4JO3L

Crystal structure of rabbit mab r20 fab in complex with v3 c-terminus of hiv-1 consensus b gp120
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
DIVMTQTPASVSAAVGGTVTINCQASETISNYLAWYQQKPGQPPKLLIYKASTLASGVSSRFKGSGSGTEYTLTISGVQCDDAATYYCQQGYSISDIDNSFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal anti-HIV-1 gp120 V3 antibody R20 light chain
publication title Rabbit Anti-HIV-1 Monoclonal Antibodies Raised by Immunization Can Mimic the Antigen-Binding Modes of Antibodies Derived from HIV-1-Infected Humans.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system/viral protein
total genus 53
structure length 214
sequence length 214
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo3L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo3L01
2EXYD 1U6AL 3IS1X 1Z5LA 1CXHA 2CK0H 2I9TB 1HDMB 3W0WE 4XCFL 1VDGA 4I4WA 1CE6A 3TVMA 1A1NB 4YBQD 2ADJB 4QRRB 1YYML 3FJTA 2QSVA 4NO5B 2Q8BL 3M1BA 4Q6IA 2AK4A 3DYOA 1JYVA 1M05B 5I16B 1RJYB 4AQ1B 2I25N 1EGJH 4OZ4B 3TJHD 2ITDA 5DVNA 5HI5D 2XG5A 2A74B 1RIVL 2JF1A 1RZKL 3KDMA 4OZFB 4KK8D 4GRLD 1J1OL 3E6HB 2DWEB 3MRNA 2NX5A 5FCSH 4FA8A 3S5LB 3RJQB 1DQLL 3FZUD 1MIMH 1NCNA 2HVJB 1LEIB 3HC0A 4F9LC 1CVRA 4RAUB 3WIHA 4UDUA 5EIVA 4KQ4H 1OTTC 3F7RA 2CIKB 1N0XH 5L2KB 2CKBB 4E42B 5IGXH 5T33H 4KGJA 2N4IA 5JIHA 3U4AA 1EXUB 2HJKB 3TESA 2GTWB 1C5CL 2R15A 3BGMB 2V2WB 3C5ZD 3BIKB 5IVXF 3L9RA 1B4JL 1EBPA 1VA9A 4WUUB 4CADB 3MUGA 3O4OC 1EAJA 5BS0E 1LNUB 2D31B 4HFWA 3KYMA 3U36B 1N2RA 5DMGC 3ES6A 2H2SC 2QADB 1MUJB 4JFOA 2XA8L 3D0VA 4U1KB 3QH3A 5BRZA 4D9QD 3HC3H 1LO0L 4KZDL 2LFGA 2XZQH 4L8SC 4MX7B 3VI4E 1PSKH 4G9FE 2EEDA 4KKLC 1O7SA 3C9NB 3PL6C 2YD2A 3LEVL 2FSEB 4YNYA 4UTAH 2Y72A 3QEQB 4G6FD 3DRQB 1GHFH 4P2RA 1MJJA 1B2WH 3RZCA 2YRLA 2P5WD 1BOGB 1PZ5B 4Z7WE 2N56A 43CAA 1Y0LA 3N06B 4IRJD 1BQHA 1QSVA 5AYUL 2EICA 1T22A 5CBEA 1ZHNB 3OB8A 1FORL 5IVNA 5KVGH 2WP3O 4QHUA 3ZDXE 1P7HL 4DZ8A 4U31A 2RGSA 4LF3A 3ZTNL 5FGCE 3E8UH 5C07A 1FFOA 3IVKB 4KROC 3QNYB 3LKOA 1JNHA 4IRSA 2V7HB 3RY6A 1NCDH 4AK1A 3DUUB 1RMFL 4M7KH 5DA4A 2XZCH 1FNGA 3GB7B 4RSVA 5JW4Q 4G7YH 5DK0B 4Z7OE 4E5XA 1L7IH 3F65A 2XN9A 2I5YH 2P24B 4LCUA 4BSWB 1G6RB 3PQYB 5KN5A 1MSPA 5JPNA 3ZE0F 5KSAB 2FJHB 1DBBH 5EN2A 3ZYIA 5T5FL 2R0LL 3LN4B 1LK2A 5CJOL 3TT1L 2XXMB 2BVPA 5HYJB 3MV8B 4K2UL 3ET9F 3ZKND 1ADQH 3ZDXF 1FYTD 3QQ3A 2XKUA 1XF2A 4UU9B 3X3GL 4NSKB 4PBVC 1TTUA 5D7KD 4ODVH 2EIEA 1NGWA 5I15L 2VDPH 3IFNL 3GMMB 1IEHA 3KNBB 3RVWC 4IS6A 1RZ7L 3C8KA 43C9B 5INCA 1S78D 1CK0H 3BMWA 4K3DL 3QHTC 2N7BA 3IJHA 3JV5A 1OHQA 1EAPB 4P23C 4PRIB 4FXKA 4N8VG 4QHLB 4QXWA 4Z7OF 3GIVA 1VKXA 4X7TB 4MB5A 3U0TA 2ED7A 2EIZA 1S9VA 4C83B 2JK5B 4OZIE 3KR3H 1T80A 4X4MA 3W0WA 4KJWD 4ODTL 4LFHG 2YS4A 3TCXA 4XCNA 3JUYA 2EYRB 4ZYKA 3F7YB 3Q0HA 5TFSL 3MCKA 2FB4L 2CK2A 3BEVB 3I85A 2MQCA 1QSEE 5ESAA 1KOAA 5HY9B 3H6JA 1VPOH 4EI5C 4GAFB 1UXSA 4M43H 5CIPB 2ZCHL 4J6RH 1S7RA 3RBGA 1F8TH 4NDMA 5DSCB 3UMTA 3IDIB 1Q0YL 4I13B 1TCRB 1FN4A 4Z18A 1OP3H 5FA4B 1K6QH 3ARFB 1U3HD 3VRJA 2Y5EA 3FT2B 2H9GA 2HTKD 3NA9L 4OD3L 2LU3A 5HHPB 1OAUH 2Y7QB 5FOJA 5I75C 3NIDE 5JW5B 5DD0H 5MHSD 5E5UB 5F7HA 4BH8A 3MJ8A 2IH3A 4YDLC 2B2XL 3FCTA 4L3EB 3DSFH 1REIA 2MKWA 1NEZG 5KG9A 3OKNB 3NZ8B 4LMQI 4HIHA 4NQED 3TFKD 1YY8B 1MWAB 2E9JA 3MC0A 3OAZH 2FX8L 1ROWA 5TE7L 4P46B 1CICA 5E2WL 2AJVH 3QEGH 1IZJA 1Y6NR 4OLVL 3T2NL 5FA3B 2WZPD 3TNMB 3VI3E 5D9SB 3I2CH 5CZKA 4OIAA 2A9ML 4NKIL 5BS0A 2OZ4A 1F6FB 1AR1C 1ZLSL 5E1HB 3KS0J 4PGBB 4WFFD 3K4AA 1HH9A 1VGEL 2FDBP 3HZKB 1B6UA 1S9XB 1VFAA 5DMKA 4YXKH 3PJSB 5D2LF 4N0UE 1DANT 1C12A 1F42A 4U7KA 2IADB 4QF1B 3NIDF 3RNQA 3OJVC 4M3JA 5D1ZD 3GSRA 1NEUA 4G9FA 1FH5L 2XNAB 4Y4HB 2WLYA 1ZGLA 3QRFM 3WFCL 3K81A 4N0FB 5HI3C 1UKSA 4MQXC 4PJ8B 3LN5A 4QRSB 4HC1A 4Z7WA 4PJBE 4OGYH 2EEBA 3VI3F 5HDQL 1T4KB 3EYUH 2V2TA 2X4PA 1UCBH 3RWCB 3FB8B 2Y36H 4FTVD 5KSVA 3RTQB 4KQ3L 3QDGB 4D9QE 2AJYH 4ALAL 3DHMA 2X1QA 3MRGB 1IM3A 3T2QA 5DD6B 5DLML 2DF3A 4PJFF 4OLWH 4J3XA 2WANA 1I3RA 4GMTH 3U2SB 5DGQA 3UAJC 1KENH 3QEUB 3QUXA 2P5WE 3BZ4A 1KCUH 1OGAD 1Q0XH 3EOBB 4GT7A 4N90D 1YEDA 3QQ9D 4NRZB 5DO2D 4RWYL 3MO1B 4PJBF 4HBQA 4ODXA 1IAII 2PO6C 2BK8A 2OM5A 1OM3H 3MRDA 4PLKC 2VL5A 3OJ2C 4XMKL 5BO1L 5FK9A 1NC4D 2FECL 4OF7A 2ZCKH 3AC0A 4EJ1C 2ORBH 4U3XA 2R56L 1TJHL 1UQSB 4MWFA 3NCCB 5F71A 3WFEH 2OQJA 4WEMB 3ZE2E 3QI9D 1W0WB 5E2JA 4P57B 3P77B 5E5RB 5AYQA 1OAKL 2FO4B 1RUMH 5IW1A 3DIFB 4LHUA 1KELL 2A73A 2DLFH 3BVNA 4DJMA 2XPGA 4JFDB 4IIQB 4OKVB 2ESVD 1HNFA 4WTXA 3GHBH 3UDWA 1SEQH 1OLLA 4OZIA 3TT3H 3Q2CA 3OKEB 4KRPB 4B53A 3D25B 4MDIA 2R2HB 4P4KB 1L0QA 3OXSA 4Z76A 3KYNB 4RNRB 1DVFC 4L8DB 3BT2L 5HYEA 2QR0B 1QSEA 1XGPB 2P8MB 2VWEE 4MNQE 1MVUA 3ZE2F 4DZBB 1U8HB 3QUMH 1YN7B 5DHXB 1VFUA 3CUPB 4HDIB 4O5LH 1OARH 3QPQD 4GXVL 3MRPB 1R6VA 4WUKL 5IIEA 2LE9A 2VZOA 4XNQB 3CLFL 3UJJH 4OF0A 3TCLB 4WIQA 3H3PL 4HUNB 1E6OH 4D0DB 5FKPB 4KKAD 4UQ3B 5CILH 5KW9L 4HUKB 1MAML 3VRLE 5EZIL 1SY6H 1KUMA 1X5IA 4UT9H 4H8WL 2HLAA 2OSLB 3T8XB 3O3AA 3TH4T 1P9MC 5J3HD 2WUCH 3S37H 1MLCB 5HVWA 4GS7C 1C1EL 5DURD 4K9EC 4N9OB 2DQEH 4UILL 3FTGB 4G6KH 4ZNEE 2EIDA 3SDCD 3UTTE 4GRLA 3T77A 5FO9B 2FBJL 4HZLA 5I1JL 2DQIL 2YZ1A 4FFYL 1LO4L 3T4AA 1CFTB 3P3YA 3UPRB 4Y7MA 2UYLB 4Y2OA 4Y88A 2VDQH 1FL5B 1QLRB 1NSNL 3R06A 3AREC 5MHSE 5CEXB 4YK4C 1EJOH 4NHUA 1BF8A 2X5PA 2HP4A 3AY4C 3QFJB 3LSOB 4ZPVB 3WXVL 3ULUH 1ETZB 1AQKL 1NFDE 3EJYD 4NQEE 3MGOB 2VXSH 5IWLC 3ZDZF 5EU5A 1Z6JT 2YK1L 1I9JL 2XWBB 4G8GB 5DRWB 1IBGH 3C5ZA 1NAMB 2Y9RT 1AKJD 4JFZH 5EZJB 1KCSL 1DUZA 1XF5A 3QJFB 3QWRD 1OAXH 2L4OA 4NJAL 3KJ6H 3E1F1 5ADPH 4HQQL 4PJBA 5JDJA 4WFFE 4HZAA 2HFGH 3M8OL 1KC5L 5D1XC 2H2PD 3HC4L 1GCFA 1V7MH 3OXRA 4UIKL 1CLCA 2OTUB 3ME0A 4G6JH 2A1WH 1CLZL 3IT8D 3CXHJ 3QT2A 2DQGH 4Y4FB 3RZWA 5IW6B 1JWMA 1FNSH 4YDIH 1K4DA 3GMNA 2OS7A 1WZLA 3DVGB 4Q2ZA 2Q86B 1ZVYA 4HIIB 1YPZE 4NN5B 4OFIA 5IROC 3PNWB 3VH8B 3S4SB 2DIBA 4F7CA 2ZSVB 1NFDF 1UT9A 2NTFA 3FQNB 2YA1A 4NZUH 4YZFF 1H3VA 2XWJA 3GK8H 2HJFB 5ECJE 1CFBA 4KY1L 3HG1D 2P5WA 2X89D 1EGJA 2IBGA 5FM5O 3ULVL 1VGKB 4ZFFB 4XVUD 1SJEB 2IPTL 3GSNL 5EBLB 1TQBB 4FTVE 3HE7C 1IVLA 5DR5H 5BV7C 1NMAL 1EPFA 3CK0H 3OV6A 2EDRA 5GGTL 4TTDD 2DRUA 4NKMB 4ODUB 4XXCC 3MRBB 2YUXA 1FDLL 3TPUB 1JGLL 1I7ZA 2B4CL 3EBAA 3Q3GA 5F6HI 3NTCL 4D8PB 3PDGA 1YPZF 4H0GA 4UTBH 3ULUD 3CFIC 1I75A 2P47B 4YDVA 5DGRA 1FVEB 3SDDB 3W39B 1Y18A 1TDQA 1KN2H 4JREC 5F7MC 4OUOA 4IDJL 2NY4B 1CQKA 3TBSB 5AG9A 1A6VL 4CDGC 3G9AB 4OSUL 5B8CC 5CJXC 1I1FB 4KKCD 2PR4L 3D9AH 4HS3A 1BX2B 2ZNXA 4QHMA 5GZOD 1BFOA 4ZS6D 4NT6B 1N26A 3G5ZB 2H41A 3MJ9H 5FYLH 4XGZA 5I1IL 3FO9A 1PEWA 3OR7B 4NP4H 5FCUL 3V4UL 2BSRA 3CPLA 4BZ1L 5C0JB 1NH6A 2FIKB 5J1SC 5FYJH 4MB3A 3PWNA 4OFYD 1HSBB 2RFXB 4UINL 4V1DD 3I50H 1N59A 1ACZA 4X9GA 5I18H 3UEZA 1QHPA 1A6AA 4MNQA 4PJIE 4RDQF 1A9BA 1OP5K 3RX8A 2E7LA 5DJCB 2DLTA 2X4RB 3BHBB 2VR9A 5DFVC 3WE6B 3NIGE 1ZMYA 5D2NB 2DQFA 1KEGL 2Y6SC 2WBWB 3RL2B 2O61B 1JPTH 4RDQG 2H26B 4UOW1 5D1QD 2J1KA 2C7UA 4ZSOE 2VLJB 5KTEL 4XP5L 2OJEA 4R4FL 5JUEL 1IGCL 3RKPA 5FKAA 3L3GB 4PY8I 3S3PA 2COQA 1MLBB 5EOQL 3QULA 3VFGH 5HHVL 5GS0H 3V4PH 3F12B 5EUOE 3HUJB 1ZT7B 3GRWL 4NHCH 2MCG1 5KVDH 2Z35B 1ZS8A 2BCKB 3O4LD 3ARXA 3KYAA 4ZNEA 1U8PB 4KZEL 4WW2C 3UTTA 5DD1L 3GMOA 4WI9A 1Q9LA 2AEPL 4GW4A 5D72H 4YFEA 3BAEH 4Z7VB 3F7VB 4OZGE 3VMPA 3RIAK 1U3HA 2CDFA 1EMTH 2GSGA 3T65B 3FQUB 1VEPA 1Q9OA 4HV8A 3O81A 2M1KA 1B3JA 4X6FA 2NY1D 3WUZA 1NFDA 4H88L 2H3NA 4NQEA 3MLYH 5FYLD 1K5NB 2Q6WA 1ADQA 3IETB 4APQD 2ILLA 4PJ9C 4X4ZA 2AEWA 3T0EB 3K7UA 4FFVD 5MEOA 4OB5H 2XQBH 4YGVA 5IT2H 3F7QA 2W9EL 3CZFA 4LSSH 5JXAH 4BK5A 2IAMC 5D93C 3MLVH 2GKIA 5AZ2H 4MJ6B 2Z4QB 1R24B 2XTJC 5DJ8A 2X4UA 5E99L 3U0WL 1Q1JH 5C86A 1JF6A 3B9KB 5HJ3A 4F3FA 5H2BA 3X12B 5DEZA 5DRXA 3H9SB 1JV5B 1QYGL 2B1HH 1AE6H 1V3KA 1WZMA 1ZK9A 5CJQH 2ICCA 1MFCL 3P73B 3MRLA 5D1ZA 1YPZA 3MA7B 4Y2DD 4UOJA 5J13B 1J18A 3E0GA 3SDAD 3MJ7B 2NNAB 4OZFH 1ONQA 3GM8A 1YUHA 4KK5C 5F7UA 1MCPH 2XG4A 5GSRB 1IRAY 3OF6A 5IBTL 3P11L 1DEDA 1QSFB 5IG7B 3ARVA 4XPAH 5GGQL 1S7WB 4BKLA 1H5BB 4FTVA 4YFLI 1P84K 2AQ3A 3DPBA 4CMMB 4QTIL 4TPRL 2Z8WC 4UQ2A 3P4MB 5T1MB 1TLKA 1IC5H 2CKBH 1JNNH 3FN0L 1U8LA 4ZFGH 4LSRL 1IKFL 2AJSL 2X42A 1HCVA 3L6FB 4Y5YB 3OHXA 1AD0B 2V5TA 2VMFA 4ZXBB 1YA5A 3KPNA 4KAQL 1OTSD 2NXZC 4NC1E 5EA0L 2V6HA 3ZZ1A 3HG1E 3EO9L 4XTRD 3EOAB 2E7MA 1H3GA 4R3SA 1N3NB 3LKPB 4NNXB 4BFGA 4RAVB 5E6IB 1LDPL 3UZEA 5A2LH 4I3GA 1MCIA 4CVXA 4JPIA 1NCAH 1HXYA 4OCMC 2QQNL 1NC4A 3DROB 3P9MA 3NCBB 1ZWIA 3SGDH 3V0WL 1BGXH 1FP5A 2YD4A 1X5LA 3BWAA 5I1KL 3RWHB 4P5KA 4ZFOB 3SQOL 5ITBL 3ULUE 4JFHE 1C16B 4RFNC 1JWSB 1KIRB 3QI9A 5ERWA 2MFNA 3ALPA 1WEJL 4LARH 3VDBA 3UYPA 2HT4D 1I8LC 4PJIA 1JN6B 2WBJB 5E8NA 1MJ8L 5EO9B 2YN3A 3JWOH 3KS0H 4NO3A 2DBLL 1P6AB 3RZCC 4NZTH 4QYOB 5IFHH 4EKXA 4O4YL 3VFPA 4PJEB 2D03H 4HKZA 5A2FA 3KVQA 3TN0B 2VLKB 3FQWA 1YEIH 3QUZA 1FNHA 1AGEB 4ZSOA 2X1XR 3QCVH 1A1MA 4NQCB 2OMBA 4OGAD 3EO1A 3PXJA 3QDAA 3GUTB 2IGFH 2ZG2A 3WLBA 2CRZA 2D0HA 2OL3L 4IRZH 3FFCD 3O8XB 2DBJA 4V1DE 1L9MA 3MRKA 4HUXB 5EUOA 2BNRB 1T66C 4F57L 1RK0B 4PJAE 5EU4B 3ULUF 4IRSC 3SGKA 1MHPL 5IEKA 2WINB 4UT7L 3RY6C 5EUKA 4YHOH 1G6RH 4EN3D 3MMEA 4WUUD 3CDGB 3GSOB 1GGBH 4JRYB 2WWKT 1QLEH 4OZGA 3WS6A 1T7ZA 2BP3A 3V4VH 1NJ9A 1TPXC 2BNUA 3C6LB 3ULSB 2ZG3A 2QADD 3L1OL 1EVTC 1QFWH 3P0YH 2AJUH 3QWOA 3UC0H 4KKBD 1JUFA 3AVEA 3WN5A 4L8SB 5KANI 2R8SH 5IQ7H 1HINH 5DRZB 2W59A 1H3XA 5DUML 3PL6B 2R0KH 4M6OL 3O4LE 4LPYA 1MCLA 5F93C 4PJAF 1DBAL 4JFXB 1WTGT 1RZIB 5K9QG 1JWUB 2YD7A 4H5SB 3BQUA 2PKDA 2O5ZL 2VYRE 3BEWB 1C5DB 3TV3H 3W9EA 3RGVC 1G7MB 5IBUG 2CLVA 3K2MC 2WNGA 4XAWL 4ZNCD 5L88L 4JY6B 2R9HC 4MS8C 3U9PL 4OJFL 5FYLE 3Q6FA 5FYJU 4L5FH 5CIPH 3CX5J 1EHLL 3JTSA 5FYJE 3U7WH 1AKJA 1CFNA 5A16A 4ONGH 3R4DA 1Q9KB 5HI4C 1JNLH 3QWRA 3O0RL 1J8HB 1RIUH 5D7LD 1G9NC 4DTGH 1ZHKA 1MCDA 4D0CB 4WFGD 3PQYD 3QUMA 1ORSA 4WY7H 3TBWB 1C7SA 2CSPA 5F3HA 3VCLB 3QIBD 4M03A 4LSQH 2DDQL 2MQ0A 5KSAD 4AG4L 3D5OF 4P9MH 5T3ZH 2R0WL 5KVFH 4UDTA 2ED9A 5D7JB 3C6SA 1MWAH 4LVEA 3CVIL 1S7XA 5E9DD 1BD2B 4KPHL 3DO3A 4QOKE 4KK9C 5SX5H 3H7BB 3TBVB 3GMRB 3UJTL 1XGRB 1SY6A 2PYFB 3U9UA 2G5BA 3DBXA 3WHXB 5B3NA 2VIRB 3HG1A 3MNVB 1IEBB 2X89A 4ZOAA 4ELKA 1YY9C 1CICC 3NACH 1YEEL 4Y19E 3D87B 4ODWA 1QFUL 1BREA 2VITA 1N5YL 3F6LA 5KJRL 2R1WA 2CXKA 3KHQA 4YIQA 1RZFH 1T5WA 1T89C 1FBIH 4IHOA 2OP4H 2L7UA 3SKNB 1XCTA 2J88L 4JFQA 2OJZH 4X6BA 4LGSB 4JHBA 5T3XD 3MOAH 3H9HA 5BQ7A 1MFDL 5HBBA 5JLZA 3MRIB 1YMHA 3TIDB 3LQZB 1UM5L 2X9WA 3RDTA 5J0BA 1IFHH 2YMXL 1ZSDA 4LIQH 3BH9A 5BJTB 4TYUA 5ICXA 2YKLL 4KC3B 2F54D 1S7TA 1W0VB 3QJHA 3EUUA 3NGBB 1EEYA 3ARQA 3QNXA 5IB4A 2XWTB 5IMKB 1HQ4A 1I1AA 2L7JA 4LCYA 1X7QB 2VKWA 3BKJH 4F80A 5TH2B 1VCAA 2ATKB 5GSVA 3IAQA 3L3DB 3VFRB 2MPAL 4HH8A 4UT6H 1CFSB 1MCKA 2EDXA 4BZYA 3TJEH 1R3HA 1G7QA 1J9CT 3STBA 3HCVB 3RX7A 3WD5L 4QRRE 5HHXH 1WBZB 1A6PA 4QO1A 4JG1L 5T3ZD 5IHBA 5E08H 5A2JH 2HFEA 4OFYA 3HI6L 3DWTA 2OBGA 2WQ8A 6CGTA 4V1DA 3IFOB 2B5IC 5IJKA 5ICYA 4PJAA 1SM3H 5I6XC 5E24E 2BY2A 3FRUA 1PG7H 1D3CA 4ORGB 1QTYT 3OB0H 5SWZB 2FGWL 3QHFH 5CEZL 5F9WC 3EYFA 2EH8H 3HNVL 3CH1A 1TZIB 2CGRH 1IM9B 3O3BA 4X7FC 4Z7UB 1T2QL 3IFLL 1DQMH 5D1QA 1A6UL 3L3HB 3QIWC 1CXFA 4LLVB 1I9IH 2W65B 5L2KE 5SWSB 5GGVY 1FJ1B 3ARDD 3HHRB 4LCIH 1GGIL 3ISWA 4XRCB 4JQVC 1KIQA 4O9HL 5AZEH 1CGYA 4JN2B 4HK3N 1IL1A 4BA8A 1E6JL 5B21A 3O4LA 3LD8B 3PDDA 4WUUE 5GHWH 4I0KA 1Y6KR 1AIFA 4YHML 1A0QL 1FGVL 5KOMC 3VXMD 4PP1C 2VC2H 3LB6D 4H1LG 1RHFA 2QJDA 4P5MA 3KPMA 3WDJA 1B4RA 4OQTH 3IFPB 1J0JA 1SMAA 1ZVHA 3SKJL 4WWKC 4RZCB 3UDWC 4JFEB 3H8NA 3MJ9A 4JVWA 5IM7B 5DUPH 2GEEA 5IFAH 1V05A 5IB1B 1NBYB 4U1JB 1NC2D 3D39B 3VFNA 3HI1A 1OY3B 2FJGB 4HJGB 3CSYA 1RJZB 1INEL 3QEQE 3L3KA 1DJSA 4LKXA 4OCRL 5DT1L 1T2XA 4N9GA 1Q9WA 5CFHA 2O26U 1SEBB 1OVZA 2AW2A 1JRHH 3CSPA 1S7VB 2YPKB 2LABA 3LQAH 3MA9H 5FO8A 3EZ8A 2E9WA 1II4E 3SCMB 3KAAA 2HFFB 1VHPA 4I3RH 1S9WB 3FT4B 4HIXH 1P1ZA 2G2RA 2VTFA 4YHKH 4U6YA 2FR4A 2FLBT 4FP8H 5HYSG 3ZMRA 4QOKA 2CR3A 2CIIA 1ORQB 5DI8B 4NO2B 1K8DB 2GK2A 3G08B 4LP4A 5LXGH 3I3EA 1CDGA 3FAWA 3FRPG 3S96B 3K4ZA 1KTDB 4TUKL 4Z95L 4NQVA 4WU5A 2B1AH 2ICWI 4WFHD 2QQQA 2Z9TA 2M2DA 4XMPH 3MRJB 4HS6B 3VFSB 3CJJA 4X5WA 2NR6C 4ISVB 4IMKC 4Y19A 4WFGE 2N7AA 5CMAB 3PQYE 4WHTA 5FECA 5J11B 4NC0B 4O58L 2ZOLA 4GKNB 4JG0H 3QUYB 1D6VH 1LO2L 5HYJE 3MFGB 4OV5B 3CVHL 1I7TA 1S5IH 4M48H 1RD6A 3BZFB 5FGRA 5EIIA 3GFUA 4KRPD 3BE1L 4S1QL 4TNVK 2HJLA 3BD5A 3S8WA 3OG6B 2DM2A 1HZHL 4B7IA 4BQBA 5IQ9A 4UAOB 4PRDB 4K8RD 3WHE1 1DVFB 1JMZA 2IBZY 4MLIA 1NDMA 4AEHL 4HHAA 3C5ZC 4KXZI 1XZ0B 1F90H 5EULV 3C08L 1JHKH 4XXDA 5IKCA 3DV6B 4YHYC 5L2JB 4GAJL 3O6FD 2I9TA 1HDMA 4PYGA 1MH5B 2DQCH 3GBNH 1IT9H 4QRRA 4FQJL 4I18B 4NO5A 4XPHH 4PRBB 5IMLB 1KFAL 2APWA 2XACC 5DD5H 5I16A 1RJYA 5D5MF 5C08B 3LEYH 4OZ4A 3VGDA 1XAUA 4U6HB 5DQDH 2R39A 1A7OL 2FX9H 2JJSA 2A74A 4XNMA 3CU7A 4OZFA 1F11B 3V95A 3E6HA 2DWEA 1AGDA 2F54E 3TH3T 3I3DA 1RVFH 2ERJC 4XVSH 4C56D 5I76B 2IQAB 2HVJA 3ROOB 4AYFA 1LEIA 1MFNA 3EHBC 2VDNL 4JO2H 1E4XH 4RAUA 1RHHB 1G7IB 5GS3A 3H0TB 2CIKA 5DQJB 5T3ZE 2RIKA 3ARPA 2CKBA 4KUZH 1BM3L 4YO0B 4OM0H 1EXUA 2HJKA 2GTWA 3MXVL 1JGVL 1AGCB 4B0MM 1P4LB 2ED8A 3BGMA 3CDFA 1GZPB 2XXCB 4EN3A 4WUUA 2X41A 5J9PA 1GIGL 4K7FB 1LNUA 1RU9L 2D31A 3V6ZB 2HLFC 1JMXA 3U36A 4JPWL 4O00A 3WXWH 2FECI 3DXAB 1MUJA 3FRPA 4JZOB 1I8MB 4U1KA 1A02N 4R2GB 4RGMC 3NFSL 4WEBL 3PGCB 2MOVA 1YEGH 4IJ3B 2ZZUT 1RAMA 4JPVH 4FNLL 1P6FA 2XQYK 4TUOB 4S0SD 3C9NA 4DN4L 3I84A 2CK0L 4PRNA 3DRQA 4JB9H 1OP3K 3FONB 1G7HA 1IAMA 3RHWF 5F9OL 2Y07L 1BOGA 1NCCL 4N68A 1I8IA 4XWGL 5EFIB 4YBLB 4O2CA 2VWEC 1AR2A 4JFFB 3SJVB 2Q87A 4LIQE 1DLHB 4JZJB 2E7LC 3VXUB 2DS4A 3ARGB 4NJ9H 1G9EA 1ZHNA 2F5AH 5BMFL 4M6MH 4M02A 1XFPA 3QDGE 4GMSH 1HHIA 1BVKA 3O9WD 3MLUL 2EH7H 2GT9B 1CFQB 2NY0C 3OAZK 4LGRB 5IB2B 1OPGH 3IVKA 3AS2A 3KPRB 4DUXA 1JPGB 2V7HA 4JEGB 1B9ZA 1RZJL 4F7EB 4HT1H 3DUUA 4K55A 4O02L 4QLRA 2YPLD 4XC3L 4HMDA 4QCIB 4CMHB 3GB7A 5JO5A 4JO3H 3EJZC 4U1LB 5DK0A 4NUGH 2B7DT 3WIIL 5FXCH 1G6RA 3PQYA 5I73B 4LBEB 5KSAA 4O2FA 5ALCL 1MEXH 4O2EA 2VXTH 1WBYB 5DJDA 1FYHB 3LN4A 1U3HC 4JHWL 4LPVA 4P59H 4KJYB 5HYJA 1JPFB 1CD1A 4PGCB 3TIEB 1WCBA 3LRGA 4L8CB 4NSKA 1B0WA 1D5ZB 4PUBH 4QWWC 3GMMA 2X4NB 4WFHE 1MFAH 4UB0L 3MNZB 4MA7H 3DVFA 4OLYL 2FO1A 1EAPA 5F1KC 4I1NB 5HGAB 2IG2H 3L7FA 4QHLA 4M5ZH 1UM6H 4X7TA 4KK6D 1ZA3B 4JPKH 1GHFL 3EGSB 4DCQA 4C83A 2YUZA 2D7OA 3ETBF 2FH8A 2VDRL 1BAFL 1JJUA 4DAGL 3WLWD 2EYRA 1BBDL 4QNPE 3F7YA 4P2OC 4MCZB 1ZANH 2UZIH 1NGYB 3WDIA 5D1ZC 1ERNA 2DTMH 5HY9A 2LTQB 4HUVB 2EE9A 3ZTJG 5C8JB 5CIPA 4H8WC 1WAAE 2GTZB 5DSCA 3IDIA 2F54A 4RBPH 4XCEB 1TCRA 4WW2B 5FAAA 4OD2B 3PDOB 3FT2A 5LAXA 5HHPA 4M7KL 1RSFA 2ATPB 1OT1A 2Y7QA 1H3TA 5JW5A 3I9GH 1L7IL 2ZOKB 4QHKI 1N0LA 1QPPA 2GI7A 4LSTH 1G84A 3OKNA 1PX3A 2NY6D 3NZ8A 3SGEH 3Q1SL 4KDTA 3INUL 1MWAA 5I9QC 5HPMB 2VN4A 4QNPF 5TJWK 4P46A 1T21B 2NYYD 4K7PY 4CL7A 4GAGH 2HMID 4RX4D 4YC2C 3RVXD 3VXSB 2R4SH 4KH2A 5FOBB 1ADQL 4X7SH 2PCPB 5FA3A 4B41A 1YQVL 4ODHL 5D9SA 3WUWB 2WIIA 5DMIL 2F58L 3BP4B 3HFMH 1WAAF 1TMCB 1NUFA 4N8CH 4PGBA 2VDPL 1SHMA 3HZKA 3MV9D 1S9XA 5DO2C 4ZPTB 3PJSA 4JM2D 3D2UB 3VRIB 1CK0L 1U9KA 3QFJE 3ZDYE 1MVFA 2IADA 1BJ8A 1UACH 1JF1A 1EFXB 4DVRL 1T0MB 4YXHH 2XNAA 3R0NA 2YHGA 5IVZB 4Y4HA 4Y16B 1EIBA 2ZCLL 4JKMA 4HWBL 5E2VH 2IANB 5DVKA 5K33A 2AJZB 4JFPA 3DECA 3JWDH 1UVQB 4PJ8A 4QRSA 1GC1C 3TA3B 1NKOA 1FO0L 4G6ML 1RULH 1T4KA 4U0RB 4UV7L 2CUMA 3RWCA 3FHQA 3FB8A 2WV3A 2DI9A 3BGAA 3TZVD 3RTQA 2IJ0C 3QDGA 3NCEB 4DW2H 3MRGA 2HTLC 4PJ5D 3B5GA 4NIKB 1WISA 1JHLH 5DD6A 3QUZC 4X9FA 3UTSB 3WFDH 3ZDYF 2DLIA 4ZTPH 3NH7H 3QXTA 3U2SA 4PJHB 5I66B 4L1HA 3VXTB 4JRXD 4YHZL 5IESH 1NCWH 3HR5B 4HH9A 3QEUA 1IGTB 5TDOB 3EOBA 4NUJB 2Y25A 5JA8B 1VADB 4FQLL 3SGKC 3KYKH 2PTTB 4HCRL 3W9DA 5MEND 2KDGA 3MO1A 5F6HJ 1MCWW 5E6ID 4ZFZB 2ZUQB 2VXQH 3VD7A 3ARWA 3QPQC 4CU7A 4PJCB 1N7MH 4WTWA 3WS6C 1KB9K 1EK3A 3RFZC 1QBBA 3UO1L 3T0WA 1T6VN 5J12C 2IBBA 1YEHH 1EZVX 1FSKC 1UQSA 4KKAC 1AXSA 1KPRB 2HKFL 3BP7B 1T1XB 1F00I 2YPLE 1W0WA 3T0BA 1LGVA 5AAMA 5GXBB 2OR8A 2FO4A 4BK4A 4LLUB 2WBJD 3DIFA 3Q5YA 3GIZH 3WV0A 5MEQB 3MNWB 1P2CA 3LAFA 4IIQA 1FVCB 3FN9A 1YEFH 1JGDB 1EBAA 3BQUC 1Z9OA 4LVOB 4X7EC 4YX2L 1UADC 3ARBC 2B0SH 3OKEA 4TSBL 4OQTA 1WZ1L 2X9XA 4R90L 2R1XA 4PB9L 4UZGA 3D25A 2DQDH 2OLDA 2R2HA 1OTTD 4P4KA 4PD4K 2VOTA 3KYNA 4RNRA 4L8DA 3MZGB 2BNRD 2AJYL 4MD0A 2P8MA 1XGPA 2HT2D 3PHQB 2ZNWA 1H3PH 3BGFB 1WAAA 3G9VA 1U8HA 1YN7A 3CUPA 3HN3A 4JRYD 5DQ9B 4HDIA 5D2NE 2VXUL 4GMTL 3X11A 2V17H 2XZZA 2VLRB 5GRZA 3O6FA 5JPMA 3GGWA 5C0RH 2NQCA 5F21B 2H2PC 2DOCA 2VLJE 1Q0XL 2HWZH 4YR6A 1T1YB 4D0DA 3O6LH 5DMGD 2NY3C 5FKPA 1LMKA 4UQ3A 2H2SD 4HF5H 3ZLQC 2VSDA 1MPAH 2OSLA 1CLYL 1HHKB 5EOCL 1WGOA 1D7FA 5FUOH 1MLCA 3SY0A 3HUJE 2P44B 1GZQB 4KKLD 1QD0A 2JE8A 3MRFA 3PL6D 5B3JF 1HSAB 3FTGA 4PBXA 1ACYL 4LRNL 4NC1C 3JXAA 4CUCA 1D6EA 3O6MH 4QEGA 3NFNB 5C0AD 1GGTA 3D3VD 3LH2L 2AXGB 4OFDA 4ZDHB 4Z7VE 2FL5A 3WFEL 1CFTA 1JGUL 2AQ2A 3KPQA 3VFMB 3QIUC 1FL5A 3VG9C 1SQ2N 2EDNA 1X5GA 2XY2A 5CEXA 3RAJL 5FUZH 4EIGB 4MJID 1WTLA 3QFJA 4ZPVA 3JSSA 4XPGH 1ETZA 1J1XH 3RGVB 3MGOA 4NBYB 4W6YB 1MFEL 2XWBA 1UB5B 3GHBL 5I1HH 5DRWA 3T0EE 4NZRL 3L5XH 2A9NH 4U49A 5EZJA 5KBNC 3HUJF 1PBYA 4H25B 3WJLA 1NMBL 3RDTC 4Y0GA 5CZVL 2GUOA 1EO8H 3O2DH 4M93B 4N1HB 5F3BB 5ELIA 2OTUA 4Z7VF 1CE1H 1UEMA 5L8JB 1E4KA 1I1AC 2FJFB 4Y4FA 5IW6A 4X9HA 3QUML 2QHRL 4KKCC 5H35B 4DQOH 5KSBB 5GZOC 3DVGA 4PIRF 2Q86A 1BD2D 2Q8AH 5JR1L 4BFBD 3IGAA 3PNWA 4PS4L 4WCYL 3CCHB 2ZSVA 2AK1H 3UJJL 1W72H 1BZ7B 2EDOA 3HRZA 3ZT7A 4KRLB 6FABH 4KI5F 1FPTL 3SE8L 3TWCH 2HJFA 4XNYH 5C09D 4PJGB 4K71B 2EO1A 3A6BL 5J56B 1EH9A 2VZ1A 5IJKC 5FEBA 1B88A 1DSFH 1VGKA 4YQXL 4HWZB 3RVWD 1QSFE 1SJEA 1WZKA 1HQRB 1EHNA 2WUCL 1X5JA 4XH2B 5EBLA 4K3EH 1PAMA 4YWGL 4GAYB 2DQEL 2NZ9C 3JBG7 4M6NH 1CGSH 3O9WA 1WF5A 9CGTA 4JM2F 4ODUA 4OTXL 5T1DH 4EI6B 3MRBA 3TPUA 3C60C 3Q48A 1J10A 2R2CA 2NY7L 4LASH 4YE4L 4HWNA 3VFVA 4ZO6A 3WIFB 1RIHH 1EFQA 4E9LA 2IQ9H 4D8PA 5TDNB 1QOKA 1WIUA 3KLSA 2IPKB 5DJXB 2AEQH 1LE9B 4RGOH 2YPLA 4XX1E 2VISB 5F1IB 1AO7D 3ULUL 1FVEA 4PBWD 3LHPH 1FCGA 3W39A 3EOYG 1RI8A 3LPGA 3N0PB 4C4KT 5CWSB 1BHGA 3MOQA 1IBGL 4JANB 3L3IB 3LPFA 1BX2A 4U0QB 5J1TC 4NT6A 1TVDA 3G5ZA 5ABDE 1MFBL 4R9HA 3SDYH 3PIQA 2HFGL 5C0JA 2FIKA 1LILA 1AI1H 1V7ML 1GVIA 2R0ZH 4ZAKB 3TNNB 5D7SH 1HSBA 1LP9F 5GGSB 1FGNL 2RFXA 1QEWB 1KJ3H 3QZWB 4OBRA 4Z7QE 1P4BH 4L3AA 5K9OB 1R0AH 4GBXB 4NM8H 2B5IB 1UYWL 2HG5A 5FO7B 4FFVC 2X4RA 5E7BA 3BHBA 3WE6A 2GYSA 5D2NA 3NABH 3G5XB 2DWDB 1T03H 4IM8A 1KBGH 3RL2A 5FFLA 2O61A 5JIKA 4NKDA 3WNOA 2H26A 3VA6A 1AR1D 5KVEH 4JY4B 3RY5A 5FDYA 2VLJA 2XV6B 3MLRL 4NQCE 2WSKA 3L3GA 5E00B 5T1KB 4EDWH 4LEXH 5FIEA 4RMQA 3D18B 4RWHA 4FQ2H 5CZXC 4I8DA 5DR5L 4LU5L 1JZ8A 3HE6C 4WV1B 3F12A 2BNRE 4ZUSA 3H7LA 4YDJB 3VD9A 3HUJA 1ZT7A 3MSPA 4XVTL 1BMGA 4I0PB 4P99A 2Z35A 3KPTA 4FZ8L 2JKXA 2BCKA 3OL2A 3VGEA 2VDOL 2WUBH 1GSMA 4JRYE 5GS0C 5TF1H 4Z6AT 2ICES 1KXQE 5HI3D 2X70B 3F7VA 4YXLL 4Z7VA 4OZHB 3WSQH 2Z31C 4YHPB 3T65A 3FQUA 1NBQA 4KJQC 2AAVA 1C5BL 1ZLWK 4JN1L 3SE9L 3GSWB 5C7XL 4YEEA 3KPSB 4LHJB 4IDLA 3NMEA 2J2ZA 5J1AB 2BVOB 4JY5L 1K5NA 3VXNB 4RFOH 2BRRH 3IETA 2VQ1B 1DBKH 1NPUA 3MJ9L 3T0EA 4K94L 4XBGB 4RX4A 3FQRB 2KL6A 2ICEB 4NQSB 1CXLA 1KXVC 3KPOB 2ZJSL 1HOCA 2F53B 1CGTA 3UAJD 5C0AE 4ZOCA 1R24A 1ZLUH 3RA7H 3QXAB 3K2UL 4PV9B 5INDA 1N4XH 3LMJL 5AWNH 3MTRA 3B9KA 5CEYB 4X0KB 4Z0BL 2FLRT 5I18L 3X12A 4LQFH 3SCMD 1JV5A 4OAWB 3RWDB 3LIZL 2PO6D 5DD3H 3CSGA 4JM4L 3MACL 4PLKD 1UM4L 3P73A 5HSFA 1NAKH 1MI5B 3OSKA 4P4RB 4X8XA 4WGWB 2EDTA 3B2VH 5C0CB 3MJ7A 5JMOC 2NNAA 5IEHA 4PYHA 4G8EB 4HKXB 1MREH 1J8HE 5GSRA 2DM3A 3RQ3A 3VFGL 1QSFA 1VESA 3V4PL 5IG7A 2JJSC 3HNSL 3V7MA 1S7WA 2V9TA 4WO4B 3TO2A 3OR6B 1H5BA 2DI7A 4BQ6A 4CMMA 5GRXG 1DQDL 3P4MA 5T1MA 3D0LB 3N9GL 3SE4A 3ZYJA 1AP2B 4HXBL 3ZT6A 5KZCD 1BD2E 2QSCH 3L6FA 4XPTL 4Y5YA 1UEYA 4XP6H 1C8PA 1EMTL 1AD0A 5CINL 1MCHA 5EU3B 1T20B 3OBAA 1FFNB 1KN4L 1OF2B 1RY7B 2YWZA 5HDLA 3V7AE 1DQQA 2DYPB 2QQLL 1A22B 3RI5F 1RURL 3OKOB 1BVLB 1DVFD 4OF5A 2CJUH 1H0DA 2CO7B 1N3NA 1QRNB 3LKPA 5MENA 5E6IA 1HKFA 3PHOB 5FF6A 1F3DH 4G3YH 3DROA 2IFGA 4HK3J 5GISH 4FXLA 2ICWB 4ZUTA 4EXPX 3C2AH 2QADC 1M7IB 4I48B 3RWHA 4ZFOA 1TVHA 2OYPA 1XGYL 1C16A 1A7NH 4L9LB 2B1HL 1AE6L 1VACB 1K9TA 4O51B 5CJQL 4X6CE 1RUAL 2QHLA 1BZQK 2WBJA 5EO9A 3HI5H 5CD3B 1FL3B 4FQIH 4RRPG 4QYOA 1D5MB 5LGKA 2EDKA 2C1OB 5GGRY 4HPOL 1G9MC 5SX5K 3KLAB 4AM0B 2BOCB 4X8JA 3ESVF 3WL9B 3GI8H 3E3QC 4NQCA 4QKXB 5LKNA 4W81A 3TBTB 5E8DH 2D7TH 3ARED 4GUPB 4XPAL 4C55A 3O8XA 2GK0B 1F6LL 3K1DA 1XGQB 2FYYB 4HUXA 5ENWB 2BNRA 1AQDB 1YEJH 4TSAH 1CXIA 2K3TA 4Z0XB 1RK0A 5EU4A 4M5YL 1JNNL 4HK0B 2WINA 5LGHL 1TETH 1WK0A 3MBXH 1XIWB 1DFBL 2A6JB 3S88L 1FZJA 5SWZE 1E27B 4FQCL 4X6CF 4JRYA 1D5BB 1BFTA 1LD9B 5EORH 3HRPA 4MD5B 1IC4L 5DEFB 2B8OT 4NFCA 1CS6A 4Z7UE 5SWQA 4GKSB 5L9DH 5D70H 3C6LA 3RWEB 3ULSA 3DXAD 3ZKMC 4LPXA 4RMWA 5D1XD 1S7SA 3MODH 2GAZA 3QAZB 3D6GA 4GG6E 5KSAC 3U6RB 4ETQB 2QV2A 5SWSE 4RGMB 1NQBA 4L8SA 4HJJH 4WI6A 3TF7C 1WVZA 5BVJB 1MRCH 2JIXB 2DTSA 1Q72H 3PL6A 4ELMF 5DJYA 4F7TA 1BGXL 1GPOL 4EDXB 5I8CA 3LZFL 4JFXA 1F97A 2W9DL 3B9DA 3SKMB 1RZIA 3IDJB 1C7TA 5C0AA 4TOYH 4CVZB 1K2DA 5HYFA 3QB7C 1OAZH 2MSPA 1JWUA 1L0XA 2LU4A 4JHAL 4U1GB 4S10A 3F8UB 1MCEA 1M7DB 2E8YA 3MBEB 4OCLC 3TP4A 5CP3H 3BEWA 1C5DA 3AGVA 5D96B 1G7MA 2G75B 3IDXH 3JWOL 3HMXH 3K8MA 4L8BA 4NZTL 5IFHL 1KIPB 1OSPH 1QVOB 5CSZA 3GO1L 4GG6F 4MA8H 3FMGL 1EHAA 2D03L 4PP2A 1CZ8H 4NWTL 5IHUH 3OB0K 4AEFA 4HX1B 5F88B 1R5VB 2H32B 3CXHK 4PRPB 4Y8DC 1Q9KA 2IGFL 4JGJA 2CMRL 4XCCL 5F7YC 5GGVL 4WTZA 4D0CA 4JRWA 4Q74A 3BDYH 3DURB 2HH0H 3TBWA 3VCLA 2ZPKH 4OIBA 1T0NB 2PTVA 3ARFC 3QO0B 2ICWJ 4LSUH 1HIMH 2DQJH 3S34L 4OGZA 2ZP0T 4J8RB 5D7JA 2PW2B 1BD2A 3G04B 4MJ2A 2JB5H 3L5WB 3H7BA 3BI9X 3DI2B 4XVJL 4X6EB 5DJ0B 5BVPL 4GRWF 3GMRA 3HNTL 4DKEH 1GL4B 2EIBA 2PYEB 2PYFA 1HN1A 4PJ7B 4U1NB 5DVOA 2AJUL 2VIRA 3MNVA 3NOIA 1BP3B 4P46C 3SDXB 1JTTA 1MF2L 4D3CL 1D5IH 2C4XA 3BN3B 3MLWL 2R8SL 4FQPA 4DN3L 4ETYA 1HINL 5DFVD 3OJMB 5E1AB 1YNKL 2UVEA 2Y6SD 3SKNA 5LJYH 3O6KH 2GHWB 4XPFL 5FM8A 3K0WA 3MV7B 4WI7A 2CLRB 1L9NA 1YNLL 3LN9A 3MRIA 3TIDA 3LQZA 3TV3L 5TQ2H 1KCVH 5T3XL 4PR5A 3OAYH 5E70A 1B0GB 2FATH 1JVKA 1NCBL 4LP5A 4X6CA 5GJTH 2FD6H 1I3GH 4OLZL 4HULB 4FABL 4Y4HC 5GRJL 3ARRA 4OGXH 1Z3GL 2V2XB 5JORB 5ILTL 1HHGA 1NCTA 5IMKA 1QR4A 2XWTA 3HLAA 5CGYC 5DZLA 4PJ8C 3BP5B 4ONGL 3C2SA 4JQIL 3L3DA 2Z8VC 2AGJH 4F58L 1CFSA 3O2DA 4OIIL 3VFTB 3MXWH 1RUQH 3MFFB 4WI3A 5E5MA 3HCVA 4FS0A 3RTQC 4QY8B 3FAXA 1ZGLM 1JIBA 5K9JH 1U95B 1RZGB 3VG0H 1NGPL 1IAOA 3X13B 1OGTB 5C08E 4P5TB 2DJUA 4P9ML 5T3ZL 4CJ1A 1I1RA 3RU8L 4BZ2L 1W72A 2AVGA 4P2CG 4URTB 4PJ9D 3ZL4L 1ZKAA 4ORGA 5SWZA 1FNEB 3P30H 3DRTB 3MUZ1 1GH7A 3JV6B 2IAMD 5I74B 1TZIA 3GKWL 1AC6A 1IM9A 1ODAA 4Z7UA 1MNUL 2XTJD 5MP6L 3L3HA 4CW1B 3NACL 4K7PX 4GG6A 2VDMH 5DC4B 3RVTD 1OSZB 3VWJB 5HHNB 4R7NA 1FJ1A 1JTPA 3P4NB 4XRCA 1RZFL 2A2QT 1DBJH 4JN2A 5GRVL 1J0IA 1JHTB 3B4NA 4PRAB 4LLWB 5GRWA 2ZUSA 3PHSA 1R3KB 2IAND 4ZO7A 2JCCF 3RWGA 2VAAB 4KK5D 3CAFA 3HZYB 2Z8RA 1MY5A 4NCDA 3DXAE 3IU3B 4M7LH 1FIGL 3IFPA 1FCCA 4IIQC 2NX5D 4OCSL 4JLRB 3FKUS 4LOUC 3U0PB 5IM7A 4X98B 3GSNB 2YSSB 5IB1A 1NBYA 4XC1H 4U1JA 4XP9H 1TQCB 4ONFL 1KYOJ 1INDH 1MRDL 2GSIA 2VABA 4UT6L 1NLDL 4HJGA 1RJZA 4QXTB 5B39G 4P4KC 1G7JB 2X1OA 4R0LC 2NXZD 1SEBA 1TITA 4EBQH 2X4OB 2YPKA 4JFFE 3V6FB 5F8QC 4U1MB 3VXUE 1KJ2L 2LQRA 5FHAH 3SCMA 2HFFA 1XCQB 1S9WA 3FT4A 3QHFL 2E9BA 2AI0H 5E2UH 1WITA 3VWKB 3KPRE 1BQSA 1ORQA 5DI8A 4ERSH 1K8DA 1LEKB 4MB4A 3G08A 4KV5E 3T09A 1FAIH 4OUUB 5BRZD 3DYMA 3S96A 1KTDA 3KXFB 1IQDA 4R4BA 3S9DB 1I9IL 2WQRA 4HS6A 5JOFB 3VFSA 4R4NC 4AMKH 2RCSL 4P2QB 1ZA6A 5JMRA 1CFVL 2X9YA 3ZHLA 1IGIH 3S6CA 2C9AA 4P2RD 4G43B 1DUYB 4GKZB 4GKNA 2W0LA 5GHWL 4OV5A 3GSQB 2WIMA 1SYVA 4YPJA 5E2TH 1YECH 3GEWB 5I1GH 3T08A 1PLGH 5DHVB 2ADIB 3RPIB 4HKJB 4TNWK 4XP4H 3BW9B 1Q8MA 4PRDA 2VERN 3CFEB 4DGYH 1DVFA 1T66D 2CLZB 5JOPE 2VDKL 1L7TH 2BY0A 4IRSD 4K8RL 1XZ0A 4ZS7L 1J7VR 4HPYL 1WWAX 5IBLC 3CDCA 5E8OB 5ACZB 3LKNB 3C09C 1FL6B 2YD3A 4OD1H 3BYYA 2DD8L 2K7QA 1KNOB 5GIRB 3BOVA 2BSTB 1MH5A 1V7NL 3EDEA 2XN9D 1YDPA 5HTSA 3S35H 5FUCE 1T7VA 3RVUC 1IGFL 3IDYC 1NUDA 4I18A 4Y4FC 3LQAL 5IMLA 2FX7H 4BH7B 1N64H 3I3BA 2E3VA 5HGDB 2BFVL 2GQHA 1AGFA 4WI8A 4Z7NE 1NMCB 3GSXA 4NN5C 4I3RL 5EC2B 2VQUA 5C08A 1MJUL 1P9MA 5IR1B 5ACLA 1FRGH 2NY5H 2DQHL 1DBML 5KAQF 1F11A 4XNZB 3BPOC 2HAZA 4Z77A 5KSUB 1M1SA 2NPLX 1DDHB 3CFKB 5I76A 2IQAA 1FZOB 2J8UB 5KAQG 2W60A 35C8L 4XMPL 1RHHA 3MLXH 3P0VL 1G7IA 1LVEA 1TQBC 1MQKH 3LQMA 3H0TA 3N1PC 5B39A 3VG9B 3X14A 5D7IB 4LCWB 5DQJA 3RGVD 1U6AH 3V6OE 5CKAA 1OT2A 5I1CL 1KPVB 3AY4A 4L1DA 3ZE1F 3MLZH 5HHMB 4YO0A 4ZTOL 2SEBB 5C2BL 3NCMA 1QLFA 5LWYH 2R9HD 5IWLA 1OAYL 2BC4A 1AGCA 2P46B 3VXSE 1P4LA 1TCMA 2Q8BH 1GZPA 3NPSB 1S7UB 3RNKB 1Z9SA 4M48L 1AD9A 4EVNB 2YBRB 5DFWH 3RUGB 1JYXA 1U8NB 8CGTA 2APVA 3V6ZA 5HI4D 5FGSA 3TYGH 3SDDC 1KJMB 1M7XA 4I2XE 5M95B 8FABB 1RZKH 2XTJE 2P5EB 2NY4C 4WW2F 1J1OH 3DXAA 5C0FA 5DS8B 4JZOA 2DN7A 4QTHB 3TEUA 1U92B 5EO1B 3CMOH 1DQLH 3PGCA 2VXVL 5EPMB 2OI9B 2FRGP 1AGBB 4RBPK 2UWEE 4DGVL 3CFBB 4L4TD 3JVGA 4HBCL 1ZLVH 2IANE 1I7RB 5F9JB 3MLTB 5EFIA 5L7XH 4PRHD 5DD5L 4JFFA 4TRPL 1YY9D 1CICD 1DLHA 1JF5A 2AV1B 3VXUA 5A2KH 4I77L 4K7PL 3FOMB 2R23B 1NGXB 3O41B 5D2NC 3CX5K 3HA0A 5KS9B 4UMGA 3C87A 2GT9A 5BS0D 1CFQA 3OKMB 5DXWA 5IB2A 1GXEA 4MD4B 3BKYL 2BNQB 3UTSE 3KPRA 4JGUA 1E4WL 3AU1B 4XVSL 4BQ9A 2XA8H 1JPGA 3C60B 1LO0H 2VH5H 4JO2L 4PJHE 1E4XL 4KZDH 4MXQC 1CI5A 1I9RL 4AH2A 1PY4A 1X5XA 2AV7A 1RV6X 4QCIA 4J2XA 3G5VB 5IMMB 2UWEF 4U1LA 3LEVH 1G0XA 3QQNA 3TVMB 5JTWA 3MREB 2F19H 3VFWB 4LBEA 3PV6A 1OB1A 3M1BB 1R3IL 1WBYA 2AKRB 4Q6IB 2AK4B 5HVGB 5AYUH 4KJYA 5AD0B 3EOTL 1JPFA 1S3KL 1R5WA 2ITDB 4PGCA 4J1UB 3TIEA 1EO5A 1D5XB 2W38A 5IMOB 3WXWL 4ZAKD 5EWIL 1D5ZA 3ZTNH 1MCWM 3UTOA 2X4NA 4U1IB 4OF8A 4BFEA 1G7LB 3T0EC 3RVXC 3MNZA 4RMUA 2CQVA 3MROB 2OL3B 1A14L 4L29A 5HGAA 3BKML 4A6YH 4JB9L 2CDEB 1ZA3A 5LVEA 3D48R 3ALXA 3T3PE 3OKDA 1HHJA 4QGYA 5CCKL 3B9KC 5CP3A 2D0FA 5JIIA 2R0LH 3L9RB 3QIWD 5CJOH 4MCZA 3TT1H 2IALB 3HMXA 4OLXH 1NGYA 1FNAA 4M6ML 3SN6N 4UNTA 4QT5B 3KYMB 5J13C 3IU4L 4HUVA 5C8JA 3X3GH 2GTZA 1K4CA 5I15H 4RQQB 1YZZA 1VEOA 4XCEA 5TQ0L 1QNZH 3HTLX 4WW2A 3JTTB 4M1GH 2VLRE 4K3DH 3PDOA 4OD2A 3F62A 1SJXA 2P4AB 2APBA 1QR1B 2ATPA 4PP1D 1HI6B 1H5BC 5I17B 2YZ8A 1OAQH 4OCXL 4LHUD 2ZOKA 2X1WL 4EOWH 3SE4C 3IXAB 1MJJB 3V6OA 4WWKD 3OJDA 4A2LA 4ODTH 2AERT 2VXTL 1Y0LB 2D7PA 4CJ0A 1T0PB 1BQHB 1C08B 1BJMA 3MOBL 3VXSA 4NYLB 4ZXBC 1HHHA 1NLBL 4ZQKA 5TFSH 2FB4H 4PJ9A 2PCPA 2DIJA 3S7GA 4MNGB 4QHUB 3WUWA 4GSDL 5FDWB 3BP4A 3DMMB 2EO9A 3DGGB 1SBBA 4PTTB 2FEDC 1I1YB 3V9FA 4I2XA 1QSED 2AJXH 1FFOB 2BOBB 1MFAL 1JNHB 3QO1A 3VRIA 3D2UA 5C0EB 4MXWL 4KTEL 3AM8A 4KDVA 1PKQE 4OD3H 3NA9H 4OCYL 1X5AA 4LVNB 2VZTA 1EFXA 1UM6L 1T0MA 5C0CD 2B2XH 2DQUH 4QRUB 5IVZA 4FQQB 4Y16A 2UWEA 2E9IA 1TJIH 2IANA 3T4YA 5TE7H 1UVQA 2UZIL 1QUNA 5E2WH 4EQ3A 4OLVH 2WBJC 5DJZB 3T2NH 4U6VL 5CJ8A 1M6OA 4WO4D 2DTML 2NR6D 3QRGL 2A9MH 4N0CC 3CD4A 3WFZA 3JWDC 5KSBE 3FOLB 3T1WA 2EYSB 4E41B 4KXZH 3TN0C 5BW7A 1VGEH 1TFHA 5J57B 3UTSA 1ES0B 5INCB 3FQXB 5K9QI 3UTQA 4PJHA 5I66A 1BVZA 2WAHA 1ZE3C 4FXKB 4L4TE 4OT1L 4FN0A 3GIVB 3O8XC 1VKXB 3QCTL 4PJGE 1IGTA 3O2VL 2G60L 4KJPC 5TDOA 4NUJA 2HT2C 3V0VB 1VADA 1U8JA 1X5YA 4PRHE 1DEEA 1PD6A 3WFCH 5F6IB 2DB8A 4GAGL 2YXMA 3T04D 4G8FB 4U33A 4Z5RB 1GGCL 3ARZA 5ADOL 5HDQH 4AY0A 5IVXB 5ESAB 1CGWA 2CPCA 2VN7A 3C6LC 3EDDA 1YNTB 1MRFL 1XMWA 1UXSB 4KQ3H 1JYNA 2QLVB 2XZAL 5JW3H 3B5TA 2XYCA 3KJ4C 4ALAH 1DQJB 1M71B 4PJXE 4OKDA 1ZV5A 3MZTA 1UACL 4LEOA 2HN7B 3B2UD 4LLUA 1TIUA 3GZKA 2A38A 3MJ8B 1I8LA 4NFBA 5MEQA 3MNWA 2C5DC 4HS8H 5KG9B 1FVCA 5TE6L 5E2VL 4RWYH 1Q38A 3LKRB 5SV4A 1X4XA 3OG4B 3EHBD 4MAUL 4XMKH 5BO1H 4TULH 2W91A 1FZKA 1T83C 3QG6B 4DW2L 3PHQA 2R56H 1TJHH 4PJXF 3UROR 3VXRB 2J6EH 2VSCA 3WFDL 1P53A 4HXAL 5E95B 3VI4F 1JBJA 2J5LC 5DQ9A 5HHOB 3UXFA 1JFQL 5IFJB 1CXEA 2VLRA 1OAKH 3NVQA 3SO3C 2XA3A 4NBXB 4XHQA 3QWQB 1MCRA 3GSRB 1JGEA 1UH3A 2HLFD 3OPZL 4HIEA 1JK8B 1T1YA 1KELH 1ZGLB 5J4MA 4Y4KB 4Z7WF 3RVVC 2ENSA 5D7JC 3W5NA 4HGWB 5E56A 1N7ML 2IWGA 1GZQA 2EDWA 1H8SA 2X4PB 4ZD3L 1HSAA 1L6XA 3IDMB 4JCMA 3UZQA 5KSVB 3BT2H 3IF1A 1NL0L 2X4SB 3NFNA 4K94C 2AXGA 4C58B 3S3JA 3W82A 4CNIB 1CDJA 4OZHE 4GRMB 3VFMA 4MNQD 5DYOB 3ZKXB 4N8VB 4GXVH 3DETC 5LCVL 3PWJB 5FM5M 1PKQA 3M07A 3GIZL 3ZSTA 5JHLL 5JA9A 3RGVA 2BXYA 3CLFH 3VFUB 3VFOB 1PW3A 4GW5B 4NN6B 3QUXB 4LVHC 3H3PH 3QHZL 2NY0D 3UTPE 1YEFL 1UB5A 4MJ4A 4ONOA 5EZIH 2B0SL 4H8WH 4JDVB 4H25A 3MRDB 3CFCL 1QKZL 1C1EH 3DGCR 4UILH 4LCCB 3EJZD 1J5OH 3THML 1CDCA 3EYOB 5F3BA 4LSVL 2FBJH 1NANI 3NGBC 4OZHF 5I1JH 2DQIH 3UTTD 2FJFA 4FFYH 4U05A 1LO4H 5H35A 2A0LC 2NY2B 5KSBA 5DJ2B 3STZB 1MHHB 4JKKA 2H1PH 4AEIL 3LEXA 3IYLW 1NSNH 4NQXA 1AHWB 5DF0A 4H0HB 3GJFH 3CCHA 5IJVB 2FCBA 5C0CE 1U3JA 4N0YL 5C0RL 3WXVH 2V7NB 1AQKH 3GHEL 1NEZB 4L4TA 3DOSA 3O6LL 4L4JA 4LHUG 4OZIF 1DANU 3NCJL 3CVHB 4PJGA 3AMLA 2YK1H 3BESR 1I9JH 2I9LB 2LVEA 4QWWD 4WJ5B 4HUUB 4HWZA 5AAWA 3QG7H 1UH4A 4PRHA 1F3RB 2Q7YB 1IGML 4XH2A 4UV4H 5TE4H 3QPXL 1U8KB 4RMSA 3BIAX 4NJAH 3EJJX 4YHIB 1WCQA 4HQQH 4J3OC 3V8OA 4Z76B 3NPZB 1T89A 3O6ML 3M8OH 1WFUA 4JCLA 3HC4H 3LDBC 4UIKH 4EI6A 1CLZH 3MV7D 4PJDB 1FG9C 1MVUB 2C26A 1U8MB 4TVPL 3VXOB 1UENA 3WIFA 3K8KA 5TDNA 4K23H 4PJXA 5DJXA 2IPKA 4NO0B 4CU8A 3QXDB 4P2OD 1LE9A 1ZLUK 3F5WB 1IZKA 5D2LB 1JI1A 4GKOA 5H94B 4YHNB 2MCPL 3MRMB 3S36X 1GAFL 2PETA 1GC1H 1QRNE 4Y1AB 5CWSA 1N8ZB 3LD8C 4KY1H 1F4YL 4CN4A 2DMCA 3K8LA 2IPTH 3OF6D 3GI9L 3P4OB 3CXDL 1J05B 3BSZL 3WEXB 5GRYA 4GRLB 5GGTH 4ZAKA 5K59E 4NFDA 5GGSA 3QZWA 1QEWA 5ESQB 1FDLH 4NN7B 3A0OA 2H6PA 5K9OA 3SE3A 2B4CH 1HKLL 2XRAL 5DFTA 4TUJB 5FO7A 4PJFB 3IJYB 1W72L 1U41A 4PY7B 2DWDA 5ID1A 4LLAA 1CLOL 2Q20A 1JL8A 1YC7A 2EDHA 3SKOA 4FXGB 3H3KA 2EKSA 4JY4A 4Q9BA 2APXA 2RHEA 1GOFA 3PF2A 1A6VH 1CF8L 3IDGB 3O45B 1VFBA 4OSUH 3H3BC 1FQ9C 2PR4H 3SCMC 3OKYA 5E00A 2Y5TA 5T1KA 3QIWA 3D18A 4J4PA 1DUZB 4XMLL 1MIEL 1PX4A 1LO5A 5IF0B 5I1IH 5FCUH 1WLHA 3V4UH 4D0BB 4JQVA 3T2PA 2VAJA 4I0PA 4OFPA 1X3DA 4DOHE 4UINH 2ENYA 1W2KT 4D9LL 2IQ9L 4MVBC 5F70A 4PPTA 4OZHA 4OI9A 2DLGA 3PGDB 3VW3H 2Q76B 5C71A 1OL0A 5CLWA 4F7CB 4PB0L 3GSWA 5J11C 1KEGH 4G6FB 3G6DL 1PZUB 3QUYC 2VLLB 4KRNA 2EZ0C 5J1AA 2BVOA 5DHVH 5JIPA 4WWKA 2HTLD 1JTOA 3VXNA 3GJEB 2GJJA 4XP5H 5KTEH 2G5RA 4R4FH 5JUEH 1IGCH 3QUZD 4IRJB 1ZTXL 4NBZB 3FQRA 3SDYL 4NQSA 5EOQH 3KPOA 3I6KA 3P9LB 5HHVH 4P9HC 1EV2E 4I0CC 3GRWH 4R0LB 4UAOC 4CDHA 4Z78B 3QXAA 4PV9A 4KZEH 1I7ZB 5CEYA 1R0AL 4NM8L 4X0KA 5C0DA 5DD1H 4JDTL 3KPPA 1CGXA 1T04A 2IEPA 4OAWA 3RWDA 5A3IC 4A6YA 5BZDA 2F9BT 5FV1L 4R97B 3NABL 1T03L 4YDVB 5I1AA 4CVUA 5FV2A 5C0CA 1DQTA 1TNNA 4I18C 5KVEL 1EEUA 4H88H 4F7PB 3MUHL 1KB5H 4G8EA 4PRPE 3DUHA 4NQUA 1YYLL 1Z0NA 3L3OB 4HS3B 1BFOB 3FO0L 1U3YA 5J6GA 3O3UN 1WIOA 1IEAB 4WO4A 2W9EH 3P0GB 1FYTB 3OR6A 4JO4L 4IMKA 4H20L 4LSPH 4XNXH 3DO7B 2EDLA 4FG6C 3LCYA 2YUVA 3IAPA 4TTGA 5E99H 1AP2A 2I26N 4J3TA 5JNYB 3BQUD 4YH6A 3V8CA 1A6AB 1NFIB 1XEDA 2MHAB 4N8PA 2BJML 3WSQL 1A9BB 2IFFL 4TNVF 1X4ZA 3ARBD 3WJJA 1T20A 4N0UA 4C4KO 1FFNA 1OF2A 1MFCH 3D85B 2DYPA 2YD8A 1FV1B 4YGAB 1BVLA 3SDXE 3MR9B 5C0BD 5AUMA 5CUSL 3VRLF 1TNMA 4WRLA 2OJEB 2X40A 3L3JB 3JV4B 3HZMA 1DBKL 4PGDB 4P3DB 2GJ6B 5L8LB 4M61B 4K3HA 2AS5M 5IBTH 1A9EB 3WFBH 3V52L 5DEGB 2HFTA 5GGQH 1FLRL 2Q3ZA 2ICWA 3C09B 3RWFB 3RA7L 3MV7E 4QTIH 4NZJA 2Y06L 4TPRH 1RUPL 4R2GC 2NY3D 1JE6A 1UZ6E 2BHYA 3IDYB 4IJ3C 3FN0H 3GMOB 1TZGL 1Q9LB 3MJ6A 4LQFL 4YHLL 4LSRH 1IKFH 2AJSH 4L9LA 1KIUA 4M7ZB 1OLZA 1P4IL 3ARSA 4FQXB 4O51A 4TQEH 4LSDA 2KZ1B 4KAQH 1N6QH 1NAKL 1Q9OB 5CD3A 4MA3A 1F13A 4KTDL 1FL3A 4Q9QH 5D6DC 3JVGC 3SDXF 3EYVB 4KMTH 3EO9H 1D5MA 3U7YL 1U93A 1HXMB 3BPNB 4K9EL 4NQEB 1SYSB 2C1OA 2E27L 3G6AA 3BPOB 4YBLC 3EZJB 4AM0A 2BOCA 3H42H 5I8KL 4JZJC 3ARGC 3WL9A 1LDPH 1YMMD 5JQ6L 3QIUD 4GUPA 5MEOB 2ADFH 2QQNH 2GK0A 4AL8L 1XGQA 5ENWA 3V0WH 4JO1H 3S36L 1AQDA 4F2MB 4ZODA 3B5HA 3MRRB 2X4UB 2X09A 3KPLA 4W4OA 5I1KH 3SQOH 2QSCL 5ITBH 1XIWA 1RPQA 1CL7L 2A6JA 2LV4A 4XP6L 1E27A 4I3SH 1MCFA 1D5BA 1LD9A 4CMHC 4MD5A 4MAYB 3REWB 4JFHD 1WEJH 3LY6A 1FVDA 5DEFA 3RDTD 1YPZB 1IAIM 1MJ8H 2UUDK 2PW1B 2R69L 4I9WD 2P5ED 4GKSA 3T2OA 2DBLH 3BDXA 4D9RE 1CBVL 2BXZA 5I73C 2GY7B 1I8KA 4O4YH 1ONQB 3U6RA 1T3FA 4ODBD 1OQXA 4K3JL 1FO0B 1I1AD 2R2EB 5LQBL 1JNJA 1ZT4A 3ZSSA 4G3YL 4NNYB 2JIXA 3K4DA 2OL3H 3C2AL 4FTVB 4EDXA 2CD0A 2XQYG 1OP5H 2VR5A 1UJ3C 3SKMA 4F57H 4XZUB 4KHXL 4CVZA 1ZGLP 1MCQA 1MHPH 5CLTA 4UT7H 2ZKHL 1A7NL 3MBEA 3OHXB 3H9YA 2X7LB 2YD6A 2NZ9D 3QYCA 4ORZC 2D0GA 2YA0A 1KIPA 1QVOA 4NC2B 4GW1B 5E0QA 1OGAB 4R3SB 3L1OH 5BV7L 5FUCC 1CT8B 3C60D 1O5DT 4HX1A 5F88A 1R5VA 3BP6B 3GI8L 2J8HA 3B6SA 3HMWL 4PRPA 5E8DL 4YBHA 3L95B 2LTQC 3GSUB 1O7VA 3BZDA 1UWEH 5EU6D 5DUMH 1J8KA 1CIDA 5HHQB 2J6EA 1YEJL 3DURA 1DBAH 4NKQB 1T0NA 3U30B 1OOAA 3CLEL 4HAGA 1G1CA 3MBXL 3PWLB 2NLJB 3QO0A 5HGBB 2O5ZH 4PJIF 3QI9B 4XHJC 5EOTB 2PW2A 5ERWB 1ZHBB 2X1PA 5IK3B 1T1WB 5IOPA 4MLSA 2X4QB 3G04A 3MRHB 2VZVA 4IOFC 3NIGF 3L5WA 2A83B 4BSJA 3N1FC 4XAWH 5DJ0A 4X6EA 5AG8A 1BBJB 3V6OC 3UYRH 4NCC1 4S2SA 5HDOA 1LO3L 4OJFH 4U1NA 4LAQL 2ESVB 2FZ3A 3BWUC 5CKGA 3SDXA 1IC1A 5F96H 5I8OL 1EHLH 1DCLA 1MOEA 4DFIA 2FNBA 1ZHLA 3O0RH 1RQ5A 5EUOF 5FYJD 3WLBB 3CDYA 5E1AA 4KVNL 4POYA 3MRKB 3TGXA 1OAZL 4NGHL 1HE7A 2DDQH 5IEKB 2H8PB 3LS5L 1F4WL 3I6LD 1A4KB 3MV7A 3PE9A 3V5DB 1I3UA 3ZHDA 4AG4H 25C8H 3AM8C 3RVTC 3MMEB 4OZGF 2CLRA 2R0WH 2R29L 1NDGB 4LPUA 2QL1A 3CVIH 4P2OA 4KPHH 5CZXD 4PREB 4LLDB 1S7QA 5FYKL 3HE6D 2JJUA 1NJ9B 5C0BE 4NRYB 4QOKD 5D6CB 2BNUB 3K46A 4Y16C 2E5EA 3UJTH 3CIQA 5JORA 3VD4A 5C0GB 4UIMA 4N5UA 1ZT1A 3F7PC 5ESVA 3S98A 1KCLA 3BP5A 3TA3C 4A2MA 5GS0D 4NWUL 3WN5B 1QFUH 4U0RC 3GNML 1GJIA 2KQMA 4Y19D 2Z31D 3MFFA 5KJRH 1NGQH 4KJQD 2ZUVA 1QPXA 4QY8A 3MUJA 3OAUL 4OCWH 3SDCB 3RWJB 1RZGA 2ZPKL 5BW7C 2J88H 3X13A 1OP9A 4LLMB 2XKNA 1OGTA 3WNMA 1HNGA 4M6AA 1HIML 3GJFA 5IV2B 1MFDH 1UM5H 1FNEA 3DYPA 3DRTA 4DKEL 3B8SA 3KYOB 1HILA 2O5XL 3EFDH 2J8UE 2YKLH 4CW1A 2ZUQC 1YMME 1FC2D 4ENEC 5F7WC 5CS7A 5D7IE 1AKJB 1OSZA 4LCWE 3BXNB 2MPAH 3P4NA 1E4XI 1A2YA 3MYJB 1KPUA 2VR4A 2BRQA 2XICA 3DSNA 5HHME 2HYMA 5FYKU 1A3LL 3U1SH 1JHTA 3WD5H 4PRAA 1AY1H 1QA9B 5IB3A 4LLWA 5HD8D 4JG1H 3QUMB 3O6KL 4BYHA 1R3KA 1MJ7L 3HI6H 1G1YA 2QKIB 4QRRD 3KLHC 1PVHA 4ZG1A 3RUGE 3TO4C 2VAAA 3HZYA 1XR9B 1QBAA 5CP7B 4I9WE 2P5EE 2FATL 1G9MH 3DVNB 3IU3A 3U4BL 1BJ1J 5CEZH 3U9UB 4E41D 4JLRA 3DBXB 2O93L 1T2QH 3HG1B 2EDFA 1A6UH 4LVOC 3TM6A 1W8NA 2YSSA 1A7RL 1AJ7L 4M62L 1NBZA 3LPWA 4AEEA 4DEPB 2AGJL 3A6CL 5GGTA 4QXTA 1G7JA 2R1WB 4X9IA 2PXYB 3WIHL 5L2KD 4O9HH 3TBYA 4LKCB 2DQTL 2J4WL 4IHOB 1MCSA 2X4OA 3V6FA 3BGFC 3RUGF 5DK2A 3IKKA 5IB5B 1A4JB 2QBWA 4ODSL 4YHMH 5JLZB 1QQDB 2PN5A 1A0QH 4CGTA 5KS9E 5E8EA 1XCQA 1CDIA 3R1GL 4N1CA 1XH3B 1PKOA 2BNQE 4FQHB 5I8EB 1ZSDB 1LEKA 3SKJH 3DX7B 2ZUYA 3IRZA 3DJ9A 5ICXB 1MCOL 4OUUA 1IE5A 3KJ4B 3QNXB 4WEUD 4LCYB 3CU1A 2OTWB 1A3RL 3G6JB 5JOFA 4PGEB 4X5XB 1INEH 5EU6E 4GQ9L 3ARUA 1G7QB 4R7DB 4MQ7B 7FABL 5EOCJ 5LGJA 4PLJC 3QEQD 1A7BA 4WENB 4OCRH 5DT1H 1KACB 1DUYA 2HFEB 3RWIB 1WWBX 4OLUL 4V1DB 4GQPH 1A64A 5ICYB 4PJAB 4G80B 3FHAA 4HIJA 5CEZD 2AJ3B 1ZLVK 5IBUB 4WU7B 3QEHB 3ARBA 5C6PB 3UTZB 4X4YB 1FFRA 3B8YA 4S1RL 5DHVA 3RPIA 4HKJA 3BW9A 3PUCA 1GRWA 3CFEA 2F5BH 2EKJA 1U2HA 5C0BA 2CLZA 5D1QB 3PP4L 1FLTX 4TUKH 4XP9L 5F7DB 1KCRL 2F74B 3ARYA 2CRMA 5ACZA 3LKNA 2J5LB 4XCYA 3C8DA 3GRWA 4JR9H 5F7KC 1FL6A 2BHUA 1KIQB 4M93C 3SO3B 2BSTA 3L7EB 5F7EL 4EBQL 1IL1B 1H3UA 4P3WA 3I6LE 4O58H 3ZKMD 3O4LB 2W0PA 3VXQB 4RAHA 4KHTL 1LO2H 4MA1B 4KVCL 5HGDA 3CVHH 2Q7NA 5HYJD 3MV8D 3BE1H 1BECA 5IR1A 1FG2B 5E2UL 4S1QH 3VD3A 4X4XB 5D8JH 3PV7A 3QFDB 4NKOB 2UY7A 1TENA 1KB5A 5F9DC 4K71C 1ZAGA 2NY1B 5KSUA 3FB6B 5FHBH 1DDHA 3CFKA 2WWMC 1G0DA 1FZOA 2J8UA 5F72S 2NY5C 4APQB 3C08H 1YMMA 2E8ZA 3QIUA 3Q6GL 1QFPA 4PRID 5BZWB 5D7IA 4LCWA 4IOSD 4GAJH 5GZNC 5C0NC 1IGIL 1KPVA 2XFXB 3IJSA 2SEBA 4LVHB 1W8OA 4FQJH 1A5FL 5EC1B 3OMZA 1XF3B 1S7UA 2JELL 3FB5A 5E2TL 1KFAH 3RNKA 4F15B 4EVNA 2YBRA 2EC9U 4MNGE 3RUGA 1U8NA 4WW1A 5DTFB 1P1ZB 3IAGC 4LDOB 4M4RA 2YPVL 4LPWA 1A7OH 4U6YB 4Y2DB 1BWMA 2P5EA 1CCZA 1YJDL 4X6DE 3SDAB 5DS8A 4QTHA 1G9NL 1U92A 5EO1A 2LVCA 4J3SA 4NQVB 4WU5B 3EDFA 5IP4A 3ARFD 2VDNH 1RZKC 1LE5A 2RQ8A 5EPMA 3LS4H 1EUUA 4UNUA 2O5YL 1AGBA 1H8OA 1CVSC 2BZDA 4CVWA 3B43A 1ND0A 3CFBA 3PGFL 5EO0B 4L3ED 4ZAKC 2EC9T 4G7VL 3BISA 1BM3H 1I7RA 1LHZA 4P48A 5F9JA 1P7KB 1F02I 4HFUL 2WMPA 2VDLL 1DLFL 3MXVH 4GBXC 3MLTA 3SE3C 2ZSWB 3B9VA 3W5MA 4P46D 2FHFA 2AV1A 4KGLA 5BOZG 4NNPH 2R23A 1U3ZA 5HPOA 4OI8A 1GIGH 1RU9H 3O41A 4R96B 1F3JB 2HJLB 5KS9A 1U8QB 2OR9L 1QBLH 4E41E 4JFYB 3OKMA 4X6DF 4JPWH 4MD4A 2BNQA 5GJSH 1A7QL 4Y5XB 1OW0A 3AU1A 4YJZL 3BJLA 1V3LA 2OZ4L 3LDBB 3C60A 3NFSH 3I02B 4WEBH 4JE4B 3VGFA 4TN9A 3MLXL 4J4PC 1KGCD 3D69B 3MUY1 4XXDB 4FNLH 4WV1C 1HH6B 2JB6B 3BUTA 4M7JL 5IMMA 2H45A 4G6AC 4DN4H 1FE8L 4I0PC 4X4ME 3MLZL 5EU6A 4Y1AD 1WQVT 1RFDL 5LWYL 3SOBH 2JJTA 3R0MA 4QRTB 3MREA 4Y4HD 3HPLA 5CBAA 3VFWA 5F9OH 2Y07H 3DX8B 1NCCH 4XWGH 4LRIC 2AKRA 5CGYD 3GSVB 4PJ8D 5IVXE 1MHCB 2N1KA 4H1LB 4TSCL 5AD0A 2GIYA 3TPKA 3TYGL 5BMFH 4J1UA 1X5HA 3Q5TA 2VRAA 4HC1L 4XNMB 1D5XA 2IC2A 4S1DC 1X6LA 5IMOA 3MLUH 3RTQD 1AGDB 1WC7B 3QDGD 4OZFG 1MQ8A 3CMOL 1EEZB 2XOTA 3QCUL 4U1IA 2QQKL 1G7LA 4RISL 3BZEB 3S5LG 1LEGB 2GITB 1RZJH 3MROA 2OL3A 4O02H 4XC3H 4BQ8A 1QO3A 2X6MA 4FFZL 1WWWX 2CDEA 1J0HA 3FFCB 2V5MA 3WIIH 2EC8A 12E8H 4OLEA 1K85A 1CDBA 3PABB 5L7XL 5CEZE 4G8IB 2FWOB 5ALCH 4J3WA 5EBMB 3E3QE 4EN3B 4JHWH 1MHEA 2IALA 5J9PB 4BM7A 3U46B 3MLPA 5HYSB 4YDKL 4QT5A 4F37F 3HE6A 5I71C 3VXRE 5SX4H 2GJZB 2A77L 3ZKQD 1BEYL 5D71H 1JZ3A 3R8BB 4RQQA 2GCYA 5HHOE 3DUSB 2VH5L 4HUWB 3JTTA 4UB0H 3WNLA 1BFVL 2J7LA 1UWGL 1QR1A 3I6GA 4OLYH 4Q0XL 3RX5A 3SPVB 4QXUL 1UFUA 4WO4C 1BIHA 1HI6A 3F6IA 2Z31A 4HKBB 5I17A 3ILQC 4GFTB 1AFVH 2X44D 4M9OA 4PRNB 1NBVL 3VGAB 4RCAA 2UY6A 2NW3A 3IXAA 4JFDD 1G7HB 2F19L 1NKRA 3RL1A 4LOUD 1I8IB 2VDRH 4XBEL 1BAFH 4O2CB 3ZE0E 3MV8E 4DAGH 1H9VA 1BBDH 2BY3A 1C08A 1RUKH 4NYLA 3WJJC 3ILPB 1F4AA 1GGYA 3U79A 5ID0B 5TF0A 3MRQB 1NAMH 1HHIB 4MNGA 4P4KD 5FDWA 1BVKB 3DMMA 3DGGA 4PTTA 4Y5VB 5HYQA 2OK0L 1I1YA 5ANMB 1CDYA 4F33B 2KUTA 2GFBB 2BOBA 3VE0B 1XR8B 3QISA 5C0EA 4X6DA 4JKWA 4OM1L 2BDNH 4PRIE 5DZOA 3MQIA 4PLNC 4LLYB 5BXFB 3WS3B 5JO5B 4A6YL 5D7LB 2P48B 5MI0C 2BY1A 5C9JB 1E28B 2C3HA 4QRUA 3X3FL 4FQQA 1A1NA 4JJ5B 3EKCA 2ADJA 3QIBB 3Q1SH 1CR9H 3INUH 1I7UB 4O2FB 2HVKB 4O2EB 1RK1B 4L9LC 5DJDB 4DGIL 4OLXL 1G0YR 1P5VA 1M05A 3EO0B 4BUHA 5E9DB 3B2UC 2HRPL 4QRPB 5DJZA 4R4ND 1CD1B 1YQVH 4JKPL 4ODHH 1WCBB 4WFED 1KYOK 5D5MB 1QBML 4YUEH 2F58H 5DMIH 4QGTA 4YFDB 3FOLA 2EYSA 4E41A 3S5LA 2Q3AA 1QNZL 4YLQT 4G9DB 4M1GL 1ES0A 1MCCA 3W2DL 1J1PH 3FQXA 3K74B 1HCFX 3DV4B 3L7FB 4L3EE 1OAQL 3QFJD 3D85D 4DVRH 3C5JB 4EOWL 1CWVA 5DDHB 5L2KA 4E42A 4DCQB 1FFPB 3V0VA 3BKCL 4RGNB 4W4OC 2ZCLH 2JJVA 4G8GD 4ZUUB 4HWBH 1XIWC 4S1SH 2GJ6D 2V2WA 3BIKA 4FRWA 4G5ZL 4G8FA 4Z5RA 5IBLD 4CADA 2K7PA 1FO0H 4G6MH 3CC5B 5E8PB 5IVXA 4UV7H 3N85L 5GRUL 3STLB 1YNTA 4PJDE 2AJXL 3QAZC 5TGBB 4NCC2 4H0IA 3RVUD 1DQJA 1X44A 1M71A 3O2WH 2F54B 2CR6A 1INQB 4Y4FD 1KGCE 4DK3A 5D2LE 5ICZB 5LAXB 2VE6B 4MX7A 1AH1A 4FQXD 3WKNA 3RRQA 4XI5C 1WJ3A 1A6WH 2HN7A 4Y1AE 4YHZH 2FSEA 2DQUL 3QEQA 4GOSA 4V2CB 1JP5A 1ZEAH 4FQLH 2YA2A 1TJIL 3GJFK 4HCRH 1PZ5A 4U1GC 3MBEC 3V5HB 2JJWA 2ADGB 3T1FB 2KPNA 3LKRA 3HZVB 2P8PB 1ZVSB 3BJ91 3WO4B 5D96C 1EGJL 2GW5A 3VGGA 4QXGH 1F58H 2WIIB 1D9KC 4PJDF 5JXEC 1P7QB 3UO1H 3QG6A 2BVEA 3VXRA 3QNYA 5E4IA 2HKFH 1MIML 4XBPB 4PJFE 5HHOA 4MAYD 5F44A 4KKNA 1BJ1H 4KQ4L 5IFJA 4Q9RH 3ARDB 1JF1B 3AMKA 2QEJA 1PQZB 1N0XL 3SDDD 5IGXL 5C3TA 5T33L 2Z91B 1JK8A 1WBXB 4BJLA 2P24A 2NY4D 4BSWA 3FN3A 2IPUG 4Y4KA 4DKAA 2P7TB 5EG6C 2MTPA 1LWRA 4JFPB 2FJHA 4YX2H 4HGWA 2E7HA 1FIEA 2UVFA 4TSBH 3VXMB 3MV8A 1WZ1H 4R90H 4BFIB 4PB9H 1A6TB 3IDMA 3QA3B 4WI2A 5JW3L 4UU9A 2R1YB 2X4SA 2BMKB 4HWEH 2XTLA 1ED3B 1UJ3B 2ARJB 2D7QA 3HC3L 3KNBA 4CNIA 5GGUB 2XZQL 4GRMA 43C9A 3BYTA 3EFFB 1NC2B 4M8QB 1PSKL 5DYOA 4N8VA 2VXUH 4FMFA 4PRIA 3PWJA 1S9YB 4UTAL 4JFDE 3VFUA 3OTTA 4HH9B 3VFOA 4GW5A 4HS8L 1SJVA 2NXYB 5JDSB 5H37H 1B2WL 3OKLB 2JK5A 3UPCA 1KJ2B 1WT5C 3W9DB 2VLJD 2ARWA 1V3JA 5AEAA 1Z9MA 1RJLB 1DN0B 4JDVA 5FGBC 1CLYH 4MXQD 5EOCH 1LDSA 4TVSa 2D9CA 1WWCA 4TULL 4AENB 3BEVA 1DN2A 2ITCB 3N1MC 5HGHB 4POZC 5KVGL 4FFWC 4LCCA 1ACYH 3EYOA 4LRNH 1U8OB 2IF7A 5DJ6B 5IW3A 4B7LA 3E8UL 4WDIB 4HSQA 4LNVA 3LH2H 1AXSB 2J6EL 1CG9B 2FHCA 1PYWB 1CTOA 5DJ2A 3STZA 1MHHA 1JGUH 1DL7H 5FA4A 3ARFA 1NCDL 5ITFB 1AHWA 3AXLB 3RAJH 2XZCL 5IJVA 3PG2A 2LAAA 4UUJB 5ALBH 4G7YL 1JPSH 1F3DJ 2V7NA 1IAKB 4L4VB 1NEZA 4OQ1A 4L3EA 2I5YL 4JQXA 1P2CB 1MFEH 3CVHA 2I9LA 4P5TC 1YY8A 4WJ5A 3LV3B 4HUUA 3PWUB 4NZRH 1DBBL 3CX2A 3U4EB 2Q7YA 3SKUD 4RIRB 3T0ED 1FYTE 4PV8B 4WFEE 2R1XB 1U8KA 1NMBH 5CZVH 4YHIA 3GBMH 3TNMA 5D7KE 5I74C 4B50A 1PY9A 4MD0B 4GO6B 3ZO0A 4ODVL 3AB0B 4PJDA 3VXOA 4N5EC 1U8MA 3B9KD 2QHRH 3S37X 3VWJC 3H9SD 1BZ9B 1AXTH 4NO0A 4H26B 4AT6B 3QXDA 3F5WA 5D2LA 1CL7I 4QF1A 3X11B 4PS4H 5JR1H 4WCYH 5L0QB 4YHNA 5H94A 4XPBH 3MRMA 3O6FB 5JPMB 3GGWB 1FPTH 1KLGB 4YR6B 4Y1AA 4G8GE 1KLUB 3SE8H 1N8ZA 3AFLA 2Z0BA 3ZDZE 3KR3L 3A6BH 2GJ6E 3W11D 2FEEL 1H15B 2Z92B 4YQXH 4N0FA 3M17B 5T1LB 2RBLA 3SY0B 3P4OA 1QSFD 5E94B <