4JNFA

Allosteric opening of the polypeptide-binding site when an hsp70 binds atp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
213
structure length
213
Chain Sequence
SVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords Hsp70 CHAPERONE DnaK
total genus 64
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2013-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jnfA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jnfA01
4F00A 2V7YA 3T46A 3T48A 4EZVA 4F01A 3T4AG 2BPRA 1DKYA 4EZZA 4EZYA 1YUWA 4JWIA 7HSCA 3DPOA 4JWEA 3QNJA 4R5GA 4R5KA 1DG4A 4EZPA 3DPPA 4JNEA 5E84A 3D2EA 4EZUA 4EZOA 4EZRA 4JWCA 4R5JA 3H0XA 4E81A 1U00A 4EZTA 1DKXA 4B9QA 4R5LA 3DOBA 3OHXM 3T49A 1BPRA 4EZWA 3T47A 2KHOA 1Q5LA 2WINM 4WV7A 3D2FA 4JNFA 4H6IA 3C7NA 3L3OM 2QFFA 3DPQA 4EZNA 5TKYA 4PO2A 4HY9A 2QXLA 3DQGA 3N8EA 4EZSA 4EZQA 4WV5A 4R5IA 4FL9A 4EZXA 2OP6A 4H6HA 1CKRA 1DKZA 3C7NB 4HYBA 4JWDA 4JN4A
chains in the Genus database with same CATH superfamily
2OBMA 3I01A 3D52A 3T46A 4EZVA 4EZZA 1O7DC 3D51A 4WPEA 4JWIA 2YL9A 4BNEA 2ND1A 3LVTA 4JWEA 2F18A 3BUBA 3BUIA 3BLBA 3LLLA 4IWOA 2F7PA 3ZEDA 2OW7A 2YIVX 3DX0A 3BVUA 3BVVA 4IM3A 4JNEA 2Z8YA 5E84A 2N3KA 4G6QA 1QWNA 4AZHA 4JWCA 3H0XA 4E81A 4HR1A 2X3VA 4EZTA 1PS3A 2YI8A 3EJRA 3LMFA 3B51X 2F1BA 1E1DA 1GNTA 4IWPA 3VEAA 4AZIA 1Y2OA 1JQKA 2OZNB 2YIBA 4JNFA 4KIKA 1TQVA 3CZNA 3L3OM 3DPQA 3DX2A 4ILGA 3BUDA 1URUA 1SUFA 4E3CA 1QWUA 1X03A 3Q0KA 4EZQA 2ELBA 3VEBA 4FL9A 4AKVA 3C7NB 2FICA 3ACOA 2PY6A 2ZXQA 3QNIA 1W9MA 1R33A 3A98A 1UPXA 2GA9D 2EWFA 3T48A 1SU6A 2V0OA 1TQWA 1DKYA 4HR1B 1OA0A 2BPRA 3UITA 1R5EA 1O7DB 2EFLA 2GAFD 3EJSA 3KAWA 3SBSA 3RV0A 1MJGA 2EFKA 3CZSA 3G9GA 3Q84A 3DDFA 3CAZA 3FD9A 3DPPA 3I2WA 3QWEA 2RAIA 2Z0VA 4EZOA 4UDYX 1GNLA 5FIGA 4EZRA 1E2UA 1TQTA 3SOGA 1ZWWA 4DCNC 1U00A 2JNSA 4FZOA 1LQ7A 1X04A 3PLTA 4JL9A 4NSWA 4R5LA 3T49A 4B9QA 1Q5LA 4H8SA 3DOBA 1I4TA 2WINM 4I43A 1YWMA 4M0MA 3F7WA 4AZBA 1HWWA 2OBLA 3D4ZA 1I4LA 2D4CA 2PMRA 3O3NB 4ATMA 4AVMA 4EZSA 2Q12A 1OA1A 3ER9B 2WYIA 3ER8C 4R5IA 4EZXA 3OWGA 3L3PA 4ILHB 3BVWA 2GF4A 2YL6A 4F00A 2V7YA 1R34A 3BVTA 4JLCA 2EX3B 3CV5A 3QA8A 1YUWA 2RAKA 2QKWA 2YL8A 2Z0NA 3KAVA 3O3OB 2Z0OA 2YIAA 3CVRA 4UDXX 5FLEX 3SBTB 4R5KA 2ND0A 3RPMA 3D4YA 1TQUA 4IM0A 4MQDA 2LM0A 3KDRA 3I39X 3CKDA 4AZCB 4FZPA 4EZUA 3HAJA 4NQIA 2NCZA 4FM3A 4D8JA 2F7QA 2MI7A 2YI9A 3DX1A 3I04A 4KIKB 4R5JA 4AZ7A 3B52X 4EZWA 3T47A 2X5CA 4I1QA 2RAJA 1OAOA 4WV7A 2Q13A 1GN9A 3D2FA 2X3WA 2YL5A 2QFFA 2YLAA 3DDGA 4EZNA 3DQGA 3N8EA 4IM2A 2FYVA 3BUQA 3BVXA 3GI7A 3QE6A 1QX1A 2OP6A 3EJPA 4H6HA 1CKRA 1DKZA 1I4DA 1E9VA 2RT6A 4HYBA 2WYHA 7HSCA 2YKTA 1WDZA 3O3MB 3HAIA 4JN4A 4F01A 2F7OA 5KBPA 3EJQA 4WV5A 3T4AG 4EZYA 5C5BB 4AZCA 4AZGA 3DPOA 2O0I1 3BUPA 2F7RA 3QNJA 2ALWA 4R5GA 3SYVA 4DYLA 3D50A 1DG4A 2C08A 4EZPA 2F1AA 1TQSA 2D1LA 4WPCA 3D2EA 2YLLA 2LXYA 4ILIA 3ABHA 4FZSA 1HTYA 1HXKA 3EJUA 1DKXA 2X3XA 3VKHA 1I49A 3EJTA 3DX3A 3OHXM 3ERCC 2KHOA 3M3WA 1SU7A 1BPRA 3B53X 3RV1A 4AZ6A 3C7NA 4H6IA 3DX4A 5TKYA 4HY9A 2JNKA 2QXLA 3OK8A 4AZ5A 4PO2A 3DYTA 1ZYLA 1SU8A 3HAHA 2OO2A 2OW6A 3ZEFA 5C5BA 4NPHA 4IW0A 4JWDA 4IWQA
chains in the Genus database with same CATH topology
2OBMA 3I01A 3T46A 4EZVA 4EZZA 4JWIA 2ND1A 4JWEA 4IWOA 3ZEDA 2YIVX 4IM3A 4JNEA 2Z8YA 5E84A 2N3KA 4G6QA 4JWCA 3H0XA 4E81A 4HR1A 4EZTA 2YI8A 4IWPA 3LMFA 3B51X 1E1DA 1GNTA 3VEAA 1JQKA 2YIBA 4JNFA 4KIKA 3L3OM 3DPQA 4ILGA 1SUFA 4E3CA 4EZQA 3VEBA 4FL9A 3C7NB 2PY6A 1W9MA 3A98A 1UPXA 2GA9D 2EWFA 3T48A 1SU6A 4HR1B 2BPRA 1DKYA 1OA0A 3UITA 2GAFD 3SBSA 3KAWA 3RV0A 1MJGA 3FD9A 3DPPA 4EZOA 4UDYX 1GNLA 5FIGA 4EZRA 1E2UA 1U00A 2JNSA 4JL9A 4B9QA 4R5LA 3DOBA 3T49A 1Q5LA 2WINM 4I43A 4M0MA 3F7WA 2OBLA 3ER9B 3O3NB 4EZSA 3ER8C 1OA1A 4R5IA 4EZXA 3OWGA 4ILHB 4F00A 2V7YA 4JLCA 2EX3B 3QA8A 1YUWA 7HSCA 3O3OB 3KAVA 4UDXX 5FLEX 2YIAA 3SBTB 4R5KA 2ND0A 4MQDA 4IM0A 2LM0A 3KDRA 3I39X 4EZUA 4D8JA 2NCZA 4FM3A 4KIKB 4R5JA 2YI9A 3I04A 3B52X 4EZWA 3T47A 2X5CA 4WV7A 1OAOA 1GN9A 3D2FA 2QFFA 4EZNA 3DQGA 3N8EA 4IM2A 3GI7A 2OP6A 1CKRA 4H6HA 1DKZA 2RT6A 1E9VA 4HYBA 4JN4A 4F01A 3O3MB 4WV5A 3T4AG 4EZYA 3DPOA 3QNJA 4R5GA 1DG4A 4EZPA 3D2EA 4ILIA 3VKHA 1DKXA 3OHXM 1BPRA 3ERCC 2KHOA 1SU7A 3B53X 3RV1A 3C7NA 4H6IA 5TKYA 4PO2A 4HY9A 2QXLA 1ZYLA 1SU8A 3ZEFA 4NPHA 4IW0A 4JWDA 4IWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F00 A;  2V7Y A;  3T46 A;  3T48 A;  4EZV A;  4F01 A;  3T4A G;  2BPR A;  1DKY A;  4EZZ A;  4EZY A;  1YUW A;  4JWI A;  7HSC A;  3DPO A;  4JWE A;  3QNJ A;  4R5G A;  4R5K A;  1DG4 A;  4EZP A;  3DPP A;  4JNE A;  5E84 A;  3D2E A;  4EZU A;  4EZO A;  4EZR A;  4JWC A;  4R5J A;  3H0X A;  4E81 A;  1U00 A;  4EZT A;  1DKX A;  4B9Q A;  4R5L A;  3DOB A;  3OHX M;  3T49 A;  1BPR A;  4EZW A;  3T47 A;  2KHO A;  1Q5L A;  2WIN M;  4WV7 A;  3D2F A;  4JNF A;  4H6I A;  3C7N A;  3L3O M;  2QFF A;  3DPQ A;  4EZN A;  5TKY A;  4PO2 A;  4HY9 A;  2QXL A;  3DQG A;  3N8E A;  4EZS A;  4EZQ A;  4WV5 A;  4R5I A;  4FL9 A;  4EZX A;  2OP6 A;  4H6H A;  1CKR A;  1DKZ A;  3C7N B;  4HYB A;  4JWD A;  4JN4 A; 
#chains in the Genus database with same CATH topology
 2OBM A;  3I01 A;  3D52 A;  3T46 A;  4EZV A;  4EZZ A;  1O7D C;  3D51 A;  4WPE A;  4JWI A;  2YL9 A;  4BNE A;  2ND1 A;  3LVT A;  4JWE A;  2F18 A;  3BUB A;  3BUI A;  3BLB A;  3LLL A;  4IWO A;  2F7P A;  3ZED A;  2OW7 A;  2YIV X;  3DX0 A;  3BVU A;  3BVV A;  4IM3 A;  4JNE A;  2Z8Y A;  5E84 A;  2N3K A;  4G6Q A;  1QWN A;  4AZH A;  4JWC A;  3H0X A;  4E81 A;  4HR1 A;  2X3V A;  4EZT A;  1PS3 A;  2YI8 A;  3EJR A;  3LMF A;  3B51 X;  2F1B A;  1E1D A;  1GNT A;  4IWP A;  3VEA A;  4AZI A;  1Y2O A;  1JQK A;  2OZN B;  2YIB A;  4JNF A;  4KIK A;  1TQV A;  3CZN A;  3L3O M;  3DPQ A;  3DX2 A;  4ILG A;  3BUD A;  1URU A;  1SUF A;  4E3C A;  1QWU A;  1X03 A;  3Q0K A;  4EZQ A;  2ELB A;  3VEB A;  4FL9 A;  4AKV A;  3C7N B;  2FIC A;  3ACO A;  2PY6 A;  2ZXQ A;  3QNI A;  1W9M A;  1R33 A;  3A98 A;  1UPX A;  2GA9 D;  2EWF A;  3T48 A;  1SU6 A;  2V0O A;  1TQW A;  1DKY A;  4HR1 B;  1OA0 A;  2BPR A;  3UIT A;  1R5E A;  1O7D B;  2EFL A;  2GAF D;  3EJS A;  3KAW A;  3SBS A;  3RV0 A;  1MJG A;  2EFK A;  3CZS A;  3G9G A;  3Q84 A;  3DDF A;  3CAZ A;  3FD9 A;  3DPP A;  3I2W A;  3QWE A;  2RAI A;  2Z0V A;  4EZO A;  4UDY X;  1GNL A;  5FIG A;  4EZR A;  1E2U A;  1TQT A;  3SOG A;  1ZWW A;  4DCN C;  1U00 A;  2JNS A;  4FZO A;  1LQ7 A;  1X04 A;  3PLT A;  4JL9 A;  4NSW A;  4R5L A;  3T49 A;  4B9Q A;  1Q5L A;  4H8S A;  3DOB A;  1I4T A;  2WIN M;  4I43 A;  1YWM A;  4M0M A;  3F7W A;  4AZB A;  1HWW A;  2OBL A;  3D4Z A;  1I4L A;  2D4C A;  2PMR A;  3O3N B;  4ATM A;  4AVM A;  4EZS A;  2Q12 A;  1OA1 A;  3ER9 B;  2WYI A;  3ER8 C;  4R5I A;  4EZX A;  3OWG A;  3L3P A;  4ILH B;  3BVW A;  2GF4 A;  2YL6 A;  4F00 A;  2V7Y A;  1R34 A;  3BVT A;  4JLC A;  2EX3 B;  3CV5 A;  3QA8 A;  1YUW A;  2RAK A;  2QKW A;  2YL8 A;  2Z0N A;  3KAV A;  3O3O B;  2Z0O A;  2YIA A;  3CVR A;  4UDX X;  5FLE X;  3SBT B;  4R5K A;  2ND0 A;  3RPM A;  3D4Y A;  1TQU A;  4IM0 A;  4MQD A;  2LM0 A;  3KDR A;  3I39 X;  3CKD A;  4AZC B;  4FZP A;  4EZU A;  3HAJ A;  4NQI A;  2NCZ A;  4FM3 A;  4D8J A;  2F7Q A;  2MI7 A;  2YI9 A;  3DX1 A;  3I04 A;  4KIK B;  4R5J A;  4AZ7 A;  3B52 X;  4EZW A;  3T47 A;  2X5C A;  4I1Q A;  2RAJ A;  1OAO A;  4WV7 A;  2Q13 A;  1GN9 A;  3D2F A;  2X3W A;  2YL5 A;  2QFF A;  2YLA A;  3DDG A;  4EZN A;  3DQG A;  3N8E A;  4IM2 A;  2FYV A;  3BUQ A;  3BVX A;  3GI7 A;  3QE6 A;  1QX1 A;  2OP6 A;  3EJP A;  4H6H A;  1CKR A;  1DKZ A;  1I4D A;  1E9V A;  2RT6 A;  4HYB A;  2WYH A;  7HSC A;  2YKT A;  1WDZ A;  3O3M B;  3HAI A;  4JN4 A;  4F01 A;  2F7O A;  5KBP A;  3EJQ A;  4WV5 A;  3T4A G;  4EZY A;  5C5B B;  4AZC A;  4AZG A;  3DPO A;  2O0I 1;  3BUP A;  2F7R A;  3QNJ A;  2ALW A;  4R5G A;  3SYV A;  4DYL A;  3D50 A;  1DG4 A;  2C08 A;  4EZP A;  2F1A A;  1TQS A;  2D1L A;  4WPC A;  3D2E A;  2YLL A;  2LXY A;  4ILI A;  3ABH A;  4FZS A;  1HTY A;  1HXK A;  3EJU A;  1DKX A;  2X3X A;  3VKH A;  1I49 A;  3EJT A;  3DX3 A;  3OHX M;  3ERC C;  2KHO A;  3M3W A;  1SU7 A;  1BPR A;  3B53 X;  3RV1 A;  4AZ6 A;  3C7N A;  4H6I A;  3DX4 A;  5TKY A;  4HY9 A;  2JNK A;  2QXL A;  3OK8 A;  4AZ5 A;  4PO2 A;  3DYT A;  1ZYL A;  1SU8 A;  3HAH A;  2OO2 A;  2OW6 A;  3ZEF A;  5C5B A;  4NPH A;  4IW0 A;  4JWD A;  4IWQ A; 
#chains in the Genus database with same CATH homology
 2OBM A;  3I01 A;  3T46 A;  4EZV A;  4EZZ A;  4JWI A;  2ND1 A;  4JWE A;  4IWO A;  3ZED A;  2YIV X;  4IM3 A;  4JNE A;  2Z8Y A;  5E84 A;  2N3K A;  4G6Q A;  4JWC A;  3H0X A;  4E81 A;  4HR1 A;  4EZT A;  2YI8 A;  4IWP A;  3LMF A;  3B51 X;  1E1D A;  1GNT A;  3VEA A;  1JQK A;  2YIB A;  4JNF A;  4KIK A;  3L3O M;  3DPQ A;  4ILG A;  1SUF A;  4E3C A;  4EZQ A;  3VEB A;  4FL9 A;  3C7N B;  2PY6 A;  1W9M A;  3A98 A;  1UPX A;  2GA9 D;  2EWF A;  3T48 A;  1SU6 A;  4HR1 B;  2BPR A;  1DKY A;  1OA0 A;  3UIT A;  2GAF D;  3SBS A;  3KAW A;  3RV0 A;  1MJG A;  3FD9 A;  3DPP A;  4EZO A;  4UDY X;  1GNL A;  5FIG A;  4EZR A;  1E2U A;  1U00 A;  2JNS A;  4JL9 A;  4B9Q A;  4R5L A;  3DOB A;  3T49 A;  1Q5L A;  2WIN M;  4I43 A;  4M0M A;  3F7W A;  2OBL A;  3ER9 B;  3O3N B;  4EZS A;  3ER8 C;  1OA1 A;  4R5I A;  4EZX A;  3OWG A;  4ILH B;  4F00 A;  2V7Y A;  4JLC A;  2EX3 B;  3QA8 A;  1YUW A;  7HSC A;  3O3O B;  3KAV A;  4UDX X;  5FLE X;  2YIA A;  3SBT B;  4R5K A;  2ND0 A;  4MQD A;  4IM0 A;  2LM0 A;  3KDR A;  3I39 X;  4EZU A;  4D8J A;  2NCZ A;  4FM3 A;  4KIK B;  4R5J A;  2YI9 A;  3I04 A;  3B52 X;  4EZW A;  3T47 A;  2X5C A;  4WV7 A;  1OAO A;  1GN9 A;  3D2F A;  2QFF A;  4EZN A;  3DQG A;  3N8E A;  4IM2 A;  3GI7 A;  2OP6 A;  1CKR A;  4H6H A;  1DKZ A;  2RT6 A;  1E9V A;  4HYB A;  4JN4 A;  4F01 A;  3O3M B;  4WV5 A;  3T4A G;  4EZY A;  3DPO A;  3QNJ A;  4R5G A;  1DG4 A;  4EZP A;  3D2E A;  4ILI A;  3VKH A;  1DKX A;  3OHX M;  1BPR A;  3ERC C;  2KHO A;  1SU7 A;  3B53 X;  3RV1 A;  3C7N A;  4H6I A;  5TKY A;  4PO2 A;  4HY9 A;  2QXL A;  1ZYL A;  1SU8 A;  3ZEF A;  4NPH A;  4IW0 A;  4JWD A;  4IWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...