSA 1TQVA 1LAVA 3B6OA 4GW6A 4Z0UA 2R7YA 1KVAA 1W7AA 1T8EA 3BVUA 3EZWA 3ENOA 5F2RA 3PO5A 1I4LA 2IDOA 3CFPA 2EWFA 5BPMA 1SQKA 4LF5K 3JSMA 1ZWWA 1Z6RA 4GMJB 1CXQA 2DFEA 4IO8A 4CIEA 2ATQA 3OW2M 3MX2A 4KREA 3RRHA 2YI9A 2X6NA 4BE0A 4EZRA 3DLHA 2D0BA 4KTQA 5KQ8A 4PL7A 3QEIA 3NF8A 1R34A 3VMFB 4IFVA 3VETA 1QVFM 1M1KO 4JWCA 2HNDA 3SYVA 2QKWA 3CZSA 4B9MA 2B6AA 4CZFA 4DR7K 1VQLN 3C6TA 4DTOA 2WYHA 2QWLA 3L6QA 3ZT1A 1SKSA 4DTRA 2YHBA 5LMUK 3L4QA 3KWIA 3L3UA 3PO4A 4B1WB 1S72N 3B51X 3ASMA 4AZ6A 1RT5A 1YT3A 3EY1A 4CFAA 1BWFO 4CF1A 1EQYA 4JKFA 4B9UA 2VQFK 4EZYA 4FZXC 4JWEA 1G99A 3TSPA 4LY7A 2HMIA 1RBUA 4QAGA 4RTFD 3ZCMA 3D51A 2PY6A 4AKVA 3A98A 3LVTA 1U47A 3TARA 4WFBL 4JLHA 4FWLA 1X9WA 1TGOA 1R59O 2NLXA 4Y0WA 1JCEA 3E66A 2Z0NA 4NB4A 3OY9A 2OBMA 4I9QA 1VSHA 1HR0K 1JQKA 3AA4A 5AQUA 3VA3A 2FBTA 2OPQA 3AGKA 5KQDA 3T3FA 3ID6A 3T1YK 3FZKA 3CPEA 3KHYA 2F4VK 3CYGA 1IV0A 4Z4CA 5CR4A 3S5TA 4E1NA 3E9LA 4JYAK 4CEAA 3CC2N 3A5NC 1O13A 1WB9A 2GWKA 3CMAN 3CJCA 3QWEA 3RSEA 3U3YA 1NOYA 3K5OA 1C0TA 3R6MA 3VEXA 4CVNE 3QETA 3DX3A 4AHSA 1QQOA 3VTHA 3TTDA 4C1NI 5I9EB 5AQFA 4H4MA 5FRNA 2KZMA 4JRPA 4IWPA 2OZSA 4DCNC 1Y2OA 4CJRA 5J2NA 4Z4EA 3BEXA 4B3MK 3E9OA 4OKKA 2KHOA 2RE2A 5M1KA 4BRFA 3MX5A 4H5VA 2FXUA 3V1OA 4DUZK 2F18A 4DFJA 1S1UA 2UUAK 3OYJA 1FXXA 3DX4A 4OGEA 3TAFA 1KVCA 5JS2A 1YIJN 1KAYA 4EZNA 4K8XA 3OYCA 2ZXQA 3VQ6A 3PV8A 1MJGA 2BPRA 3QEPA 2UU9K 3THXB 4CEZA 3HAHA 3GE1A 1VSEA 2YKMA 2E20A 3VENA 4DTXA 2P9UA 3MMVA 3I8BA 4DV1K 3PY8A 4LF9K 3VEZA 3KLHA 1FW6A 4ELVA 1D9FA 4Q0BA 3N8EA 3QIOA 3O1BA 5AZJA 4YOTA 3O4QA 2XY6A 2O8BB 2D0CA 2Q3SA 3WEEB 1W0HA 2XHBA 4E72A 5AQZA 4HUFA 2P9LA 4FJGA 3CJ7A 1V4TA 5BPNA 5BRDA 3VESA 3ZT4A 4OLBA 4HHTA 4AF1A 2C1GA 4CK1A 2W41A 2WONA 3MCPA 4X66K 3FLCO 3WXIA 4BR5A 3HPOA 3B53X 4C1NK 1SV5A 1VQNN 1HYZA 3VGLA 4OPJA 4ZHRA 3MEDA 1QZ6A 3BUQA 5C12A 4JKGA 4GV6A 1E4FT 2E6LA 1NWKA 4CIGA 3VEAA 4PY5A 2P9PA 2P1JA 3P39A 1EETA 2NRHA 4BVOA 4DTJA 1NMNA 3LDSA 4FK4A 1I49A 4DU4A 4IDHA 1A5XA 2QK9A 4X62K 1NK6A 5AZIA 2VWBA 3MEGA 1C0FA 1ILYA 4FM1A 1ZBHA 3ZETB 1VQ5N 1JL2A 2YNGA 3AO4A 4I43A 1T6DA 1CXUA 3W0LA 3U4LA 3HPGA 4BEBA 1WUAA 1UOCA 3O3HA 4FL9A 5J2PA 3NAEA 3FE1A 3NF7A 4DQIA 4FJ7A 1Q9XA 1UA0A 2F9TA 1K73O 4DR1K 1KXPA 2Q1NA 3LDQA 1U6ZA 4F2RA 5AQLA 2O8DA 2OA8A 1KAXA 1GN9A 3B6PA 4Y1DA 1Q82O 3AO2A 1RT7A 1TUYA 1U2VA 3DOKA 5DMRA 2OW6A 3AVHA 1IJJA 5JICA 4PHTX 2GBZA 3OS1A 4DV3K 4QS9A 3KLEA 1LOTB 1EKEA 3J7ZO 5CZ1A 1YJNN 2YLLA 4JI7K 1TKXA 5LY3A 4B3TK 2Z8YA 2E1ZA 5EXWA 1S6QA 3RV1A 1B92A 5AQWA 3ZLJA 1Y97A 1N33K 1WN7A 4M7YA 1T03A 5AQRA 4CZHA 3NF6A 3SBTA 3CCJN 2VWJA 1IBKK 4CJUA 1C6VA 1TUUA 3HAIA 2KKZA 4O0IA 2HOEA 3VQ4A 4CW7B 2P9IA 4O5FA 2QKBA 1RDBA 4KIKA 5BREA 4Z4GA 2D4WA 1S9GA 3G9GA 3SLCA 3D0PA 4U67L 4JWIA 3BY5A 1NGIA 1BIUA 2FLOA 1Z26A 3BZKA 3RR8A 3KAWA 4HCBA 1W9MA 3AARA 1VSMA 4J2DA 4H5TA 4Y1CA 3ER8C 3ACOA 2V0OA 1RBVA 4CJTA 5KPZA 1A5VA 2I7PA 4DU1A 3C0BA 4LSLA 3G0ZA 4A59A 2H3GX 4CCHA 3H45C 3SUPA 4KPYA 1JKHA 4F2SA 4BRAA 3UITA 2IIRA 4BG9A 3J80O 1YI2N 3ZSYA 4GKKK 3LP3A 1ZYLA 3OJSA 4DQ8A 3ZSOA 1N8RO 3HZ6A 1QHAA 2X6SA 4FZOA 1FK9A 1YWMA 3LDLA 1X9SA 1K6YA 4DV4K 5EOYA 1NJYA 1HNVA 4IDKA 4JN4A 2HMPA 4ILHB 3HTVA 3MEEA 3MWTA 5C5BB 2YHXA 5FPDA 2PAVA 3A0IX 3BUPA 4I6MA 4JI3K 4W5QA 1LQ7A 1IKYA 4CZJA 1T7PA 3SCXA 1NJZA 1BQNA 3K5NA 2Q31A 3DXKB 5HOOA 3DRRA 3VEBA 3AA3A 2CGKA 4C8NA 3Q7BA 1UWBA 3BP8A 4PA1A 1JLCA 3DLKA 2ZGZA 4BG8A 1TQWA 2HF4A 2DTUA 3AVIA 4B9VA 2OTJN 4DR4K 2F7TA 4AZCB 1LAWA 1S3XA 3AVGA 5CYQA 3U9DA 1WNSA 3QE6A 1VSJA 1RT2A 4MDBA 4JHDA 1NNEA 1NKBA 3ULDA 3TWHA 4IWQA 1TK0A 4BE2A 3CVRA 1J9AA 1QQNA 1EO1A 1JLEA 4JWDA 4DYLA 3K57A 2D1LA 3H1VX 4AZHA 4LFBK 1BG3A 5C0YA 1ASWA 4CBUA 4H5RA 4EZQA 4FLYA 3L3VA 2EX3B 1DTTA 2F7QA 1DKYA 3DJCA 4CIFA 3EKUA 4DLEA 5HROA 4CGDA 4LFCK 3VF6A 4PKGA 4YFUA 1SUQA 3CG7A 3LLLA 3TANA 1Q18A 3UE5A 2P9SA 4ZTFA 1K8KB 3FD9A 1TYQA 3DX0A 3KLFA 4FVUA 1SAZA 4BREA 4DCHA 4IJAA 1OVYA 3VQDA 1Q5LA 3O6WA 3SI6A 1CZBA 2D4CA 4YOWA 3DLRA 3AV9A 3DPQA 3CHWA 1LWCA 2Y1IA 4EZXA 4L3QA 3HM9A 5HRSA 2EFLA 4TSXA 2HHIA 2BDPA 1URUA 4QOZB 1BCOA 1YVUA 5BN9A 2O8FB 3G6EN 2YIVX 3CIPA 3ZT3A 3VGKA 4EZSA 1BA1A 4DF8A 1YXQA 4BR2A 1OKJA 4RW6A 2E8AA 1BU6O 4PL8A 1S1TA 3C6HA 3DI6A 5BRHA 1CLQA 3CMEN 2HHUA 4FW1A 3GOIA 3D2FA 4YOXA 1KTQA 1QTMA 4N56A 1IG9A 1HTYA 1BGXT 2HHQA 5C10A 2DFFA 1TK8A 1RTIA 4CJKA 3M1FA 4PKIA 4IO9L 3T7ZA 3JAMO 1Q7YO 1RNHA 3L2VA 3VA0A 1NGAA 4CE9A 3SV4A 3ULEA 4DV5K 1ATRA 2YLAA 4ILIA 3O9SA 3ZEUA 4NXNK 2V7ZA 3V81A 1JLGA 5LJWA 3KK3A 3P83D 3PX0A 2YI8A 1TAUA 2LSNA 3RRGA 1HPZA 4O5BA 3MDQA 1P90A 4R79A 2YL9A 3L0QA 4MDAA 4LFAK 2C1IA 4AZGA 4H6HA 4JD2B 3THXA 1S1XA 2WOMA 2D0PA 3P5JA 2VQEK 3C7NA 2RAIA 3KLGA 2YI1A 2ND1A 2NRXA 1BUPA 3SJHA 3E01A 2I7NA 1L3TA 5JS1A 3T49A 4FWNA 3EE8A 4A57A 1OH5A 3NE6A 1GOCA 4HYBA 1YTAA 2I5JA 3THYA 5M1PA 1X04A 3VQPA 2PZSA 2E6MA 2YJFA 4F00A 1NOZA 4H0OA 4DF4A 3M8QA 1IKVA 5AQNA 4O0JA 3UB5A 3HXMA 3C6UA 4GNIA 1IKXA
chains in the Genus database with same CATH topology
2BH1A 4ILGB 3TTDA 3VTHA 4BRNA 2ZJRL 4C1NI 3N4PA 2P9LB 3FZLA 5AQFA 5AQPA 5I9EB 4BECA 1X3NA 4NPHA 4E3CA 2YHWA 1NJIO 3ID8A 3H6EA 4IWPA 5JMVA 4B9QA 3CJBA 2E1YA 4WQ5C 3GI7A 4D8JA 1HKCA 3DPOA 4BC3A 1WOQA 3BEXA 2Q2RA 2QA4N 4QS8A 3E9OA 1SZ2A 4C23A 2ASPA 4BROA 5AQVA 2PBDA 3SK3A 2KHOA 4H0PA 2RE2A 2PFUA 4BGBA 3MX5A 4WYBA 4BRFA 4H5VA 4E81A 2FXUA 2V7YA 5M1KA 3LM9A 3TPQA 3U9ZA 4JD2A 5ADXH 3L3OM 2QI2A 2OBLA 4R79A 3DQGA 4IJNA 3VF2A 4WFNL 4ISEA 4JKGB 1HJOA 5C15A 4FSVA 3ZYYX 5AQMA 3QICA 3QFUA 4IW0A 2P9PB 1YIJN 1KAYA 4IWVA 3FZMA 4EZNA 3PIOL 3F5TA 1MWMA 4E1JA 3TTFA 2DPNA 2YX6A 4MLHA 4BC5A 2WINM 1ATNA 2A3ZA 1MJGA 2BPRA 5AQYA 1XC3A 2IVPA 2QWOA 5AQSA 5JLFA 3FFKB 3GE1A 4EFHA 5AZIB 4YDUA 1NGHA 2E20A 2RHKA 4H5NA 3U8XA 3ZX2A 3O1WA 3VENA 4IEEA 4BE7B 3DOBA 2P9UA 1NGDA 3I8BA 3MMVA 2QWRA 3HI0A 1NGBA 2HF3A 3MN7A 4JKBA 4MLEA 4BRPA 3VEZA 4JK8A 2QFFA 3SBSA 3CERA 3N8EA 3B8AX 5AFUH 3O1BA 5TKWA 4YOTA 5AZJA 1BO5O 2VCPA 4MQDA 3NVMA 4K43A 7HSCA 2GUPA 3TSUA 3WT0A 4BRHA 4EZUA 3WEEB 2WC9A 3FGUA 4ILGA 5BRFA 5AQZA 1RDWX 2P9LA 3UKRB 1NLVA 1BOTO 3CJ7A 1V4TA 3I33A 3IFRA 1MA9B 2ITMA 5BPNA 5BRDA 5AQKA 3VESA 3CC7N 4AF1A 2C1GA 1RFQA 3I04A 2YJEA 4ILJA 2W41A 3C65A 3WUHA 3MCPA 4EZTA 2W00A 1VQMN 2Q0RA 5TKYA 1BA0A 3LDPA 3M3ZA 3WQTA 3NMUA 2IVNA 3FLCO 4FO0A 3WXIA 1QQMA 4BR5A 4H03B 3B53X 1YUWA 1RGIA 2QEXN 2NRWA 3AAQA 1ATSA 4C1NK 3SAGA 1VQNN 3FZHA 3H1QA 3ER9B 3CJ1A 1U2VB 3IUCA 3VF4A 3VGLA 4BRKA 3HBTA 2HSTA 4CZIA 2GAFD 1QZ6A 2C1IA 3H0XA 5C12A 4JKGA 5LJVA 1W2BM 4GV6A 1OA1A 1E4FT 3GG4A 4WQ4A 1NWKA 3VEAA 2NRVA 2QWMA 4FWOA 2P9PA 3N4QA 3P39A 1D4XA 1OAOA 3KAVA 4CBWA 4IFEA 2NRHA 4HY9A 3CCUN 3M6GA 4BVOA 1XUPO 1SU6A 3TSQA 4IDHA 2ASOA 4F01A 3SBTB 3AGRA 2VWBA 4JNEA 5AZIA 3CC4N 1GLEG 2CH6A 4EZZA 3EN9A 4EZWA 4KH5A 4BQLA 3IDHA 1GLAG 5KPTA 1H1VA 1C0FA 2HBLA 1ILYA 1QZ5A 3KVGA 3ZETB 2NRTA 4IWOA 2EWSA 2P9IB 4YDUC 1VQ5N 5ELZA 2HBKA 3ERCC 4KIKB 3O3MB 4M0MA 1J6ZA 3ATUA 4RWTA 4J8FA 1VQON 4I43A 3O3OB 1KC8O 4H6IA 1T6DA 2P9NB 4PKHA 3W0LA 2E2PA 3U4LA 3WEEA 1ZBSA 3LDOA 1WUAA 4BEBA 2RT6A 4FL9A 3UKRA 5AQHA 4BR4A 4CZLA 4GV9A 1Y64A 3FE1A 3M5RA 4FWQA 3CXCM 2F9TA 5AQGA 1K73O 4FWSA 1Q86O 4BC2A 1KXPA 3EL2A 5AQTA 3HOTA 2Q1NA 3O80A 3LDQA 4K25A 3CCLN 1N8RO 1U6ZA 3CETA 5GAHP 2P9KB 3P38A 2YCHA 5AQLA 3LL3A 4BRGA 2QWPA 5AFUA 4DB3A 4U7BA 3FZFA 4FPBA 4GVEA 3SBGA 5CE3A 4CJ7A 1KAXA 1GN9A 2YIBA 3CCVN 1Q82O 3KDRA 3I56N 1U00A 1TUYA 1U2VA 4EZVA 3T47A 1UPXA 3SAFA 1IJJA 2A42A 5JICA 4PHTX 1E4GT 4HWIA 4CZKA 4R5KA 2A5XA 4QS9A 1LOTB 3J7ZO 5M1OA 4OO1J 1YJNN 4IOXA 3VEVA 4IEIA 3OBYA 5LY3A 2VGMA 4WQ4C 3ZEDA 5H1SQ 3GBTA 2Z8YA 4KH6A 2E1ZA 2WBNA 5EXWA 3RV1A 3T48A 5AQWA 1DG4A 2GTDA 5AQXA 3T46A 1HPMA 4M7YA 5AQRA 4CZHA 1SUFA 3P31A 3Q7CA 5KQDA 1NGCA 3SBTA 3P4IA 3CCJN 4BRDA 3D7EO 5M1NA 1VQKN 4JKHA 1MWKA 2E2OA 2JWLA 1TUUA 3I01A 1GLCG 2KKZA 2VGNA 3BF3A 2HOEA 2BUPA 3ZETA 4M7XA 2ZJQL 4IOCL 2P9IA 4O5FA 4JAXA 3CCMN 3DXKA 4CZMA 1YJ9N 3B52X 4KIKA 3F9MA 1VQ6N 2V52B 1DT9A 5BREA 3I55N 3D6RA 4KH4A 2D4WA 4UDXX 2E2NA 2P9NA 3T4AG 4YOYA 1CKRA 4R5JA 5DM6L 4CD3A 2JNSA 3SLCA 5AQJA 1ZC6A 3KWGA 4I6MB 4U67L 4JWIA 2CGJA 3OHXM 1NGIA 4MO4A 1VQPN 2FLOA 1YHQN 3R3LA 3KAWA 1RDUA 3GL1A 1W9MA 3AARA 4BC4A 5JVHL 4H5TA 3ER8C 3LDNA 5AR0A 3SMPA 3QDKA 1VQ7N 5KPZA 5E84A 2I7PA 2P9KA 3C0BA 2QM1A 2NZTA 3CJ9A 1GLJO 3O08A 3R9PA 5GADP 3UKUB 4O8KA 4BR0A 4A59A 3QFPA 4ISGA 3OA9A 2A41A 2H3GX 3H45C 4CBXA 4BRMA 3HOSA 1BPRA 3QBXA 2Q0UA 4JK9A 4BRAA 1JJ2M 3UITA 4A5AA 5FIGA 1DGKN 2IIRA 2QWQA 4BG9A 5BR9A 3QA8A 1NM1A 1YI2N 2UYTA 3FR0A 1NBWA 4LC9B 4O8UA 5JLHA 3ZX3A 3HM8A 1E9VA 1ZYLA 3CPWM 3CCRN 1ESVA 4HTLA 4DQ8A 3I39X 2AA4A 5CHIA 4K41A 4JHDB 2J4RA 2NNWA 3C6AA 3HZ6A 1BDGA 3VKHA 1QHAA 5BPLA 2WUSA 3MWPA 4FOIA 5C2DA 3LMFA 3RV0A 3LDLA 4A2BA 4JKDA 3ZEFA 2OTLN 3CD6N 3CCEN 1NMDA 5E26A 3O5BA 4H0XB 3R8EA 4BRQA 4EZOA 2QWNA 2OP6A 4EHTA 2ZJPL 1VQ4N 5EOYA 2OANA 4JN4A 2HMPA 3ATVA 4BY9C 4ILHB 3HTVA 3O9QA 4BRCA 4ISFA 3MWTA 3QNJA 5FPDA 1E1DA 2D0OA 2YHXA 2PAVA 4CZEA 3G71N 2WFBA 3KK7A 3DXMB 1E2UA 3T69A 2ZWHA 3A0IX 4HR1B 4I6MA 1X9JA 4JLCA 4EAHD 4CZJA 5ADXA 2GA9D 3L4IA 1X3MA 5B8HA 2CH5A 2Q31A 3DXKB 3F2KA 5HOOA 4IZ9A 2P9SB 3D2EB 3VEBA 4OPHA 2CGKA 3Q7BA 3ENBA 5AQQA 3PLAA 3BP8A 2FSNA 4GV3A 1MDUB 1TYQB 1CZAN 3QMLA 1C0GA 4BRIA 3S41A 3UKUA 2ZGZA 2FF3B 4H0YB 4XJXA 4XH1A 1GNTA 1DKGD 3EO3A 3A5MC 4BG8A 1OA0A 1VQ8N 2QTDA 4GY2B 3JXUA 3O3NB 2HF4A 3ZX0A 3AAPA 3DPPA 2OTJN 5F0XA 1JCFA 2FF6A 3H46O 2F7TA 3VEWA 5BN8A 2HBJA 2V51B 4DHYA 4G9ZA 2KLAA 1KQSM 3K9KA 2YIAA 1S3XA 2N3KA 5C2FA 3U9DA 3CCQN 3OBWA 3R1XA 5FPNA 4UY8O 3H3OB 3E9PA 2GX9A 4JL9A 2NRZA 4IM3A 3A5LC 2CGLA 4B1YB 4BRLA 4MDBA 1DKXA 4JHDA 1SS6A 2FSKA 4YORA 4B1VA 1GNLA 4QS7A 4IWQA 5M1FA 4CD1A 4IXCA 1QQNA 1EO1A 3EKSA 4A61A 4FPAA 4JWDA 5GAEP 3CF5L 4XH4A 4XEIA 4NLBA 1NGJA 4WFAL 2AP1A 3VEYA 2E2QA 2LM0A 3BF1A 3HSCA 4ILHA 3WQUA 1DKZA 3H1VX 1BG3A 5C0YA 3G25A 3G4SN 4CBUA 2NRRA 4IM2A 4EZQA 4FM3A 1HX1A 1YAGA 1HLUA 3MK6A 4H5RA 3W3DA 1QVGM 4FOEA 3MCAB 1T6CA 2EX3B 3DXMA 3NVKA 1DKYA 3DJCA 3WXLA 3EKUA 4JEPA 4HR1A 3D2FB 2QW9A 2F9WA 1HKGA 3VF6A 1SU7A 4B1UB 4PKGA 4AM6A 4EHUA 3JS6A 1Q18A 3UE5A 2P9SA 1GLFO 5DM7L 3D2EA 3J8AA 3SMSA 1K8KB 3FD9A 1M90O 1YITN 1VQ9N 1TYQA 2IVOA 2A6AA 4Z94A 1SAZA 3AY9A 4BREA 3WXJA 1DEJA 4DCHA 4IJAA 4FVUA 1OVYA 3ULEB 3EZWA 1Q5LA 3ENOA 3ZEUB 3O6WA 5KPRA 1ZXOA 5F2RA 4YOVA 3CQYA 2W40A 2EWFA 5BPMA 1P8ZA 1SQKA 3GDQA 1IG8A 3CCSN 4YOWA 3TU5A 1Z6RA 3DPQA 2ZF5O 3LM2A 4IO8A 4UDYX 4K42A 4JNFA 3OW2M 3MX2A 4BR9A 1HUXA 3A5OC 3CHWA 3TTCA 3A8YA 4BVPA 4CZGA 2YI9A 1SU8A 4EZXA 4L3QA 5EX5A 4KBOA 5GIOA 4EZRA 2ASMA 4FWKA 1GLBG 3VTIA 2GELA 5KQ8A 4DKWA 2GEMA 4PL7A 5MLCQ 3QB0A 3C7NB 5BN9A 3VMFB 5AQOA 4B1ZA 3VETA 1NGEA 3ENHA 4WFBL 3G6EN 1M1KO 2YIVX 4JWCA 3CIPA 1QVFM 3CI5A 4IOAL 3DAWA 3VGKA 3O4WA 4JKCA 4BR7A 4BQZA 4EZSA 1BA1A 4CZFA 1YXQA 4BR2A 4NLCA 1OKJA 1VQLN 2E8AA 1BU6O 4PL8A 1XQSC 3C6HA 1K9MO 5BRHA 3OHRA 4R5GA 1JCGA 2QWLA 3L6QA 2ZGYA 3VPZA 4A5BA 3EE9A 1HKBA 3MN9A 4H5WA 1YVNA 3L4QA 3PIPL 3KWIA 4H0TB 3CMEN 2QXLA 4B1WB 4YOUA 3GOIA 3D2FA 3O9UA 5EY4A 3E1YA 3RSEB 4WF9L 3B51X 4YOXA 1S72N 5JVGL 1YJWN 5AQIA 4RCHA 5FPMA 2HBMA 2Q97A 5C10A 1BWFO 3VGMA 1EQYA 4JKFA 4JK7A 1Q81O 4AM7A 5HL7L 4WQ5A 2BTFA 1K8KA 1KAZA 3M1FA 5F1XA 4EZYA 4PKIA 4IO9L 1KD1O 3T7ZA 1T3VA 3CJAA 1Q7YO 5EVZA 1NGAA 2A40A 1K8AO 4JKEA 5GAGP 3ULEA 2GWJA 4WCEL 1ATRA 4JWEA 4ILIA 1G99A 3O9SA 3TSPA 3ZEUA 1NGFA 2V7ZA 4XH5A 2YHYA 4F9OA 4OPAA 2NCZA 5LJWA 4WV7A 4RTFD 4JKAA 1Z05A 4R5IA 2YI8A 4EZPA 4FWPA 4B1XB 2X5CA 3CQXA 4CI6A 3O8MA 2PY6A 1NGGA 3A98A 3KZBA 4PO2A 3MDQA 1P90A 3IKMA 3MN5A 3DWLA 3L0QA 1W97L 4MDAA 2Q36A 4BGAA 3O9RA 4R5LA 1GLLO 4FWLA 4G6QA 3WXKA 4H6HA 1R59O 4JD2B 2NLXA 1GLDG 1S22A 4NO7A 4Y0WA 1JCEA 2D0PA 5GINA 2VYPA 3E66A 3VERA 2D1KA 4NB4A 2OBMA 3C7NA 3HRGA 4A62A 4IM0A 2YI1A 2ND1A 2NRXA 1BUPA 3SJHA 3DLLL 2I7NA 4M63C 3VEOA 2ND0A 3OWGA 3T49A 4FWNA 1JQKA 4FWMA 5AQUA 3VOVA 3EE8A 3AGKA 1LCUA 1T44A 4H0VB 4MO5A 3WXMB 1V4SA 3F7WA 3ID6A 4A57A 4HYBA 2FSJA 3BUZB 2JWKA 1VAZA 5FLEX 3CPEA 3FZKA 3K9JA 3KHYA 5M1QA 3RVCA 4EIAA 5M1PA 5CR4A 4A2AA 3E9LA 3O9TA 2P9UB 3CC2N 3A5NC 1O13A 2YJFA 1YF5L 2GWKA 3H3NO 3CMAN 3CJCA 4F00A 4WV5A 3RSEA 5FPEA 4H0OA 3R6MA 3VEXA 5AZJB 5GIPA 3QBWA 4FWRA 3MN6A 5AQNA 3UB5A 3SAHA 2E88A 3IMXA 4GNIA 1QQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRN A;  2P9L B;  3FZL A;  5AQF A;  5AQP A;  5I9E B;  1X3N A;  2YHW A;  3ID8 A;  3H6E A;  5JMV A;  4B9Q A;  3CJB A;  2E1Y A;  4WQ5 C;  1HKC A;  3DPO A;  4BC3 A;  1WOQ A;  3BEX A;  2Q2R A;  4QS8 A;  4C23 A;  1SZ2 A;  2ASP A;  4BRO A;  5AQV A;  2PBD A;  3SK3 A;  2KHO A;  4H0P A;  4BGB A;  4BRF A;  4WYB A;  4H5V A;  4E81 A;  2FXU A;  2V7Y A;  3LM9 A;  3TPQ A;  3U9Z A;  4JD2 A;  5ADX H;  3L3O M;  3DQG A;  4IJN A;  3VF2 A;  4ISE A;  1HJO A;  4FSV A;  5AQM A;  3QIC A;  3QFU A;  2P9P B;  1KAY A;  4IWV A;  3FZM A;  4EZN A;  1MWM A;  4E1J A;  2DPN A;  4MLH A;  4BC5 A;  2WIN M;  1ATN A;  2A3Z A;  2BPR A;  5AQY A;  1XC3 A;  2IVP A;  2QWO A;  5AQS A;  5JLF A;  3FFK B;  3GE1 A;  4EFH A;  5AZI B;  4YDU A;  1NGH A;  2E20 A;  4H5N A;  3U8X A;  3ZX2 A;  3O1W A;  3VEN A;  3DOB A;  2P9U A;  1NGD A;  3I8B A;  3MMV A;  2QWR A;  3HI0 A;  1NGB A;  2HF3 A;  3MN7 A;  4MLE A;  4BRP A;  3VEZ A;  2QFF A;  3CER A;  3N8E A;  3B8A X;  5AFU H;  3O1B A;  5AZJ A;  1BO5 O;  2VCP A;  4K43 A;  7HSC A;  2GUP A;  3WT0 A;  4BRH A;  4EZU A;  3WEE B;  3FGU A;  5BRF A;  5AQZ A;  1RDW X;  2P9L A;  3UKR B;  1NLV A;  1BOT O;  3CJ7 A;  1V4T A;  3I33 A;  3IFR A;  1MA9 B;  2ITM A;  5BPN A;  5BRD A;  5AQK A;  3VES A;  1RFQ A;  2YJE A;  2W41 A;  3WUH A;  3MCP A;  4EZT A;  2Q0R A;  5TKY A;  1BA0 A;  3LDP A;  3M3Z A;  3WQT A;  2IVN A;  3FLC O;  4FO0 A;  3WXI A;  1QQM A;  4BR5 A;  4H03 B;  1YUW A;  1RGI A;  3AAQ A;  1ATS A;  3FZH A;  3H1Q A;  3IUC A;  3CJ1 A;  1U2V B;  3VF4 A;  4BRK A;  3VGL A;  3HBT A;  4CZI A;  1QZ6 A;  3H0X A;  5LJV A;  1E4F T;  3GG4 A;  4WQ4 A;  1NWK A;  2QWM A;  4FWO A;  2P9P A;  1D4X A;  4CBW A;  2NRH A;  4HY9 A;  3M6G A;  4BVO A;  1XUP O;  2ASO A;  4F01 A;  5AZI A;  2VWB A;  4JNE A;  1GLE G;  2CH6 A;  4EZZ A;  3EN9 A;  4EZW A;  4BQL A;  3IDH A;  1GLA G;  5KPT A;  1H1V A;  1C0F A;  1QZ5 A;  3KVG A;  3ZET B;  4YDU C;  2EWS A;  2P9I B;  5ELZ A;  3ATU A;  1J6Z A;  4RWT A;  4J8F A;  4H6I A;  1T6D A;  2P9N B;  4PKH A;  3W0L A;  2E2P A;  3U4L A;  3WEE A;  1ZBS A;  3LDO A;  1WUA A;  4FL9 A;  3UKR A;  5AQH A;  4BR4 A;  4CZL A;  1Y64 A;  3FE1 A;  4FWQ A;  2F9T A;  5AQG A;  4FWS A;  4BC2 A;  1KXP A;  3EL2 A;  5AQT A;  2Q1N A;  3O80 A;  3LDQ A;  4K25 A;  1U6Z A;  3CET A;  2P9K B;  2YCH A;  5AQL A;  3LL3 A;  4BRG A;  2QWP A;  5AFU A;  4DB3 A;  3FZF A;  4FPB A;  5CE3 A;  4CJ7 A;  1KAX A;  1U00 A;  1TUY A;  1U2V A;  4EZV A;  3T47 A;  1IJJ A;  2A42 A;  5JIC A;  1E4G T;  4HWI A;  4CZK A;  4R5K A;  2A5X A;  4QS9 A;  1LOT B;  3VEV A;  5LY3 A;  4WQ4 C;  3GBT A;  2E1Z A;  5EXW A;  3T48 A;  5AQW A;  1DG4 A;  2GTD A;  5AQX A;  3T46 A;  1HPM A;  4M7Y A;  5AQR A;  4CZH A;  1NGC A;  3P4I A;  4BRD A;  3D7E O;  1MWK A;  2E2O A;  1TUU A;  3BF3 A;  1GLC G;  2HOE A;  2BUP A;  3ZET A;  4M7X A;  2P9I A;  4O5F A;  4JAX A;  3DXK A;  4CZM A;  3F9M A;  2V52 B;  5BRE A;  2D4W A;  2E2N A;  2P9N A;  3T4A G;  1CKR A;  4R5J A;  4CD3 A;  3SLC A;  5AQJ A;  1ZC6 A;  4I6M B;  4JWI A;  2CGJ A;  3OHX M;  1NGI A;  4MO4 A;  2FLO A;  3GL1 A;  3AAR A;  4BC4 A;  4H5T A;  3LDN A;  5AR0 A;  3SMP A;  3QDK A;  5KPZ A;  5E84 A;  2I7P A;  2P9K A;  3C0B A;  2QM1 A;  2NZT A;  3CJ9 A;  1GLJ O;  3O08 A;  3R9P A;  3UKU B;  4O8K A;  4BR0 A;  3QFP A;  4ISG A;  2A41 A;  2H3G X;  3H45 C;  4CBX A;  4BRM A;  1BPR A;  3QBX A;  2Q0U A;  4BRA A;  1DGK N;  2IIR A;  2QWQ A;  4BG9 A;  1NM1 A;  2UYT A;  3FR0 A;  1NBW A;  4LC9 B;  5JLH A;  3ZX3 A;  3HM8 A;  1ESV A;  4HTL A;  4DQ8 A;  2AA4 A;  4K41 A;  4JHD B;  2J4R A;  3HZ6 A;  1BDG A;  1QHA A;  5BPL A;  2WUS A;  4FOI A;  4A2B A;  3LDL A;  1NMD A;  5E26 A;  3O5B A;  4H0X B;  3R8E A;  4BRQ A;  4EZO A;  2QWN A;  2OP6 A;  4EHT A;  5EOY A;  2OAN A;  4JN4 A;  2HMP A;  3ATV A;  3HTV A;  4BRC A;  4ISF A;  3QNJ A;  5FPD A;  2YHX A;  2D0O A;  2PAV A;  4CZE A;  3DXM B;  2ZWH A;  3A0I X;  4I6M A;  1X9J A;  4EAH D;  4CZJ A;  5ADX A;  3L4I A;  1X3M A;  5B8H A;  2CH5 A;  2Q31 A;  3DXK B;  4IZ9 A;  2P9S B;  3D2E B;  2CGK A;  5AQQ A;  3BP8 A;  2FSN A;  1MDU B;  1TYQ B;  1CZA N;  3QML A;  1C0G A;  4BRI A;  3S41 A;  3UKU A;  2ZGZ A;  2FF3 B;  4H0Y B;  4XH1 A;  1DKG D;  3EO3 A;  3A5M C;  4BG8 A;  4GY2 B;  3JXU A;  2HF4 A;  3ZX0 A;  3AAP A;  3DPP A;  5F0X A;  1JCF A;  2FF6 A;  3H46 O;  3VEW A;  2V51 B;  4DHY A;  1S3X A;  3U9D A;  5FPN A;  3H3O B;  3A5L C;  2CGL A;  4B1Y B;  4BRL A;  1DKX A;  4JHD A;  2FSK A;  4B1V A;  4QS7 A;  4CD1 A;  4IXC A;  1QQN A;  3EKS A;  4A61 A;  4FPA A;  4JWD A;  4XH4 A;  4XEI A;  1NGJ A;  2AP1 A;  3VEY A;  2E2Q A;  3BF1 A;  3HSC A;  3WQU A;  1DKZ A;  3H1V X;  1BG3 A;  3G25 A;  4CBU A;  3MK6 A;  4EZQ A;  1HX1 A;  4H5R A;  1YAG A;  1HLU A;  3W3D A;  4FOE A;  1T6C A;  3DXM A;  1DKY A;  3DJC A;  3WXL A;  3EKU A;  3D2F B;  2QW9 A;  2F9W A;  1HKG A;  3VF6 A;  4B1U B;  4PKG A;  4AM6 A;  4EHU A;  3JS6 A;  1Q18 A;  3UE5 A;  2P9S A;  1GLF O;  3D2E A;  3J8A A;  3SMS A;  1K8K B;  1TYQ A;  2IVO A;  2A6A A;  4Z94 A;  1SAZ A;  3AY9 A;  4BRE A;  3WXJ A;  1DEJ A;  4DCH A;  4IJA A;  3ULE B;  3EZW A;  1Q5L A;  3ENO A;  3ZEU B;  3O6W A;  5KPR A;  1ZXO A;  5F2R A;  3CQY A;  2W40 A;  5BPM A;  1P8Z A;  1SQK A;  3GDQ A;  1IG8 A;  3TU5 A;  1Z6R A;  3DPQ A;  2ZF5 O;  3LM2 A;  4IO8 A;  4K42 A;  4JNF A;  4BR9 A;  1HUX A;  3A5O C;  3CHW A;  4CZG A;  3A8Y A;  4EZX A;  4L3Q A;  5EX5 A;  4KBO A;  4EZR A;  2ASM A;  4FWK A;  1GLB G;  2GEL A;  5KQ8 A;  2GEM A;  4PL7 A;  3QB0 A;  3C7N B;  5BN9 A;  5AQO A;  4B1Z A;  3VET A;  1NGE A;  3ENH A;  4JWC A;  3CIP A;  3CI5 A;  3DAW A;  3VGK A;  3O4W A;  4BR7 A;  4BQZ A;  4EZS A;  1BA1 A;  4CZF A;  1YXQ A;  4BR2 A;  1OKJ A;  2E8A A;  1BU6 O;  4PL8 A;  1XQS C;  5BRH A;  3OHR A;  4R5G A;  1JCG A;  2QWL A;  3L6Q A;  2ZGY A;  3VPZ A;  1HKB A;  3MN9 A;  4H5W A;  1YVN A;  4H0T B;  2QXL A;  4B1W B;  5EY4 A;  3GOI A;  3D2F A;  3RSE B;  5AQI A;  4RCH A;  5FPM A;  2Q97 A;  1BWF O;  3VGM A;  1EQY A;  4AM7 A;  4WQ5 A;  2BTF A;  1K8K A;  1KAZ A;  3M1F A;  5F1X A;  4EZY A;  4PKI A;  3CJA A;  5EVZ A;  1NGA A;  2A40 A;  3ULE A;  2GWJ A;  1ATR A;  4JWE A;  1G99 A;  3ZEU A;  1NGF A;  2V7Z A;  4XH5 A;  2YHY A;  4F9O A;  5LJW A;  4WV7 A;  4RTF D;  1Z05 A;  4R5I A;  4EZP A;  4FWP A;  4B1X B;  3CQX A;  4CI6 A;  3O8M A;  1NGG A;  3KZB A;  4PO2 A;  3MDQ A;  4BGA A;  3MN5 A;  3DWL A;  3L0Q A;  2Q36 A;  5BR9 A;  4BVP A;  4R5L A;  1GLL O;  4FWL A;  3WXK A;  4H6H A;  1R59 O;  4JD2 B;  2NLX A;  1GLD G;  1S22 A;  4NO7 A;  4Y0W A;  1JCE A;  2D0P A;  2VYP A;  3VER A;  2D1K A;  4NB4 A;  3C7N A;  4A62 A;  2YI1 A;  1BUP A;  3SJH A;  2I7N A;  4M63 C;  3VEO A;  3T49 A;  4FWN A;  4FWM A;  5AQU A;  3VOV A;  5KQD A;  1LCU A;  1T44 A;  4H0V B;  4MO5 A;  1V4S A;  4HYB A;  2FSJ A;  3BUZ B;  3FZK A;  3KHY A;  5BN8 A;  4EIA A;  4A2A A;  2P9U B;  3A5N C;  2YJF A;  3H3N O;  2GWK A;  3CJC A;  4F00 A;  4WV5 A;  3RSE A;  5FPE A;  4H0O A;  3R6M A;  3VEX A;  5AZJ B;  3QBW A;  4FWR A;  3MN6 A;  5AQN A;  3UB5 A;  2E88 A;  3IMX A;  4GNI A;  1QQO A; 
#chains in the Genus database with same CATH topology
 1TL1 A;  1FKO A;  2BH1 A;  4ILG B;  2ZJR L;  3N4P A;  4FZZ A;  4NXM K;  4E3C A;  3ID8 A;  1FKP A;  5JMV A;  4DV2 K;  4B9Q A;  4E7I A;  2E1Y A;  1HKC A;  4E7H A;  3DPO A;  1S1V A;  2Q2R A;  2QA4 N;  4QS8 A;  4DLG A;  4C23 A;  5AQV A;  4H0P A;  2FBV A;  4HUG A;  4WYB A;  4DR3 K;  2V7Y A;  2P5O A;  3LM9 A;  3RMB A;  3TPQ A;  4DR5 K;  2QI2 A;  2OBL A;  1HNZ K;  2RAJ A;  3VF2 A;  4ISE A;  1HJO A;  4CHZ A;  4MFB A;  3THW B;  4EZ9 A;  1MWM A;  4E1J A;  2DPN A;  1F21 A;  3L2R A;  5AQY A;  4I2Q A;  4DV7 K;  4PQU A;  3U8X A;  4BAC A;  2C08 A;  3DOB A;  2BGG A;  3HI0 A;  4MLE A;  2YL8 A;  4FLV A;  1HNI A;  3CYM A;  2D0A A;  5AFU H;  5TKW A;  2O8E A;  1I39 A;  2VCP A;  4K43 A;  7HSC A;  4M3U A;  3MXM A;  3NGY A;  4QCL A;  3FGU A;  1C1A A;  4LF8 K;  1RDW X;  3OVN A;  3UKR B;  5JLH A;  3IFR A;  5BR8 K;  3NH2 A;  2KFN A;  3CC7 N;  1RFQ A;  3I04 A;  2YJE A;  4ILJ A;  3C65 A;  2W00 A;  5TKY A;  4KHW A;  3WQT A;  2IVN A;  4FO0 A;  4W5N A;  3SQ2 A;  1QHT A;  3QEX A;  4DTU A;  4JV5 K;  4H03 B;  3TAE A;  1RGI A;  2YHA A;  3ZT0 A;  2XY5 A;  4CJ3 A;  1ATS A;  3NFA A;  3FZH A;  3H1Q A;  3ER9 B;  3DDF A;  3IUC A;  3VF4 A;  5LL6 Z;  4G1Q A;  4KAZ A;  1W2B M;  2Z0V A;  1VRU A;  3GG4 A;  4WQ4 A;  2NRV A;  1HXK A;  4FWO A;  3PSI A;  3O3G A;  4AHU A;  1D4X A;  3CCU N;  4B8A B;  3OYD A;  4DSL A;  3DLE A;  3M6G A;  3L2W A;  1HYV A;  3DX1 A;  1IBL K;  3TSQ A;  3VQ7 A;  4CEO A;  3V1Q A;  2RAK A;  4F01 A;  3V1R A;  3OS0 A;  3AGR A;  3CC4 N;  1GLE G;  3QEW A;  4EZW A;  4AIL C;  3IDH A;  3HO1 A;  4N76 A;  4BNE A;  1HNX K;  4IWO A;  2EWS A;  4NCB A;  3ERC C;  4OJR A;  3K59 A;  4M3Z A;  3S3N A;  5LMN K;  2F7P A;  3O3O B;  4DU3 A;  3BVV A;  1N36 K;  2P9N B;  1N5Y A;  2E2P A;  2O8C A;  4DFP A;  4K8Z A;  2RT6 A;  5HRN A;  5I3U A;  5AQH A;  4AZ7 A;  4WE1 A;  4CZL A;  4CJP A;  4YY3 K;  3CXC M;  4AZ5 A;  1Q86 O;  5AQT A;  3EZ5 A;  1XI1 A;  2UXB K;  4OGC A;  2FC0 A;  4Z4I A;  3EJP A;  5KBP A;  3SOG A;  3LL3 A;  4CJS A;  2QWP A;  5AFU A;  4FPB A;  3K2P A;  4AZB A;  2YIB A;  1W9H A;  3CCV N;  3KDR A;  3K58 A;  1KFD A;  1TKT A;  4CJV A;  2ZD1 A;  1E4G T;  2OPS A;  4HWI A;  4R5K A;  4HCC A;  4CF0 A;  4IOX A;  3VEV A;  3EYZ A;  3I0S A;  3OBY A;  2VGM A;  4WQ4 C;  5H1S Q;  3GBT A;  3MXJ A;  2WBN A;  3RR7 A;  3T48 A;  2MI7 A;  2XY8 A;  5AQX A;  3OK8 A;  1SUF A;  2Z0O A;  3P4I A;  5M1N A;  4JKH A;  1MWK A;  2HVI A;  3BF3 A;  1LV5 A;  3SUQ A;  2VGN A;  3TAB A;  3ZSQ A;  2ZJQ L;  4IOC L;  4C8K A;  3DXK A;  4CZM A;  1VQ6 N;  3B52 X;  3F9M A;  1EWR A;  1Q9Y A;  3RMC A;  1RBR A;  3TR8 A;  2BE2 A;  3T4A G;  2RN2 A;  5KTQ A;  4YOY A;  1YTU A;  3KWG A;  4FM2 A;  2CGJ A;  3OHX M;  1VQP N;  1S6P A;  1RDU A;  4BC4 A;  4NCA A;  1XNQ K;  4JI2 K;  1R5E A;  3SMP A;  3QDK A;  3AO5 A;  4B9L A;  1S1W A;  2P9K A;  1ZYQ A;  4M3X A;  3CJ9 A;  3O4N A;  3O08 A;  3R9P A;  5GAD P;  4ISG A;  2A41 A;  1KCF A;  4E7K A;  3HOS A;  3QBX A;  1N6Q A;  1UA1 A;  4MQ3 A;  3RMA A;  4KTZ A;  2O4I A;  4A5A A;  5SZT A;  3QIN A;  3FR0 A;  4LC9 B;  3DDG A;  3HM8 A;  4FJX A;  3CPW M;  3LWM A;  3I39 X;  3AVF A;  3O3F A;  4AHC A;  1NKC A;  2NNW A;  2KTQ A;  3VKH A;  1WBB A;  2WUS A;  4A2B A;  3KTQ A;  4JKD A;  5J1E A;  3CD6 N;  2XY7 A;  5E26 A;  4BRQ A;  3WNH A;  1VQ4 N;  2OAN A;  3ATV A;  2B5J A;  4DS5 A;  3M3W A;  3QES A;  4KB0 A;  1OVQ A;  1O7D C;  4ISF A;  4CEF A;  1C0U A;  3M8P A;  3D50 A;  1WAJ A;  4CZE A;  3DXM B;  1E2U A;  3T69 A;  5A2Q O;  2HHV A;  2GA9 D;  5B8H A;  3BVX A;  2CH5 A;  4JI0 K;  3Q0K A;  4B3R K;  4OPH A;  3PLA A;  2FSN A;  4GV3 A;  4BRI A;  3S41 A;  3UKU A;  5HRR A;  1XNR K;  2VG7 A;  3A5M C;  1S9E A;  4I2P A;  3ZX0 A;  2O8F A;  1FJG K;  5F0X A;  3TAQ A;  2HBJ A;  2V51 B;  4DHY A;  2DY4 A;  1KQS M;  2N3K A;  4BWJ A;  4KRF A;  2F7O A;  3AVK A;  3VQA A;  3DYA A;  3OBW A;  1B9D A;  4UY8 O;  3VQ9 A;  4JL9 A;  3HVT A;  3QER A;  2NRZ A;  4IM3 A;  4FLU A;  3A5L C;  2CGL A;  1DKX A;  3L8B A;  1SS6 A;  1BI4 A;  3LAN A;  4CD1 A;  2ZM6 K;  3EKS A;  4A61 A;  3JYT A;  3CF5 L;  4CHP A;  3BUI A;  2AP1 A;  3VEY A;  2LM0 A;  4L8R B;  1HMV A;  4I7F A;  3G25 A;  3G4S N;  3IRX A;  2NRR A;  4IM2 A;  1HX1 A;  4FM3 A;  1QVG M;  2OO2 A;  3W3D A;  5KRT A;  3M8S A;  1T6C A;  1XMO K;  3DLG A;  1TKZ A;  2OPR A;  4HR1 A;  4FM0 A;  3QNN A;  1HKG A;  1SU7 A;  3CFO A;  1VSD A;  1JL1 A;  1JLQ A;  3D2E A;  4GVM A;  4FK2 A;  3HYF A;  1RTJ A;  4F3T A;  4RG8 A;  1M90 O;  2IVO A;  3LAK A;  2A6A A;  4Z94 A;  3AY9 A;  4PUO A;  4FJM A;  1HRH A;  1SKW A;  2VWK A;  4KHP K;  1QE1 A;  2FBY A;  2VG6 A;  5KPR A;  4YOV A;  3CQY A;  4FK0 A;  1P8Z A;  3GDQ A;  1IG8 A;  3CCS N;  3TU5 A;  1VSL A;  3CQ8 A;  4UDY X;  4CGF A;  3TTC A;  3A8Y A;  3T1A A;  4FLZ A;  5EX5 A;  4KBO A;  3VTI A;  2GEL A;  3V4I A;  4DKW A;  2EFK A;  4DSI A;  5MLC Q;  4FLX A;  3NCI A;  3EJR A;  1U4B A;  3DRP A;  5AQO A;  1NGE A;  3ENH A;  4N5S A;  2FBX A;  4IOA L;  1XHZ A;  4JKC A;  1NK9 A;  4DQP A;  4HTU A;  3F73 A;  4ID5 A;  3KKR A;  1XQS C;  1K9M O;  3VQC A;  3TAG A;  3EE9 A;  3PIP L;  1ITG A;  3KK1 A;  1KRP A;  4YOU A;  3O9U A;  3RSE B;  4WF9 L;  1EWQ A;  5AQI A;  4RCH A;  4CHN A;  3BGR A;  4C8L A;  4DQR A;  3VGM A;  4JK7 A;  1HWW A;  1Q81 O;  4AM7 A;  1GOB A;  5HL7 L;  4E0D A;  1GOA A;  2DFH A;  4W5T A;  2UUB K;  3CJA A;  2A40 A;  3QEV A;  3CM6 A;  1NU0 A;  1ZBL A;  5T7B A;  1BHL A;  1EP4 A;  3NGZ A;  1I94 K;  1NGF A;  4XH5 A;  1LWE A;  5FRO A;  4F9O A;  2G8W A;  3AVJ A;  3SPY A;  2X78 A;  2OW7 A;  3L3P A;  4R5I A;  1HNW K;  3PSF A;  4FWP A;  2UXC K;  3O8M A;  1NGG A;  3KZB A;  4PO2 A;  4CF8 A;  1W97 L;  1HQU A;  5BR9 A;  3O9R A;  4R5L A;  1ZBF A;  3WXK A;  5GAG P;  1K8A O;  4NO7 A;  4XIU A;  1U49 A;  2VYP A;  4H8S A;  3VER A;  2D1K A;  1RDD A;  2NUB A;  3HRG A;  4FJ5 A;  4IM0 A;  1XC9 A;  3DLL L;  4EP4 A;  3K0S A;  2ND0 A;  3DYT A;  3VOV A;  1LCU A;  1T44 A;  3M8R A;  3WXM B;  3F7W A;  3BUZ B;  4X65 K;  1VAZ A;  5FLE X;  4EIA A;  3K9J A;  1KSP A;  1VSF A;  3O9T A;  1JLB A;  2E4L A;  2P9U B;  1YF5 L;  4CF2 A;  2A1R A;  4LF4 K;  3V9W A;  4WV5 A;  3LAL A;  3KD1 E;  5AZJ B;  4DS4 A;  3QBW A;  4FWR A;  2E88 A;  3IMX A;  4ID1 A;  3F9K A;  5I42 A;  4BRN A;  2P9L B;  5AQP A;  4BEC A;  1X3N A;  4E3S A;  1NJI O;  3H6E A;  2IAJ A;  4AH9 A;  3GI7 A;  1TVR A;  1WLJ A;  2B4J A;  4Q5V A;  3CZN A;  1SZ2 A;  4BRO A;  3AVB A;  1J53 A;  2ITG A;  4CJ4 A;  1D9D A;  4AQY K;  4BGB A;  4IFY A;  4E81 A;  3D4Y A;  1EX4 A;  5ADX H;  3LZI A;  3L3O M;  5C24 A;  4WFN L;  2P5G A;  3HPH A;  4JKG B;  1J5O A;  3ZYY X;  3QIC A;  3BVT A;  2P9P B;  4IWV A;  3FZM A;  3TTF A;  4DR2 K;  4DR6 K;  2YX6 A;  5AJ3 K;  4BC5 A;  1NK5 A;  2WIN M;  1TQT A;  2A3Z A;  1QWU A;  3LPU A;  3ZSW A;  3HT3 A;  2QWO A;  5AQS A;  2OCE A;  3FFK B;  5JLF A;  3NF9 A;  5IT9 O;  5AZI B;  4YDU A;  3NH1 A;  4LD0 A;  3TAM A;  3QNI A;  3O1W A;  3I2W A;  1NGD A;  2QWR A;  1NGB A;  2HF3 A;  3TAP A;  4KI4 A;  4M3R A;  4JK8 A;  2QFF A;  1T05 A;  1UAX A;  1BO5 O;  4AHV A;  1TAQ A;  4CFD A;  4BRH A;  1R33 A;  2WC9 A;  3V9U A;  2G8V A;  2YNF A;  4FJ9 A;  5BRF A;  1NLV A;  1BOT O;  1QX1 A;  1ASV A;  3KIO A;  4EZT A;  3V6D A;  1TQU A;  1VQM N;  2G8U A;  3M3Z A;  3LDP A;  2GV9 A;  3NMU A;  4OKE A;  1QQM A;  3ITH A;  1IO2 A;  1YUW A;  2NRW A;  2O8D B;  5C42 A;  3QLH A;  1U2V B;  3HBT A;  4WPC A;  2HST A;  2GAF D;  2XRI A;  3H0X A;  5LJV A;  3IS9 A;  1OA1 A;  4CES A;  2QWM A;  3VQQ A;  5CYM A;  3N4Q A;  3DM2 A;  1C1B A;  3ZSZ A;  1OAO A;  3KAV A;  4IKF A;  4RW9 A;  4K0K K;  1SU6 A;  2JGU A;  2WTU A;  1VSI A;  4DWI A;  2ASO A;  3VN5 A;  4O4G A;  3SBT B;  2CH6 A;  4EZZ A;  1LW0 A;  4KH5 A;  1GLA G;  4KTW A;  3AVA A;  2HBL A;  4CJL A;  3LZJ A;  4YDU C;  2P9I B;  3OYK A;  4KIK B;  3O3M B;  4M0M A;  3ATU A;  3U6F A;  2O8B A;  3AVL A;  2Z1H A;  2D5R A;  4H6I A;  3SUO A;  1NJW A;  3WEE A;  3NDK A;  1ZBS A;  3LDO A;  1XWL A;  5CY4 A;  4CJW A;  4AZI A;  4DV6 K;  1Y64 A;  4FWQ A;  5KRS A;  3KKS A;  5CZ2 A;  4FWS A;  1QWN A;  5J2M A;  3O80 A;  4K25 A;  2RPI A;  1XMQ K;  2YL5 A;  3P38 A;  4JI6 K;  3K5M A;  1NK7 A;  1OH7 A;  1U48 A;  2EHG A;  3FZF A;  4U7B A;  4GVE A;  5CE3 A;  1TKD A;  3ALY A;  1UPX A;  3SAF A;  2A42 A;  1NG9 A;  3CKD A;  3ZSX A;  4CZK A;  4IG0 A;  2A5X A;  4N41 A;  4OO1 J;  3DMJ A;  1ZBU A;  4B9S A;  4DSJ A;  2HHH K;  1DG4 A;  1HPM A;  5GIN A;  3P31 A;  3Q7C A;  1NGC A;  3QO9 A;  5C25 A;  4E7J A;  3HL8 A;  1QQC A;  2E2O A;  2FYV A;  3I01 A;  1GLC G;  4KHU A;  2BUP A;  3Q84 A;  4M7X A;  3ZET A;  2X3V A;  1YJ9 N;  2IOC A;  3K5L A;  4KB1 A;  4UDX X;  2OZM A;  4NSW A;  4PWD A;  1X03 A;  1CKR A;  4R5J A;  5DM6 L;  2JNS A;  4AVM A;  4I6M B;  1YHQ N;  4MO4 A;  3EEQ A;  3R3L A;  4FJH A;  3LDN A;  1VQ7 N;  4B9T A;  4O55 A;  3VQB A;  2QM1 A;  2NZT A;  5SWM A;  1GLJ O;  3HVR A;  4OLA A;  3QFP A;  3OYE A;  2E5L K;  1RIL A;  3OA9 A;  4JI5 K;  4FJN A;  4BRM A;  2HW3 A;  3AVM A;  4YNQ A;  4DUY K;  4CGG A;  3UIQ A;  2LXY A;  1BIZ A;  2UYT A;  3KK2 A;  1NBW A;  2IC3 A;  3CCR N;  1IBM K;  4J2E A;  1OH8 A;  1RTH A;  4JHD B;  2J4R A;  1KLM A;  3C6A A;  5BPL A;  1QSL A;  3MWP A;  3SYZ A;  4FOI A;  5C2D A;  3SV3 A;  3O5B A;  4H0X B;  2ZJP L;  4EZO A;  2OP6 A;  4DG1 A;  5HP1 A;  4BY9 C;  3O9Q A;  4BRC A;  3BLB A;  4M3W A;  3QNJ A;  4CFB A;  2D0O A;  2YNH A;  2WFB A;  1DTQ A;  2VG5 A;  2ZWH A;  1RT1 A;  3C95 A;  3CV5 A;  3DX2 A;  4JLC A;  1X9J A;  3L4I A;  2IGI A;  3F2K A;  2P9S B;  4FLW A;  3NH0 A;  3CM5 A;  4DQQ A;  4J2B A;  2PYL A;  1TYQ B;  1DLO A;  1NK4 A;  4KHQ A;  2OYQ A;  2FF3 B;  4XJX A;  4DTP A;  4XH1 A;  1GNT A;  4ICL A;  3EO3 A;  4CJ5 A;  4FCY A;  4DSF A;  3DPP A;  3LWL A;  3HST B;  4YHH K;  1JCF A;  2FF6 A;  3H46 O;  3VEW A;  4G9Z A;  2ZE2 A;  2KLA A;  3K9K A;  5C2F A;  2Z1I A;  3R1X A;  5FPN A;  3H3O B;  2GX9 A;  1WBD A;  2ELB A;  3SQ0 A;  4CK3 A;  4B1V A;  1D5A A;  3KJV A;  1RTD A;  4QS7 A;  4KHS A;  3TI0 A;  5FDL A;  3WNG A;  1U45 A;  1TQS A;  4IXC A;  4FPA A;  4XH4 A;  1TK5 A;  4XEI A;  4NLB A;  3SQ1 A;  2E2Q A;  3BF1 A;  4ILH A;  2F8T A;  4CED A;  2Q12 A;  3MK6 A;  5C5B A;  1YAG A;  1N34 K;  1HLU A;  1REV A;  3WXL A;  3D2F B;  2QW9 A;  4CEQ A;  4NYF A;  4B1U B;  1QSS A;  3RPM A;  4AM6 A;  1CZ9 A;  2WYI A;  5DM7 L;  1TV6 A;  3SMS A;  4CGH A;  1YIT N;  1VQ9 N;  4F3O A;  2GF4 A;  4ELU A;  3WXJ A;  1DEJ A;  3ZSV A;  3ULE B;  1JLA A;  3ZEU B;  1ZXO A;  4X64 K;  1LWF A;  2W40 A;  3QIP A;  1ASU A;  2YKN A;  2ZF5 O;  2F96 A;  3LM2 A;  4NCG A;  4K42 A;  1KFS A;  4JNF A;  4BR9 A;  4AZC A;  1HUX A;  3A5O C;  3AVC A;  4CZG A;  5GIO A;  3P1G A;  1SU8 A;  4B9N A;  2ASM A;  4FWK A;  5D3G A;  1GLB G;  4R5P A;  2W6K A;  2GEM A;  3LAM A;  3NHG A;  3QB0 A;  3C7N B;  2YNI A;  3D45 A;  1PS3 A;  4M42 A;  4B1Z A;  4HVJ A;  3CCL N;  2KQ2 A;  3CI5 A;  3OYA A;  3DAW A;  3O4W A;  4BR7 A;  4BQZ A;  1QS4 A;  4DFK A;  3D52 A;  4NLC A;  5HBM A;  1S5J A;  3OHR A;  4OX9 K;  4R5G A;  1JCG A;  4BWM A;  2W42 A;  2ZGY A;  3THY B;  3VPZ A;  4A5B A;  4CJF A;  1HKB A;  3MN9 A;  4H5W A;  1YVN A;  1RT6 A;  3EJU A;  2HNY A;  3RMD A;  4H0T B;  2EX3 A;  3S3O A;  2QXL A;  4CF9 A;  3LP2 A;  5EY4 A;  4DTN A;  3E1Y A;  1RT3 A;  4FYD A;  1WDZ A;  5JVG L;  4LSN A;  1YJW N;  4C8O A;  2W6L A;  5FPM A;  2HBM A;  2Q97 A;  4CEE A;  1SL2 A;  4WQ5 A;  2BTF A;  2OPP A;  1K8K A;  1KAZ A;  5F1X A;  1NKE A;  1KD1 O;  1T3V A;  5EVZ A;  4B3S K;  4JKE A;  4WCE L;  2GWJ A;  2AJQ A;  4JRQ A;  1X1P A;  4CEB A;  2YHY A;  4OPA A;  2NCZ A;  1VSK A;  4WV7 A;  4JKA A;  3BVW A;  1Z05 A;  4B1X B;  4EZP A;  3H08 A;  3J7A P;  2X5C A;  3CQX A;  4CI6 A;  4DSE A;  4FVM A;  3U3G A;  3SAH A;  3IKM A;  4BGA A;  3MN5 A;  3DWL A;  2F7R A;  2Q36 A;  3C94 A;  1BQM A;  1GLL O;  3FFI A;  4G6Q A;  4BVP A;  4W5O A;  4KHY A;  2KZZ A;  1GLD G;  1S22 A;  5E41 A;  4CGJ A;  4FW2 A;  4JI8 K;  3AO3 A;  1QSY A;  1I4D A;  1BCM A;  4IBN A;  4A62 A;  2PMR A;  4M63 C;  1J5E K;  2Y1J A;  3VEO A;  3L2U A;  3OWG A;  3V9X A;  4FWM A;  2YKT A;  4H0V B;  4MO5 A;  3VQE A;  1WSI A;  1V4S A;  4O44 A;  1JJ2 M;  2FSJ A;  1D8Y A;  2JWK A;  5KGW A;  5BN8 A;  3RVC A;  5M1Q A;  4A2A A;  3OYF A;  1U04 A;  4H8K A;  3G10 A;  1Q8I A;  1WAF A;  3H3N O;  4BDP A;  3OTO K;  2ETJ A;  5FPE A;  3I0R A;  3QNO A;  5GIP A;  2O8E B;  3MN6 A;  4EZ6 A;  3WNE A;  2RKI A;  3OYH A;  1HJR A;  3FZL A;  4FJ8 A;  4NPH A;  2X74 A;  1JLF A;  2YHW A;  1Z25 A;  3CJB A;  4WQ5 C;  4CHY A;  4D8J A;  4BC3 A;  1WOQ A;  3OYG A;  1O1W A;  2ASP A;  2PBD A;  3SK3 A;  4ZTJ A;  2PFU A;  1SKR A;  2HNZ A;  1E3M A;  3U9Z A;  1RBT A;  3T1H K;  4JD2 A;  4GKJ K;  4WPE A;  3DQG A;  1A5W A;  4IJN A;  3DRS A;  3OYB A;  3VQ8 A;  5C15 A;  4FSV A;  2HHX A;  3AA5 X;  5AQM A;  3QFU A;  4FXD A;  4IW0 A;  4F4K A;  2HHT A;  5HRP A;  3S9H A;  2A1S A;  4KFB A;  3PIO L;  3F5T A;  3IAY A;  4LF7 K;  4MLH A;  1ATN A;  4CK2 A;  1EXQ A;  2F1A A;  3T19 A;  1XC3 A;  2IVP A;  4M41 A;  2G8H A;  3IG1 A;  4EFH A;  1NGH A;  2RHK A;  4H5N A;  5J2Q A;  3ZX2 A;  4EP5 A;  4IEE A;  2KFZ A;  4BE7 B;  4JKB A;  4OPK A;  3VQ5 A;  4BRP A;  3MN7 A;  4DMN A;  1MU2 A;  3OYI A;  3SQ4 A;  1WSG A;  3SBS A;  3CER A;  3B8A X;  5KI6 A;  4AHT A;  2G8I A;  2O0I 1;  1RBS A;  4FJI A;  4MQD A;  3NVM A;  3TSU A;  2GUP A;  3WT0 A;  4W5R A;  1IKW A;  4EZU A;  2O8C B;  2FIC A;  4ILG A;  4RW4 A;  4KV8 A;  3I33 A;  2ITM A;  1MA9 B;  5AQK A;  2UUC K;  4C8M A;  3J81 O;  4F8R A;  3NGI A;  4FLT A;  1SL1 A;  3WUH A;  5EU7 A;  2Q0R A;  1WSJ A;  3HP9 A;  1BA0 A;  1NK8 A;  3PUF A;  4KO0 A;  4JS5 A;  4CER A;  2QEX N;  4DV0 K;  3AAQ A;  3ABH A;  1JXE A;  3SAG A;  2HB5 A;  3CJ1 A;  4BRK A;  2XO7 A;  4CZI A;  3MXI A;  3RTV A;  3KD5 E;  3THW A;  2F8S A;  4CBW A;  4IFE A;  4HY9 A;  3A2F A;  3OYM A;  2RF2 A;  4JI4 K;  5K14 A;  4CHO A;  1XUP O;  4CFC A;  1IH7 A;  2Z1G A;  1X9M A;  5DK5 A;  4JNE A;  2ZQB A;  3EN9 A;  3DOL A;  4BQL A;  5KPT A;  1H1V A;  3LP0 A;  1O7D B;  1QZ5 A;  3KVG A;  3BDP A;  2NRT A;  5ELZ A;  2HBK A;  3SJJ A;  1J6Z A;  1HQE A;  4RWT A;  4J8F A;  1VQO N;  1KC8 O;  4PKH A;  4JS4 A;  3UKR A;  1RDC A;  4BR4 A;  4GV9 A;  3ZSR A;  3M5R A;  3KLI A;  5AQG A;  4BC2 A;  3HOT A;  3EL2 A;  3PX6 A;  3THV A;  1L3U A;  3BUD A;  3CET A;  5GAH P;  2P9K B;  4FZP A;  2X3W A;  2YCH A;  4BRG A;  4KKO A;  4DB3 A;  4M3T A;  3SBG A;  4CJ7 A;  2IS3 A;  2ALW A;  4BDZ A;  2HVH A;  3I56 N;  1U00 A;  1OH6 A;  4EZV A;  3T47 A;  1L3S A;  5JEN A;  1JXB A;  3SUN A;  1J54 A;  1I3A A;  4DSK A;  5M1O A;  4IEI A;  4CJQ A;  5IWA K;  3ZED A;  4LH4 A;  4KH6 A;  2GTD A;  3EJQ A;  3T46 A;  2BAN A;  2HHW A;  4FJL A;  1L3V A;  4BRD A;  3AO1 A;  3D7E O;  1BIS A;  1RDA A;  2PY5 A;  1VQK N;  1NJX A;  1ZBI A;  1R0A A;  1SL0 A;  4H4O A;  3AVN A;  2JWL A;  5FRM A;  4JAX A;  4BE1 A;  4HUE A;  4OVL A;  3CCM N;  4CGI A;  2V52 B;  1C0M A;  2Q13 A;  1DT9 A;  1WSF A;  3D6R A;  3I55 N;  3DLB A;  4KH4 A;  2E2N A;  2P9N A;  2YL6 A;  3LPT A;  3HAJ A;  1I4T A;  4V19 S;  4CD3 A;  1WSE A;  5AQJ A;  3PLT A;  1LW2 A;  2GUI A;  1ZC6 A;  4M45 A;  3OYN A;  2F1B A;  3BZC A;  4RW7 A;  4UQG A;  1VRT A;  1L5U A;  3GL1 A;  5JVH L;  4BDY A;  4I9L A;  5AR0 A;  1C1C A;  5E84 A;  3OJU A;  4NQI A;  4JI1 K;  3UKU B;  4O8K A;  4BR0 A;  4Z4H A;  4FJJ A;  4RW8 A;  2JLE A;  4CBX A;  3S3M A;  1BPR A;  4AHR A;  2Q0U A;  4DTS A;  4ATM A;  2QXF A;  4JK9 A;  4J2A A;  5FIG A;  1DGK N;  2QWQ A;  1XHX A;  3QA8 A;  1NM1 A;  3ISN C;  4E1M A;  2PYJ A;  4O8U A;  3ZX3 A;  3HP6 A;  1E9V A;  3BUB A;  1ESV A;  4HTL A;  4B8C A;  3WNF A;  2HHS A;  2AA4 A;  5CHI A;  1RT4 A;  4K41 A;  3EJS A;  1BDG A;  4E19 A;  1BI4 B;  2G8F A;  3V9S A;  4CEC A;  2G8K A;  4LH5 A;  3LMF A;  3RV0 A;  1RCH A;  3ZEF A;  2OTL N;  4ELT A;  3CCE N;  4KHN A;  1NMD A;  1G15 A;  2OZN B;  3R8E A;  4EHT A;  1VHX A;  2QWN A;  4KI6 A;  3MEC A;  3L2Q A;  4FZS A;  2KW4 A;  1E1D A;  3G71 N;  1TL3 A;  3KK7 A;  4HR1 B;  3SPZ A;  5FLX O;  4EAH D;  5ADX A;  1X3M A;  2JNK A;  3NBP A;  3D4Z A;  4IZ9 A;  3RWU A;  3D2E B;  1NK0 A;  3HK2 A;  3ENB A;  5AQQ A;  1MDU B;  3QML A;  1CZA N;  1C0G A;  3MAQ A;  4H0Y B;  1DKG D;  3CAZ A;  4B08 A;  4NYN A;  1VQ8 N;  1OA0 A;  3EJT A;  2QTD A;  4GY2 B;  1KLN A;  3JXU A;  4LF6 K;  3HJF A;  4I1Q A;  3O3N B;  4E7L A;  3AA2 A;  3AAP A;  1HYS A;  3ZT2 A;  3SZ2 A;  5HLF A;  2QKK A;  4FZY A;  3OS2 A;  2YIA A;  1VK0 A;  4B3O A;  1BL3 A;  1KVB A;  3CCQ N;  1B9F A;  4M3Y A;  5KGX A;  3I8D A;  3E9P A;  4N47 A;  4B1Y B;  2P51 A;  4BRL A;  4YOR A;  2FSK A;  1GNL A;  2Z1J A;  5M1F A;  1N32 K;  2X3X A;  2YV0 X;  5GAE P;  4E89 A;  4IG3 A;  1NGJ A;  4WFA L;  3V9Z A;  4CHQ A;  4Z4F A;  3HSC A;  3SNN A;  3CFR A;  3WQU A;  1DKZ A;  4OKJ A;  1WSH A;  4FOE A;  3MCA B;  3J7Y P;  3DXM A;  3LP1 A;  4DTM A;  3NVK A;  4JEP A;  4DFM A;  2F9W A;  4EHU A;  3JS6 A;  2O4G A;  4CJE A;  1GLF O;  3OYL A;  2UXD K;  4FJK A;  3J8A A;  3PX4 A;  4DQS A;  1TQV A;  1LAV A;  3B6O A;  4GW6 A;  4Z0U A;  2R7Y A;  1KVA A;  1W7A A;  1T8E A;  3BVU A;  3EZW A;  3ENO A;  5F2R A;  3PO5 A;  1I4L A;  2IDO A;  3CFP A;  2EWF A;  5BPM A;  1SQK A;  4LF5 K;  3JSM A;  1ZWW A;  1Z6R A;  4GMJ B;  1CXQ A;  2DFE A;  4IO8 A;  4CIE A;  2ATQ A;  3OW2 M;  3MX2 A;  4KRE A;  3RRH A;  2YI9 A;  2X6N A;  4BE0 A;  4EZR A;  3DLH A;  2D0B A;  4KTQ A;  5KQ8 A;  4PL7 A;  3QEI A;  3NF8 A;  1R34 A;  3VMF B;  4IFV A;  3VET A;  1QVF M;  1M1K O;  4JWC A;  2HND A;  3SYV A;  2QKW A;  3CZS A;  4B9M A;  2B6A A;  4CZF A;  4DR7 K;  1VQL N;  3C6T A;  4DTO A;  2WYH A;  2QWL A;  3L6Q A;  3ZT1 A;  1SKS A;  4DTR A;  2YHB A;  5LMU K;  3L4Q A;  3KWI A;  3L3U A;  3PO4 A;  4B1W B;  1S72 N;  3B51 X;  3ASM A;  4AZ6 A;  1RT5 A;  1YT3 A;  3EY1 A;  4CFA A;  1BWF O;  4CF1 A;  1EQY A;  4JKF A;  4B9U A;  2VQF K;  4EZY A;  4FZX C;  4JWE A;  1G99 A;  3TSP A;  4LY7 A;  2HMI A;  1RBU A;  4QAG A;  4RTF D;  3ZCM A;  3D51 A;  2PY6 A;  4AKV A;  3A98 A;  3LVT A;  1U47 A;  3TAR A;  4WFB L;  4JLH A;  4FWL A;  1X9W A;  1TGO A;  1R59 O;  2NLX A;  4Y0W A;  1JCE A;  3E66 A;  2Z0N A;  4NB4 A;  3OY9 A;  2OBM A;  4I9Q A;  1VSH A;  1HR0 K;  1JQK A;  3AA4 A;  5AQU A;  3VA3 A;  2FBT A;  2OPQ A;  3AGK A;  5KQD A;  3T3F A;  3ID6 A;  3T1Y K;  3FZK A;  3CPE A;  3KHY A;  2F4V K;  3CYG A;  1IV0 A;  4Z4C A;  5CR4 A;  3S5T A;  4E1N A;  3E9L A;  4JYA K;  4CEA A;  3CC2 N;  3A5N C;  1O13 A;  1WB9 A;  2GWK A;  3CMA N;  3CJC A;  3QWE A;  3RSE A;  3U3Y A;  1NOY A;  3K5O A;  1C0T A;  3R6M A;  3VEX A;  4CVN E;  3QET A;  3DX3 A;  4AHS A;  1QQO A;  3VTH A;  3TTD A;  4C1N I;  5I9E B;  5AQF A;  4H4M A;  5FRN A;  2KZM A;  4JRP A;  4IWP A;  2OZS A;  4DCN C;  1Y2O A;  4CJR A;  5J2N A;  4Z4E A;  3BEX A;  4B3M K;  3E9O A;  4OKK A;  2KHO A;  2RE2 A;  5M1K A;  4BRF A;  3MX5 A;  4H5V A;  2FXU A;  3V1O A;  4DUZ K;  2F18 A;  4DFJ A;  1S1U A;  2UUA K;  3OYJ A;  1FXX A;  3DX4 A;  4OGE A;  3TAF A;  1KVC A;  5JS2 A;  1YIJ N;  1KAY A;  4EZN A;  4K8X A;  3OYC A;  2ZXQ A;  3VQ6 A;  3PV8 A;  1MJG A;  2BPR A;  3QEP A;  2UU9 K;  3THX B;  4CEZ A;  3HAH A;  3GE1 A;  1VSE A;  2YKM A;  2E20 A;  3VEN A;  4DTX A;  2P9U A;  3MMV A;  3I8B A;  4DV1 K;  3PY8 A;  4LF9 K;  3VEZ A;  3KLH A;  1FW6 A;  4ELV A;  1D9F A;  4Q0B A;  3N8E A;  3QIO A;  3O1B A;  5AZJ A;  4YOT A;  3O4Q A;  2XY6 A;  2O8B B;  2D0C A;  2Q3S A;  3WEE B;  1W0H A;  2XHB A;  4E72 A;  5AQZ A;  4HUF A;  2P9L A;  4FJG A;  3CJ7 A;  1V4T A;  5BPN A;  5BRD A;  3VES A;  3ZT4 A;  4OLB A;  4HHT A;  4AF1 A;  2C1G A;  4CK1 A;  2W41 A;  2WON A;  3MCP A;  4X66 K;  3FLC O;  3WXI A;  4BR5 A;  3HPO A;  3B53 X;  4C1N K;  1SV5 A;  1VQN N;  1HYZ A;  3VGL A;  4OPJ A;  4ZHR A;  3MED A;  1QZ6 A;  3BUQ A;  5C12 A;  4JKG A;  4GV6 A;  1E4F T;  2E6L A;  1NWK A;  4CIG A;  3VEA A;  4PY5 A;  2P9P A;  2P1J A;  3P39 A;  1EET A;  2NRH A;  4BVO A;  4DTJ A;  1NMN A;  3LDS A;  4FK4 A;  1I49 A;  4DU4 A;  4IDH A;  1A5X A;  2QK9 A;  4X62 K;  1NK6 A;  5AZI A;  2VWB A;  3MEG A;  1C0F A;  1ILY A;  4FM1 A;  1ZBH A;  3ZET B;  1VQ5 N;  1JL2 A;  2YNG A;  3AO4 A;  4I43 A;  1T6D A;  1CXU A;  3W0L A;  3U4L A;  3HPG A;  4BEB A;  1WUA A;  1UOC A;  3O3H A;  4FL9 A;  5J2P A;  3NAE A;  3FE1 A;  3NF7 A;  4DQI A;  4FJ7 A;  1Q9X A;  1UA0 A;  2F9T A;  1K73 O;  4DR1 K;  1KXP A;  2Q1N A;  3LDQ A;  1U6Z A;  4F2R A;  5AQL A;  2O8D A;  2OA8 A;  1KAX A;  1GN9 A;  3B6P A;  4Y1D A;  1Q82 O;  3AO2 A;  1RT7 A;  1TUY A;  1U2V A;  3DOK A;  5DMR A;  2OW6 A;  3AVH A;  1IJJ A;  5JIC A;  4PHT X;  2GBZ A;  3OS1 A;  4DV3 K;  4QS9 A;  3KLE A;  1LOT B;  1EKE A;  3J7Z O;  5CZ1 A;  1YJN N;  2YLL A;  4JI7 K;  1TKX A;  5LY3 A;  4B3T K;  2Z8Y A;  2E1Z A;  5EXW A;  1S6Q A;  3RV1 A;  1B92 A;  5AQW A;  3ZLJ A;  1Y97 A;  1N33 K;  1WN7 A;  4M7Y A;  1T03 A;  5AQR A;  4CZH A;  3NF6 A;  3SBT A;  3CCJ N;  2VWJ A;  1IBK K;  4CJU A;  1C6V A;  1TUU A;  3HAI A;  2KKZ A;  4O0I A;  2HOE A;  3VQ4 A;  4CW7 B;  2P9I A;  4O5F A;  2QKB A;  1RDB A;  4KIK A;  5BRE A;  4Z4G A;  2D4W A;  1S9G A;  3G9G A;  3SLC A;  3D0P A;  4U67 L;  4JWI A;  3BY5 A;  1NGI A;  1BIU A;  2FLO A;  1Z26 A;  3BZK A;  3RR8 A;  3KAW A;  4HCB A;  1W9M A;  3AAR A;  1VSM A;  4J2D A;  4H5T A;  4Y1C A;  3ER8 C;  3ACO A;  2V0O A;  1RBV A;  4CJT A;  5KPZ A;  1A5V A;  2I7P A;  4DU1 A;  3C0B A;  4LSL A;  3G0Z A;  4A59 A;  2H3G X;  4CCH A;  3H45 C;  3SUP A;  4KPY A;  1JKH A;  4F2S A;  4BRA A;  3UIT A;  2IIR A;  4BG9 A;  3J80 O;  1YI2 N;  3ZSY A;  4GKK K;  3LP3 A;  1ZYL A;  3OJS A;  4DQ8 A;  3ZSO A;  1N8R O;  3HZ6 A;  1QHA A;  2X6S A;  4FZO A;  1FK9 A;  1YWM A;  3LDL A;  1X9S A;  1K6Y A;  4DV4 K;  5EOY A;  1NJY A;  1HNV A;  4IDK A;  4JN4 A;  2HMP A;  4ILH B;  3HTV A;  3MEE A;  3MWT A;  5C5B B;  2YHX A;  5FPD A;  2PAV A;  3A0I X;  3BUP A;  4I6M A;  4JI3 K;  4W5Q A;  1LQ7 A;  1IKY A;  4CZJ A;  1T7P A;  3SCX A;  1NJZ A;  1BQN A;  3K5N A;  2Q31 A;  3DXK B;  5HOO A;  3DRR A;  3VEB A;  3AA3 A;  2CGK A;  4C8N A;  3Q7B A;  1UWB A;  3BP8 A;  4PA1 A;  1JLC A;  3DLK A;  2ZGZ A;  4BG8 A;  1TQW A;  2HF4 A;  2DTU A;  3AVI A;  4B9V A;  2OTJ N;  4DR4 K;  2F7T A;  4AZC B;  1LAW A;  1S3X A;  3AVG A;  5CYQ A;  3U9D A;  1WNS A;  3QE6 A;  1VSJ A;  1RT2 A;  4MDB A;  4JHD A;  1NNE A;  1NKB A;  3ULD A;  3TWH A;  4IWQ A;  1TK0 A;  4BE2 A;  3CVR A;  1J9A A;  1QQN A;  1EO1 A;  1JLE A;  4JWD A;  4DYL A;  3K57 A;  2D1L A;  3H1V X;  4AZH A;  4LFB K;  1BG3 A;  5C0Y A;  1ASW A;  4CBU A;  4H5R A;  4EZQ A;  4FLY A;  3L3V A;  2EX3 B;  1DTT A;  2F7Q A;  1DKY A;  3DJC A;  4CIF A;  3EKU A;  4DLE A;  5HRO A;  4CGD A;  4LFC K;  3VF6 A;  4PKG A;  4YFU A;  1SUQ A;  3CG7 A;  3LLL A;  3TAN A;  1Q18 A;  3UE5 A;  2P9S A;  4ZTF A;  1K8K B;  3FD9 A;  1TYQ A;  3DX0 A;  3KLF A;  4FVU A;  1SAZ A;  4BRE A;  4DCH A;  4IJA A;  1OVY A;  3VQD A;  1Q5L A;  3O6W A;  3SI6 A;  1CZB A;  2D4C A;  4YOW A;  3DLR A;  3AV9 A;  3DPQ A;  3CHW A;  1LWC A;  2Y1I A;  4EZX A;  4L3Q A;  3HM9 A;  5HRS A;  2EFL A;  4TSX A;  2HHI A;  2BDP A;  1URU A;  4QOZ B;  1BCO A;  1YVU A;  5BN9 A;  2O8F B;  3G6E N;  2YIV X;  3CIP A;  3ZT3 A;  3VGK A;  4EZS A;  1BA1 A;  4DF8 A;  1YXQ A;  4BR2 A;  1OKJ A;  4RW6 A;  2E8A A;  1BU6 O;  4PL8 A;  1S1T A;  3C6H A;  3DI6 A;  5BRH A;  1CLQ A;  3CME N;  2HHU A;  4FW1 A;  3GOI A;  3D2F A;  4YOX A;  1KTQ A;  1QTM A;  4N56 A;  1IG9 A;  1HTY A;  1BGX T;  2HHQ A;  5C10 A;  2DFF A;  1TK8 A;  1RTI A;  4CJK A;  3M1F A;  4PKI A;  4IO9 L;  3T7Z A;  3JAM O;  1Q7Y O;  1RNH A;  3L2V A;  3VA0 A;  1NGA A;  4CE9 A;  3SV4 A;  3ULE A;  4DV5 K;  1ATR A;  2YLA A;  4ILI A;  3O9S A;  3ZEU A;  4NXN K;  2V7Z A;  3V81 A;  1JLG A;  5LJW A;  3KK3 A;  3P83 D;  3PX0 A;  2YI8 A;  1TAU A;  2LSN A;  3RRG A;  1HPZ A;  4O5B A;  3MDQ A;  1P90 A;  4R79 A;  2YL9 A;  3L0Q A;  4MDA A;  4LFA K;  2C1I A;  4AZG A;  4H6H A;  4JD2 B;  3THX A;  1S1X A;  2WOM A;  2D0P A;  3P5J A;  2VQE K;  3C7N A;  2RAI A;  3KLG A;  2YI1 A;  2ND1 A;  2NRX A;  1BUP A;  3SJH A;  3E01 A;  2I7N A;  1L3T A;  5JS1 A;  3T49 A;  4FWN A;  3EE8 A;  4A57 A;  1OH5 A;  3NE6 A;  1GOC A;  4HYB A;  1YTA A;  2I5J A;  3THY A;  5M1P A;  1X04 A;  3VQP A;  2PZS A;  2E6M A;  2YJF A;  4F00 A;  1NOZ A;  4H0O A;  4DF4 A;  3M8Q A;  1IKV A;  5AQN A;  4O0J A;  3UB5 A;  3HXM A;  3C6U A;  4GNI A;  1IKX A; 
#chains in the Genus database with same CATH homology
 2BH1 A;  4ILG B;  3TTD A;  3VTH A;  4BRN A;  2ZJR L;  4C1N I;  3N4P A;  2P9L B;  3FZL A;  5AQF A;  5AQP A;  5I9E B;  4BEC A;  1X3N A;  4NPH A;  4E3C A;  2YHW A;  1NJI O;  3ID8 A;  3H6E A;  4IWP A;  5JMV A;  4B9Q A;  3CJB A;  2E1Y A;  4WQ5 C;  3GI7 A;  4D8J A;  1HKC A;  3DPO A;  4BC3 A;  1WOQ A;  3BEX A;  2Q2R A;  2QA4 N;  4QS8 A;  3E9O A;  1SZ2 A;  4C23 A;  2ASP A;  4BRO A;  5AQV A;  2PBD A;  3SK3 A;  2KHO A;  4H0P A;  2RE2 A;  2PFU A;  4BGB A;  3MX5 A;  4WYB A;  4BRF A;  4H5V A;  4E81 A;  2FXU A;  2V7Y A;  5M1K A;  3LM9 A;  3TPQ A;  3U9Z A;  4JD2 A;  5ADX H;  3L3O M;  2QI2 A;  2OBL A;  4R79 A;  3DQG A;  4IJN A;  3VF2 A;  4WFN L;  4ISE A;  4JKG B;  1HJO A;  5C15 A;  4FSV A;  3ZYY X;  5AQM A;  3QIC A;  3QFU A;  4IW0 A;  2P9P B;  1YIJ N;  1KAY A;  4IWV A;  3FZM A;  4EZN A;  3PIO L;  3F5T A;  1MWM A;  4E1J A;  3TTF A;  2DPN A;  2YX6 A;  4MLH A;  4BC5 A;  2WIN M;  1ATN A;  2A3Z A;  1MJG A;  2BPR A;  5AQY A;  1XC3 A;  2IVP A;  2QWO A;  5AQS A;  5JLF A;  3FFK B;  3GE1 A;  4EFH A;  5AZI B;  4YDU A;  1NGH A;  2E20 A;  2RHK A;  4H5N A;  3U8X A;  3ZX2 A;  3O1W A;  3VEN A;  4IEE A;  4BE7 B;  3DOB A;  2P9U A;  1NGD A;  3I8B A;  3MMV A;  2QWR A;  3HI0 A;  1NGB A;  2HF3 A;  3MN7 A;  4JKB A;  4MLE A;  4BRP A;  3VEZ A;  4JK8 A;  2QFF A;  3SBS A;  3CER A;  3N8E A;  3B8A X;  5AFU H;  3O1B A;  5TKW A;  4YOT A;  5AZJ A;  1BO5 O;  2VCP A;  4MQD A;  3NVM A;  4K43 A;  7HSC A;  2GUP A;  3TSU A;  3WT0 A;  4BRH A;  4EZU A;  3WEE B;  2WC9 A;  3FGU A;  4ILG A;  5BRF A;  5AQZ A;  1RDW X;  2P9L A;  3UKR B;  1NLV A;  1BOT O;  3CJ7 A;  1V4T A;  3I33 A;  3IFR A;  1MA9 B;  2ITM A;  5BPN A;  5BRD A;  5AQK A;  3VES A;  3CC7 N;  4AF1 A;  2C1G A;  1RFQ A;  3I04 A;  2YJE A;  4ILJ A;  2W41 A;  3C65 A;  3WUH A;  3MCP A;  4EZT A;  2W00 A;  1VQM N;  2Q0R A;  5TKY A;  1BA0 A;  3LDP A;  3M3Z A;  3WQT A;  3NMU A;  2IVN A;  3FLC O;  4FO0 A;  3WXI A;  1QQM A;  4BR5 A;  4H03 B;  3B53 X;  1YUW A;  1RGI A;  2QEX N;  2NRW A;  3AAQ A;  1ATS A;  4C1N K;  3SAG A;  1VQN N;  3FZH A;  3H1Q A;  3ER9 B;  3CJ1 A;  1U2V B;  3IUC A;  3VF4 A;  3VGL A;  4BRK A;  3HBT A;  2HST A;  4CZI A;  2GAF D;  1QZ6 A;  2C1I A;  3H0X A;  5C12 A;  4JKG A;  5LJV A;  1W2B M;  4GV6 A;  1OA1 A;  1E4F T;  3GG4 A;  4WQ4 A;  1NWK A;  3VEA A;  2NRV A;  2QWM A;  4FWO A;  2P9P A;  3N4Q A;  3P39 A;  1D4X A;  1OAO A;  3KAV A;  4CBW A;  4IFE A;  2NRH A;  4HY9 A;  3CCU N;  3M6G A;  4BVO A;  1XUP O;  1SU6 A;  3TSQ A;  4IDH A;  2ASO A;  4F01 A;  3SBT B;  3AGR A;  2VWB A;  4JNE A;  5AZI A;  3CC4 N;  1GLE G;  2CH6 A;  4EZZ A;  3EN9 A;  4EZW A;  4KH5 A;  4BQL A;  3IDH A;  1GLA G;  5KPT A;  1H1V A;  1C0F A;  2HBL A;  1ILY A;  1QZ5 A;  3KVG A;  3ZET B;  2NRT A;  4IWO A;  2EWS A;  2P9I B;  4YDU C;  1VQ5 N;  5ELZ A;  2HBK A;  3ERC C;  4KIK B;  3O3M B;  4M0M A;  1J6Z A;  3ATU A;  4RWT A;  4J8F A;  1VQO N;  4I43 A;  3O3O B;  1KC8 O;  4H6I A;  1T6D A;  2P9N B;  4PKH A;  3W0L A;  2E2P A;  3U4L A;  3WEE A;  1ZBS A;  3LDO A;  1WUA A;  4BEB A;  2RT6 A;  4FL9 A;  3UKR A;  5AQH A;  4BR4 A;  4CZL A;  4GV9 A;  1Y64 A;  3FE1 A;  3M5R A;  4FWQ A;  3CXC M;  2F9T A;  5AQG A;  1K73 O;  4FWS A;  1Q86 O;  4BC2 A;  1KXP A;  3EL2 A;  5AQT A;  3HOT A;  2Q1N A;  3O80 A;  3LDQ A;  4K25 A;  3CCL N;  1N8R O;  1U6Z A;  3CET A;  5GAH P;  2P9K B;  3P38 A;  2YCH A;  5AQL A;  3LL3 A;  4BRG A;  2QWP A;  5AFU A;  4DB3 A;  4U7B A;  3FZF A;  4FPB A;  4GVE A;  3SBG A;  5CE3 A;  4CJ7 A;  1KAX A;  1GN9 A;  2YIB A;  3CCV N;  1Q82 O;  3KDR A;  3I56 N;  1U00 A;  1TUY A;  1U2V A;  4EZV A;  3T47 A;  1UPX A;  3SAF A;  1IJJ A;  2A42 A;  5JIC A;  4PHT X;  1E4G T;  4HWI A;  4CZK A;  4R5K A;  2A5X A;  4QS9 A;  1LOT B;  3J7Z O;  5M1O A;  4OO1 J;  1YJN N;  4IOX A;  3VEV A;  4IEI A;  3OBY A;  5LY3 A;  2VGM A;  4WQ4 C;  3ZED A;  5H1S Q;  3GBT A;  2Z8Y A;  4KH6 A;  2E1Z A;  2WBN A;  5EXW A;  3RV1 A;  3T48 A;  5AQW A;  1DG4 A;  2GTD A;  5AQX A;  3T46 A;  1HPM A;  4M7Y A;  5AQR A;  4CZH A;  1SUF A;  3P31 A;  3Q7C A;  5KQD A;  1NGC A;  3SBT A;  3P4I A;  3CCJ N;  4BRD A;  3D7E O;  5M1N A;  1VQK N;  4JKH A;  1MWK A;  2E2O A;  2JWL A;  1TUU A;  3I01 A;  1GLC G;  2KKZ A;  2VGN A;  3BF3 A;  2HOE A;  2BUP A;  3ZET A;  4M7X A;  2ZJQ L;  4IOC L;  2P9I A;  4O5F A;  4JAX A;  3CCM N;  3DXK A;  4CZM A;  1YJ9 N;  3B52 X;  4KIK A;  3F9M A;  1VQ6 N;  2V52 B;  1DT9 A;  5BRE A;  3I55 N;  3D6R A;  4KH4 A;  2D4W A;  4UDX X;  2E2N A;  2P9N A;  3T4A G;  4YOY A;  1CKR A;  4R5J A;  5DM6 L;  4CD3 A;  2JNS A;  3SLC A;  5AQJ A;  1ZC6 A;  3KWG A;  4I6M B;  4U67 L;  4JWI A;  2CGJ A;  3OHX M;  1NGI A;  4MO4 A;  1VQP N;  2FLO A;  1YHQ N;  3R3L A;  3KAW A;  1RDU A;  3GL1 A;  1W9M A;  3AAR A;  4BC4 A;  5JVH L;  4H5T A;  3ER8 C;  3LDN A;  5AR0 A;  3SMP A;  3QDK A;  1VQ7 N;  5KPZ A;  5E84 A;  2I7P A;  2P9K A;  3C0B A;  2QM1 A;  2NZT A;  3CJ9 A;  1GLJ O;  3O08 A;  3R9P A;  5GAD P;  3UKU B;  4O8K A;  4BR0 A;  4A59 A;  3QFP A;  4ISG A;  3OA9 A;  2A41 A;  2H3G X;  3H45 C;  4CBX A;  4BRM A;  3HOS A;  1BPR A;  3QBX A;  2Q0U A;  4JK9 A;  4BRA A;  1JJ2 M;  3UIT A;  4A5A A;  5FIG A;  1DGK N;  2IIR A;  2QWQ A;  4BG9 A;  5BR9 A;  3QA8 A;  1NM1 A;  1YI2 N;  2UYT A;  3FR0 A;  1NBW A;  4LC9 B;  4O8U A;  5JLH A;  3ZX3 A;  3HM8 A;  1E9V A;  1ZYL A;  3CPW M;  3CCR N;  1ESV A;  4HTL A;  4DQ8 A;  3I39 X;  2AA4 A;  5CHI A;  4K41 A;  4JHD B;  2J4R A;  2NNW A;  3C6A A;  3HZ6 A;  1BDG A;  3VKH A;  1QHA A;  5BPL A;  2WUS A;  3MWP A;  4FOI A;  5C2D A;  3LMF A;  3RV0 A;  3LDL A;  4A2B A;  4JKD A;  3ZEF A;  2OTL N;  3CD6 N;  3CCE N;  1NMD A;  5E26 A;  3O5B A;  4H0X B;  3R8E A;  4BRQ A;  4EZO A;  2QWN A;  2OP6 A;  4EHT A;  2ZJP L;  1VQ4 N;  5EOY A;  2OAN A;  4JN4 A;  2HMP A;  3ATV A;  4BY9 C;  4ILH B;  3HTV A;  3O9Q A;  4BRC A;  4ISF A;  3MWT A;  3QNJ A;  5FPD A;  1E1D A;  2D0O A;  2YHX A;  2PAV A;  4CZE A;  3G71 N;  2WFB A;  3KK7 A;  3DXM B;  1E2U A;  3T69 A;  2ZWH A;  3A0I X;  4HR1 B;  4I6M A;  1X9J A;  4JLC A;  4EAH D;  4CZJ A;  5ADX A;  2GA9 D;  3L4I A;  1X3M A;  5B8H A;  2CH5 A;  2Q31 A;  3DXK B;  3F2K A;  5HOO A;  4IZ9 A;  2P9S B;  3D2E B;  3VEB A;  4OPH A;  2CGK A;  3Q7B A;  3ENB A;  5AQQ A;  3PLA A;  3BP8 A;  2FSN A;  4GV3 A;  1MDU B;  1TYQ B;  1CZA N;  3QML A;  1C0G A;  4BRI A;  3S41 A;  3UKU A;  2ZGZ A;  2FF3 B;  4H0Y B;  4XJX A;  4XH1 A;  1GNT A;  1DKG D;  3EO3 A;  3A5M C;  4BG8 A;  1OA0 A;  1VQ8 N;  2QTD A;  4GY2 B;  3JXU A;  3O3N B;  2HF4 A;  3ZX0 A;  3AAP A;  3DPP A;  2OTJ N;  5F0X A;  1JCF A;  2FF6 A;  3H46 O;  2F7T A;  3VEW A;  5BN8 A;  2HBJ A;  2V51 B;  4DHY A;  4G9Z A;  2KLA A;  1KQS M;  3K9K A;  2YIA A;  1S3X A;  2N3K A;  5C2F A;  3U9D A;  3CCQ N;  3OBW A;  3R1X A;  5FPN A;  4UY8 O;  3H3O B;  3E9P A;  2GX9 A;  4JL9 A;  2NRZ A;  4IM3 A;  3A5L C;  2CGL A;  4B1Y B;  4BRL A;  4MDB A;  1DKX A;  4JHD A;  1SS6 A;  2FSK A;  4YOR A;  4B1V A;  1GNL A;  4QS7 A;  4IWQ A;  5M1F A;  4CD1 A;  4IXC A;  1QQN A;  1EO1 A;  3EKS A;  4A61 A;  4FPA A;  4JWD A;  5GAE P;  3CF5 L;  4XH4 A;  4XEI A;  4NLB A;  1NGJ A;  4WFA L;  2AP1 A;  3VEY A;  2E2Q A;  2LM0 A;  3BF1 A;  3HSC A;  4ILH A;  3WQU A;  1DKZ A;  3H1V X;  1BG3 A;  5C0Y A;  3G25 A;  3G4S N;  4CBU A;  2NRR A;  4IM2 A;  4EZQ A;  4FM3 A;  1HX1 A;  1YAG A;  1HLU A;  3MK6 A;  4H5R A;  3W3D A;  1QVG M;  4FOE A;  3MCA B;  1T6C A;  2EX3 B;  3DXM A;  3NVK A;  1DKY A;  3DJC A;  3WXL A;  3EKU A;  4JEP A;  4HR1 A;  3D2F B;  2QW9 A;  2F9W A;  1HKG A;  3VF6 A;  1SU7 A;  4B1U B;  4PKG A;  4AM6 A;  4EHU A;  3JS6 A;  1Q18 A;  3UE5 A;  2P9S A;  1GLF O;  5DM7 L;  3D2E A;  3J8A A;  3SMS A;  1K8K B;  3FD9 A;  1M90 O;  1YIT N;  1VQ9 N;  1TYQ A;  2IVO A;  2A6A A;  4Z94 A;  1SAZ A;  3AY9 A;  4BRE A;  3WXJ A;  1DEJ A;  4DCH A;  4IJA A;  4FVU A;  1OVY A;  3ULE B;  3EZW A;  1Q5L A;  3ENO A;  3ZEU B;  3O6W A;  5KPR A;  1ZXO A;  5F2R A;  4YOV A;  3CQY A;  2W40 A;  2EWF A;  5BPM A;  1P8Z A;  1SQK A;  3GDQ A;  1IG8 A;  3CCS N;  4YOW A;  3TU5 A;  1Z6R A;  3DPQ A;  2ZF5 O;  3LM2 A;  4IO8 A;  4UDY X;  4K42 A;  4JNF A;  3OW2 M;  3MX2 A;  4BR9 A;  1HUX A;  3A5O C;  3CHW A;  3TTC A;  3A8Y A;  4BVP A;  4CZG A;  2YI9 A;  1SU8 A;  4EZX A;  4L3Q A;  5EX5 A;  4KBO A;  5GIO A;  4EZR A;  2ASM A;  4FWK A;  1GLB G;  3VTI A;  2GEL A;  5KQ8 A;  4DKW A;  2GEM A;  4PL7 A;  5MLC Q;  3QB0 A;  3C7N B;  5BN9 A;  3VMF B;  5AQO A;  4B1Z A;  3VET A;  1NGE A;  3ENH A;  4WFB L;  3G6E N;  1M1K O;  2YIV X;  4JWC A;  3CIP A;  1QVF M;  3CI5 A;  4IOA L;  3DAW A;  3VGK A;  3O4W A;  4JKC A;  4BR7 A;  4BQZ A;  4EZS A;  1BA1 A;  4CZF A;  1YXQ A;  4BR2 A;  4NLC A;  1OKJ A;  1VQL N;  2E8A A;  1BU6 O;  4PL8 A;  1XQS C;  3C6H A;  1K9M O;  5BRH A;  3OHR A;  4R5G A;  1JCG A;  2QWL A;  3L6Q A;  2ZGY A;  3VPZ A;  4A5B A;  3EE9 A;  1HKB A;  3MN9 A;  4H5W A;  1YVN A;  3L4Q A;  3PIP L;  3KWI A;  4H0T B;  3CME N;  2QXL A;  4B1W B;  4YOU A;  3GOI A;  3D2F A;  3O9U A;  5EY4 A;  3E1Y A;  3RSE B;  4WF9 L;  3B51 X;  4YOX A;  1S72 N;  5JVG L;  1YJW N;  5AQI A;  4RCH A;  5FPM A;  2HBM A;  2Q97 A;  5C10 A;  1BWF O;  3VGM A;  1EQY A;  4JKF A;  4JK7 A;  1Q81 O;  4AM7 A;  5HL7 L;  4WQ5 A;  2BTF A;  1K8K A;  1KAZ A;  3M1F A;  5F1X A;  4EZY A;  4PKI A;  4IO9 L;  1KD1 O;  3T7Z A;  1T3V A;  3CJA A;  1Q7Y O;  5EVZ A;  1NGA A;  2A40 A;  1K8A O;  4JKE A;  5GAG P;  3ULE A;  2GWJ A;  4WCE L;  1ATR A;  4JWE A;  4ILI A;  1G99 A;  3O9S A;  3TSP A;  3ZEU A;  1NGF A;  2V7Z A;  4XH5 A;  2YHY A;  4F9O A;  4OPA A;  2NCZ A;  5LJW A;  4WV7 A;  4RTF D;  4JKA A;  1Z05 A;  4R5I A;  2YI8 A;  4EZP A;  4FWP A;  4B1X B;  2X5C A;  3CQX A;  4CI6 A;  3O8M A;  2PY6 A;  1NGG A;  3A98 A;  3KZB A;  4PO2 A;  3MDQ A;  1P90 A;  3IKM A;  3MN5 A;  3DWL A;  3L0Q A;  1W97 L;  4MDA A;  2Q36 A;  4BGA A;  3O9R A;  4R5L A;  1GLL O;  4FWL A;  4G6Q A;  3WXK A;  4H6H A;  1R59 O;  4JD2 B;  2NLX A;  1GLD G;  1S22 A;  4NO7 A;  4Y0W A;  1JCE A;  2D0P A;  5GIN A;  2VYP A;  3E66 A;  3VER A;  2D1K A;  4NB4 A;  2OBM A;  3C7N A;  3HRG A;  4A62 A;  4IM0 A;  2YI1 A;  2ND1 A;  2NRX A;  1BUP A;  3SJH A;  3DLL L;  2I7N A;  4M63 C;  3VEO A;  2ND0 A;  3OWG A;  3T49 A;  4FWN A;  1JQK A;  4FWM A;  5AQU A;  3VOV A;  3EE8 A;  3AGK A;  1LCU A;  1T44 A;  4H0V B;  4MO5 A;  3WXM B;  1V4S A;  3F7W A;  3ID6 A;  4A57 A;  4HYB A;  2FSJ A;  3BUZ B;  2JWK A;  1VAZ A;  5FLE X;  3CPE A;  3FZK A;  3K9J A;  3KHY A;  5M1Q A;  3RVC A;  4EIA A;  5M1P A;  5CR4 A;  4A2A A;  3E9L A;  3O9T A;  2P9U B;  3CC2 N;  3A5N C;  1O13 A;  2YJF A;  1YF5 L;  2GWK A;  3H3N O;  3CMA N;  3CJC A;  4F00 A;  4WV5 A;  3RSE A;  5FPE A;  4H0O A;  3R6M A;  3VEX A;  5AZJ B;  5GIP A;  3QBW A;  4FWR A;  3MN6 A;  5AQN A;  3UB5 A;  3SAH A;  2E88 A;  3IMX A;  4GNI A;  1QQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...