4JO2L

Crystal structure of rabbit mab r56 fab in complex with v3 crown of hiv-1 consensus a gp120
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
216
Chain Sequence
b'QVLTQTPSSVSTAVGSAVTINCQSSQNVYSNNNLAWFQQKPGQPPRLLIYDASKLASGVPSRFKGSGSGTQFTFTISDVQCDDAATFYCLGGYDCSSGDCAAFGGGTEVVVRGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal anti-HIV-1 gp120 V3 antibody R56 light chain
publication title Rabbit Anti-HIV-1 Monoclonal Antibodies Raised by Immunization Can Mimic the Antigen-Binding Modes of Antibodies Derived from HIV-1-Infected Humans.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system/viral protein
total genus 49
structure length 216
sequence length 216
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo2L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo2L01
4OTXH 5D2NA 4ZD3H 3BGMB 2V2WB 3GMNB 1FPTH 4M61A 4P2RB 3VA6A 5DQJA 3VE0A 1BOYA 4DGYL 3FO0H 5DD3H 2OTWB 3UTPD 3UC0L 5L88H 4OCXL 3U30C 4IOSD 3BKCH 3FQRB 4JQXA 4NWTH 2G9HA 4YAQA 1MIEL 2F53D 4HC1H 4KDVA 3O3EA 4WI2A 1SYSA 2IH1A 5F9JA 4ZFZB 4CVZA 4HJJH 2WNGA 2XQYG 1DBAH 3FO2A 1KEGH 4AQOA 4N5ED 3MODL 1KCVH 4CDHA 2CIKA 3NN8A 1U93A 1AIFA 3DGCR 2UZIH 2XG4A 4A6YL 2FATH 1AGDA 2OLDA 1FC2D 5E6IB 4X7TA 2XTJE 2FJHB 2MSPA 4QRRD 1S9YA 3EOAA 3PWJA 3SQOH 1QYGL 3AMKA 4HBCL 4R9HA 5GS1C 5FOBB 5E08L 5DFVD 4XCYB 1W0WA 5KSUA 3TF7C 5L2KB 1WAAA 4NC2B 3EHBD 1VHPA 5DO2D 4N8VA 4GRMB 2W9DH 1F4XH 4P2RD 1WJ3A 3GHBL 5J13C 1SY6H 4MNQD 1C12A 4F7PB 1HQ4A 3HS0B 4J3WA 3MXWL 5SWSE 4S2SB 1WT5A 2BMKA 2EDDA 5J11C 4Z0XB 5IG7A 4EOWH 4G9FE 1TETH 2XIDA 3CLFH 5DK0A 4L1HA 3TBYA 5LGJB 3TH4T 3U9PL 4BSJA 1ORSA 4E5XA 2OK0H 2NY5L 2AAVA 3NCBB 3HCVB 2PR4L 2GFBA 5I6XC 4AIXA 3D39D 2AV7A 5KVEH 1ZANL 3CFDA 5JW4N 4V1DB 4QTIH 4GRWB 4RMVA 4JZJA 1NAMB 3IDGA 3LVEA 3C60A 3QYCA 5E9DA 4LEXH 1F90H 2VJXA 2NY3C 3UYOD 3I85A 3MOAH 5DQDH 5C0GA 7FABH 4G6JH 3AY4C 4OD3L 1IE5A 5D2NC 4JPVL 1QSVA 1NLDL 1MEXL 2Y9RT 3IDYB 1G7IA 4M7JH 5L2KD 4XC3L 1YECL 2VWEC 1INEL 4ZSOE 2HMIC 3O3DB 3UMTA 4UUJA 4IM8A 5DD0H 2B2XH 1LDSA 5HVWA 4LKCA 4ZOBA 1L0YA 5CS7A 2D7OA 1S9XA 1FAKT 2BVOB 4OIBA 1QFWM 1N2RA 1LGVA 4X5WA 3LKOA 4YWGL 5IFHL 2FWOA 4J3UA 4MXWL 4YHIA 2XXMB 2A1WH 3WN5A 5BS0B 1I3GL 4QHKI 1NFIA 5TQ2L 4LVNB 4F58H 4KZEL 2AXFB 3NCJL 3ARGC 2A6KB 3VRLE 5CEZL 5EH1A 3LH2H 3B8SA 1E4XL 5CILL 3MA9L 1V7NH 1WQVT 2WAHA 2W38A 3P4MA 5I8CB 3MV7B 4EUPG 2E3VA 4Z77B 1K4DA 4HMCA 4ODSH 2EKSB 2VDKH 4I2XB 3LZFL 3X3FL 3EYOA 4PRDA 1BAFL 3ARWA 1FNGA 2X1WL 4O2EB 3UXFA 3CH8A 5IJVA 3QCTL 1ZV5A 5F7MC 1FE8H 4ODWB 1FYTA 3D9AH 6FABL 1KELH 4PJGF 3IJSA 4K8RD 3S4SA 3MOBL 2DQDL 3ZZ1A 3KPNB 3MGTA 4K7FA 3QIWC 4JR9L 1BFVL 3V6FA 5SWZD 5JDSB 2AEWA 5SWSA 3HPJB 4LCIL 4Y16A 1CYGA 5F96H 4DGIL 4G9FA 4UV4L 3BGAA 3RNKB 5FA3A 5CMAB 5AZ2H 1D5IL 3OF6A 4XCFH 1N59B 2A6IB 2CLZB 2V9RA 1YUHA 1I1AB 4ODTH 4PJAF 4QWWD 1T1ZA 3GMPA 5EU5B 1VCAA 4FZ8L 2H32H 2W1NA 1EUUA 2ORBL 3IF1A 5JXED 4CVXA 2LE9A 1R5VA 2MPAH 3X17A 3O8XB 5H2BB 4IDJH 2PYFB 3B6SA 4XNMB 4BZYA 4YHYC 5L0QC 4YEFA 1BJ1H 3ARYA 5F88B 5GZND 4POYA 4NKQB 4ZSOA 3GMRB 4OZIF 3FFDB 3MBED 1YYMH 3WS3B 3IU4H 3NFNB 3EYUH 1H3VA 5FV1L 3CSBA 3F7VB 3DWTA 3FT2B 3D0LA 4D9LL 5D9SA 3ES6B 2FGWH 4RMSA 3WHXA 3MBXL 3IDUA 4KJQD 5DUBB 3D85B 5FHAH 1BLNB 3WN5C 1MFBH 2YRLA 1ZOXA 5IVXF 3NTCH 3OGOE 3G5XB 3W5NA 1DN2A 5JZ7D 1YEIL 4JFQB 3PUCA 4RGND 4Y4KB 4X9IA 1BIIB 2BK8A 3CZFB 4PJCE 4FTVE 1CDIA 3BOVA 5DK2B 2XTJC 1J0ZA 3NIDE 4PLJC 4P2YA 4JO4L 5AEAA 32C2B 2RQ8A 3D0VB 4Y19B 4HMEA 1S9KC 2MKLC 3I2CH 1XF3A 4NQEB 5BXFB 2NY6C 3DVNA 4ZUSB 3WFDL 3OGCA 3BZ4A 3EBAA 2EDRA 5GJTH 5KBNC 2FBJL 5IQ9A 3B9KD 2BOCB 4UIMB 1YN7A 2Y6SD 4BFGA 3IVKA 1LEIA 2XYCA 4LL9A 2R56H 4MMZC 4P99A 4XVTH 3O6FB 5D5MA 3UTOA 1LE9B 1UWGH 4WWKC 4U1HB 4JEGB 5FYLH 4FFYH 2KUTA 4HIJB 5INDA 3D85D 1RZ8B 2P45B 4ZPVB 4PGDA 4Z7WB 1PSKH 2BY3A 3V6OC 2YPKA 5J6HA 3TM6A 5E1AB 1U8JA 1KCUL 2B0SL 2H41A 5J1TC 4U6TA 4MJ2A 3U2SB 1B2WH 4OV5A 1Z9MA 4F2MA 2OQJA 4OZHB 5D71H 1Q9LA 1ZAGA 1EEUA 1MCOL 5GGRB 4Y19D 3T1FB 2CSPA 4BK4A 1QSFE 2DQGH 4NNYB 3VFOA 4XNYH 4D94A 5DXWA 4A6YB 4UIKH 1NBYB 1R3LA 3MA7A 3V0WH 2JJVA 1QA9B 2VR5A 2X4SB 4M6NH 1C7TA 4C57C 3VA2C 4JQVA 1IAOA 5CD5C 3MNZA 5ALCH 1YJDC 1Z9OA 3TBVB 5EOCH 3P2TA 3BGFC 1CD0A 2JELH 4Z78A 3NZHH 5KN5A 4PJIB 1LILA 5T1KB 1FAIL 4OLZL 4P2OC 4LVEA 2CLRA 1R3HA 2V7HB 3PHOA 4HIIA 5DHYA 2X89D 4PJCA 4DTGH 4FTVA 1NCBL 4PRNB 2OTUB 5TPWL 4AY0A 1K5NB 4P5TB 5EPMB 4Y5YA 2DLHA 5CIPB 4LSRL 5HTSA 3SKOA 3PP4L 4G9DB 1N6VA 1T6VN 4JM2C 2XZQL 3AB0C 3NVQA 3TVMA 2JTDA 4FQXB 4XPBH 2R29L 4LP5A 2IFFL 3VJ6B 2DLFL 3GSWB 1JYWA 3PIQB 3N85L 2BNUB 1N6QH 4J3SA 1WCQA 2H6PB 3I02A 3V4PH 3GUTA 1OAUL 3KR3H 4PY8J 3MJ7A 5B38A 2HVKB 2X4UA 1Q9KB 1S5HA 3HC4L 1W72H 2GCYB 4UOW0 5EZOH 5T3ZE 3HMXH 3U82B 5DR5H 1MCEA 1IKFL 1X7QA 1BEYL 4OLEA 3Q6FB 1P5UA 1B4RA 4JANA 3MRHA 1ETZA 2FL5B 4M9OA 4YC2B 4JZOA 4QHLA 3BVNA 3QUMB 1MFAH 5EORH 1TZHB 4Z7WF 3S5LB 1JWSB 5GQBA 1I3UA 3RKDD 1O5DT 2WBJA 1KNOB 4P5TD 1DVFB 3T4AB 3MCLL 4G80A 3QNYA 4NWUL 5ID1A 3SDXE 3ZKNC 4BH7B 2ED8A 3NGBB 5LCVH 4ERSL 4ZFOB 3HZVB 3MGAA 2UWEE 1LO4L 4PRHA 3TN0A 1CT8A 1QKZH 4MCYB 2MQ0A 2ITDB 1DBKL 2XQBH 5F97E 3HPLB 3FCTB 1YEFH 1RZ7H 4BSWB 1QFHA 3EOYG 3CK0H 1MQKL 4JFOA 4XCNA 1S7QA 2N1KA 3QUYA 1EHXA 1YJDH 2HKFH 4K3DL 4RIRB 4JAMB 2OP4H 5GGTA 4LFHD 2VXSH 4P2CG 1U8IB 4DN4L 3DMMA 5IB3B 5HD8D 3K81A 3QCVH 4K9EL 3ET9F 3O41A 1XH3B 4TULH 3T0EE 1CDYA 3CSYA 4M6ML 1K4CA 4NT6B 4JRYD 1H3XA 4KVCL 4DZBA 5LQBH 1W0WB 4YR6B 1NANH 1DVFD 3EDFA 3LS4L 4NSKB 2NXYB 1GH7A 3ZE1F 2XRAH 2D0HA 5JA9A 1QFOA 1DN0B 1TZGH 2R4SL 1N64L 2ADIA 5IBUG 1ZGLA 4NOBA 3ULUE 2K7QA 1IGTA 3G08B 2D7TL 3MACH 1I8LA 2XZAL 2DKSA 1TJIH 2W0LA 4WNQB 4I77H 5KSAA 5ID0A 2EDYA 1AR1C 4JDTL 3GJFA 5HHNB 5HGAA 3IU3A 1X5IA 1ZHBB 2HJFA 2Z93B 1O7SA 4C56B 2XPGA 3LRSA 1X5XA 1AD9A 1HHJB 4NUGL 1OAYH 3THMH 5DWUH 1IC7L 4DKFL 5E9DB 3TLRA 3VRIB 2B8OT 4HZAA 4MD4B 1F58L 1IEBA 3W0WD 1A8JH 4QY8B 3MRMA 3SDXA 2AQ1A 2NXYD 3OAYK 3PXJA 3TIEA 4PBVC 3OB0H 2UWEA 2ENYA 4UUJB 4W70A 3VFWB 4FQQB 5IMOB 5EO0A 3CMOL 5AUMB 2FB4L 4X6CB 1CCZA 4HS8L 4MNGB 3C5SA 5JR1L 3O3AB 3IJYA 4HEME 4WUKL 3RWIA 2E9WA 4Z7VB 1DDHB 1ZEAH 3MGOB 3LIZL 4I0PC 4PP2A 5FA4B 1HYSC 2H45A 3E3QE 5C0FB 3R0MA 4HW6A 1C5CH 3VXQA 4KJPC 4QRSA 5DC9B 5I73B 1FVDB 5I0ZA 3NA9L 4JFYA 3HE6C 5JUEL 1DP0A 3L3DB 4X5XB 4C56D 1HCVA 4TTDD 1RUPH 2Q6WB 3T0EA 1QRNB 4Y2DC 5EUKB 1GHFL 2A6JB 4RX4A 3BT2H 3QQ9D 2HFGH 2HJLA 1H3GA 1D6EB 3IDJA 4MQXC 4Q6IA 1T1WB 2IAMD 4FS0A 3UZEA 4NFBA 1F4YL 1AO7D 5CJBA 3ULVD 2ZUSA 4XCEA 2F74A 5GGTL 1QSZA 3BQUA 3I75B 1RPQA 1JPTH 4HAFA 3T3PF 2VDPH 1GZQA 5AZEH 4ELKA 2VDQH 1J1OL 3GJFK 3O45A 1EXUA 5KSAC 1ZLSH 2EKJA 1RAMA 5DDHB 4Q6YA 5JIIA 1XGPB 5FYKD 4LKXA 4PLKD 1NC4B 3OAUH 3UJTH 4MA8L 5C9KA 5FM4A 3QXDA 1YUHB 4JKWA 1A5FL 3DHMA 3U7WH 5FO9B 3S9DB 3QWOA 2AS5M 5BZDB 4KKCD 2DIAA 1U8LB 5D7KE 1QRND 4JDZA 4U7KA 5I16A 1NSNL 3MLUL 5DF0A 5CZKA 3ULVF 1KTKE 2EC9T 5DYOA 3LMJL 3P4LA 5T3ZL 1JPFB 3OAZH 4LF3B 3QUZA 3BJLA 4UAOC 1NBVL 4U1MB 1EVTC 4NO0A 2HKHH 2Y25A 5E00A 4D9QD 4ONFL 3QEQA 3S36H 1HIMH 1ED3B 2Q7NA 3B2VL 3C6LB 3V5KA 5T1LA 4ZXBA 3LQAC 5EO9A 4HHAA 1MCWM 2BNRB 4OLVL 5DUML 2F8VA 1EHAA 5T3XD 1A1MB 1C8PA 5D7IF 3MXVH 5F9WC 4LHJB 3ROLB 3KGRA 2MFNA 1NC4D 2EXYD 2WM0A 2ZJSL 1OM3H 4NRZB 2X44D 2V2TB 5HHOD 3ARFD 1NLBL 2ZG2A 5I8EA 1UEMA 3FQWB 2CDGA 3ARBA 1ZMYA 5ESAA 2YD6A 4Y5XA 1H8OA 4X4YB 4HQQH 5MEND 4M1GL 1U3ZA 5IGXH 2WINB 4CL7A 5JIHA 5D6DA 3ZHLA 2H2SD 4YGVB 4F7EB 3VWJA 1CLZH 4EDWH 3WO4C 3PWPB 5C9JA 3VFNA 4UBDD 3HE7D 2FO4A 5DVNA 4MSWB 3BDXA 3CVHB 1NFDB 2NNAA 5GGQH 1EJ6A 3NCCB 3L5WB 3ULUC 3MCG1 5F6HI 3L3JA 1OAKL 5IBLC 5FIEA 1Q72H 3D3VE 5JPNA 4QHMA 2CGRL 1QNZH 2P48B 3I3EA 5DZOA 1A7OH 5T3ZH 1I75A 2PYEE 2IADA 4UT9H 1TFHA 3O6LL 1BZ7B 1U91A 1N0XL 2CJUL 2BNRD 3H9SB 3FQNA 1BX2B 3DURB 1LE5B 1QHOA 2VDMH 1WZKA 4PJ5E 1GPOH 5JHDE 4MAYA 1RZFL 1UXWB 3CSPA 4EXPX 3DVGB 3UPRB 2C3VA 2CKBB 4Z0BL 1VDGA 4JG1H 1R0AL 4O9HL 3SJVB 3QRGH 1S78D 2XI9A 3BDBA 5AYQA 4NHUB 5HHQA 4JY4A 3T0VA 4AK1A 2OQJB 2X5PA 4J1UB 4U1LB 2DJUA 4HWBH 3VH8G 4KWUA 3MFFB 3O4LD 3PWPD 3VG0H 1HHHA 3QUZC 3O9WB 3MJGX 2A6DB 1HXYA 3STBA 4PRBA 5E5UB 1GGIL 2WQRA 4Y4FC 1CK0H 4HFWA 4JVPA 1EEQA 5D1QC 4S1RH 1PFCA 4X7FC 2XWJB 5TH2A 4X9GA 3GHEL 2VISA 3LQAH 1KB9J 3E3QC 5GIRB 5L7XL 4KI5F 4PJBA 3H9ZA 1P4LA 3H9SD 3VFGL 2P8PA 1LD9B 4I3RL 3DUUA 4LARH 1EEYA 1KB5L 4WFHD 5K33A 5IT2L 4XCCH 1CFBA 1G1CA 1OB1B 1R3HB 4FNLH 2VLLB 3PWNB 4Y5XC 4OIAA 4O5LL 5DJDB 1AXIB 4K2UH 3PXHA 5C0JB 3WLWD 3ZDXF 1A1OA 3SJVD 4FMKA 4QHNA 3U7YL 3UBXG 2X4RA 5FXCH 1UJ3B 2XKUA 4Y1AB 1IZKA 2QQLL 2DBJA 5KS9F 1QO3A 2GK0A 3I84A 3VFRA 4XBPB 2ESVD 4LP4A 3I02B 3ULUH 3BEVA 2DDQL 2OZ4A 2J5LB 4FRWA 2L0DA 3DSFL 3H42H 1ZVSA 2AV1B 4ZUVA 1I9RH 4LSSL 1S8DB 5A40E 3CFJA 5IMLB 3TJEL 4U1GB 2Z4QB 3UYRH 1AC0A 5I2IA 5IWLC 2PYEA 4KKAD 2VKXA 4HZLA 2VXQH 4HIEB 4GG8B 4PJ5A 1PY4A 2OJEA 3D18A 2OX5A 2B1AH 1R3KB 1L7TL 2RFXA 4PGEA 1JPST 1M71B 1CICB 3EYSH 1NDMA 1G7LB 4ONHB 4F7MB 3DX8A 4OFKA 1BOGA 3MV8B 1HOCB 4ZAKB 3TPUB 4Q7DA 2R8SH 5IBTL 1VPOH 1JF1B 2Q76A 3MRBA 4Y1AD 3CGTA 4UZGA 3V4VL 3QSKB 1F45A 1S7XA 1I8MA 4F3FA 3O4OC 1BWMA 4WFED 4PRHB 4J4PA 3GMMB 4U6VL 2VO5A 5IUSA 3BO8B 4U1IA 2Y7QA 4N1HB 3RUGE 1T7VA 4UT7H 5KANI 3TC9A 4IIQC 4DCQB 3EFDH 4NQSB 2VLRB 1AXTH 4EBQH 3LHPH 1CS6A 2BRRH 1W0VA 5HBBA 2XZCL 3IFNL 4OLYH 1JWMB 4HUMB 1JNJA 2B5IC 2SEBB 3LD8C 3G6JE 2BERA 4WDIA 4ZQKA 4R3SB 3O41B 4NKIL 4ENEC 1M1SA 4B7IA 4L3AA 4G6AC 3HFMH 3BAEH 4R0LB 3VFUA 4LIQE 3P9MB 1LWRA 3HR5B 5KW9H 1WIPA 1U3HD 1BJ8A 4M3KB 3MV8D 1CXHA 1MREL 4ZAKD 1H15A 5EU3A 4Y8AA 3SCMC 4HX1B 5IJKC 5CZXD 1E28A 1CTOA 4OSUH 2EH8L 2GSGA 3FB7B 1NCWL 3ROOA 3WXVH 3ZDZE 3F58L 5AAWA 4CMHC 3NMEA 3H0TB 1HH6A 3WD5L 5F1IA 4P57B 3MSPA 1F4HA 5HYQA 2ZUQC 3GJFB 3KHOA 2VABA 1E4WH 1YY9D 5E6YA 1JNHB 3QJHA 4DGVL 2PXYA 4GXVH 1AD9B 3NIFE 2YD1A 1OF2B 3WJJC 5GGVH 4IJ3C 2OZ4L 4BSVB 1OGTA 5BVPH 3SE9L 4M48H 3FO9B 4GXUM 4KJWC 1JGVL 2ADJA 3BDYH 4B5EA 3LEVL 3HI6H 4MJ5A 5FO8A 3L3OB 4BH8A 2AJZB 4R96A 1IGIL 2CDEB 4WFFD 3RWJA 3MNWA 4PJEF 1KENH 2FHBA 3BE1H 4BJLA 3RUGA 4KAQL 3HC0A 1S9VB 4HXBH 2VERN 2YK1H 3DSNA 4KK5C 3IRPX 1WIOA 2QSVA 4N0CC 3AU1A 4PRAA 4Y4HA 4MS8D 3VFPB 2VMFA 2W59A 3G9VA 5GGSB 4MA1C 2XWTB 3C5JB 3MROB 2OR9H 3DV6A 1UACL 2DRUA 4J3XA 5J1SC 5KJRH 1OD9A 3MRIB 1XGUB 2EH7L 1FLRL 4WV1C 3U1SH 3G6JA 4NBZB 4MCZA 5F89B 1U3YA 3DROB 3Q5TA 4XMPH 5GZOD 1EERB 4M5ZL 1T1YB 3ZE0E 4X7DC 1NGZA 1FG2B 4FG6D 1UFUA 3OPZL 3MOQA 3BZEA 1Q1JL 1L9MA 4MDIA 3UCRA 3HAEA 4P9HL 1UYWL 5KSBA 1N7ML 5E4EB 4DJMA 1DBML 4LOUC 4QRTA 4BA8A 3Q2CA 2A83B 3JTTB 4XPTL 4Y88A 2W9EH 2WV3A 3QUKA 1BFSA 1KIPB 4PJDB 3U4EB 1ZHKA 1TNNA 4XNQB 3DIFA 1G6RA 2J8HA 5JOFB 1BZ9B 5J12C 2E5EA 2R1XA 3L3IB 1C5DB 5EIVA 1KJ3H 1F3DH 1MRCL 4FZEL 1GC1C 4PJFE 5DRWB 4MJIB 4OLWL 3OKKB 4Q9BA 5AWNH 2Z91B 5F1NA 2QL1A 4LU5L 4CN1A 3CPLA 4AEHL 1H5BA 2BNQD 4Z7UB 1RFDL 1A2YB 1KB5B 4LLWA 4TNVK 1JRHI 4YX2L 2Z8RA 4LCUB 2E6PA 3R4DA 3VXPB 3K1DA 3ULSA 1T0NB 1MJ8L 5ICXA 1CU4L 4NUJB 4NO0B 4NQTA 5D72H 1QSEB 3MRQB 1LNUA 3IXTA 5D8JH 5F7DB 3EOTH 3QIUB 3FN0H 4AG4H 1E4KC 4OGZA 1NMCB 4OB5H 4YHOL 2FBOJ 4E0RB 3VXRE 4ZS7L 1EZVY 4QCIB 3BUYB 1I7ZB 4UOW1 2X41A 3VXMB 1C1EH 1KT2B 2YS4A 4LHUB 1ZLVK 4P2QB 1Y18A 1UB6B 3MYJA 4PYGA 5FKAA 5GRUL 2WIIB 3ZL4L 4YZFF 2XFXA 5EWIH 2EDOA 3VFTA 2BSTB 4AEFA 4K94C 4MJID 4OD1L 1NDGA 4PV9A 5C86A 3B2UC 3U6RB 1RUMH 2W07A 1K6QL 1WTLA 4OIIH 3TPKA 2I60H 3D5OF 3HHRB 3QNZB 4XH2A 1H8SA 2D9CA 3KAAA 1P6FA 4I48A 3GSUA 2V5RA 3O6ML 1MFEL 3OX8A 4L8DA 3LKPB 3ELAT 3K46A 2DL9A 2VIRA 1JPSL 1Z0NA 1FFNB 4WEUD 4PJDF 1EH9A 3GSNH 4WGWB 4BFIA 1IAMA 2YPLE 2ZOKB 3QIUD 5EZJA 2FR4A 3T4YB 5TDNA 2GJZB 3QR2A 2X1XR 1LO3H 3X11B 3FT4B 3EJYD 4X98A 4WI7A 2DMKA 4JKPH 1I3RA 5JO5A 4JFXA 1QR4A 1RZJC 3BWUC 1FH5L 2BSRB 2AJUH 5F8RC 5IK3B 1PG7H 5AD0A 5JPMB 4LMQI 4LHUD 1JUFB 4KRPB 2VAAA 2W60A 1QBML 1GC1H 4FQLH 3LEYL 4PJFA 2X9YA 5B8CB 3IJHA 3MR9A 4NM4H 3IDXH 1WK0A 3G6AA 5C0NC 5IF0A 1RU9H 2CRYA 3BP6A 4GKZA 3FMGH 1UM5L 4JKMA 4PD4J 1CE6A 1CFVL 1IGJA 1TCRB 5D1XB 1H8NA 1J10A 2BXYA 5LWYL 3OHXB 3SKNA 1J1XL 1R24A 2YC1B 1K8IB 3EGSA 2YXFA 2PCPA 2VDOL 4NZUL 4PP1D 3T09A 4M93C 3M17B 4MVBC 4ODHL 4H25B 4UI2A 3VXNB 1OSPL 4XGZA 4P46A 2QJDA 5C09B 2VH5H 2D31A 3VXRA 2GTWB 2BVYA 3G9AB 1QD0A 2R23A 5E8EB 4CMMA 1RJZA 4DN3H 1YQ2A 1P4LB 2ZUXA 3SY0A 1G9NC 2VAJA 1Q0YH 3GMQA 4F37F 2KH2B 4G7VL 3L9RA 4G5ZH 5K9JL 1HSAA 1YMMB 1FCGA 2DQTH 3QDJB 1YZZA 4XAWL 1DTUA 2ITCB 4LFHG 1R3IL 4K94H 4RISH 5B3NA 4CADB 3KPSE 3PHQA 3TJHC 4EN3C 3QDGB 3DPBA 4LIQH 1N5YH 3BPNB 3FQTB 4PJHA 3RKPA 3ZLQC 5EBLA 2BVUA 4AEIH 2X70B 3S5LG 1TVHA 5D1ZA 2ERJB 2I24N 5SX5H 1KCRH 1P7QA 3FFCB 4OLUH 4D8PA 2I9LA 4P23D 1JP5A 5C2BH 3G6DL 2EDFA 3VGBA 2VDNH 4IRJA 1SEQL 2F54E 2IPUK 4G6KL 2DTMH 1MCJA 3QAZC 1U58B 1X5YA 2NYYC 3CFJB 2YPLA 4PRPE 1CFVH 2VDRL 1KACB 1G6RH 3V95A 2R4RH 4G8EA 4GOSA 4QHUA 5C09D 4HLJA 3FRUA 3EYVB 5FYJH 5HJ3B 1AJ7L 1TPXB 3MLYH 2Q3ZA 3FQXB 1TJHL 5DZLA 1WWWX 1RZJH 2Q86A 3WFBH 4OCYH 4F9LA 5C08D 1YMMD 3ZTJH 1UCBH 4WY7H 3QDJD 3W81A 1W2KT 5J4MA 1PVHA 1YYLL 3RI5F 3QDGD 1NMBL 3FRPA 4UV7H 1BIHA 5J9PB 3B4NA 4WIQA 4PJ7F 5HY9B 1LO0H 4ZYKB 4LVOB 2DQUH 1JVKA 2O5XL 1NGYA 5I15L 1FV1B 1IBGH 1R3IH 5DURB 4YHNA 5IV2A 4KTEL 4HUKB 1JJUA 3IDNB 4U6XA 3AROA 1CGXA 3TFKC 1W0VB 4X7EC 1NQBA 4N8VG 1JZ5A 4M7KL 5DJZA 4U0QB 3QI9A 5FFLA 4J6RH 5DD6B 4XZUA 1G9NH 3RY6A 5CZVH 3AREC 2G2RB 5ISZE 1EUTA 1PLGL 3PJSA 2AABL 1LEGB 3RL2B 2ZSVA 1BVKB 4DOHE 2XWBB 3KPSA 3FHAA 2A74A 2DQFB 1KJVA 1YMHB 5GISH 4QF1A 4ALAH 3AM8A 4JY6B 4XMKL 3MMEA 2WSKA 4NIKB 2P8LA 3HRPA 3GSRA 1XIWA 3NA4A 5E03A 1ZLWH 2J3SA 1H3PH 3CXDL 3SE3A 3QIBB 3PWLB 4OLXL 3S96A 1N26A 4OGXH 4MDJB 1A1NB 1UT9A 3MRNA 1VESA 2MMXA 4KUCF 4OCMC 4PRPA 3DRQA 5F9AC 1E4JA 2OJZH 2EDTA 3K8KA 2NPLX 3KPPA 1CD8A 3ZT7A 1YN6A 3G5YB 1WITA 1A7QL 5DMYA 2LV4A 4XNZB 4XBGB 1S7TA 4MJ6A 5DO2C 5D2LB 3CUPA 4XVSH 4G8GD 4J8RA 5EUOB 4OZGB 1EBPA 4GW4A 4ESKA 3DO3A 2VZ3A 5JIPA 3RL1A 4GAYB 1BREA 2PO6D 1J8HB 1ZLUK 2N4IA 2O5YL 4JGUA 4YDLB 1KOAA 4R4BB 5FO8B 5FAAA 4HAGA 4OCSH 4LRNH 3MNWB 4NO5A 1M7IA 4UTBL 4R6UA 4P3DA 4PY7B 3ZO0A 3QXUA 1T0MA 1OVZA 4X6DE 1NFKA 1AGFA 1LO5B 4ELME 3OJVC 1NBZA 5DSCA 2APBA 1QQDB 4RDQG 5DJCA 3VGAC 1VA9A 4X0KA 5F3BA 1JFQL 5IB2B 3N50A 3D6GA 4KHXL 2J6EH 4EI5A 2YWYA 5ISZA 5JHLH 1WUNT 3ZT5A 5A16B 2RBLA 1KULA 1FCCA 1CDCA 1DUZA 5I8OH 1TQBC 1ZA3B 4CAGA 1CL7H 2HWZH 4P5MB 1XR9A 4H20H 4WENB 3AM8C 2D03H 2VLKB 4MDIB 4P3CH 1ONQA 4DUVA 2YN5A 5TF0A 4J23A 5HI4D 2V6HA 3ALWA 4UB0L 3CXHK 1I9IL 1RK0A 5JOPE 3RTQA 4CVUA 1HDMA 4ISVB 4WO4B 4OFIA 1NCCL 5AYUL 1U8MB 4JE4B 4WW2A 4KHTH 2C3WA 2IMMA 5IMMA 3WXWL 4RMTA 1A6TB 1DQJA 1NMAL 3PP3K 1JZ7A 2P24B 3D25B 3O2VL 5FB8A 4MD5A 1J87A 2XN9E 5I1AB 5C0AE 5GS1B 5L9DL 1RHHB 5TDPB 1KPUA 1T03L 2ARJQ 2ZSWB 4OI7A 5EO1A 1FZKB 3MRGA 2HFFB 3TWCH 5C07B 3HUJB 2QHLA 3HG1B 1H5BB 3IFPB 5IR1B 5T1MB 3RA7L 5GS0L 1FN4A 3MUZ1 2C26A 2VLKD 2NZ9C 3TT3L 2IMNA 4WJ5A 2D9QB 1T83A 3SKMA 5J11B 1JNLL 2C1PB 3VI3E 4GG6F 4C83B 3ILQC 5K9KA 3BZFA 3UTTA 2LAGB 1F6AB 5DC4B 2BC4A 4FXKB 4UINH 4MJ4A 1IKNA 1I1YB 4L9DA 5D7LA 2CQVA 4Z18A 5CWSA 3RWFB 4OM1L 2IALA 4NKOB 5I6XB 4S11A 3HZKA 2DI8A 2MHAB 2HVJB 4ELMA 5J89A 1YY8A 3BWAA 4QWWC 1YC8A 5CAYB 2H32B 3S7GA 2ICES 3NCEB 3DTXB 3GBMH 2OXHA 4LNRA 5JXEC 2BJML 3KWWB 2A9MH 1UADC 2CUHA 3GMOA 4P4KC 1Y18B 2V7NA 1K8DA 3DRTA 3OKLA 2J4WH 3TBTA 2ADFL 3ZE2F 4PV9B 4YHPB 3WS6A 4NJAH 3V7AG 1QBLL 1IGFL 1T21B 2KPNA 3ZDYF 3HG1D 4QNPF 1TZIB 4TSCH 1T89A 3EO0B 5I74C 4OCWL 1F2QA 3VGEA 35C8L 3KXFE 3RU8L 1QFUH 3G5ZB 4LSPL 2DQIL 4WCYL 3LDBC 4CJ0A 4RAVA 4O00A 1MCNA 4WUUD 4HKZB 5ILTL 5CSBA 4WW2C 2PW2B 3ARGB 1T2XA 1KCSL 1YNTA 5B22A 4RGMC 3KJ6L 2IH3B 4R2GD 5I1DA 4XNUL 5EZLB 3O2DA 4MQ7B 2E9IA 1PQZB 4OBSA 2MQCA 2XN9A 3MRKA 4JFXB 5MI0C 2BDNL 3SDCC 1TJGL 1BD2B 2NY3D 2X4TB 4LMQE 3Q1SH 5C0RL 3SE8H 4PV8A 4N0UE 4PJXE 4HUUA 3PL6B 5IW1B 1DQLL 1KXTB 1DEEA 3KLSA 5DJ2A 5JQ6L 2HMID 3UTZB 1JN6B 3BMVA 4I4WA 1FZJA 5CGTA 5J1AA 3SO5A 1MCFA 3EO1B 3QIWB 4PPTA 1RULL 4DUWA 2CD0A 1T83C 1YEHH 1KPRB 3ARQA 5DT1H 5E95B 1G7MB 2F58H 2VXVL 3B43A 5HHPB 5GGUB 2AJSL 4OJFH 1QVOB 3X12A 2P5EB 1JTPA 1SJVA 2BCKB 1KJ2A 2IG2L 4ZUUB 1MUJB 2YHGA 1S5IH 5IOPA 3C09B 1PD6A 1RJZB 1II4E 1KLUA 3I9GL 1KLGA 1LP9F 4Y2OA 4I0KA 5FCSH 3SDAB 5B38G 4JPIA 4PR5A 2HTKC 2OMNA 5L0QB 5FGCE 2J12B 3LPFA 3AS2A 4GKSB 4RZCA 4RMWA 2VR9A 4PRIE 1ZA6A 1MWAA 2AXGA 5EU7E 4XP1H 1MCDA 3V52L 1I7UA 2WK2A 4PLNC 4WHYH 2P8MB 2YUWA 3GSOB 1T89C 3RGHA 1XT5A 2QQNH 4HDIB 4Q74A 3I50H 4JFEE 1KIQB 4YXLH 5D1ZB 3MRDA 3QIWD 1E27A 1IC4H 4S1QL 3KXFA 4JCLA 3O11B 3TNNB 1J0HA 3I6LE 5FYLD 5C0BB 3KPRE 3QZWB 4KRNA 1ZGLM 2AXHA 2HT3C 2ICEB 5LGKA 1I3VA 4GXUN 1AI1H 3INUL 3L5JA 2Z31A 2KL6A 1EAPB 1B4JL 2Y07H 3AXLA 2XQYK 3JVGA 1NL0L 3GB7A 2FEDD 1FVEB 4ETQA 3JUZA 3BN3B 4UU9A 2YOCA 4X6EA 3RAJL 1UWXK 3KJ4C 1WAAF 1X5FA 5GRWA 4OZFA 3W9DB 1QLEH 5TFSL 3KLAB 3HNTL 4RQQA 5KOVC 4WTZG 4AJ0A 4LSVL 3VWKB 2NY6B 1A6AB 4N0UA 4PJXA 2QKIB 1QLFA 8CGTA 3T77A 3UTQB 5T33H 4YXHH 2NTFB 3P0GB 4UQ3B 3T0WA 4ONOA 1C08B 1CGTA 1W72B 2HFEA 3NFPA 4EUPA 4TUJB 3O2DL 1SEBB 1FHGA 4WWKB 2F5BL 2VZUA 4NN5C 3ABZA 5HGBB 3CFEA 5C0BD 1KN2L 2R1YB 2DQEH 2VQUA 2APXA 2VYRE 2XOTA 4FXGA 2ICWB 4PG9A 4D0CA 1VFAA 5KTEL 1XF5A 5DMGC 3EJJX 43CAA 1RMFH 3IKCB 3SE4C 3MREA 1FGNH 2GSIA 2APFA 4TRPH 3TBWA 2XTJD 3E0GA 4KQ4L 4F7TB 2EDBA 4JKLA 3V4UL 2DQCH 5MEOB 2C1OB 4PLJD 1OWWA 4PB9L 4F8QA 1JRHL 1XF2A 2GAZA 3INUH 3MUHL 1AHWC 3QG6A 4PRIA 4S1SL 2DKUA 1TENA 4XPFL 2GQHA 1WZ1L 4N68A 1KJVB 3KDMA 2NY0C 2E8YA 4NDMB 1KJ2L 3GKWL 4H26B 1H3TA 5DMIL 2WMPA 3KYMB 4LLQB 1A3LH 4JFEA 1U6AH 3SDDA 3SHSA 4RBPH 2A73A 2VQ1B 4I3GA 4QRPA 5DJ0A 1OAQL 2JCCE 1G7PB 2IQ9L 3BGFB 3BIKA 1BMGA 3OJMB 3CFCH 3RX7A 1R5IB 5KVGH 2YBRB 3KPRA 4FFVC 1MCIA 2VL5A 5ECJE 3ARDA 3GIVA 5E4IA 4N0FB 4R8WH 1MHCA 1XCTB 4P2OB 2E7MA 4NPYB 5CINL 1P2CB 4JRXB 3TYFA 3NPSB 1AGEB 5I19L 5K59E 4HKXB 2DI7A 4LQFH 4NO3A 3KPPB 3QB7C 2JJTC 3HTLX 2XNAB 3LS5H 2FYYA 1GAFH 1U8OB 5KSVA 4OCLC 2I9TA 2H8PB 1Z9SA 4JM2B 2FSEB 1IAKA 2AGJL 4Q9QL 3DGGA 4RDQF 4CDGC 1MLCB 5IHUL 4QGYA 1CBVL 2VTFA 3REVA 2UYLB 4MNHB 5INCB 5BJTB 4WW1B 5E8DH 3QDME 5D96C 1BWWA 5KAQF 4XXDA 2EYSB 2OL3A 3GSVB 2EYRB 3UBXI 2C5DC 2CRMA 3DYMA 3QULA 4BM7A 1FFOA 3CFBA 5CD5D 4XP4H 5FECA 4YBHA 3WFCL 3MUGA 8FABB 1NC2A 1RURH 2FX8H 2O5ZL 4YDVB 1EMTL 4JG0H 1A7PH 2O93L 3SOBH 1RUQH 4RA0C 5CBAA 4XI5C 1Z0MA 4JFPA 3EFFA 1INQB 4DZ8B 2E8ZA 2F8XC 4OQTH 4EI5B 4OFYA 5AG9A 4JM2D 1MWAH 5EU7C 2X6MA 4HFUL 2V5SA 5C0CE 3SGKA 4LCCA 3PV6A 3RWHB 4Q97A 3AMLA 4KMTH 2NY7H 1CI5A 3EDJA 2IBZX 3SKJH 3UAJC 3SDDC 5DRXA 1NUNB 1XGTB 2BSED 1CFNA 1U0QA 2CMRL 5HI3D 4QRUB 4K7PY 4R26H 3W82A 2JCCA 4FQCH 4W4OA 3NH7H 4KTYA 3WBDA 2AEQH 3VCLA 2WWKO 3K8MA 1EZVX 3VRLF 1YDPA 3MJ8B 4L9LC 4RNRB 2J8UE 1WICA 4GMSL 3WFHB 1MHHA 4HS6A 1EDQA 3C5ZB 4JPWH 4Y0GA 5ADPH 3DOSA 3CC5A 5E2VH 3WIHH 4JHWL 4KDWA 4ZS6C 2FX9H 3DV4B 1JGUL 3VXTA 1HCFX 4LRIC 1V7MH 3RZCA 4RFEB 3HI1A 1G7JA 3QQ9C 4ZUTB 2VE6A 2R0WH 1H3UA 2IAMC 3C6SB 1S7RA 3ZKND 1S7VA 1DBJH 1WWCA 4TPRH 1KFAH 2P4AB 1FORH 3D2UB 3JWNC 3Q6GH 3QDMA 2BOBB 3O3BB 1J05B 2N56A 2E7LC 3WL9A 1B0RB 4LLDA 1A9EB 5DC0A 3UTTB 1PAMA 4TVPL 3CDCA 3EYQC 3ZSSA 1T5XA 5DEGA 1D9KA 1FNSL 3ALPA 2VLJB 4NQVB 4WFGD 2DICA 3VMNA 1JI2A 2JK5B 3OXRA 3VXUB 4NYLA 3LN5A 1ZT1B 4NP4L 3BXNB 1I7RB 3NCYS 3RWEB 5JXAH 1C7SA 4FTVD 1UM4H 4HWNA 3TT1L 3CSGA 4MA7L 1A3RL 2PTTA 3L5XH 4LGRB 5BMFH 1URLA 1X5AA 5I0DA 1QFWH 1QSFB 3TVMD 4YFLF 1CR9L 4JJ5B 1G7HA 3X14B 5ESVB 5FDWA 3QCUL 4K7PL 4MX7B 3B9EA 3TA3C 3SEPA 2GITB 5B39B 2CXKA 5J8OA 4QYOA 2HLAB 1RD6A 1KTLA 4FP8L 1MPAH 3NZ8B 4M7LT 3RBGA 3RNQA 2AI0H 5JA8B 2DMBA 2R69L 4I0PB 3OKMB 1OGAE 1MJUL 5HHME 2DKMA 1MF2H 1F02I 4GW5B 1DLHB 1BFOA 2VLJD 2J8UA 1M7XA 4PJCF 2LVCA 4O2CB 1IGCL 3ARFC 3HE6B 4E41B 1YEEH 3A0OA 3NIDF 1OARL 2VUYA 4Y2DB 4DVBB 1NJ9B 1LK2A 4OGYH 2I5YH 4WWID 1UM6L 4PGBB 2JJSA 3EDKA 1D5MA 2DYPB 2RCSL 4IRSB 2Q8AH 1YEDB 3ZTNH 4UBDC 2G5BA 3B9AA 4PTUB 1QSFD 4TUKL 1ZSDB 1IQWL 1BBDH 2P47B 5CEXA 1D5ZB 2R0LL 3K8LA 5HHXL 2IPKB 5J1AB 5D7JA 2OL3H 3RGVA 3OKOA 1T4KA 3D69A 4KRMB 3GI9L 1MFDL 4R7NB 4L4TA 4TTGA 4NBYB 4XPGH 4D9RE 1TLKA 4KXZI 4TNWK 5T5FL 1HYSD 1X5GA 3LN4B 4HJGA 4HUWB 3CLEL 4I9WE 4IRZH 4KI5C 4G3YH 1XF1A 5CLWA 3DMMD 2DQJL 1J0KA 5FYKU 4HCRH 5IFJA 4QOKE 1HILB 1FZMA 3ECBB 5IMKB 1UH4A 4ODUA 2OYPA 3HE6D 4M43L 5EN2B 5DHVA 1OPGH 5HDBE 1KLUB 4GBXC 1M05A 4PJ9C 4Y2DD 5HYSB 1U3JA 4YQXL 3EZJB 3QFJB 2X40A 4HXAL 4MQXD 4WEBL 3TZVA 4RFNC 4YE4L 1MCKA 1ACYH 1U41A 1D6VH 5I75C 4G8FA 4HIHA 3DHJA 4R7DA 1XCQB 4UAOB 5EIIA 1RZGA 4EEEA 2X2YA 3LKNA 3P4NB 1MRFH 5DS8B 4I3SL 3H3PL 1RJYB 25C8L 5TE7L 5L8KB 3KPOA 1AGBA 3TGXA 5KSAD 5T3ZD 1FZOB 3GBNH 4MHHI 3MLSL 1OGAA 4KGJA 3MRFA 5MEPA 1Y0LB 3EYFB 1CGSL 4TQEH 4PS4L 5F9WB 5E8NA 1MFCL 4L8SB 5DTFB 2BHUA 2NXZD 1RK1A 1MJ7H 5IQ7H 3JWDC 2X4QA 1P7KA 4GRLA 3DETC 4I18C 1DQMH 1FJ1A 3QEGL 2AEPL 2X1OA 4MB3A 2YEZB 3CVIH 1F11A 3K0WA 5JORA 2EO9A 3K2MC 5BRZB 3WO4B 4ZDHA 4RQQB 3QFJD 5FK9B 4Z7QE 1Z5LA 4AQ1B 2WIMA 3QISA 4MWFA 3TCLB 3QH3B 4MD0A 3DXAB 5IP4A 2YRPA 5CJXA 1EJOL 1PZ5A 3F12A 3H7BB 3MV9E 5DEFB 3RGVC 4RWYL 3L95A 2DBLL 4YNYB 3UYPA 5FEBA 1I8KA 3KG5A 1ITCA 2V9QA 4BZ1L 3PQYE 4TSBL 2XA8H 3TH2T 3CD4A 1TVBB 2MCPH 4XWGH 3RIFK 4ZOEA 4HIXL 5BZWB 5A3IC 5IW6B 2ZCLL 1V8HA 1JMXA 3FN9A 1JPGA 2AEIT 2Y06H 3RX8A 1EFQA 4QOKA 2X7LB 3CDGA 4U3CA 3T0ED 3JV6A 1IGYB 3JUYA 4LCWE 1T2QH 1WIUA 3TBSA 2RAMA 5DJAB 5CJOL 3EUUA 3WNLA 1DFBL 3SDXF 3VDBA 3TZVC 3BSZH 5GJSH 2WW8A 1P9MC 2UWEF 3R06A 5EC1A 1MI5E 4XPHL 5JW4M 2VLME 3U36B 2D0FA 1RZKH 5ERWA 2IANE 1JBJA 2YA0A 1T7XA 4Y4FB 1VGKB 3DYOA 3ULUD 3UJJH 1ES0B 1HEZB 3H9HA 4JFZH 4Y7MA 5D1QB 1EEZA 5IBLD 4FQ1L 1EFXA 3C8KA 3STZA 5HGHB 2CLVB 3L7EB 2F8OA 3L5IA 3HRZA 3PABA 1AGCB 2R15A 1GGCH 5FUOH 4Y5VC 2XA3A 3HNSL 2FHCA 3I6GA 4JFDE 3X3GH 1R5WB 4P5KA 1INDL 3JWDH 3V5HB 1CN4A 3RDTA 1IEAA 4B0MM 1WZLA 3OR7A 1KGCD 4XP5H 2P42B 1UQSA 3KPMB 1QPXA 1IC5H 4G43B 1HZHL 1YNLL 1SBSL 5DLMH 4NM8H 3QUZD 4KPHH 3ULUF 1DBBH 2P5WB 5CZXC 5C0EA 3WYRA 4BQ9A 1JZ6A 2FIRT 2VN7A 5FCUL 3T2OA 3WEXB 5CHNA 4APQA 3HC3L 3MV9A 4XXDB 4Y4FD 5BV7C 2O61B 1JYXA 4TSAH 3QJFA 5J0BA 1Q94A 2R2BA 3KLDA 3V6ZB 4YDKL 5D1QD 3PDGA 4AM0B 3O2WL 3LEXA 4P4RB 2ATPB 3MC0A 3T8XA 1LK3H 1V3JA 4DAGH 5CGYD 2ZNWA 1OTUC 3HAEG 5HDQL 4G42B 3ZYZA 2WP3T 2VXTL 2YD3A 1A4JB 3OBAA 5L2JB 4ORGA 1GIGH 1UWEL 4JFPB 4OCRH 5EOTB 5C3TA 3JBG7 4KDTC 3V0AC 4AMKH 1NAKH 4M7LL 2G75B 3B5GA 4P2RE 2W0PA 1X5KA 2NX5B 4RGOL 4YHKL 1WC7A 2J88H 1DL7L 4LAQH 4NGHL 3E6FB 3U0TB 4F33B 1MI5A 3O4OB 1MFNA 1JNNH 5I66B 1XGQB 3ME0A 3NBNA 2P5WD 3MJ9A 4GQ9H 9CGTA 3LKSB 3HI5L 5DA4A 3U0PB 4HF5H 1Q0XH 2W0FB 1FL3B 4IIQB 5IW3A 1F13A 2EC8A 1EHNA 2O26U 5I8KH 3KYNB 4NQUA 1KCLA 5E99L 1Y6NR 4O51A 1U8PB 4NO2A 3QQ4B 1WFOA 4XXCC 1DZBA 5GSRA 3VH8A 2LFGA 1D5XA 5C1MB 3BFOA 4XVUC 2Y36H 4PREB 2B5IB 5TE4L 3WKML 3EJZD 1GJIA 4JFDA 4RFOL 4MAYD 3VGFA 1A6VL 2C7UA 3DUHA 2VZ1A 5L2KE 3UTSB 1T5WB 1Y6KR 5I1CH 5IHLB 3WSQH 3AC0A 2W91A 3KPQA 2IPTH 4L4VB 3U0WL 3RWGB 4F7CB 4QXTB 5ITFA 2F53A 1IM3A 4OM0L 1MNUL 3SCMB 1UA6H 3LQZB 1W8OA 1HKLL 3OR6A 1CLYH 3KS0H 1QLRA 2HRPH 4CMHB 2IQAA 3DLQR 3D3VB 5BV7H 1CF8H 3TO2A 3QUXC 3VD5A 3VI4E 4WHTA 2BHYA 4FQJL 3GGWB 4V1DE 3GIZL 3ORJA 1CIUA 4GRWE 5AG8A 2ZUQB 1NCDH 4G6FB 5GRJL 2GJ6B 4M6AA 3PGFH 2F5AH 2ZP0T 4YXKL 2COQA 1MHEA 3ZYOA 3K4AA 4NYLB 3KLHC 5E5MA 5EBWB 2A9NL 3VG9B 2KQMA 4ENED 3C8HA 4OF7A 3MLZL 3TO4C 3UTSD 4IJ3B 3BGMA 2V2WA 3GMNA 4W81A 4G6AD 1J5OL 1F97A 1RHFA 4P2RA 2X05A 1ZXQA 2H3NB 2K1MA 3ARPA 2EICA 4MNQA 2OTWA 3L3KB 5ALBH 1EO8H 1RIUH 3GRWA 1AQKL 2CIIB 3IFLL 3REWB 3FQRA 3T2NL 5M95B 1VSCA 2CUMA 2IPUG 2R9HC 3SCMD 2AK1L 4ZFZA 4K23L 4FN0A 3UX9B 5BS0E 1UKTA 4TVSa 2DJSA 3WJLC 3RVUC 3D3VD 5TE6L 4WRLA 3RNQB 4PJBF 1REIA 1TITA 1MAML 4MA1B 3S88L 4XP6H 5DMKB 5E6IA 4QXUH 4YHML 2FJHA 2HG5B 1UH3A 3MV7E 4KJYB 4PJ5D 2GJ6D 2JLLA 4WV1B 5JHDD 5FOBA 1MVUB 4I2XE 4XCYA 1E6OH 2DTSA 3A67H 5L2KA 4M4PA 4XHJC 1QBBA 3MJ9L 1F4WL 2FCBA 1UEYA 3GK8H 1Z6JT 4GRMA 4X99B 2AK4E 5BW7C 3MQIA 3C08H 5TF1H 5D7SL 1J0IA 4NHCH 4KJWD 4F7PA 2HT4C 3T0XA 4GKNB 2BX5A 2E7BA 3UROR 5GHWH 3HS0A 5I1HL 4M9PA 4I1NB 4S2SA 1AXSB 2BFVL 4Z0XA 2YPVL 5LGJA 5IVZB 4XX1G 4IEFB 3NACL 1ZKAA 2IEPA 1JIBA 3GSNB 3HCVA 1XR8B 5F6IB 4L4TB 4KK5D 5IB4B 4K3JH 4V1DA 4J12A 4YDJB 5F72S 5J12B 2B4CC 3MZTA 1NAMA 4TUOB 1T7YA 1FO0H 1OW0C 5DD1H 1I8IB 3FB5B 5IM7B 2F19L 4IMKA 4JO1H 4KVNL 3ESUF 2ATKB 4KUZH 1HHKB 4GS7B 5ITBH 4JB9H 4GW1B 4JN1L 1JWUB 3KYOA 1EO7A 3O3DA 4ZTOH 4GAGL 2YD9A 5C6PB 2BVOA 2NMSA 4F57H 3MTRA 4U49A 2KBGA 5JW3H 5I30L 1A6WH 5A43C 5BS0A 3W2DH 4HPOL 4LCYB 2BVQB 2YA2A 4N1CA 2AXFA 2A6KA 5K9QI 1B0GB 4XP9H 2VC2L 1SBBA 4KKNA 1AE6H 1JGLL 4UQ2B 3GRWL 5I8CA 3MV7A 4Z77A 3G5VB 2IJ0C 4JHAL 5D4QA 1T6WA 2X4QB 1K9TA 2EKSA 4X4MA 4I2XA 4YBQC 4O2EA 4NQEE 1KEML 3BKJL 2CK0L 4ODWA 3TYGH 3AGVA 1YEKH 3KYKL 4TOYH 2XKSA 3NCMA 5DQ9B 5E2WH 4ZMAT 1NCAL 5A2JH 1RIVL 2FHFA 3BHBB 3O6KL 1RUAL 3KPNA 4NN7C 4YDIH 1I9JH 5JDSA 3HPJA 4P23C 4XPAL 1X5ZA 1UC6A 3GNML 3NABH 3RNKA 3BKYH 5CMAA 3FB6B 2IF7A 1KN4L 1S3KL 4LASH 2HJKB 4NC1E 1N59A 2A6IA 2CLZA 4YHZL 3LV3B 4LLYB 5ADOH 1KC5H 3MLXH 3ARSA 5H35B 4MXVE 5EU5A 3R1GL 1GZPB 2B4CH 1F5WA 4AL8H 2XV6B 4IMKC 3O8XA 5H2BA 4OZHE 1PY9A 2PYFA 4Q9RL 4XNMA 3QDAA 4RRPA 5F88A 2OS7A 4CNIB 5TQ0L 3B2UD 1KG0B 3GMRA 3MLVL 3U4AA 4OT1H 1ZTXL 2CRZA 3FFDA 4U4BA 1HINH 3WS3A 1FDLH 1CXLA 3T65B 3NFNA 3ARZA 4M00A 2EIZB 1JZ2A 4QNPE 3F7VA 3UEZA 3FT2A 1XGYL 1JF5A 4TNVF 2FD6L 3RUGF 3ES6A 2HT2D 1NAML 5DUBA 3D85A 1BLNA 5FUCC 4M93B 3G5XA 4PJIE 3I6KB 2A0LC 4AH2B 3QHZH 4JFQA 5FDYA 5FHBH 2BY0A 4QHKJ 3AFLA 4Y4KA 3RHWK 1WFNA 4XMLH 5T1DH 3PABB 4DW2H 4K8RL 3CZFA 1AY1L 2KQNA 5DK2A 5FYJD 3CX5K 3G6JF 5F7YC 3ZKMC 2DIBA 32C2A 3D0VA 4JFFB 4Y19A 1EK3A 4YUEH 5J3HC 4V2CB 1OAZL 4NQEA 3MRCB 4EN3B 4NZTH 4ZUSA 2VXUL 5E8PB 3K2UL 3M8OH 1CD1B 4GH7B 4OD2B 4LDEB 5HYJB 4U1JB 2BOCA 4UIMA 5CCKL 1WEJL 3O6FA 3ZDZF 4U1HA 1GRWA 2AKRB 4HIJA 3AAZB 3ZMRA 2FX7L 1B9ZA 2DLTA 1J1PL 4MVBD 1RZ8A 3P73B 1I1AC 4ZPVA 2HH0H 4GRWH 1RZIB 4Z7WA 5IKCB 2XKNB 4LSTH 5E1AA 4PJ8B 4NQCB 3GDBA 1MIML 2CDFB 3NIFF 4LPYA 2QADC 1YPZB 1XFPA 5EULV 3SGJC 3U2SA 3CCHB 4OZHA 3VXSB 3EKCA 4UOJA 3T1FA 1M6OB 4NNYA 4MAUL 2BVPB 3KPLB 4A6YA 3F7PC 1F6LL 1NBYA 3TJHD 4EN3D 4HSQA 1QA9A 4I5BB 5I17B 2X4SA 5L6YL 1ND0B 3QPXH 4KH2A 3HMWH 3WIFB 3S98A 1OP5K 1ORQB 1S7UB 4HLZG 3UP1A 5C0DB 3TBVA 2ZCKL 1WBXB 5IFAL 1FBIL 1XZ0B 4WI4A 1IM9B 5I1IH 5E0QA 4PJIA 3MLRH 5T1KA 3CIQA 1CD9B 4Y4KC 1EX0A 2NYYD 1IT9L 2V7HA 1OP9A 2VL4A 3N9GL 3LQMA 4PRNA 4ODVH 2OTUA 4C58B 1K5NA 4P5TA 5EPMA 1DSFL 4RSVA 3QG7L 3AREB 5CIPA 3RPIB 1A22B 4OFVA 5D70L 4NQCD 4UT6L 3RVVC 4G9DA 3E1F1 2R0ZH 2QHRL 4FQXA 3RIAK 4LDOB 1ADQL 4UDUB 3VJ6A 1X5HA 5GSVB 4YHLH 3GSWA 4KROC 3JWOC 3PIQA 4KK9C 2BNUA 1A7NL 1QEWB 1TTFA 1P69B 2Q8BL 3P0YL 2H6PA 3WFEL 3HNVL 2EDWA 4UTAH 2DQHH 4H0HB 5HI4C 2HVKA 5HVFB 1Q9KA 5DUPL 2ZKHH 2GCYA 1T0PB 4YLQT 5BQ7B 3Q6FA 2P1YA 1IM9D 2FL5A 4FQ2H 3QUMA 4C56E 3MRRB 4P46D 1TZHA 3S5LA 4M1CC 1A6UH 1VACB 1F3DJ 1JWSA 4EKXA 4RAUB 4N0YL 4QRRB 3DX7B 1VFOA 5E9DE 2QQKH 5B39G 5I1EH 4E42B 4PJFF 1KNOA 1YEJH 1DVFA 1OL0A 3T4AA 2R1WB 3ARED 3IETB 4LBEB 4DQOH 5I1GL 1O7VA 3L1OL 1HHIB 3QO0B 4BH7A 4R4NC 1QUNA 3B9DA 4ZFOA 3HZVA 4OKDA 4KI1A 4LLMB 1OOAA 4MCYA 4MNQB 2ITDA 3HPLA 5ENWB 4MNGE 3FCTA 1AD0B 4ZUWB 5IIEB 1H0DB 5MP6H 4O02H 4XVJL 4JY5H 4BSWA 3P30H 4Z7VE 1P7QD 1KB9K 2YMXH 43C9B 2GKIA 1QTYT 2FH8A 3OQ3B 4BK5A 2ZPKL 4S1DC 4DKEL 4LAJH 2WUCL 4F9PA 2ZUWA 1NGQL 4RIRA 5KVFH 5CUSH 1OP5H 4IRJD 4G8IB 4JAMA 1UGNA 1N4XL 4Z95L 1U8IA 5EOQH 5BVJB 3D39B 3AUVA 5ICYB 5IB3A 1UCTA 2YPLD 2ZUYA 4Y89A 3MRPB 4N9GB 4Q2ZB 4WU5B 4JO2H 1AKJB 1XH3A 1A0QL 3U4BL 3VGAB 2LQRA 1QRNE 3BD4A 4JQIL 1CZ8L 4GSDL 1RV6X 4XNXH 2YKLH 4NT6A 2NY5C 4YR6A 4NSKA 4FQXC 2VOTA 3SDYH 1B6UA 1TQBB 1NEUA 5HHVH 2DD8L 2FJGB 1FYTE 1Q9OB 1DN0A 4HV8B 1N8ZB 3JWOH 4PJGB 1GGBH 4OFPA 4UDTB 5F7EL 3G08A 4DFHA 1JGDB 3L3HB 2Z92B 4FABH 4WNQA 5IEHB 5DD5L 1M4KA 1NBQA 3PGDB 1PG7X 5HHNA 2AVGA 4DGYH 1DR9A 2F54B 4YC2C 2V5TA 2FZ3B 5E7FA 4QTHB 3UC0H 1V05A 4OCXH 4C59B 1ZHBA 3UO1L 2Z93A 4YPGB 5H94B 4C56A 1MIEH 4R2GC 1OAXL 1HHJA 1AKJD 4PJAB 1NGPL 2WBWB 3QI9D 3QXAB 3Q5YA 1T04B 2DL2A 3VRIA 4ACPA 1KBGL 4MD4A 2RIKA 4QY8A 3NGBC 3MODH 2QSCL 4CU6A 1UVQB 3IFOB 3KYOB 4A6YH 2EXWC 1F00I 4HUVB 3VFWA 5EBGA 1Z3GL 2G60L 4FQQA 5IMOA 4OZIB 5AUMA 3IDIB 4JQXC 4X6CA 3QUML 4MNGA 3VD7A 1QYGH 4HBCH 5SWZB 5E08H 3O3AA 5BO1L 4HT1L 1XF4B 4Z7VA 1DDHA 3MGOA 1XIWD 3QBTB 5HVHC 2BNRE 2YD7A 3N1MC 5F70A 3PWUB 1TTUA 5FA4A 3E2HC 2CH8A 4OZFG 4OF8A 5C0FA 4MGXA 5IVXB 1ZT4B 2F54D 3GHBH 3S3SA 4ZFOL 4N8CL 4PRPD 1FVDA 3MXWH 3SBWA 3L3DA 4X5XA 3FB8B 1A7RL 3F7RA 2Q6WA 1QRNA 4X6BB 3A6CL 4X9BA 2HYMA 4NKDB 5EUKA 1OP3K 2A6JA 3S37L 3U9PH 3C2AL 1TQCC 4P4KB 1D6EA 2E9BA 2NY5H 3DX6B 5E8OB 3PWPE 1T1WA 4N9OB 2PR4H 3NFSL 4M7ZC 4DOHB 4RCAA 1ZANH 4O2FB 2H26B 5E2TL 4PGJA 1NFDE 3MBEB 1RIHL 2H9GA 3I75A 4IHOB 3A6BL 3RY4A 1GOHA 5T5NF 1V3MA 3VFVB 3B5HA 1WT5C 2NZ9D 3LRGA 4FQIL 5D5ME 3QO1B 3BKML 4OD3H 3MCKB 4HPYL 5CJQL 3DNKA 3CX2A 4JPVH 3LDBB 3ILQD 1NLDH 1MEXH 3VFMB 1AFVL 4XRCB 2R2HA 4XC3H 1YECH 5IHBA 3H9SE 5DDHA 1INEH 4WFHE 3UJIL 1XGPA 4OCNC 3V7AE 2V5MA 1NC4A 5IROA 3TFKD 1A6ZB 4RGNB 3ARXA 2JJUA 3SO3C 3BPCB 4RGMB 1A9BB 4U6HB 5FO9A 3C9NB 5LBSL 4JZJC 2FEDC 4YBLC 5BZDA 3RWCB 1CGYA 4J3TA 3SJVE 3C60C 4YWGH 1A4KB 5IFHH 1U8LA 1OCWL 3SDCB 4MXWH 1I3GH 4P4KD 5ISZD 4Z7OE 5TQ2H 4UILL 4KZEH 3ARVA 1L6XA 3NCJH 5E6ZA 5CEZH 3E8UL 1JPFA 4KGLA 1E4XH 3U7AA 2VITB 4LF3A 5CILH 3MA9H 2CRIA 4LEOB 4U1MA 3B9KB 3Q3GB 1AP2B 4OGAD 3FL7A 4KV5E 2D4FA 1ED3A 2ARJB 3GJEB 4L8CB 1U2CA 3C6LA 3LZFH 3X3FH 1LQSR 1BAFH 1EAJA 1P1ZB 3JXAA 5F1OB 3RTQD 3QCTH 5JW5B 3EOBB 2BNRA 1AC6A 1BQLL 6FABH 1A1MA 4XWOD 4EQ3A 3EIFA 2I26N 3MOBH 4X6DB 2DQDH 5CSZB 3ROLA 2DMCA 1IQDB 4YO0B 3R8BB 3ULVL 4NRZA 2V2TA 5CP3A 4JR9H 1BFVH 1AR2A 3FQWA 4LCIH 4NZRL 1JK8B 4DGIH 1JHLL 4X4YA 4UV4H 4JM4L 2WINA 4YGVA 3SDCD 4F7EA 1D5IH 3O4LA 3PWPA 3WUWB 3BRGC 4MSWA 5FYKL 3CVHA 5DMJB 4NQDB 1NFDA 4HWEL 1A14L 1FVCB 4FZ8H 3L5WA 3GSQB 4KTDL 2ORBH 3OJ2C 4Y16C 3IT8D 3R0NA 1BZ7A 3H9SA 4WW2F 5EFIB 1BX2A 2EZ0C 3DURA 1LE5A 1BM3L 1RUKL 1MCHA 1OLZA 3DVIA 5CSGA 3T2PA 2ED9A 3HZYB 3VW3L 5J6GB 1UXWA 3DVGA 4OI9A 3UPRA 1UG9A 5C6TL 1X4YA 3SGEI 2CKBA 4D9LH 1OTSC 2ZUTA 4U0RC 1FGVL 2Y1VA 3MBXH 1IL1B 2GUOB 3SJVA 3KJ4B 4CJ1A 4DVRL 1SYVB 2HTKD 2W65B 4NHUA 1CQYA 3MV8E 3HR6A 4J1UA 4U1LA 1VFBB 1YEIH 1S9WB 3MFFA 5T3XL 3O9WA 2MOVA 4K3HA 5LXGL 2B7DT 2A6DA 4PRHE 5FUZL 1U8HB 3MLWL 4NQDD 1F8TL 4L4JA 3GSXB 2B1HL 4JO4H 2QEJA 2VLRE 3C6LC 4NN5B 2XWJA 4U6YB 5I1LB 3ILPB 4IOIB 2E27L 4R90L 5JOPD 5GIRA 2Q7YB 5A1AA 3WFDH 4X6DF 1JGEB 2HT3D 4ELMF 3IXAB 5TDOB 1LD9A 2FBJH 3FOLB 1OB1A 2VLLA 1KTDB 1HH9B 3PWNA 3W9EB 4POZC 5DJDA 4GLRH 5C0JA 2UZXB 2XN9D 5C0AD 5I18L 2OI9C 1A64A 1SMAA 1WV7T 2XG5A 4QT5B 1AHWB 1UJ3A 2PETA 3K80A 4Y1AA 4O4YL 1OSZB 5JW4R 4WFFE 1E6JL 3WCYA 1P53A 4XBPA 3FOMB 3RJDA 2OXGA 1CLCA 4PBXA 1KCUH 2B0SH 3GI8L 1KPVB 3HB3C 2AV1A 1ZT7B 4QRQA 1S8DA 5F6HJ 3ALXA 5HI3C 1MCOH 5IMLA 5HGDB 1BF2A 3DO7B 3TP4A 1JCKA 2Z4QA 2XACC 4KY1L 1I4FB 2LABA 3BH9B 3O0RL 5HVGB 4HIEA 4GG8A 1ZS8B 2XZZA 1ZHNB 1J0JA 1R3KA 5DMGD 3CVHL 3KNBB 3S35L 1T3FB 1ZHLB 2EYTB 3JV4B 4JRYB 1M71A 1CICA 1G7LA 4ONHA 4F7MA 4NKMA 5TJWK 3MV8A 1HOCA 4ZAKA 1FAIH 4WI8A 3FQUB 4OLZH 2FJFB 3O9WC 4K9EC 3TPUA 1JF1A 3OJDB 5L8LB 1HK6A 4ONGL 4MB5A 1UB5B 2NCMA 1IVLA 3GMMA 1CE1L 1NCBH 5D96B 3BO8A 15C8L 5TPWH 5HI5C 2NY0D 4DEPB 3H8NA 3B3IB 3VI3F 4LSRH 5I1JL 4AT6B 4DCQA 3PP4H 4NQSA 5EA0L 3W39B 4JQVC 2VLRA 2CKBL 2PTUA 5HDLA 2XZQH 2X4PB 4GUPB 1SM3L 4WTZA 2M8XA 2GTZB 2R29H 2IFFH 2DLFH 4FFVD 4FXLA 1JWMA 3L3GB 3N85H 1I7TA 4Q0XL 5DJYB 4KZDL 2SEBA 1OAUH 5CP3H 4R3SA 5GXBB 4ZOAA 2FRGP 3HC4H 5FGBA 4YK4B 4D0BB 1SMOA 3BPOC 4Y5YC 1IKFH 4X4ZA 1BEYH 4R0LA 3CU1A 3W0WB 1RJLB 2D2OA 4OBRA 1UJ3C 3MLTB 3P9MA 1EPFA 3TVMC 3HR5A 5FF6B 3CNKA 5FKPB 1EBAA 2BHZA 2A77L 4HKJB 4HX1A 5DI8B 1CG9A 1YEGL 1U8KB 1HXMB 3FB7A 5F93C 2AJVL 4ODXB 3MCLH 3K3QA 3H0TA 4NWUH 1WCBB 3CXHJ 4ZPTB 4PUBL 4ERSH 4P57A 5DGQA 4ZNEE 4G6ML 1LO4H 4L9LB 1DBKH 2Y5EA 2EE6A 1JNHA 5A2KH 4XI5D 1SJEB 4JPKL 3MX0A 1MQKH 1OF2A 1S7SB 2YSSB 5DVOA 4BSVA 2WBJC 4K3DH 3FO9A 5IVOA 2IGFL 2IAMB 3BPLC 4DK6A 4Z7UE 4PJXF 3DBXB 2OTPA 4DN4H 1AO7B 4PRID 5ETUB 1YNKL 3VD9A 4K9EH 1IC1A 3L3OA 2AJZA 2J1KA 3TN0C 2CDEA 3BEWB 1QSEE 3QEQE 4M6MH 3BP7B 4JFED 1S9VA 3UAJD 4KVCH 3SDDD 4K55A 3LS4H 3QUYC 2IFGA 3I6LD 5ACLA 3VFPA 5GGSA 1LDPL 1LMKA 3MPCA 3OKNB 2R4SH 4LHQB 1N64H 2XWTA 3C5JA 1X5LA 3MROA 2BSSB 3SKUD 3VXME 3MNVB 5D7IB 3DMMC 3MRIA 1XGUA 4P2QE 2JB5L 4ZNCD 2D7TH 5F89A 2XZAH 4ZS6D 1P6AB 5MEQB 3DROA 5F1SA 3FO1B 1T1YA 4M5YL 4R0LC 1T7WA 1FG2A 4JDTH 4LPUA 5F71A 3QHFL 1ZWIB 3KVQA 5JLZB 3MZGB 5DJ6B 5E2UL 1S7WB 1G9ML 5JNYB 4NUGH 2H9GB 3TA3B 1IC7H 2QLVB 1P5VA 2A83A 3JTTA 4DKFH 4QXGL 5ICZB 3BMWA 2D7QA 5GGSY 1DQDL 4D0DB 1I8LC 4G7YL 1F58H 1KIPA 1R3JB 3L7FB 4PJDA 3U4EA 3DJ9A 4XNQA 5HPMB 3WHE0 3EYQD 2R2HB 1NC2D 3EZ8A 5JOFA 4ZNEA 1BZ9A 1XGRB 1A21A 3L3IA 3DX9B 1UZ8B 1BGXL 2NXZC 2AJYL 3CMOH 5HHOB 2FB4H 1C5DA 3MRLB 4HS8H 3ARFB 5JR1H 1U36A 4WUKH 4MJIA 5DRWA 3OKKA 4I13B 1ULVA 2Z91A 5LGHL 5MENB 1BF8A 4L5FL 3LIZH 4XC1L 1WBZB 2UUDK 4Z7UA 2PTVA 1A2YA 1BQSA 3HE7B 1KB5A 1P4BL 4JDVA 5I1KL 2QTEA 3NA9H 4LCUA 4NJ9L 3VXPA 5JUEH 1HKFA 2V2XB 1T0NA 3BRDA 2ZOLB 4NUJA 1YQVL 1PEWA 1L6ZA 4X7SL 1GHFH 3OAYH 1QSEA 3TA3D 3MRQA 3VRJB 2Z8VC 5F7DA 3QIUA 1RJCA 3EO9L 1KJMB 4E0RA 1F4YH 3SQBA 4PJBE 2PW1B 4QCIA 4M62L 3BUYA 5GGTH 1I7ZA 3VXMA 2H1PL 1KT2A 2OBGA 2GK2A 1I1FB 4LHUA 4BZ2L 1J1OH 4P2QA 1UB6A 3PNWB 3QDJE 4ODBD 3RVXC 2WIIA 2C3HA 2BSTA 5C70A 3T0EC 4GBXB 3NAAL 4PJ9B 1MRDL 4P59L 3QDGE 3U6RA 1NGWB 4Q6IC 4RFNB 4LSUL 4MA8H 3O4LB 4EI6B 4J3OC 3QNZA 5C0CB 4AENB 5I75B 1IZJA 1A5FH 3FFCE 5KS9B 4I8DA 3M1BB 3BQUC 3LKPA 5FGRA 2GT9B 5FGSA 3QDMD 3ESVF 1FL5B 4EVNB 1NSNH 1EHLL 3OTTA 1FFNA 2JCCF 3MLUH 2ZOKA 2ZZUT 1V3LA 3HZMB 3LMJH 3T4YA 2GJZA 4R97C 3X11A 3FT4A 3GJFH 1G1YA 1NBVH 3K1KC 1IAIL 2EEBA 4HS3B 4KI5D 1NCUA 5K59F 4ONFH 5IK3A 2BSRA 2NY1C 5I76B 4U3XA 1IGML 1FP5A 4I18B 5JPMA 2EEDA 1JUFA 3IB4A 3U79A 5EG6C 3B2VH 3EDEA 5B8CA 3QEHB 5IB5B 4GBXD 1SVCP 4OLVH 4PJ9D 5DUMH 1FNEB 5MERB 1T20B 2JKXA 5MHSE 2ZJSH 2Z8WC 1TCRA 5D1XA 5C0CD 1NLBH 2ESVB 3WIIL 5IEKB 3OHXA 4GAJL 5HXMA 3ARRA 2YC1A 1K8IA 4M1GH 4V2BA 2YD2A 5B21A 3M17A 2MQ3A 4H25A 3VXNA 4ZXBC 3F6IA 4Z8FL 3PGCA 3A6OA 4DWHA 5C09A 12E8L 5CEYB 2GTWA 5CGYC 5E8EA 3TV3L 3WDHA 2AXJA 4X80L 2NLJB 4WI3A 4M4RA 1MLBB 1BP3B 4YGAB 4TNWF 1MCPL 2EECA 4MZ2A 5LAXB 1OAKH 1YMMA 1NH6A 2WUBL 5EU4B 3ARBC 3DETD 3QDJA 3H7LA 5ESQB 2CGRH 3F7YB 1PGRB 2ITCA 1FRGL 3AS0A 2YA1A 4CADA 2DWEB 5D6DC 1L7IL 4JO3L 3WE6B 4UNVA 3QDGA 3O6LH 1N0XH 2CJUH 3MJ6A 3VWJC 4YH6A 2EDKA 3FQTA 4CUCA 2X70A 5KZCD 3TH3T 1JL8A 1J88A 1RZFH 1IFHL 5DGRA 4PB0L 1DCLA 4H8WL 1JHKL 3FFCA 4S0SD 2FDBP 4Z0BH 2I25N 4OAWB 2VR4A 4GMTL 4O9HH 1R0AH 3RGVD 1SJHB 5D6CB 3PF2A 5F3HB 4QRQB 5KOMC 1U58A 1H3WM 5KVDL 4HH9B 4Y5VB 5A3ID 2J8UF 1PKQB 4WHCA 4M1DL 3EYVA 5HJ3A 1GGIH 3EJZC 3FQXA 2JE8A 4MAYC 1CLOL 2L7JA 1NEZB 4FFZL 4BKLB 4KRPC 1JMZA 4M02A 4IMLB 2FLBT 3HKFA 2R0KL 5B8CC 5D2LE 5J7CC 1N5AB 5C7XL 1EGJA 2Q1EA 3GHEH 3S37X 1KSRA 1RVFL 5L7XH 5EUOE 4OZGE 3OKDB 5JOEA 4N0RA 1C5BL 4NKMB 3ZYJA 5GS3A 3TZVD 3VFGH 1U3HB 1VGEL 4I3RH 1VERA 5IT2H 1KB5H 1J8HE 5J9PA 2XY2A 5HY9A 4ZYKA 5CD3B 4OZ4B 4X9HA 3SPVB 4O5LH 4OUUB 2VSCA 4LLAA 1FV1A 1HHGB 2ZCHL 4PJEB 4HK3N 3GFUA 3BD3A 2JIXB 3U7YH 4JZNB 4MZ3A 1T1XB 3IDNA 4GT7A 5EZIL 5IESL 1M7DB 1CTNA 2QQLH 5DRZB 4P9ML 1DEDA 3N06B 5HHMD 1I7TB 4U1KB 2R2EB 5DD6A 2YZ8A 4X6FB 5I9QB 2DDQH 3DSFH 2G2RA 4LSSH 3V7MA 4W68A 1LEGA 3RL2A 1BVKA 3TJEH 2AJ3B 2XWBA 4LSQL 3PWVB 2DQFA 4ZTPL 2VLKE 1YMHA 2UV3A 4JY6A 4HC1A 4HWUA 1MHPL 5DRNB 2NQCA 5KSBE 1HNGA 2V17L 1L7TH 5K9OB 1CG9B 1I85A 2QQQA 1L4IA 3QIBA 2QSQA 3PDOB 3PWLA 4MDJA 1A1NA 3KPTA 2JIXD 5E94B 1FNLA 5IBTH 2HLFC 4WVRA 4D9RD 3V4VH 3T08A 3GBLA 2KKQA 4U6VH 1OTUD 4I9WD 5F7LB 3OKYA 3OZ9L 3G5YA 4M6OL 4X83A 1J11A 1FQ9C 4R4FL 4XBGA 3Q0HA 4KQ3L 2ZUVA 5D2LA 5TGBB 2XZCH 5C07E 3IFNH 4NCC2 5CJ5A 3HUJE 3V8OA 3GO1L 3HG1E 1LEKB 5EUOA 4OZGA 1SY6A 1CFTB 3QNXB 4JLRB 4GAYA 4O58L 4LVOC 1J8HA 1JV5B 3P0VL 5E70A 4R4BA 1FL6B 4NKIH 4J4PC 1LO2L 4OF0A 3U9UB 3WLBB 2VKWA 4N5UA 4FA8A 3P11L 1WFTA 5JW4Q 1QOKA 3QUXB 4PY7A 3PQYB 2XT1B 2BXZA 1LO5A 4P9HC 3BW9B 1EGJL 1MREH 1QQDA 1P4IL 4XVUD 1FO0B 1FFRA 3IRZA 2KZWA 2EH8H 1T66C 5IB2A 1NCWH 2P7TB 4L8BB 3F58H 1R6VA 5HDBF 4Z76B 5F9OL 3TO4B 5A16A 2BRQA 4LCWB 1KYOJ 2HA1A 2VDLL 2VWEE 2AJXL 3WD5H 4RMUA 2JB6B 2X42A 3CH1B 1ZA3A 4DK3A 2BNQB 4ZFGL 4NNPL 2EC9U 4P5MA 1DQQB 2VLKA 1MH5B 4XAKE 4EQ2A 5I71B 1FIGL 2M2DA 3BH8B 4DGVH 4H88L 1IJ9A 2IANB 4K3EL 1UKSA 4NFDA 3RWDB 2V9TA 3RQ3A 5CGMA 4D3CL 3S34L 2OZ4H 2I07B 3MV9D 3P9LB 4Z5RB 4ISVA 1OT1A 1N3NB 4WO4A 3SE9H 2ADGB 4OTXL 4RRPG 4ZD3L 4WU7B 3QUXD 1JGVH 3PQYD 1U8MA 1FPTL 2Z35B 2GEEA 3FO0L 5DD3L 3LEVH 3DI3B 4L3EB 1A6TA 1WVZA 5L88L 3OG6B 2P24A 1IGIH 3D25A 3BKCL 5I1AA 4U33A 4NWTL 5GS1A 3BISA 4HC1L 1BD2E 1RHHA 2PXYC 5TDPA 1W0YT 4KAQH 4H1LB 2ZSWA 3KLHD 1PYWB 1VKXB 1FZKA 4HJJL 4NQXB 1HWGB 3SGEH 2HFFA 1DBAL 3TO4D 1KEGL 4LCWD 5C07A 3FTGB 3HUJA 1KCVL 3HG1A 1SJXA 4Z7QF 3IFPA 5IR1A 5T1MA 1UACH 2UZIL 4JDVB 2FATL 2EH7H 1FLRH 1FLTX 4MHHG 2BVEA 2VLMD 2C1PA 3LKRB 4C83A 3RVWC 2R9HD 2IAND 3SQOL 2IBZY 1F6AA 2NW2B 4M5ZH 2P5EE 4FXKA 1D5BB 3RWFA 1I1YA 3OPZH 1JYVA 3VXOB 3UBXB 3STLB 5E2JA 1Q1JH 4NKOA 3FKUS 3RVUD 4CW1B 4P48A 4Y4HC 2WQ8A 1MJJB 5DHXB 2MHAA 2HVJA 2W9DL 4P9HH 1F4XL 2X4NB 1UYWH 5EBMB 2H32A 1N7MH 4C4KO 1ZVHA 5EC2B 1DBMH 1SY6L 4L3ED 3DTXA 3JTSB 1LP9A 4JFDD 3KWWA 4XPTH 3V2AR 4XX1E 3AY4A 4NRXB 2DM2A 4EOWL 1TETL 3CLFL 5ABDE 1WISA 3OKEB 4FFWC 2CR6A 4ZFFB 4M3JA 4XHJD 3S35X 2OK0L 4YHPA 3QEUB 5SX4I 1AQDB 2YR3A 1T21A 4PJHE 1PX4A 5KVEL 1TZIA 4QTIL 3EO0A 2W92A 2HT4D 4FZEH 1MRCH 3VMPA 3RVTC 2HT2C 4OLWH 3ZKXC 4LEXL 1F90L 4YIQB 1U95B 5C0BE 3G5ZA 1NKOA 2DI9A 3EW3B 4NNXB 5IB1B 3MOAL 5DQDL 7FABL 4LU5H 4G6JL 4WO4C 4HKZA 4AEHH 1X4ZA 4M7JL 2GW5A 2PW2A 3ARGA 1RFDH 3B8YA 5DD0L 1P84J 2B2XL 2IH3A 4YX2H 5BOPA 1JZ4A 5EZLA 4MQ7A 1PQZA 1MJ8H 1PX3A 3UZQA 1CU4H 4IS6B 1QZ1A 1C16B 2Y23A 1BD2A 1VADB 4NRYB 3X13B 2X4TA 5GRXG 5C0IB 1CGVA 3QPQC 2A1WL 3PL6A 4YHOH 4AIZB 5IW1A 4ZS7H 2NTSP 4F58L 1H5BC 3UTZA 1JN6A 3LAFA 1Q9WB 3LH2L 3EO1A 4NN7B 3QIWA 2ENSA 4ZG1A 1V7NL 1KPRA 1U8NB 5GRUH 1G7MA 4PJ7B 1U42A 4K71C 4P23B 3ZL4H 1OTTC 4U1NB 2C4FU 5HHPA 4OD1H 5GGUA 1QVOA 4ODSL 2P5EA 2VDKL 1JZ8A 5FOJA 1K6QH 2BCKA 3IDMB 4HUXB 1FE8L 4ZUUA 1MUJA 3D9AL 3PGCB 1KELL 3H3BC 3V6OE 3O6MH 1MFEH 3N1GC 5E6ID 4L29B 3C87A 3U46B 3QA3B 3SDAA 4HKBB 1GCFA 1UENA 1JPSH 5F96L 5C08B 4FQHB 2Y5TB 4GKSA 3L6FB 1IMHC 4HGMA 4U3HA 4YBQD 1J7VR 1I1RA 4WI5A 5AZ2L 1ZLVH 1K2DB 4JVWA 4XCFL 4ZO6A 2R39A 5B3JE 2P8MA 5CFHA 3GSOA 5FO7B 1CFQB 4HDIA 2K9UA 5KG9B 4ODTL 3HAEH 1FH5H 1KIQA 1MCWW 1PBYA 4JHZA 2WBKA 1QBMH 3LEYH 3O11A 5JDJA 3TNNA 2J8OA 5C0BA 1E0OB 3QZWA 2MPAL 4IDJL 1KIRB 2ICEA 5C8JB 3V5DB 1UM5H 1EAPA 4JRXE 4V1DD 3BP5B 1YYML 3N1FC 3TNMB 3IU4L 5LWYH 3O81A 1FVEA 3EYUL 1J1XH 2ICCA 3BP4B 2N7BA 5FYJU 2VDOH 4NZUH 3W9DA 2FGWL 2IC2A 3KLAA 4ODHH 1OSPH 5FHAL 3PL6C 3MLPA 1MFBL 3VWKA 3QFDB 1A6AA 1DUYB 3NTCL 2QKIA 2AK4B 1LVEA 4HWZB 2X4OB 3UTQA 1G7QB 4PIRF 2APTA 2NTFA 4LVHC 4UQ3A 3OV6A 1VEOA 1C08A 4G7VH 4Y8DC 1W72A 3KS0J 5K9JH 5H8DA 4TUJA 3HA0A 3HMXA 1SEBA 4WWKA 5DJXB 4XAWH 5HGBA 3CAFA 3VI4F 1U92B 5BS0D 2R1YA 3HLAB 1OHQA 4MA3B 2A0LD 4GRWF 3I2CL 2ICWA 5DVMA 4P46C 4LLUB 1FFPB 2FIKB 3C09C 3RJQB 3IKCA 3V6OA 5GJTL 1EVUA 3MRJB 4KUCD 2YUZA 3QQ3B 3SDAC 2NR6D 4F7TA 4WTWA 5CP7B 3WHE1 2R56L 3MV7D 3G6DH 4XVTL 2QADB 3VFSB 3ZKMD 3WDJA 5MEOA 2C1OA 4PGCB 1UWGL 1SEQH 3OMZA 4G6KH 5FYLL 1WWAX 4FFYL 2UY7A 1MVFA 1DLFL 3LY6A 2LVEA 5J3HD 4KKLD 2VDRH 4BQCA 4G8GB 4IOFC 2AK4D 3L5HA 1AJ7H 1WBYB 4NDMA 1J12A 2PO6B 1TJHH 3LRHA 4H26A 5D1ZC 1PSKL 3KYMA 4LLQA 2PF6A 2VQ1A 1G7PA 4LLVB 1B2WL 1R5IA 2YBRA 4WFGE 4IRJC 1YYLH 5D71L 3QXTA 4N0FA 5ANMB 1XCTA 1JHTB 2DQGL 3F8UB 1NMBH 4P2OA 4XNYL 4NPYA 1BECA 4H5SB 1I1AD 1P2CA 4UIKL 4JRXA 2YRZA 1AGEA 3V0WL 4HKXA 2O5XH 1QFPA 3GZKA 4QO1A 3LKQB 4A2MA 3KHQA 3RHWF 5I15H 4M6NL 5C6WH 4EDXB 5EU6B 4LPXA 2HTLC 5IHZB 2XNAA 1QR1B 3O8XD 5F7NC 1U8OA 2QADD 4F9LC 4KTEH 2H8PA 5ALCL 4JM2A 5CKGA 1XMWA 2FSEA 5EOCL 3VWKC 2F15A 1F6FB 2JELL 4E9LA 3NZHL 5CBEB 1MLCA 1OY3B 2K3TA 4KROB 4F15C 4M7KH 2DLIA 2UYLA 4MNHA 5INCA 5BJTA 4WW1A 2EYSA 1TIUA 3GSVA 4DTGL 2EYRA 4L3CB 1PLGH 2AABH 3UTTE 1DLFH 4Z7NE 4GG6B 3WV0A 4RMQA 4WI9A 8FABA 5D7LE 4JFHE 1CGWA 2VLJE 4OKVB 3V8CA 4YDVA 2NW3B 4XPBL 2L4OA 4HK0B 3IGAB 3VXUE 1HSBB 4XMKH 4Y4KD 4S10A 1N6QL 3V4PL 3QI9C 1INQA 3FONB 3KR3L 4DZ8A 1BVLB 3RY6C 3OG4B 5EU6D 2YD4A 3CXDH 1W72L 4HH8A 1QRKA 3OXSB 5EZOL 4OLXH 3RVVD 3HMXL 5JMRA 5DR5L 4NQED 5BCAA 3RWHA 1FSKC 3JSSA 4BUGA 4KROD 4KK9D 1MFAL 3U30B 4JN2B 5EORL 3V0VB 3P77B 1JE6A 2HN7B 2MKWA 1A7QH 3O6FD 2D4DA 2VN4A 1XGTA 3FT3B 4ZO9A 1DE4B 1XIWC 4QRUA 3CFKB 3SE3C 5LCVL 3MJ8A 5GS0C 3G04B 4KRLB 4RNRA 3TIDB 5F7HA 3WFHA 1HI6B 3P40A 3C5ZA 3NPSC 1HQRB 4E41E 2O5YH 4M8QA 2OSLB 4M1CD 1QKZL 5ACZB 2XQBL 2XXCB 3DV4A 1F4AA 5CLTA 2WWKT 4X4XB 1YEFL 2QR0B 2D3VA 4U31A 1RZ7L 4RFEA 4ZUTA 4UTBH 3CK0L 5DJ8B 1JYNA 1YJDL 2HKFL 3C6SA 3W11C 4R4ND 1ZVYA 2OP4L 2VXSL 3D2UA 3RIAF 5J13B 3NIGE 3QCVL 5F7WC 4AYFA 2BOBA 5K9QG 1JFQH 3O3BA 1J05A 4TULL 4KHXH 1B0RA 1BQHB 5SWQB 1A9EA 3LOWA 1TMCB 4URTB 4OF3A 1CXKA 1FIEA 1ZGLP 4S1DD 4WUUB 3E6HB 5LQBL 1ZLUH 4PTTB 1BBJB 2QBWA 2VLJA 4NQVA 4U1SB 5T1KD 2JK5A 3MUY1 1T2JA 3P4OB 2XRAL 4R2GB 3VXUA 4MXVF 1TZGL 1ZT1A 2LU4A 4UB0H 3BXNA 1I7RA 3RWEA