4JN4A

Allosteric opening of the polypeptide-binding site when an hsp70 binds atp
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
600
structure length
600
Chain Sequence
SGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords Chaperone protein DnaK
total genus 192
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00012 HSP70 Hsp70 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jn4A05
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jn4A04
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jn4A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jn4A01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jn4A03
2D1KA 4MO5A 4M63C 4BRNA 3EO3A 4EZZA 1JCFA 4ISFA 3I33A 3WXKA 2E88A 3M3ZA 3HTVA 3QBWA 5AQPA 3EZWA 1KAYA 3MK6A 4CI6A 3D2EA 3JS6A 1DKYA 4WQ4C 2A3ZA 2CGJA 3R8EA 1TUYA 2YHYA 4K43A 3WXIA 4CD1A 5AQUA 2OANA 3WT0A 2KHOA 3DWLA 3LDLA 3EKSA 4CZEA 4R5GA 4H0OA 3VF6A 5ELZA 5AFUA 4IJAA 4QS9A 4RTFD 4YDUA 1RFQA 4EZNA 3U8XA 3OHRA 2H3GX 3MN7A 3H3NO 1NGJA 1QZ5A 4XH4A 1ZC6A 2P9LA 3ATVA 1SAZA 4FWPA 2PBDA 3UKRB 4CJ7A 1X9JA 5FPDA 1IJJA 2P9IA 3H45C 4MLHA 2YJFA 3ZEUA 3LL3A 5FPNA 4JAXA 1XUPO 3FZHA 4HWIA 4KBOA 4J8FA 3WQUA 1KAZA 5FPEA 2ITMA 2P9SA 3VEYA 1NGIA 2CH6A 3QNJA 4FWLA 2BTFA 4I6MA 4DCHA 3VENA 4K41A 4FPBA 3TU5A 3WUHA 4CD3A 3VF4A 1ATNA 4FWSA 2F9TA 2NZTA 3O1WA 4BR5A 2EWSA 2CGLA 4CZFA 3A5LC 2P9KA 2ZWHA 1ZBSA 3IDHA 5AQIA 4R5LA 1TYQB 3DQGA 4CZMA 4H0VB 4DB3A 4JD2A 2VWBA 2YCHA 1GLBG 7HSCA 4BRLA 3O4WA 2A40A 3MN5A 1E4GT 4CZLA 4B1ZA 3SK3A 4PL7A 3DOBA 1H1VA 1HKBA 2A42A 2HOEA 4FPAA 4AM7A 3QICA 1DGKN 4ISEA 4K42A 3WQTA 2HF3A 1JCGA 3H6EA 5AR0A 3UKUA 1NM1A 5ADXA 3ENOA 2ASOA 4PKHA 3LDOA 3P4IA 2NLXA 4JNFA 4FSVA 1YXQA 3WXJA 1C0GA 1NGCA 3ID8A 3UB5A 4RCHA 3D2EB 3HSCA 4JHDB 3U4LA 4BREA 2WUSA 3FGUA 3EL2A 1SZ2A 2Q0RA 3LDQA 3S41A 3ATUA 3VEWA 2Q97A 3A0IX 4XEIA 4B1UB 5I9EB 5EY4A 2E2QA 2D0PA 1DEJA 3VESA 1BA1A 3FZKA 3T47A 3AAPA 4EZXA 3U9ZA 1MWKA 2Q31A 3QFPA 2GTDA 3C7NA 5AQRA 3ZX0A 3AARA 2E1YA 4BRPA 2P9PB 5BR9A 3VPZA 4HY9A 3CJCA 5F1XA 1RDWX 2QFFA 1NGHA 1K8KB 3T46A 2V7YA 2YHXA 3FFKB 4EAHD 3CJ7A 1WOQA 1NGBA 3JXUA 2HF4A 1NBWA 5LY3A 4H5TA 2P9SB 2GWKA 3GBTA 3DXKA 5EXWA 1GLAG 1C0FA 1U2VA 1D4XA 2QXLA 1Z05A 5E26A 3B8AX 5E84A 5AFUH 3VEXA 1XC3A 3MCPA 4IJNA 5BN9A 1HJOA 3AAQA 4BR7A 3VETA 2V51B 3VEZA 3AY9A 4BRDA 3VF2A 3OHXM 2FSNA 3HZ6A 3M6GA 3C0BA 2W41A 2BUPA 4A62A 3ZX2A 4JNEA 5JLHA 4WYBA 5BN8A 3BF3A 1Q18A 1JCEA 3D2FB 1BPRA 1G99A 4JWDA 5ADXH 4PL8A 1GLJO 4FOIA 1S3XA 4L3QA 4WV5A 4CZJA 4NB4A 2QWNA 1Z6RA 3GE1A 1IG8A 4BR9A 4H6IA 4BRCA 1SQKA 3FE1A 3DXMA 3FLCO 3LM9A 4R5KA 5LJWA 1GLDG 3GG4A 1DKGD 2GELA 2IIRA 4H5NA 4JWEA 1GLFO 1P8ZA 2QWOA 3UE5A 4A2AA 5EX5A 3O08A 1YAGA 3I8BA 2YI1A 4ISGA 2QWQA 2QWLA 4F00A 4BR0A 2E2NA 1BWFO 3L4IA 4EZYA 5AQJA 4PKGA 5AQHA 3LDNA 4EIAA 5KQDA 1LOTB 4QS8A 3CJBA 3MMVA 1YVNA 1NGFA 4DHYA 3BP8A 1MWMA 5JICA 4EFHA 4BR2A 4B1VA 4H0YB 4NO7A 1HPMA 5AQXA 3MN6A 4BQZA 4WQ5A 2P9NA 3CERA 1OKJA 4WQ5C 3RSEA 1K8KA 3H3OB 4EZVA 5CE3A 3O80A 1WUAA 4O8KA 3ZX3A 3DPQA 2ZF5O 4FWOA 2ZGYA 2P9LB 3HI0A 3CQYA 1HKGA 2I7NA 5LJVA 2QW9A 3ULEA 3QDKA 4Y0WA 3SLCA 3D7EO 2V52B 4CBWA 2CH5A 4XH1A 3EKUA 5KPRA 1MA9B 1RGIA 3N8EA 4BRGA 4C23A 3EN9A 2W40A 3KZBA 3GOIA 5KPZA 1KXPA 3IMXA 3M1FA 3W3DA 1QQNA 4BRKA 4I6MB 1BDGA 3G25A 2E2OA 1BU6O 1BG3A 4FWNA 3T49A 4HTLA 2QM1A 3FZLA 2P9UA 1NGAA 2Q0UA 5AQVA 4JWIA 1T6CA 2OP6A 5AQTA 2QWMA 3WXLA 3CJ9A 2PAVA 4Z94A 2A41A 5AZIA 4HYBA 5AQMA 1QZ6A 4JD2B 3DPOA 1ATRA 1BA0A 4PKIA 2FSJA 3KVGA 4BG8A 4BRHA 3MDQA 3MN9A 5AQKA 1X3MA 4EZTA 1T44A 4QS7A 3U9DA 5AQZA 4H0PA 4DQ8A 2BPRA 2IVOA 2FF6A 1V4TA 3FZFA 1HUXA 4FL9A 4LC9B 2YHWA 3FR0A 5BREA 4YDUC 4BROA 3VGMA 3CHWA 5B8HA 4E81A 2J4RA 2HMPA 1DKZA 4R5JA 4JHDA 4BRFA 4JN4A 1MDUB 1BOTO 2IVNA 5AZJA 4H5VA 5BPNA 2A6AA 1NLVA 4IWVA 3ZEUB 4EHUA 5BRHA 3QB0A 5EOYA 1QQMA 5AQYA 2AP1A 3DPPA 2P9NB 4FOEA 3RSEB 2Q36A 4XH5A 4BG9A 4EZOA 3H1QA 3HM8A 4BC2A 4F9OA 3BF1A 4B1WB 2ASMA 1HLUA 3LDPA 3CJAA 4K25A 4R5IA 5AQOA 3QFUA 2AA4A 1GLCG 1KAXA 3CIPA 4FWKA 4CZHA 3WEEB 4EZPA 4IO8A 3ULEB 4FWRA 1TUUA 4H0TB 4H0XB 4BC5A 4B1XB 3BEXA 5KPTA 2IVPA 1LCUA 1Q5LA 3VGKA 3A5NC 4H03B 4CBXA 3O1BA 1NGGA 1J6ZA 5BPLA 4A2BA 1R59O 1U2VB 1GLLO 2Q1NA 4H5RA 1BO5O 3ENHA 2P9UB 1E4FT 1QQOA 1S22A 1V4SA 1T6DA 4BRQA 4H6HA 3ZETB 4EZQA 4CBUA 1HX1A 1Y64A 2DPNA 4EZUA 3A5OC 3UKUB 1NGEA 2GUPA 3O5BA 4WQ4A 3GDQA 3FZMA 3HBTA 2D4WA 5BPMA 3L6QA 5AZIB 5FPMA 4MO4A 3CETA 1YUWA 1CKRA 3VEVA 3T48A 4FWMA 4WV7A 3DJCA 4M7YA 2QWPA 3D2FA 3O8MA 3SMPA 4BGBA 2D0OA 5TKYA 3SMSA 1XQSC 4M7XA 3BUZB 2YJEA 4BGAA 1GLEG 2NRHA 4BC3A 1CZAN 4GY2B 4JWCA 4BC4A 2VCPA 2E20A 5AQQA 4CZIA 3QBXA 5AQNA 4MLEA 2FSKA 5EVZA 2GWJA 4BRMA 3DXMB 1X3NA 3C7NB 1ESVA 2V7ZA 3GL1A 4CZGA 5F2RA 1EQYA 2P9PA 1ATSA 1NMDA 1BUPA 3LM2A 5AQLA 5BRFA 1DG4A 3SJHA 1HKCA 1U6ZA 5AZJB 4E1JA 3QMLA 2Q2RA 3CJ1A 4FO0A 4F01A 2ZGZA 2VYPA 2WINM 1QHAA 5AQSA 2E8AA 4GNIA 4CZKA 1NWKA 3T4AG 3VGLA 3UKRA 2P9IB 4BVOA 2A5XA 2E1ZA 2FF3B 4A61A 2E2PA 3DXKB 4B9QA 3A5MC 5KQ8A 4FWQA 4BRIA 3W0LA 1DKXA 4EZSA 3F9MA 3H1VX 3WEEA 5AQFA 3VOVA 3H0XA 2I7PA 5F0XA 5JMVA 3J8AA 4RWTA 4O5FA 4BVPA 4IZ9A 2FXUA 2GEMA 3IFRA 4BR4A 1ZXOA 2UYTA 3KHYA 5AQGA 3CI5A 2CGKA 4EZWA 4EZRA 4BRAA 2P9KB 4AM6A 4B1YB 2FLOA 1NGDA 1TYQA 3H46O 3IUCA 3L0QA 3TPQA 5JLFA 3R6MA 1U00A 3A8YA 3DAWA 3ZETA 5AQWA 5BRDA 4IXCA 2QWRA 2ASPA 4PO2A 2F9WA 3O6WA 3VERA 3VEOA 4EHTA 4BQLA 3R9PA 3L3OM 4H5WA 3CQXA
chains in the Genus database with same CATH superfamily
3D50A 1JLEA 4MO5A 3K5OA 1BISA 4EZZA 4JYAK 2VQFK 1TK0A 4OJRA 1NMNA 3QINA 3F9KA 3TANA 2D4CA 4FJJA 1BIZA 3OYBA 1KFDA 3L2WA 1O13A 1TKXA 4GVEA 3HTVA 5JVHL 3LP1A 3QBWA 1HRHA 3ZT3A 3JS6A 1DKYA 4BDZA 3VQ8A 3S3OA 3SNNA 4I7FA 1BQNA 2YHYA 4KHYA 4CD1A 4N41A 2UXDK 3WT0A 3OW2M 2KFZA 1JXEA 2KZZA 3VF6A 5ELZA 5AFUA 2HHSA 4IJAA 4QS9A 2FC0A 4YDUA 2YX6A 4KH6A 1LWFA 4XIUA 4RW9A 5M1NA 4M3TA 1KVAA 2Z0NA 3U8XA 2HBKA 3H3NO 4XH4A 1QZ5A 2NRTA 4FWPA 4CJ7A 3SAHA 1X9JA 3D0PA 3VEBA 1IJJA 3H45C 4B9LA 3KIOA 4OPHA 3OYJA 2UUCK 4FLUA 1OH8A 1YWMA 3AVJA 2FBXA 2KQ2A 4IM2A 4BE1A 2G8UA 3KLFA 2P9SA 3VEYA 1KVCA 3TTCA 1EXQA 1NOZA 4CGIA 3CMAN 3RR8A 2BTFA 4J2EA 2X3VA 1JKHA 3S3MA 4K41A 3C65A 4FPBA 3AV9A 3LVTA 3WNEA 4CHPA 2GAFD 3O1WA 4R79A 1DTQA 4CZFA 1Q86O 4B9TA 2P9KA 2O8EA 4LSLA 4Y1DA 4CF1A 2ND1A 4R5LA 1C0TA 2EHGA 4HUGA 2A40A 2GA9D 4UQGA 3AO3A 1Q9YA 1HKBA 3CAZA 4JRQA 2OW6A 4FW1A 1JCGA 4O0JA 3ABHA 2F7RA 5FLEX 3BVTA 2Z1HA 4BECA 5ADXA 3ENOA 1HNXK 1RDDA 2ASOA 4W5NA 4GKKK 4I9QA 4FSVA 3NGZA 2WYHA 3WXJA 1NGCA 1N32K 1SU8A 3U4LA 4KB0A 2HHUA 4JK7A 3PIPL 5GAGP 2Q0RA 3LDQA 1YJWN 2F8SA 1GOAA 3AVIA 4B1UB 2Q97A 1VQ9N 2D0PA 3MAQA 4E7IA 3JAMO 4CHQA 3OS2A 3OYLA 5C0YA 3CZNA 3J80O 1MWKA 4CEOA 4FZPA 2P9PB 4E1NA 2OZSA 4HY9A 1IO2A 1JLAA 5F1XA 1OVQA 2QFFA 2RE2A 3KK7A 1K8KB 5HROA 2UUBK 1VHXA 3CJ7A 4DFKA 4NSWA 3OYNA 3P1GA 1XHZA 4H5TA 4DV2K 4L8RB 4JKBA 1LWEA 4RG8A 5GAEP 4DSLA 3GBTA 3DXKA 5CYMA 1GLAG 2RF2A 1VRTA 4CJKA 3L2VA 4O4GA 1D4XA 3NVKA 3THXB 2GF4A 5E84A 5AFUH 1XC3A 4NPHA 3RR7A 4DFMA 4E3SA 4BR7A 5H1SQ 4BRDA 4PQUA 4PY5A 3HZ6A 3IS9A 5JLHA 3UITA 3CPEA 1D9DA 4B3TK 3ZSRA 4AH9A 2NCZA 4ILGA 5MLCQ 4FOIA 4JI1K 3I0RA 4CZJA 3U6FA 3HP9A 4I1QA 4WFAL 1N8RO 1FW6A 1IG8A 1SQKA 2Z1JA 3FE1A 3LM9A 4KTWA 3HOTA 3GG4A 3C6TA 3V1RA 2IDOA 3K9JA 3I8BA 4HCBA 4AHCA 1SU7A 2QWLA 3CM6A 3SUOA 4JKAA 1SL0A 1C1AA 4YORA 1YVNA 1T7PA 2ZD1A 1RNHA 2HNDA 3MX2A 2DFHA 4NO7A 1J5OA 5KBPA 1HPMA 2RPIA 3CCQN 3MEEA 5M1QA 1K8KA 4DU4A 3QNNA 3KD1E 1NG9A 2FYVA 3NVMA 3K5MA 2P9LB 3HXMA 1HKGA 3VQAA 4JI7K 4UY8O 3ULEA 1GOBA 1ZBIA 4ILHB 3SLCA 2V52B 4CBWA 3EKUA 5KPRA 1RGIA 4C23A 2O8BA 2VQEK 3EN9A 4B9SA 3KZBA 5KGWA 1ZYLA 3CZSA 3M1FA 4DLGA 4ELTA 1QQNA 4BRKA 5DK5A 3G25A 4DSJA 1NK8A 3KKRA 3T49A 2QM1A 4DKWA 3C94A 4NYNA 1OH5A 5AQVA 1NKBA 1YTUA 4G1QA 4DQQA 3SI6A 3L8BA 4ILGB 1Q7YO 4BWJA 4HYBA 1QZ6A 1NJWA 2WYIA 2X6NA 1IBLK 1BA0A 4JEPA 5HRRA 1WAFA 4DTSA 3LALA 1R5EA 2F8TA 4LF6K 4B9MA 3U9DA 3CCRN 3SUQA 5AQZA 4V19S 1Z25A 3G71N 3RVCA 1YTAA 4JK8A 5A2QO 4DQSA 3ZT2A 2YHWA 1RDBA 1RDCA 1S6QA 4JL9A 1YI2N 1KFSA 2HMPA 1DKZA 2D1LA 3QO9A 4R5JA 1RBRA 3WNFA 4ICLA 3DDGA 5BPNA 2A6AA 3V9UA 4IWVA 5BRHA 1WNSA 5AQYA 2AP1A 4FJHA 1ASUA 2RAIA 4FOEA 1CZ9A 4KB1A 4EZOA 2OBMA 4DR1K 3CYMA 4LFAK 2YI9A 3BF1A 3O4QA 1GOCA 3ITHA 4NCBA 1WN7A 1KAXA 3CIPA 3SAGA 4EZPA 4IO8A 5C42A 4LF7K 3H08A 4FWRA 4H0XB 4BC5A 4ILHA 2Y1IA 4B1XB 3CC2N 4CJTA 4F8RA 2O8BB 3VGKA 4YOWA 4FLZA 3HO1A 4M3UA 3CMEN 2A1SA 3T7ZA 2G8VA 3TTFA 2HHQA 5BPLA 4YOVA 1NJYA 2OPPA 3BVUA 1GLLO 3OJUA 3ENHA 1HWWA 2GV9A 3SOGA 4BRQA 3M5RA 1NU0A 3AVLA 1WSHA 1Y64A 4Z4EA 1IV0A 1NGEA 1UWBA 3B6OA 3O5BA 4WQ4A 3GDQA 3FZMA 3HBTA 4FXDA 4RW8A 3L6QA 5BPMA 3TARA 4F2SA 3CETA 4UDXX 3T48A 5T7BA 3D6RA 4DTXA 3BY5A 3DJCA 3K2PA 4CJPA 2QWPA 3O8MA 4LFCK 2D0OA 5TKYA 3SMSA 2PY5A 3THWA 4Z4GA 3SBTA 3CM5A 4BGAA 2OPSA 1TQUA 2NNWA 3HK2A 3L3PA 1RILA 1YJNN 3L3VA 1DLOA 3THYB 5AQNA 2FSKA 3E1YA 3DXMB 4IWOA 4CZGA 3OYKA 2YLAA 3RV0A 2P9PA 1ATSA 5AQLA 3HM9A 5M1KA 4RW4A 3QWEA 3QIPA 3QMLA 3CJ1A 3DMJA 1M1KO 4CEBA 1QHAA 1E9VA 1HPZA 4CZKA 3T4AG 2HVHA 3E9OA 2P9IB 4BVOA 1W2BM 3VKHA 1VSKA 4AZ5A 4B9QA 3DXKB 3O3HA 4DV1K 3OYAA 1NKCA 4RW6A 2X5CA 3W0LA 2NUBA 1DKXA 4EZSA 3H1VX 4KHQA 1T3VA 1REVA 4DTUA 1JJ2M 5HRPA 3MXJA 1VQ5N 3J8AA 4KTZA 4BVPA 3KK2A 3KKSA 3N4QA 3OBYA 3IFRA 4BR4A 1ZXOA 4C8NA 2UU9K 2UYTA 3L2RA 2DFFA 3DX0A 3RMDA 4B3OA 4PHTX 4EZRA 1JLCA 3CCEN 1VQ8N 3LP3A 4MQ3A 3PSFA 1S1WA 2FLOA 3ULDA 1TYQA 4AZBA 1FKPA 3R6MA 5JVGL 4PA1A 3A8YA 3WNGA 2OPRA 3DAWA 2KLAA 2ASPA 3L3UA 1NKEA 2DFEA 4H5WA 5HLFA 1FJGK 2G8IA 1B9FA 3OA9A 4KFBA 2BDPA 1X9WA 3DDFA 3DLGA 3TSQA 4KHWA 3ZCMA 2F96A 3THWB 2F7PA 3I33A 2E88A 5KRSA 3TWHA 5SWMA 2HHWA 3PSIA 1ZBHA 5AQPA 3OYIA 4FVUA 3D2EA 1YVUA 3I56N 3LAKA 5KTQA 4DV4K 4DS5A 2CGJA 1RBUA 3CVRA 2HVIA 3R8EA 4QOZB 5CYQA 1WSIA 3BUIA 1OH7A 1T03A 4CZEA 1X04A 4H0OA 1ILYA 2C1IA 2RAKA 1VSEA 3D4YA 1I3AA 3OHRA 5KRTA 5FPDA 1SAZA 2PBDA 3NCIA 4GV6A 2P9IA 2W00A 4HR1B 4CHOA 2WOMA 1TVRA 2ZJQL 3QEIA 1XUPO 4YOUA 3D52A 1UPXA 1KAZA 5FPEA 4I43A 2AJQA 5AJ3K 1NGIA 2JGUA 3ZLJA 4DMNA 3VENA 1R0AA 3WUHA 3TU5A 3U3GA 4CD3A 3VF4A 4M3RA 2GUIA 4BR5A 2EWSA 3MX5A 3PY8A 4LF4K 3A5LC 4CGFA 4LSNA 3QEXA 2ZWHA 4FJ8A 2F18A 5AQIA 4DSEA 1TYQB 1UA1A 4CGDA 4LFBK 2WBNA 4H0VB 4DB3A 3MN5A 2ITGA 1E4GT 2IOCA 4DLEA 4CZLA 4U67L 2A42A 4AM7A 3O3NB 4IKFA 1BGXT 4FJIA 1D8YA 1NM1A 1U45A 3U3YA 3Q7CA 2D5RA 3HVRA 2QKWA 4KI4A 1YXQA 2XY8A 4FM1A 4RCHA 4BREA 4K8XA 4IW0A 4IFEA 3KLHA 2HHVA 2ZJRL 3S41A 3HAJA 3ATUA 4NCGA 4XEIA 2HBMA 4A5AA 3D51A 3J81O 1WSGA 4BE0A 1CLQA 1EO1A 1YHQN 1BA1A 3R3LA 3T47A 4CIGA 3AAPA 2F7OA 3U9ZA 2F1BA 2Q31A 3QFPA 2GTDA 3C7NA 5AQRA 3AARA 2R7YA 3WNHA 4BRPA 3B6PA 1TL3A 3LWLA 3ENBA 3MWPA 3OS1A 4JK9A 1NGHA 4H8SA 1SKSA 4O8UA 2V7YA 4DR3K 4J2BA 4N47A 3SBSA 1NGBA 4C1NK 2GWKA 2Q3SA 4IG3A 5LMNK 4KHUA 3NBPA 1JLFA 1C0FA 3HPHA 4BE2A 1Z05A 1Q9XA 3VEXA 3ERCC 4IJNA 3AAQA 3L2UA 3TAGA 3DRRA 2V51B 3VF2A 4KIKA 2BUPA 3AVFA 4CJ5A 3O9SA 2EFKA 1IKYA 1BPRA 1G99A 1D9FA 5C24A 3WXMB 3I2WA 4EZ9A 4DTRA 2F1AA 1L3VA 2QTDA 1C1CA 2B5JA 4OLAA 1IKXA 2B4JA 4NB4A 4AKVA 1NK6A 2Z8YA 1Z6RA 1W9MA 3GE1A 3QA8A 4BR9A 3NF9A 3ZEFA 4KTQA 1S9GA 4ELUA 1GLDG 3ZT0A 2RN2A 4H5NA 4IFVA 3D4ZA 1GLFO 3G4SN 3O08A 2X6SA 5JENA 2HNZA 2PY6A 1X1PA 3L4IA 3TTDA 2E6MA 3SBGA 3V9XA 3LDNA 4EIAA 5C10A 4QS8A 1U48A 1NGFA 3O9RA 4WFNL 5JICA 3G9GA 4BR2A 1VSMA 1FK9A 4BQZA 5AQXA 4E7JA 5D3GA 1L3SA 2P9NA 4FJGA 3RPMA 4LF8K 3RSEA 4FVMA 3HL8A 3H3OB 3ZX3A 2I5JA 3CYGA 4M3ZA 2RKIA 4X62K 3KAWA 3PX0A 3SAFA 4LF5K 4DFPA 4KV8A 3F7WA 4FLTA 3D7EO 1QVFM 3DLHA 1VQKN 2CH5A 4JKGA 5C5BB 4DTMA 5JS2A 3RWUA 2W40A 4IEEA 4X64K 3J7ZO 3DOLA 1KXPA 4JRPA 4CGGA 1BG3A 4FWNA 2P5OA 1Q81O 2IGIA 4HTLA 1HNWK 4KIKB 3FZLA 1T8EA 1NGAA 5BR8K 3VQ4A 4JWIA 3K59A 3VEAA 2QWMA 3WXLA 2HW3A 2HMIA 2PAVA 3T69A 4CF0A 3HAHA 5AZIA 2FBYA 2WONA 5AQMA 4JD2B 3DPOA 3LP0A 3AVBA 3AVAA 1B92A 3E01A 4ILIA 1S1TA 4AILC 4E1MA 3K5NA 2YIVX 4IEIA 1JL1A 4DTPA 3KWGA 1KSPA 4B9VA 1SV5A 1U04A 3NF8A 3P5JA 4W5TA 3RMCA 2IVOA 2FF6A 1IH7A 1V4TA 3DX4A 3FZFA 1HUXA 1NK4A 3P83D 4FL9A 4LC9B 5CZ2A 2WFBA 1HNVA 4BROA 3DYTA 3CHWA 4AZCB 3ZSWA 2ZQBA 4JHDA 4JN4A 3PX4A 4I2PA 1BOTO 5AZJA 1QSYA 3CD6N 3EJQA 4H5VA 3RRHA 3J7AP 4JS5A 1NLVA 2KTQA 3ZEUB 5EOYA 2Z0OA 2XO7A 3DLEA 3EE9A 3VQEA 3F2KA 5J2MA 4B3SK 4DSKA 3DX2A 4W5OA 2P9NB 3AO5A 4XH5A 2QKKA 4IDKA 3I04A 2PFUA 2PZSA 1HLUA 4Q0BA 3CJAA 1O7DC 4K25A 3TI0A 4R5IA 3O3GA 3K5LA 4CJSA 2AA4A 3EEQA 4DR7K 4CZHA 4JV5K 2Z1IA 2RAJA 1QS4A 2O4IA 4B3RK 4H0TB 2YV0X 2X78A 3OYHA 4AF1A 1GN9A 4CHNA 1LCUA 2E5LK 2XHBA 3LPUA 1NGGA 1L3TA 4Z0UA 1S1XA 4Z4HA 3A98A 1U2VB 3OYGA 4H5RA 1BO5O 1S22A 3B53X 1UA0A 3RMAA 4H6HA 3CC7N 2DPNA 3VMFB 2DTUA 3ZYYX 5AZIB 1QHTA 4OKKA 1HYZA 4MO4A 1TQVA 4JI5K 1CKRA 3FFIA 3HVTA 5LL6Z 5SZTA 3DX1A 2VWKA 1VQON 4FZZA 3ER9B 1EP4A 3L2QA 1NK9A 1RT6A 1XQSC 2N3KA 1W9HA 3TSPA 4BC3A 4E7LA 4GKJK 3BUPA 4JWCA 3DLLL 3O3OB 2E20A 5AQQA 4W5RA 4MLEA 5EVZA 4CW7B 4JKDA 4TSXA 1X3NA 3C7NB 1NK5A 1HTYA 3BUQA 5TKWA 3OK8A 3I55N 3SJHA 3MEDA 1HKCA 5AZJB 2F4VK 1EETA 4FO0A 3DRPA 1S72N 4IM0A 3CCJN 1BI4A 2VYPA 4CK1A 1LW2A 1VAZA 3UKRA 2A5XA 1C0UA 4A61A 2E2PA 1JL2A 1BL3A 3A5MC 5M1OA 3VA0A 4WFBL 5KI6A 2YI8A 5AQFA 1QWNA 1W97L 1JLQA 3VOVA 3C6UA 4AQYK 1T05A 4DCNC 4E7HA 4RWTA 1W0HA 2FXUA 4IZ9A 2HNYA 3PLTA 1SL1A 5J2PA 1I4TA 3KHYA 5AQGA 4W5QA 4B9UA 1IKVA 3CG7A 2CGKA 4EZWA 1YF5L 3ACOA 2P1JA 3V1QA 3O3MB 1LV5A 2GX9A 5GAHP 3LZJA 4B1YB 1TQTA 3DYAA 1NGDA 3H46O 3NE6A 1WSEA 3IUCA 3E9LA 1XI1A 4B9NA 3ZETA 5BRDA 3G10A 4DQIA 4PO2A 3O6WA 1RBVA 3VEOA 2PMRA 4BQLA 3R9PA 1SU6A 3CF5L 3F5TA 3SQ1A 3N4PA 4BRNA 4M63C 2ETJA 3EO3A 3RMBA 1NNEA 1LQ7A 4KAZA 1BCOA 1K73O 1TQWA 1JCFA 2WC9A 2YNFA 2XY5A 4DR5K 3PO5A 3WXKA 3ISNC 4DV0K 3M3ZA 4WE1A 4B08A 4BE7B 1RDUA 2QK9A 1KAYA 1CXQA 3MK6A 2UXCK 4B8AB 2A3ZA 3BVVA 4DG1A 1SUQA 4HUEA 5IWAK 1LWCA 1TUYA 4CJQA 4K43A 2OA8A 3LAMA 4DV6K 4WCEL 2KHOA 3LDLA 1VK0A 1N5YA 2OBLA 1EWQA 3QIOA 3RTVA 4RTFD 3CXCM 1VQ7N 4EZNA 4OO1J 1S9EA 2YNIA 3M8SA 2YLLA 1NGJA 4YHHK 1ZC6A 3ATVA 3UKRB 4CEDA 2OZMA 2BANA 2YJFA 2RHKA 4O5BA 4IFYA 3K58A 3LL3A 3C6AA 2HHTA 5FPNA 2ZJPL 3FZHA 4FJLA 4HWIA 4KBOA 3ZSYA 3WQUA 2ITMA 1GNTA 4ZTFA 2CH6A 3QNJA 4I6MA 4DCHA 2YHBA 4CF9A 3OYDA 4IBNA 3PLAA 3OYMA 2F9TA 4CJLA 3GI7A 1CZBA 4CHYA 2CGLA 3TAPA 3V9WA 2PYLA 3SQ0A 4JKHA 4CJWA 1ZBSA 3LDSA 4CK3A 1E3MA 3PIOL 4GMJB 4CZMA 3HYFA 3TAMA 4JD2A 2IAJA 4IG0A 1J5EK 4F3TA 1GLBG 3TSUA 1OA0A 3EZ5A 1BIUA 1VSLA 3NF6A 1FKOA 4B1ZA 4PL7A 3DOBA 3QICA 3WQTA 4K42A 2YIAA 2HF3A 3AO1A 4DSFA 1RCHA 3H6EA 3HSTB 1O1WA 5AR0A 4BNEA 3UKUA 3NH2A 2HBLA 4OGCA 5J2QA 1I4DA 4RW7A 4PKHA 1VQ4N 4YOYA 4CK2A 3LDOA 3P4IA 2O8FB 1QWUA 1HMVA 2B6AA 1A5VA 4OPJA 1RTDA 4AZCA 1C0GA 1QTMA 1S6PA 1B9DA 3HSCA 4JHDB 2KFNA 2WUSA 4LF9K 3FGUA 5J1EA 1SZ2A 1DT9A 3SPZA 4CECA 2HHXA 4FJXA 2VG6A 3THYA 3FZKA 4JI0K 4EZXA 4N56A 3BZCA 3NGIA 3TAFA 3AO2A 4F3OA 2OYQA 2LSNA 1WB9A 2E1YA 5LMUK 3VQ5A 5BR9A 3SUNA 4DWIA 3VPZA 4NLBA 4IWQA 3CJCA 2X74A 5CY4A 3MXIA 1TV6A 1NJZA 3V9SA 5DMRA 1K9MO 4CFCA 3HT3A 3L4QA 1U49A 1WOQA 4NQIA 1OVYA 3JXUA 3PV8A 4OPKA 3LMFA 5LY3A 5GINA 4DF4A 1HYVA 2P9SB 2F7TA 1RT1A 1U2VA 1Q82O 2QXLA 4BDPA 1GNLA 5E26A 3B8AX 1RBSA 4YOTA 4EP5A 4KRFA 1HJOA 1RTHA 3VETA 3AA5X 2ZE2A 3VA3A 5FRNA 4FJ9A 3VEZA 4LD0A 4DTNA 3OHXM 2FSNA 3M6GA 3E66A 1XHXA 4CJVA 2RT6A 2W41A 5C25A 4OLBA 2HB5A 4JNEA 3VQCA 4WYBA 3BF3A 1XMQK 1C6VA 3D2FB 3OYEA 4DSIA 4JKFA 4JWDA 3M3WA 5ADXH 1IG9A 4PL8A 5FDLA 3KLEA 2ELBA 1S1VA 2QWNA 4GV9A 3OTOK 3KK3A 3S5TA 3K0SA 1WSJA 3Q84A 3O3FA 3EJSA 4IOCL 1TGOA 2O8FA 4BRCA 2O4GA 4ID5A 5FLXO 4R5KA 5LJWA 1JLBA 1DKGD 2GELA 4CEZA 2IIRA 4JWEA 2C1GA 1P8ZA 2QWOA 3UE5A 1MU2A 5EX5A 3EY1A 1YAGA 2YI1A 5C2DA 2QWQA 4BR0A 4H8KA 4DQRA 2BE2A 4EZYA 4PKGA 3RV1A 1NJIO 2YIBA 1LOTB 3CCSN 4AZ7A 2G8FA 3MMVA 2YKTA 1KC8O 4CIEA 4DHYA 3BP8A 4KHPK 4CFBA 1VSFA 4B1VA 2O0I1 4AZ6A 4FM0A 1HXKA 4H0YB 1SS6A 2NRZA 3MN6A 1ASVA 4WQ5C 2YKNA 3M8PA 1XNRK 4CCHA 3BLBA 4AVMA 4EZVA 4R5PA 5CE3A 3O80A 1HNZK 1WUAA 4O8KA 3DPQA 3CCUN 2ZF5O 4FWOA 1WAJA 4CJ4A 2ZGYA 2I7NA 1Z26A 4O55A 3PX6A 5C2FA 4O0IA 1DTTA 4MDBA 1MA9B 3NH0A 3NH1A 4BRGA 3SJJA 3THXA 3GOIA 4ZHRA 2HBJA 3IMXA 1BDGA 2E2OA 1KLNA 3NGYA 2VG5A 1N34K 3EJRA 4KREA 1U47A 2FBTA 2VGNA 3OY9A 3AA2A 2Q0UA 1T6CA 2OP6A 3DOKA 4CEAA 2QEXN 2JNSA 2O8CA 2A41A 3QE6A 1KTQA 2JWLA 5J2NA 4C8LA 4IOXA 5DM6L 5FRMA 3AGRA 4KPYA 3AVKA 4BG8A 3MCAB 3MDQA 4M3YA 5AQKA 1VRUA 1BHLA 1QE1A 1R34A 1RTIA 1T44A 4MFBA 4QS7A 4DR6K 3KLIA 2P51A 4JKCA 4DQ8A 2BPRA 1VQ6N 3CCMN 4DU3A 2Y1JA 3I01A 1ZYQA 4Z4FA 4A5BA 3FR0A 1URUA 4IO9L 5BREA 4J2AA 4YDUC 1C1BA 1TKDA 1KQSM 4DR4K 3BZKA 3NDKA 5HP1A 3BDPA 4BRFA 3C6HA 1HR0K 1VQLN 1PS3A 3DLRA 3DLKA 1QQMA 1S1UA 1QQCA 3HOSA 5GIOA 3KJVA 1O7DB 4FM3A 4MDAA 3G6EN 4JLHA 4BC2A 4F9OA 4HCCA 4B1WB 2ASMA 1NK7A 3SPYA 3Q0KA 5AQOA 3QFUA 4UDYX 3AGKA 5FIGA 3ULEB 4G6QA 2HHIA 2W6KA 1OAOA 3OS0A 3QEVA 4CERA 1J54A 1UAXA 3K57A 3CPWM 3OVNA 2O8EB 4DTJA 3BEXA 5KPTA 1Q5LA 4FCYA 4H03B 4H4OA 3ZSOA 1X03A 1SUFA 4AHTA 3V4IA 4PUOA 2YL5A 4Y1CA 2Q1NA 3AVCA 3KTQA 2Q13A 1E4FT 5I42A 1YITN 1J53A 1V4SA 1T6DA 4CFDA 4KH4A 4Q5VA 4EZUA 3UKUB 3ZT1A 2G8KA 4JI8K 4CJUA 2D4WA 2O8CB 4JI3K 2VGMA 5FPMA 4JI2K 4OVLA 3VTIA 1FXXA 2XRIA 3VEVA 2GBZA 4FWMA 4M7YA 3KWIA 4FYDA 3SMPA 4BGBA 4M7XA 1D5AA 4E89A 4DFJA 1CZAN 4GY2B 4CGHA 2Z1GA 1HQUA 3DLBA 3MWTA 4C8OA 1ZBUA 3DRSA 3B52X 2Z0VA 4YY3K 1J9AA 2FBVA 1R33A 3UIQA 2GWJA 4BRMA 4CEFA 2BGGA 1ESVA 2V7ZA 2OTJN 4M3XA 1EQYA 3LM2A 1BUPA 3I8DA 2G8HA 4N76A 2Q2RA 4CJ3A 1Y97A 4IOAL 3JYTA 4E72A 4F01A 4HVJA 3P39A 5AQSA 3CQ8A 1XMOK 3OBWA 3PUFA 4WPCA 3QETA 4GNIA 4YOXA 1NWKA 3OJSA 4CIFA 4HR1A 5IT9O 2E1ZA 3ZSZA 1ZBFA 1LAWA 2IS3A 2A1RA 3OWGA 5CHIA 3F9MA 2LXYA 2PYJA 5DM7L 3QNIA 3H0XA 5F0XA 5JMVA 1A5WA 4DUYK 4XJXA 5CR4A 3Q7BA 1RTJA 3ALYA 2WTUA 2QI2A 2KKZA 1RT3A 3I39X 3CI5A 4DQPA 3NMUA 4ILJA 3MXMA 1HJRA 1F21A 1YJ9N 3O4NA 2V0OA 4JKGB 3TR8A 4CJEA 1VSDA 3ZEDA 4KKOA 3VN5A 2MI7A 4HUFA 3L0QA 4DV3K 3TPQA 5JLFA 3F73A 3DM2A 1U00A 1RT4A 2HSTA 5AQWA 3BUBA 3T1HK 2YL9A 4CEQA 2F9WA 4Z4CA 1EWRA 4AZGA 3CFPA 3L3OM 2OPQA 4KH5A 3CQXA 1RT7A 2D1KA 3CV5A 4EP4A 3CC4N 1HQEA 4KO0A 3J7YP 1P90A 2C08A 1WLJA 2FICA 1IBMK 3CFRA 3HP6A 3SQ4A 4FK4A 4ISFA 5GIPA 4YFUA 3SBTB 2O8DB 1TL1A 3T19A 1XNQK 1L3UA 3EZWA 1ASWA 4CI6A 4WQ4C 3LZIA 3WXIA 5AQUA 2OANA 3DWLA 3TABA 3EKSA 2XY6A 1I49A 4R5GA 3IRXA 4NXMK 1QSSA 1RFQA 3RRGA 1RT2A 3KK1A 3EJPA 2H3GX 3MN7A 3QERA 3SCXA 2P9LA 1HNIA 4MLHA 4WPEA 4OPAA 1YIJN 4QCLA 3SYVA 4ID1A 3ZEUA 4FZXC 3V1OA 4FK2A 2D0CA 3O9QA 4JAXA 4DR2K 3KDRA 5CZ1A 4J8FA 1KD1O 2JWKA 4CESA 4FWLA 2EFLA 1ATNA 4FWSA 1Y2OA 2NZTA 1S5JA 2YL6A 4K8ZA 5M1PA 4AHVA 3ER8C 4CEEA 4MQDA 4CJRA 3IDHA 3O9UA 3BUDA 3LP2A 3DQGA 2P5GA 1KCFA 2VWBA 2YCHA 3QESA 7HSCA 4BRLA 3O4WA 3VQ9A 3CFOA 4AZHA 4A57A 1OH6A 2QA4N 3A2FA 4OKEA 3SK3A 1H1VA 4QAGA 1A5XA 2HOEA 4H4MA 4FPAA 4FJKA 2NRRA 4WF9L 1DGKN 4ISEA 4ATMA 2KW4A 3MECA 4FLYA 2OZNB 4AZIA 4FJ5A 4D8JA 3AA4A 4LY7A 3V6DA 4FM2A 1KRPA 2DY4A 4AHUA 3OYFA 4E0DA 2NLXA 2ND0A 1VSJA 4AHSA 4JNFA 2OO2A 4FZOA 3ID8A 3UB5A 3D2EB 3AO4A 3V9ZA 3QLHA 3QEWA 4CFAA 1TK5A 3EL2A 1NOYA 5HBMA 4CGJA 2UXBK 4YNQA 3VEWA 3A0IX 1C0MA 5I9EB 5EY4A 2E2QA 1N36K 3LLLA 2NRVA 1WBDA 1ZWWA 1DEJA 3VESA 3SQ2A 2OW7A 4KHSA 1SL2A 1QVGM 3VQ7A 3ZX0A 1N33K 3BVXA 2VG7A 4DUZK 2ATQA 4CHZA 1RDWX 2E4LA 1VQNN 3IKMA 3T46A 3CCVN 2YNHA 1U4BA 1BI4B 3QNOA 2LM0A 1EX4A 2YHXA 3FFKB 4EAHD 1QSLA 1I94K 3VQDA 4BWMA 2HF4A 1NBWA 3I0SA 3THVA 4F4KA 5EXWA 4FJNA 3S3NA 5C12A 3MCPA 2ZXQA 5BN9A 3LANA 4O44A 3P31A 3AY9A 4C1NI 3D45A 3AVNA 1BQMA 3DI6A 3R1XA 2OCEA 3C0BA 1MJGA 4A62A 3ZX2A 5BN8A 3EYZA 3TAEA 3EJUA 1Q18A 1JCEA 2G8WA 5E41A 4JS4A 2HHHK 3HPOA 3IG1A 3DX3A 1GLJO 1S3XA 4JLCA 3T1AA 4L3QA 4WV5A 4BDYA 2XY7A 4OKJA 3VQ6A 5I3UA 1SKRA 3AVGA 3OYCA 3NAEA 4H6IA 1RBTA 3CCLN 3DXMA 3FLCO 1N6QA 4Z4IA 2JNKA 4A2AA 2ALWA 4HHTA 4DU1A 1TAQA 2UUAK 1EKEA 5KGXA 1JLGA 2JLEA 4E19A 4ISGA 4KI6A 3HRGA 4F00A 2E2NA 1BWFO 4A59A 5AQJA 5AQHA 5KQDA 3CJBA 1K8AO 1RDAA 2QKBA 1MWMA 2EWFA 5M1FA 4EFHA 3PO4A 4M3WA 3VQQA 4WQ5A 3CERA 1OKJA 4FJ7A 1TKTA 4JI4K 4NXNK 4FW2A 4IM3A 4G9ZA 3SYZA 4FZSA 3BGRA 4FLXA 3KD5E 3HI0A 3CQYA 2BH1A 1Q8IA 2QW9A 5LJVA 3QDKA 4Y0WA 1VSHA 2ZM6K 2YKMA 3AA3A 4XH1A 1RT5A 3N8EA 1JQKA 1TAUA 1LAVA 1G15A 5KPZA 2NRXA 3W3DA 4I6MB 4M45A 3JSMA 3LPTA 1BU6O 1VQMN 4X66K 4IDHA 2P9UA 3O9TA 1X9MA 3ZSXA 5AQTA 4N5SA 4K0KK 3KLGA 2F7QA 3NHGA 3CJ9A 2QXFA 2EX3B 4DS4A 2X3XA 4Z94A 1TQSA 4C8MA 1BCMA 5K14A 4LH4A 3T1YK 2D0BA 1NJXA 2O8DA 1ATRA 3VQPA 4PKIA 2FSJA 3M8RA 3KVGA 4BRHA 1WSFA 5C15A 3MN9A 1XC9A 1X3MA 2X3WA 4EZTA 5HRNA 1K6YA 1E2UA 4X65K 3E9PA 4E7KA 1OA1A 2NRWA 4H0PA 1X9SA 1NK0A 2VWJA 3HPGA 4OGEA 3FD9A 5FROA 4CVNE 3VGMA 5EU7A 1L5UA 5B8HA 4E81A 2J4RA 4CJFA 4DTOA 1MDUB 2IVNA 3B51X 2YNGA 4B3MK 2D0AA 4EHUA 3QB0A 1TKZA 3P38A 3VQBA 3DPPA 4FLWA 3RSEB 1M90O 4AHRA 4BACA 2Q36A 4BG9A 4GVMA 4EZ6A 3H1QA 3HM8A 1VQPN 3LDPA 4F2RA 2W6LA 4DV5K 1YT3A 1GLCG 4FWKA 3WEEB 3AVMA 2KZMA 1TUUA 1E1DA 4C8KA 4IWPA 2E6LA 1UOCA 3T3FA 5C5BA 3NF7A 2IVPA 4LH5A 3A5NC 4CBXA 3O1BA 1J6ZA 4A2BA 1R59O 5HL7L 3ZT4A 3AVHA 2P9UB 3BVWA 1QQOA 3SUPA 1WBBA 3ZETB 3C95A 4EZQA 4CBUA 5JS1A 1HX1A 1QX1A 4CF2A 1I4LA 3A5OC 4NLCA 2GUPA 3VTHA 2W42A 2EX3A 3QEPA 4FZYA 3ZSVA 1YUWA 2IC3A 1HYSA 3MEGA 4CF8A 3HJFA 4WV7A 4I2QA 1I39A 3D2FA 5HOOA 4GV3A 4NCAA 1LW0A 3BUZB 2YJEA 3S9HA 1GLEG 2NRHA 5HRSA 3SV4A 4BC4A 2VCPA 4M42A 4BY9C 3ZSQA 4CZIA 3QBXA 2YHAA 3GL1A 3ASMA 5F2RA 1ITGA 1NMDA 1KLMA 5BRFA 1DG4A 3IAYA 1U6ZA 4E1JA 2Q12A 4DYLA 3K9KA 4FLVA 1ZBLA 2YL8A 2ZGZA 1JXBA 2WINM 4CE9A 3LWMA 3EJTA 4DF8A 4JI6K 2E8AA 4ZTJA 1KVBA 3ID6A 4DV7K 3VGLA 1SKWA 3NFAA 4E3CA 1W7AA 2FF3B 4BEBA 3EE8A 5KQ8A 4FWQA 4M41A 4BRIA 4HTUA 4U7BA 3WEEA 3TAQA 5GADP 1XWLA 4ELVA 4KHNA 2I7PA 3G0ZA 4OX9K 4O5FA 2GEMA 3SZ2A 4FJMA 1IKWA 3V81A 1WDZA 4I9LA 1TK8A 1VSIA 4NYFA 2OTLN 3M8QA 3CKDA 4FK0A 4BRAA 2P9KB 3SV3A 4AM6A 3KAVA 1IBKK 4B8CA 4IXCA 3HAIA 2QWRA 4GW6A 3VERA 4EHTA 4J2DA 4PWDA 4JKEA 1CXUA 4M0MA
chains in the Genus database with same CATH topology
2D1KA 3OA9A 3N4PA 4MO5A 4M63C 4BRNA 3EO3A 3CC4N 3NMUA 1K73O 4EZZA 1P90A 1JCFA 2WC9A 3TSQA 4ISFA 5GIPA 3I33A 3SBTB 3WXKA 1O13A 2E88A 3M3ZA 4GVEA 3HTVA 5JVHL 3QBWA 5AQPA 4BE7B 1RDUA 3EZWA 4FVUA 1KAYA 3MK6A 4CI6A 3D2EA 3JS6A 1DKYA 4WQ4C 2A3ZA 3I56N 2CGJA 3R8EA 1TUYA 2YHYA 4K43A 3WXIA 4CD1A 5AQUA 2OANA 3WT0A 4WCEL 2KHOA 3DWLA 3OW2M 3LDLA 3EKSA 4CZEA 4R5GA 2OBLA 4H0OA 3VF6A 5ELZA 1ILYA 2C1IA 5AFUA 4IJAA 4QS9A 4RTFD 4YDUA 2YX6A 1RFQA 4KH6A 4EZNA 5M1NA 3CXCM 1VQ7N 4OO1J 3U8XA 3OHRA 2H3GX 2HBKA 3H3NO 1NGJA 1QZ5A 2NRTA 3MN7A 1ZC6A 2P9LA 3ATVA 1SAZA 4FWPA 2PBDA 3UKRB 4CJ7A 1X9JA 5FPDA 3VEBA 1IJJA 2P9IA 3H45C 4HR1B 4GV6A 4MLHA 4OPAA 2W00A 1YIJN 2YJFA 2RHKA 3ZEUA 4OPHA 3LL3A 2ZJQL 3C6AA 3O9QA 4JAXA 1XUPO 3FZHA 3KDRA 5FPNA 4YOUA 2ZJPL 4HWIA 4KBOA 4J8FA 1UPXA 1KD1O 4IM2A 3WQUA 1KAZA 5FPEA 4I43A 1GNTA 2P9SA 2ITMA 2JWKA 3TTCA 3VEYA 1NGIA 2CH6A 3QNJA 4FWLA 2BTFA 3CMAN 4I6MA 4DCHA 3VENA 4K41A 3C65A 3PLAA 4FPBA 3TU5A 3WUHA 4CD3A 3VF4A 1ATNA 4FWSA 2F9TA 2NZTA 2GAFD 3GI7A 3O1WA 4BR5A 2EWSA 2CGLA 3MX5A 4R79A 4CZFA 1Q86O 4JKHA 3A5LC 5M1PA 3ER8C 2P9KA 2ZWHA 1ZBSA 4MQDA 3IDHA 5AQIA 2ND1A 3O9UA 4R5LA 1TYQB 3PIOL 3DQGA 4CZMA 2WBNA 4H0VB 4DB3A 4JD2A 2VWBA 2YCHA 1GLBG 7HSCA 4BRLA 3O4WA 3TSUA 2A40A 3MN5A 1OA0A 2GA9D 1E4GT 4A57A 4CZLA 2QA4N 4B1ZA 4U67L 3SK3A 4PL7A 3DOBA 2A42A 1H1VA 1HKBA 3O3NB 2HOEA 4FPAA 2NRRA 4AM7A 3QICA 1DGKN 4ISEA 4K42A 3WQTA 4WF9L 2YIAA 2HF3A 1JCGA 3H6EA 5FLEX 5AR0A 3UKUA 4D8JA 1NM1A 2HBLA 4BECA 5ADXA 3ENOA 1VQ4N 2ASOA 4PKHA 4YOYA 3LDOA 3P4IA 2NLXA 2ND0A 3Q7CA 4JNFA 4FSVA 1YXQA 3WXJA 1C0GA 1NGCA 1SU8A 3ID8A 3UB5A 4RCHA 3D2EB 3HSCA 4JHDB 3U4LA 4BREA 2WUSA 4JK7A 3FGUA 3PIPL 3EL2A 1SZ2A 4IW0A 2Q0RA 3LDQA 5GAGP 1DT9A 4IFEA 1YJWN 2ZJRL 3S41A 3ATUA 3VEWA 2Q97A 3A0IX 4XEIA 2HBMA 4A5AA 4B1UB 5I9EB 5EY4A 1VQ9N 2E2QA 2D0PA 1NJIO 2NRVA 1EO1A 1DEJA 3VESA 1YHQN 1BA1A 3FZKA 3R3LA 3T47A 5C0YA 4CZHA 3AAPA 4EZXA 3U9ZA 1MWKA 2Q31A 3QFPA 1QVGM 2GTDA 3C7NA 5AQRA 3ZX0A 3AARA 2E1YA 4BRPA 2P9PB 5BR9A 3VPZA 3ENBA 4HY9A 4IWQA 3CJCA 3MWPA 4NLBA 5F1XA 1RDWX 2QFFA 4JK9A 2RE2A 3KK7A 1NGHA 1K8KB 1VQNN 3IKMA 3T46A 4O8UA 3CCVN 1K9MO 2LM0A 2V7YA 2YHXA 3FFKB 4EAHD 3L4QA 3CJ7A 1WOQA 3SBSA 1NGBA 1OVYA 3JXUA 2HF4A 3LMFA 1NBWA 5LY3A 4H5TA 4C1NK 5GINA 2P9SB 2GWKA 2F7TA 4JKBA 5GAEP 3GBTA 3DXKA 5EXWA 1GLAG 4KH5A 5C12A 1C0FA 1U2VA 1Q82O 1D4XA 2QXLA 3NVKA 1GNLA 1Z05A 5E26A 3B8AX 5E84A 5AFUH 3VEXA 1XC3A 4NPHA 3MCPA 3ERCC 4YOTA 4IJNA 5BN9A 1HJOA 3AAQA 4BR7A 3VETA 3P31A 2V51B 3VEZA 3AY9A 4C1NI 4BRDA 3VF2A 5H1SQ 3OHXM 2FSNA 3E66A 3HZ6A 3M6GA 4KIKA 3C0BA 3R1XA 2RT6A 2W41A 1MJGA 2BUPA 4A62A 3ZX2A 4JNEA 5JLHA 3O9SA 4WYBA 5BN8A 3UITA 3CPEA 3BF3A 1Q18A 1JCEA 3D2FB 1BPRA 4JKFA 1G99A 4JWDA 5ADXH 2NCZA 4ILGA 4PL8A 3WXMB 5MLCQ 1GLJO 4FOIA 2QTDA 1S3XA 4JLCA 4L3QA 4WV5A 4CZJA 4NB4A 2QWNA 4GV9A 4WFAL 1Z6RA 2Z8YA 1W9MA 1IG8A 3GE1A 1N8RO 3QA8A 4BR9A 4IOCL 4H6IA 4BRCA 3ZEFA 1SQKA 3DXMA 3FE1A 3FLCO 3LM9A 3CCLN 4R5KA 5LJWA 1GLDG 3HOTA 3GG4A 1DKGD 2GELA 2IIRA 4H5NA 4JWEA 1GLFO 2C1GA 1P8ZA 2QWOA 3UE5A 4A2AA 3K9JA 5EX5A 3O08A 1YAGA 3G4SN 3I8BA 2YI1A 4XH4A 5C2DA 4ISGA 2QWQA 1SU7A 2QWLA 3HRGA 4F00A 4BR0A 2E2NA 2PY6A 1BWFO 3L4IA 4A59A 3TTDA 4EZYA 4JKAA 4PKGA 5AQJA 4YORA 3RV1A 5AQHA 3SBGA 3LDNA 4EIAA 2YIBA 1LOTB 5C10A 4QS8A 5KQDA 3CCSN 3CJBA 3MMVA 1YVNA 1KC8O 1K8AO 1NGFA 3O9RA 4DHYA 3BP8A 1MWMA 4WFNL 5JICA 2EWFA 5M1FA 4EFHA 4BR2A 4B1VA 3MX2A 4H0YB 1SS6A 4NO7A 1HPMA 5AQXA 2NRZA 3MN6A 4BQZA 4WQ5A 2P9NA 3CERA 1OKJA 4WQ5C 3CCQN 3RSEA 5M1QA 1K8KA 3H3OB 4EZVA 4IM3A 3O80A 5CE3A 1WUAA 4O8KA 4G9ZA 3ZX3A 3DPQA 3CCUN 3SAHA 2ZF5O 4FWOA 3NVMA 2ZGYA 3KAWA 2P9LB 3HI0A 3CQYA 1HKGA 2I7NA 4UY8O 2BH1A 3SAFA 5LJVA 2QW9A 3ULEA 3QDKA 3F7WA 4Y0WA 4ILHB 3SLCA 3D7EO 1QVFM 2V52B 4CBWA 5C2FA 1VQKN 2CH5A 4JKGA 4MDBA 3EKUA 4XH1A 1MA9B 1RGIA 3N8EA 1JQKA 4BRGA 4C23A 3EN9A 5KPRA 2W40A 3KZBA 3GOIA 4IEEA 5KPZA 3J7ZO 2HBJA 1KXPA 1ZYLA 3IMXA 3M1FA 2NRXA 3W3DA 1QQNA 4BRKA 4I6MB 1BDGA 3G25A 2E2OA 1BU6O 1VQMN 1BG3A 4FWNA 1Q81O 3T49A 4HTLA 4IDHA 2QM1A 4KIKB 3FZLA 2P9UA 3O9TA 4DKWA 2VGNA 1NGAA 2Q0UA 5AQVA 4JWIA 1T6CA 2OP6A 5AQTA 3VEAA 2QWMA 2QEXN 3WXLA 2JNSA 3CJ9A 2PAVA 2EX3B 3T69A 4Z94A 2A41A 5AZIA 4ILGB 1Q7YO 2JWLA 4HYBA 5AQMA 1QZ6A 4JD2B 3DPOA 4IOXA 1ATRA 1BA0A 4JEPA 5DM6L 3AGRA 4PKIA 2FSJA 4ILIA 3KVGA 4BG8A 4BRHA 3MCAB 3MDQA 5C15A 3MN9A 5AQKA 1X3MA 4EZTA 1T44A 4QS7A 1E2UA 3E9PA 2YIVX 4IEIA 1OA1A 3U9DA 2NRWA 5AQZA 3CCRN 3G71N 3KWGA 4H0PA 4JKCA 3RVCA 4DQ8A 4JK8A 2BPRA 2IVOA 2FF6A 1V4TA 3FZFA 3CCMN 1VQ6N 1HUXA 3I01A 4FL9A 4LC9B 2YHWA 4A5BA 3FR0A 4IO9L 2WFBA 5BREA 4YDUC 3FD9A 4BROA 3VGMA 3CHWA 4JL9A 5B8HA 1YI2N 1KQSM 4E81A 2J4RA 2HMPA 1DKZA 4R5JA 4JHDA 4BRFA 4JN4A 1MDUB 1BOTO 2IVNA 5AZJA 3CD6N 3B51X 4H5VA 3C6HA 1VQLN 5BPNA 2A6AA 1NLVA 4IWVA 3ZEUB 4EHUA 5BRHA 3QB0A 5EOYA 3EE9A 3F2KA 1QQMA 5AQYA 2AP1A 3P38A 3DPPA 2P9NB 4FOEA 3RSEB 1M90O 2Q36A 3HOSA 4XH5A 4BG9A 5GIOA 4FM3A 4EZOA 2OBMA 3H1QA 3I04A 4MDAA 3G6EN 2PFUA 3HM8A 4BC2A 4F9OA 1VQPN 2YI9A 3BF1A 4B1WB 2ASMA 1HLUA 3LDPA 3CJAA 4K25A 4R5IA 5AQOA 3QFUA 2AA4A 1GLCG 4UDYX 1KAXA 3AGKA 3CIPA 4FWKA 5FIGA 4EZPA 4IO8A 3WEEB 3ULEB 3SAGA 4FWRA 4G6QA 1TUUA 1OAOA 4H0TB 1E1DA 4H0XB 4ILHA 4B1XB 4BC5A 4IWPA 3CC2N 3CPWM 4AF1A 1GN9A 3BEXA 5KPTA 2IVPA 1LCUA 1Q5LA 3VGKA 4YOWA 3A5NC 4H03B 3CMEN 4CBXA 1SUFA 1NGGA 3O1BA 3T7ZA 1J6ZA 3TTFA 5BPLA 4YOVA 4A2BA 1R59O 3A98A 1GLLO 1U2VB 2Q1NA 5HL7L 4H5RA 1BO5O 3ENHA 2P9UB 1E4FT 1QQOA 1YITN 1S22A 3B53X 1T6DA 1V4SA 4BRQA 3M5RA 4H6HA 3ZETB 4EZQA 4CBUA 3CC7N 1HX1A 1Y64A 4KH4A 2DPNA 4EZUA 3A5OC 4NLCA 1NGEA 2GUPA 3UKUB 3VMFB 3O5BA 3VTHA 4WQ4A 3GDQA 3FZMA 3HBTA 2D4WA 5BPMA 3L6QA 3ZYYX 2VGMA 5AZIB 5FPMA 4MO4A 3CETA 3VTIA 1YUWA 1CKRA 3VEVA 4UDXX 3T48A 3D6RA 4FWMA 4WV7A 3DJCA 1VQON 4M7YA 3ER9B 2QWPA 3D2FA 3O8MA 5HOOA 3KWIA 4GV3A 3SMPA 4BGBA 2D0OA 5TKYA 3SMSA 1XQSC 2N3KA 3BUZB 4M7XA 3TSPA 3SBTA 2YJEA 4BGAA 1GLEG 2NRHA 4BC3A 1CZAN 4GY2B 4JWCA 2NNWA 4BC4A 3DLLL 3O3OB 3MWTA 2VCPA 1YJNN 4BY9C 3B52X 2E20A 5AQQA 4CZIA 3QBXA 5AQNA 4MLEA 2FSKA 5EVZA 3E1YA 4JKDA 2GWJA 4BRMA 3DXMB 1X3NA 3C7NB 1ESVA 4IWOA 2V7ZA 3GL1A 4CZGA 2OTJN 5F2RA 1EQYA 3RV0A 2P9PA 1ATSA 1NMDA 1BUPA 3LM2A 5AQLA 5TKWA 5M1KA 5BRFA 3I55N 1DG4A 3SJHA 1HKCA 1U6ZA 5AZJB 4E1JA 3QMLA 2Q2RA 3CJ1A 4FO0A 1S72N 4IM0A 3K9KA 4IOAL 3CCJN 1M1KO 4F01A 2ZGZA 2VYPA 2WINM 3P39A 1QHAA 5AQSA 1E9VA 3OBWA 2E8AA 4GNIA 4CZKA 4YOXA 3ID6A 1NWKA 3T4AG 3VGLA 1VAZA 3UKRA 4E3CA 3E9OA 2P9IB 4BVOA 4HR1A 1W2BM 2A5XA 2E1ZA 2FF3B 4A61A 2E2PA 3EE8A 3VKHA 3DXKB 4B9QA 4BEBA 5M1OA 3A5MC 3OWGA 5CHIA 5KQ8A 4FWQA 2X5CA 4BRIA 3W0LA 4WFBL 1DKXA 4EZSA 3F9MA 3H1VX 4U7BA 1T3VA 2YI8A 3WEEA 5AQFA 1W97L 5GADP 3VOVA 5DM7L 1JJ2M 3H0XA 2I7PA 5F0XA 5JMVA 1VQ5N 3J8AA 4RWTA 4O5FA 4BVPA 4IZ9A 2FXUA 2GEMA 4XJXA 3N4QA 3Q7BA 3IFRA 3OBYA 5CR4A 4BR4A 2QI2A 1ZXOA 2KKZA 2OTLN 2UYTA 3I39X 3KHYA 5AQGA 3CI5A 2CGKA 4EZWA 4ILJA 4PHTX 4EZRA 1YF5L 4BRAA 3O3MB 2P9KB 4JKGB 1YJ9N 2GX9A 5GAHP 1VQ8N 3CCEN 3ZEDA 4AM6A 4B1YB 2FLOA 3KAVA 1NGDA 1TYQA 3H46O 3IUCA 3L0QA 3E9LA 3TPQA 3R6MA 5JLFA 5JVGL 1U00A 3A8YA 3DAWA 2HSTA 3ZETA 5AQWA 5BRDA 4IXCA 2KLAA 2QWRA 2ASPA 4PO2A 2F9WA 3O6WA 3VERA 3VEOA 4EHTA 4BQLA 3R9PA 1SU6A 3L3OM 3F5TA 4H5WA 4JKEA 3CF5L 3CQXA 4M0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D1K A;  4MO5 A;  4M63 C;  4BRN A;  3EO3 A;  4EZZ A;  1JCF A;  4ISF A;  3I33 A;  3WXK A;  2E88 A;  3M3Z A;  3HTV A;  3QBW A;  5AQP A;  3EZW A;  1KAY A;  3MK6 A;  4CI6 A;  3D2E A;  3JS6 A;  1DKY A;  4WQ4 C;  2A3Z A;  2CGJ A;  3R8E A;  1TUY A;  2YHY A;  4K43 A;  3WXI A;  4CD1 A;  5AQU A;  2OAN A;  3WT0 A;  2KHO A;  3DWL A;  3LDL A;  3EKS A;  4CZE A;  4R5G A;  4H0O A;  3VF6 A;  5ELZ A;  5AFU A;  4IJA A;  4QS9 A;  4RTF D;  4YDU A;  1RFQ A;  4EZN A;  3U8X A;  3OHR A;  2H3G X;  3MN7 A;  3H3N O;  1NGJ A;  1QZ5 A;  4XH4 A;  1ZC6 A;  2P9L A;  3ATV A;  1SAZ A;  4FWP A;  2PBD A;  3UKR B;  4CJ7 A;  1X9J A;  5FPD A;  1IJJ A;  2P9I A;  3H45 C;  4MLH A;  2YJF A;  3ZEU A;  3LL3 A;  5FPN A;  4JAX A;  1XUP O;  3FZH A;  4HWI A;  4KBO A;  4J8F A;  3WQU A;  1KAZ A;  5FPE A;  2ITM A;  2P9S A;  3VEY A;  1NGI A;  2CH6 A;  3QNJ A;  4FWL A;  2BTF A;  4I6M A;  4DCH A;  3VEN A;  4K41 A;  4FPB A;  3TU5 A;  3WUH A;  4CD3 A;  3VF4 A;  1ATN A;  4FWS A;  2F9T A;  2NZT A;  3O1W A;  4BR5 A;  2EWS A;  2CGL A;  4CZF A;  3A5L C;  2P9K A;  2ZWH A;  1ZBS A;  3IDH A;  5AQI A;  4R5L A;  1TYQ B;  3DQG A;  4CZM A;  4H0V B;  4DB3 A;  4JD2 A;  2VWB A;  2YCH A;  1GLB G;  7HSC A;  4BRL A;  3O4W A;  2A40 A;  3MN5 A;  1E4G T;  4CZL A;  4B1Z A;  3SK3 A;  4PL7 A;  3DOB A;  1H1V A;  1HKB A;  2A42 A;  2HOE A;  4FPA A;  4AM7 A;  3QIC A;  1DGK N;  4ISE A;  4K42 A;  3WQT A;  2HF3 A;  1JCG A;  3H6E A;  5AR0 A;  3UKU A;  1NM1 A;  5ADX A;  3ENO A;  2ASO A;  4PKH A;  3LDO A;  3P4I A;  2NLX A;  4JNF A;  4FSV A;  1YXQ A;  3WXJ A;  1C0G A;  1NGC A;  3ID8 A;  3UB5 A;  4RCH A;  3D2E B;  3HSC A;  4JHD B;  3U4L A;  4BRE A;  2WUS A;  3FGU A;  3EL2 A;  1SZ2 A;  2Q0R A;  3LDQ A;  3S41 A;  3ATU A;  3VEW A;  2Q97 A;  3A0I X;  4XEI A;  4B1U B;  5I9E B;  5EY4 A;  2E2Q A;  2D0P A;  1DEJ A;  3VES A;  1BA1 A;  3FZK A;  3T47 A;  3AAP A;  4EZX A;  3U9Z A;  1MWK A;  2Q31 A;  3QFP A;  2GTD A;  3C7N A;  5AQR A;  3ZX0 A;  3AAR A;  2E1Y A;  4BRP A;  2P9P B;  5BR9 A;  3VPZ A;  4HY9 A;  3CJC A;  5F1X A;  1RDW X;  2QFF A;  1NGH A;  1K8K B;  3T46 A;  2V7Y A;  2YHX A;  3FFK B;  4EAH D;  3CJ7 A;  1WOQ A;  1NGB A;  3JXU A;  2HF4 A;  1NBW A;  5LY3 A;  4H5T A;  2P9S B;  2GWK A;  3GBT A;  3DXK A;  5EXW A;  1GLA G;  1C0F A;  1U2V A;  1D4X A;  2QXL A;  1Z05 A;  5E26 A;  3B8A X;  5E84 A;  5AFU H;  3VEX A;  1XC3 A;  3MCP A;  4IJN A;  5BN9 A;  1HJO A;  3AAQ A;  4BR7 A;  3VET A;  2V51 B;  3VEZ A;  3AY9 A;  4BRD A;  3VF2 A;  3OHX M;  2FSN A;  3HZ6 A;  3M6G A;  3C0B A;  2W41 A;  2BUP A;  4A62 A;  3ZX2 A;  4JNE A;  5JLH A;  4WYB A;  5BN8 A;  3BF3 A;  1Q18 A;  1JCE A;  3D2F B;  1BPR A;  1G99 A;  4JWD A;  5ADX H;  4PL8 A;  1GLJ O;  4FOI A;  1S3X A;  4L3Q A;  4WV5 A;  4CZJ A;  4NB4 A;  2QWN A;  1Z6R A;  3GE1 A;  1IG8 A;  4BR9 A;  4H6I A;  4BRC A;  1SQK A;  3FE1 A;  3DXM A;  3FLC O;  3LM9 A;  4R5K A;  5LJW A;  1GLD G;  3GG4 A;  1DKG D;  2GEL A;  2IIR A;  4H5N A;  4JWE A;  1GLF O;  1P8Z A;  2QWO A;  3UE5 A;  4A2A A;  5EX5 A;  3O08 A;  1YAG A;  3I8B A;  2YI1 A;  4ISG A;  2QWQ A;  2QWL A;  4F00 A;  4BR0 A;  2E2N A;  1BWF O;  3L4I A;  4EZY A;  5AQJ A;  4PKG A;  5AQH A;  3LDN A;  4EIA A;  5KQD A;  1LOT B;  4QS8 A;  3CJB A;  3MMV A;  1YVN A;  1NGF A;  4DHY A;  3BP8 A;  1MWM A;  5JIC A;  4EFH A;  4BR2 A;  4B1V A;  4H0Y B;  4NO7 A;  1HPM A;  5AQX A;  3MN6 A;  4BQZ A;  4WQ5 A;  2P9N A;  3CER A;  1OKJ A;  4WQ5 C;  3RSE A;  1K8K A;  3H3O B;  4EZV A;  5CE3 A;  3O80 A;  1WUA A;  4O8K A;  3ZX3 A;  3DPQ A;  2ZF5 O;  4FWO A;  2ZGY A;  2P9L B;  3HI0 A;  3CQY A;  1HKG A;  2I7N A;  5LJV A;  2QW9 A;  3ULE A;  3QDK A;  4Y0W A;  3SLC A;  3D7E O;  2V52 B;  4CBW A;  2CH5 A;  4XH1 A;  3EKU A;  5KPR A;  1MA9 B;  1RGI A;  3N8E A;  4BRG A;  4C23 A;  3EN9 A;  2W40 A;  3KZB A;  3GOI A;  5KPZ A;  1KXP A;  3IMX A;  3M1F A;  3W3D A;  1QQN A;  4BRK A;  4I6M B;  1BDG A;  3G25 A;  2E2O A;  1BU6 O;  1BG3 A;  4FWN A;  3T49 A;  4HTL A;  2QM1 A;  3FZL A;  2P9U A;  1NGA A;  2Q0U A;  5AQV A;  4JWI A;  1T6C A;  2OP6 A;  5AQT A;  2QWM A;  3WXL A;  3CJ9 A;  2PAV A;  4Z94 A;  2A41 A;  5AZI A;  4HYB A;  5AQM A;  1QZ6 A;  4JD2 B;  3DPO A;  1ATR A;  1BA0 A;  4PKI A;  2FSJ A;  3KVG A;  4BG8 A;  4BRH A;  3MDQ A;  3MN9 A;  5AQK A;  1X3M A;  4EZT A;  1T44 A;  4QS7 A;  3U9D A;  5AQZ A;  4H0P A;  4DQ8 A;  2BPR A;  2IVO A;  2FF6 A;  1V4T A;  3FZF A;  1HUX A;  4FL9 A;  4LC9 B;  2YHW A;  3FR0 A;  5BRE A;  4YDU C;  4BRO A;  3VGM A;  3CHW A;  5B8H A;  4E81 A;  2J4R A;  2HMP A;  1DKZ A;  4R5J A;  4JHD A;  4BRF A;  4JN4 A;  1MDU B;  1BOT O;  2IVN A;  5AZJ A;  4H5V A;  5BPN A;  2A6A A;  1NLV A;  4IWV A;  3ZEU B;  4EHU A;  5BRH A;  3QB0 A;  5EOY A;  1QQM A;  5AQY A;  2AP1 A;  3DPP A;  2P9N B;  4FOE A;  3RSE B;  2Q36 A;  4XH5 A;  4BG9 A;  4EZO A;  3H1Q A;  3HM8 A;  4BC2 A;  4F9O A;  3BF1 A;  4B1W B;  2ASM A;  1HLU A;  3LDP A;  3CJA A;  4K25 A;  4R5I A;  5AQO A;  3QFU A;  2AA4 A;  1GLC G;  1KAX A;  3CIP A;  4FWK A;  4CZH A;  3WEE B;  4EZP A;  4IO8 A;  3ULE B;  4FWR A;  1TUU A;  4H0T B;  4H0X B;  4BC5 A;  4B1X B;  3BEX A;  5KPT A;  2IVP A;  1LCU A;  1Q5L A;  3VGK A;  3A5N C;  4H03 B;  4CBX A;  3O1B A;  1NGG A;  1J6Z A;  5BPL A;  4A2B A;  1R59 O;  1U2V B;  1GLL O;  2Q1N A;  4H5R A;  1BO5 O;  3ENH A;  2P9U B;  1E4F T;  1QQO A;  1S22 A;  1V4S A;  1T6D A;  4BRQ A;  4H6H A;  3ZET B;  4EZQ A;  4CBU A;  1HX1 A;  1Y64 A;  2DPN A;  4EZU A;  3A5O C;  3UKU B;  1NGE A;  2GUP A;  3O5B A;  4WQ4 A;  3GDQ A;  3FZM A;  3HBT A;  2D4W A;  5BPM A;  3L6Q A;  5AZI B;  5FPM A;  4MO4 A;  3CET A;  1YUW A;  1CKR A;  3VEV A;  3T48 A;  4FWM A;  4WV7 A;  3DJC A;  4M7Y A;  2QWP A;  3D2F A;  3O8M A;  3SMP A;  4BGB A;  2D0O A;  5TKY A;  3SMS A;  1XQS C;  4M7X A;  3BUZ B;  2YJE A;  4BGA A;  1GLE G;  2NRH A;  4BC3 A;  1CZA N;  4GY2 B;  4JWC A;  4BC4 A;  2VCP A;  2E20 A;  5AQQ A;  4CZI A;  3QBX A;  5AQN A;  4MLE A;  2FSK A;  5EVZ A;  2GWJ A;  4BRM A;  3DXM B;  1X3N A;  3C7N B;  1ESV A;  2V7Z A;  3GL1 A;  4CZG A;  5F2R A;  1EQY A;  2P9P A;  1ATS A;  1NMD A;  1BUP A;  3LM2 A;  5AQL A;  5BRF A;  1DG4 A;  3SJH A;  1HKC A;  1U6Z A;  5AZJ B;  4E1J A;  3QML A;  2Q2R A;  3CJ1 A;  4FO0 A;  4F01 A;  2ZGZ A;  2VYP A;  2WIN M;  1QHA A;  5AQS A;  2E8A A;  4GNI A;  4CZK A;  1NWK A;  3T4A G;  3VGL A;  3UKR A;  2P9I B;  4BVO A;  2A5X A;  2E1Z A;  2FF3 B;  4A61 A;  2E2P A;  3DXK B;  4B9Q A;  3A5M C;  5KQ8 A;  4FWQ A;  4BRI A;  3W0L A;  1DKX A;  4EZS A;  3F9M A;  3H1V X;  3WEE A;  5AQF A;  3VOV A;  3H0X A;  2I7P A;  5F0X A;  5JMV A;  3J8A A;  4RWT A;  4O5F A;  4BVP A;  4IZ9 A;  2FXU A;  2GEM A;  3IFR A;  4BR4 A;  1ZXO A;  2UYT A;  3KHY A;  5AQG A;  3CI5 A;  2CGK A;  4EZW A;  4EZR A;  4BRA A;  2P9K B;  4AM6 A;  4B1Y B;  2FLO A;  1NGD A;  1TYQ A;  3H46 O;  3IUC A;  3L0Q A;  3TPQ A;  5JLF A;  3R6M A;  1U00 A;  3A8Y A;  3DAW A;  3ZET A;  5AQW A;  5BRD A;  4IXC A;  2QWR A;  2ASP A;  4PO2 A;  2F9W A;  3O6W A;  3VER A;  3VEO A;  4EHT A;  4BQL A;  3R9P A;  3L3O M;  4H5W A;  3CQX A; 
#chains in the Genus database with same CATH topology
 3D50 A;  1JLE A;  4MO5 A;  3K5O A;  1BIS A;  4EZZ A;  4JYA K;  2VQF K;  1TK0 A;  4OJR A;  1NMN A;  3QIN A;  3F9K A;  3TAN A;  2D4C A;  4FJJ A;  1BIZ A;  3OYB A;  1KFD A;  3L2W A;  1O13 A;  1TKX A;  4GVE A;  3HTV A;  5JVH L;  3LP1 A;  3QBW A;  1HRH A;  3ZT3 A;  3JS6 A;  1DKY A;  4BDZ A;  3VQ8 A;  3S3O A;  3SNN A;  4I7F A;  1BQN A;  2YHY A;  4KHY A;  4CD1 A;  4N41 A;  2UXD K;  3WT0 A;  3OW2 M;  2KFZ A;  1JXE A;  2KZZ A;  3VF6 A;  5ELZ A;  5AFU A;  2HHS A;  4IJA A;  4QS9 A;  2FC0 A;  4YDU A;  2YX6 A;  4KH6 A;  1LWF A;  4XIU A;  4RW9 A;  5M1N A;  4M3T A;  1KVA A;  2Z0N A;  3U8X A;  2HBK A;  3H3N O;  4XH4 A;  1QZ5 A;  2NRT A;  4FWP A;  4CJ7 A;  3SAH A;  1X9J A;  3D0P A;  3VEB A;  1IJJ A;  3H45 C;  4B9L A;  3KIO A;  4OPH A;  3OYJ A;  2UUC K;  4FLU A;  1OH8 A;  1YWM A;  3AVJ A;  2FBX A;  2KQ2 A;  4IM2 A;  4BE1 A;  2G8U A;  3KLF A;  2P9S A;  3VEY A;  1KVC A;  3TTC A;  1EXQ A;  1NOZ A;  4CGI A;  3CMA N;  3RR8 A;  2BTF A;  4J2E A;  2X3V A;  1JKH A;  3S3M A;  4K41 A;  3C65 A;  4FPB A;  3AV9 A;  3LVT A;  3WNE A;  4CHP A;  2GAF D;  3O1W A;  4R79 A;  1DTQ A;  4CZF A;  1Q86 O;  4B9T A;  2P9K A;  2O8E A;  4LSL A;  4Y1D A;  4CF1 A;  2ND1 A;  4R5L A;  1C0T A;  2EHG A;  4HUG A;  2A40 A;  2GA9 D;  4UQG A;  3AO3 A;  1Q9Y A;  1HKB A;  3CAZ A;  4JRQ A;  2OW6 A;  4FW1 A;  1JCG A;  4O0J A;  3ABH A;  2F7R A;  5FLE X;  3BVT A;  2Z1H A;  4BEC A;  5ADX A;  3ENO A;  1HNX K;  1RDD A;  2ASO A;  4W5N A;  4GKK K;  4I9Q A;  4FSV A;  3NGZ A;  2WYH A;  3WXJ A;  1NGC A;  1N32 K;  1SU8 A;  3U4L A;  4KB0 A;  2HHU A;  4JK7 A;  3PIP L;  5GAG P;  2Q0R A;  3LDQ A;  1YJW N;  2F8S A;  1GOA A;  3AVI A;  4B1U B;  2Q97 A;  1VQ9 N;  2D0P A;  3MAQ A;  4E7I A;  3JAM O;  4CHQ A;  3OS2 A;  3OYL A;  5C0Y A;  3CZN A;  3J80 O;  1MWK A;  4CEO A;  4FZP A;  2P9P B;  4E1N A;  2OZS A;  4HY9 A;  1IO2 A;  1JLA A;  5F1X A;  1OVQ A;  2QFF A;  2RE2 A;  3KK7 A;  1K8K B;  5HRO A;  2UUB K;  1VHX A;  3CJ7 A;  4DFK A;  4NSW A;  3OYN A;  3P1G A;  1XHZ A;  4H5T A;  4DV2 K;  4L8R B;  4JKB A;  1LWE A;  4RG8 A;  5GAE P;  4DSL A;  3GBT A;  3DXK A;  5CYM A;  1GLA G;  2RF2 A;  1VRT A;  4CJK A;  3L2V A;  4O4G A;  1D4X A;  3NVK A;  3THX B;  2GF4 A;  5E84 A;  5AFU H;  1XC3 A;  4NPH A;  3RR7 A;  4DFM A;  4E3S A;  4BR7 A;  5H1S Q;  4BRD A;  4PQU A;  4PY5 A;  3HZ6 A;  3IS9 A;  5JLH A;  3UIT A;  3CPE A;  1D9D A;  4B3T K;  3ZSR A;  4AH9 A;  2NCZ A;  4ILG A;  5MLC Q;  4FOI A;  4JI1 K;  3I0R A;  4CZJ A;  3U6F A;  3HP9 A;  4I1Q A;  4WFA L;  1N8R O;  1FW6 A;  1IG8 A;  1SQK A;  2Z1J A;  3FE1 A;  3LM9 A;  4KTW A;  3HOT A;  3GG4 A;  3C6T A;  3V1R A;  2IDO A;  3K9J A;  3I8B A;  4HCB A;  4AHC A;  1SU7 A;  2QWL A;  3CM6 A;  3SUO A;  4JKA A;  1SL0 A;  1C1A A;  4YOR A;  1YVN A;  1T7P A;  2ZD1 A;  1RNH A;  2HND A;  3MX2 A;  2DFH A;  4NO7 A;  1J5O A;  5KBP A;  1HPM A;  2RPI A;  3CCQ N;  3MEE A;  5M1Q A;  1K8K A;  4DU4 A;  3QNN A;  3KD1 E;  1NG9 A;  2FYV A;  3NVM A;  3K5M A;  2P9L B;  3HXM A;  1HKG A;  3VQA A;  4JI7 K;  4UY8 O;  3ULE A;  1GOB A;  1ZBI A;  4ILH B;  3SLC A;  2V52 B;  4CBW A;  3EKU A;  5KPR A;  1RGI A;  4C23 A;  2O8B A;  2VQE K;  3EN9 A;  4B9S A;  3KZB A;  5KGW A;  1ZYL A;  3CZS A;  3M1F A;  4DLG A;  4ELT A;  1QQN A;  4BRK A;  5DK5 A;  3G25 A;  4DSJ A;  1NK8 A;  3KKR A;  3T49 A;  2QM1 A;  4DKW A;  3C94 A;  4NYN A;  1OH5 A;  5AQV A;  1NKB A;  1YTU A;  4G1Q A;  4DQQ A;  3SI6 A;  3L8B A;  4ILG B;  1Q7Y O;  4BWJ A;  4HYB A;  1QZ6 A;  1NJW A;  2WYI A;  2X6N A;  1IBL K;  1BA0 A;  4JEP A;  5HRR A;  1WAF A;  4DTS A;  3LAL A;  1R5E A;  2F8T A;  4LF6 K;  4B9M A;  3U9D A;  3CCR N;  3SUQ A;  5AQZ A;  4V19 S;  1Z25 A;  3G71 N;  3RVC A;  1YTA A;  4JK8 A;  5A2Q O;  4DQS A;  3ZT2 A;  2YHW A;  1RDB A;  1RDC A;  1S6Q A;  4JL9 A;  1YI2 N;  1KFS A;  2HMP A;  1DKZ A;  2D1L A;  3QO9 A;  4R5J A;  1RBR A;  3WNF A;  4ICL A;  3DDG A;  5BPN A;  2A6A A;  3V9U A;  4IWV A;  5BRH A;  1WNS A;  5AQY A;  2AP1 A;  4FJH A;  1ASU A;  2RAI A;  4FOE A;  1CZ9 A;  4KB1 A;  4EZO A;  2OBM A;  4DR1 K;  3CYM A;  4LFA K;  2YI9 A;  3BF1 A;  3O4Q A;  1GOC A;  3ITH A;  4NCB A;  1WN7 A;  1KAX A;  3CIP A;  3SAG A;  4EZP A;  4IO8 A;  5C42 A;  4LF7 K;  3H08 A;  4FWR A;  4H0X B;  4BC5 A;  4ILH A;  2Y1I A;  4B1X B;  3CC2 N;  4CJT A;  4F8R A;  2O8B B;  3VGK A;  4YOW A;  4FLZ A;  3HO1 A;  4M3U A;  3CME N;  2A1S A;  3T7Z A;  2G8V A;  3TTF A;  2HHQ A;  5BPL A;  4YOV A;  1NJY A;  2OPP A;  3BVU A;  1GLL O;  3OJU A;  3ENH A;  1HWW A;  2GV9 A;  3SOG A;  4BRQ A;  3M5R A;  1NU0 A;  3AVL A;  1WSH A;  1Y64 A;  4Z4E A;  1IV0 A;  1NGE A;  1UWB A;  3B6O A;  3O5B A;  4WQ4 A;  3GDQ A;  3FZM A;  3HBT A;  4FXD A;  4RW8 A;  3L6Q A;  5BPM A;  3TAR A;  4F2S A;  3CET A;  4UDX X;  3T48 A;  5T7B A;  3D6R A;  4DTX A;  3BY5 A;  3DJC A;  3K2P A;  4CJP A;  2QWP A;  3O8M A;  4LFC K;  2D0O A;  5TKY A;  3SMS A;  2PY5 A;  3THW A;  4Z4G A;  3SBT A;  3CM5 A;  4BGA A;  2OPS A;  1TQU A;  2NNW A;  3HK2 A;  3L3P A;  1RIL A;  1YJN N;  3L3V A;  1DLO A;  3THY B;  5AQN A;  2FSK A;  3E1Y A;  3DXM B;  4IWO A;  4CZG A;  3OYK A;  2YLA A;  3RV0 A;  2P9P A;  1ATS A;  5AQL A;  3HM9 A;  5M1K A;  4RW4 A;  3QWE A;  3QIP A;  3QML A;  3CJ1 A;  3DMJ A;  1M1K O;  4CEB A;  1QHA A;  1E9V A;  1HPZ A;  4CZK A;  3T4A G;  2HVH A;  3E9O A;  2P9I B;  4BVO A;  1W2B M;  3VKH A;  1VSK A;  4AZ5 A;  4B9Q A;  3DXK B;  3O3H A;  4DV1 K;  3OYA A;  1NKC A;  4RW6 A;  2X5C A;  3W0L A;  2NUB A;  1DKX A;  4EZS A;  3H1V X;  4KHQ A;  1T3V A;  1REV A;  4DTU A;  1JJ2 M;  5HRP A;  3MXJ A;  1VQ5 N;  3J8A A;  4KTZ A;  4BVP A;  3KK2 A;  3KKS A;  3N4Q A;  3OBY A;  3IFR A;  4BR4 A;  1ZXO A;  4C8N A;  2UU9 K;  2UYT A;  3L2R A;  2DFF A;  3DX0 A;  3RMD A;  4B3O A;  4PHT X;  4EZR A;  1JLC A;  3CCE N;  1VQ8 N;  3LP3 A;  4MQ3 A;  3PSF A;  1S1W A;  2FLO A;  3ULD A;  1TYQ A;  4AZB A;  1FKP A;  3R6M A;  5JVG L;  4PA1 A;  3A8Y A;  3WNG A;  2OPR A;  3DAW A;  2KLA A;  2ASP A;  3L3U A;  1NKE A;  2DFE A;  4H5W A;  5HLF A;  1FJG K;  2G8I A;  1B9F A;  3OA9 A;  4KFB A;  2BDP A;  1X9W A;  3DDF A;  3DLG A;  3TSQ A;  4KHW A;  3ZCM A;  2F96 A;  3THW B;  2F7P A;  3I33 A;  2E88 A;  5KRS A;  3TWH A;  5SWM A;  2HHW A;  3PSI A;  1ZBH A;  5AQP A;  3OYI A;  4FVU A;  3D2E A;  1YVU A;  3I56 N;  3LAK A;  5KTQ A;  4DV4 K;  4DS5 A;  2CGJ A;  1RBU A;  3CVR A;  2HVI A;  3R8E A;  4QOZ B;  5CYQ A;  1WSI A;  3BUI A;  1OH7 A;  1T03 A;  4CZE A;  1X04 A;  4H0O A;  1ILY A;  2C1I A;  2RAK A;  1VSE A;  3D4Y A;  1I3A A;  3OHR A;  5KRT A;  5FPD A;  1SAZ A;  2PBD A;  3NCI A;  4GV6 A;  2P9I A;  2W00 A;  4HR1 B;  4CHO A;  2WOM A;  1TVR A;  2ZJQ L;  3QEI A;  1XUP O;  4YOU A;  3D52 A;  1UPX A;  1KAZ A;  5FPE A;  4I43 A;  2AJQ A;  5AJ3 K;  1NGI A;  2JGU A;  3ZLJ A;  4DMN A;  3VEN A;  1R0A A;  3WUH A;  3TU5 A;  3U3G A;  4CD3 A;  3VF4 A;  4M3R A;  2GUI A;  4BR5 A;  2EWS A;  3MX5 A;  3PY8 A;  4LF4 K;  3A5L C;  4CGF A;  4LSN A;  3QEX A;  2ZWH A;  4FJ8 A;  2F18 A;  5AQI A;  4DSE A;  1TYQ B;  1UA1 A;  4CGD A;  4LFB K;  2WBN A;  4H0V B;  4DB3 A;  3MN5 A;  2ITG A;  1E4G T;  2IOC A;  4DLE A;  4CZL A;  4U67 L;  2A42 A;  4AM7 A;  3O3N B;  4IKF A;  1BGX T;  4FJI A;  1D8Y A;  1NM1 A;  1U45 A;  3U3Y A;  3Q7C A;  2D5R A;  3HVR A;  2QKW A;  4KI4 A;  1YXQ A;  2XY8 A;  4FM1 A;  4RCH A;  4BRE A;  4K8X A;  4IW0 A;  4IFE A;  3KLH A;  2HHV A;  2ZJR L;  3S41 A;  3HAJ A;  3ATU A;  4NCG A;  4XEI A;  2HBM A;  4A5A A;  3D51 A;  3J81 O;  1WSG A;  4BE0 A;  1CLQ A;  1EO1 A;  1YHQ N;  1BA1 A;  3R3L A;  3T47 A;  4CIG A;  3AAP A;  2F7O A;  3U9Z A;  2F1B A;  2Q31 A;  3QFP A;  2GTD A;  3C7N A;  5AQR A;  3AAR A;  2R7Y A;  3WNH A;  4BRP A;  3B6P A;  1TL3 A;  3LWL A;  3ENB A;  3MWP A;  3OS1 A;  4JK9 A;  1NGH A;  4H8S A;  1SKS A;  4O8U A;  2V7Y A;  4DR3 K;  4J2B A;  4N47 A;  3SBS A;  1NGB A;  4C1N K;  2GWK A;  2Q3S A;  4IG3 A;  5LMN K;  4KHU A;  3NBP A;  1JLF A;  1C0F A;  3HPH A;  4BE2 A;  1Z05 A;  1Q9X A;  3VEX A;  3ERC C;  4IJN A;  3AAQ A;  3L2U A;  3TAG A;  3DRR A;  2V51 B;  3VF2 A;  4KIK A;  2BUP A;  3AVF A;  4CJ5 A;  3O9S A;  2EFK A;  1IKY A;  1BPR A;  1G99 A;  1D9F A;  5C24 A;  3WXM B;  3I2W A;  4EZ9 A;  4DTR A;  2F1A A;  1L3V A;  2QTD A;  1C1C A;  2B5J A;  4OLA A;  1IKX A;  2B4J A;  4NB4 A;  4AKV A;  1NK6 A;  2Z8Y A;  1Z6R A;  1W9M A;  3GE1 A;  3QA8 A;  4BR9 A;  3NF9 A;  3ZEF A;  4KTQ A;  1S9G A;  4ELU A;  1GLD G;  3ZT0 A;  2RN2 A;  4H5N A;  4IFV A;  3D4Z A;  1GLF O;  3G4S N;  3O08 A;  2X6S A;  5JEN A;  2HNZ A;  2PY6 A;  1X1P A;  3L4I A;  3TTD A;  2E6M A;  3SBG A;  3V9X A;  3LDN A;  4EIA A;  5C10 A;  4QS8 A;  1U48 A;  1NGF A;  3O9R A;  4WFN L;  5JIC A;  3G9G A;  4BR2 A;  1VSM A;  1FK9 A;  4BQZ A;  5AQX A;  4E7J A;  5D3G A;  1L3S A;  2P9N A;  4FJG A;  3RPM A;  4LF8 K;  3RSE A;  4FVM A;  3HL8 A;  3H3O B;  3ZX3 A;  2I5J A;  3CYG A;  4M3Z A;  2RKI A;  4X62 K;  3KAW A;  3PX0 A;  3SAF A;  4LF5 K;  4DFP A;  4KV8 A;  3F7W A;  4FLT A;  3D7E O;  1QVF M;  3DLH A;  1VQK N;  2CH5 A;  4JKG A;  5C5B B;  4DTM A;  5JS2 A;  3RWU A;  2W40 A;  4IEE A;  4X64 K;  3J7Z O;  3DOL A;  1KXP A;  4JRP A;  4CGG A;  1BG3 A;  4FWN A;  2P5O A;  1Q81 O;  2IGI A;  4HTL A;  1HNW K;  4KIK B;  3FZL A;  1T8E A;  1NGA A;  5BR8 K;  3VQ4 A;  4JWI A;  3K59 A;  3VEA A;  2QWM A;  3WXL A;  2HW3 A;  2HMI A;  2PAV A;  3T69 A;  4CF0 A;  3HAH A;  5AZI A;  2FBY A;  2WON A;  5AQM A;  4JD2 B;  3DPO A;  3LP0 A;  3AVB A;  3AVA A;  1B92 A;  3E01 A;  4ILI A;  1S1T A;  4AIL C;  4E1M A;  3K5N A;  2YIV X;  4IEI A;  1JL1 A;  4DTP A;  3KWG A;  1KSP A;  4B9V A;  1SV5 A;  1U04 A;  3NF8 A;  3P5J A;  4W5T A;  3RMC A;  2IVO A;  2FF6 A;  1IH7 A;  1V4T A;  3DX4 A;  3FZF A;  1HUX A;  1NK4 A;  3P83 D;  4FL9 A;  4LC9 B;  5CZ2 A;  2WFB A;  1HNV A;  4BRO A;  3DYT A;  3CHW A;  4AZC B;  3ZSW A;  2ZQB A;  4JHD A;  4JN4 A;  3PX4 A;  4I2P A;  1BOT O;  5AZJ A;  1QSY A;  3CD6 N;  3EJQ A;  4H5V A;  3RRH A;  3J7A P;  4JS5 A;  1NLV A;  2KTQ A;  3ZEU B;  5EOY A;  2Z0O A;  2XO7 A;  3DLE A;  3EE9 A;  3VQE A;  3F2K A;  5J2M A;  4B3S K;  4DSK A;  3DX2 A;  4W5O A;  2P9N B;  3AO5 A;  4XH5 A;  2QKK A;  4IDK A;  3I04 A;  2PFU A;  2PZS A;  1HLU A;  4Q0B A;  3CJA A;  1O7D C;  4K25 A;  3TI0 A;  4R5I A;  3O3G A;  3K5L A;  4CJS A;  2AA4 A;  3EEQ A;  4DR7 K;  4CZH A;  4JV5 K;  2Z1I A;  2RAJ A;  1QS4 A;  2O4I A;  4B3R K;  4H0T B;  2YV0 X;  2X78 A;  3OYH A;  4AF1 A;  1GN9 A;  4CHN A;  1LCU A;  2E5L K;  2XHB A;  3LPU A;  1NGG A;  1L3T A;  4Z0U A;  1S1X A;  4Z4H A;  3A98 A;  1U2V B;  3OYG A;  4H5R A;  1BO5 O;  1S22 A;  3B53 X;  1UA0 A;  3RMA A;  4H6H A;  3CC7 N;  2DPN A;  3VMF B;  2DTU A;  3ZYY X;  5AZI B;  1QHT A;  4OKK A;  1HYZ A;  4MO4 A;  1TQV A;  4JI5 K;  1CKR A;  3FFI A;  3HVT A;  5LL6 Z;  5SZT A;  3DX1 A;  2VWK A;  1VQO N;  4FZZ A;  3ER9 B;  1EP4 A;  3L2Q A;  1NK9 A;  1RT6 A;  1XQS C;  2N3K A;  1W9H A;  3TSP A;  4BC3 A;  4E7L A;  4GKJ K;  3BUP A;  4JWC A;  3DLL L;  3O3O B;  2E20 A;  5AQQ A;  4W5R A;  4MLE A;  5EVZ A;  4CW7 B;  4JKD A;  4TSX A;  1X3N A;  3C7N B;  1NK5 A;  1HTY A;  3BUQ A;  5TKW A;  3OK8 A;  3I55 N;  3SJH A;  3MED A;  1HKC A;  5AZJ B;  2F4V K;  1EET A;  4FO0 A;  3DRP A;  1S72 N;  4IM0 A;  3CCJ N;  1BI4 A;  2VYP A;  4CK1 A;  1LW2 A;  1VAZ A;  3UKR A;  2A5X A;  1C0U A;  4A61 A;  2E2P A;  1JL2 A;  1BL3 A;  3A5M C;  5M1O A;  3VA0 A;  4WFB L;  5KI6 A;  2YI8 A;  5AQF A;  1QWN A;  1W97 L;  1JLQ A;  3VOV A;  3C6U A;  4AQY K;  1T05 A;  4DCN C;  4E7H A;  4RWT A;  1W0H A;  2FXU A;  4IZ9 A;  2HNY A;  3PLT A;  1SL1 A;  5J2P A;  1I4T A;  3KHY A;  5AQG A;  4W5Q A;  4B9U A;  1IKV A;  3CG7 A;  2CGK A;  4EZW A;  1YF5 L;  3ACO A;  2P1J A;  3V1Q A;  3O3M B;  1LV5 A;  2GX9 A;  5GAH P;  3LZJ A;  4B1Y B;  1TQT A;  3DYA A;  1NGD A;  3H46 O;  3NE6 A;  1WSE A;  3IUC A;  3E9L A;  1XI1 A;  4B9N A;  3ZET A;  5BRD A;  3G10 A;  4DQI A;  4PO2 A;  3O6W A;  1RBV A;  3VEO A;  2PMR A;  4BQL A;  3R9P A;  1SU6 A;  3CF5 L;  3F5T A;  3SQ1 A;  3N4P A;  4BRN A;  4M63 C;  2ETJ A;  3EO3 A;  3RMB A;  1NNE A;  1LQ7 A;  4KAZ A;  1BCO A;  1K73 O;  1TQW A;  1JCF A;  2WC9 A;  2YNF A;  2XY5 A;  4DR5 K;  3PO5 A;  3WXK A;  3ISN C;  4DV0 K;  3M3Z A;  4WE1 A;  4B08 A;  4BE7 B;  1RDU A;  2QK9 A;  1KAY A;  1CXQ A;  3MK6 A;  2UXC K;  4B8A B;  2A3Z A;  3BVV A;  4DG1 A;  1SUQ A;  4HUE A;  5IWA K;  1LWC A;  1TUY A;  4CJQ A;  4K43 A;  2OA8 A;  3LAM A;  4DV6 K;  4WCE L;  2KHO A;  3LDL A;  1VK0 A;  1N5Y A;  2OBL A;  1EWQ A;  3QIO A;  3RTV A;  4RTF D;  3CXC M;  1VQ7 N;  4EZN A;  4OO1 J;  1S9E A;  2YNI A;  3M8S A;  2YLL A;  1NGJ A;  4YHH K;  1ZC6 A;  3ATV A;  3UKR B;  4CED A;  2OZM A;  2BAN A;  2YJF A;  2RHK A;  4O5B A;  4IFY A;  3K58 A;  3LL3 A;  3C6A A;  2HHT A;  5FPN A;  2ZJP L;  3FZH A;  4FJL A;  4HWI A;  4KBO A;  3ZSY A;  3WQU A;  2ITM A;  1GNT A;  4ZTF A;  2CH6 A;  3QNJ A;  4I6M A;  4DCH A;  2YHB A;  4CF9 A;  3OYD A;  4IBN A;  3PLA A;  3OYM A;  2F9T A;  4CJL A;  3GI7 A;  1CZB A;  4CHY A;  2CGL A;  3TAP A;  3V9W A;  2PYL A;  3SQ0 A;  4JKH A;  4CJW A;  1ZBS A;  3LDS A;  4CK3 A;  1E3M A;  3PIO L;  4GMJ B;  4CZM A;  3HYF A;  3TAM A;  4JD2 A;  2IAJ A;  4IG0 A;  1J5E K;  4F3T A;  1GLB G;  3TSU A;  1OA0 A;  3EZ5 A;  1BIU A;  1VSL A;  3NF6 A;  1FKO A;  4B1Z A;  4PL7 A;  3DOB A;  3QIC A;  3WQT A;  4K42 A;  2YIA A;  2HF3 A;  3AO1 A;  4DSF A;  1RCH A;  3H6E A;  3HST B;  1O1W A;  5AR0 A;  4BNE A;  3UKU A;  3NH2 A;  2HBL A;  4OGC A;  5J2Q A;  1I4D A;  4RW7 A;  4PKH A;  1VQ4 N;  4YOY A;  4CK2 A;  3LDO A;  3P4I A;  2O8F B;  1QWU A;  1HMV A;  2B6A A;  1A5V A;  4OPJ A;  1RTD A;  4AZC A;  1C0G A;  1QTM A;  1S6P A;  1B9D A;  3HSC A;  4JHD B;  2KFN A;  2WUS A;  4LF9 K;  3FGU A;  5J1E A;  1SZ2 A;  1DT9 A;  3SPZ A;  4CEC A;  2HHX A;  4FJX A;  2VG6 A;  3THY A;  3FZK A;  4JI0 K;  4EZX A;  4N56 A;  3BZC A;  3NGI A;  3TAF A;  3AO2 A;  4F3O A;  2OYQ A;  2LSN A;  1WB9 A;  2E1Y A;  5LMU K;  3VQ5 A;  5BR9 A;  3SUN A;  4DWI A;  3VPZ A;  4NLB A;  4IWQ A;  3CJC A;  2X74 A;  5CY4 A;  3MXI A;  1TV6 A;  1NJZ A;  3V9S A;  5DMR A;  1K9M O;  4CFC A;  3HT3 A;  3L4Q A;  1U49 A;  1WOQ A;  4NQI A;  1OVY A;  3JXU A;  3PV8 A;  4OPK A;  3LMF A;  5LY3 A;  5GIN A;  4DF4 A;  1HYV A;  2P9S B;  2F7T A;  1RT1 A;  1U2V A;  1Q82 O;  2QXL A;  4BDP A;  1GNL A;  5E26 A;  3B8A X;  1RBS A;  4YOT A;  4EP5 A;  4KRF A;  1HJO A;  1RTH A;  3VET A;  3AA5 X;  2ZE2 A;  3VA3 A;  5FRN A;  4FJ9 A;  3VEZ A;  4LD0 A;  4DTN A;  3OHX M;  2FSN A;  3M6G A;  3E66 A;  1XHX A;  4CJV A;  2RT6 A;  2W41 A;  5C25 A;  4OLB A;  2HB5 A;  4JNE A;  3VQC A;  4WYB A;  3BF3 A;  1XMQ K;  1C6V A;  3D2F B;  3OYE A;  4DSI A;  4JKF A;  4JWD A;  3M3W A;  5ADX H;  1IG9 A;  4PL8 A;  5FDL A;  3KLE A;  2ELB A;  1S1V A;  2QWN A;  4GV9 A;  3OTO K;  3KK3 A;  3S5T A;  3K0S A;  1WSJ A;  3Q84 A;  3O3F A;  3EJS A;  4IOC L;  1TGO A;  2O8F A;  4BRC A;  2O4G A;  4ID5 A;  5FLX O;  4R5K A;  5LJW A;  1JLB A;  1DKG D;  2GEL A;  4CEZ A;  2IIR A;  4JWE A;  2C1G A;  1P8Z A;  2QWO A;  3UE5 A;  1MU2 A;  5EX5 A;  3EY1 A;  1YAG A;  2YI1 A;  5C2D A;  2QWQ A;  4BR0 A;  4H8K A;  4DQR A;  2BE2 A;  4EZY A;  4PKG A;  3RV1 A;  1NJI O;  2YIB A;  1LOT B;  3CCS N;  4AZ7 A;  2G8F A;  3MMV A;  2YKT A;  1KC8 O;  4CIE A;  4DHY A;  3BP8 A;  4KHP K;  4CFB A;  1VSF A;  4B1V A;  2O0I 1;  4AZ6 A;  4FM0 A;  1HXK A;  4H0Y B;  1SS6 A;  2NRZ A;  3MN6 A;  1ASV A;  4WQ5 C;  2YKN A;  3M8P A;  1XNR K;  4CCH A;  3BLB A;  4AVM A;  4EZV A;  4R5P A;  5CE3 A;  3O80 A;  1HNZ K;  1WUA A;  4O8K A;  3DPQ A;  3CCU N;  2ZF5 O;  4FWO A;  1WAJ A;  4CJ4 A;  2ZGY A;  2I7N A;  1Z26 A;  4O55 A;  3PX6 A;  5C2F A;  4O0I A;  1DTT A;  4MDB A;  1MA9 B;  3NH0 A;  3NH1 A;  4BRG A;  3SJJ A;  3THX A;  3GOI A;  4ZHR A;  2HBJ A;  3IMX A;  1BDG A;  2E2O A;  1KLN A;  3NGY A;  2VG5 A;  1N34 K;  3EJR A;  4KRE A;  1U47 A;  2FBT A;  2VGN A;  3OY9 A;  3AA2 A;  2Q0U A;  1T6C A;  2OP6 A;  3DOK A;  4CEA A;  2QEX N;  2JNS A;  2O8C A;  2A41 A;  3QE6 A;  1KTQ A;  2JWL A;  5J2N A;  4C8L A;  4IOX A;  5DM6 L;  5FRM A;  3AGR A;  4KPY A;  3AVK A;  4BG8 A;  3MCA B;  3MDQ A;  4M3Y A;  5AQK A;  1VRU A;  1BHL A;  1QE1 A;  1R34 A;  1RTI A;  1T44 A;  4MFB A;  4QS7 A;  4DR6 K;  3KLI A;  2P51 A;  4JKC A;  4DQ8 A;  2BPR A;  1VQ6 N;  3CCM N;  4DU3 A;  2Y1J A;  3I01 A;  1ZYQ A;  4Z4F A;  4A5B A;  3FR0 A;  1URU A;  4IO9 L;  5BRE A;  4J2A A;  4YDU C;  1C1B A;  1TKD A;  1KQS M;  4DR4 K;  3BZK A;  3NDK A;  5HP1 A;  3BDP A;  4BRF A;  3C6H A;  1HR0 K;  1VQL N;  1PS3 A;  3DLR A;  3DLK A;  1QQM A;  1S1U A;  1QQC A;  3HOS A;  5GIO A;  3KJV A;  1O7D B;  4FM3 A;  4MDA A;  3G6E N;  4JLH A;  4BC2 A;  4F9O A;  4HCC A;  4B1W B;  2ASM A;  1NK7 A;  3SPY A;  3Q0K A;  5AQO A;  3QFU A;  4UDY X;  3AGK A;  5FIG A;  3ULE B;  4G6Q A;  2HHI A;  2W6K A;  1OAO A;  3OS0 A;  3QEV A;  4CER A;  1J54 A;  1UAX A;  3K57 A;  3CPW M;  3OVN A;  2O8E B;  4DTJ A;  3BEX A;  5KPT A;  1Q5L A;  4FCY A;  4H03 B;  4H4O A;  3ZSO A;  1X03 A;  1SUF A;  4AHT A;  3V4I A;  4PUO A;  2YL5 A;  4Y1C A;  2Q1N A;  3AVC A;  3KTQ A;  2Q13 A;  1E4F T;  5I42 A;  1YIT N;  1J53 A;  1V4S A;  1T6D A;  4CFD A;  4KH4 A;  4Q5V A;  4EZU A;  3UKU B;  3ZT1 A;  2G8K A;  4JI8 K;  4CJU A;  2D4W A;  2O8C B;  4JI3 K;  2VGM A;  5FPM A;  4JI2 K;  4OVL A;  3VTI A;  1FXX A;  2XRI A;  3VEV A;  2GBZ A;  4FWM A;  4M7Y A;  3KWI A;  4FYD A;  3SMP A;  4BGB A;  4M7X A;  1D5A A;  4E89 A;  4DFJ A;  1CZA N;  4GY2 B;  4CGH A;  2Z1G A;  1HQU A;  3DLB A;  3MWT A;  4C8O A;  1ZBU A;  3DRS A;  3B52 X;  2Z0V A;  4YY3 K;  1J9A A;  2FBV A;  1R33 A;  3UIQ A;  2GWJ A;  4BRM A;  4CEF A;  2BGG A;  1ESV A;  2V7Z A;  2OTJ N;  4M3X A;  1EQY A;  3LM2 A;  1BUP A;  3I8D A;  2G8H A;  4N76 A;  2Q2R A;  4CJ3 A;  1Y97 A;  4IOA L;  3JYT A;  4E72 A;  4F01 A;  4HVJ A;  3P39 A;  5AQS A;  3CQ8 A;  1XMO K;  3OBW A;  3PUF A;  4WPC A;  3QET A;  4GNI A;  4YOX A;  1NWK A;  3OJS A;  4CIF A;  4HR1 A;  5IT9 O;  2E1Z A;  3ZSZ A;  1ZBF A;  1LAW A;  2IS3 A;  2A1R A;  3OWG A;  5CHI A;  3F9M A;  2LXY A;  2PYJ A;  5DM7 L;  3QNI A;  3H0X A;  5F0X A;  5JMV A;  1A5W A;  4DUY K;  4XJX A;  5CR4 A;  3Q7B A;  1RTJ A;  3ALY A;  2WTU A;  2QI2 A;  2KKZ A;  1RT3 A;  3I39 X;  3CI5 A;  4DQP A;  3NMU A;  4ILJ A;  3MXM A;  1HJR A;  1F21 A;  1YJ9 N;  3O4N A;  2V0O A;  4JKG B;  3TR8 A;  4CJE A;  1VSD A;  3ZED A;  4KKO A;  3VN5 A;  2MI7 A;  4HUF A;  3L0Q A;  4DV3 K;  3TPQ A;  5JLF A;  3F73 A;  3DM2 A;  1U00 A;  1RT4 A;  2HST A;  5AQW A;  3BUB A;  3T1H K;  2YL9 A;  4CEQ A;  2F9W A;  4Z4C A;  1EWR A;  4AZG A;  3CFP A;  3L3O M;  2OPQ A;  4KH5 A;  3CQX A;  1RT7 A;  2D1K A;  3CV5 A;  4EP4 A;  3CC4 N;  1HQE A;  4KO0 A;  3J7Y P;  1P90 A;  2C08 A;  1WLJ A;  2FIC A;  1IBM K;  3CFR A;  3HP6 A;  3SQ4 A;  4FK4 A;  4ISF A;  5GIP A;  4YFU A;  3SBT B;  2O8D B;  1TL1 A;  3T19 A;  1XNQ K;  1L3U A;  3EZW A;  1ASW A;  4CI6 A;  4WQ4 C;  3LZI A;  3WXI A;  5AQU A;  2OAN A;  3DWL A;  3TAB A;  3EKS A;  2XY6 A;  1I49 A;  4R5G A;  3IRX A;  4NXM K;  1QSS A;  1RFQ A;  3RRG A;  1RT2 A;  3KK1 A;  3EJP A;  2H3G X;  3MN7 A;  3QER A;  3SCX A;  2P9L A;  1HNI A;  4MLH A;  4WPE A;  4OPA A;  1YIJ N;  4QCL A;  3SYV A;  4ID1 A;  3ZEU A;  4FZX C;  3V1O A;  4FK2 A;  2D0C A;  3O9Q A;  4JAX A;  4DR2 K;  3KDR A;  5CZ1 A;  4J8F A;  1KD1 O;  2JWK A;  4CES A;  4FWL A;  2EFL A;  1ATN A;  4FWS A;  1Y2O A;  2NZT A;  1S5J A;  2YL6 A;  4K8Z A;  5M1P A;  4AHV A;  3ER8 C;  4CEE A;  4MQD A;  4CJR A;  3IDH A;  3O9U A;  3BUD A;  3LP2 A;  3DQG A;  2P5G A;  1KCF A;  2VWB A;  2YCH A;  3QES A;  7HSC A;  4BRL A;  3O4W A;  3VQ9 A;  3CFO A;  4AZH A;  4A57 A;  1OH6 A;  2QA4 N;  3A2F A;  4OKE A;  3SK3 A;  1H1V A;  4QAG A;  1A5X A;  2HOE A;  4H4M A;  4FPA A;  4FJK A;  2NRR A;  4WF9 L;  1DGK N;  4ISE A;  4ATM A;  2KW4 A;  3MEC A;  4FLY A;  2OZN B;  4AZI A;  4FJ5 A;  4D8J A;  3AA4 A;  4LY7 A;  3V6D A;  4FM2 A;  1KRP A;  2DY4 A;  4AHU A;  3OYF A;  4E0D A;  2NLX A;  2ND0 A;  1VSJ A;  4AHS A;  4JNF A;  2OO2 A;  4FZO A;  3ID8 A;  3UB5 A;  3D2E B;  3AO4 A;  3V9Z A;  3QLH A;  3QEW A;  4CFA A;  1TK5 A;  3EL2 A;  1NOY A;  5HBM A;  4CGJ A;  2UXB K;  4YNQ A;  3VEW A;  3A0I X;  1C0M A;  5I9E B;  5EY4 A;  2E2Q A;  1N36 K;  3LLL A;  2NRV A;  1WBD A;  1ZWW A;  1DEJ A;  3VES A;  3SQ2 A;  2OW7 A;  4KHS A;  1SL2 A;  1QVG M;  3VQ7 A;  3ZX0 A;  1N33 K;  3BVX A;  2VG7 A;  4DUZ K;  2ATQ A;  4CHZ A;  1RDW X;  2E4L A;  1VQN N;  3IKM A;  3T46 A;  3CCV N;  2YNH A;  1U4B A;  1BI4 B;  3QNO A;  2LM0 A;  1EX4 A;  2YHX A;  3FFK B;  4EAH D;  1QSL A;  1I94 K;  3VQD A;  4BWM A;  2HF4 A;  1NBW A;  3I0S A;  3THV A;  4F4K A;  5EXW A;  4FJN A;  3S3N A;  5C12 A;  3MCP A;  2ZXQ A;  5BN9 A;  3LAN A;  4O44 A;  3P31 A;  3AY9 A;  4C1N I;  3D45 A;  3AVN A;  1BQM A;  3DI6 A;  3R1X A;  2OCE A;  3C0B A;  1MJG A;  4A62 A;  3ZX2 A;  5BN8 A;  3EYZ A;  3TAE A;  3EJU A;  1Q18 A;  1JCE A;  2G8W A;  5E41 A;  4JS4 A;  2HHH K;  3HPO A;  3IG1 A;  3DX3 A;  1GLJ O;  1S3X A;  4JLC A;  3T1A A;  4L3Q A;  4WV5 A;  4BDY A;  2XY7 A;  4OKJ A;  3VQ6 A;  5I3U A;  1SKR A;  3AVG A;  3OYC A;  3NAE A;  4H6I A;  1RBT A;  3CCL N;  3DXM A;  3FLC O;  1N6Q A;  4Z4I A;  2JNK A;  4A2A A;  2ALW A;  4HHT A;  4DU1 A;  1TAQ A;  2UUA K;  1EKE A;  5KGX A;  1JLG A;  2JLE A;  4E19 A;  4ISG A;  4KI6 A;  3HRG A;  4F00 A;  2E2N A;  1BWF O;  4A59 A;  5AQJ A;  5AQH A;  5KQD A;  3CJB A;  1K8A O;  1RDA A;  2QKB A;  1MWM A;  2EWF A;  5M1F A;  4EFH A;  3PO4 A;  4M3W A;  3VQQ A;  4WQ5 A;  3CER A;  1OKJ A;  4FJ7 A;  1TKT A;  4JI4 K;  4NXN K;  4FW2 A;  4IM3 A;  4G9Z A;  3SYZ A;  4FZS A;  3BGR A;  4FLX A;  3KD5 E;  3HI0 A;  3CQY A;  2BH1 A;  1Q8I A;  2QW9 A;  5LJV A;  3QDK A;  4Y0W A;  1VSH A;  2ZM6 K;  2YKM A;  3AA3 A;  4XH1 A;  1RT5 A;  3N8E A;  1JQK A;  1TAU A;  1LAV A;  1G15 A;  5KPZ A;  2NRX A;  3W3D A;  4I6M B;  4M45 A;  3JSM A;  3LPT A;  1BU6 O;  1VQM N;  4X66 K;  4IDH A;  2P9U A;  3O9T A;  1X9M A;  3ZSX A;  5AQT A;  4N5S A;  4K0K K;  3KLG A;  2F7Q A;  3NHG A;  3CJ9 A;  2QXF A;  2EX3 B;  4DS4 A;  2X3X A;  4Z94 A;  1TQS A;  4C8M A;  1BCM A;  5K14 A;  4LH4 A;  3T1Y K;  2D0B A;  1NJX A;  2O8D A;  1ATR A;  3VQP A;  4PKI A;  2FSJ A;  3M8R A;  3KVG A;  4BRH A;  1WSF A;  5C15 A;  3MN9 A;  1XC9 A;  1X3M A;  2X3W A;  4EZT A;  5HRN A;  1K6Y A;  1E2U A;  4X65 K;  3E9P A;  4E7K A;  1OA1 A;  2NRW A;  4H0P A;  1X9S A;  1NK0 A;  2VWJ A;  3HPG A;  4OGE A;  3FD9 A;  5FRO A;  4CVN E;  3VGM A;  5EU7 A;  1L5U A;  5B8H A;  4E81 A;  2J4R A;  4CJF A;  4DTO A;  1MDU B;  2IVN A;  3B51 X;  2YNG A;  4B3M K;  2D0A A;  4EHU A;  3QB0 A;  1TKZ A;  3P38 A;  3VQB A;  3DPP A;  4FLW A;  3RSE B;  1M90 O;  4AHR A;  4BAC A;  2Q36 A;  4BG9 A;  4GVM A;  4EZ6 A;  3H1Q A;  3HM8 A;  1VQP N;  3LDP A;  4F2R A;  2W6L A;  4DV5 K;  1YT3 A;  1GLC G;  4FWK A;  3WEE B;  3AVM A;  2KZM A;  1TUU A;  1E1D A;  4C8K A;  4IWP A;  2E6L A;  1UOC A;  3T3F A;  5C5B A;  3NF7 A;  2IVP A;  4LH5 A;  3A5N C;  4CBX A;  3O1B A;  1J6Z A;  4A2B A;  1R59 O;  5HL7 L;  3ZT4 A;  3AVH A;  2P9U B;  3BVW A;  1QQO A;  3SUP A;  1WBB A;  3ZET B;  3C95 A;  4EZQ A;  4CBU A;  5JS1 A;  1HX1 A;  1QX1 A;  4CF2 A;  1I4L A;  3A5O C;  4NLC A;  2GUP A;  3VTH A;  2W42 A;  2EX3 A;  3QEP A;  4FZY A;  3ZSV A;  1YUW A;  2IC3 A;  1HYS A;  3MEG A;  4CF8 A;  3HJF A;  4WV7 A;  4I2Q A;  1I39 A;  3D2F A;  5HOO A;  4GV3 A;  4NCA A;  1LW0 A;  3BUZ B;  2YJE A;  3S9H A;  1GLE G;  2NRH A;  5HRS A;  3SV4 A;  4BC4 A;  2VCP A;  4M42 A;  4BY9 C;  3ZSQ A;  4CZI A;  3QBX A;  2YHA A;  3GL1 A;  3ASM A;  5F2R A;  1ITG A;  1NMD A;  1KLM A;  5BRF A;  1DG4 A;  3IAY A;  1U6Z A;  4E1J A;  2Q12 A;  4DYL A;  3K9K A;  4FLV A;  1ZBL A;  2YL8 A;  2ZGZ A;  1JXB A;  2WIN M;  4CE9 A;  3LWM A;  3EJT A;  4DF8 A;  4JI6 K;  2E8A A;  4ZTJ A;  1KVB A;  3ID6 A;  4DV7 K;  3VGL A;  1SKW A;  3NFA A;  4E3C A;  1W7A A;  2FF3 B;  4BEB A;  3EE8 A;  5KQ8 A;  4FWQ A;  4M41 A;  4BRI A;  4HTU A;  4U7B A;  3WEE A;  3TAQ A;  5GAD P;  1XWL A;  4ELV A;  4KHN A;  2I7P A;  3G0Z A;  4OX9 K;  4O5F A;  2GEM A;  3SZ2 A;  4FJM A;  1IKW A;  3V81 A;  1WDZ A;  4I9L A;  1TK8 A;  1VSI A;  4NYF A;  2OTL N;  3M8Q A;  3CKD A;  4FK0 A;  4BRA A;  2P9K B;  3SV3 A;  4AM6 A;  3KAV A;  1IBK K;  4B8C A;  4IXC A;  3HAI A;  2QWR A;  4GW6 A;  3VER A;  4EHT A;  4J2D A;  4PWD A;  4JKE A;  1CXU A;  4M0M A; 
#chains in the Genus database with same CATH homology
 2D1K A;  3OA9 A;  3N4P A;  4MO5 A;  4M63 C;  4BRN A;  3EO3 A;  3CC4 N;  3NMU A;  1K73 O;  4EZZ A;  1P90 A;  1JCF A;  2WC9 A;  3TSQ A;  4ISF A;  5GIP A;  3I33 A;  3SBT B;  3WXK A;  1O13 A;  2E88 A;  3M3Z A;  4GVE A;  3HTV A;  5JVH L;  3QBW A;  5AQP A;  4BE7 B;  1RDU A;  3EZW A;  4FVU A;  1KAY A;  3MK6 A;  4CI6 A;  3D2E A;  3JS6 A;  1DKY A;  4WQ4 C;  2A3Z A;  3I56 N;  2CGJ A;  3R8E A;  1TUY A;  2YHY A;  4K43 A;  3WXI A;  4CD1 A;  5AQU A;  2OAN A;  3WT0 A;  4WCE L;  2KHO A;  3DWL A;  3OW2 M;  3LDL A;  3EKS A;  4CZE A;  4R5G A;  2OBL A;  4H0O A;  3VF6 A;  5ELZ A;  1ILY A;  2C1I A;  5AFU A;  4IJA A;  4QS9 A;  4RTF D;  4YDU A;  2YX6 A;  1RFQ A;  4KH6 A;  4EZN A;  5M1N A;  3CXC M;  1VQ7 N;  4OO1 J;  3U8X A;  3OHR A;  2H3G X;  2HBK A;  3H3N O;  1NGJ A;  1QZ5 A;  2NRT A;  3MN7 A;  1ZC6 A;  2P9L A;  3ATV A;  1SAZ A;  4FWP A;  2PBD A;  3UKR B;  4CJ7 A;  1X9J A;  5FPD A;  3VEB A;  1IJJ A;  2P9I A;  3H45 C;  4HR1 B;  4GV6 A;  4MLH A;  4OPA A;  2W00 A;  1YIJ N;  2YJF A;  2RHK A;  3ZEU A;  4OPH A;  3LL3 A;  2ZJQ L;  3C6A A;  3O9Q A;  4JAX A;  1XUP O;  3FZH A;  3KDR A;  5FPN A;  4YOU A;  2ZJP L;  4HWI A;  4KBO A;  4J8F A;  1UPX A;  1KD1 O;  4IM2 A;  3WQU A;  1KAZ A;  5FPE A;  4I43 A;  1GNT A;  2P9S A;  2ITM A;  2JWK A;  3TTC A;  3VEY A;  1NGI A;  2CH6 A;  3QNJ A;  4FWL A;  2BTF A;  3CMA N;  4I6M A;  4DCH A;  3VEN A;  4K41 A;  3C65 A;  3PLA A;  4FPB A;  3TU5 A;  3WUH A;  4CD3 A;  3VF4 A;  1ATN A;  4FWS A;  2F9T A;  2NZT A;  2GAF D;  3GI7 A;  3O1W A;  4BR5 A;  2EWS A;  2CGL A;  3MX5 A;  4R79 A;  4CZF A;  1Q86 O;  4JKH A;  3A5L C;  5M1P A;  3ER8 C;  2P9K A;  2ZWH A;  1ZBS A;  4MQD A;  3IDH A;  5AQI A;  2ND1 A;  3O9U A;  4R5L A;  1TYQ B;  3PIO L;  3DQG A;  4CZM A;  2WBN A;  4H0V B;  4DB3 A;  4JD2 A;  2VWB A;  2YCH A;  1GLB G;  7HSC A;  4BRL A;  3O4W A;  3TSU A;  2A40 A;  3MN5 A;  1OA0 A;  2GA9 D;  1E4G T;  4A57 A;  4CZL A;  2QA4 N;  4B1Z A;  4U67 L;  3SK3 A;  4PL7 A;  3DOB A;  2A42 A;  1H1V A;  1HKB A;  3O3N B;  2HOE A;  4FPA A;  2NRR A;  4AM7 A;  3QIC A;  1DGK N;  4ISE A;  4K42 A;  3WQT A;  4WF9 L;  2YIA A;  2HF3 A;  1JCG A;  3H6E A;  5FLE X;  5AR0 A;  3UKU A;  4D8J A;  1NM1 A;  2HBL A;  4BEC A;  5ADX A;  3ENO A;  1VQ4 N;  2ASO A;  4PKH A;  4YOY A;  3LDO A;  3P4I A;  2NLX A;  2ND0 A;  3Q7C A;  4JNF A;  4FSV A;  1YXQ A;  3WXJ A;  1C0G A;  1NGC A;  1SU8 A;  3ID8 A;  3UB5 A;  4RCH A;  3D2E B;  3HSC A;  4JHD B;  3U4L A;  4BRE A;  2WUS A;  4JK7 A;  3FGU A;  3PIP L;  3EL2 A;  1SZ2 A;  4IW0 A;  2Q0R A;  3LDQ A;  5GAG P;  1DT9 A;  4IFE A;  1YJW N;  2ZJR L;  3S41 A;  3ATU A;  3VEW A;  2Q97 A;  3A0I X;  4XEI A;  2HBM A;  4A5A A;  4B1U B;  5I9E B;  5EY4 A;  1VQ9 N;  2E2Q A;  2D0P A;  1NJI O;  2NRV A;  1EO1 A;  1DEJ A;  3VES A;  1YHQ N;  1BA1 A;  3FZK A;  3R3L A;  3T47 A;  5C0Y A;  4CZH A;  3AAP A;  4EZX A;  3U9Z A;  1MWK A;  2Q31 A;  3QFP A;  1QVG M;  2GTD A;  3C7N A;  5AQR A;  3ZX0 A;  3AAR A;  2E1Y A;  4BRP A;  2P9P B;  5BR9 A;  3VPZ A;  3ENB A;  4HY9 A;  4IWQ A;  3CJC A;  3MWP A;  4NLB A;  5F1X A;  1RDW X;  2QFF A;  4JK9 A;  2RE2 A;  3KK7 A;  1NGH A;  1K8K B;  1VQN N;  3IKM A;  3T46 A;  4O8U A;  3CCV N;  1K9M O;  2LM0 A;  2V7Y A;  2YHX A;  3FFK B;  4EAH D;  3L4Q A;  3CJ7 A;  1WOQ A;  3SBS A;  1NGB A;  1OVY A;  3JXU A;  2HF4 A;  3LMF A;  1NBW A;  5LY3 A;  4H5T A;  4C1N K;  5GIN A;  2P9S B;  2GWK A;  2F7T A;  4JKB A;  5GAE P;  3GBT A;  3DXK A;  5EXW A;  1GLA G;  4KH5 A;  5C12 A;  1C0F A;  1U2V A;  1Q82 O;  1D4X A;  2QXL A;  3NVK A;  1GNL A;  1Z05 A;  5E26 A;  3B8A X;  5E84 A;  5AFU H;  3VEX A;  1XC3 A;  4NPH A;  3MCP A;  3ERC C;  4YOT A;  4IJN A;  5BN9 A;  1HJO A;  3AAQ A;  4BR7 A;  3VET A;  3P31 A;  2V51 B;  3VEZ A;  3AY9 A;  4C1N I;  4BRD A;  3VF2 A;  5H1S Q;  3OHX M;  2FSN A;  3E66 A;  3HZ6 A;  3M6G A;  4KIK A;  3C0B A;  3R1X A;  2RT6 A;  2W41 A;  1MJG A;  2BUP A;  4A62 A;  3ZX2 A;  4JNE A;  5JLH A;  3O9S A;  4WYB A;  5BN8 A;  3UIT A;  3CPE A;  3BF3 A;  1Q18 A;  1JCE A;  3D2F B;  1BPR A;  4JKF A;  1G99 A;  4JWD A;  5ADX H;  2NCZ A;  4ILG A;  4PL8 A;  3WXM B;  5MLC Q;  1GLJ O;  4FOI A;  2QTD A;  1S3X A;  4JLC A;  4L3Q A;  4WV5 A;  4CZJ A;  4NB4 A;  2QWN A;  4GV9 A;  4WFA L;  1Z6R A;  2Z8Y A;  1W9M A;  1IG8 A;  3GE1 A;  1N8R O;  3QA8 A;  4BR9 A;  4IOC L;  4H6I A;  4BRC A;  3ZEF A;  1SQK A;  3DXM A;  3FE1 A;  3FLC O;  3LM9 A;  3CCL N;  4R5K A;  5LJW A;  1GLD G;  3HOT A;  3GG4 A;  1DKG D;  2GEL A;  2IIR A;  4H5N A;  4JWE A;  1GLF O;  2C1G A;  1P8Z A;  2QWO A;  3UE5 A;  4A2A A;  3K9J A;  5EX5 A;  3O08 A;  1YAG A;  3G4S N;  3I8B A;  2YI1 A;  4XH4 A;  5C2D A;  4ISG A;  2QWQ A;  1SU7 A;  2QWL A;  3HRG A;  4F00 A;  4BR0 A;  2E2N A;  2PY6 A;  1BWF O;  3L4I A;  4A59 A;  3TTD A;  4EZY A;  4JKA A;  4PKG A;  5AQJ A;  4YOR A;  3RV1 A;  5AQH A;  3SBG A;  3LDN A;  4EIA A;  2YIB A;  1LOT B;  5C10 A;  4QS8 A;  5KQD A;  3CCS N;  3CJB A;  3MMV A;  1YVN A;  1KC8 O;  1K8A O;  1NGF A;  3O9R A;  4DHY A;  3BP8 A;  1MWM A;  4WFN L;  5JIC A;  2EWF A;  5M1F A;  4EFH A;  4BR2 A;  4B1V A;  3MX2 A;  4H0Y B;  1SS6 A;  4NO7 A;  1HPM A;  5AQX A;  2NRZ A;  3MN6 A;  4BQZ A;  4WQ5 A;  2P9N A;  3CER A;  1OKJ A;  4WQ5 C;  3CCQ N;  3RSE A;  5M1Q A;  1K8K A;  3H3O B;  4EZV A;  4IM3 A;  3O80 A;  5CE3 A;  1WUA A;  4O8K A;  4G9Z A;  3ZX3 A;  3DPQ A;  3CCU N;  3SAH A;  2ZF5 O;  4FWO A;  3NVM A;  2ZGY A;  3KAW A;  2P9L B;  3HI0 A;  3CQY A;  1HKG A;  2I7N A;  4UY8 O;  2BH1 A;  3SAF A;  5LJV A;  2QW9 A;  3ULE A;  3QDK A;  3F7W A;  4Y0W A;  4ILH B;  3SLC A;  3D7E O;  1QVF M;  2V52 B;  4CBW A;  5C2F A;  1VQK N;  2CH5 A;  4JKG A;  4MDB A;  3EKU A;  4XH1 A;  1MA9 B;  1RGI A;  3N8E A;  1JQK A;  4BRG A;  4C23 A;  3EN9 A;  5KPR A;  2W40 A;  3KZB A;  3GOI A;  4IEE A;  5KPZ A;  3J7Z O;  2HBJ A;  1KXP A;  1ZYL A;  3IMX A;  3M1F A;  2NRX A;  3W3D A;  1QQN A;  4BRK A;  4I6M B;  1BDG A;  3G25 A;  2E2O A;  1BU6 O;  1VQM N;  1BG3 A;  4FWN A;  1Q81 O;  3T49 A;  4HTL A;  4IDH A;  2QM1 A;  4KIK B;  3FZL A;  2P9U A;  3O9T A;  4DKW A;  2VGN A;  1NGA A;  2Q0U A;  5AQV A;  4JWI A;  1T6C A;  2OP6 A;  5AQT A;  3VEA A;  2QWM A;  2QEX N;  3WXL A;  2JNS A;  3CJ9 A;  2PAV A;  2EX3 B;  3T69 A;  4Z94 A;  2A41 A;  5AZI A;  4ILG B;  1Q7Y O;  2JWL A;  4HYB A;  5AQM A;  1QZ6 A;  4JD2 B;  3DPO A;  4IOX A;  1ATR A;  1BA0 A;  4JEP A;  5DM6 L;  3AGR A;  4PKI A;  2FSJ A;  4ILI A;  3KVG A;  4BG8 A;  4BRH A;  3MCA B;  3MDQ A;  5C15 A;  3MN9 A;  5AQK A;  1X3M A;  4EZT A;  1T44 A;  4QS7 A;  1E2U A;  3E9P A;  2YIV X;  4IEI A;  1OA1 A;  3U9D A;  2NRW A;  5AQZ A;  3CCR N;  3G71 N;  3KWG A;  4H0P A;  4JKC A;  3RVC A;  4DQ8 A;  4JK8 A;  2BPR A;  2IVO A;  2FF6 A;  1V4T A;  3FZF A;  3CCM N;  1VQ6 N;  1HUX A;  3I01 A;  4FL9 A;  4LC9 B;  2YHW A;  4A5B A;  3FR0 A;  4IO9 L;  2WFB A;  5BRE A;  4YDU C;  3FD9 A;  4BRO A;  3VGM A;  3CHW A;  4JL9 A;  5B8H A;  1YI2 N;  1KQS M;  4E81 A;  2J4R A;  2HMP A;  1DKZ A;  4R5J A;  4JHD A;  4BRF A;  4JN4 A;  1MDU B;  1BOT O;  2IVN A;  5AZJ A;  3CD6 N;  3B51 X;  4H5V A;  3C6H A;  1VQL N;  5BPN A;  2A6A A;  1NLV A;  4IWV A;  3ZEU B;  4EHU A;  5BRH A;  3QB0 A;  5EOY A;  3EE9 A;  3F2K A;  1QQM A;  5AQY A;  2AP1 A;  3P38 A;  3DPP A;  2P9N B;  4FOE A;  3RSE B;  1M90 O;  2Q36 A;  3HOS A;  4XH5 A;  4BG9 A;  5GIO A;  4FM3 A;  4EZO A;  2OBM A;  3H1Q A;  3I04 A;  4MDA A;  3G6E N;  2PFU A;  3HM8 A;  4BC2 A;  4F9O A;  1VQP N;  2YI9 A;  3BF1 A;  4B1W B;  2ASM A;  1HLU A;  3LDP A;  3CJA A;  4K25 A;  4R5I A;  5AQO A;  3QFU A;  2AA4 A;  1GLC G;  4UDY X;  1KAX A;  3AGK A;  3CIP A;  4FWK A;  5FIG A;  4EZP A;  4IO8 A;  3WEE B;  3ULE B;  3SAG A;  4FWR A;  4G6Q A;  1TUU A;  1OAO A;  4H0T B;  1E1D A;  4H0X B;  4ILH A;  4B1X B;  4BC5 A;  4IWP A;  3CC2 N;  3CPW M;  4AF1 A;  1GN9 A;  3BEX A;  5KPT A;  2IVP A;  1LCU A;  1Q5L A;  3VGK A;  4YOW A;  3A5N C;  4H03 B;  3CME N;  4CBX A;  1SUF A;  1NGG A;  3O1B A;  3T7Z A;  1J6Z A;  3TTF A;  5BPL A;  4YOV A;  4A2B A;  1R59 O;  3A98 A;  1GLL O;  1U2V B;  2Q1N A;  5HL7 L;  4H5R A;  1BO5 O;  3ENH A;  2P9U B;  1E4F T;  1QQO A;  1YIT N;  1S22 A;  3B53 X;  1T6D A;  1V4S A;  4BRQ A;  3M5R A;  4H6H A;  3ZET B;  4EZQ A;  4CBU A;  3CC7 N;  1HX1 A;  1Y64 A;  4KH4 A;  2DPN A;  4EZU A;  3A5O C;  4NLC A;  1NGE A;  2GUP A;  3UKU B;  3VMF B;  3O5B A;  3VTH A;  4WQ4 A;  3GDQ A;  3FZM A;  3HBT A;  2D4W A;  5BPM A;  3L6Q A;  3ZYY X;  2VGM A;  5AZI B;  5FPM A;  4MO4 A;  3CET A;  3VTI A;  1YUW A;  1CKR A;  3VEV A;  4UDX X;  3T48 A;  3D6R A;  4FWM A;  4WV7 A;  3DJC A;  1VQO N;  4M7Y A;  3ER9 B;  2QWP A;  3D2F A;  3O8M A;  5HOO A;  3KWI A;  4GV3 A;  3SMP A;  4BGB A;  2D0O A;  5TKY A;  3SMS A;  1XQS C;  2N3K A;  3BUZ B;  4M7X A;  3TSP A;  3SBT A;  2YJE A;  4BGA A;  1GLE G;  2NRH A;  4BC3 A;  1CZA N;  4GY2 B;  4JWC A;  2NNW A;  4BC4 A;  3DLL L;  3O3O B;  3MWT A;  2VCP A;  1YJN N;  4BY9 C;  3B52 X;  2E20 A;  5AQQ A;  4CZI A;  3QBX A;  5AQN A;  4MLE A;  2FSK A;  5EVZ A;  3E1Y A;  4JKD A;  2GWJ A;  4BRM A;  3DXM B;  1X3N A;  3C7N B;  1ESV A;  4IWO A;  2V7Z A;  3GL1 A;  4CZG A;  2OTJ N;  5F2R A;  1EQY A;  3RV0 A;  2P9P A;  1ATS A;  1NMD A;  1BUP A;  3LM2 A;  5AQL A;  5TKW A;  5M1K A;  5BRF A;  3I55 N;  1DG4 A;  3SJH A;  1HKC A;  1U6Z A;  5AZJ B;  4E1J A;  3QML A;  2Q2R A;  3CJ1 A;  4FO0 A;  1S72 N;  4IM0 A;  3K9K A;  4IOA L;  3CCJ N;  1M1K O;  4F01 A;  2ZGZ A;  2VYP A;  2WIN M;  3P39 A;  1QHA A;  5AQS A;  1E9V A;  3OBW A;  2E8A A;  4GNI A;  4CZK A;  4YOX A;  3ID6 A;  1NWK A;  3T4A G;  3VGL A;  1VAZ A;  3UKR A;  4E3C A;  3E9O A;  2P9I B;  4BVO A;  4HR1 A;  1W2B M;  2A5X A;  2E1Z A;  2FF3 B;  4A61 A;  2E2P A;  3EE8 A;  3VKH A;  3DXK B;  4B9Q A;  4BEB A;  5M1O A;  3A5M C;  3OWG A;  5CHI A;  5KQ8 A;  4FWQ A;  2X5C A;  4BRI A;  3W0L A;  4WFB L;  1DKX A;  4EZS A;  3F9M A;  3H1V X;  4U7B A;  1T3V A;  2YI8 A;  3WEE A;  5AQF A;  1W97 L;  5GAD P;  3VOV A;  5DM7 L;  1JJ2 M;  3H0X A;  2I7P A;  5F0X A;  5JMV A;  1VQ5 N;  3J8A A;  4RWT A;  4O5F A;  4BVP A;  4IZ9 A;  2FXU A;  2GEM A;  4XJX A;  3N4Q A;  3Q7B A;  3IFR A;  3OBY A;  5CR4 A;  4BR4 A;  2QI2 A;  1ZXO A;  2KKZ A;  2OTL N;  2UYT A;  3I39 X;  3KHY A;  5AQG A;  3CI5 A;  2CGK A;  4EZW A;  4ILJ A;  4PHT X;  4EZR A;  1YF5 L;  4BRA A;  3O3M B;  2P9K B;  4JKG B;  1YJ9 N;  2GX9 A;  5GAH P;  1VQ8 N;  3CCE N;  3ZED A;  4AM6 A;  4B1Y B;  2FLO A;  3KAV A;  1NGD A;  1TYQ A;  3H46 O;  3IUC A;  3L0Q A;  3E9L A;  3TPQ A;  3R6M A;  5JLF A;  5JVG L;  1U00 A;  3A8Y A;  3DAW A;  2HST A;  3ZET A;  5AQW A;  5BRD A;  4IXC A;  2KLA A;  2QWR A;  2ASP A;  4PO2 A;  2F9W A;  3O6W A;  3VER A;  3VEO A;  4EHT A;  4BQL A;  3R9P A;  1SU6 A;  3L3O M;  3F5T A;  4H5W A;  4JKE A;  3CF5 L;  3CQX A;  4M0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...