4JO3L

Crystal structure of rabbit mab r20 fab in complex with v3 c-terminus of hiv-1 consensus b gp120
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
DIVMTQTPASVSAAVGGTVTINCQASETISNYLAWYQQKPGQPPKLLIYKASTLASGVSSRFKGSGSGTEYTLTISGVQCDDAATYYCQQGYSISDIDNSFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rabbit Anti-HIV-1 Monoclonal Antibodies Raised by Immunization Can Mimic the Antigen-Binding Modes of Antibodies Derived from HIV-1-Infected Humans.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system/viral protein
molecule keywords monoclonal anti-HIV-1 gp120 V3 antibody R20 light chain
total genus 53
structure length 214
sequence length 214
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo3L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo3L01
2YRPA 2XWBA 5DJCB 4ZS6D 1FHGA 1Z5LB 2HH0H 5DD0H 5FB8B 3WL9A 3DLQR 4TSBH 3B9AA 1A7NL 2BMKA 1SEBA 1R3IH 5F7EL 3SE8L 2Z92A 5FO7B 1RPQA 3EGSB 3I6GB 3AROA 2FWOB 5C0BD 1K4CA 1BVLB 2CDEA 2VABA 4Z7NF 1ZLVH 1GHFH 4NNYA 1ND0A 2F54D 2WBJC 4FMKA 4PJAF 2QSTA 2BOBB 3U30B 3P0VH 2XZAL 4ZMAT 1RAMA 4G9FB 5BW7A 8FABB 3ARSA 1MI5A 2HVJA 3G04B 5FK9A 2ZG3A 1C1EH 1G9NH 3CPLA 2AXGB 4ZPTA 1Q0XH 4LSDA 4WWID 3FONA 5IB2B 1HH6A 1DQLH 4NKIH 5ADPL 2HJKB 4MCYA 3BSZL 1T89C 4WTWA 1YUHB 3VFRB 4L4VE 2DM7A 4MSWB 4OUUA 3VI4E 4F37K 4R7DB 1MCRA 1PEWA 5HI4C 5C0DB 3SDXB 3EYFB 1FNSL 1UCBL 1K85A 3CX5J 2RQ8A 3PQYB 1AGDA 4LPWA 1G0DA 2D7NA 4XXDB 4MA1C 4U1LB 4PJDF 1KIRB 3MFGB 3ME0A 4OZIF 1KLUA 4P2YA 4PJ8D 5CILH 1S9KC 1SVZA 4MHHI 4OFIA 5JPMB 4ERSH 1U3ZA 1F4YL 3QFDB 2DKMA 5IMOB 2HKFH 2EEAA 1XCQB 4PJGF 3P9MB 1WEJL 2WZPD 2IANA 3IU4H 4IRJD 5J1TC 1HHGB 5CJXC 4LLYB 3MR9B 4X5XB 4ODHH 3GSNH 1YN7A 4D9RE 3DURA 5I1EL 4KVCH 3HZMA 2AK4D 4PTTB 43CAB 1KJMA 4U3XA 1RFDL 2X9YA 3CJJA 5GRZA 1WITA 4FQCH 4HJ0D 4JHAL 4XX1E 4NQUA 4LCUB 4FP8H 1OGAB 4ZS6C 2VQTA 1YNLH 1JNLL 1SEQL 2D7OA 3J7HA 1F4AA 4HLZH 1VFMA 5F1IB 3GI9L 1N5AB 1T04A 3S88H 1PZ5A 5LAXA 5GS0C 5DQ9A 1NGXA 1A0QH 3MV9E 4AQOA 1FYTB 2OL3H 5MEOA 1AO7D 1DSFL 2A74A 2QTEA 4KUZH 3F7PC 1AXTH 3BDYL 5ADOL 2DLFH 5SWSA 2EICA 4HQQH 4KK8C 3GK8H 3HLAA 4HV8B 3FT3B 1N2RA 3I50L 2RJMA 3Q2CA 1OAYL 1A0QL 4NC2B 3MGTB 3L5WB 3EGSA 2VO5A 2YEZB 1T3FA 3VXPA 2P24B 1NKOA 4MAYB 1IQWL 4G7VL 3EYQD 3RY5A 2I25N 3QISA 5GRUH 1DBML 4O51B 4UI2A 3VW3L 4LP5A 1KC5L 3GIVA 2D3VA 3S5LA 1MCCA 3O0RL 1PX3A 2HJKA 5DFTA 5KZCB 4LSPH 4WFED 1L9MA 4NT6B 4OCMC 1OB1A 2IADB 5E0QA 2YS4A 5I15H 4HQQL 4R3SB 1PZUB 2EH7L 1CD9B 1UZ6F 2J12B 1NFDA 5FHAL 3VG0H 4JFEE 4K9EH 5HDBF 4ZSOE 3DO7B 4DGVL 2QQKH 2CUMA 3S88L 4QYOB 4LK4A 3HRZA 2R23B 1MLBB 5D1XC 2ZP0T 3B9KA 3TFKC 2HVKB 2DQCL 5L88L 3NPSB 4YWGH 3RZCD 1NCDL 3EOYG 4YIQB 4R97C 3LCYA 4M93B 1NCWL 3OR6B 5KVGL 1DQDL 1GZQA 1Q0YH 1XR8A 5DEFB 1ZKAA 1QD0A 2WINB 3MA7B 3OXRA 4G6JL 1FL6A 4OQ1A 2XV6B 3VI3F 5EO0A 4OF8A 1UCTA 4L29B 2VN7A 1NCWH 3QPQD 4G3YH 2QLVB 3X3FL 4Z7NE 5BVPH 2EZ0C 1KJ2B 4NQCB 3OKLA 1LO0H 3X11A 3LY6A 2E9IA 4JPIB 3RDTC 1Q72L 1JZ5A 5E8DL 3LS5H 3A67L 4PB9H 4NQCD 4HK0A 1LP9B 2P5WE 2XQBH 1ORQB 1LGVA 1TZIB 4Y2DD 3QUKB 1OGAA 1T4KB 2F58L 1NMCB 5E8DH 2J2ZA 4ACPA 4LQFH 5E7BA 4PJ5B 4U6HB 5F89B 4OF3A 3A6BH 2X7LB 1EO8H 2VDPH 2PO6B 3VRIB 3GB7A 4NP4H 3KLHC 2EDQA 1KEMH 3QXVA 3ARGA 1W72B 2DLGA 1D5ZA 4HFWA 3BI9X 3RVVD 3FB7A 1W0YT 4U6VL 4XP1H 5GISH 3RWDA 1K3IA 2EIBA 1G6RL 3IJHB 3SJVE 3NN8A 2BJMH 3RVXC 4XPGL 4M6OL 2CGRH 4RNRA 4P9ML 4LKCA 1MAJA 4RZCB 4XCNA 4QXTB 2W07A 4QTHB 4OZFB 2ARJQ 2DD8L 2Y4SA 3HNTL 5F7YC 4QHUB 4P2OC 4YHOL 5HTSA 4XNQB 4LL9A 3QDMB 1FYTD 4NRXA 2CGRL 5D7IA 1MUJA 1Y6NR 1HEZA 3EKCA 3QO1A 4GRLD 4HCRL 1MHHB 5L7XL 1S9XB 4JR9L 2YWYA 5GPRA 3H9HA 5B8CA 1D9KB 3IJSA 4Y5YC 1I1AC 1RVFH 4WI8A 2OSLA 3UPRB 3MX0A 3QFJD 1CYGA 2RCSH 1F3JB 1IC1A 1WBZA 1F11B 2ADFL 4NGHH 5B4MC 2D03L 1FSKC 1YEKH 2Z8RA 1M6OB 1I3RB 3U7YH 1J11A 2NY6D 3SKMA 1TJGH 5EU4A 5D7IF 1CL7L 5D7SL 1B3JA 4B41A 2NY4C 5FOJA 4X6DF 4YXHH 3TN0C 5ANMB 1UA6H 1R3JA 3ZZ1A 5HSFA 5DJAB 3ARED 1WFTA 1WEJH 2X4RB 4N9GB 1AO7B 3QQ9D 3BP7A 3X13A 5KS9F 2NR6D 2FATL 1INEH 2NX5E 4C56A 1OQOA 2CQVA 3E6HB 1Z0NA 3ULUF 1Q9WA 1MJ8L 5ICXA 4HK3N 2Y7QB 2QSQA 3CVIL 4PRNB 4X5LA 5GGQL 2AXHA 3QIUD 3O11A 3IB4A 5H2BB 3F58L 1U95B 1SY6H 1UCBH 4JRYA 4F58H 3RUGF 1BJMA 1SEQH 1JTPA 4JFDB 2PTTB 3OB8A 1BGXL 4R9HA 4U0RB 3JVGC 3WO4C 3W2DL 3ZSTA 4HXAL 5F7KC 4F57H 3T4AB 3QDME 4KKLD 2W1NA 3NOIA 3LKPA 1RIHL 3QPQC 3KPSE 4F7TB 4JN2B 2VLRD 1P6FA 4HZLB 3TESA 3G6JB 4ZODA 2OX5A 4J7RA 1EMTL 3C5JA 2VWEE 4P2OD 3IU4L 3UTTA 4XHJC 3DVNB 5DFVD 3BZEA 4TUJA 3RIAK 5I75B 1XGYL 4YR6B 4HC1A 2APTA 4MQTB 1T0MA 1DLHA 1S5HB 4L5FL 4POZD 3PWPD 4UV7H 4XRCA 2GCYA 4NYLA 1N5AA 1T04B 2FATH 4KKCC 4N1HB 2V9RA 5IMLA 1HEZB 2XACC 4Y2DB 4Q9QL 1A5FH 3WSQH 4ELMA 3EFFB 3HPJA 5IMMA 2ITDB 3KPRB 3WL9B 1NBYB 3T4YA 1GOFA 4UINH 3L3IB 1XR9B 1TJIH 3OX8A 3QFJE 3TJEH 2ARWA 2VISA 2YD6A 2HJLB 1A02N 1A5FL 5T3ZE 1QFWI 2ZOKA 1XZ0B 3GBML 5BZDA 2HFEA 4KK5D 5CBEB 2QQKL 3EOAB 1VADA 3FT2B 2FIKB 1KLFA 1SHMA 5I8KL 1CFVL 2YN3A 4JFDE 4HKZA 2ZJSL 1ORSB 4L8BB 4JFFE 4QKXB 3TV3H 4BA8A 5HD8D 4P4KA 4EBQL 3MC0A 4F8TA 3TNMA 4EUPB 4LSQL 5F8QC 4Z6AT 2Q8BL 5JOFB 4JO3H 4G6FD 2DQTH 1F2QA 1ETZB 4WU7A 3TBVA 3K0WA 5T3XE 1Q9WB 2MCPH 1UH2A 2BVUA 4X5WA 4EZMA 4N9GA 2P7TB 4FQ1L 4Y19A 2D0GA 4PJ9A 4GKZA 5SWZE 4MCYB 3VFRA 1BD2E 5DC0A 3A6CH 3CLFL 3RZWA 4S1QH 4TULH 1YEIH 4MDIA 5E6IB 3MJ8A 4RFOH 2ICWB 1MRFL 5I1IL 1RJLB 4PRPD 4TNVF 1NC2D 1EGJA 3STZB 2I9LA 2W65A 3BJLA 3QXAB 2VDNH 3IU3A 3FQXB 3QDGB 5EUOE 1Z5LA 2Y25A 3C6LC 4Z7UB 5E1HB 4ODVL 5DMIL 3QI9D 1S7WA 3CFEB 2KZ1B 3SQOL 5IMKA 4EI6A 3T4AA 3N9GL 5JMOC 1MJ7L 3HNVH 4BQ9A 3V5DB 5D1ZA 1AFVH 3SBWA 2MMXA 2WV3A 1KEML 1ZANH 4FFVC 4GLRI 2GSIB 5FYLL 1YMME 4TQEH 4LBEB 4GRWB 4HPYH 5DWUH 4C58B 1RZ7L 3ARYA 4PV8B 2B39A 3BZEB 1LO2H 4HH8A 3S7GA 1F45A 1K6QH 2V2XB 3QIUC 1Q94B 3CVHL 2IQ9H 1UACH 3S35H 4LCUA 5F7LB 2E7BA 2MQ0A 4OLWL 1A9BA 3HNSL 1WTLA 1GYAA 3KJ6H 3DOSA 1NBVL 3RPIB 4HCRH 1FRGL 5I73C 2K3TA 5JW4R 1GGTA 4X7EC 3KPQA 5E8OA 3CCHA 5EIQA 3C5SB 4HKXA 3BW9A 4PJXE 5IFJA 2D7TL 1QBBA 4CVUA 1A4JA 3LKSB 5L88H 1XF2B 1MFNA 2XT1B 5DO2D 1P7QD 4OD2B 5DHYA 2DKSA 4U1KB 4UOJA 4K9EC 3UZEA 3ORJA 5D96B 5JIIA 4PLKD 1A7NH 3B43A 1LK3H 1EFXD 3RY6A 3G5YA 4R0LC 3BQUC 1RUML 4JB9H 1QFWH 5EU3A 3UTTD 35C8H 2DM3A 1P53A 1U36A 3DUUA 4R6UA 5J9PB 4XVUD 1RHHB 1KB9K 2VKXA 3FB8B 4WFHE 3NIGF 1QSEE 3MNVB 3VFNB 2X9XA 4Y89A 3HMXA 3P11L 4LU5H 3WN5C 3ILPB 3PV6B 4BZ2L 2J6EA 4FQPA 3OKEB 4HFUH 4QLRA 1F3JA 3TBTB 4YXKH 1WCBA 5IVXF 1NAMA 4NQEB 4BSWB 2NX5D 1HH9A 3QG6B 4RMQA 3RWFB 1G1CA 4DN4L 5FUOH 3MA9L 2NY4B 4HUNB 2CKBH 1G9ML 1RZKL 2R2BA 2ZSWB 4HHAA 5D9SA 5T1KB 4GMSH 3V5HA 3BUYA 3S8WA 2DOCA 1EUUA 1XGTB 2LV4A 1L0YA 4QY8A 3MRCB 5FYLD 3WXWL 1KUMA 4MA3B 2GJZB 2UY7A 2VSDA 1MCOL 5L0QC 5GISL 4O00A 1MFEL 1T03L 1X4XA 3TPUA 2EKSA 3VD5A 2XKSA 3SBWC 3U2SA 1EEZB 4CN4A 1ZHNB 2VLKA 1KOAA 1S7SA 2FR4A 3IKKA 3O3UN 1JMXA 2A9ML 4QRSB 4OGXL 1T2JA 4QHLA 5D5MB 5I1LB 4MD5A 3RWJB 2M8XA 1JP5A 3BRFA 4WUUB 3DVGB 1ES0B 3MROB 1A21A 2Y6SD 3BMVA 1TTGA 2Y1VA 5E8EB 2MJWA 5L9DH 1JPTL 1ZTXL 3CAFA 2X5PA 3HZYB 1G9NC 2AEPH 2E9BA 3CU1A 1NBQA 1JFQH 3LH2H 2BSSB 5D5ME 4RMUA 5ETUA 4DTGL 4JVWA 1DEDA 3VXMA 5I1AA 3EZ8A 2W9EL 5I66A 3LEXB 1FAIH 1CE6A 4JAMA 5DK3A 4N0UE 4HT1H 3D9AL 4NT6A 4WI7A 3TCLA 4P23C 2V2WB 2VH5H 5EU7E 2PUQT 2G2RA 4JDTH 2ED8A 4Z18A 1IGFL 2VDMH 2UV3A 3DX8A 3ARGB 3T0AA 2V5TA 4AH2B 4LNRB 1CE1H 1UB5A 4PGBB 3NTCH 3O6ML 4D0BA 1NFKA 4ONGH 5F9OH 3QCTL 5ITFB 3KHQA 1NGZA 5ALCL 3VFTA 1WWWX 1ZHKA 4HKJB 3B2VH 3HI1B 3FN9A 3O41B 4M4PA 4IRZL 1JPTH 3SE9L 2DIJA 2EEDA 3OR6A 5AAMA 1TVDA 1ZAGA 4XPAH 3RWEA 1XF4A 4KK9C 1FL3A 4P5TA 4I18C 4NJAH 4GOSA 2BOCA 1AY1L 1BLNB 1RIVL 5E9DD 2VR5A 2HT3C 3QQNA 2AJVH 2NPLX 1U8JB 4BSWA 2FHCA 4C57C 5C0RL 4K3GA 1DQLL 3RWFA 1DBBL 4HWEL 2Z4QA 3CFBA 3I3BA 3LKOA 3U9PL 4L3EB 1I7RA 1I8KB 5D8JH 3F7VA 2VR4A 4NUJA 4W4OA 1YPZE 3T77A 3TN0A 4V2CB 3TZVD 3C60A 4MQ7A 5JR1H 4J3WA 1CCZA 1G9EA 1I9IH 4U1LA 5C6TL 1TTFA 2D9QB 4HWEH 1KV3A 1AD0B 3I84A 3QAZC 3D39E 4FQQB 4K8RL 2R4SH 4JPWH 3T3ME 4AEHH 2EDEA 3NACL 3UTSA 3K8MA 4NRYA 5F89A 4PY7B 2VLKB 5HHOE 2GT9B 2EKJA 3V0WH 1S7RB 3LRSB 1R0AL 2R2EB 1Y18B 4XPTH 3SDYL 5C0EA 2BRRH 1BX2B 1MFDL 4OZHF 4KROD 4I4WB 4Y8DC 4Y4FA 2BC4B 3RZCA 4I3GA 4L1HA 4P23D 2EDDA 4WJ5A 1OP5K 3WIFB 5EIIA 1QSFA 5TE7L 5HGHA 5HPMA 1IEAA 3JWDC 1KJVB 2ZUTA 4TULL 4L8CB 5LWYH 4GAGH 3E2HB 3UYRL 1WAAE 4ODUA 3PDOB 4GUPB 2L0DA 3CH1A 5JW3L 4LMQI 1WIPA 3QWQB 4XVUC 4A6YH 1GJIA 5HYSA 5JW4M 3WYRA 2ICWI 1T0PB 2BXZA 3QDHA 2CDGB 4XMPL 3SE3A 3TA3B 4OCYH 4WFFE 4G7YH 4DN3H 1IC7L 5I1JH 1QZ1A 3SKJL 2APBA 3N06B 1J88A 4U1GB 1ZT4A 4OTXL 5E6ID 3DPBA 4BQ6A 5M95B 2VOTA 1AD9B 5C09A 3U4EB 3T0EC 2F54E 3MSPA 5IFHL 3SO3C 1NUFA 4GFTB 5C0CE 2NX5B 3D2UD 3HE7A 3ARDA 4YH6A 2J8UE 4XAWH 1N59A 3MXWL 2NY4D 5T33H 3Q6FA 15C8H 2H3NB 3D0LA 1TIUA 4HBCH 1VKXB 4XCFH 3IDJB 1MRDL 3HS0A 3TZVB 4NKDA 4ZS7H 5SX4I 2FJHB 4LPTA 1SJEA 4RX4A 3IT8D 4OD3H 3U4BL 5JW4Q 3GMQA 5GGSY 5DRZB 3MLYH 5D7LE 5CJ5A 1A7OH 1QRND 1HWHB 3E0GA 3FOMB 5KSBA 3ZHLA 4HULB 3BP7B 2DLHA 4KGJA 4X98B 2H32A 5I8CA 3MA9H 4LPUA 2EZ0D 2C7UA 1EJOL 4ODVH 5DMIH 1JUFA 2LTQB 4C54A 2I5YH 5CMAA 3L3KA 3O3EA 2NZ9C 5EA0L 4E9LA 12E8H 1S7QB 4GMSL 1MWAL 5C0BE 2PO6C 4PJCF 3DBXB 3O9WC 1ERNA 3CNKA 3ZKND 4FHBD 1K3ZA 4JVPA 4NIKB 4NKMB 5GGRY 4BH8B 4YO0B 3BPNB 3GSNB 2CKBA 2CXKA 4V1DA 3EUUA 1JE6A 1IT9H 4LAQL 4XCEB 4WHYG 2ID5A 4PGCA 4R26H 4OGZA 4UNTA 5JW4N 3FO2A 1J10A 3LKPB 5MEOB 4NQEA 1NFDF 4L4VD 2ZSVB 1W0WB 2CH8A 3UDWC 3PGCA 4WFGD 3ULUH 5C0CB 1X4YA 2Y36H 1CICC 3BZFA 5CKGA 4YNYB 4NRZA 5F3HB 1JRHH 2VLJB 4KGLA 3UTTB 5GHWL 2FGWL 3V8OA 1M1SA 3DX9B 2GJ6D 3OF6D 1Q1JL 2UWEE 2EC8A 3ARBC 4GG8B 4HPOL 4FZEH 1JYNA 2BDNH 5ACZB 1EX0A 4WNQA 4JFFB 4XCYB 4YBHA 32C2B 1YY8B 3STLB 2YD5A 1LO3L 1H15B 1OTTC 2HJLA 2H9GB 2LVEA 4W4OC 2IQ9L 3EDEA 3P73A 3NCFB 3ARDB 1WQVT 4I13B 1H3TA 1IGYA 2PYED 1QPPA 3QI9C 5F97E 2GTWB 4Z7VE 3MRNB 5KSUA 4U3HA 4UMGA 1SYSB 4DVBA 4MNQB 4ZPVA 3OKYA 1VHPA 5EBLA 5A2KH 3FHAA 3SCMB 4C4KO 4NP4L 4AM0B 1A1NB 1RZJC 1VADB 3RQ3A 1FV1A 4RISH 2CJUH 4G8GA 1A9BB 2ED7A 1SYVB 1XGYH 3GMQB 2NYYD 5HVHC 5FOBB 4TSBL 1L0XA 3FONB 3JTTA 2Y72A 3D87B 3TIEB 2I27N 5DJXA 4ELKB 4CDGC 2W91A 5DVMA 3BEWB 4IRJA 1ZSDA 2COQA 3GMNA 5IF0B 4RA3A 4RFEA 2K9UA 3QIWC 5BRZA 3RGHA 1NGZB 3VFTB 1RJYB 5AZEL 1K8DB 1GGCL 4K94H 4U6XB 5GS0H 2WMPA 2J88L 5DR5H 3WIHH 3IVKA 4FQXD 2C7UB 2E6PA 1HQRB 3WFDH 4LSSH 3LMJL 3DV4A 3BQUD 1X5LA 2EIZB 3FL7A 4ENED 2XXCB 4IM8A 1UXSA 5ANMA 3WFCL 3GMOA 5CZXD 3UJIL 1YEJH 2ZCLH 4DW2L 3U0PA 4ZQKA 2Q8AH 1T7WA 2VLJD 1CTOA 1L4IA 4WFEE 1KJ2H 3IU3B 3QUMA 2IF7A 3ARBD 5E8NB 5K9KB 2IH3A 1ZLUK 3GSOA 5DF0A 4YNYA 4JFPB 2ERJB 5E6YA 5DQJB 1FNLA 5MERB 5EU5B 4IRSA 3DHJA 5E2WH 4KZDL 4Z7WE 4Z7VB 3TYFA 1JNHA 2QHRL 5GGQH 4IMKC 2NY3B 4WEUD 1CF8L 1Z9LA 5E5UB 5KOMC 2A6DB 1A6VH 3RWDB 4NHUB 1BJ1H 1KCKA 1OAQH 3R0NA 5IBTH 5C08A 1T66C 4G8EA 3WLWD 4MDJB 4KQ3L 5JQ6L 3EJYD 5KSVA 1X9QA 2X4TA 4MJIA 3S5LG 1I9RH 3D85A 1IL1B 2BVQB 3TP4A 3RKDD 5HVHB 1P4LA 3P73B 4FXGB 5IHBA 2AJSL 4G6KH 2IQAA 2XG5A 1CWVA 1PD6A 3BIBX 1GIGH 4ZFOL 1I7ZA 1MCFA 1XAUA 4QHKI 5AZ2H 5H94A 1KTKE 3MLVH 2DKUA 4IOFC 1JYWA 3RWJA 1XH3B 4BH7B 1JVKA 1XF5A 1CD1B 3QHFL 2RFXA 5IM7B 2A73A 5DVOA 1FYTE 4UV7L 1BM3H 1QBAA 3DUSB 3ARRA 5INCA 3RUGB 1GOGA 2XNAA 1G7HB 2F5BH 4Z0XB 4FFYH 2CIIA 3FB5B 3OKEA 2DLTA 3SPVA 4PJBB 5ESVA 2F19L 5F9OL 4HIEB 4QHMB 2DQEL 3ULSA 1MELA 3KPNB 5AYUH 3GUTB 3O8XB 5FYKH 5F3BA 1KCSL 1MLBA 1OD9A 2FSEA 3BPCA 1P5UA 3F62A 2R1XA 3SKOA 3IDMB 5TQ2L 2EXWC 4HH9A 4XCCL 1KLGB 3GGWA 4HGKC 3BKJL 4L9LB 4X4YB 1CFNB 1WFOA 1JFQL 3LH2L 5IB1B 5E70A 1N3NA 3Q0HA 3W9DB 3WNPA 3HG1E 1MRDH 1CBVL 1X5YA 5CD5C 3MQIA 5ESAA 5FECB 1E0OB 4QO1A 5FCSH 2BVTA 3F12A 2XWBB 3O3DA 3BP5A 3EYSH 4JFED 4J2XA 5E00A 3RKDC 1VFUA 3IFOB 4LSUH 1SJHB 2DYPB 1Q9KA 1VACA 3C2AH 3CFCL 1BQLH 3KLDA 4PRIE 1J0ZA 4KKCD 4YDIL 4OTXH 1TCRA 3NIDF 4BSVA 5CEZH 4L4TE 4TTDD 1S5IH 4JRXE 3VXUB 2Q1EA 3I02A 4G6FB 1F6FB 4EI5D 3FO1A 1NEZA 4AIZA 1HHJA 5KVMC 2V2WA 5FIEA 2YPLB 4HS6B 3WNOA 1FFNB 1EPFA 4FS0A 5L8LB 3UXFA 3DX6A 3QEQE 3NFNB 2YPLD 4Y4HC 3PL6A 4M8VA 3MLTA 2E7LC 1YDPB 4N5EC 4O58L 4BUGA 4L8SC 5JA9A 5F1NA 4EJ1C 3GNML 5J11C 4WI3A 1LP9E 2ADGB 3DUHA 1Q72H 4QNPE 2B8OT 5H94B 1GL4B 5FHAH 1KJVA 1LNUA 3D0VB 4L3EE 4X6CE 1AE6H 1RUQH 3OKOB 3HN3A 4X7TA 3QR2A 3UYOD 3W0WA 2B0SL 3GSQA 4P3DA 3QIWD 2VZVA 2GFBB 1FZJA 2APWA 5C2BL 1TNNA 2XTJC 5KS9B 1JWSA 3GSXB 4JZOB 4D3CH 4EN3D 2YA0A 1CFSA 4YJZL 1NUDA 1UJTA 5JIHA 5T3ZH 1DDHB 4AYFA 5CSZA 1HHGA 3HMXH 1EH9A 3O3BB 3DYOA 1E6OL 4W6WB 4MJ5A 5HHMD 1M71A 2PYEA 4X4XB 1ZHLA 4GBXC 3TN0B 4LPXA 4P2RB 1YEJL 2VITA 3U0TA 3WFCH 4TUOB 3VWKD 4ZO6A 2FX7H 4X0KA 4Z7VF 3CK0L 5I73B 4YFLF 4PBVC 3R4DA 3ARDD 4UT7L 3MOBH 5DMGC 3K2UH 3VWKA 2JELL 5IJVA 3HZVB 3RA7L 2BNUB 3BD3A 2R1YA 1ZMYA 3T3MF 5CJQL 4JN1H 4MVBD 4B7LA 5K9QI 4KZDH 3TO4C 1VERA 3AM8C 4GAFB 1DN0A 1NDGB 2BCKB 5F9WB 4FTVE 3S37X 5ANME 1YYLL 2YR3A 5L2KA 4HMCA 3FRPA 3U0PB 3DI2B 2JCCE 4BK5A 5MHSE 1ZA6A 1RULL 3ILQD 1U2HA 2A77H 3RWIA 5BCAA 4NHCH 3FMGH 1ED3B 5EC1A 1FZOA 1KN4L 3ARTA 1NEUA 3M07A 4XC3H 3OJVC 4HUUB 1N4XL 1P7QB 1BQSA 2CLVA 3MODL 3I6GA 5B21A 4I8DA 2YD4A 4RISL 4LCWB 1QA9A 3QEQD 5F88B 2UZYB 3WS6C 3H9SA 4P46A 2FX7L 3GSUA 4MS8C 4S10A 2BOBA 3OB0H 4DZ8A 4CVWA 1QQDB 5GGVL 4Q58C 3W0WD 3RAJL 3RL1B 3CC5B 4W68A 1CVRA 3Q6FB 3TBYA 5L0QB 4N0YL 1V05A 1JZ2A 3QO0B 5H8DA 4XXCC 4NQVB 1QEWB 5GJTL 3ULVC 2Z91B 3LD8C 4ZXBC 2DRUA 3ZL4L 1U8OA 5DT1H 1YJDH 5DD1H 4JO2L 1UB5B 3NAAL 3DJ9A 2C3VA 3ARFD 2L7JA 4QGTA 4JCLA 5FKPA 5GSVA 3PQYA 1A1MA 2YD9A 5IUSA 4EOWL 1QSED 4XWOC 3RGVC 1DLFL 1VFAA 2AJYL 1DFBH 4RGMC 3N1GC 4MNGB 4NKIL 3MFFB 3HC4L 1ZEAL 4OJFH 3ZKMC 4LDEB 4UT6L 2FO1A 4LIQH 4OT1H 2AP2A 3BPOC 1TVHA 4PRAB 1D5IH 2E27H 2IGFH 2JK5B 4U1HA 4WO4B 4JCMA 1YEFH 1IGIL 2AGJH 4L3ED 2NY6C 4MZ2A 1TZGH 3QCTH 3KYKH 3FFCD 4ELKA 3MUHL 1OW0A 1DANU 1QRNB 4F9LA 3FQWB 1G7IB 3ARGC 3DURB 4ETYA 4PJGE 4Y7MA 1IGIH 2AGJL 2HG5A 2HT3D 4N0RA 3P77B 4ALAL 1A3RL 1CE1L 5CEZL 3PE9A 1CLCA 4KRPB 2ARJB 3MBED 3FB7B 1RZJH 4AENA 5D2LE 5T5FH 1WFNA 4G80A 1DTUA 4FOMA 1ZV5A 3LHPL 4ZAKA 3SO3B 5EUKB 3IDUA 3WSQL 3SKNA 1OLLA 3MV8B 3EFDL 5F6IB 2HH0L 1CFQA 1TETL 3Q1SH 5KSBE 4NWUH 3K8KA 4M3KB 3LEXA 2BC4A 3LD8B 4Q0XL 5JPNA 2UYLB 3GM8A 1MFCH 1YY8A 3F6IA 2NY1D 5EULV 3UEZA 1KENL 1V3LA 1JZ7A 4KZEH 1MRCL 3HR5A 1HH6B 2V7NA 2AABH 3H9SE 1I9JH 3TYFB 4P3CH 1P4IH 2P49B 4WU5A 3DRQA 3V0WL 1QQDA 3DGCR 4NFCA 4UQ2B 1AQDA 1NMBL 3MRNA 4FQJH 5KSUB 4X9IA 2W59A 3RVWC 5EIVA 1LK2A 4YHMH 5I8EB 3VRJB 1JF1A 2FEDC 1F2XK 3AVEA 4WHTB 4YHYB 1F90H 3VXSD 5EZJB 1YEIL 1U8HA 2WBJB 4ODWA 1UXWB 4P5KB 5C09E 1WWAX 2BNRB 3SKJH 3NIDE 2B5IC 4NWUL 1A7QL 1NAKH 1YYML 3X3GH 5DS8B 2OMBA 2YMXL 1G7QA 3H6JA 5FKPB 1BPVA 4U1KA 5CEZE 5AAWA 5DDHA 1GGIH 5KVEH 3F7YA 5SX5K 4CMMA 4HBQA 3FFDB 3P11H 4LU5L 1X5IA 1T7YA 3UBXA 2YUZA 1XIWA 1X5FA 1DVFD 1WAAA 3CGTA 3E2HC 1ZLUH 5EZLA 4R4FL 3OXSA 5DHVB 2W92A 4ZUTA 3NABL 3OF6A 3PNWA 4KI5E 2Y07L 1XR8B 2IAMD 1HNGA 2GAZB 1A7RH 5JTWA 1FJ1B 5F96H 3TIDB 5F6IC 4ONFL 3KJ4B 5IB4B 1BQLL 4XNZB 2J1KA 2JCCA 3MACL 4NSKB 2JELH 1NMAH 3HE6A 3P40A 2P46B 3FOMA 5CIPB 1UJ3A 4IHOA 5L2KE 4BZYA 4PUBH 1OT2A 4XT1C 1UG9A 5E24E 4IRSD 1OAYH 2XTJD 5B3JF 5SWZB 2XRAH 3G9VA 1V5JA 5IIEA 3UC0L 5ACLA 3BAEH 4MNHA 4M1GL 2V17H 4OZ4B 3SDAD 4J1UA 5FM4A 3U0TB 5CBAB 2KZWA 1UKSA 3O9WD 4R4ND 2D7TH 5EU7C 5BXFA 1QLRA 4YE4L 4OGYL 4WW2A 5EPMB 3SEPA 1BEYL 3M45A 1VGKA 4OD1L 5HYQB 3QEGL 4MA8L 2EE2A 2BNRE 2E9JA 2OR9H 2BMKB 3V9FA 5J8OA 3I75B 5D7KD 4HFUL 4KH2A 5I17B 2DDQL 5JHLH 3VXTB 3V5DA 3FQNA 4XXCA 4X6CA 1LDPL 5EBGA 1IGCH 1DN0B 1NDGA 4K7FB 3GSVA 4NRZB 1ITCA 1ROWA 4PLJD 2VZ1A 4PREB 3FQTA 1AGBA 1OCWL 4A6YB 1KJ2L 4N90D 4NO2B 3DUSA 1CG9A 1C12A 5TDNB 3D18B 2V6HA 2X89A 1BGXH 3SQBA 3WXWH 2VXVH 1NQBA 4P23B 1RMFL 3B4NA 3WDHA 2CRYA 4JZJC 2P48B 4NRXB 1SJVA 2BVOA 3IRZA 1NSNL 3AS3A 3GHBL 3MV8D 3QHZL 3O2WH 4P2QD 1KNOB 4G6MH 5LJYH 3K4ZA 4KKBC 1EHAA 3HI5L 4LASH 4Y19D 4YXKL 4HJJL 4ENEC 4PRIA 1S9WA 1JGEA 3H9ZA 4QXGL 5J7CC 3O9WA 2PO6D 1RUPL 5FO9A 3A0OA 1U8IA 2X4UA 4XXDA 5LGJB 1MFEH 1T03H 3KPOA 3TO4D 1INEL 3QEUB 1ZS8A 1MCKA 1WLHA 1XF4B 3KPTA 2W0LA 4NZJA 2OZ4L 4KI5D 3P4MB 3MV9B 4F33B 5ILTL 1AJ7H 3KPLA 1BFTA 1AQKH 4MMZC 1RK1B 1KPRB 3VXQB 1RSFA 1YMHA 5E8PB 3NFPA 3MLSL 2VLKE 5J1AB 4I5BA 4L4TA 1XGPB 4XBPB 4IIQA 4KTYA 1U3HC 4OCXL 4G9DB 1N26A 3RVXD 2QJDA 1ZWIB 4X83A 1PYWA 2FX9H 2V7HA 3X12A 4NM8H 3QUMH 4BSVB 2D0HA 1FRGH 5D1ZB 1DQML 3P9LA 1FCCA 1A14H 5EBWA 1IFHH 1IC4L 2IBZX 4WVRA 5BO1H 3IDIB 2F15A 3WUZA 5T3XD 3KPMA 3TJHC 1UEMA 2FL5B 3KDMB 3U9UB 5D7IB 2I60H 1FYTA 4OI8A 1IAOB 2R2HA 4BELD 1I7TB 1S7SB 1S8DA 2OZ4H 3D39B 4YEFA 2EXYD 4ODTH 1D7FA 2DMKA 2O93L 5D2LF 3E8UL 1T3FB 4WUUE 5FF6A 4Y5YA 1DLHB 4CKVX 2HYMA 3ZDZE 3GJFB 3KVQA 2MQ3A 3BUTA 3EJYC 1HYSC 5E8EA 2X4TB 1JWUA 4C83B 4NBXB 1I1RA 1UZ6E 2C5DC 2VDQL 1M7IB 4F9LC 8FABA 1PSKL 5ICZA 1V7ML 2IBGA 3P30L 5IHZA 1KEGL 3OAZH 4DEPB 4RX4D 1WZ1H 4M6NL 3CSGA 3G08B 4WV1B 3MTRA 5CUSL 5DGQA 5DFVC 3L3JB 4AEEA 1VEPA 3KXFA 5DD3L 3ZKNC 4ESKA 4KMTL 4UOW1 3EZJB 3FQUB 2DAVA 5C0DA 3MLRH 4TTGA 4L1DA 1HINL 2OJEA 1J7VR 1RY7B 5IB5A 3GIZL 1PX4A 2R4RL 3PGFL 1FAKT 2OP4H 2WBWB 1GAFH 5C0BB 1XGQA 4X0KB 2CIIB 2KPNA 5CGMA 2NTFB 3AB0B 4GW5A 1MLCB 4P5TB 3SPVB 3RTQC 3TBYB 2EE6A 3CSYA 4XBPA 2FECI 2X4QA 1HE7A 3QRGL 1M4KA 1ULVA 4YHLH 4B5EA 4JKMA 4F2MA 1DR9A 5EOCJ 4P4RA 5JXEA 4ZD3L 5TFSL 3T0BA 5C0GB 2G60H 1QKZL 5FAAA 1Y6KR 2NW3A 2F8OA 2J8UB 3VXQA 4G8FB 5C9JA 5DSCB 2P44B 3FB6B 4RIRA 4QHNB 2AJXL 1IBGH 2DWDA 2ZCLL 4DW2H 2C4FU 3QUYB 3UTPE 2VWEC 4OCYL 5BRZE 1T21A 5H35A 1R3HA 5EBMA 4UDTA 1IVLA 3RVTC 3AREC 1K2DA 2QEJA 4KI5F 5JORB 4X4YA 5AUMA 5I74B 4ZDHA 2JJUA 2NXYD 3ET9F 1OP3K 1OAKL 2BY3A 2EDNA 3BKCH 5EFIA 1T1YB 1JCKA 4OLVH 1H5BA 1UWGL 2E7CA 5DVLA 2P8PB 5I1GL 5D7LD 5CEXB 1FPTH 1BD2A 4OZHE 2SEBA 1P7KB 3UAJD 5H37G 3ULUD 4H20H 4KJYB 1WWCA 1I7TA 5D71L 5EORL 3WNKA 5GS1A 2XWTB 4G6AD 5CIPH 1KTDB 3GMRB 3T0VA 1MQKL 6CGTA 2QQNL 2ZUXA 4W6YB 1VB9A 5ID1A 1TZHA 2OL3L 5HHNA 2CLVB 1QFUL 1KPVB 4J8RA 4ZFOA 3L5WA 3WUWB 2V17L 2VDLH 4O4YH 5T5NG 4E41D 1TPXB 2WIIB 4P3WA 4HJGB 3VCLB 1ZVYA 15C8L 1OOAA 2BZDA 5DK0B 2OI9B 4LRIA 5I2IB 1DE4B 2FDBP 3AB0C 3FAWA 5IROC 1H8NA 1KIRA 4G8GE 1AR1D 5EUKA 1IQDB 2R69L 1D6VH 1XGRB 3BWAA 4X99B 2UWEA 3FTGA 3UYPA 5I1EH 3BW9B 1P9MC 2JJVA 3CFJA 4R0LA 4KVNL 3NIFE 3RVVC 3QI9B 3ALWA 5J13B 1F11A 4WV1A 4F15B 4GAJL 1LD9A 1YC7A 4RAHA 1AIFB 1WBYB 1QEWA 2WP3O 2OTWA 1J8KA 2NY2D 4DFHA 5FDWB 5EC2B 1QUNA 4LLDB 3MRFB 3B5HA 2ICWJ 4F7CA 2I5YL 3V0VB 4FZ8H 1C7SA 2JB6A 2J6EL 3EYOA 4YHPA 3DIFB 5FOBA 3NCYP 5DJYB 4NJ9L 3QUYD 4G9FD 4BK4A 1IAKB 2Y36L 4M1GH 4GG6B 1J1OH 5GGUB 3MRGB 5F9WC 4EDWH 4OCRH 1U3HA 5DR5L 3DV6B 2VH5L 3O2WL 1MLCA 3P4NA 4OV6F 4F9PA 2IJ0C 3BP4A 2O5ZL 3FT4B 2CLRA 2CXGA 2F74B 1LE9A 5C0IA 5EBMB 3L1OL 4KKAD 5KSBB 1F4HA 1O7SA 4WFFD 2CK0H 3WLBA 1FVCB 1WAAF 2R0WL 2VE6A 5HHVH 4TNWK 1OAXH 5GZOD 4LARH 4LBEA 3VFVA 3Q48A 1XGTA 4PV8A 2VXSH 4EKXA 1M05B 2WUBH 1JNNL 2QBWA 1BD2B 4ZQKB 2NY1B 3ZLQC 2OI9C 3PQYE 4HWNA 3WFEH 3HC3L 3TO2B 5BO1L 4BKLB 3ILQC 3CH1B 4KV5E 4XPHH 5ITBH 4K7PL 2G75A 2GSGA 4KFZC 4C56E 4HUWA 3VXRB 1KJ3H 1RI8A 2DMBA 1Z2KA 1HYSD 3VFOA 4PGEB 4TUJB 4Z7UE 3GB7B 3WFHB 1BZ9A 1NUNB 1CDGA 3JV6A 4OLYH 3S96B 3VXNA 1FN4A 1KTDA 2DQUH 3BGFB 5C0CA 1OPGL 1J05B 1NCDH 1KACB 1T83C 2QR0A 3UO1H 1ND0B 2V7NB 4FFWD 3PWUA 2NCMA 2BSED 1P4BL 3INUH 4P4KD 2UWEB 3FTGB 4MB3A 3T2PA 1EXUB 3B9KB 4NHCL 1MEXH 1OAZH 4PJ8B 1MCWM 1AGCB 3WEXB 2X4SA 1T20B 2M2DA 4XWGL 5DJZA 3TT3H 2R9HC 1KFAL 3QAZB 3BN9C 5IMMB 1N4XH 3UCRA 3MV7B 3C9NA 4OV5B 3MRFA 3AS1A 1AQKL 4JZOA 1FL6B 5FF6B 3M17B 5SWQB 3KGRA 2YWZA 4D0BB 4HWZA 3V5KA 4ZO8A 1KN2H 2OCFD 3T3PF 5GS2H 1WBYA 2P5WD 1B6UA 1K8IB 4KHTH 4PY8J 4ZUVB 4YPGB 5IVOA 4PD4J 2H32B 4PRBA 3MBEA 4JJHA 3MJ7A 3HKFA 3K4DA 1EJ6A 3QQ9C 1FH5H 3D18A 4Y1AB 5HGAA 4X7CC 3UBXB 5JOFA 4NQDE 1PVHA 3B3IA 5DA0B 5IHLB 4W70A 5HHOA 4NSKA 1FGVH 1BLNA 3MLXH 2VDQH 1B0GA 3UTSE 1UWXH 1FBIL 3GI8L 1SMAA 4GMTH 4TUOA 5ALCH 4GO6B 3ALXA 1BREA 1N8ZB 3MRMA 2Y6SC 5F3BB 2JLLA 4JHZA 3DX7B 2X4NB 4J3VA 1OGAE 4PJEF 2Z8SA 3RUGE 4ORGA 1YPZA 1BMGA 2EE9A 5I71B 4MAUH 2D4DA 2Y06L 2I9LB 4WEMB 4NKQB 4ZUSB 1U95A 4WW2B 3V8CA 1S7TB 1MCNA 2PYEE 3LIZH 2ICWA 3MJ6A 5E03A 4J1UB 5TE6H 3QBTB 4JLRA 3HR6A 3VXUE 1GGUA 4JJ5A 3NIFF 5E2UL 2DQGH 2DWEA 1RU9H 2NXZD 2UZIH 3KHOA 1RZ8B 1WTGT 4NGHL 3IFOA 3MRJA 3LKRB 4P2RD 3SGKA 5JUEL 4G43A 2W0FA 5CLWA 1U58B 1FZOB 3U83A 2OXHA 4YFDB 3AREB 5H35B 4IDLA 4YHYC 1C12B 3MJGX 3NPZB 4LEOA 1JNHB 3BD5A 1FGVL 3MLXL 3QEHA 3VXOB 3T09A 3OKDA 2P24A 4XCCH 5T1KD 1E4XL 4G80B 1FLTX 3LOWA 3HG1D 5DJDB 5E6IC 2VLRA 4XHJD 2VXTL 5JIKA 2JCCF 4FP8L 2AW2A 1CFQB 1AJ7L 3G6AB 1NFDE 3VXME 4KV5F 5I1CH 1CGSH 1FPTL 2BHYA 5IFJB 3SDAA 1J8HE 2AJ3B 2M1KA 5IV2A 3ES6B 3RTQD 4PJ8A 4PRIB 1QSVA 4NO0A 5D2NB 2AK4B 1FG2B 4I48B 3OGCA 4JDTL 3C08L 1DBKL 3VG0L 3SE3C 4Z95H 2VXUH 2XZAH 2EYTB 1I1FA 4U2YA 1HXMA 1I1AA 4KDTC 1B0WA 2P42B 4YC2B 5KANG 5GJTH 4P3DB 4OIBA 5MHSD 2OTUA 1BFVL 3KPLB 5LQBL 4XPAL 5DD1L 4S0TD 3GBNL 2YHGA 3LV3A 2GI7A 1M7IA 4PGZA 4Z7UF 1T1WA 1F02I 5J1AA 1R5WA 5KG9A 3JWOH 2PXYB 1YYMH 5MEND 3O6LH 5CSBA 5EO0B 2QL1A 4G3YL 3MV7D 3KXFB 2Q86B 3Q6GL 3SDDD 1QBMH 3WMSA 1N7ML 4UTBH 3HG1A 1ZHLB 2XWJA 2VL4A 3IDMA 2J8UF 3MRCA 3X12B 1KT2B 4NO5A 2Q76B 4M62L 4NHUA 4M9PA 2P8LB 3DV6A 1A2YA 5D6CB 1N3NB 2JCCB 4G43B 4LF3B 2EDYA 1DJSA 1V7MH 3RVWD 4QOKB 1YA5A 1HKLL 3O3DB 5J6GA 2D31A 4NUGH 2DBLH 1VPOH 3S34L 2DQUL 5FYJH 3MROA 4Y4HD 2K1MA 3O4LB 5F3HA 4POZC 3MYZA 1TQCB 1MJ7H 4HGWB 4RFOL 4CADB 3MJ9L 4MD5B 4D8PA 2NXYC 5BXFB 4I0KA 3E6FA 3O6LL 4PJIA 2BK8A 1AE6L 1BOYA 2J3SA 3FHQA 1TVBA 2GEEA 1FFOA 3C09C 4CRPA 2CKBL 3WV0A 2OR9L 5IW3A 5A2JH 2DQDH 4PP2A 2IPKB 4OZIE 1INDL 3JV4B 4I1NB 4HKXB 4TOYL 4L8SA 1WJ3A 4KK5C 3T65B 5TH2A 2XZZA 1HHIA 4XVTH 4CN1A 4E42B 4KI5C 4LSTH 2VDNL 4LQ1A 4LRIC 4OLYL 4P5TD 1MIEH 3W11D 3V4VH 1K4DA 4X98A 2ZZUT 2WWMC 4BQCA 1S7VA 1E6OH 1VDGA 5HHQB 4MJIE 3QXUA 4XBGA 1I1FB 4ZFGH 2VRAA 4ZUWB 4OZIB 5TQ0L 1A7QH 1NAKL 2VC2L 2B1AH 5CAYB 1L9NA 1TJGL 1DBAH 2PW1B 1KTLA 1SY6A 5IFAL 1WFUA 5I1DB 3OZ9H 2NY2C 4WIQA 5FYLH 1JHTB 3GIVB 3CFCH 1G6RB 3FB8A 5KBNC 2AKRA 3L3OB 5EUOA 4D0DA 3K80A 1L6XA 5IB1A 3MR9A 3TIDA 4MJ6B 1H3GA 5GGTH 3MRRB 3UTQA 2O5YH 3KPRE 5D70L 1M7DB 4X80L 4MQ7B 5DHVH 4JPVL 5GZND 3LQZA 4YDJA 1K2DB 3U36A 2IMMA 3QDJA 4TTDC 5SWZA 3LKOB 5EO1B 2UVFA 3L3HA 5GJSH 4L4JA 3JVGA 1X5HA 4TVPL 3JUZA 4U1JB 5F7DA 3W82A 5ISZA 3HI5H 5HI3D 2FEEI 2AXJA 2BHUA 2XI9A 3BMWA 4LCIH 4WGWB 1OTUD 2A74B 4NN6C 2A77L 3TVMB 3UJJL 1FZMB 1A6PA 3JV0A 4GG8A 3BKML 4LPYA 2X41A 5D6CA 1CDCA 4JFFA 4DK3A 4LLQB 3S6CA 5MERA 1Q9LB 3T2NL 2WUBL 4XNMA 3MRDB 3HB3C 4P9HL 5D93B 5T5NF 2VQ1A 1LO5A 2OL3A 5EOQH 5C3TA 5FO7A 4WW2C 2F58H 1KFAH 5MENE 4Y19E 4EXPX 2H32H 3AAZB 3CSBA 3WBDA 3T2QA 1QBLH 4MDJA 3VFVB 3QFJA 5TFSH 4ZD3H 5J6HA 2VABB 5C1MB 3ZDXE 1I8MB 4KC3B 4ZAKB 1DZBA 5FO8B 5EZOH 4J8RB 4ZFOB 2F8VA 4P2QB 4XP5H 4DGYH 4X80H 4MD4A 2ZNWA 4EQ3A 2BDNL 1NCAH 2LU7A 3MXVL 4UINL 1WUNT 3JV5A 1DE4A 3U4EA 1IEBA 4I0PC 1WIUA 5F7EH 4YXHL 3TIEA 3DWTA 4OZGF 1CL7H 5D7SH 1GPOL 5I9QC 2WUCH 5C2UB 1NLDH 3BT2H 4NO3A 2PN5A 2DJUA 1SM3L 2PR4L 4NNYB 4HC1H 3SDXA 5IG7A 1NAMH 4BSJA 4R2GC 1MQ8A 5C0AA 3H42L 5LQBH 5LGKA 1MJ8H 4Y4HA 5C0JA 3P0VL 1RVFL 3QJFB 3U7WH 4JFFD 4QRTA 5CCKH 3ZDZF 5I1DA 1AGCA 2DTML 3D2UB 2IGFL 2DL2A 2EYRA 3WLBB 5MP6L 4JRYE 5IEKA 4KKBD 1KSRA 3HCVA 1QO3A 3NZ8A 5GRJL 3U7WL 1CLOL 5HBBA 6FABL 3O3EB 2YN5A 2OSLB 4UNVA 4NUJB 3AS0A 1RZIA 4U1GC 1WBZB 4QRPD 1IMHC 2A83A 3VRLE 1G6RH 3T0EB 3UZVB 3VG9C 4EI5A 5BW7C 5IKCB 3MBXH 4HIJB 4K7PY 5C0BA 2FLBT 4U1JA 5F7DB 5D1XB 3RY6C 3WXVH 1IM9A 4WI9A 5ERWB 5KSVB 5DTFA 1NL0L 1TVHB 4Y4KA 1Q9LA 1OGTA 2Z8VC 1UKTA 2BSSA 1X5KA 5GGTA 1NGPL 1Q8MA 2RIKA 5DMKB 2DS4A 2P8MA 3TH2T 5GZOC 3VH8B 4HC1L 1N5YL 5D7LA 2G75B 2GSGB 4NZRH 2DYPA 1BF8A 4PJFE 5DMGD 4G8IB 2V9TA 3MGOA 4UIMB 5CZXC 3SE9H 3PUCA 5E2WL 5JO5B 3W39B 4KKLC 3HZKB 1CFBA 4GAYB 3NVQA 2ERJC 4UBDD 3CVHH 4N68A 5FGCE 2A6JB 4KROC 1MCQA 5GRWA 2GUOB 1MCEA 4QHUA 4YXLH 1BZQK 3PIQB 1J1PH 3EDJA 4L4VB 1D5XB 3NN8B 1P7KA 4GSDH 4LKCB 4LSUL 4HS6A 5EU6E 1CGXA 3NCMA 3O2DL 2A2QT 5DYOB 4UILL 3REVA 4XVTL 1A4JB 3LKSA 2VLMD 4WNQB 1DP0A 1T6VN 1HSAB 1MUJB 2VLLB 3AMKA 2XQBL 5D5MF 1CLYH 3X14A 2AQ3A 5BS0D 4GQPH 5C7XL 4X6FA 2YUVA 2YEZA 1CDIA 1UWXK 4M61A 12E8L 3FQUA 3FKUS 1IM3B 5HDLA 3QXWA 4HJGA 3VCLA 1BIIB 2IG2L 2CPCA 2QSVA 5CUSH 4QRUA 4XPBH 2M26A 1M6OA 1FFOB 1KYOJ 3A6CL 4N8VG 4RMWA 5DEGB 1VFAB 1OF2B 4DVRL 4QRRE 5JHDA 5GS2D 3LQAL 4NRYB 3RP1A 2X4NA 1PBYA 1NGWA 4F7PB 4N90E 2IWGA 5JDSB 3VGAB 3PXHA 2J4WH 4EBQH 3ZDXF 3HHRB 2X89D 2JE8A 1CT8B 5FUOL 2F53A 3RZCB 2X6MA 4AT6B 2Q8BH 4EI5C 5AWNL 1U92A 4U1SB 4KPHL 4KROB 3KR3H 5BOPA 4WY7L 1F3DH 5HHMB 3B2UC 2EH7H 4CDHA 1F6AB 4OGYH 4PJCB 4NM8L 3BGFC 3EO1A 2PYFA 1WZKA 1DL7L 5EU6B 1MFAH 1A6UL 2P5WA 5KAQF 1XGPA 4DKFH 1EEZA 3WS3A 5JDJA 5DQJA 3CMOH 2FR4B 1ZVSB 1OAUH 3LQZB 1FL5A 4YDJB 3VFMA 3L5XH 4H5SA 4TSCL 3V6BR 3H0TA 1ZT1A 2W9DH 5I30H 3QEHB 2AK1H 3O6FB 1IGCL 4Z7WF 1REIA 1MI5D 3GO1L 5ICYA 1HN1A 4Z5RA 2HP4A 3HZKA 3ULUE 4JRYD 5E56A 3TVMC 4H26B 3ZTNL 1HSBB 3CXHJ 3HPJB 1W8NA 5BV7C 4NCC2 2DICA 4CMHC 3N1FC 4I0PA 4UDUA 1FGNL 5HI3C 4FQHA 3LQAC 1FZJB 3QXTA 1PKQB 5IOPA 5BMFH 1AXSB 3RVUC 1LILA 5EA0H 1IAIH 3ISWA 4X6FB 3TNNB 1D9KA 1X7QA 3C6LA 1AGFB 3OAYH 3EJZC 2LU3A 5IM7A 4I0CC 2BXYA 3VWJC 1YEDB 1NUGA 1C1EL 4CBPA 1K5NA 3RZCC 2CSPA 4RMVA 4XVSH 1H3PL 5F1KC 1CG9B 1RUAH 4OZFA 1MHEA 4UAOC 1G7HA 5I8OH 2CR6A 5GGRB 4JFHE 1JWMB 2NNAB 1OQXA 1R6VA 3CXDH 5DJZB 1FP5A 2VDRH 2C3XA 1MCSA 4Z7OF 2G5BB 1UEYA 4NKMA 3S5LB 4Y2DC 5GJSL 4Y4KC 3WHXB 1EAJA 4Z8FH 1GCFA 1A7PL 4IEFB 3DO3A 2QSCL 3PWVB 2XTJB 5C92A 3FT4A 4BJLA 4GW1B 1I9JL 3AM8A 1MY5A 5KS9E 4U1SA 4OLUL 1CGUA 1BQHB 3PG2A 4AMKL 2CDFB 1S9VB 4ONGL 4MHHG 3UO1L 2FSEB 1AP2A 4F9PC 3U48A 4OGXH 4B7IA 2Y9RT 4YK4B 3MRLA 3MV9A 2NYYC 5DUML 3WIIL 4F33A 2RAMA 3X3FH 2VUOA 4LVNC 3DX9A 4ALAH 4ZTOL 3F12B 1C5DA 4S1SH 4UNUA 3VJ6A 2KDGA 5EPMA 3ZE0F 3ROLA 4HF5H 4PG2C 1ZE3C 4I3SL 3TT3L 2OYPA 5IEHB 1OAQL 5IBTL 1CVSC 1U8PA 2DI8A 3KWWB 3REWB 4U1NA 43C9B 1GVIA 5K9OB 1QSEA 1PY4A 2I9TB 3R0MA 1D6EB 3WKML 1T5XB 2ITCA 5TGBA 3I3DA 4MX7B 5TE4H 5E94A 1JL8A 3DSFL 3GHEH 1D5BB 3UJTL 1TMCB 4GUPA 3RI5F 5D9SB 5KZCD 3SKUD 2XA8L 4JY6B 4M03A 3GSWA 1RUMH 1LE5B 4EUPH 5IMLB 1FC2D 4MJIB 3C8KA 2CLZA 3T0DA 4F7TA 3MLPA 2WWMD 3I6LD 2Q3AA 5EOQL 2P8MB 3I02B 2ZKHH 3E1F1 4UILH 1CD0A 3HC0A 1ZLWH 3O2DH 3B9DA 4CL7A 1OWWA 2EYSB 4F80A 3TJHD 1IRAY 2MHAB 1YJDL 2EKSB 4PJXA 4QRPB 2BX5A 3PWNB 4FQHB 4JKPL 1CLYL 3C8HA 4GQ9H 5KAQG 4NQTA 4EIZC 3FFCB 1F90L 4OV5A 3QUZC 4IRJB 3OTTA 1XF2A 1XF5B 5J4MA 1BFSA 3FOLA 4M8QA 4X6CF 2NLJB 2FIKA 3TN0D 2PW2B 3AY4C 4L8BA 2R4RH 3PGFH 4OM0L 4YE4H 1EZVX 3K1KC 2PF6A 2AXFB 1MI5E 4WFHD 4ZS7L 1CL7I 1JN6A 3BKYH 4F15C 1CDBA 3EIFA 4OUOA 1R5IA 3QNZA 3BVNB 2XICA 1IJ9A 1KGCE 1MHCA 4LLDA 3GSXA 1Z0MA 3OKLB 3F7YB 5DLML 4J6RL 2OR8A 5EU5A 1Y6MR 5D71H 4FQCL 1ADQL 2BSRB 4HK0B 3KS0H 2H6PA 2XKUA 3MPCA 5CINL 2DLEA 4BQBA 5CJOL 2HFGH 3CIQA 4MNQE 2AJZB 3VMNA 4J4PC 4DKEH 5EU4B 1JF6A 3IDGA 4OLXL 2EO9A 4NKOA 4DGIH 3OV6A 3BXNA 1BVKB 1WK0A 2FH8A 5DJCA 2VLJE 1IILE 5KW9H 3UYRH 3QT2A 4TN9A 5CJBA 3TV3L 3VXRE 1JMZA 4I18A 4LOUC 1T66D 1TJHL 1MCBA 4B53A 4QNPF 4CVZB 1SEBB 5CZVH 1EVTC 1MRFH 2VZSA 4UDTB 1SM3H 1KJ3L 1WBXB 2GK2A 2PR4H 2X70A 3STZA 4O4YL 5IW1B 1WICA 1RD6A 4UV4H 1HIMH 1NMAL 4PJGB 2QHLA 3SCMD 5GRUL 4PRDA 1VFBA 4TVPE 4AY0A 3FO0L 1IGTA 2IFFH 4DAGL 4QOKA 1LO3H 3GSRB 4QRPA 1BHGA 3VFOB 1FC1A 3H2WA 1B2WL 5KVFH 4JO3L 1HKLH 3UTSD 4OQTA 4OCXH 1JTOA 1UH3A 1DANT 4O2FA 3ZDYF 3EHBC 4KWUA 5B38G 4ELME 1F6LL 5IB2A 3ULUC 4OI9A 4EUPG 2V2XA 4HKBA 4XNUH 1MAKA 3MBXL 5BJTA 1V3KA 1EXUA 3H9SB 4P46B 3S35L 2R29H 4PJ8C 4RGOH 1CXFA 3C08H 4OB5H 3CD4A 4NJ9H 5HPOA 4NCDA 3GSNL 1IBGL 1T0NB 1JRHI 4YFEA 4WI4A 4RMSA 4LQFL 3MLWH 4WO4D 3TA3A 1AO7A 1XGQB 2JJSA 2AERT 4NPYA 4PJ7A 5AD0B 1QHPA 4GW5B 2FO4B 4YGAB 1NBYA 2EDRA 2C3VB 5DRXA 1ZT4B 1YEDA 3L3IA 4O2EB 1AD9A 5C09B 5JW5B 3PF2A 2CK0L 5C0GA 4JFXB 4RMTA 5GS0L 2HWZL 4GKNA 1U8OB 1KTRL 4P59L 4XBGB 1E4WH 1QR1B 4LLYA 4Q7DA 4X5XA 5IVNA 3LEYL 1Q9KB 4OZFG 4BQ8A 2GY7B 4H1LB 2NXYB 3KYMB 1F97A 3HUJF 3P4MA 1EK3A 4X4XA 4DK6A 2H2SC 1FNGA 3QDJD 5JXAL 4NN7B 2GITA 2BHZA 3Q6GH 3MV7E 1NLDL 4QXWA 3MNVA 4A6YL 4R96B 2C1OB 2X1PA 3FQRB 3MBEC 1N0XH 2HA1A 3OAUL 3V95A 4OFDA 5C0AE 1HHKB 2Z31C 3FJTA 4O2CB 1UM4H 1UADC 5EIIB 1CDUA 3WIFA 4IOSD 3SDXE 1J8HD 5C0IB 3U36B 2R15A 3DROB 1WBXA 3KYOA 2R29L 4RGOL 1FGNH 3PJSA 2DM2A 1WT5C 4XNYH 2UUDH 4NNXB 4YK4C 4HV8A 5JLZA 4IMKA 4R97B 1X5AA 2J7LA 4BFIA 3DARA 4QY8B 3QIUB 5DRWB 5K59E 4CU7A 3B6SA 2R0KL 4KI1A 4PTUB 1GC1C 4YO0A 4RRPA 2X09A 3MUGA 3CH8A 3T4YB 3KYNB 4U6HA 4D9LL 4NWTL 1PLGH 1C5CH 1ZHBB 4JHWL 5JOEA 4HUWB 4XNMB 3VXRA 4QRQA 3QH3A 5K9OA 1ZVSA 4TSAH 5INDA 2ZSVA 3VGDA 3EW3B 2AK4E 5I18L 5LXGH 4HK3J 4U4BA 1N6UA 2J4WL 4M6NH 1YQ2A 4QTIL 3IJHA 4XVJL 3AC0A 5A16A 1DVFA 3DSFH 3GHEL 5FO9B 3TC9A 3IETB 3DXAD 2HKHL 5DEGA 5CSZB 4FQXC 3TNMB 3UDWA 4KRPC 1KIQA 5JXED 2FJHA 5I66B 5HHPA 1GSMA 2YD7A 4JRXB 2OJZH 2PW1A 3TCLB 4P2RA 1I1YB 1DSFH 1A22B 2EDXA 4PJXB 2X42A 2R1WA 3IGAB 3K4AA 3H9HB 1YNTB 2A9NH 2E8YA 4LHUB 2IPUK 4LNRA 1KCSH 4GSDL 4M5ZH 5IJVB 5GS3A 4RAVB 1RZGB 3EO9L 2G60L 4QF1B 5HYJA 4OCWL 4M43H 4MAUL 3FZUD 1A14L 3SKMB 3K3QA 2VXTH 3PABB 3IXAA 3L3HB 4L8DB 2W38A 2GAZA 3AY4A 3GRWA 1H3UA 4AM0A 4F58L 5J57B 2B4CL 4LLMA 3MREB 2X4PA 4Q9QH 5HYJD 1CF8H 1YEEL 2LE9A 1JGDA 4DGYL 5DJAA 3DETC 4WCYH 3HB3D 2EE3A 4LMQE 3ABZA 2CR3A 4L5FH 4LLAA 1T83A 3KPMB 3MLRL 1MREH 3ARVA 4EN3A 3PWJA 5EB9A 5JUEH 5I9QB 3QUYA 2QADD 5JLZB 3Q5YA 4FTVD 4N0UB 3MCLH 4EVNA 4MQXD 3BGMA 3DX7A 4KJQC 5DFWH 2MSPA 3CUPA 2QADB 3MZTA 3B9EA 1UKQA 5IIEB 3TH3T 4YWGL 4KJWC 3S35X 4OZGB 3H9YA 4ETQB 4ZSOA 3BE1H 4P2OA 3KPPB 4JFEA 2VTFA 3MYJB 3MRHA 4EIGB 2F53D 1VESA 1EO7A 2HLFC 1OHQA 1NJ9A 3TBWB 5I1CL 4TYUA 1AKJD 5HVWA 1N5YH 3GSVB 4OCWH 2DJSA 4BZ1H 3KJ4C 4M00A 3U2SB 3GNMH 4ZOAA 4JFPA 5I76B 3DRTB 3HE7C 1IGMH 3T0ED 5FUZH 1SYSA 1G7LB 3QWRD 1NL0H 5EBLB 1MHEB 4U0RC 1CICB 4WW1A 1GRWA 2FJFB 1U91A 2DQEH 4FTVB 2JJTC 5A16B 3OG6B 1F00I 4U1MA 1OM3H 2NQCA 3VGAC 2W9DL 5I30L 2NW2B 3DTXA 3ZKSD 2WUCL 3DXAE 5KS9A 5KVDL 1FORH 1P4LB 2KQNA 2GJJA 4Y16D 1UXWA 4P5KA 1CE6B 4JAMB 2J8OA 2AXGA 3IAPA 4TRPH 1KELH 4Y0GA 4GH7B 3VW3H 2AJXH 2UVEA 4X6EB 1BQHA 1B9ZA 2P5EB 3ARQA 4NZDA 3D69B 1CDJA 4GW4A 5DDHB 2LAAA 2R2BB 2ZSWA 4MSWA 4OUUB 3WKNA 1EFQA 1G84A 1MOEA 4JM2C 5FYKE 4HKZB 2A83B 5FGSA 1HINH 4FXKA 5IKCA 3OXSB 1JNJA 1RZFH 4NC0B 4GKSB 3B5GA 4J3XA 5INCB 4ZDHB 4XZUB 3O6FC 5GRXG 1N0XL 4WENB 1KENH 4EQ2A 1DBJH 4V1DB 5CILL 3D48R 4XAKE 5C6PB 5JPMA 5TQ2H 2IANE 4HWBL 4F7PA 4ZUUA 4M7ZB 4MJID 3DVGA 5FCUL 2C3WA 3PWJB 1U41A 4ONFH 3HUJE 2KQMA 3P4OB 4TQEL 5E6IA 4OGAD 2AEWA 3VE0B 1S9YB 1T7ZA 3E3QC 3NA4A 1ZLWK 3QIWB 2VDPL 4X6BB 2FYYB 3OKMB 3VFPB 4H1LH 3GGWB 4PJHF 3TF7C 3QXAA 1MJJA 4PRHB 5FEBA 5I1AB 1IC5L 2E7HA 3SDDC 4Y4FC 1UZ8B 2HLAB 2GUOA 2G9HA 4HDIB 4M48H 3IFLL 1JIBA 1NFIB 1A6TA 1MSPA 1XCTA 4L4VA 5FFLA 5HHVL 4LCWE 4FQLL 2VLRE 4PGEA 5LVEA 1JPGA 2VQ1B 5DURD 3CVHB 1DEEA 1C5BL 2D4FA 3G6AA 5EORH 2AEPL 5L6YL 3QUXC 2R8SL 4LCWA 2VIRA 3O2DA 3VXSB 4ODSH 5FYKL 1INQB 4XNXH 4HEPG 3OPZL 1J0KA 4JE4B 2ZCHH 4YDKL 5I1KL 5JHLL 4PJAA 4ZFGL 3MACH 4U1IB 4YHNA 4WW2F 1PQZB 1RURH 5EWIL 5EZIL 5T1MA 2ADJB 3SGKC 1FO0L 3N1QC 2RFXB 4M4RA 4RCAA 2A6IA 4GRWH 3VXSE 4JQVA 5FGBC 2C3GA 3L7EA 3TZVC 1EFXB 2AEQH 4LVHB 4XMKL 1JHLL 2R0ZH 2XZCH 2XIDA 3MRGA 2B5IB 2DIBA 4XNUL 2N56A 3UPRA 4R7NB 1CZ8L 4NBYB 5TH2B 4RBPH 2R56H 4R3SA 2NTSP 1R3KA 4D94A 4QRRA 1U8KA 4X8XA 3THMH 1R5VB 1TJHH 4DUWA 5DJ6A 1MHCB 3C5ZA 4JM2A 1U8LB 1UM4L 1JPST 4PBXA 4G6KL 3PHOB 5IT2H 4BFBD 5DO2C 1ZGLP 2DQIL 3WFEL 2LVCA 1KCRL 6FABH 2EEBA 3K46A 1LEGB 3FO0H 2F5AL 2X4RA 4W4NA 3O45B 4FZEL 4NQDA 1CXKA 5SV3A 3ZHDA 4YZFF 2HRPL 2YPKB 3QXDB 1YYLH 4U6YA 3MRMB 5B22A 2JF1A 5DI8B 4UIKH 2IH3B 2DWDB 4X7SH 2NY7H 3BXNB 1R3HB 4JGMA 3DMMB 3BQUB 2R56L 4NQSA 3MNWA 5FUCE 5DSCA 4MXVF 2NY0D 3TA3D 2GSIA 4RIRB 4CW1B 5I0ZA 2EIZA 3N50A 4JRXD 4LCCA 3MV8E 1MF2H 3B5TA 4WI5A 3BIKA 1SBSL 3Q5TA 4X6BA 1XIWC 1ZLVK 1L7IH 4HIIA 2D7QA 3QUZB 4IRJC 5FA4A 5C6WH 3HTLX 4PRDB 2J8HA 2CKBB 3GSNA 3QQ4B 3MXVH 3I6KA 5C8JB 2EDBA 5E2JA 5CEXA 3ECBA 4M1CD 1J86A 1T20A 4WHYH 4GAYA 1RUKL 5E94B 3LN5B 3QPXH 3L95B 4OIAA 4U1IA 4YHNB 1AXIB 1HKFA 1S5HA 2FB4H 5LBSH 3FAXA 1HK6A 3PL6C 5FYJU 4N8CL 4C4KT 2CDEB 4Q9RL 1S78D 4FQJL 3GSWB 3MCKA 1DQMH 3SHSA 4FA8A 1T0NA 1JF1B 4ODHL 3C8KB 3B2VL 4KTDH 1N0LA 3INUL 5CS7A 3NACH 3I2CH 3MYJA 1P4BH 3BH8A 4NZTH 4P2QE 4ZOEA 2Z35A 2V2TB 1JWSB 1L7IL 3SQOH 1DFBL 2WIMA 5IGXL 1YMMB 4OAWB 3P0YL 1DVFC 3DRTA 2YA2A 2NZIA 5J3HC 1KPRA 3C87A 4F3FA 2BRQA 5HD8C 1JUFB 2RCSL 4PJXF 5IQ7L 3PWVA 3ZO0A 3QULB 2ZKHL 1BF2A 1U91B 5DQDH 2GTWA 5DJ2A 4HX1A 1B88A 4JKWA 4R4FH 3UJTH 5DGRA 4FFWC 4P4KB 1VGEH 1FDLL 2X2YA 3JXAA 2H45A 3C6LD 3RI5K 1E4XI 5IESL 3VFSA 4AEHL 5HHME 4KK6D 2IAND 3N1PC 1UJ3C 2VITB 5CP3H 1NCNA 2GITB 1QVOA 1O5DT 3E8UH 5KSBF 1LEGA 2A6KA 1CK0H 3PHQA 1INDH 4NQDB 2EC9U 2BRRL 5E6ZA 4TVSa 1F42A 1U3HB 3O8XA 3E3QE 1KB5L 2VAJA 2YK1L 3MJ9A 2R1YB 4OT1L 4RWYH 3K2MC 3C60B 4DKDC 4PRNA 2P4AB 4JG1H 3QQ3A 2B2XH 5TGBB 2DBLL 3QWOA 3BDYH 3HPLB 2P8LA 3IXAB 3PABA 2Q7YA 4L8DA 1JZ6A 2DQHL 5MENA 1IAMA 1DQJB 5JOPE 5F9JB 5F8RC 4YHIA 2QQNH 3MZGB 3U46B 5DTFB 2V5RA 4KKAC 2O5XL 4XPFH 5C0EB 4XAWL 2R2EA 4YBLB 2CK2A 3VGFA 4KDVA 3KS0J 4WDIB 4ZTPL 2O61B 4YUEL 1NLBL 4K23L 1D9KD 5CINH 3O4LA 1BECA 4GAJH 5C8JA 3ES6A 3ARGD 4PD4K 2AAVA 1E28A 2CRZA 1EJOH 4U31A 2B7DT 1QSFB 1GAFL 4XNXL 4WJ5B 3N85H 5SWSD 2HRLA 3MLZH 3EDKA 3BE1L 4I0PD 3VU2A 1Q9OB 4UT7H 5IB3A 3NH7H 2ARJA 5B3NA 1T89A 3BPLB 1RURL 4HLJA 5C0FB 3FRPG 1FO0B 4EDXA 4YDLC 4RDQG 1VPOL 3T2OA 5DJ8A 3JWOL 1YECL 2PO6A 3VRIA 4XCFL 4DVRH 5ID0A 3KPPA 3IFLH 4JFEB 4PS4H 4GG6F 2IALB 1I3GH 4KMLB 2HLFD 1LO4L 3KPRA 3TT1H 4HJJH 5SWQA 3MLTB 1QFPA 1T22A 5BVJB 2H1PL 3LN9A 4OAWA 1NMBH 1ACYL 1IZKA 5BV7H 1KPUA 5ENWA 2PXYD 3DGGB 3OWEA 5FUCC 3V6OC 3MV7A 2APXA 4HS3A 4MYWB 4XPTL 1YN7B 5HGAB 4OBSA 1AKJA 3WN5B 1CICA 1KCRH 3I6LE 2DMCA 3L7EB 1PKQE 4HX1B 4YIQA 2UY6A 1GXEA 3LKQB 3DYMA 1RJZA 1CLZH 3WIHA 3NFPB 3MLSH 1KCUH 4GT7A 1N8ZA 1A9EA 1U8HB 5E4EC 3F5WB 4AIOA 3QA3B 4D3CL 4L4TB 5FXCH 3VFSB 4YBLC 2ZUVA 2JJSC 1SBBA 5LWYL 4DKFL 1JHKL 4JFQA 1H9VA 4HAGA 4CGTA 1X5JA 2APVA 5JW5A 4H0HB 2PXYC 1Y18A 4BUHA 1U8NB 1OPGH 3OKKA 2MPAH 4U0QB 2AK1L 1P84J 3OJDA 1ZOXA 2C9AA 4MA8H 4DGVH 1MCLA 3LS4L 5T1KA 3L5IA 4OZGA 4XB7A 3KXFE 2HFFB 3MJ8B 4PJIE 3MRLB 4LLUB 5JNYA 4YGVB 5I74C 3HFMH 2BFVH 1IEAB 2D9CA 5TDOA 2C26A 4GBXA 4AZ8A 3RGVD 4EXKA 3VXPB 4ISVA 3VXRD 3CXDL 1JZ3A 1T4KA 3HPLA 4WTZG 4YDKH 5DURB 3KG5A 5KN5A 2DQDL 1N64L 2UYLA 3NCBB 4XMLL 4O2CA 1JNNH 4K3HA 2AJUL 4IDJH 3MV8A 1BBDH 1W0VA 2NY6B 1MFBH 1MAML 5E9DE 4LDLB 5JXEC 3VGGA 5T1LB 4QRPE 3DRQB 3RNQA 1ES0A 4QOKE 1H3XA 4ODBD 1JK8A 3DVFA 3LN4A 4KHTL 4O02H 5ICYB 2NY5H 4G6ML 5HYEA 1CU4L 1KB9J 3VA6A 5CBAA 3BPNC 2FYYA 3OKMA 2A1WH 3VFPA 5A2IH 3BRGC 5ETUB 3VXOA 3MO1A 5DRNA 2XNAB 1EV2E 4QXGH 3HC0B 4ODWB 2HVJB 1HOCA 5MEQB 3HNSH 3V0VA 5HI4D 2XFXA 3ZMRA 1XCTB 4JQIL 4NO0B 5I8EA 4LNVA 5I6XC 4IRZH 5FHBH 3KPNA 2YD3A 2YC1B 4S0SD 3K2UL 3DSNA 4ZYKA 2XY1A 3V6FA 4HS3B 3P4NB 3PL6B 2FHFA 1N6QH 3N1MC 1FO0H 5CJQH 5TDPA 4POUB 4APQD 1YDPA 3CX5K 3H7BB 3PHSA 1AGBB 1PKOA 4MNQA 4ZPVB 4DOHB 1OWRM 1QLEH 3WFDL 2EYTA 2AV7A 1ZXQA 3TGXA 1YMMD 5DC4B 4JQXC 3QDGD 5HY9A 3FO9A 4KTDL 5BS0A 5EU3B 2Q6WB 5B4MD 1R24A 3CDYA 1SYVA 1F4YH 3DUUB 2HWZH 1I85A 4PJ5E 4F2MB 3JTTB 2Z91A 4XZUA 3ZL4H 1TLKA 1WZ1L 4PJEE 5HGBA 3ARFA 3MGAA 4RFEB 4TNWF 1F5WA 2XTJE 4PGCB 3T77B 3V79C 2A1WL 3WS3B 1G7IA 3V7AE 3TWCH 3QNYB 5KVDH 1BZ9B 5CGYD 1DLFH 2F5AH 1NANH 1BM3L 2ZOLB 4PJEB 5KSAB 3OJDB 1RHFA 1EEYA 5BRZD 5MP6H 3NZHL 4WI2A 5IW6A 2DQHH 5D1QC 5JOPD 5MI0C 1PEZA 2NY1C 4GBXD 4JREC 4KK8D 3LDBC 2F5BL 2C4FT 3GMOB 2YSSA 4DUXA 4WU7B 5GRJH 5FYJD 4JEGB 2DWEB 1F4WL 1OSZA 3MRBA 2BNQA 1XGUB 1S7XB 4YHKH 4K23H 3WEXA 2CIKB 4LASL 3QIBB 1T1ZA 2DB8A 4MXQC 2R2CA 4OM1L 2IBBA 2FD6H 4L3AA 4PJAB 2RBLA 3KPSB 5IW1A 3RKPA 1UQSB 1NAML 3NA9H 3FRUB 4YPJA 1G0XA 1BD2D 5I16A 3W0WB 4DKAA 5IG7B 4NO2A 3U46A 2GCYB 4GS7B 5IMKB 4RBPK 1PDKA 1XIWD 1EZVY 2ATKB 3IDXH 3LZFL 4D0CA 5C0AD 4PP2B 4PYHA 5IJKA 2GIYA 1ZA6B 1F4WH 5JPNB 1EUTA 4PB0H 2ZUSA 1KXTB 3ZTJH 1NCAL 1R3LB 4M1DL 4H88H 1CI5A 1CFVH 3D2UA 3HE7D 3PWNA 3VD3A 3WJJC 3ZT5A 1I7ZB 4P49A 3IKCB 3VMPA 5IHUH 5HHQA 4XWOD 1I4FB 2GYSA 2JJWA 2CKNA 1IGJB 3BGAA 1IC7H 5I1JL 4PGBA 3Q1SL 1A3RH 2Q6WA 2C1PB 3BKJH 1MVUA 5MI0B 2PW2A 4G5ZL 1Q1JH 3CFDA 4S1RL 4DZBA 4GG6A 5IFHH 2X44D 5JZ7D 1QRKA 2ADIA 1AP2B 2Y23A 3PHOA 4PRHD 2BP3A 1JZ8A 5I1KH 4AL8H 4HIEA 1KYOK 4UQ3B 5HJ3A 4TRPL 1LO4H 1FFPA 3LEVH 3BKCL 4RDQF 5FM5M 2E7LA 1ZEAH 4OJFL 4Y19B 4M7JH 1MIMH 4MB5A 5BV7B 2ATPA 4PG9A 2ZOLA 3GSOB 4LAQH 1GC1H 4YAQB 5IW6B 4R26L 5DEZA 4MCZB 4MD0A 5F72S 4GAGL 4PJDA 1KJMB 4NQSB 3HI6H 1I75A 3HNVL 3K74B 4V1DD 4Y5XC 3RIFK 3KLAA 3MOQA 2OS7A 1CFNA 4OCSH 1G9MC 1RZKC 1AC6A 4U33A 3MRBB 4GRWE 4EI6B 4PRAA 3WFZA 1RK0B 3RVTD 3CFEA 4OKVB 1EGJL 2CLZB 4PIRF 2BNQD 1DBAL 1CN4A 1FYHB 1W0WA 2NY2B 4XGZB 1LP9F 5L2JA 4UAOB 2I26N 1D5ZB 4HFWB 1BBDL 1NJ9B 3FCTA 3QDGE 4MLSA 5SWSB 5CEYB 1UQSA 3ARXA 2DM4A 1XEDA 3FQWA 3V4VL 3GJEA 4OLVL 3C2SA 2DQJH 4HIXH 2XZQL 2YD2A 1TCRB 1G7LA 5TQ0H 1A6UH 4QXTA 4ZNCD 2OBGA 4PRHA 2ATKA 3VGHA 1EIBA 1D9KC 4Y5YB 5HDBE 5K93A 1HXMB 1I1AB 2HLAA 4HDIA 3HFML 4MD4B 5EFIB 4YHOH 2EC9T 5I16B 1YY9C 1H5BB 2YPLA 3D5OF 1FVDA 1HHJB 4K9EL 3I75A 1OT1A 4Y5VC 4POYA 1S9XA 1MPAL 4OFPA 4OQTL 4QHLB 1MWAA 5GS1B 4E0RB 1X7QB 3JV4A 3PV7A 4U49A 2RGSA 1YNKH 2KL6A 5HGGS 3L3JA 4IIQC 1I3RA 2XTLA 3VH8G 5BQ7A 5HDQL 5D93C 3MNZA 4K3EL 1I4FA 5AG8A 3MFFA 2Y5TA 3SDCB 2WLZA 1LMKA 4LGSB 2AS5M 1CU4H 4Y5XB 5KW9L 4M6OH 2V9QA 1N59B 5GRVK 3KNBA 2AQ2A 3CSYB 2F53E 2VSCA 3S4SB 4AK1A 1TCMA 4FXKB 4HBCL 4X7DC 3VRJA 2G2RB 2XPGB 3QCVH 1JHTA 3VGEA 5C9JB 1IZJA 5FKAB 4LHUA 4UU9B 1HWGB 1DQQB 1KIPB 3VGBA 4DQOL 1CZ8H 2D0FA 4TVPH 4H8WH 3TBTA 1TFHA 2DLFL 4JFYA 3V4PH 1R3KB 4KUCD 4JN1L 4P4RB 5D2NE 1BWMA 5E00B 4YHZH 2GQHA 1A6AA 3GJFH 1TZGL 5F93C 3Q3GB 3UROR 4N8PA 2ORBL 3O3BA 1ZS8B 1OSPH 3P4OA 1FL3B 2H2SD 1AKJB 1BAFH 1EO8L 2DI7A 2P45B 2HFTA 1JGDB 2EDWA 4EI5B 3MRQB 3UPAA 2P47B 3X17A 5A2FA 2UZIL 2NY5L 4HUVB 1W8OA 3PGDA 2LTQC 4UOW0 3QG7H 5SX4H 1VFOA 2ESVA 1G9MH 1RZKH 3C5JB 1D6VL 2UWEF 1U8PB 4MAYD 1E28B 1KN4H 5IBLC 3BGMB 4GXVH 4MXWH 1MCJA 4OSUL 5DZLA 3C5ZD 3C5SA 4HXBL 4DTGH 4LCCC 2NR6C 1BEYH 1NMCC 1AD0A 1HHIB 4G8EB 1Y0LA 3ZE0E 5CWSA 3PXJA 4J23A 4WUUD 1ZLSH 5D7KE 2A0LD 4ZSOB 3O3AA 3VFWA 1DUZB 4H8WL 5FUZL 1A6WL 2VDKL 4GRLB 4X7TB 4LLWB 3MUGB 4ZPTB 3QIBC 1ED3A 1OTSC 1FG2A 2V5YA 4I48A 4KAQH 1RHHA 3VXMD 2ICCA 2R2HB 1HCFX 2PETA 1IEBB 4RGND 1CLOH 1IC4H 1IFHL 3ARBB 2VXUL 3GRWH 1NGQL 3SDCA 1E4KC 3HAEH 1J5OL 5EN2B 2VXQL 1WCBB 1AIFA 1JWUB 1ZHKB 4HKJA 2OTUB 5ENWB 4EOWH 4LGRB 5BQ7B 3DETD 5DHVA 2BFVL 4LFHD 4PRID 1ITBB 3U82B 3BDBA 3V5HB 3U9PH 2EH8L 4E5XA 4Q0XH 5IWLA 1EEQA 2NXZC 4ELMF 1U8NA 1OVZA 4FQIH 2IPTL 5A1AA 5I19L 3P0GB 3SN6N 5TE6L 2HJFA 4GRMB 1GC1L 4OLUH 5DQDL 1OARL 2ZCKL 5BRZB 1RU9L 5IBLD 3DMMA 5GSVB 3F65A 1RZGA 2J88H 4I2XA 1GH7A 3PJSB 3WIHL 5H37H 4DZBB 4EEEA 2LU4A 3KPOB 5LG1A 5GRYA 3PGDB 2ADIB 1QLRB 4XHQA 3RGVA 3W9DA 5HYQA 4OZFH 4BFIB 3LPFA 5HY9B 1UXSB 1EAPA 5IR1B 4P3CL 4J3OC 5DQ9B 3UBXI 1CK0L 3S4SG 1FFPB 5DMKA 5E8PA 2ESVB 2R39A 4P46C 3F7QA 5EC1B 4U3CA 2H26A 1N2RB 4JFOB 1A8JH 1T21B 2G5RA 1KCVL 3BSZH 4KXZH 3QH3B 1JGVL 4PJDB 1LDSA 4UTBL 1C08B 1KG0A 3VRLF 4XC1L 3S96A 1VSCA 4OI7A 3SO5A 1RQ5A 2P43B 2IAMC 3OAZK 3MUY1 3G6DH 3KPRD 1ZGLA 1EBPA 4JJ5B 5DK2B 1AXSA 5A43C 3TBSA 3QZWA 1KIQB 2FCBA 4X99A 3MOBL 2Z35B 2V2TA 5DHXB 4WV1C 4JRXA 3CFJB 4R0LB 4LLVB 1LVEA 4I0PB 4UDUB 5I71C 4G5ZH 4N5UA 3QIBA 1EHLL 4NZTL 4HKBB 4NQED 3MBEB 5HDQH 5KVEL 3WUWA 5EC2A 7CGTA 2ESVD 5EOTA 4DAGH 1NCBL 4N8VB 5CBEA 2E9WA 5TDPB 2R23A 3V5KB 1NGPH 2YBRB 3UPCA 1FVDB 4X4ME 5T3ZL 2GFBA 3ARPA 3WE6B 1RK1A 2QQLL 4P0DA 1YNLL 4QWWD 1G6RA 4WHTA 1XGRA 2YUWA 3BWAB 4EUPA 5IQ7H 3U0WH 4Y1AA 3RL2B 4RA0C 3IDGB 4ONHB 2ILLA 4XC3L 1DQTA 5L6YH 3IDNB 5B8CC 4E5XB 4W6XB 4QHMA 4P9HC 5ALBH 4ORGB 3G6JE 4X5WB 1LWRA 3QDAA 4KKNA 4JY4A 3G9AB 2NY3D 1DL7H 3GKWH 1F8TH 3TFKD 2VJXA 1PFCA 1BQHG 1FG9C 1J87A 4MA3A 5EZLB 4IJ3C 1W72H 3O8XC 3FQRA 2VLME 2ZG1A 3LV3B 5FB8A 2DIAA 3ZYOA 2BNQB 3JWDH 1JHLH 2R0ZL 2W60B 2XZCL 2GK0B 1G7MB 3LSOB 4C56B 2WQ8A 2RHEA 4JRWA 2F74A 4DQOH 3MOAH 5DVNA 1XCQA 2CO6B 5D7JA 1NBVH 4HD9A 3VJ6B 2WSKA 4OLWH 5DMYA 2R0WH 4JRYB 5IHUL 3RX8A 1U8MB 1CFTB 3OAUH 1YY9D 3IYLW 3OPZH 3QFJB 1T1ZB 2EXWD 3X14B 4NCC1 4YDIH 3EO0B 2O5ZH 1ZTXH 1C08A 1TPXC 1CQKA 4HMEA 2NY0C 1TQCC 4XNZC 4R90H 2JJTA 4U7SA 5IVXE 2GY5A 1J9CT 3C6SA 1UGNA 4FFZH 3IFNL 3ZYJA 1YEFL 1A2YB 3PWPE 2FB4L 1B6DA 5C0NC 4WCYL 1LO0L 4H1LG 4XNYL 1ZGLB 4PFEA 1VKXA 4KTEL 2XA3A 3AGVA 4OKVA 5DZOA 3GKWL 1MREL 5B8CB 1IARB 2AV1A 4X7SL 1P7HL 3DX8B 1CGWA 3I2CL 2DYPD 3BT2L 1AHWB 1Z6JT 2AJ3A 5IV2B 1VEMA 1N6VA 4KJWD 2H2PC 4KXZI 3FOLB 3KJ6L 3OR7A 5HGDA 4CN6A 4X6DA 1NBZB 4G8GD 3FFCA 3CFDB 4Y2DA 4D9LH 5CGTA 4Y4HB 1IGJA 4ELMB 5CMAB 3T3PE 3CC5A 4G8GB 3HAEA 1DN2A 2NLJA 2YBRA 4MLIA 3IDNA 3HC3H 1MEXL 5HJ3B 3CDFA 1FAIL 1U8JA 4PLKC 3RU8L 1F6AA 2EYRB 1B4JL 1IQDA 5L7XH 2HTKC 5KSAC 1YJDC 3WDIA 3V52L 2X9WA 4IOIA 4XCEA 3T0EE 4UIKL 1J0YA 1IC5H 5ICXB 2FX9L 4H25A 4WGVB 3BPOB 1R5IB 2BSRA 4PY8I 4G9FE 5J1SC 3MV01 3IVKB 4P5MB 4OF6A 4U6XA 1MHPH 5E08H 1FZKB 1V8HA 3SY0B 4LHQB 1HQRA 1JHKH 3WJLC 2PYEB 2W60A 2PTTA 4M6ML 4DCQB 2CD0A 1B0GB 9CGTA 4IS6B