4JO3L

Crystal structure of rabbit mab r20 fab in complex with v3 c-terminus of hiv-1 consensus b gp120
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
DIVMTQTPASVSAAVGGTVTINCQASETISNYLAWYQQKPGQPPKLLIYKASTLASGVSSRFKGSGSGTEYTLTISGVQCDDAATYYCQQGYSISDIDNSFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords monoclonal anti-HIV-1 gp120 V3 antibody R20 light chain
publication title Rabbit Anti-HIV-1 Monoclonal Antibodies Raised by Immunization Can Mimic the Antigen-Binding Modes of Antibodies Derived from HIV-1-Infected Humans.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 53
structure length 214
sequence length 214
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo3L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jo3L01
2X2YA 4E9LA 1E4WL 3FL7A 1KTKE 3VXUA 1HNGA 5DUML 4G8EA 4TRPH 1ZOXA 5JHDE 3S36H 2JIXB 3UPAA 1H15A 3DUUB 1T21B 3UBXA 2I60H 5D7SL 2NR6D 4Z77B 2H26B 5L0QB 3X14A 3SBWC 1S7TA 2QKIA 3MLTA 4WHTB 9CGTA 2VE6A 1H3GA 1JPTH 4PYGA 4S1SL 4ETQA 4TUJA 3C2AH 2CO6B 1M1SA 5F7MC 5CD3A 4GRMB 5D72H 2R0WH 1IM9D 5C0DB 4MB4A 5FV2A 2W0FB 2HJLA 2FHCA 5EBLA 5L6YH 3ZYZA 4OZIB 4LHQB 3QCVH 4IJ3C 1LO5A 2ED9A 3PJSA 3UP1A 5C0FB 3PP4H 3MRKA 4HIIB 3VFNA 3KPNA 3RUGF 5DJ6A 3BVNB 4G9FA 3MLVH 3ARSA 4F7PA 4U1SA 3H9HA 1F97A 3C60D 1A0QL 1T03L 3HAEB 2R0ZL 4M4PA 4G9DA 3E6HA 1UB5A 2C3HA 3RZCD 1KJ2H 2VLJA 3QXDA 1NL0L 3QQ4A 3EOYG 3WDIA 2AV1B 4MCYB 3ZKXB 4G43A 2ZUQC 4P57B 1NFDA 5HGBA 3W39A 3KPSE 3BGFB 5F7HA 4XCYA 4WO4B 5SV4A 2YPKA 2DI8A 2W1NA 1EPFA 4MXQC 4QYOA 5T5FL 3W9EB 3QUYD 5IJKA 4YXHL 2EYRA 4IJ3B 1KBGH 1EK3A 1AY1H 3R0NA 2YZ8A 4KDTA 5HHOE 1W0VA 3KYKL 3HNTH 1HH6A 3R4DA 2P8LA 4HWBH 4OGXL 2IBZX 4S11A 3TZVB 2VL5A 5LKNA 1WSST 3MX0A 1QLFA 3RY6A 1F3RB 1RVFH 4PJEB 3U36A 4HFUL 4GH7B 4OF5A 1OAXL 1KPUA 4UDTA 2LU4A 5E03A 3ARDC 2CK2A 2DMKA 4AY0A 4XBPB 4HBCL 4MQ7A 4ODBD 1T0MA 4H20L 1F4WH 5KJRL 3WXVH 5TDOB 3SE3A 1N2RA 1ZHKA 2CLVA 5E4EC 1CLCA 1NCWH 5AG9A 3O2WH 4QRRD 3JWDC 3MV8B 3S34L 4L9DA 4PIRF 2EXYC 3OB0H 4YHZH 4AT6A 4NQTA 4J8RB 5IVXB 3UX9B 4P5TA 5ANMA 5JOPE 3VXUB 2OBGA 4UT7L 4M93B 4G8EB 2XQBL 2V7NB 4DGYL 5CCKH 3UXFA 1MCRA 4FMFA 3N1MC 4QRSA 2HMID 4K71B 1FO0B 3VFTA 1QBLL 4MD4A 5BRZD 3MJGX 3UBXB 4GKNB 4OB5H 4X6FA 5I8CA 1B90A 1NCDH 4LHUD 4HKJA 5E8PA 2XNAA 3CXHK 3QEQA 3JV6A 4GBXC 2QQNH 2QKIB 2BX5A 2ED8A 4JO3H 2UYLA 2VE6B 5DQJB 2CR3A 5SX5K 1NMBH 1R3JA 2ZNXA 4ETQB 3TPUB 2NNAB 3CVHH 4G6AC 2YPLB 1PKQE 4UB0H 4BA8A 3U7YH 3CX5J 3L5HA 5D5ME 4PJCE 5C0ND 2EDBA 3DHMA 1WAAF 3SDCC 4X4ZA 3VG9C 1F3JA 4V1DE 3L9RB 2E6PA 2JCCF 3C6LC 5EBLB 1MF2L 1RIHL 1MFEL 3FN0H 3I3BA 5C1MB 4BH7A 1GGBL 2C26A 4XNMB 2VQ1A 4B41A 2VXUH 3MLYH 4QCIB 1WVZA 1LE9A 3MRKB 2D4DA 3FQRB 1L7IH 4P2RA 3HB3C 3KPNB 3LKSA 4NKDA 4LASH 4ZOBA 2H2SC 1QFWM 2DM7A 4OI8A 4FQIH 3VFWA 4U1SB 2DD8L 2I9LB 2J5LC 1UZ6E 4JFFA 5HY9B 4XPTL 4AJ0A 5MHSD 2VLRE 3DVFA 2R23B 2ZCKH 4JFYB 4HJ0D 4G7VH 3LKRA 4GBXB 3QQ4B 2ZNWA 2DIAA 1QSZA 1GZQA 3NPSC 5JXEA 4OLWL 4ZO6A 1OHQA 1L6ZA 3GBNH 4OKVA 4NN5C 3NMEA 4LF3B 4OIIL 4CMMB 1MFBL 1RIUL 5LBSH 2J8UA 2YPKB 1T5WA 4TQEL 2EDXA 2VIRA 4QYOB 1DTUA 4XX1E 3C6LB 3VG0H 3QXAA 1EZVY 4XAKD 3WFCL 3U0TA 5FO9B 4H1LA 4PRBB 3P4NA 4R90H 3EYSH 3WUZA 3F7YA 5CP3H 4HX1A 4XC1L 3ULVL 4NN7C 3QWRA 1JWSB 1XGUB 4LVOC 3KYAA 3VXME 1GC1C 1QLFB 4Y16C 3A6BH 5AYUH 1MCBA 3KNBA 1H5BA 4BFGA 1QHOA 1R5WB 2CR6A 4PRIA 4XWOD 1BD2D 4U1MB 3TBWA 1OTTC 2IADA 1TLKA 1BQLH 4PB9L 2YSSA 4QHMA 3RTQC 1W0WA 2DF3A 2VN7A 4PJGE 1GIGH 1KCSH 4GUPB 3EYVB 4NFDA 2VYRE 3MRPA 4ONOA 5C07D 2OQJB 2OL3H 1CYGA 3CDCA 2FIKB 2ICEB 1E4XI 1B3JA 1Q9KA 4JLRB 4P5TB 3IDGA 1T7VA 2MSPA 5JHDA 4LSSH 4DK3A 3MXVH 1ZVHA 4M6ML 4JZNA 1CGWA 1IILE 3BGMA 3I2CL 4QRSB 2QR0B 2ARJQ 3VFTB 4HIHA 4CNIB 1G0YR 4X6FB 5JHLH 5SV3A 4KUCD 2VDKH 4P23A 4HKJB 3C87A 4OD2A 3QEQB 3JV6B 5HD8D 4ZAKB 4XCCL 3LRSB 4XVSH 4PG2A 4N9OB 4NFCA 5EWIH 2PTUA 4NDMA 1I7TA 1BAFH 1B0RA 5DZLA 4H8WH 43C9B 2OTPA 3WDHA 3TJHC 4R96B 1HCVA 5ETUB 4Y4HA 1IZKA 4XNYH 3MLWH 4JE4B 5DJAB 1F3JB 5IWLC 1QFUH 1T66C 2BHUA 3C09B 1I1RA 5HI4D 4ELMF 2DIBA 1I8IA 4RDQF 4R8WL 4C83A 4W81A 4KV5E 5LG1A 1B4RA 1QSEB 3P9LB 2Y5EA 2CIIA 5KSUA 2GSIA 3VFWB 2VDQL 1X5XA 4JFFB 1KTLB 5CZVH 3R1GL 1CXHA 1U8PA 1VDGA 5D1ZB 2XT1B 4NO2A 3DX6A 4JDVB 1NBZB 1CBVL 1BP3B 4HKXB 4O5LL 4QT5A 5CZKA 1TZIB 5DRWA 5IT2L 4EZMA 5CJ8A 3KPSA 4ZOCA 5FGCB 5IIEA 1NFKA 5MEQA 1WZ1H 2P5WE 3VXSB 3HA0A 2J8UB 2F58L 2PYED 2VIRB 4YX2L 4S1RH 3NN8B 1BBJA 1PG7W 4BSJA 2F54B 4G5ZH 1F5WA 1A47A 4H1LB 4Z7OE 5MEPA 1Z9OA 3QRGL 3OWEA 3OG6B 3TA3C 3F7YB 2WWMC 4RGMC 4HX1B 5CMAB 1MLCA 5DJYA 4WCYH 5DQDL 4FZEL 2ADFL 2HLFC 3BI9X 2DL2A 5MI0B 3P2TA 4NYLB 5H37G 5IROA 5I1AA 1KB9K 4P2QB 3AAZA 1P7KB 3F6LA 5I1JL 4KKBD 4XB7A 5ISZB 5D8JH 1OSPL 2Z31C 4JFXA 2NY4D 1BZ9B 5E08L 2YSSB 4JFDB 3IF1B 4QHMB 4D0CB 1GOHA 4DWHA 3C5ZA 3CPLB 3RWIB 1U42A 2APFA 1T04B 5IB2A 4PUBH 4Z7VF 3L5WA 2A9NH 3LPGA 1OQOA 2NYYD 4P2OC 3JUZA 3MRPB 4AQOA 4PJ5B 4IRZL 3BPNB 5FYLD 1A64A 2O5YH 1G84A 3TBTB 2R0LH 2X9XA 4YEFA 4TSBL 4R97B 1A2YB 2ZCLH 3JV4B 4TSCH 2I07A 5CUSL 1F02I 4MCZA 1MSPA 1UCTA 4C4KT 3S4SG 2J6EL 3VI4F 2D7QA 1H8SA 4HUUB 5J1TC 4NQEE 4HIHB 1UEYA 3L3GA 3X12A 4XCFL 1CDIA 4FQCL 5IR1B 1NCAH 3CFIC 4CN6A 2OZ4L 1GGIL 3MNVA 2MWCA 1LO4H 3EDEA 3O6FA 2H45A 5I1DA 5JW5A 2VKWA 4NZTL 1PKQA 2Z31B 1MRFH 3SQBA 4NDMB 4JZJC 5D5MA 5JDSA 4LNRA 3IXTA 3OAYH 3LKOB 3OV6A 2PETA 4M7LH 5TPWH 4HK3J 1RUAL 3HE6A 1T20A 4F57L 5E9DE 4TVPH 1GCFA 5DDHB 2AERT 2RIKA 4P2OB 2V7HB 5FEBA 2P45B 5BV7C 2F19L 3BXNB 1UYWL 3SDAB 3IVKA 1IC1A 4ORZC 1AC0A 3VFUB 3GKZA 3VH8B 3ZE1E 1U8LA 1A4KA 1ADQH 1XFPA 4Q6IA 5D96C 4M3JA 3P0YL 3MRCB 5KSUB 4R0LB 4HUXA 2GSIB 5EU6D 4YHKH 1T5XA 4JRYD 5EBWA 5E8DH 4QRPD 2ZJSL 2EE3A 2VLRA 4WI2A 1DQMH 1HQRA 1HXYA 5EZOH 2IFFL 1K4DA 3SQOL 3P0VH 3CFEA 1A3LL 4ODVL 1BFVL 1JUFA 4JHWH 2F5BH 2J6EA 3ARUA 4QT5B 5DRWB 3OKOA 1ZT7B 2F5AL 3C8DA 1KOAA 5IIEB 3ARBD 2DBLH 4MDIB 5MEQB 1IGFL 5T1KD 4RAVB 1IFHH 3QUML 2OZ4A 3SJVB 4RRPA 2VXTH 1RZKL 4O9HL 4EOWH 5FXCH 1JCKA 1BBJB 4U7MA 3O4LE 1WICA 6FABH 5AZ2H 5HYSB 2FBOJ 1PZ5A 2XPGA 3FQUA 3QFJD 5MEPB 3QEUA 3W5NA 1EDQA 4P0DA 1I3GH 4EN3B 5DJYB 5L9DL 4NQUA 4LKCA 1CXFA 1NQBA 1R3LA 3HC4L 5IFHH 1I9JL 1PSKH 5TDNA 3S88H 3KPLA 1OD9A 4IRSD 3QI9D 4MAYC 2B1HL 3CAFA 1LO2L 4HZAA 3T8XA 1UKSA 4LIQL 1QYGH 4WW2F 4FQXB 2BVEA 1ZTXH 5FK9A 1YEEH 3MMEA 1IAKA 3H9SE 1JRHI 2BNQE 4P4KA 1G0XA 4HS3A 1E4WH 3BRDA 5DUMH 1IM3B 1D5IH 2OR9H 4MA8L 4PJBF 3L5WB 4U3XA 1IKFH 4ODXA 3U7WL 1BVKA 4PB0L 2AJXL 4XWGH 4EUPA 4KUCF 3QH3A 2X5PA 4JDZB 4PJ9A 1MJJB 3LZFL 1RK0A 3RL2B 3QO1B 4KZEL 3QUMA 1R24A 4X9FA 4WWKB 1QPXA 2H41A 5I76A 3MGTA 4S1SH 3L3DB 4HG4K 2VO5A 4Q9RL 4PD4K 1VGKB 4X7SH 4X6DF 4X4YA 3K0WA 4JFHE 2BNRD 4LCIH 3H8NA 5JW5B 3O6FB 3DROB 3ILPB 4QWWC 1H3UA 3ISWA 3FQXB 1D9KD 2ZOLB 1NMCC 4RSVA 4IBLT 3FFCA 5FOBA 3MC0A 2JB5L 3KLSA 2GJJA 2FHFA 1T20B 1OD7A 4POZC 4JQXC 4RAUB 4EEEA 3ULUD 4MNQE 1TQCC 4HWZA 1Y6NR 5I8EA 1A0QH 3BGAA 1T03H 5EA0L 1IBGL 4XBGA 1YC8A 4XH2A 3QUZC 4O2EB 1NEUA 1A4KB 5JZ7C 3A0OA 1NFIA 3EYQD 1LDSA 1T5XB 5EBWB 3WXWH 1HHGB 4HUWB 4Y89A 2AAVA 1HQRB 1PEWA 1M71B 3HC0A 1K4DB 1QFOA 3ARVA 3KXFE 3RZWA 3DUSB 4M1DL 5T5FH 3OKOB 4YXHH 1SMOA 4WGVB 3B9KC 5IM7B 2VL4A 4YEEA 4K7PY 3RWFA 5ITBH 1J05A 3L3JA 1V05A 1XR9B 5F7LB 5ADOL 5JORA 3V4PL 1LEGA 3L3HA 2IBBA 3UJIL 4ZUSA 3KYKH 3V9FA 4K9EL 3WFZA 2JCCA 3LKPB 3RGVA 4UBDD 2XKUA 1FNEA 4I0PA 5HHOD 1TQCB 4YXKL 1PEZA 2FD6L 4HFUH 5INDA 3NCBB 1OAXH 3FQUB 2XPGB 3HNSL 1EBPA 3KPMA 3QEUB 4JEGB 3RUGB 3O45A 2FO1A 3HI1B 4NQDE 3S4SA 3HMXL 4PRHB 3L6FB 2UUDH 5TDNB 4UOW1 5B38B 3F12B 5CEZE 3MNZA 1RZJC 5D1QA 4H20H 5KJRH 2LAAA 2V9QA 3KYNA 3T8XB 1A1OB 4JVPA 2EDHA 1S7XA 3U82B 1PFCA 3MJ9H 4Z7QE 3S34H 5IMLB 4O00A 2LE9A 3O8XD 3V6OE 1M7XA 1GPOL 1IKNA 2PUQT 1JFQL 4APQA 3PDDA 1RFDL 2KPNA 4UT7H 1TXKA 2XQBH 5TDPA 2ICES 4MJ4A 1JWMA 1L9MA 4JRWA 4ODXB 4NO5A 1ZXQA 3QH3B 5D70L 2YWZA 4I18A 5JOPD 4YFLI 1FE8L 4D94A 1C7SA 2HWZL 4NZDA 3EYUH 4QTHA 4R6UA 2V2XA 1R3HB 5DJDA 3OL2A 3RIAF 3U4AA 3DGGA 5GJTL 3RFZC 3MGTB 4XNQB 1SEBA 2R39A 3VDBA 3QFDA 3CLFL 1MRCL 1JF5A 3LY6A 4X4YB 5GRYA 2ERJC 4N8PA 2BY3A 2EEAA 3CIQA 1UH2A 3HMXA 1MF2H 1RIHH 1MFEH 1UVQA 3QQ9C 4OIAA 1GGBH 4JQVA 3T0EC 1VFBA 3PHSA 5C8JA 1KSRA 3L7FA 3RI5F 3FFCB 4V1DD 2GK2A 1Q9WB 2CLZA 4Y5YC 1ACZA 4MD0B 1JNJA 4IRJD 2DLHA 2DD8H 2W07A 1RMFL 4DUWA 1OB1A 1UQSA 1ORQA 4W6WB 4XPTH 3JVGA 4UIKL 3Q6GH 4PRPB 4XH2B 2V9TA 1LD9B 3UTTE 1BJ8A 1HQ4A 1CXLA 4GRWF 3FT2B 4OLWH 1GGCL 3OHXB 3QIWA 5ALCH 4NKQB 3PWLA 4UQ3A 4KGLA 4XPGL 1MFBH 2XZQH 1RIUH 1VFOA 3IDUA 3SPVB 3RWGA 4BK5A 3ZTNH 1SJXA 1GAFL 3K4AA 3MSPA 4ZG1A 1K8DA 1YUHA 2R1XA 3WNNA 4BQ9A 5IESL 1W72H 5FKPA 4LEXH 1AO7E 3MRBA 1LEGB 2AP2A 1PD6A 4XC1H 4NN6C 1N26A 3TBSA 2JCCB 3MJ8A 3DX7A 3O4LA 4PRDA 3RGVB 4FP8H 1FNEB 1XF4A 4ENED 3P0GB 4JDTL 3WN5B 4N5EC 1D5ZB 3KLAA 2A6JB 3BHBA 2MOVA 2OJZL 4PB9H 1TJHL 3MNZB 4PS4L 5HI5D 3HE7C 1KTDB 3KYNB 3TO4C 4F9LA 1T83A 3X11A 4U6HA 3LKQB 2FB4H 1SMAA 3H9SA 3LV3B 3LIZL 3QNYA 2Q3ZA 2A74B 3BP5B 3G6JE 4P59L 1JF1A 1T2XA 2VN4A 5E8OB 2W9EH 3EFFB 4M6MH 2OCFD 5HDBE 5TDPB 4FQHA 1JWMB 3I2CH 4NN6B 2NR6C 2AGJL 2I5YL 4X4XA 5DK0A 4P4RA 4NO5B 3F6IA 4D0DA 4I18B 4JREB 4X4MA 4XCEB 3BPLC 1FYTA 4KQ4H 4F37K 5CLTA 3S7GA 5F3HB 2Z92A 1NGXB 1WWAX 2GIYA 1M6OA 2APTA 5DJDB 3FKUS 5JDJA 4U1KA 4XCCH 1WT5C 4OZHE 3CSYB 3ARFC 1MUJA 1OCWH 3TH2T 5IF0A 2D4FA 3D39D 4R3SB 1BJ1J 3HN3A 4PJDE 2JELL 4MQTB 3HE7B 1U8OB 3B8SA 2P5EE 3ULUF 1UZ8A 3VRLE 2Z8SA 3LD8B 5EC2A 3UJJL 4LPTA 4ZXBA 4J23A 1VHPA 3EHBD 5C8JB 4R8WH 2IBGA 4LVHB 2QQKL 5F7EL 1RHFA 3VRIA 3GHBH 4OZFG 3JWOC 4M6OL 2VDQH 4JY5L 1UQSB 3RZCC 4N0UE 5F6IC 3R1GH 3DO7A 2N7AA 5I9QC 1RUKL 1UH4A 3B83A 2X4SA 4RGND 1HQ4B 3MLUL 3P30L 1P84J 4O5LH 3GBML 1S7SA 2VUOA 2X41A 2NY2C 4GRLC 3ARED 3WCYA 3KXFA 3O6LL 3WE6B 3PWLB 4MX7B 3QUYC 4UQ2B 4X5XA 3QZWB 3RWGB 2APBA 5GRVK 3WUWG 4L8CA 5C7XL 4UAOC 2P5WD 4YX2H 2FCBA 4HMEA 1KFAL 1YUHB 3N1PC 4UI2A 2R1XB 1S9XA 2HRPL 3QRGH 3N85H 1DBAL 5D7JA 4H8WC 3C60B 1I8KA 4RBPH 3RVXD 4FZEH 1KYOJ 3MJ8B 3TBSB 3HPJB 3DX7B 3MLRH 1JE6A 4HMDA 2M8XA 4FTVD 2ADFH 4ZO9A 4Z8FL 1XF4B 5F6IB 2P7TA 1FVDA 3QDME 3BP6A 4UU9B 2R56L 5CINH 1U92A 5JO5A 5I1JH 2VLLA 1LEIA 3D3VA 4PJXF 4WHYH 1OSPH 2V17L 1HHIB 5FUCE 4XMKL 4GAGL 5GRZA 4POYA 3B2UD 5E08H 3I9GL 2G2RB 1FFPB 2AW2A 3MRQB 5ICZA 2BSTB 3QB7C 3QUYB 2AXGB 4OGYL 2V5MA 3VXRE 2KDGA 4XXCC 5FM4A 4IRZH 1AGFB 2Z9TA 2X4PA 4W4OA 5DJ8B 4TSBH 3WHE1 2YUXA 3CUPB 3NGBC 3EO1B 3MO1A 1P6FA 2HMIC 4FNLL 5CUSH 1LP9E 4ZOEA 3SKOA 4X4XB 5DK0B 3LCYA 2X70A 3F8UB 4LSVH 3EAKA 1FVCA 4HKZA 3RIFF 4XCFH 4X6BB 3OAUL 4FQCH 1FC1A 1FYTB 1BD2A 4D9QE 4AEFA 1GGIH 2Z92B 5BW7C 4EJ1C 4U1KB 1IQDA 3MR9B 4PJCF 3D0LB 2QJDA 2BVTA 2J4WL 4CMHC 1FG2B 1A7RH 4NZTH 5DHYB 1MUJB 5IF0B 1CLOH 4FQ2H 3S35H 5C0NC 1NEZA 1M05A 1J0HA 1JPST 4NUGL 2ADIA 4RFEA 1EA9C 4FQPA 4HJGB 3MLXH 4QRRB 4WW2A 1RUAH 4F57H 4ZXBB 4HIEA 3H3KA 2GW5A 1NUDA 1O0VA 3O3AB 3GDBA 5EUOE 3SCMD 5DXWA 1UYWH 4NQVA 1ZHLB 2IPKA 5DQ9A 3OMZA 5E9DD 2GJ6E 5F9OH 1BQHG 1I1FB 4OIBA 4PJBA 4IEFB 3VRIB 3P0YH 3U4EB 5BRZB 4Z7VB 4MJ2A 1LK2A 3KPTA 1JGDA 4K3EH 2ZJSH 4LHUB 5EPMB 4HJ0C 4XHQA 2YXMA 1INQA 5T5NG 3RWHB 3OB0K 1KENL 2G5BB 3SQOH 3VWKA 3DO7B 5HI3D 4ODVH 5EULV 1YYLL 1Z9MA 1BFVH 4PJ8A 3P4OA 2R4SL 3DGCR 1YJDC 4KAQL 4EUPH 4QY8A 4LSPL 4LVNB 2ZKHH 1CICD 4LLDA 5IHBA 5J6HB 3FOLB 4S1DC 3QUMH 4Z0XA 3MJ7A 4NO3A 3U9PH 4JKKA 4MXWL 1RZKH 3B9EA 4O9HH 5GS1C 4NC0B 4L8CB 3F58L 4OZ4A 1JHTB 1CFTA 5F9AC 1GJIA 1UKQA 2JKXA 5L9DH 3HC4H 1DQDL 1I9JH 1OTUD 4M03A 3PGCA 2CXKA 2B1HH 1TTUA 1LO2H 2P7TB 2RQ8A 4LIQH 4J3OC 1MIML 1U92B 1HK6A 1I1AA 3U7AA 4XZUB 3D3VB 1KF9B 4PJGF 4NT6A 2CK0L 4NQCD 1JMXA 4R7NA 5DEFB 3TBYA 1RI8A 5EU3A 1TZGH 1XR8B 1XF3A 4PBXA 5ICZB 5C2UB 1EX0A 4MA8H 3OKMA 5HYEA 2VLKE 2BNQD 3KPRA 1VGEL 3CZJA 3NFNA 2NPLX 4YHLL 3U7WH 1AP2B 2AJXH 3EYFA 4PB0H 4G8GA 5E2VL 3U6RA 3NIFE 3TIEA 2PCPB 1IEAB 2X4PB 3LZFH 2DLIA 2QBWA 4KZEH 1KELL 4I5BA 3MO1B 4B50A 2EE6A 2KBGA 4HT1H 4NWUL 4MD5A 3BKCH 2PO6A 3WV0A 3FTGA 2BXYA 5HD8C 1C7TA 3BT2H 2DQFB 1BD2B 3T3ME 3X17A 3BP7B 4IIQC 3BZEB 1KIPB 5F7WC 4MJIE 4PJDA 3S5LA 3BD5A 1MIEH 3MQIA 2PF6A 1NEZB 1QSFE 4XXDB 4RFEB 4HDIA 2JB5H 3K3QA 1J86A 1MCQA 1V3KA 4WW2B 4B7LA 2G9HB 5C07B 1T1ZA 3KG5A 2EYSA 2Y72A 1OW0C 3ARRA 4RISH 1C8PA 5DD0L 1Y6KR 4LPUA 2VZ3A 4MJ5B 3QJHA 5D2LE 1IBGH 4FXLA 2IPKB 5DQ9B 4KJYB 4JVWA 5HHPA 2X4RB 4MNQD 5GGSY 3MUZ1 1G7LB 1U93A 3CXHJ 2A0LD 1FVEB 4PJBB 3AXLB 4MSWA 3IJHB 3JXAA 4N0UA 1LK2B 1JGDB 2CIKA 1KN4L 2UZXB 5FDYA 3VA2C 1INQB 3GMOA 3IJYA 4L4TA 2Y9RT 5L88L 1MCDA 4OUUA 3MLPA 4K94C 2D0HA 1MCWM 8FABB 3JV5A 4PGEB 4XP4L 3OR6A 3J8F7 3O2DL 4I1NB 3NIGF 3RWCB 2WBJD 3MJ6A 1FC2D 2MMXA 4Z0XB 3KPQB 3V4PH 3UJIH 4NBXB 3IU3A 4X6DB 4K9EH 4Z7OF 4TN9A 2J7LA 2VITA 2VC2L 3GMRB 1Q9OB 4YDVB 2GAZB 4YXKH 5GJSL 4OZ4B 3HTLX 1GL4B 1CFTB 2FD6H 2FX7L 5AAMA 2HYMA 3HNSH 3FQNA 1JPFB 4Z7NE 3EOAB 1CD9B 5F7KC 3RY6C 3HMXH 5T33L 1XF5A 5L8JB 3QDMA 1P7QD 5C92A 1AI1L 2FNBA 4NQDD 4KKBC 2GFBB 2X4UA 2FRGP 2NY4C 3AS0A 3V4UL 5CEZD 4X6EB 4CAGA 1CD0A 1GPOH 1REIA 2ICWI 2Y6SC 3VW3L 5B4MD 2NY7L 1XH3A 4LPCA 1JFQH 3QG6A 5D2NE 5ACZA 4WTXA 4XNXL 1UWXK 2A73A 3WFEH 1RFDH 4L9LA 4RAHA 1NCUA 3KPRB 3WLBB 4KU1A 3QULA 3NFNB 5IFAL 3AFLA 1I7ZB 5AD0A 1A02N 1CFBA 2ZG3A 1H8NA 2RB8A 1RAMA 4O51A 2MFNA 4QNPF 3O2DA 4Y4FD 5D70H 1X4XA 2DTSA 3M17A 3L1OH 4ZNCD 3FB5A 2HWZH 1FL6B 3PWUB 1BQHA 2W9DL 4I5BB 4LPXA 1JGEA 3V5HB 4HULB 2DL9A 2CKBB 3ZHDA 5HDQL 1BM3L 1N59A 5GJTH 1T1YA 5C0BE 3VD3A 3D9AL 4MD5B 1MRDL 1FRGL 4ZFZA 5DUBB 2F53E 5B21A 3FTGB 3TPKA 4POUB 1EAPA 3CLFH 5HXMA 1MRCH 3ULUL 5CBAA 4XCNB 5C6PB 2J8HA 3BZFB 3GK8L 1TVBA 2E9WA 2WBKA 1S5IL 4IS6A 4ESKA 4ZS6D 5EC1B 2O26U 2EC9T 3EKCA 1VEPA 5IQ9A 4LARL 1EO7A 4QXWA 3VFRB 1JI1A 1RMFH 4EKXA 4KVNL 3QJHB 4PJ7F 2FZ3B 4UIKH 2HN7A 2H6PA 1S9WB 4WUUA 4PLJD 4KK8C 2DLFH 2EKSA 1U93B 5DJCB 4MSWB 3AU1B 3JV0A 3V0AC 1FLRL 3JWNC 4PPTA 3UTTD 1GGCH 1XEDA 4QHKI 1VFUA 1HHKB 2JJSC 4PGDA 4QHNA 4ZDHA 4PREA 3U0PA 4L4TB 4XPGH 1YEGH 4HAFA 5JXEC 5I0ZA 1FNHA 1T3FA 4OUUB 5JIPA 4H5SA 5IB5B 1FIGL 3D87B 4Z7UE 1GAFH 2HT4C 2ZSVB 4L8DA 5J89A 2ZG2A 3OR6B 5I75C 1HYSD 3EW3B 4X7CC 3MBXH 3MRFB 3SO3C 4WW1A 5IESH 2Q6WA 1G6RL 1I4FB 1Y0LA 3IU3B 4ZTOL 2VITB 3MRMB 4PY8I 1AKJA 3MA7A 4PJFF 4AG4H 1JTTA 5H94A 1AO7D 4M00A 2H3NA 1PLGH 4JDTH 1T89C 2UVFA 5EU6B 1I9RL 3FQNB 3NTCL 4JRYB 3VXOA 3CU7A 3OAYK 4IRSC 3QI9C 1F4XH 1XF5B 4F3FA 1F2QA 2OJZH 4YK4B 5DMJB 3D6GA 5EU7E 4PS4H 1YNKL 4RCAA 4LNVA 5TE6L 3LIZH 2FECL 2N7BA 2BMKA 3K8LA 1CLYL 2YN3A 5FYJD 3TN0D 3ARBB 3SDXE 3OX8A 3NFPA 4OLUL 5T1KB 4P59H 1KEGH 4NJ9L 5EO1A 5I75B 1DLFH 1FGNH 1BLNB 5ACZB 5E8EB 4Q2ZB 4RGOL 3DTXA 4FFVC 1YPZF 2A73B 4L9LB 1X6NA 3MYZA 3SGKA 2Z91B 1UACL 1I85A 2XYCA 3QULB 3OKLA 2VERN 1P4LA 2AGJH 2I5YH 3BISA 4I13B 1OARL 5AD0B 4WV1C 3BSZH 1F11A 2VAAA 2IGFL 1G9MC 4LBEB 5MERB 3M17B 3QFJB 1QLEL 5AG8A 4Z95L 3FB5B 5CJ5A 4U1GB 5JNYA 1JGEB 5I66B 1G6RA 3EGSA 4Y8AA 4WU7A 4IRSB 3CFJB 2FX8L 3QI9B 3REWA 1T1YB 4P23C 2E27L 4K07A 3MRNA 1SBSL 4CJ0A 1YZZA 2JELH 4KJPC 5JPNB 4PG2C 1L7TL 2RJMA 1KJVA 2EDNA 2WV3A 4M48L 2YKLL 4LLUB 1ZT1B 1U8IA 1AE6L 1ZA3A 2Z8RA 4KDVA 1N0LA 1D9KC 1EIBA 3UJJH 4PJXA 1QSFA 1KLGA 1MAKA 1TVBB 4Y4HC 1JMZA 4BK4A 4O02L 2P5ED 4OFPA 4XI5D 4GW5A 3ALWA 1F4HA 4IS6B 3CD4A 5ID1B 1G7MA 2QQKH 1R3IL 3LQZA 4CU7A 4M6OH 1FH5L 5D2LA 4JY5H 43CAA 4TTGA 1B2WL 4KRLB 5CGTA 4NNPL 3KAAA 3DETD 4D9LH 2CDEA 2ZSWA 2J12B 1OM3L 5FUZH 4ZYKA 3EJYC 3EYQC 1ZS8B 2H6PB 1F45A 3FRUB 1RUKH 3UZQA 5IW3A 2DLTA 3P30H 3MLUH 1VKXB 3FZUC 3DARA 3IETA 3RVVD 2SEBB 3OZ9L 2X10A 4KY1L 3M8OL 2H2PC 3O6LH 4ZDHB 4F7TA 2BNRB 2HKFL 3U0PB 4NQXA 3O6KL 1T3FB 3DRTB 1LK3H 1D9KB 1FFNA 2YXFA 1QZ1A 4H5SB 3RVWC 5C7XH 4Y7MA 4QHUB 3V5DA 4YZFF 3V4VL 1A7BA 1KFAH 1SM3H 3VFOB 5IV2A 3DBXA 3B5HA 5DUPL 2CGRL 1OPGH 3E3QE 2H9GB 4HHAA 3IFNH 5ELIA 5C0JB 2HRPH 5DK2B 3MBED 4PJIE 4ZQKA 2XN9E 2OXHA 1Y0LB 1NUFA 4UBDC 4I9WE 1DBAH 1YYML 1TZHA 3BUTA 3E6FB 1AKJB 5F96L 3MA7B 1BJMA 1BX2A 3Q0HA 5HPMA 1DUZA 2K9UA 5E1HB 1JYWA 1RIVH 2R56H 3PQYE 1A8JH 4LPWA 5E8NA 5BVJB 3L5JA 3VXOB 2DQCL 2H32A 32C2A 4QOKA 5DJXB 3KLHD 1T7YA 3PL6D 1R5IA 5T3XE 2V17H 4Q9QL 3SY0A 1CL7L 3A67L 3A6CL 4GAGH 4JJHA 4XMKH 5BVPH 3I9GH 4JO1H 3BIAX 3V7AE 2DWEA 3QWOA 1DDHA 5CJBA 2XTJE 3ALXA 1KN2L 4OQ1A 2AI0H 2M1KA 3NCMA 4P5KA 4R4BA 4GKZA 1ND0A 4HLZG 1LE5A 3C5ZC 4ACPA 4XVTH 3V0WL 3BKJL 3MV11 1WZMA 4XP1L 4JM2D 3VXRD 1FZMB 1A6VH 4QRQB 1BJ1H 3DTXB 4FNLH 1S5HB 3E2HB 1UJ3A 1MAML 4YPGB 2X9WA 5D4QA 2BSRA 4U2YA 2EDQA 2IAND 3BDBA 1S7RB 1F11B 2VAAB 1FORH 4Z18A 4G7YL 3OAUH 1UXSB 4XB8A 2NZ9D 2WNGA 3QNXB 1G6RB 5GRXG 4LLWB 1FAIL 3PXJA 5J1AA 4WU7B 4M7ZC 2J4WH 1P4BH 1VCAA 4D9QD 4ZFOA 3PDGA 3V7AG 4NUGH 3RVUC 1CG9B 5SWZD 1X3DA 4NJAH 1TETL 3G5ZA 1FYHB 1ZA3B 3MTRA 3O8XB 1ES0B 4PJXB 3VFGL 2UWEA 2YMXL 1GZPA 4EIZC 2W59A 1IEBA 5JW4Q 4PG9A 4UV4L 1CK0L 4GW5B 1QQDA 2UUDK 4JN1L 4IRJC 2F8VA 4AH2A 1XF1A 3V6FB 3LQZB 4DKAA 1JHLL 3TNMA 4CADB 1B0WA 5A2FA 3QO0A 3OKEA 5CKAA 3KJ4B 2GJ6D 4Q6IC 4BKLA 4HG4J 4LEOA 1U8NA 1V7NL 2B4CC 1P2CA 1YYLH 2O61A 3MOBL 3QDGD 2XXMB 2R4SH 4KAQH 4U1HB 1AQKH 4LSPH 2X4OA 1Z3GH 5JPMA 2GTWA 3D5OF 4GG6F 4FQQA 4MXWH 4NQXB 4Z7UA 3GM8A 1K2DB 1QFPA 2X42A 4KJQD 5FDWB 4CW1B 4E5XA 2BSSB 1AD9B 3DV4B 4FQ1L 2F8XC 1JNHA 3V5DB 3F58H 5FCUL 4XNZC 5IV2B 3AB0C 3ZKMD 1I9EA 1S3KL 4HHAB 1EUTA 4A2MA 1QRNE 4ZQKB 5L8LB 4QO1A 2A6IB 4ENEC 4NNYA 2Z35B 1DQDH 1JPGB 3T65A 5HPMB 2HJFA 4AM0A 1JK8A 3WIIL 4LLMB 1MIMH 3KWWB 1C5BH 1EFXD 1EBAA 5E8NB 1BFOB 32C2B 1NGYA 2ESVE 1R5IB 4OZGE 3QUXA 1LO3L 1BEYL 5C08E 2EO1A 3MA9L 1U8QB 5DJ0B 5I1CL 3FCTB 1FL3A 2FR4B 1DDHB 1NBQA 1HHJA 4R4BB 2ATPA 1VGEH 2NX5A 4YHLH 3UZEA 4GKZB 5CIPB 2YUWA 1MJUH 3P9MA 2VLKD 3OKKA 1A6AB 4XNZB 1J12A 1KELH 1D6VH 1HKLH 5DJ2A 1Z2KA 3ES6A 3S96B 4YR6A 3TVMA 5FIEA 1MI5D 1UJ3B 5EZLA 2HVJA 1P1ZB 2O5ZL 2BSRB 4NWUH 2CDGA 5ALBH 5CSGA 5F6HI 3MREB 3QDJD 4PRAB 4TULL 3O41A 2VRAA 2XA8H 5EOQL 2O5XH 4JRXE 2Q8AL 1X5HA 4OFKA 4NHCH 3STBA 5C09E 3BMWA 1DEEA 2DJUA 2YUZA 2YC1A 4MQXD 1G7HA 1OAZH 1CFVL 3I02A 4NM4L 4XHJD 1U91A 5DEGB 5F7DB 3BPOB 4MJID 1KCUL 4JFOA 3G5ZB 3SE9L 2P44B 5GGQL 4H88L 5DD0H 3ARWA 5HHQA 1BPVA 2UWEB 2APXA 1IEBB 3MRGB 5DVKA 1IC4L 1QQDB 1FBIH 4N1EA 3I6KA 1J8HD 5C86A 5DVMA 3WL9A 4AH2B 5HPOA 1X5ZA 1FNFA 2W60A 3L3OB 2BVUA 3QO0B 1KN4H 4BKLB 3QCUL 1FZOB 2AJ3A 3ZE2E 2VSCA 1U8NB 3B6SB 1HINH 1N7MH 3D1MC 3D39B 3AREC 5L7XH 4XP4H 1OSZA 3DSFL 5JPMB 5DJZA 1AGEB 2HTKD 4HF5L 1NC4D 1AIFB 4PJHE 1KT2A 3GKWL 3QWQB 4JFPA 1IGCL 4NHUB 4DCQB 4KQ3L 2VC2H 4W68A 1JNHB 4JFQA 4M1GL 5D1XA 4IOIA 4EVNB 2DYPA 1KIQB 2YHGA 5D7LD 5GJSH 2E9IA 4NKOB 1HH9A 5JMOC 1RJLA 2FX7H 1E4KA 2K3TA 3RVXC 1FIEA 5FUOL 1PX3A 5T33H 2ZWLT 3D69B 4NNYB 3QUKA 1RZFH 3ZE0E 3WO4B 3PQYA 4PJ7A 1AI1H 3PWNB 5IQ7L 4KK9C 1PG7X 3QIBA 4RGNB 5I16B 3T2NL 3TO2A 3V4UH 4HMCA 5D1QC 2NLJA 5EZJA 3B2UC 1FNGA 2LQRA 4Y1AD 2Y5TA 3AREB 5HTSA 4OBRA 3QUXB 3VW3H 1BVLA 1ZSDA 2NY7H 4TPRL 5DD3L 1NSNH 3DX8A 5B8CC 4IM8A 3ZYJA 3HUJA 3MFFA 1HHJB 2ATPB 1IKNC 4HKBB 1X5JA 2NX5B 3MCLL 4APQC 1AGBB 3FO1A 1MH5A 1II4E 5FO8B 3WS6C 5E6ZA 1S7UB 1LILA 3T1FB 1SBBA 2UZYB 3LQAH 2Y06L 3OKKB 2LU3A 1S7QA 1U6AL 1IARB 2VZVA 3VXPB 3ES6B 1A5FL 1A3RL 4XP6L 1BM3H 4FTVB 4LCWE 5T5NF 1AQDA 1T2QL 5BS0E 1M7IA 5EZLB 4F15B 5INCA 3D9AH 1CFQA 1MRDH 1FRGH 2W92A 4N8VA 5ILTL 1J5OL 3UJTL 3RHWF 5DZOA 5C0BD 1IAOB 4WI8A 4WEBL 1QA9A 2F53D 3GK8H 5GGTL 1DEEB 4YDIH 1MQKL 2YC1B 1S5IH 1DLHB 3WSQL 3V52L 3I02B 1T0NA 5ICYB 1U91B 5B8CB 2CKNA 4CDGC 3F7PC 1PY9A 4LARH 1E28B 4KVNH 2HFFB 3VI3F 5GGUB 4LGPB 4JKLA 3IB4A 3I6KB 1YMME 1LVEA 3WL9B 1X44A 1NGZB 1G7QA 3HFMH 2A38A 1FLRH 4WUKH 3ARDD 1B9ZA 4AIZB 2IQ9L 5HI3C 4KGJA 2AJ3B 2XKNA 4NCDA 3H42L 4YHML 4HV8A 4GQ9L 4I2XA 3SKNA 5I71C 4GW4B 5TGBA 4OSUH 3VXQB 1MCWW 3GMNB 1FIGH 1CICC 3WKMH 3UTSE 1A9BA 1HOCA 1OSZB 2ZUXA 1VESA 2LV4A 1BOGB 5IHLB 3GJEA 3GIZL 1CIDA 3GSNB 3OKDA 1G6RH 2R29L 1EHAA 4GMSL 2GSGA 4KZDL 4OCSL 5GGTA 3SCMB 4R26L 4JFQB 3D18A 3NPZB 5GSRA 4YPJA 1BZ7B 5DA4A 2X05A 1RJLB 4OFYA 3IDYB 1XGQA 1A22B 2Z0BA 3OG4B 4IHOA 3FQTB 4JKPH 3H0TA 3DXAE 1WEJH 3X3GH 2K7PA 5FA4A 3WJJC 4PJ7B 3BDYH 2DB8A 3IFPA 4ZS7H 3UAJD 5IBTL 3W0WE 5GGRY 3TO2B 4J4PD 1V8HA 1K8IA 1CLYH 2ICWB 5EZJB 5F3BB 3DURA 3SDCD 5C08A 4NZRL 1R5VB 1EXUA 3BQUA 4OLUH 2RHEA 1ZSDB 4NJ9H 12E8L 4LU5L 1N8ZB 3NIFF 4X5WA 1FZJA 4NRZA 4RGOH 3DX8B 4PRNB 5IMKA 3MFFB 4F58L 1UACH 5KSBA 2P46B 1IL1A 4HK0A 5I19H 1ZK9A 4I77H 1OARH 5I74C 4K2UL 4DKDC 1ZT4A 3VFVA 2IGFH 2JLLA 3DRQA 1C08B 3CFKA 3MODL 2D0GA 3IXAB 1QLEH 4X80L 4JFZL 4Z95H 2VTFA 1QEWA 3S98A 4X9GA 4PP2A 4LCCA 2G60L 4LSQL 5DC9B 1P7QA 2FX8H 4DGIL 5CEYB 2E27H 3CC5B 4PJFB 1TENA 2PTTB 3TF7C 4PJAE 1SBSH 4EI5D 4M48H 2YKLH 1GYAA 3OF6A 2H8PA 4NQCB 1E6OL 1QA9B 5F8RC 2IMMA 4J1UA 3V5KB 3QHZH 5K59E 4O02H 2AQ1A 1AXTL 1T0NB 5KS9F 3T3PE 3RRQA 4YNYA 2XIDA 2EDKA 3HZKA 1KG0A 3LDBC 1R3IH 2H32H 3AY4C 3ZDXE 4Y4FA 1Q0XH 3PWPE 1FH5H 1XGRA 2JK5A 1B2WH 1KV3A 4NNPH 4MJ6A 2A0LC 1OM3H 3SKMA 3MUGA 4JFEA 3UEZA 1ONQA 3F7VA 4Y16D 1YPZB 4PTTA 1F8TL 4BM7A 2CD0A 1KTRL 4Z76B 3V95A 4P46A 1J9CT 3OZ9H 4RA0C 1MY7A 2XKNB 1U95A 1T4KB 4KY1H 3M8OH 3PNWA 2HKFH 4HV8B 2OXGA 4I2XB 3RTQD 3SKNB 3O6KH 4WI9A 4MNGA 3SDYL 4LSTL 3TYGL 3MRJA 4YDJA 2BNUA 4QGYA 4OD1L 4DZ8B 1YNTB 3QIUD 3GUTA 2DS4A 1HOCB 3V4VH 3EO0B 5HYJE 2EC8A 5DUPH 4PJHA 3GJEB 4EDWL 4P3DA 1BIIB 5FM5M 5J13C 1NJ9B 3RGHA 1PQZA 3LS5L 4WI6A 5F96H 4Z7NF 3LSOA 5I17A 1CFSB 3AMLA 4E42B 2XN9D 3QEGL 1HCFX 5FYJL 2PKDA 5EH1A 1YEHL 2DQCH 2GYSA 4OLXH 5FA3B 4Q9QH 3A67H 3A6CH 2DQTL 4PV8B 4I4WB 5L2KD 4YHOL 5FA4B 1KGCD 5KG9A 3DVGB 5TF1L 2QV2A 1OAKL 3KDMB 5T3XD 4AEIL 1KN2H 1F3DJ 3BDXA 3ESUF 1WFTA 3U2SB 1K8IB 3TJHD 3DURB 2V2TA 4G6FD 2WBJB 1EXUB 3BQUB 2XTJD 3BKJH 1T66D 4JY4B 4XP1H 3V6OC 5T1LD 2LVEA 2E9JA 3HCVA 4H25A 5DMYA 4GG6A 1WBYA 5IMKB 2GQHA 1MAMH 5H2BB 1MHCA 5KSBB 4HK0B 3BH8A 3FO9B 3KLDA 1ZT4B 1QFWI 1C5DA 1FFOA 3JTTA 5JXAL 2XFXA 1U41A 4G7YH 3I75A 4FFZL 1J10A 3MGOA 4M5YL 4LCWA 5F9WC 2HKHL 1XCQB 4C56E 4PP2B 4LCCB 4LPYA 1FAIH 1P7QB 3STLA 5HGDA 5MEND 4JPIA 4UOW0 5E94A 5IKCA 5CGYC 5SX4H 4L3CA 1NC2D 1IGIL 3NCJH 2XZCL 4LDLB 2GI7A 1DVFA 1TETH 2CSPA 5EO0B 1XIWC 5C0CD 5I0DA 1I8MB 4FFYL 5AUMB 3VFGH 2CXGA 5HGAA 4OUOA 4ZS6C 3G5VA 3N9GL 4YXLL 5A2JH 4UV4H 5J11B 3FFDA 1CK0H 3ZYOA 3KHOA 4UNTA 2YD8A 4G3YL 4CU8A 1K85A 2IH1A 4OCNC 3VWJA 1KG0B 4DJMA 1YY8A 5T1MA 1CE6A 1JHLH 4Y4FB 5FYKE 5DR5L 1U8HB 4HCRL 1A3QA 3TA3D 1XGRB 4YGVB 3BKML 4PLJC 1JL8A 5CJOL 1HEZA 1H0DA 3MV7E 1V7NH 2HLFD 4LCYB 3SGEI 1N4XL 1UM5H 3MOBH 3W81A 3G9AB 5BXFA 3VWKC 5C0AA 3CDYA 5FGBA 4JQIL 1J7VR 4NM8L 1P4IL 4PJ8C 1AH1A 3PNWB 1GHFL 3CDFA 2C1PA 5SWSA 3GSWB 4NGHL 4MNGB 4JJ5B 3MRJB 4YDJB 2BNUB 4FQ1H 5I8OH 1N5YL 3GUTB 1MY5A 5FCUH 5FECB 3PDOB 1S3KH 4K7FB 2B0SH 4O4YL 4DZBA 2GK0B 2BHZA 3KS0H 1EHNA 2CDFA 3IJSB 4M61A 3E0GA 2WIIB 1HHHA 3VMOA 1B88A 5I17B 5I18L 2AXFA 1QRND 5F7UA 4UILL 3WIIH 4B7IA 2IWGA 4OFVA 4AIXA 1FFRA 1I1CA 3DUHA 2YOCA 5EZIL 1WZKA 1E27A 2BOBB 5DYOA 1OLZA 2EZ0D 4HCRA 3PWJB 1VADA 1I1AC 4PTUA 2EKJA 4Y5VC 5IHUH 1G9NC 4OZIE 3MA9H 3SDXF 3W0WA 1DQJB 2ESVD 4L5FL 3TN0C 4CKVX 5EOCJ 3U83A 3O3BA 1UH3A 3B9DA 3MACL 3QG7L 3VXTA 5IMOA 2QSQA 1RSFA 5EUKB 4NFBA 3IDMA 2V2TB 2D2OA 5D6CA 3MBEA 3KVQA 5GQBA 2AK4A 3L5XL 4GG6B 1FN4A 1MNUL 4YDKL 3WFDL 1MHCB 4U1IA 4PGZA 1DCLA 3ROLB 4U0RC 3HRPA 2CUIA 4O58L 1SJEA 4P9HC 1A4JB 1C5DB 1FFOB 2X7LB 3JTTB 3P4MA 1NUNB 1IC7L 5EOQH 2Q8AH 1PGRB 2PO6C 4OLEA 2V5YA 2JJWA 1OAQL 4PJAA 3WNMA 5HGDB 1D3CA 2FWOB 2VISA 4JPIB 1FCCA 5E94B 4JRXD 4X6CA 1CFVH 4L29A 4NM4H 4Y5VB 3X3FL 1YA5A 3DMMD 1DVFB 5C09D 3BKYL 1KCUH 3FMGL 3TN0B 5CJXC 5F1NA 5EBMB 3MRIA 4OAWA 5GGQH 4H88H 4XI5C 2Q7YB 5IG7A 4JR9L 1LEKA 5HGAB 4FXGA 2GITA 3G5VB 2ZG1A 4M6AA 2AJZA 3FFDB 3HAEG 1IC4H 4EQ2A 1TVHA 4L4JA 2DTML 1ZHNA 3P11H 1QR1B 5KSAD 4PJEE 3BO8B 1O5DT 1SQ2N 5T1MB 4K3DH 3DETC 5J6GA 4PBVC 5IEKB 3QCUH 4V2BA 4H26A 4PFEA 3IYLW 4MAYD 3HNVL 3O9WD 3RVVC 2D3VA 5DMIL 3IAQA 5ACMA 5EOTA 2C7UA 5BXFB 3MV8E 2X1PA 5C0AB 2PXYA 3DSFH 3BYYA 1L4IA 2NXZB 5IVXE 1EEYB 5DRZA 2IQAA 5JLZA 4HF5H 2Q86A 3GKWH 4RZCA 2C1PB 3VXUE 4EBQL 4M1CD 2LTQB 1UXWB 4KQ3H 2ZCHL 4PJIF 1ZVSB 2P5EB 1LO0H 2J3SA 1IC5L 3QNZB 2K7QA 4M1GH 5GGVY 5HYJA 1A14L 3IU4L 4K8RL 4KMTL 2E5EA 5FUOH 2CDFB 3ARGD 2E7BA 2XZZA 2FEEI 1UM4L 4PYHA 4M61B 5EOCL 1NBYA 3MYJB 1HHHB 4TTDD 4XGZA 3HRZA 4OF8A 2AEIT 2YPLE 3PL6C 3ZDYF 3T2NH 4FZ8L 2J8OA 4NCC1 5DYOB 4JHAH 4E41A 3UDWA 3QXUA 3QA3B 1PVHA 4QWWD 5FUCC 4O2CA 4TPRH 4WHDA 2NY6D 5KW9L 1JJUA 3T2OA 1TJIL 5FYKL 2DICA 3O3BB 3L3KB 2XG4A 3EYOA 3MCLH 5DT1L 3OKNA 4HWNA 2FGWL 4JM2C 4X7FC 1WZLA 3HR6A 4RNRB 4ZPTA 3UBXG 5IB1A 2C4XA 4MA7L 3MBEB 4UDUA 3RDTA 3RWEA 1Q9LA 4XNUH 5J9PA 1OVZA 2AK4B 1A5FH 1A3RH 2HVKB 2OTUA 4NKMB 1T2QH 4JANA 4BFIB 5ILTH 3OKYA 1SJEB 2RFXA 1A9EA 1I8LA 2NZ9C 1F4AA 1MJ8L 4FXKA 3UJTH 1EFXA 2LFGA 5DMKA 4D8PA 4C56A 1CGYA 3A6OA 5BS0D 1E6JH 2OYPA 5LXGL 3VRJA 1ZANH 5GGTH 1MQKH 3N06B 3WSQH 3V52H 1J88A 1Z5LA 2D7NA 2DM3A 1HN1A 2IAMA 2IPTH 1H8OA 4OAWB 4UT6L 1L0YA 1MCPH 4ERSL 1NCBL 1XCTB 5IG7B 5D6DA 3VXRB 1I3VA 1VACA 3WHE0 2AJZB 2WQRA 2YEZB 4ZUVB 5FGSA 3ZSSA 1ZMYA 5DA0B 3PV7A 2IANB 1CGUA 5H35B 4KKCD 2NQCA 1MWAB 5J6GB 1DSFL 2IQ9H 1YMMD 3LN5B 3MV7A 5CSBA 1N0XH 3H42H 4H26B 2I25N 2PW1A 4JN2A 3M1BA 1WIOA 4I48A 3SE8L 1QP1A 3LQAC 3GMLB 3QAZC 4OKDA 5SWZB 4KJQC 5BZWB 3GIZH 2IQAB 5JLZB 3HI5L 3PGDB 3CJJA 2WWKT 4WGWB 4GMSH 5C9JB 4OCSH 1GXEA 3ZKMC 3BEWA 1GGUA 4Z77A 5K9QG 5EG6C 2EDWA 2H26A 5KS9A 3CH8A 1M4KA 4WHTA 5IUSA 3QEQE 1ZKAA 2GJ6B 3HI6L 3O3EA 2VDNL 1P69B 4NO0D 4GRMA 1IAIL 3QDGB 3DXAD 2W0FA 1P84K 4LMQE 2F15A 2QSCL 1FG9C 4E41B 4G80B 4OZIA 5LGJA 3C2SA 3IKCB 1DEDA 4G6KL 4N0CC 4P99A 5C0FA 4LU5H 5LGHH 3QQ9D 4HIIA 5SWQA 3T0ED 1QKZL 3BVNA 1S7WB 5GGSB 2GY7B 1QSEE 3EYOB 4J3TA 2CLRA 5IVOA 1ZA6B 4K2UH 2HT3D 5DD6B 4ZUWB 5IBLD 2ORBL 3K2UL 3C9NB 4ZPTB 4OTXL 4KI5E 1KIUA 3HAEA 3MODH 2A6DA 4JFFE 1E0OB 4X80H 4JFZH 5HHNA 2F9BT 2YN5A 1U0QA 3SBWA 2KL6A 1Q9LB 3RWEB 4DVBA 2W91A 4RX4A 1KYOK 2G60H 4JGMA 4LSQH 5EFIA 5C0RL 4MCYA 2OTUB 2AJYL 5IJVB 4LSRL 4DGIH 3BAEL 4JANB 3QEHB 4P57A 35C8L 3NIDE 2RFXB 1AHWC 4OCXL 3PUCA 5E99L 4FXKB 3C5JB 1MCIA 1BBDH 1EFXB 5FGCE 5DMKB 4WO4A 3LEXB 4DEPC 4MQXC 3VXSE 4WTZA 1E6OH 2J8UE 4L3EA 5FYJU 1PKOA 3PIQB 5LQBL 1AGCB 3DVNB 4LL9A 4MNHB 4Y4KD 1KCVL 1AXTH 2IAMB 3CXDH 1V5JA 2OI9B 5GS2H 3RU8L 4D9RE 4PJEA 5L2JA 3UO1L 1RUPL 1MI5B 4P2QE 3PWPD 1OGAA 3GHEL 1F8TH 1F90L 2VABB 3MOAL 3JWDL 1QPPA 5I1GL 4C59B 4OT1L 3QDJB 4WEMB 5F1SA 3MUHL 2PW1B 5LWYL 1FSKC 4FRWA 4NRXB 3TO4D 3MV8A 3TYGH 5D71L 4IOSD 1VA9A 4OD1H 2VDML 1DP0A 2HTKC 1FFQA 4J8RA 4K55A 3RVTC 4PGBB 4CN1A 4NSKB 4JKMA 2R4RH 1OY3B 4H1LG 4F37F 3RX8A 3NABL 2V7NA 2WANA 4EDWH 5D93C 1MJ7L 1MEXL 4MQSB 2IFGA 3LS5H 1FO0A 1DZBA 5I73C 3BEWB 4HXAL 4GKNA 3G6AA 5DMGC 1J8HB 1KXTB 4JO4L 3Q6FA 3LS4L 3EJZC 3ZE0F 5KS9B 1NPUA 1YEHH 5DQJA 2JJTA 3O3EB 3ULVE 3TPUA 2NNAA 3K80A 2DQTH 1YMHB 4A6YB 2YPLA 4RIRB 1UKTA 3ARFD 3HMWL 5TF1H 4UNUA 4S0TD 1FSKB 4AEIH 3L9RA 1WITA 4Y2DD 4UTBL 3NFSL 1DN2A 5DRXB 2VDRL 4WFFE 4XNMA 5LGJB 1BWMA 3C8KB 5I1LA 5EO9B 4QCIA 1NC4B 3FQRA 5SWQB 4OFDA 4D0BB 2X4TB 3OR7B 5D2NC 5DURB 4LSDA 1XGTA 1P7HL 2CLRB 3H9YA 2I9LA 5D7LB 4XT1C 5HY9A 4WU5B 5I73B 1KCRH 3SKJL 5JXAH 4ZFFB 4FABL 2A6DB 5HHNB 2R23A 4FFZH 4JFYA 5BOZG 4M5YH 2VNCA 4GBXA 4DVBB 5EFIB 2AEWA 3WMSA 2E9BA 1JZ4A 4LDEB 1IGIH 4LF3A 4CMMA 2XZCH 1FCGA 4AZ8A 2Z4QB 2NY2D 4GRLD 4Y1AB 4L8SC 4FFYH 1Y18B 3C6LA 4L3EB 5JOEA 2CUMA 3N9GH 4YXLH 3V7MA 4LSUL 4XP9L 1WC7A 4GLRI 5FO9A 1GC1L 1J18A 2B8OT 2R15A 4PRBA 4XVJL 4G3YH 1SYSB 2C4FU 3MLSL 3I3DA 1NKRA 2AQ2A 2ADJB 1IRAY 5E6ID 1QD0A 3EFDH 3L7EA 1JWSA 4HCRH 1XGUA 4LAJH 3BKMH 1B6UA 4OCRH 5CJOH 3S3SA 3RWDA 4GLRH 4DVRL 5L2JB 5DHVA 4TUKL 4PV9B 3BJLA 3U4BH 5J12C 1R5WA 1OGAB 1N4XH 2VH5L 1PAMA 4U1MA 5KAQG 1F00I 4YIQA 3ZO0A 1HSAB 1EJ6A 4IMLB 2ZUQB 1XZ0A 3JZ7A 5F1KC 4JQIH 4NM8H 3KPOB 4XPFH 1P4IH 1MFAH 1QBML 1GHFH 4NGHH 4ONHB 4GUPA 3EYVA 4L8SB 3IT8D 2OQJA 3QPQD 3K74B 1N5YH 2FIKA 4NNXA 2ICEA 5FOJA 3T77A 4JLRA 4HZLB 1RK1B 4O4YH 5HYSG 3VA6A 1XF2B 4LK4A 3G08A 2NTSP 2QR0A 4N9GB 1F3DH 5I18H 4CNIA 4J3WA 3G6AB 2MCG1 2YK1L 5B3JE 3Q6FB 1JGUL 1JN6B 1PDKA 3Q3GB 5JQ6L 2A2QT 5JIKA 4ZAKA 5KVFL 2VZTA 3LRSA 3ARDB 2R1YB 3HG1D 2WUBH 2CRYA 1ZEAL 3D25A 3UAJC 3RTQA 4YHIB 43C9A 4J4PC 5EU7C 4R96A 5E4EB 4HIJA 4L5FH 4YHNA 5ETUA 2B5IC 5DJAA 2NY5C 3MACH 3QG7H 4GAYB 4XRCA 4R4ND 3B9AA 1H3PH 4KTDL 5I1LB 3DWTA 4Y19D 3S36X 3ZHKA 1CGSH 5BJTB 3O0RL 2DI7A 1QSEA 3AROA 3NA4A 3P9LA 4HC1L 4D3CH 1OWRM 2VZOA 4ZSOA 3NCYS 1D5MA 1XGTB 1WUNT 4N0RA 1KTLA 4DW2L 1A6ZB 1UWEL 5IB3A 4LLVB 5D1ZA 5DLML 5JMRA 2BJML 4JDVA 1NBZA 5KOMC 3TYFB 5E2UL 2EXWC 4GAJL 2NY1D 4EI5C 1OAQH 4HKXA 1TZIA 5IFJA 5H8DA 2XV6B 1FJ1B 2L7JA 1R3KB 1KLUB 4JB9L 3WEXB 3X3FH 1A7OL 3QPXL 1AXSA 3VXSA 3BKYH 3SDCB 3PHQB 2B5IB 3VG9B 4S1DD 1FZKB 4WHYG 4JR9H 5JIHA 3NN8A 3ZDXF 5I2IA 5T1LA 2DOCA 1WC7B 2F54A 3F7QA 2R0KL 2VZUA 2DTMH 2CPCA 1B4JH 5CMAA 3TZVD 2EH8H 2X1QA 3L7EB 5FYKU 1DUYB 4PRHE 2J5LB 4YGAB 4NYLA 3BMVA 4P2QA 3RWDB 3MXWL 1A21A 2HH0L 4JG0L 5DHVB 3RP1A 1P7KA 4HC1A 4JHZA 4TVPD 5DMIH 4X99A 2AV7A 5ISZA 4YIQB 4YBHA 4OCMC 1BZ9A 2PW2A 2XXCB 5I30H 3NPSB 1WWWX 3IF1A 4JFDA 4M5ZL 1CDJA 4D0CA 4PGJA 1XZ0B 4G8IB 1N3NB 1ETZA 4NN5B 3C8HA 3CPLA 3RWIA 3E8UL 1T04A 2R2HB 1BFSA 4RRPG 3QIUC 4EBQH 4XX1G 4QEGA 4MA1C 2ZCHH 1BQSA 5IGXL 2W0PA 4YBQD 4PJ5A 3MV9D 3H7BB 3V0VA 4OFIA 1IC5H 3TBTA 4BELD 4NNXB 2FBJL 5GS0H 2IBZY 3T77B 1A2YA 3IU4H 4K8RH 4KWUA 3VXUD 2QQLH 3JV4A 4KMTH 4ELKB 3E3QC 3G08B 3GJFA 3KYOB 4NN7B 3TT3L 1E4KC 5EOCH 4GG8B 1QVOB 3B9VA 4HUUA 5E0QA 3S3PA 1NAMB 2EIZB 5B38G 2OK0L 4LVOB 4TNWK 4Y16B 5IR1A 2UZIL 4X98B 3SGDI 4FZ8H 3RY5A 5DZNA 2WW8A 5IK3B 2FATL 3INUH 4J3SA 1XAUA 2Z31A 3T0VA 2HT2D 3QIBC 1NUGA 3D25B 1BF2A 2FX9L 5BV7L 3LKOA 5KVMC 4LHJB 1DQQB 3RTQB 4ZNEE 5KW9H 3FFCE 4HIJB 1TJIH 4YHNB 5FYKH 4LIQE 1NANH 3SGDH 1TCRB 2XTJC 3QIUB 5EIQA 4UIMB 5DDHA 4XRCB 2FGWH 4P2OA 2V7HA 1QACA 4EUPG 2UV3A 1MLBB 3C08L 3BXNA 1MFCL 4MA7H 1BIHA 2MNUA 2HFTA 3SDAA 3BN3B 3VFUA 1RULH 3VH8A 4WY7L 1CVSC 4G9FD 4PRPE 3MRCA 2ID5A 1C12B 4R0LA 4ZSOB 1AXIB 1D5MB 4PJIB 2BK8A 1UWXH 5IB3B 3IDNB 1IMHC 3AM8C 4TOYL 4IOFD 2VLJD 4M02A 2OX5A 1QNZL 3VFSA 4OM0L 5F89B 2P24A 5LXGH 1HSBA 2QHRL 1J1OH 1PY4A 4ODWB 4ZUTA 5L2KB 1ZT7A 5IFJB 5I8KL 1GVIA 4MDIA 5AYQA 2CJUL 2VR5A 3ZZ1A 4RAVA 4P9MH 3SJVA 1AXSB 2IALA 3ME0A 2AEPH 4MVBD 3I6LD 4UT6H 4QRTA 2MCPL 1WAAE 2KZWA 1NCBH 3GM0A 2JCCE 2NY3C 2VDPL 3GI9L 4NBZB 5T1LB 5I2IB 4Y5XC 1TJGL 3U46B 5HYSA 1HIML 4NUJA 4ZD3H 4Z78B 5FGRA 3Q1SL 2MTPA 4EN3A 3CLEH 2QL1A 2EEBA 4ODHL 3WNOA 1DSFH 1H3WM 4XP5L 4FQXA 1U3ZA 3SE8H 5MENB 3WNKA 4X99B 2AV7B 5GIRB 1NC2B 2PW2B 2ZZUT 2YPVL 3GSUB 4PLOB 5IW6B 4NRYB 3HAEH 2E6JA 3LQMA 1DL7H 1ETZB 2Y6SD 5C0CB 3WNLA 1ZHBA 5FB8B 1IM3A 4KK5D 3WIHL 3H3BC 1G0DA 5IHZB 4GKSB 5I1HL 4YHPB 2WM0A 1MCLA 3DI3B 4JDZA 3RNQB 3V0VB 4DKFH 4P5TD 1MJJA 1DANU 4Y5XB 3F7RA 5F7YC 3QO1A 3RL2A 2FL5A 2CRIA 1JGLL 2XQYK 4WWKA 3TA3B 5K9JL 5M7QA 4RGMB 3GJFB 4HGWA 4PY7B 3VGFA 3S37X 3L3DA 4YBLC 1ACYH 1CF8L 2W65A 1VGKA 3VFPA 3VGGA 1IAIH 2EH7H 4G6JL 5D7IF 2EZ0C 2XRAL 2QSCH 3ILPA 3DROA 5FHAL 3FQXA 2ZOLA 2BVYA 4RMQA 1FDLH 1NLBL 2MHAB 4G6KH 4MDJB 5C0GA 4OV5A 2DQGL 4RAUA 1EUUA 3T09A 5E70A 2ORBH 4QXTA 3K2UH 4OTXH 4TRPL 1S9KC 4P2RD 4O2EA 1OT1A 3WIHA 2I60L 3TFKD 4KI5D 4MB5A 4KK8D 1HHGA 4HUWA 3BAEH 3UBXI 3P9WB 1VPOH 2VLME 1JZ8A 4U33A 5CP7B 1M71A 1JPTL 4C58B 3DUSA 4U1LA 3VFSB 4WI4A 1KIRA 3AVEA 2P24B 4KRPC 1HSBB 3T0XA 4ZUTB 1FO0H 5JXED 3DMMC 2YD5A 5CFHA 2Y07H 5LQBH 4WI5A 2D7TL 5IM7A 5EU4A 4KVCL 2HT4D 4JZJB 4AL8L 3NCFB 3C6SB 1EEZA 1XR9A 3IS0X 4U3HA 2IALB 5IW1B 4L4VA 1HKFA 4QRTB 4JQXA 2X6MA 1OTSD 3LKPA 3QJFB 3LOWA 1PYWB 1X7QB 3RU8H 1WFNA 5KSAC 1RZJL 5BV7B 1EO8L 3UO1H 1MOEA 1A6TA 1RUPH 4NUJB 3QUZA 4YHYC 3RUGA 3BIKA 1VERA 4F2MA 1X5IA 1YQVL 3HI1A 3GHEH 4HXBL 3QWRD 5D96B 1F90H 5GGRA 4PRHA 3MOAH 2NTFB 4RQQB 3JWDH 3L6FA 4XVUC 5I1GH 1UG9A 3LMJL 5B38A 3F12A 5GPRA 4OT1H 4DFHA 4BFEA 4YH6A 3DV6B 3O9WC 3L95B 5B39A 2IC2A 2I27N 5DS8B 3T04D 1T6VN 1A1OA 5LWYH 1WGOA 4P46C 4OF6A 3HS0A 4ODTH 4PRID 4DAGL 1CN4A 3QZWG 5IMLA 3SDDC 5DRNB 1Q38A 2VDMH 5GRJH 2ZUYA 4G6ML 3ZLQC 3TCLB 3VGBA 5D9SA 4JHBA 3B9KA 4M1CC 4R7DB 5ABDE 2GCYB 1ZHBB 1HE7A 3NABH 2BC4B 2DQJL 4I0KA 5TE4L 1MJ7H 1MEXH 3VD5A 2GT9A 5M95B 3V79C 4FFVD 1AY1L 4X7TA 5C3LD 4HXAH 3VD4A 3BWAB 5D7SH 4MXVE 4JO4H 5JHDD 4LVEA 3S8WA 4RDQG 2FL5B 3ARGC 3LS4H 4WHCA 4X4ME 1B0GB 2A83A 4YFEA 4LCUA 4WI3A 4YHYB 6CGTA 1FYTE 1R3HA 1FGVL 4TTDC 3B2VL 3TP4A 1RVFL 2Y1VA 4XNQA 4HGWB 5KSVA 5K9QI 4MAYB 4HD9A 2WP3T 2W65B 4P23D 3FHAA 3CFCL 3O9WB 4LLQA 3VFPB 5F8QC 5DD5L 4LAQL 4KJPD 3NCEB 2OLDA 1OAUL 3DOSA 4MB3A 4RMSA 4UTBH 3CMGA 4F7CB 1VFMA 2NY6C 1ZLUK 4WFEE 4ZNEA 1OP9A 2HP4A 2E6QA 1Q9WA 4KFZC 4TNVK 4Y4HD 1FNAA 5C0GB 3V2AR 4OV5B 4MD0A 4WFFD 4R9HA 1UA6L 3BESR 5BRZE 5IMMB 4QXTB 5GHWL 3SKJH 4FABH 2R0ZH 4PRPA 2R2BA 1LD9A 3ARGB 1MPAL 4LRIA 1NL0H 1NFDF 1RZGA 3EJYD 3PE9A 3ROOA 1NCDL 4PR5B 4HUNB 2D9QB 3FT2A 1WBXB 1TMCB 4Z7WF 5T3ZL 3OHXA 1NKOA 3VI4E 3FZUD 2DMBA 1EFQA 2R2CA 1JIBA 5F88B 4U1LB 3SPVA 2H2PD 1KIRB 2OSLB 3KPSD 3U7YL 5J3HD 2DKSA 4WENB 4WRLA 4F9PA 3CMOL 4LSUH 4XP9H 5KN5A 1NMCB 5EU4B 3RVWD 1CXIA 1GC1H 4XVJH 2J88L 1EEZB 4JPKL 5CLWA 1NCTA 3MLSH 4Y5YA 1WAAA 5KANG 2NW2A 4L4VB 2HLAA 4HWEL 2DM2A 4OGXH 2ITDB 1DN0B 3RA7L 2IEPA 3VWJC 4ISVA 4CDHA 5MHSE 3O3UN 4UOJA 1A6TB 4Z5RA 3QDHA 3QUZB 4TUKH 3BIKB 1KXQE 3V6ZA 3WN5A 4F2MB 4KKCC 1D5ZA 2VH5H 5GGRB 2A6JA 4HPOL 4XAWL 3GNML 1WF5A 3UCRA 3S9DB 2A77L 4C57C 3D3VE 4HBCH 2OS7A 3QISA 4ZUUB 1KTDA 5B39B 3LKQA 1QBMH 3HS0B 3B8YA 3LV3A 3GBNL 5FGBC 2A74A 2X89D 3BP5A 4XAKE 2BZDA 5LBSL 3NOIA 5E8OA 2DKMA 5D9SB 3B9KB 3C5ZD 3EFFA 1HNFA 2FYYB 1ZGLM 1NBVL 3VG0L 4KMQA 5K9KA 1QO3A 5DGQA 4DGYH 2BOCA 1WISA 7CGTA 2GT9B 2XKSA 4FQLL 4X7TB 1QBLH 1U3HC 2YK1H 4XCEA 4F8QA 5LAXB 5F3HA 1ZV5A 1OP3H 1NGXA 2A83B 2BVPA 4LCUB 5KVFH 1BD2E 5CBEB 3CSYA 3S37L 2FO4B 5KSVB 5IP4A 4R3SA 2E8YA 2EDJA 3WIFA 4Q6YA 3LPFA 3HE7A 4H1LH 4LLQB 1U8OA 4P5MA 3ZT6A 1MVFA 3LKNA 5IOPA 3RVUD 3O6FD 4WI7A 3SKUD 3ARXA 1YN7B 5C07E 3JWOL 1K4CA 5CD5D 1IGJB 1KJ2B 1T2JA 1ULVA 4JG1L 2YRZA 5KVEL 1C16B 3O0RH 1ZLVH 2VWEE 4BUHA 2OJEB 3HE6D 4HC1H 2L4OA 1EAJA 2HT3C 5IBLC 4MA3B 4PJBE 3GSQA 4QXUL 4LSSL 1UWEH 2ATKA 2X4QB 3ZKNC 3WJLA 3CX2A 2R2BB 1S8DB 5DLMH 2BJMH 4NOBA 1RZGB 1BVZA 2Y25A 5E2UH 5CHNA 3ROOB 2VDKL 1E4XL 2VLRD 1WBZA 3MRLB 5JA9A 1VB9A 4JB9H 1NEZG 2GTZB 3O3DB 4J6RL 1IM9A 3RNKB 4OIIH 4XVSL 3WE6A 5HYIA 4AQ1B 4MX7A 3ULSA 1A7OH 3QPXH 1GGTA 1OF2B 3MOQA 4UQ2A 4TQEH 1HXMA 3QZWA 4RMVA 5HHVL 2ERJB 4X6DE 4Y4KC 3LN9A 4YFLF 4H8WL 5IVZB 1J0YA 3WFCH 5KN5B 3T0EB 4MHHG 5E2TL 4Y5YB 1I7UB 2NW2B 3HZVA 4O2FA 3ULVH 2HLAB 4QHLB 2ZUSA 3C60A 3HPJA 4ELMA 3RZCA 4ISVB 1T7WA 3MXWH 3OQ3B 4QKXB 4UU9A 4Z5RB 4NWTL 4JG0H 2FEDC 3GZKA 3V6ZB 3VXMD 2ENSA 2XY2A 1JBJA 1HHIA 1A7QL 1Z9LA 2G2RA 4M5ZH 1FFPA 4GRLA 3MCKB 3MRQA 3E8UH 2BSTA 3QUYA 2AXGA 2YWYA 3UYOD 2PXYC 5IBUG 5C3TA 1WZ1L 1CS6A 3W82A 3KPRE 3EDKA 4P4KD 5IGXH 1N6QL 4AMKL 1AGFA 4UUJA 1GRWA 2DIJA 1BREA 4G8GE 2BVQA 5DJ8A 3WLWD 3CUPA 3EO1A 2CO7B 3NH7L 5K9KB 1QO3B 4K3HA 3RBGA 3CVHB 2BOCB 2R9HC 3TT3H 1OWWA 3HR5A 2C5DC 4YC2C 4PJ9D 4YDLC 2OK0H 5GGVL 3PWPB 4X6BA 1WIUA 2UZIH 4WCYL 2BVPB 3O6ML 3MR9A 3D0LA 2FATH 3RJDA 1FG2A 2X1WL 1MFNA 3QQ3B 5DHYA 4KROD 5LJYH 2ZUTA 1FPTL 2FX9H 4LLYB 5BV7H 2VAJA 3WIFB 4FQJL 4HJGA 4Y2DC 3ARYA 1YEIL 4QRRA 3PABB 3TO4B 3UDWC 4P5MB 5KVGL 1TTFA 3LKNB 4IMKA 5IOPB 1K5NB 1U8JB 3OAZH 4DN3L 4XXCA 4ODSL 1K4CB 3F65A 3FFCD 3O3AA 4PUBL 2XTLA 2A9NL 1ZHLA 5F7NC 1HI6A 4WY7H 1I1FA 3U4EA 5BRZA 4Z7VA 4EXPX 8CGTA 3RDTC 3GSQB 1YJDL 1G9EA 4LHUA 5EPMA 2ATKB 1VSCA 4BSVB 5KAQF 3RWHA 5JR1L 2G5BA 3BPLB 1QNZH 3FRPA 5GS0C 4L4TE 5BW7A 4OM0H 2QHRH 3DX9B 5CHNB 3MROB 1CBVH 3MLZL 5IT2H 3S5LG 3ARFB 1WBZB 3H9ZA 4DGVL 5I8KH 3FQWA 2CJUH 1LO4L 1IM9B 4UINL 5J6HA 3FOLA 4Y8DC 3ULSB 2D9CA 5D7IA 1MRFL 2F58H 1HXMB 4JPVL 2MCPH 4HS8L 3UPRA 1I1YA 4Y19A 4U6TA 3RPIB 2VDPH 3GI9H 1U58B 2NCMA 2BVOB 1JHTA 1KC5L 2X1XR 5JIIA 1ZVYA 5E6IC 4QRUB 4N0FA 5D6DC 1IT9L 2FGZA 3CGTA 3MUJA 3BN9C 2OMBA 3U0WL 3Q1SH 3GO1L 3HZVB 4O2FB 5HYQB 1RHHB 5DQDH 3RGVD 4ZMAT 4I0PD 4ODHH 1ADQL 1MCCA 1XGYL 2Q76A 4ELMB 3FT3B 3RZCB 4XP5H 4H0GA 2A6KA 5F1IA 3FB7B 1MCSA 5I9QB 1KEML 4XZUA 4KK9D 4WDIA 3TESA 1FQ9C 3P0VL 5D1QD 2YPVH 2F74A 5DEFA 2NY2B 1XR8A 4GRLB 1ITBB 1CZ8L 3WIHH 3QPQC 5DWUL 3WD5L 3C5SA 4G42B 3VGEA 5I1HH 3HPLA 1AP2A 4OD3L 5FV1L 1IFHL 4UAOB 4LKXA 1T1WB 2PCPA 4UUJB 4APQD 1IEAA 2BVQB 2R69L 3QFJE 5FFLA 1JGLH 4YQXL 3ZHLA 5B3JF 3PP3H 2JB6A 4XMLL 5HGGS 4CVWA 1XMWA 6FABL 2J6EH 3HR5B 2R1WA 3ZL4L 1CD1A 3U79A 3K8MA 1EEUA 2DQFA 2WLZA 4G6JH 2OZ4H 4K3GA 1PSKL 4I3RL 3BP7A 2XRAH 5D5MF 4NQED 3MPCA 3BZEA 1KIPA 3IFOA 5FHAH 1T1XA 4U0QB 1ADQA 4RFOL 1YNLL 4JM4L 1ZWIA 3CDGB 1G1YA 4XXDA 1EJOL 4CJ1A 1YEEL 4R4NC 2G9HA 4JZOB 5C07A 5CZXD 4Z0BL 3MV9A 4KRNA 1I7RB 5LCVL 3ARPA 1D5IL 2OR9L 4MJ5A 2F19H 3KHQA 4KTEL 1UZ6F 1IKFL 4KJYA 1HI6B 3H2WA 3NGBB 4XWGL 2WUCL 2X4RA 1SVCP 1G7LA 5C0IA 3ZTJH 1FVEA 1JRHL 3AXLA 4WUUE 1N5AB 4K94L 3IJHA 5IB4B 3GRWL 2KQNA 2IFFH 1YEDB 3ZKXC 2NY1C 1KJMB 4ODUA 1A3LH 3HG1B 1QLRB 2BNRE 2VLMD 2ZPKL 8FABA 3BGFC 4GW1A 3LH2L 4IIQA 4PGEA 3DHJA 4X7SL 4CMHB 3L3IB 4WO4C 2F5AH 3QIWD 2D7TH 4OI9A 3FQWB 4KVCH 4AL8H 3RWCA 4LCIL 3AGVA 1IGFH 5ICXB 5A3ID 1P6AB 3GMQB 3KPQA 1OGTA 5D7IB 2CKBL 4X6DA 4NPYB 2E8ZA 3B3IB 3SEPA 3BPCB 1OW0A 3ULUE 4F33B 3GMRA 5BZDB 1I1YB 4Y19B 5J7CC 3UPRB 2E7LC 3WFHA 3BWUC 5HJ3B 1Q9OA 4YDVA 1FV1B 5I15L 2GAZA 1RZJH 5F9JB 5A2IH 1EZVX 1CTOA 1EO8H 4ZPVA 2EYTA 3TZVC 2FJFB 5KVDL 4WFHE 1JPFA 2WSKA 4N0FB 1YQVH 3IDXL 4HXBH 3EOAA 3O4LD 5TH2B 3LMJH 3D85D 2Q76B 2XWBB 1A1NA 4L1DA 2GFBA 3FJTA 2A6KB 3WXWL 5F1IB 2NY1B 3OB8A 4DAGH 4NC1C 5FYLL 4CL7A 3ARTA 4WDIB 4X6EA 4U2ZA 4G6MH 2BDNL 4Z7WA 2F74B 3GRWA 1JWUB 5E5RB 2PYEA 3H9SD 4YBQC 3WLBA 2DQJH 1IAIM 1I7ZA 2VKXA 3C5SB 5TE4H 3G9VA 3RHWK 2C3WA 3HPLB 5CEXB 3LAFA 5GS1B 5ITBL 1NAKL 4M93C 3B5GA 4LKXB 3NCCB 1FL6A 3PWUA 7FABL 4K71C 4LOUD 3V5HA 2CKBA 5JA8B 1FGVH 5MEOA 3TCXA 4DUXA 3TBVB 2JB6B 2VUYA 4S10A 3B2VH 3OJMB 2R1WB 4S2SA 4Q9RH 5DUBA 3H7LA 3R06B 3TLRA 1CD1B 1FYTD 4N90E 2JJTC 2X09A 3CFCH 5E1AB 5GRUL 4U1JB 1EGJL 1F13A 1TPXC 3EO9L 5DD5H 3RKDD 2KH2B 4LAQH 2HT2C 1S78C 1OAUH 3H6JA 4XCNA 4MLIA 4BQ6A 3BZFA 3IFOB 4Y2OA 4CUCA 1T1XB 4PBWD 4PJXE 3IDIB 1G7PA 1ZWIB 5C6TL 1CLZL 1U3YA 4JFHD 5EC1A 3MJ9L 2PTVA 3Q5OA 2YD7A 4ZXBD 4KV5F 2E3VA 3AS3A 4WFED 3MV9B 3VFRA 4DOHB 3P77A 4HUMB 1UA6H 3TGXA 1K3ZA 1H3VA 1LWRA 1P5VA 3ORJA 5GHWH 2FZ3A 5EA0H 1H15B 2ILLA 1S9WA 4URTB 1MPAH 5C0IB 5DJCA 2BRRL 2E7MA 3AU1A 2Q20A 4IOFC 3X14B 3EYUL 4P2CG 5T3ZH 4WVRA 1S7TB 1HHKA 3MLTB 1V7ML 5EORL 1DBBL 4ODUB 4M1DH 1TPXB 4TUJB 3S35X 5IB5A 4GW1B 5CD3B 2ZSVA 4IIQB 4ZOAA 1NGQL 3CMOH 1YECL 5FHBL 3KXFD 5J57B 4NZUL 2HJLB 3MRFA 4MVBC 2J88H 4JPKH 1EGJA 4I3GA 5ADOH 3BOVA 4PLKC 5IJKC 1I4FA 1OGTB 1JP5A 4GXVL 1F6FB 4MZ2A 1LO5B 2OR8A 4BZ1L 4HWEH 3MRMA 3PJSB 4KDTC 3WFHB 3RA7H 3VFNB 3QYCA 1RPQA 5DJ6B 1AR2A 4G9FB 3QCTL 2AJVL 3MJ9A 5FAAA 4ZPVB 2EYTB 2WIMA 4F7PB 15C8L 3GSXA 2W0LA 5EU6A 1QR4A 3H9HB 4JRYA 2D7OA 1UFUA 5D7JD 4QRPA 1LDPL 4XAWH 4HPOH 3GNMH 3Q6GL 2A77H 4G9DB 4QOKE 1QRKA 3E6HB 1UB5B 2VLJB 5GISL 1HWHB 3QXDB 1KPVA 1A1NB 1EH9A 2JJSA 1QFHA 1AC6A 5HVGB 1JZ2A 3PHOA 4G43B 3D3VD 1NFDB 5ALCL 3SE3C 5HGBB 3W39B 3ARBA 4XCYB 5T1KA 2XZQL 4Z7WB 1G9ML 4KK5C 1BLNA 5E8EA 4Q2ZA 3ZTNL 1NBVH 1Q0YL 2BP3A 2PYEB 1TIUA 2EYRB 2Z91A 3DYMA 4P5TC 1C1EL 4FQLH 1W72L 4LEXL 1YQ2A 1UB6A 1W0VB 4LBEA 5MERA 3QFJA 1IGML 1FE8H 3EIFA 3T0WA 1HH6B 2P8LB 1T89A 2XA3A 5D7KE 5I66A 2VL5B 4FP8L 1JVKA 2DQHL 5MEOB 1NDMA 3CFJA 3QI9A 4IRSA 4NCC2 3S37H 3U36B 1MQ8A 4ZAKC 1KPUB 4S2SB 4UDTB 5CJQL 1NH6A 1RZIA 5JPNA 4FN0A 2YR3A 5CGYD 4LLUA 1ZT1A 2NY4B 4MQ7B 2WQ8A 3NZHL 1T0MB 1ERNA 2ADGA 5JW4M 1N2RB 1XIWD 1ZHKB 2CLVB 3JWOH 3UPCA 3H3PL 1MVUA 4JG1H 2FB4L 1MAJA 5KVEH 1G7PB 2UWEE 3VMPA 5ID1A 1LHZA 3C09C 3OXRA 4OJFL 2VZ1A 4AT6B 4D2NA 3VCLA 1U2CA 3ZE1F 2W9EL 3P77B 5ANMB 4QXUH 4WV1A 3K1KC 1WWCA 4MLSA 3TFKC 2WLYA 1ZS8A 4KI5C 4OLZL 2D7PA 3FRUA 4MD4B 1VKXA 5I8CB 5D1ZC 4HIXL 1E4XH 1W72A 4KQ4L 2VOTA 5E8PB 2XNAB 3D39E 2SEBA 4J6RH 2UYLB 3VWKD 4DN4L 2BNRA 4PP1D 1R3JB 1OCWL 3DRTA 4RWHA 4PJ8D 3ILQD 1D9KA 5HHVH 2BY0A 4QHUA 1A6UL 3EDJA 3VFOA 2OTWA 5E2TH 5HHXL 2H9GA 5C0JA 5DK2A 1OTSC 4BH7B 3E6FA 2VQ1B 1H3TA 5HVFB 4R4FL 1LE9B 4P2RB 1N6VA 1X4YA 3LKSB 4NKDB 3GHBL 4NZJA 5M94B 5KANI 4NWTH 3GSXB 5BVJA 5MI0C 4RGNE 4QRPB 5DJXA 3BH9A 1A7QH 1H5BC 1CDCA 3QXTA 1TJHH 3IAGC 3LKRB 1KPVB 3TJEL 3X13A 4U1NA 1I1AD 1X5AA 3PHOB 1GZQB 4FA8A 1AJ7L 1INDL 4OKVB 1MCFA 4GFTB 2NX5E 4GRWB 4AMKH 1N6QH 2DQIL 3I50L 3P3YA 2XQYG 1T5WB 1FZMA 25C8L 1S9VA 4FOMA 4QRQA 1K6QL 3SO3B 3KPRD 1JNLL 4MXVF 3BPNC 3NH7H 5T1DL 1S5HA 1VENA 3NIGE 3QXAB 4YPGA 3U0TB 4R97C 5HHOA 3DYOA 4G8GD 3VDAA 3VGAC 1S7RA 4FTVE 3P4NB 1UB6B 1HWGB 5GGVH 1ITCA 1W0YT 3N85L 3UZVB 1BWWA 1UXSA 3HZYA 3N1FC 1TCMA 4U6YA 2R2EA 3QNXA 3MLRL 3O6MH 4LLWA 1NDMB 3P73A 1X6LA 3KNBB 2PO6D 5CINL 1FPTH 1WFOA 1H5BB 5ERWA 3ULVC 1RZIB 3QHFL 4J7RA 4PRIB 5DF0A 1CG9A 4FQJH 3TBWB 1YEIH 2IADB 5KVGH 2Q8BL 2X89A 4I0CC 3O8XA 1ES0A 2LU7A 1KJ3L 1HDMA 2ADGB 4DN3H 1OOAA 4N1CA 4ODSH 1W0WB 5E95B 5L8KB 1MVUB 1AR1D 2VDOL 4Q97A 5JTWA 3FONA 4JGUA 1DE4A 1DQTA 5F7EH 3OXRB 2B4CL 3V6FA 3VCLB 3SDAC 4CADA 1OQXA 1L0QA 4LQFL 1Q9KB 3ECBA 3IDGB 3VGAB 5JHDB 1YJDH 4WV1B 4JZNB 4R0LC 3N0PB 4WIQA 4QNPE 5JR1H 3BGMB 3DVIA 4DKEL 4LSVL 4OF0A 3MLZH 4U1HA 1W72B 3GBMH 3QSKB 4P23B 4OD2B 2EO9A 4DGVH 3RX7A 3NVQA 4L4TD 4UINH 4JAMA 1A7RL 5J3HC 1CLOL 4FQ2L 1K2DA 5FDWA 3S35L