4JO5A

Cbm3a-l domain with flanking linkers from scaffoldin cipa of cellulosome of clostridium thermocellum
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
170
structure length
170
Chain Sequence
b'NTPVSGNLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRFAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWGKEPGGSVVPSTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosome anchoring protein cohesin region
publication title Structure of a family 3a carbohydrate-binding module from the cellulosomal scaffoldin CipA of Clostridium thermocellum with flanking linkers: implications for cellulosome structure.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cellulose binding protein
total genus 38
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4jo5A00
2WOBA 2WO4A 2XBTA 1JS4A 1K72A 4B9FA 1GA2A 3TF4A 1NBCA 3ZQXA 4B9PA 2XFGB 4C8XA 1G43A 1KFGA 1G87A 1TF4A 2L8AA 3ZQWA 3ZUCA 2WNXA 3ZU8A 4JO5A 2YLKA 4B97A 4B9CA 4TF4A 4B96A
chains in the Genus database with same CATH superfamily
3D69B 4FABH 4GRLD 4H44C 5I30L 5IVOA 1RHFA 3VWKC 3CLWA 5DJCA 4QTHB 4YHIA 2JQMA 2AJYL 5DJZA 3H6JA 3RB7A 1UZ6E 2FECL 3EZ8A 4JO4H 4JFYA 2G0KA 3STBA 1FIGH 2IGLA 3BI9X 3DK0A 5IQNA 3SPHA 5C3IA 4AWJC 4WJ5A 4HZ1A 4UUJA 1VA9A 4KV5E 4MA8L 4YFDB 5T3XE 1NDGA 2IV8A 4I3RL 1U95B 2WJ5A 2W59A 4HQQL 2A9AA 5CP3H 4B96A 4E5XB 1NC2B 3FW6A 4WTXA 5GS1B 2K45A 3VXOA 3MJGX 4K23L 5ESAA 5IB1B 4DZBA 2NCMA 5EEXA 5M7QA 1Z9LA 2PTUA 4KKLC 2IPUG 3GF8A 4RWYL 1SVBA 2ERJB 1PLGL 1B2YA 3QDJD 2IDCA 3RPIA 3EO9L 4X99B 4AMKL 3ILPA 2CBMA 2A74B 4FNPA 4Z3FA 3O6MH 2B3IA 4MDJB 3L4CA 1H19A 1F97A 2D7TL 1A7NL 1XR8A 3GSNH 3TS8A 3VI4B 5F7HA 1CGUA 1T7XA 4Z0XB 5B8CA 4YXKH 1IEBA 3MN8A 5I1KL 1KJ3L 3TF7C 4RFEB 5G4OA 3V7MA 5L4JA 1NC4D 3A6CH 1XVSA 3CDGA 4O02H 4X7SH 4ZOAA 2FX8H 4HJ1A 3RX8A 1UG9A 4ZAKD 3OLIA 5J8OA 3P2BA 4YK4B 4PS8A 1L4IA 4NENA 3VFPB 3ILEA 5EZJB 1INEH 4XCNB 3CV5A 3ZL2A 4P4RA 3QRBA 5E5LA 1BVLA 4XTRD 1U93B 4OI7A 2WXMA 4GSRA 2HLEB 2OQJB 4WUUA 3WL9B 1FNGB 1WH0A 1UD3A 4XN7A 3G6JA 1H0DB 1ZS8A 3BAEH 1NA8A 4GUPA 3GO1H 3SBWA 1XGZA 4DKDC 3T8XA 4MZRA 5JOPE 2BOBA 1XHHA 1YEIH 4W4OC 3V0EA 3X1FA 3DYPA 1AD9A 1IC4H 5LUMA 1NDTA 1J05A 2K6ZA 3HEIB 4MGXA 1RH8A 3GMPB 4U1NB 5D96B 1S6NA 2BNQB 3DO7B 3PV6B 4K71C 4Z5RA 1EHAA 3E1ZA 2FEDD 3PWVB 3W0WD 3HPLA 3UMNA 3VH8G 1K2DA 1JHKH 5IQ9B 4LCWA 4ETQB 5LGJA 2FL5A 5IVXB 3O3EB 3QEQA 3QWRD 4LSUL 2X4TB 4DK3A 1BQHA 2DQ6A 3WKYA 3B9EA 3LZQA 1IJNA 4OFYA 4IRZH 1SXZA 4IKNA 1TZOA 3ZXAC 5KYXA 3HHRB 1DVXA 5FFLA 2CDFB 4UNIA 2OW7A 2QVIA 4FFVD 1ND0A 1LE5B 2C7FA 5ICUA 4NQDE 4FC3E 3AWFA 2CIIA 2ZCHH 2RFXB 4ODXB 4APXA 5IQ7H 4PGEB 4J3VA 1GMEA 4FQ2L 1ZDQA 4GP8B 1W80A 1XQ4A 3ZDXE 3ECVA 5DMIL 3GRGA 2Q3AA 5JIMA 5HHOD 5SX4H 3MRMA 5BRZB 3SDDB 3NQIA 2APTA 5CGTA 3KL0A 3H42L 1RZ7L 3L3IB 3MLSH 2DN7A 3O2VL 3RYMA 3O4LB 1TJHL 3BP6B 4PD4K 1AKPA 2R56H 3WG7B 3N42F 5CCKL 1RZKL 3C08H 2CLZA 2VUKA 3FQXB 4FFYA 4EI0A 1TTAA 1KJ2H 4WO4B 2XCMC 1OE2A 4NLAA 4XGZA 5AYUH 5JO5A 3NBNA 4GEJA 2XWBA 5TFSL 2B0SH 2OCCB 4R96A 3X1BA 2F53A 1E4XH 4CA4A 1IAKA 1MLBA 4G6FB 2GY5A 5IP4A 4AYGA 5I0DA 3JWDH 3N50A 4P46B 3WELA 5KAQG 3EJZC 2VC2L 1XDTT 3KLLA 4HU8A 1PZ5B 2YD5A 1UATA 1WCBB 3IJSA 2J7LA 3IJYB 4Y5VA 1MFNA 5CBAA 2BZ7A 3ASOB 1J5OL 2IGFH 4FD0A 4WW2F 4AVKA 1QFUL 3TBBA 4N9GB 1KTLA 4Q2ZB 1MVUA 5HI3C 2OMWB 3DA0A 3H7BB 2GJRA 5FA4A 5TDOB 3M1BB 4FQQB 4P07A 2EADA 5E4EB 1S9XA 4GP5B 1QQDB 4H8HA 5H35B 4IBVA 3VA6A 5B38B 3V0HA 5LG6A 1EVTC 4RETB 5E8PA 1QLFB 2HRHA 2D4FA 4F7CA 2H1LM 2X1WL 1P9MC 1QRNA 4ESKA 1QNZH 3DKHA 1OAZH 4I9XA 3QNZA 1IJ9A 4KKQA 4N1CA 1IM9B 1CURA 2F54D 3IDGB 2AJXH 3HS0B 3D2UB 3MFFA 5E6IB 3JWOH 5GGTH 4DGWC 3MTRA 3MX0B 5D2NB 2VNCA 4L4TB 5ES4B 5D8JH 3LIZL 5DTFB 2P48B 4XH2A 5I82A 3UAEA 2DQJH 2JI1A 2GITB 1ES0A 3IFLH 4KTYA 3MXWH 3DMMB 3HR5A 5DQJA 3WJMB 5DK2A 3B3IB 3MTXA 4YSAA 3M46A 3GSNB 5D9SB 4NBXB 2DJUA 3G9AB 4MYPA 4AITA 4O02B 5H37H 1SXCA 5BCAA 1R3IL 1U8LA 2X2IA 4UTBL 4PGJA 3ARTA 1RJZA 3D12B 4JPQA 1AYRA 2OL3L 3IE4A 4PWKA 3W0WE 3AM8A 3H3KA 4LGRB 4YK4C 2CO7A 4XZUA 3EGDA 1DJWA 1N59A 2VN5A 1EXGA 1QLRA 1S7RB 4M7LT 5AZEL 2FUQA 3V0JA 4M6ML 1BG1A 2GTQA 1OKEA 1R33A 3TT1L 2VR7A 5LHDA 1VIWA 2IQ9H 1YPZF 2JKWA 4XNXL 4QY8B 3RY6A 2QPDB 2WN3A 4WI7A 1BA9A 2WSPA 3U4BL 4WO0A 3RDTD 3SDCA 3LS4L 3MRGA 1H3PH 2MHAA 4OKVA 5DHMC 2WXRA 4BUHA 4Q7DA 1HL4A 4HEMA 3K0WA 5A7BA 2XSKA 3FTGB 2B9AA 4NQDB 3STLA 3ZDYF 2NNCA 5F6IB 3V4VH 1EJ8A 1WEJL 1XAKA 1FLRL 1SM3L 2HT3D 1K8DB 2ZX9A 4Y8DC 2V2TA 2YBRA 1GVIA 4GRLB 5DK3A 2VO5A 3OKYA 2BP8B 3P4LA 2F74B 4XWGH 1CD1B 4C8XA 5I1IH 3NVQA 3UO1H 2YO3A 2XN9A 3FAXA 2EH8H 3KYOB 1R24B 5C0EA 3MLVH 4YHOH 4EKJA 1NIEA 3B8YA 3NGBB 4Q56A 3EW3B 3MUGB 4ZT1A 2YQGA 2HKHL 3VFOA 4DN3H 2WB1A 4H8QA 3RBGA 1F42A 3EZJB 1AAJA 5IB3A 5I1CL 2J88H 3VFTA 4BQ8A 4JVPA 5F97E 5DEFA 2VJ0A 7TAAA 2IAND 4LLVA 3POHA 1T6WA 1X4YA 2FQEA 4LPUA 3EBIA 4XMKH 1TTCA 2OMZA 3N85L 3P4MB 5GJSL 2AJ3A 4PJCF 4PJ5A 1C1EL 1CN4A 1M6UA 4UT9H 2BSRA 4JM4L 1B88A 3US1A 2FO8A 3L7EB 4XBPB 4HKBB 5KYWA 4WLCA 4N22A 3JUZA 4P4KA 3NUKA 3GK8L 3TPUA 1RPKA 3BD3A 3QDJB 4BV1A 2EUZA 25C8L 2YMXL 4G43B 3Q3GA 3SDDC 4I0CC 3RJDA 4PJGA 4GMTH 1BQ5A 1N70A 3C60A 1B4TA 1IC7H 3QS3A 1DJSA 1KBPA 4QKXB 5IROA 4X5PA 3I6LD 3GXFA 3KWWA 1Y0LB 2ZUVA 2NTFB 1KJ2B 2BP3A 2P5ED 2BY2A 1YPZE 2HX7A 2JTDA 1S3RA 3MRDA 3DTDA 3EDJA 4MMXB 1B2WH 4OJFH 4IHBA 4HPOL 1JI1A 4UWQB 4WO4C 4Y7OC 2YSTA 2DI9A 1S9VB 2HA1A 4JVUA 4ZAKB 4TNVK 3QUGA 4S1RH 3T3PE 5HHQA 2HJLB 1JFQH 5FXCH 2VXVH 2F1BA 2XLLA 4QDGA 1Q1PA 1BG9A 3U83A 2X09A 3EH2A 4P46C 3D4CA 5DVOA 3HUJA 2H1XA 5D1XE 1OM3H 4ZW5A 1TZIB 3RPBA 3NDZE 3UGEA 5E5MB 1QSED 4XCYA 5JIPA 2XNAB 1JK9B 1IGJB 4HDIB 1E42A 5I6KA 3WFCH 4MQ7B 3L1OH 1HCYA 4WUKL 4D9QD 1CT8B 1OSZB 1ZY9A 3RA7H 3IMUA 4R7XA 1KCUH 4NZUL 2Q2EB 4RMUA 2A9ML 3BP5A 5D1ZD 4HIHB 4L4VA 2Y25A 4TUKH 3R8QA 2YMOA 3G08A 5E4EC 3UYPA 4JZJB 1BFVH 3WJJC 3ATBA 4LVOB 2WLHA 4KVPA 5EWIL 5AEAA 2UYLB 3F7YB 2VRQA 4NQEA 2YGPA 3W0WB 4P5SA 4XR8C 2ZOUA 1CU4L 3LQZA 1WFIA 1A3RH 2Q86B 4XX1E 4BA0A 1NSNH 3BO8B 1NPUA 4PJCE 3GKWL 4X5RA 1BGXH 3CMOL 3WN5C 4PRPA 2YQBA 4OF7A 4JO8A 2FJGB 1CG9B 2KBGA 2N59A 5T5NG 3VJ6B 1TEFA 4GKSA 5IG7A 3DMMC 4QXVA 5LBSH 1UXWB 2ZP9A 4NUPA 4WW2B 4X2UA 5JA9A 4B60A 3BVUA 4XBEH 1SY6H 3CHSA 4F20A 3OMIB 1MG3C 1U36A 1SLWA 4I5BB 4F2ME 2Z65C 3EJCA 4N3TA 1LWHA 3GJFK 1CGXA 3ZZQA 4OAWA 3UAFA 1HEZB 5CJOL 2YEZB 2ZOKA 2GVYA 2JB5H 2Q6WB 4YJZL 4EIUA 4GQ9H 1IC5L 4BH8B 4HPYL 3V6ZA 2DPKA 4HKZA 3ZTJH 1ZEAL 4MMYA 5HHOB 4OD1L 3ULUD 2WQVA 1XF3B 5D70H 1MIMH 4PGCA 5F3HB 3GS0A 5IBTH 1OCWL 5ILTH 1OHQA 1ECZA 2APSA 5CJQH 1ICTA 2GJJA 3LKPB 4HCRA 5A16A 2GCYA 1UA6L 1EPFA 1Z0NA 3UTQB 3ASNB 2CUMA 1ED3A 4N6RA 2IALB 4WNQA 1BMZA 1PG7H 5I8KH 1JPST 3BVXA 3MCYA 1YEDA 1QR4A 4LPXA 3PAZA 1MELA 1ANUA 1BZEA 1RCYA 2EKJA 5BRQA 2NTSP 4UNVA 2IANE 3PE9A 1S7QA 1S5IH 4UI2A 4NAJA 2J6WA 3F00A 2E7CA 2BLFA 3WXVL 4HV8B 2B08A 3P4NB 5EULV 5KBMA 3V7AG 3V4VB 1V27A 2W38A 3GSQB 4X80L 2PP8A 2J1YA 1HXYA 4GOSA 4G7VH 4I2XE 4JZNB 5CR8A 1TTFA 1QAWA 1VESA 4GRLC 5GISL 4DEPB 5B1JA 2WY3B 3UMTA 4TVSa 4XMZA 1S7UA 3ZQ9A 2Q7YA 5DJAA 4B5EA 1BZ8A 2RQ8A 4WW1B 4DGUA 4X4YA 3AG1B 3W11C 4JFSA 2TRYA 5D7LA 2X2YA 5FECB 1SXAA 4FQ1L 3C5SA 1BD2E 1ZT4B 3OF6A 1B3IA 4ZYKA 3N2JA 1L0QA 1KELL 4OZIF 4HHAB 4OCRL 5C0JB 1ZANL 1YPZB 4BQCA 3H2QA 4OLYH 1IE5A 5EBWB 1FN4A 2DBLH 3ULUF 2OMYA 1PAMA 2G4EA 4HHWA 1O9ZA 4F7PA 2HKFH 2F54B 2EIZB 3C2SA 2R1YB 4AQAA 4AKOA 4JFDA 4BFIB 1JTTA 4AYDC 2YRPA 3DYMA 4UANA 4JDTL 3ZDYB 3VGFA 4LZKA 3QR1A 1ZE3H 3VYPA 1H3TA 1MWOA 4MD4A 1TZGH 3MRNB 3SO3C 3S8WA 1WG3A 4OZ4A 4L23A 5I8OH 4FL4C 5C8JA 1J0HA 2ID5A 4N0CD 3G5WA 4N2CA 1I8LC 4PYHA 2R2HB 2BCMA 3FSZA 3CHPA 4G8EB 4NQUA 4UM8B 3ZYIA 3P4OA 5EIIG 1EJOH 2ZJSL 3JUYA 1SDYA 4YR6B 2X4UA 4AQEB 5IMOB 5IQLA 3US9A 1T1YB 5TE6L 4ZMOA 2WYHA 3BDYL 4MS6A 1G84A 4MMXC 3TO2A 5ELIA 3WD5L 2X2JA 2ZICA 1ECYA 1E2WA 3DX2A 3FCSB 4X6EB 5TTRA 2CZNA 3X3FH 3OWRA 4ZAKC 1RL1A 2X40A 5J06A 3GIZL 3NH7H 1SMDA 4I1NB 1FZKB 3JWDC 4JHAL 4PJXE 5FO9A 1NFKA 3A6BH 1E6JH 3CFBA 4OBSA 2H32A 4XTRC 4PJCB 1CZ8H 2GJZA 3VI3F 3PHOB 3HC3H 3G5YA 1F8TH 5HYSB 1EK3A 1WUNT 1VSCA 2IH1B 1MCQA 2W92A 2QDVA 2EVIA 3X3GL 4XVJH 2WWKO 2C1PA 4GI6A 3B56A 2ZP0T 3FF7A 3PABA 4ECNA 3U2IA 3RDTB 1OF2A 5T3ZE 3A4AA 2G75A 2ENSA 2FNWA 4NPYB 3DGGB 4YHKL 5E9DD 5HDQL 3CFEA 2YD1A 2ZP8A 4FJYA 2RCSH 4K15A 4F2MB 4NYLB 3WUWG 4HIEA 4YDVB 3PIQA 4CGUB 4BFGA 1DJIA 4KXBA 1QZNA 3WDJA 2PN5A 2DWYA 4JPIB 2V7HA 4PV9B 4HZAA 3ULUE 3EYVB 2B16A 3NA4A 2FEDC 2ZXEB 3DUUB 5GIRB 2APVA 3WGUB 2R1WA 3SKMA 3ZIYA 3TVMA 1UM6H 1HIMH 3S88H 4FQCH 1FNHA 1JXKA 1P4LA 4GSQA 4Y9EA 3L3OC 5D7JD 4F37F 2R0KH 2JKTM 5I1HH 4HF5L 4HIPA 1VZGA 3S34L 4G7QB 3IGFA 4J6RH 4UNUA 3QQDA 1GZPB 4WW2C 5EB9A 1MFEH 1JZ8A 2ZG2A 1XCTA 4NPKA 1A6ZA 3BD4A 1JF1A 2VDQL 4IMKC 4FAAB 2IANB 5LGHL 3BRDA 1N18A 1IAOB 5EO1A 5IW6B 4P5MA 3KL5A 3GB7A 4K0OA 4X6CA 1ZXKA 3QORD 3G5VA 3BKCH 4PJIF 2IDTA 1CL7I 4FXKA 5ECJE 1HHHB 2CDEB 1E9QB 1O7VA 1WITA 4NT6A 2AJZA 3QULA 4TSCL 3VW3H 3U48A 1ZT7B 1ACZA 2CJUH 4HIIB 1U91A 2HRGA 5DRNB 2ZXBA 2FK9A 1FYTB 3C12A 5ABZA 1AQ8A 4ANKA 4KJPC 1F6LL 3EJRA 1RLBA 2DLTA 1TJIL 4H2AA 4MNQA 3VI3E 3W37A 2DD8H 3DV6B 2P5EB 4BXVA 1ORQB 3KBPA 1JGLL 3P3YA 4XWOD 2GSGA 4LGSB 1RK0B 4R7LA 3GDCA 3DURB 2FO1A 3I9AA 4X8JB 1R5IB 3LOWA 3TNMB 1LO4L 4QHMA 3BWAA 1D6EB 3BZ4A 5C0CA 3P73A 1MJUL 3ME0A 3OX8A 2BSTA 3UTPD 3QUZD 4ZW3A 4JB9H 1UASA 1QSEB 2BMKB 2WXHA 1BQKA 4WI4A 1G7PA 3OAWA 3N44F 3W3BA 3D50A 3QZWB 4DEPC 1XF2A 1C7SA 4PJ7F 3U0PA 4X8XA 4PWIA 2JIXD 3NJGA 3S5LB 1A6VL 2FEEI 5ITFB 4PBXA 2AEOA 4M4PA 1CICA 5D1ZB 5E56A 2YLHA 2IMMA 3HE7D 1N0LB 4M29A 4RMWA 3CFKA 5HJBA 3F6IA 3VD9A 4S1SH 2KHAA 1UA3A 2JJVA 4LIQH 1SJHB 3VAEA 5F0LB 4OU3A 1C16B 2R7EA 5CWSA 2PP7A 3QEGH 4K7FB 2MNWA 3LKOA 1SUHA 3GRBA 2KQNA 4KJWC 4JZOA 4DCQA 4FQHA 3BISA 4X83A 4LHUD 3SD2A 2GT9A 4NZRL 1P7HL 2O5ZH 5ANMB 4D3CH 1MFVA 1Q4NX 4DVRH 5KN5A 4JFQA 3T6WA 3FT2A 5EIQA 1MFDH 1QSVA 2BY0A 4PJIE 4DN4L 1THAA 2ROXA 4LEBA 5D1XC 5CLYA 5JPMA 2R2BB 1PZSA 1F56A 5TF1L 3EYOB 4CU6A 4NKMA 3UG3A 2F61A 1BJ1H 3FU5A 3BGMA 3IDJB 1M7DB 1KEML 5ENWA 4LK4A 4GKNA 4NO5B 1WZ1H 4K5PA 4F93B 2FT8A 3L9RA 2X89A 3HZMB 3KPPB 4G1EA 4LAJH 5D5MF 4ZMWA 2DQDH 3EOAB 4NZTH 3KLQA 3HPJA 3O8XA 3ULVD 2GTWA 1BF5A 4OFDA 1ODUA 3GZOA 1TQCC 3DIFB 3IDUA 3LKRA 5DT1H 3X13A 1BQLH 4XAKE 5IMLA 5DZLA 1DZ0A 4W9KC 4OZIB 1LO0H 2EIBA 1ROCA 4G8AC 1GAFL 2D2OA 3FTUA 3BVTA 3RZCA 4LKXA 1QSFD 2UXFA 1S3KH 2IVFC 1IEAA 4QHUA 2P24B 2BOCA 2UZIH 4I4WB 4N8VB 5KVEE 4N2GA 3CZNA 4MMZA 2AABH 4QAMB 2XXGA 5E7BA 3SD5A 4M7LH 3CLFH 3BAYA 2DB8A 5K59F 3OGOE 3CLEH 3LY6A 4TVPH 4RMSA 1D6VH 3RDTC 4E42A 2VDRH 2D7OA 3KHQA 4N0FB 4A7UA 2GSIB 3RX5A 4UTBA 4POYA 4LO9A 2VZ1A 3KBHE 4OT1H 2I32A 1I8UA 1UA7A 2PLTA 4QRQB 4NBYB 1T2QH 1XGQA 4YGVA 5FB8B 3IU3B 4KO6A 4WHDA 3VFNB 3U2JA 4ZUUA 1NBVL 3DO3A 5AB9A 1XIWA 4UOW0 2HT3C 4AE1A 5E2WH 4XC3L 1SJEB 1ZGLB 4UTAA 4UIKH 3GSVA 1DVFD 4G59C 2OMXB 1OCRB 1WV7T 1U4FA 3Q2LA 4HJUA 4J3BA 4ZX5A 4LPCA 5CJXA 1MNNA 1QLEH 2D0HA 2F58H 3I74A 1ADWA 3BH8A 2BIMA 4PWHA 3CSTA 3JQOB 1DSFL 4IIQA 2VQ1A 3ULVF 3MBEB 2VYRE 3ABMB 5JIQA 1CD0A 3QWOA 3NJIA 3L4ZA 2WYIA 1M4KA 1LO2H 4CSTA 4XI5C 5DRWA 1NKRA 1MG2C 2EIEA 5JW4N 2WIIA 3T77B 1LE9A 2WBXA 3MJ8B 1F2XK 3ZX1A 3HLAA 3QCVH 1CGSL 3TBCA 2IFFH 3SB3A 5JHMA 3LSOB 5E6UB 2JJSA 2FO4A 3TA4D 4EVNB 1YVLA 1G4RA 4J3OD 4GRMA 3BD5A 2A6IB 1J86A 2C3WA 4OUUA 1UACL 3U0WL 4Y19A 4HJGA 3K4ZA 5MP6H 4AE0A 2R0WL 1PQZB 1PKQE 4RMBA 1PLBA 2H0FA 1MXGA 4ZSOE 1SOSA 2D2CC 2ZWZA 3KGTA 3MV01 3HRZA 3Q7JA 5L8KB 3QUXA 3M1CA 2YK1H 1H5BA 2OM5A 4MJ4A 3SKJL 5TD4A 3TEUA 4ABUA 4QRTB 2WBKA 4MWFA 3FT4A 4IMLA 2WZPD 1LNUA 1ZHNB 3NCJL 1TZHB 3BKML 4KH2A 5GGVH 1SEQL 4N2HA 2Y07H 5T1JA 5CO1A 4HUNB 2EE3A 4H26A 3ULVH 2VM4A 4GMSH 2P9RA 3DX4A 3RIAF 2OP4H 3OJVC 1XXDC 5HTSA 3H7LA 1XGYL 4KH9A 2WNXA 4NSKB 5DK0A 3REWB 1HNYA 3ROOB 1AQDA 4KRLB 3NTCH 3HZYB 1IGCH 2AKRB 4XPHL 2GI0A 1X5FA 1MEXH 1HL9A 3PHQB 4H1LH 2LU4A 4H20H 5HGGS 3MLWL 4GAYB 4DKTA 3H2WA 3H9HA 2Q8BL 1BAFH 5E1GA 4P2AA 35C8H 2W80C 2FGZA 3MBWB 4A66A 4PJIB 1QA9A 1N4XH 3UEQA 2FQGA 3VVVA 4XP9H 4LARL 1GYAA 1HK6A 2JV6A 1LP9F 5JLZA 2BVPB 3B7YA 5FHAH 3GUFA 3O9WC 1X5JA 1IGYB 5CBEA 5E9DB 4N2OA 1F3JB 5ALBL 4J3OF 1V3KA 1A64A 1JXGA 3KJ6H 4BRVA 4C56A 5D1ZC 3U0TA 3GSRB 1UUSA 1HHIB 4JKNA 4JFXB 4WSGA 3FQUA 4DPAX 5HVHB 2CRIA 3KXFA 2E9IA 2YS4A 4GBXD 1A8ZA 2Y7QA 1TVBA 1HINL 1ERNA 5EC2A 3QAZB 4KGLA 2EEFA 1Q0XL 3W81A 2WWOA 2VMJA 1JZ3A 3L3DA 2E75C 2P5PA 1NBCA 1E4KA 3WFEL 2L3BA 3V5HB 2A4EA 1BJ8A 1YECH 2GKIA 3JVGC 5JYMA 5FUOH 2DDQL 3FN0H 4EZLA 4PFEA 4GEIA 1A7RH 1KXVA 5D7JB 1EAPA 4UYPA 5AW3B 3N44B 1NAKH 2PYED 3L4UA 1LEKA 4JBSA 3O0RH 4PJ7B 5ESVA 4AYMC 5C07D 2A6KB 3L3JB 4IYKA 4JJ5B 3Q05A 2ZAIA 4FA8A 5M94B 3W38A 4D9LH 3S37L 1G0DA 2FD6L 4K3GA 5J6HB 5B7FA 2BWDA 2DWTA 4ACPA 3D69A 2OI9B 3QORB 4JPKL 3AY4C 2W5PA 3APCA 4ODTH 3UJJH 2N56A 4HEPA 1C5DA 1CVRA 2QJDA 4WV1A 3ULUC 4UU9B 5G2NA 1BM3H 2IXQA 5KVFL 2JSFA 5KJRL 1S7XB 3QP3A 2ZG3A 4M62L 2VXUL 2TSBA 4BFBD 4F9LC 5HHVL 5KSBF 4FULA 3HMWH 4KKCD 4M7KL 1PIGA 3MRIB 3QYCA 5E4OA 1KWKA 2DZEA 4YIQA 1IGML 4ELKB 1PFCA 3BIKA 5GS1A 1LP9E 5JHBA 2VDRB 4LLYB 4B9PA 4IHOA 5AALA 1UADC 3GC3A 4NI6A 1VKXA 2F8XC 2BHZA 4ZK8A 1JD7A 1VEOA 3VXMA 1CXLA 5D5MB 4PJAF 3ZN6A 1M6OA 4QRRA 3QUZB 3OD3A 2VH5H 1YNTA 3VFUA 2D9CA 3L5JA 4V2BA 3AFLA 1ITCA 2E6QA 4J3XA 2VXTH 3FB7B 2J3SA 4ZSOB 4NHUB 4AGQA 1QLEB 3ILDA 4MRBA 3O41B 5I6MA 2J72A 2P8LA 1IAIM 5F7EL 2JIXB 2AEQH 1XR9A 3GXMA 3VXPB 4BE6A 4JRXA 4NZJA 1RK7A 3GMNA 3GI8L 3HE7B 5L4IA 3QHFH 5D93B 1IKOP 1HU8A 3OXRB 4WVRA 4P3CL 2BRQA 1KN2L 3VFPA 3RVTD 4XCNA 1Z9OA 3SCMA 1P69B 3FO9A 4HUWA 1HOEA 4LSVH 5CZXD 4LHUB 1U8NB 2NLJA 3QUYD 4BK5C 3MRLB 1L9OA 1FNGA 4L5FE 4GIAA 4MAUH 3CMGA 1XT5A 5F7LB 4S11A 3HBGA 5GGVY 3QIWA 1DQKA 3P02A 4YN3A 5H4YA 2G2RA 3E8VA 1GY2A 4ODVL 5CN3A 4U2YA 1XWVA 1F02I 5F1KC 4N0CC 5A40E 3INUH 3U46A 3QHZH 3V0VA 4FLSA 3WSQH 2CUAA 4ZX3A 3ATFA 3CDZB 4RMVA 5E99L 1BVZA 3RGVA 4EZMA 5KSBE 4ZXBD 4UT7L 2P45B 4AYFB 2VLLB 4X6BA 5DFAA 3PWVA 4WWKA 5SV4A 3AG3B 3ZVVA 4L48A 2XQ0A 4MDIB 2QPEB 4H1LB 2B8OT 3M17A 2C9PA 1QSFB 1YUHB 3S96B 3QRGL 2W9LA 2FATL 1JJUA 4Y4FA 4PJAE 1JYNA 1JYXA 1OPGH 3VXQB 4PP1D 4EBQH 4XNYH 4L05A 2CHDA 2Q20A 4PJEA 4X8CA 4WDIB 4PGDB 4QAWA 3OJMB 1NINA 3M6DA 4G9DB 2EUWA 3S4SG 1QTPA 1EEYB 2YWZA 4PJ9D 1JGIA 4NNXB 2PYEE 4PJBA 3K4AA 3RIFF 4ZZFA 3M86A 4MQXD 5C07E 5D71H 4YQXH 4ZW6A 2EO1A 5DLMH 2Q1EA 4LNVA 3ILQC 2WM0A 3EO0A 3IF1B 1Z6JT 5T1LA 2C3VA 2NY7L 1F2QA 4Y2OA 3IDXH 1AG0A 1GYCA 1PBYA 2VE6A 1KPVB 4NCDA 3V0WL 4PGEA 5DC9B 2D3NA 3H56A 5HVHC 3G04B 1YEFL 2DH2A 1GS8A 1KGJA 3Q9PA 2CCVA 4KUZH 3S3SA 2HSIA 4CU7A 3N1QC 3QAZC 4Y16C 1N68A 1OXYA 4TNWF 1DVFB 3MO1B 1OCCB 4CVWA 3FN9A 4PW9A 1WD9A 5TH2B 1DQQB 3VE0B 2IFGA 1NEZG 3WNIA 2WBWB 4BINA 3STZA 5TQ0L 1EMTL 3CXFA 4X6FB 2YAEA 4GIOA 4FZ8L 2EEAA 2NYZA 2PO6A 4F8LA 4MCZA 4QXWA 2N7BA 4UV4H 5I24A 1U8QA 1HWWA 4MLSA 2NNAB 3WMSA 1EEZB 3QBTB 1GW6A 1LP9B 2H45A 1V3JA 1N64H 3U4EB 2UZPA 3BVVA 1BVKB 1CXKA 2QR0B 4N87A 3N0PB 3V5DB 2XWZA 3IGAB 4NOFA 4G5AA 3Q9QA 1KTJA 1JV5A 1MAMH 3B6SB 5GPRA 3QORC 3BKYL 1FO0H 1OHZA 3FCGA 1DTUA 4X5WA 2WJ7A 4W9IC 2FWUA 4Y7MA 3FFCD 4TSBH 1SN2A 3WFDL 2HUHA 1M3IA 1TJXA 5CEZE 2VUYA 4OLXH 1WFMA 1FF5A 2XQYK 2FBJL 1E3ZA 5DHYB 4F7EA 3DXAA 5BRPA 1EFQA 3B9VA 5JQIB 3ZHFA 5TDOA 5F71A 4ZW7A 5HPMB 2QVKA 3ZRSA 1KCRL 3ZU8A 6TAAA 4CVZA 2DEXX 2L04A 3QVAA 1UH4A 1QLFA 4FQXC 4R5VA 3MOAL 3ATAA 3CVIL 4FXGA 5SX5H 1AHMA 4XWOC 4JPWH 2B2XL 1JS4A 5AD0A 3R7RA 5BQ7A 1V10A 4AC2A 3HI5L 1QI4A 3CN4A 3HS0A 1MW0A 4DP2X 2ATAA 4IIZA 3VRJB 2BVOB 4KU1A 4L4TA 1MIEL 4Z7QF 3T6VA 2VDPH 1NL0L 3P0YL 4KZDL 4WI2A 3P0VL 3MGTA 1MHPH 1J9SA 3E3QC 5AOJA 3RAJH 5IB5A 1YZZA 4B7IA 2X9XA 2YQ3A 2VL4A 2ZSWB 4PBWD 3G5XB 3MNZB 2ARJB 2YPKB 4JANB 1I8IA 4X4XB 5BS0B 2QQLH 4ZO9A 4IKJA 1GYVA 3TV3H 3BRFA 3HE7C 5KW9H 5KAQF 4Y1TA 5D93C 3LNEA 1QHOA 1S7SB 2VLJA 3BN9C 5KSBB 4PRBB 2YWYA 4GBXB 2V8LA 3BPLB 1CYWA 4AL8C 2ED9A 3UZVB 2ED7A 3VFMA 2ZSVA 3SJVD 3V5KA 3PY9A 1KB5H 2X7LB 4F7MB 1F4WH 1LD9A 3QXDA 4KKBD 5CF3A 4KITB 3HAEH 4PJAB 3B1TA 4QXGH 1FGVH 2IWFA 4RAUB 2H1PH 1AE6L 1CQKA 4X5XB 1CFBA 2A1WH 3ARUA 4G8IA 3R8BB 4WI6A 3VU1A 4HLEA 5L7XH 1RZ8B 1JVLA 5GHWL 3I9GL 1UENA 2PYEB 4OJAA 3TIDB 1ZTXH 3US0A 2X88A 1B0IA 5C07B 4XE0A 3EJTA 2X6BA 3M7OA 4JM2D 5FV1L 2VMDA 3KNBB 1W72H 5IHZB 3V95A 1FYHB 3KGSA 4R97C 4Q97A 2VKWA 3O2DL 1WIUA 4C4BA 1I8MB 3PWPE 5F9DC 4GRWE 4YWGH 3GBLA 4LSQL 2F74A 2WOBA 4L0PB 1JK8B 2EIMB 1JGVH 2AJVH 3HB3D 5ABAA 1CVSC 2WXFA 3CBRA 4U49A 1EX0A 3ARWA 3V4UH 3NZ8A 4AG4H 2IG2H 4YFEA 3UTTA 5F9WC 3UYRL 2P8PB 4ZUVB 5I1AB 1Q90A 4ZPTB 3T0EB 3HN8A 4IRZA 4GO8A 1PYWB 3G5ZA 3FT1A 1F4XH 1YC8A 2EH7H 2WKOF 5HXMA 1NCCH 4HJ0D 5B7EA 2RH0A 1YEEH 3FN3A 1UTDA 1KXTA 2AK1H 2BCKB 1NM4A 5JHDA 4RX4D 3CHOA 4FXLA 5C97A 3QA3B 2CLRA 5FO7B 1EGJL 3X1NA 4DTGH 4HKBA 4NO0A 4WJKB 2Z0UA 3ARGD 1WWWX 3F05A 5T5FA 4BEIA 3AB0B 3RNQB 2E9JA 3LEVH 4G43A 2O4EA 3D85D 4RH4A 5C0AA 5LXGH 2ZWSA 4OLUL 2Y0SA 1DVFC 2HYMA 3EFOB 2FJFA 2N7SA 4JM2F 5FO8B 1A3ZA 5I8CA 5F6HI 5KOMC 3OJ2C 5B39G 5DSCB 1UT9A 1WWCA 1JZJA 1NMAH 1EJFA 2OMUA 4O5LL 1SJMA 4HC1H 3PGCA 3N91A 4B3EA 4FNTA 5BZWA 4DVBB 3TH2T 1RUQH 4YLCA 4LEOB 4AYSA 1WYJA 1L6XA 4NFBA 1EA9C 4KRMB 2QFRA 3QQ3B 1Q9LB 3PL6D 2V5TA 1OW0C 3NJKA 5J1AB 1MJJA 1NBZB 4Z7VA 4LLQA 4OBRA 1DVUA 1LVEA 4Y4KD 2NUTA 2DWSA 3LZFL 3QUYB 2CQVA 4YHLL 1FO0B 3CXDH 4J3OC 1MREL 3JZ7A 4AEIH 2FB4L 4U6HA 4BJLA 5ETUB 5KVDL 3CFDB 3C2AL 4LP8A 4L4JA 5KWYC 3WJLC 5LNDA 2MNJB 3U1SH 1PVHA 3AADB 4JO1L 3KPMA 4W4NA 2AXJA 4XAWL 3LRSA 4X7FC 4KNUA 4WQOA 1VERA 2R69H 5KBNC 1ADQH 1D5XB 5CLXA 1JNHB 5LNGA 1XMEB 5IJBC 4OQTA 1GIGH 2WMPA 3CE1A 1DE4A 3BN3B 4X0KA 3HE6C 1CTMA 4OM0L 4ZXBB 1C5BH 3F7VB 3VG9C 3LNGA 3LZLA 5EEZA 1HDMB 4CSSA 4A7SA 3ZSTA 2L7EA 3FKUS 2ZCZA 3FPXA 3OMZA 3QNYB 4LEXH 4PRNB 1J5DA 3X12A 4F8OA 3WU1A 3K74B 3PP4H 3IMWA 5FGBC 2NY1D 3FO0H 3DSNB 5DJ6B 5GGTA 3B1UA 3SJVE 3BO8A 1FSKB 4DUWA 2VDPB 3CUPA 5TQ2H 1D2PA 1G9NC 3FOMB 5KYYA 1CG9A 4ZUSB 5L8JB 1URLA 4KQ4L 4BA8A 1J1XH 5F7AA 4PJ9B 4GW1A 1JWUA 4LVHC 4NM8L 3QZLA 3NACL 2PMZA 3SPCA 1J5HA 4NC1E 3GYRA 1HSAB 5DQ9A 4I5BA 1L6ZA 2X3BA 3FQ1A 2XVKA 4UBDD 1OO2A 3H9SD 1NCOA 3BUQA 4ZMAT 4XC1H 4E9VA 1FBIH 1EIBA 4BH8A 4WY7H 3L9EA 4P5TD 4N0YH 2HLFD 4Q4EA 4G6JH 1U8IA 3L95A 3MRFB 4HD9A 1N3NA 1K6QH 2WZ0A 1FNFA 5LCVL 4P06A 2AJUH 5H94A 4PAZA 2W07B 2ZUWA 3GLAA 1YJDH 3HC2A 4ZFFA 2YD7A 1G43A 2HX9A 3OB0H 1XF5A 3UTQA 1HC1A 3LNFA 3JWNH 3IETA 4Z7QB 2XBDA 5F1NB 1UB6B 3GLEA 1K8IB 2VLMD 5BJTA 3MLTB 3C5ZA 1TJGH 2X4OB 3MV11 3UTZB 1EDQA 4F80A 4RGND 2IDSA 3L08A 3T1FA 5HYIA 1JCVA 1DFXA 5E94A 1W72B 2H47C 1DFBL 5I71B 4GI9A 1JCKA 2F08A 2GTZA 3CFJB 4JFFD 1MRCH 3APNA 4LQFH 1DQIA 3AAZB 5KG9B 4J6IA 1CYGA 3JT0A 2XXFA 3KDMA 4QRSA 3NCXA 4IOSD 4JFHD 1EH9A 1O6TA 3BPCB 2C26A 3FFCB 1INQB 1MNUL 4MXQD 4X9HA 3SKOA 4CMHB 5C2BH 1DLFH 1C8PA 5EOCJ 5EZIL 2FECI 3AITA 4X4ME 5EORH 3DPBA 2P4AB 5T5NF 1L7TH 2Y2TA 4IDJL 4NRZB 2OTWB 1I7UA 1HL8A 5F96H 1JV2B 4M4RB 1NAML 5INCB 3ZZ1A 1UH3A 1CGWA 1SFHA 3DVGA 4G71B 3NN8A 4KHXL 3SGDI 3GMLB 1HJBC 1TQTA 4WFHD 1F11B 4MS8D 4NJAL 1YDPB 1M57B 4UILL 5DA0B 5EBWA 3VXRD 2EYSA 3GMRB 3HHSB 2Y24A 2J4WH 3KPRD 3QEUA 4HLZG 3QUKA 2CKBH 5F6HJ 2ILLA 1E6OL 1CFVL 4TLKA 2EIZA 3ZL4H 1R3JB 2R1YA 2VDNB 2Q76A 5HDRA 5M95B 2PXYD 3EJPA 3WBDA 2D7NA 4HG4K 3QJXA 1ZWIB 1Z3RA 3QI9D 5I6PA 2E8YA 3F7LA 3WY4A 4AVJA 2B59A 3QCTH 4FHBD 4U2ZA 3P2DA 2ZAHA 3AB0C 1RP9A 4PJDE 5I73B 3D7PA 5DJXB 2FR4B 1QACA 4XB7A 1IAIH 5D2LA 3O81A 3WEXA 4Z7NF 2EE0A 3BAWA 5EFIB 1J0KA 4NCC2 3TYFA 3QCUH 4W6XB 3WHE0 2JKIS 2PP9A 2W81C 3ZTEA 5IMOA 2FHBA 1JERA 2Y7LA 4G8FA 4LAQH 4NNPH 1X7TA 3QPXL 1YY9D 2Z4TA 4K9EH 2DYPD 2Q3XA 1ZV2A 2EABA 5DU7A 3MYZA 1NGYB 4MJ6A 2MKWA 3QE5A 1TSHA 3OZ9H 5GJTH 2J71A 2EDTA 2FGWL 4J12A 2OK0H 4XNUH 3PWUB 3QUYC 4IGBA 1ORSA 4G3YH 3QIBD 1T1XB 4L9LB 3U36A 2GJ6A 4I48B 4Z77A 1A6WH 3TA3A 3WO4B 3IPEA 5JW5A 1I7ZA 4LNRA 1HH6B 3FRPB 2N4IA 4LBEB 4U6VL 2WO2B 4NPYA 5G55A 4JNXA 3CH1B 2XWTB 4F8TA 1IQWH 4JM2B 1G1OA 4TOYL 3THML 1KLGB 5C2UB 4ZRGA 2R4RH 3FC8A 4ZFGL 2Z6FA 5DHVH 1V3LA 2VL5B 1KT2A 2YAOA 1MH5B 1D5MB 4FHJA 1SMAA 1S7TA 4W6YB 4G6KH 4MNGB 4QMEA 1Q8MA 5GGSY 3OB8A 3HB3B 2ZE0A 4PJFF 2YUZA 2R2CA 5MHSD 1E7UA 4AIEA 5A2FA 5F89A 2BDNH 4UCFA 4FX5A 4GI8A 5GGSB 2EXWD 2BSEA 4GIPD 1I1AA 4KQ3L 4PP1C 2WIMA 2JCCF 5EIVA 2BRRH 2VZOA 5LBSA 2CPCA 3ABZA 3Q2WA 5C9JB 3P11L 3V6FB 4ZS6D 1SY6A 3LRLA 1JHLL 4R3SA 2XZZA 2DMKA 1XH3A 4G7YH 4XN5A 4CC0A 4MQXC 3SQOL 5CINH 1IAOA 3VGBA 2EDQA 5IW6A 4QRBA 3O6KL 1E27A 1F90L 4JKLA 1YQ2A 4TQIA 5IR1A 1TOXA 2AXWA 3ECQA 1P7QA 2ADIA 2CDEA 2VSMB 3ARGB 4S0HA 4JFHE 2CA4A 1DQLL 3DV4A 4M8QA 3BP7A 3QPQC 4K3JL 1B90A 3KGRA 4ZMVA 1ZLWK 3D85B 1WZKA 1FYTA 4KBPA 4MJHA 1AP2B 1JL8A 1TPXB 3HZKA 1G6RA 1GXEA 3I2CL 1HAWA 1KDJA 3F2LA 3F58H 5SWZD 1ORQA 1W15A 2NW2B 4KGJA 4WFHE 3E9UA 4Y1SA 1WA0X 5A6MA 2FZ3B 4F37K 3AU1A 3P77B 2EC9T 3CX2A 4RNRA 2WOYA 5KSUA 4F9PC 3TNMA 1OLLA 1G7JB 2LGNA 3HNSH 2X3AA 4R2GD 1PS3A 4LSRL 4CKVX 2NY5H 3PL6B 2OYMA 5EU6E 1R17A 5I6LA 1M3JA 3B3BA 5DUPH 3MACL 15C8H 4Y4KB 3UH8A 3J2PA 4UIMA 2HN7A 2BMKA 5DRXA 3ESVF 2AZAA 2EO7A 4QRPD 4ORZC 3P9MA 2V2WA 4AXWA 1NGPL 3FUHA 4CMHC 4D7PA 3ZRCC 5ICZB 1JGEA 4MJ5A 4M48H 3FOLA 4LDOB 3JV0A 1SBSH 5D6DC 3OKMA 1RZGB 1ZA3B 2ZCLL 4P59H 3UPAA 3LKQA 5JMOC 3NPZB 5C0BD 4TRPH 5AL8A 3MCLH 3L3GB 1MWAH 4N20A 5AW7B 3WTYA 3V6OA 4K2UH 4O51A 3ARDD 4R26L 2CR0A 5CILL 5DVLA 4YPJA 4R7DB 4PS3A 5I74B 2CKBB 2CUHA 4GAGH 4MYWB 3EFFB 1CWVA 1FP5A 3IJEA 3RG1C 2NY1B 4GQRA 3FU8A 3HMXL 4L1SA 4MZ3A 4PSPA 3MRCA 3ZE1E 4FADA 4ONOA 2R23A 4YSOA 3DWTA 2OXGA 5C09E 4Y4HA 1PKOA 3K71A 2BW4A 3W2DL 3WFHB 1A5FL 3V9FA 5C0DB 3FU9A 2NY0B 4NFDA 5K39B 1YNKH 4M9PA 2WLIA 3IDJA 1AR2A 1M7DA 5I73C 5HGDB 3D39A 1PW3A 3D08A 2V5YA 1OP5H 5CN1A 4CRPA 1RPQA 4JUTA 4DQOH 3ARFA 4ODSH 5C7ZA 3NZUA 3EOAA 43CAB 1INDL 3T0VA 3FH7A 4AT6A 5LKNA 2XIDA 3H9SB 3CN1A 5BOPA 4FJ6A 5KANG 2HPTA 4U3SB 1MFBH 4RMQA 3S37X 1RZIB 2ZOTA 4FFZH 5DRZB 4P5TB 3VD4A 4E36A 4RAVB 4MRCA 2DQGH 2SODB 3D9AH 2HX8A 5KSAA 4IBTA 2WLKA 2E76C 4HX1A 2ARWA 3MLZH 2C9XA 5MHSE 2K4AA 2AP2A 1X5YA 2JK5B 2P24A 4PLKD 1ZGLP 1CL7H 4TULL 2YC1B 4N8VA 1SXSA 4KKBC 3HNTH 4LT7A 5HVWA 5L2KE 4L9LC 2FLMA 3HCVB 5J3HC 3WNMA 1Y18B 2XYBA 1MRDH 4M03A 3UJTH 4BFRA 3WHE1 4PG2A 1T89A 4HCIA 4Z7NB 5I1GL 4N0FA 4RGNB 3S36H 2GSIA 3U25A 4P9HH 4B9IA 2JKNA 4NC1C 1NDMA 2UXTA 4ABWA 5D1QE 4ZPVA 2H3XC 5E2VH 5AW1B 3IFNL 4JFFB 1H3UA 2B14A 4LOVA 1HTYA 4N90E 2N7AA 1AHWA 5DHVB 3VFNA 4BCXA 1COBA 1EZVX 2IPTH 1JNLL 3GIVB 4CILA 4D0BB 4GW4B 1SJEA 4OIIH 2B5IC 3F3HA 4YEEA 5I18H 2ICEB 2OMXA 5CZVH 1FGNL 5CD3B 4GAJL 3TJPA 3U7YH 2Z35A 4GP4B 4JJHA 1OSYA 4AI7A 2JLLA 3KPSE 3CK0H 5T1MB 3MBEA 3OJDB 4ONGL 5SWZE 3RWDA 3KS0J 3TX4A 4ELMF 4F24A 5BVJB 1VB9A 4MSWA 1JAEA 2XBZA 3HW7A 4DGIL 4YE4L 3LNIA 3VXRB 2X44D 3CH8A 4Y5YB 4HJ0C 3AJ7A 4WFGD 3GHBH 3QUMH 4OM1L 5SV3A 3KPRB 2DMHA 4N5UA 4MCNA 3OAYK 2O61A 4A7GF 1LGVA 4Q9RH 2HG5B 3FT9A 3VRLF 4PRDB 2PXYB 3LDBC 3L3KA 3MA7A 3FUJA 1MUJA 1H8OA 3QI9B 2A4CA 3ARVA 5FYKU 3VX1A 3GUTA 4LRIA 1RUMH 1I1YB 4K9JA 1JE6A 4M6NH 4O00A 2ZUUA 1OAJA 4NWTH 2QQKH 1M9WA 1HKFA 2AZUA 5CN2A 4PJFB 3PQYA 3L4XA 4RIRA 1FFNA 1TPXC 4FG2A 5C0BE 1PDKA 3ELQA 4AVIA 1JN6A 4YC2B 2JKSA 3GI9L 2D7QA 2CO6B 2JCCB 5FA3B 2DMCA 1AKJA 2GUYA 2IDQA 2DYPB 4NSKA 3ROOA 5F7DB 3I3EA 3VXSE 2AKRA 1EGJA 3UTOA 5BXFA 1BYOA 1JHTA 1L9SA 2HT4D 1J8HA 4N2IA 1Q1JL 2O5YH 1ULVA 3PL6C 2ITEA 4GLRH 5T3XL 1TR7A 3Q6FB 2Z64C 2F8VA 4Y4KC 3Q48A 1L7IL 1UKQA 1HI6B 2E7BA 5TGBA 3TNNB 4C4KT 4KAQH 1FG2B 3QIBB 4RFNB 5I0WA 2IBZY 5JORB 3FYIB 1OTSD 3SDYL 4XMXA 3ZHKA 5GS0D 4NEHB 1MCFA 4FABL 4M1DH 1Q94B 5DLLA 1QWUA 3LEXB 3BEWB 3MLXH 3QO1A 5E9DA 3IPFA 4XPGL 2W9EL 4MD5A 3Q5TA 1SLUA 2Y6SD 4ELME 3MV9A 3TBTB 1RK1B 3MA9L 1TZAA 4MBRA 1WAAA 4HJTA 1I4FB 3WYRA 1T1ZB 4J3SA 3RIAK 1K3ZA 3BQUC 3ZUCA 1D5ZB 2CGZA 5I74C 3W9EB 3ZKNC 4F5CA 2ADJB 3DSFH 4M02A 1AGBB 3ZL1A 5ISZD 1T7YA 2G4GA 1GTNA 1TVDA 4YXHL 1FG9C 4CMMB 3BT2H 2OA9A 1A1NA 5DO2C 4BKSC 1KIPB 1WBZA 5FYLD 1E4HA 4NUGH 1BQRA 4HOWA 1YQVL 2FT6A 1Q72H 4HKJB 4Z7WE 3T8MA 4HUXB 2C7UB 2HFTA 1MCEA 3EDFA 3RILA 4BD4A 2X4NB 5IJKC 2A6KA 2HFGL 3BJLA 3CCHA 5CHNA 2X4RA 1DBKL 4NQSA 4YSCA 3L4YA 1DDTA 3VRIB 1OE1A 5IM7B 4Q0XL 4BQBA 5J6HA 1IGIH 2X4SB 3ESMA 4JPVH 1BZOA 3IFPB 3K2UH 4E5XG 2XIIA 1A7QH 3H9YA 3IYLW 5CP7B 3DETD 1QMUA 4AQ1B 1L9NA 3UBXB 3L4WA 1PMYA 3INOA 1EAOA 4AZUA 4P5TC 2HLFC 5GGQL 1TETH 4XP4L 1ZMYA 1U9KA 2XUWA 5E2TL 5SWQB 1CFMA 1OSPL 5HGAB 3WS6A 1D2OA 3LKSB 1B3JA 4OY9A 1XGPA 5DD0H 5SWZB 3WV0A 4NC0B 4LE8A 2GC4C 3RURA 4LF3B 3MRIA 3MRKB 4TQEH 4N0UA 2XV6B 4APQA 4G72B 4N2NA 1IUZA 3DX3A 5DUBB 5JR1H 3LMJL 4HWBH 4RGMB 1MFAL 4RGNC 3ML9A 4R2GB 4BFKA 1NLBL 3EJQA 5FX3A 2CLVA 1YEIL 5EDSA 2GFBA 2C9UA 3QUZA 1SDAB 5AOKA 4QO1B 5LCVA 3MUJA 1KY6A 4OF5A 4JO3H 5L4FA 2CJ3A 3IRCA 3W56A 5I8EA 4EI5B 4QRPB 1A9EB 4AV4A 3JV4B 4F3FA 3ALXA 1SDDB 1N9PA 5C0GA 4HWEL 2ICEC 2ENYA 1RIHL 1W91A 3BSZL 2YPLE 3O41A 2KKQA 4MXQC 1EHNA 2IBBA 1JF6A 4WI0A 3VFGL 2C9AA 3CPLA 4OTXL 2PW2B 4R6UA 4WUUD 3FFDA 1TVHA 5E6ZA 3NEOA 3MCKA 3FL7A 2AQ3A 2FX7H 3NQKA 2XA8H 1KG0A 3UZEC 4G5ZL 1H9DA 5F2FA 2VM9A 2VO8A 3WTVA 1Z5YD 3ARDB 1DEDA 3UG5A 3EADA 1AXSB 3QUMB 4MS8C 5HY9B 2YD8A 1YYLH 3NFNA 1M2VB 4Y5YC 4B27A 4U1HA 3BKJH 5DUMH 3QDAA 3T2NH 1M1SA 4P23A 4IEFB 4JDVA 1AIFA 3BE1H 2Y5QA 2VDKH 2YPVL 3P0GB 1A9BB 3V4PH 4HIXL 2Y06H 1F13A 3IRZA 3QI9C 2NXZD 1TMCB 4K7PX 3VTMA 4ZG1A 2C4FU 5FYLH 5IOPA 2DLFL 1NAMA 2BVQA 4I18A 1G5GA 3EGXA 4N25A 4XOBA 4LCWD 5IW1B 2HVKB 1T4KA 3GRWH 3NIGF 4LCVA 5EPMB 3ZR5A 3QEQD 2JFCA 2E47A 1EEUA 2X05A 3FU6A 3N9GH 1FVEB 3RWGA 4AIZB 4G8GA 4RFOH 4OFYD 1QFOA 4ELMB 3BPOB 4AYFA 2PCPA 3LAFA 4BH7B 3VFVB 2ICWI 4F1ZA 4M56A 1WVZA 4OZHE 1XGUB 4QF1A 3H2PA 3CFCL 4LLAA 3DOSB 3MGOA 2JH2A 5BZDA 3S96A 1A6TB 4FXTA 1N5YH 3QDME 3FUDA 2WW8A 5IV2A 1XGTB 5GSVA 5DMKA 1JPTL 1A7BA 4K94L 1I3RB 5FYLE 4L8BA 3G6JF 3JWDL 4D9RE 3DJRA 2FEJA 3QIBC 4RFNC 1HH9A 3G6AB 4NNXA 1I1FB 2Z34A 2QSTA 2Z93A 1MLCB 5LDSA 2BFGA 1CFTA 4JFZL 1HEHC 5DF0A 3ZT7A 3LKNB 3QNXB 2XPYA 4PP2A 2WVVB 4UT6L 3SY0B 5IHWA 3DX6A 5TDPA 1IQDA 4MA7L 1HVXA 1XGRA 3EDKA 3I02B 4NNYA 2ZQKA 1CDUA 1DL7L 3L3HB 4R0LB 5C0RH 5TPWL 3WAJA 3OZLA 7PAZA 2E7LC 3BW9A 1V7NH 2F53D 4IOFD 4UQ3A 1WBXB 1WIPA 1RHHA 2HVJB 3QC6X 4NQCA 2NR6A 4XO4A 2WQ8A 3F7RA 4UQ2B 5G4MA 5JW4Q 3EYUL 3M8OH 2HJFB 3ZMNA 4KI5D 4D0DB 4IQHA 3FQTA 1P2CA 5F3BA 3KYAA 2VXQL 4HXBL 4JX0A 2BP0B 1G7HA 4GT0A 3ZTNH 3Q2CA 2EXWC 5BNXD 1NTDA 4K8RH 3P30L 1EAQA 4YH6A 1RMFH 1RJYB 2F18A 5L0QC 3MOBL 4XMPL 5A2AA 3L5XL 2J6EH 2ZPKH 4N86A 3RIFK 4ZS6C 5MEOB 4YNYB 2OLDA 4NQXB 3IFLL 3S97C 4A38A 1EQWA 4O58H 1BVKA 1FAKT 3BZFB 2DV6A 4BHUI 4Q9QL 2DMGA 2EVFA 4R84A 2V4LA 5I1DB 5D1QC 1KTBA 4G9FE 3RVWC 4Z3EA 1U2HA 2L8AA 4XMVA 1PX3A 2G5UA 4CC4C 1QRND 5HHXL 4V33A 2YD3A 3ESOA 4W9ZA 2WSDA 1KB3A 4WTQA 1QR1B 5IB4A 4Z23A 4TNWK 2A6DA 4JY6B 1ZTMA 1ZDSA 5EBMB 4HS6B 5LO7A 1USZA 5DHYA 3MRQA 2V33A 5I9QB 2FYVA 3LPFA 3F65A 4DHLA 4WUUE 3RDJA 4Z8FH 3II3A 3AS3A 1J87A 1Z0MA 2Y22A 3EAKA 3G6JE 4K5MA 1ZHBB 1DBJL 3MLRH 4WWNA 2PUQT 3KYKL 1JDDA 2LR4A 4M7ZC 2FWOA 4LLUA 3OKNA 4RSVA 5DJ8B 4KNSA 5IFJA 5D7KE 1WS8A 3PJSA 4LSPL 4GG8B 2AQNA 4WU7B 2O72A 4KJYB 3GNMH 4P9HC 4YPGB 2B1HH 4WFFD 3U30B 3F7PC 4E41E 1RUPL 4TUJB 4QOKE 4I0PA 4KI5F 1BW8A 2YLKA 5KS9E 1DR9A 1TCRB 2Y72A 4UF7C 3SDXA 4DOHB 1HOCB 1FAIH 2FRGP 3HNVL 5FHBL 2AGJL 4YUEH 2X4PB 4E9WA 4BSJA 4YS4A 4QHLA 4ERSH 5EF1A 1TTGA 3QG7L 4Z95L 2AEWA 2AV7B 3V4VL 1VFBB 1T2JA 3PWLA 4FF9A 2QVFB 3AABA 3RI5F 2MPVA 3NPSB 4LCWE 3VFSB 1MVFA 3G5XA 2BVUA 1RFDL 1IKFH 4MHHG 5ICXA 3KGUA 4NHCL 3FUIA 3T0WA 1DBBH 3UO1L 5BS0A 2ETWA 1E8XA 3V52L 5I2IA 2JJTC 3FQNB 4HS8H 5K33A 1A7PH 3TASA 2NUPA 4JFEA 5E23A 1IO4C 2HRPH 1O75A 4FFYH 2A73A 3P40A 2UZXA 3PGFL 1H3XA 1IBDA 1PNDA 1U2YA 3ARPA 3SDCD 5FOBB 2EE9A 2F1AA 4QYOB 3ROLB 4LB8A 5ISZB 1L6PA 2Z4QA 3BHBB 3V4PB 4AQOA 4F7MA 5FW6A 4HSCX 2FUTA 2LV4A 4WZ9A 1DBAL 2XZAL 1P7BA 2XV0A 2ICWJ 5GGUA 5L9DL 5C9KA 4R8WL 5FO2A 1UM5L 4PMFA 3SN6N 3U7AA 1Q9WA 4LOUD 5DJCB 2VXSL 1J5IA 1BV8A 2XN9D 4YHIB 2MCPL 5DJZB 2AFNA 3LVEA 1I8KA 5CJBA 1H8LA 4L1HA 1OF0A 3FQ4A 1DVZA 2FWSA 4ZDHB 4JFYB 3WTUA 3ARBC 1DQML 3QJVB 2NOYA 4S2SA 2H3NA 4WI5A 4DUXA 3HMXA 1UOKA 3E6HA 1NDGB 1IZKA 1UWEL 2F53E 1G7MB 5EUKA 4FZEH 1NFAA 3AUVA 5C0NC 3VXOB 1Q9KA 3BSHA 4AW4A 1KY7A 4ZUVA 5I1AA 4LASH 4PJ5D 4DZBB 3OMNB 3T0EA 4DP1X 4G6AD 2J73A 2PYFA 4P4KD 1I85C 4NZFA 3KPNA 2AANA 1BBDH 3RPIB 3FCBA 4G82A 2C34A 1JGUH 5DZOA 5C1MB 3LEYL 2IDFA 2BCKA 3ILPB 3OHXC 1GZHC 1UXLA 4BFOA 2CO3A 1ETJA 3C60D 1KCVH 2NY4D 4JN1L 4KK9D 1GGCH 5IROD 4YE0A 2GBTA 1BQSA 4BBWA 2FQDA 4WEEA 5BVPL 4G83A 1F18A 1XR8B 3NIGB 4CGTA 2F8IA 4YSTA 3RU8L 5B8CB 4F7TA 4A39A 2I9TB 1IEBB 3C09B 3RA7L 4LOEA 4YDJA 1OK8A 3DUHA 2RA1A 3CDGB 3RNQA 4R0LC 2CO2A 4TUKL 3NABH 5F44A 3K6IA 3WN6A 1FZMA 3AXHA 4X98A 1N10A 3TU6A 1R4XA 4YGAB 2ODHA 3ASWA 1HWGB 4NENB 3NK3A 4E0RA 3H3PL 1NCWH 4M1CC 5D55A 2J56A 4P4RB 4W9FC 2ENQA 1BVLB 2JWYA 4BCYA 3JV6A 5FM5O 4GXFA 1RIUH 2FDBP 4WUUB 5DSCA 3DDGA 4IU2B 2Z91A 3ZE0F 1OOWA 2W9DH 3KWUA 1NSNL 3ZYZA 3G6JB 4FEMA 1ZS8B 2GY7B 5KEZA 2XQYG 4GUPB 5GQBA 3OR6A 4LQ1A 2ZYRA 1E65A 4PYGA 3EBAA 5F9JA 3T8XB 3I6GA 5AW6B 1PZUB 2XV2A 4S1QH 3IE9A 1BXVA 1A3LL 3ZLQC 1AD9B 4L4VD 4E9SA 1J05B 1JRHH 3SE8H 1X44A 2XYCA 3ARRA 5PCYA 4GXUM 1ET8A 2V17H 3QW9A 1BXUA 2WWMD 3DX0A 2NXZB 4GUOA 2A5UA 4Z5RB 4NQED 4PS4H 4PJGF 4Z3TA 3HPLB 1W6LA 4J7RA 4Z9KB 1K2DB 2Y2YA 3N0AA 4H0LC 4PY8J 5I9QC 5L88L 5LGJB 2FL5B 2DWEA 3QEQB 1T2XA 4U1IA 8PAZA 3FCTB 1B4JH 4UQ9A 5D4IA 5TDNA 4PRPD 1BQHB 5ILTL 2I27N 3OG4B 3QJTB 1HDMA 3K6OA 1CUOA 3VB9A 3VGGA 2EO9A 5E70A 3M7FB 3Q8BA 5H37G 5KYXB 4CDGC 2MTPA 5I8KL 1R5WA 3QHTC 4URKA 4MBOA 3U30C 1ND0B 2HT4C 2X1PA 3CDCA 4A7QA 4BE5A 3HUJF 1RJLB 2OZ4H 5D7IE 5J56B 2CIIB 1GS6X 1J1PL 3FOMA 3OR7A 1MCWM 4APXB 7FABH 2WXLA 2KZWA 2R0LL 2YEVB 4RDQG 3VXNA 4YHZH 4I3SL 2XN9E 5I16B 5GS0C 2YGNA 3NPSC 3TWCH 3BIAX 3KR3L 4J4PD 2QSCL 4OCXL 2CLZB 3MJ9A 2YJLA 4NUJB 3ZE0E 2F7PA 4RGOH 4ZW8A 1KCSH 5C7XH 2NNFA 2VDLH 4GFTB 5JO5B 5I1EL 4XGZB 2J55A 4LSSH 3L2MA 1PY0A 2XWBB 4AM0A 4R4ND 4R96B 5F7YC 1OT1A 2EP6A 5BV7H 1IAKB 1AZCA 1KB5A 2W07A 1H3WM 4HGWA 4OLYL 3T6QC 5A6IA 4HZLA 1NANI 4O9HH 5JUEH 3RWFA 3HAEA 4OGXH 4YBQC 2LTQB 4Y5XC 4WF7A 1QFWH 1TT6A 2MOVA 3D30A 5CBAB 3ES6A 3IJSB 4Y5VB 1KCBA 1RUKL 2E86A 1JZ7A 4IRSA 4HT1L 4WEBL 1BECA 3W82A 4ABVA 1Z9MA 3HRPA 2W95A 5F7BA 4OF6A 5DHXB 3PHSA 3S35H 2FSDA 5AUMA 1KTLB 3EKCA 4JQIL 4YHML 2FEEL 1L9RA 3W5MA 4KHTH 5FA4B 4OZGE 3OF6D 3IAQA 4AJVA 4BQ9A 2UX6A 3WJJA 1S9XB 1LO3L 1MSPA 3WDIA 5T3ZL 5E8PB 2DQUL 2X6UA 4F7CB 1FC2D 2DQTH 3BPCA 4HCGA 1LK2A 2R8SH 4NN5B 1QRNB 3W1ZA 2W8CA 4N2LA 3QNZB 2X42A 3VACA 1KYDA 2QQQA 3FB6A 5DCCA 1WCQA 3RFZA 4M4RA 2E0PA 3HUJE 3NEEA 1F4YL 3C9NA 3MFFB 1HNFA 2DAVA 3NH7L 3NJMA 4JFDD 1V3MA 2PR4H 3ZT6A 1NBYA 4KNQA 5DZPA 3MV7E 4S10A 3ULUL 4NFCA 2EUVA 1GSKA 2ZUTA 4XH2B 6CGTA 2ZOLB 1CZ8L 1ES0B 4EZKA 3IPBA 2HH0H 1AJ7L 2BJMH 3HR5B 3P3TA 4I3GA 5DQJB 2KLRA 2VLKE 3DX7A 2UX7A 3OMAB 5DK2B 4QJ3B 4P2QB 5DQDL 5HDWA 3ARSA 1E2VA 4J3TA 4L4VE 4IBWA 5IVZA 1S7WA 1ZWIA 4FYSA 5B4MD 5B8CC 4BELD 4OGZA 2YARA 2P44B 4KY1L 1U8LB 4Z0BH 3W57A 4QI3A 5E08L 1RJZB 4NQEE 1RUAL 3EOTL 4XVTL 4XX1G 2CO7B 4ZMZA 5KTEL 4XZUB 3EGDB 1N59B 5HYSG 4Q9BA 1QLRB 2DJSA 2NY6D 4FS0A 3LHPH 5AVUB 3D3VA 4PRPE 4FNSA 3T4AA 4QJ4B 4NOBA 1BZ7B 4HCRH 1ACYL 1PZBA 3DDFA 1S5HA 3BX7C 4XXDA 1S9KC 4H8VA 4WNSA 1DVQA 1EWHA 1O6VA 3SBWC 1UM6L 4NO2B 1B0GA 2YQ2A 3SDCB 5DHDA 1AZVA 2MHAB 4OKVB 5EEUA 4AYEC 5DVKA 1AZNA 5BO1H 5CEXA 3HN3A 3DJ9A 1ZKAA 3SOBH 3SKNB 3L2LA 1OD9A 4H8UA 1GPOH 3STLB 3U4AA 4XMLH 2BSBA 5EA0H 2V2TB 2YD6A 1J1OH 5T33H 2YBRB 3BMVA 2NXZC 1NIDA 1VGEH 4LLWB 3BCDA 1RIVH 1AQMA 3FRPA 4Q9CA 3WTWA 4GSDH 1NCTA 2XN9B 3CH1A 3VW3L 2XWTA 4PJHB 5C0EB 2CJUL 4JM2A 3J07A 2YGQA 3ZHNA 3TVMD 1RZFL 3EYSL 2J43A 3VFOB 2CA3A 3OKDA 3A21A 5IB2B 1IL1A 5IB3B 3ZE0B 3QG6A 2Y9RT 3VFTB 1MH5A 4JREC 3M88A 1UGKA 1KB9J 4JKPH 3DGDA 4MNGA 5DEFB 3MRJA 1V54B 4N5ED 2D31A 5MI0C 1UURA 1A4KB 2CRMA 4JQXC 4LLVB 1MQKL 2OMZB 3ZTJG 2YXWA 1GGIL 2J8UE 5CFHA 4PJ5B 4OLWL 1T5WA 3DO4A 5I30H 2NMSA 3RX9A 4Y1AA 3AUWB 5KYWB 5J7CC 3DC0A 3ZYJA 4P4KB 3TPUB 5E1QA 1KENL 1RXLA 2AJYH 4GUQA 5HDBE 1DANT 4N3UA 1VFAA 3Q3GB 2IMNA 4PJGB 3QR0A 5AW0B 3C60B 3WO3B 2NY4B 5D7LE 1I8LA 4A67A 2XZCL 2VITB 3GWJA 4MNQD 3KWWB 4AX3A 4MA8H 3TIEB 1BWMA 2VDLB 1BP3B 1H6UA 4HQQH 3MRDB 1G94A 3CHXA 2YGOA 4K23H 1MFCL 2OSYA 1FVCA 3PXJA 1N2RA 3K2KA 2WNKA 4HKXB 4MNHA 2OW6A 4IOFC 3ZTCC 2ED8A 4X5QA 5HHQB 1AP2A 3OQ3B 5C0CD 3H1ZA 4JFDE 4RWYH 2YXMA 1PLGH 3E8UL 5BO0D 3HUJB 2LTQC 1PCXA 3EO9H 5E1IA 3QZWG 2EDLA 2Y7MA 4AMKH 5JXEA 1SOQA 4XCYB 1RZPA 3Q1SL 4M1GL 2GIYA 3S5LG 1E28A 5E6RB 4FTVB 1A7NH 4JHUA 3IM1A 5KVEL 3R19A 5I1KH 3KMDA 3LRGA 3T0AA 3CDYA 1OAQL 1CICD 4X6CF 4L4VB 2HPOA 3G08B 3UYPB 4ZX4A 1HE8A 4M8UA 2WCSA 1NCNA 3QK0A 3BEVA 4FNUA 4MXVE 4U33A 4YXLL 1C8QA 4NN5C 2W88A 5I6XB 3TN0A 2ZT9C 2CDGA 1YAZA 3BAJA 3BAKA 4PB0H 2VWEE 3LH2L 4WTZA 5ICZA 1NGWB 1BZQK 1MW1A 3AY2A 1LEGA 2OJZL 3TZVB 1ZA3A 4BFNA 4FLQA 5DFVC 1DEEA 4PGZA 4HH9A 4W1TA 3S8FB 3L3GA 1QUNA 4C47A 4CAGA 3EJYD 1H6FA 4GKSB 1CK0H 5IG7B 2P5WA 1L0XA 1FORL 4H88H 2Y3AA 2NCEA 4KMTL 1XZ0A 4IMKA 4JL1A 5FV2A 2X89D 5MEQA 2Y2WA 2OR9L 3N41F 3L9BA 2EDJA 3O8XD 1NCAL 3I75A 1SQ2N 4BUGA 2PKDA 1WAEA 3CVHL 3CZSA 2DTML 3CGTA 4N2KA 4OAWB 4OT1L 5C0DA 2ZOKB 4A1RA 2UVFA 3V6ZB 3Q1EA 5ALCL 4MMYB 4PPTA 1U8OA 3RZCD 2F5BH 3AM8C 1MCSA 2XWJA 4N8VG 4LSUH 4PGCB 5E2WL 2JF1A 2V5RA 2VN6A 4EIBA 2WZAA 1UD2A 3D1MC 3OKLA 5A16B 2GCYB 5ADPL 2FX9L 1G1KA 1QLEL 4HH8A 4U3SA 3CBKB 2IQAA 4WNQB 2NYYC 3WKML 4AKQA 2WPGA 1YEDB 4BWTA 4TL4A 2WTOA 4V11A 4DSYA 1K5WA 2V3DA 1U3JA 1S7QB 1T3FA 2JK5A 5BUAA 4KTDL 3NCWA 4FQ2H 1XD1A 4L9DA 5DMIH 4AL8L 2X10A 3FQWA 2IFFL 3D25A 1KGIA 2XVLA 3QEHA 4BYHA 3GZKA 4PD4J 3I9PA 1XIWD 3VSTA 2N1TE 3H42H 1RZ7H 1AIZA 2F7OA 1D9KB 3WEOA 5KYUA 1Z3GL 4AMWA 4LOUC 1S7UB 5CCKH 1X3DA 1RZKH 1YEGL 4KZ0A 5DJAB 5DO8A 4QCIB 1OV8A 4X4YB 4HAGA 1BPVA 1D5RA 2WQUA 5AOLA 2ENJA 2ZG1A 3U79A 3B8SA 5I17B 3C5SB 5E8EA 3PLYA 1MCOL 4ZYKB 5TFSH 5IT2L 4B53A 1TENA 4M3HA 5E8DL 3FTXA 3X11A 1FN4B 2OMYB 4P2RA 1LLAA 1V7ML 2Y69B 5C0CE 4AZ8A 2CU9A 3QJRB 3RE0A 4OVVA 5PAZA 3WEBA 2E6PA 4AQAB 1QEWA 2E27L 1IRAY 4JFDB 4Y19D 2YAQA 1J5OH 5D1XA 1BIIA 4G6AC 5T8IA 2DOCA 1QFUH 5JA8B 4P4KC 1BAFL 1ZVYA 2E8ZA 4MKMA 3VXRA 3RPKA 3QUXD 5H8DA 2AI0L 1ZK5A 1U8KA 3HI6L 1TZ8A 4OZ4B 2O30A 3P69A 4ILDA 5F88A 4A2HA 5IROC 2NY4C 3V8OA 5C92A 4JRLA 1IKNA 1AVAA 1U8JA 2HG5A 4NP9A 4NUQA 3ZQXA 5C0FA 3L54A 4J2XA 3LB6D 1H3GA 3BUTA 3P4OB 1U3HA 4FOMA 2X4UB 3TO2B 3QRFM 4IBQA 4M93B 3A67L 4CN6A 1IEHA 2NY3D 4PJFA 3B9DA 1U21A 4Q6IA 4ZQTA 4F1SA 2Y23A 1CF1A 3LIZH 5FO9B 2JKLA 1W8EA 4HMDA 4ADGA 1LHZA 1HHJA 1KFAL 2H32B 2NY6B 4PHZA 3H4FA 2GJZB 3GSUA 4AW7A 3KPLB 4PU2A 4WCYL 4CUCA 1WFTA 1NJ9A 5A3ID 1IT9L 1IVLA 2BXZA 1II4E 4ZOEA 1G87A 3MGAA 3PABB 1WFNA 4WK2B 3NEXA 1OF2B 3FN0L 1GMIA 3HIZA 1UHVA 2G75B 1QBLL 1QTYT 1R3IH 3CFEB 4C56D 4UTBH 5IESH 4HIEB 1HI6A 3PDGA 5C08E 3PIQB 2DH3A 2DI7A 3SBQA 2NW3B 1J8RA 3KXFD 2F2HA 4D9LL 2V7HB 4LMQE 2WWMC 4XHJD 3PPEA 3NJVA 2ITDA 5DGRA 5AZEH 3X2QB 4ES9A 2O6FA 4M6MH 5CGYD 2MRYA 3LEXA 1XBDA 3RQ3A 3LRMA 1D5IL 2HTLD 2IAMB 2K4WA 2R1WB 5JIKA 1MWAA 4ODWA 3SKMB 4XNXH 5IBUB 3RWIA 4NXKA 2XVGA 1PX4A 3OG6B 1LQSR 4XP1L 4M9OA 1P4LB 4BUQA 3LS4H 3N1FC 3OSVA 2EDRA 1R1CA 1D5ZA 2PWHA 2ADJA 3PRZA 2Q7NA 4LPTA 3QJUB 3HMWL 1PSKL 3L4TA 1XCTB 4DT2A 1A6ZB 5A7EA 1JF1B 1PX8A 5DD5L 4XNDA 1HWHB 1WEJH 4KZEL 1FLRH 1SM3H 2G9HA 5FYJD 3K0YA 3NSFA 2OTUA 5EO1B 4P5MB 5CMAB 1NQBA 3GB7B 4X6CB 2JKJA 1JXJA 3U9WA 3G5VB 1JPSL 1NUFA 2XIBA 4FNLL 1UZ8A 4HKJA 3DYOA 4I2XA 4NT6B 5MENA 4TNEA 1G9NL 1Y1DA 2AJZB 3QULB 5A2LH 4CADA 3I50L 5B1AB 2L0DA 2Z7UA 5DI8A 3FK3A 2X41A 4L5FL 2HKHH 3RNKA 4OCNC 3MXVH 4I1RA 3VRIA 4BKTC 3AVEA 3NJHA 5I1CH 1O7DE 4MNQB 4WKXA 1IBGL 4GG6A 3UBXA 1BD2A 1DVTA 4JY5L 4PW4A 2GSGB 3SE3C 2H41A 5GJSH 4DUVA 1MOEA 2NXYD 4R4NC 1C1EH 5I5MA 2YBGA 4QHMB 3BWAB 3PS6A 1KJVA 1NGXA 5HGAA 3OQRA 1T6BX 4JM4H 3BZ4B 3CZJA 1WWAX 3QT2A 5C0CB 3VXMD 2ZKHH 3AW5A 2B77A 3LKSA 3P73B 2BSTB 3MNMA 3GK8H 2QHRL 3N41B 3PNWA 4QRRD 25C8H 2YMXH 4B0MB 2FJHA 1OAYL 3FHAA 5F7NC 4ODBD 3V6BR 5IFAL 1G7PB 5DUBA 3KLKA 5B1JC 1BAWA 2PNDA 1XF2B 3ZYOA 1HEJC 2I9LB 3U0PB 3U9PL 3LD8B 3BWUC 2OX5A 1R46A 2NNXA 3MBXL 1FIEA 1C12A 4JRXD 3U1PA 4HPOH 1CICB 1XMWA 3K6FA 2E74C 5KVMC 1WE5A 4ZNCD 2ZCKH 2LABA 4EI5A 5CWSB 4UOQA 3JV4A 4D2NA 4LHUG 4OGYL 2CWRA 5K9QG 2RMNA 2XFXA 1TEYA 4JZOB 4DCQB 3SCMD 2EEBA 4N8PA 5CD5C 1SOKA 2QV4A 4FQHB 1A65A 5KBLA 2FJUB 1RZQA 1AXTL 1ASOA 1OB1A 4PJXA 4AVHA 5KN5B 5FCSH 4JFQB 3FT2B 4LMQI 5JPMB 4H5SB 2GB2A 4H8WC 1A47A 1S78C 3QIWD 3ARDA 3QUHA 1E8ZA 5B3NA 4XXWA 4JQIA 4NKMB 2A9BA 3FUEA 1M2VA 4NZUH 3BGMB 2E5EA 2A9MH 2FH8A 4ZUTA 2ATPB 2WHVA 1KPUA 4IEFA 5DVPA 3O3BA 4GKNB 3I3BA 4XN2A 1BX2A 4C56E 2LLGA 3WIHL 2E6JA 3L9RB 4G1EB 1YEHL 1A9BA 1EO5A 5D71L 4Y0GA 1GA2A 5GZNC 1BQUA 3O8XB 2WTRB 3AS1A 2Y5TA 3HPJB 1SYSA 2GTWB 2XX1A 4X4KA 5EWIH 3RGVD 3SY6A 5B4MC 3LKRB 1YNTF 2VW4A 4H1LG 3X13B 5IMLB 1IVTA 2HUEA 1CU4H 3AY4A 2H8PA 4WWKD 2AK4E 4M93C 4RVBA 3ZSSA 3MJ7A 3RZCB 3SPJA 3GKWH 4HULB 4LKXB 3CN0A 1CDBA 2APWA 3MRBA 1F1AA 2E56A 2VWEC 1XH1A 1IEAB 4QHUB 4Y4FD 5ERWB 1FVEA 2BOCB 4AY0A 4AIZA 2V0AA 2HCZX 4L3FA 1QW9A 4OGQC 5CEZL 1ZHLA 4MMZB 2G2NA 1FHGA 5E9NA 4EIGB 3BPNB 3ISRA 4NDMA 3IKKA 1GC1C 1KEGL 2CNZA 2EDOA 1S8DA 5GRJL 4ENEC 3WI9A 3ZGHA 4E42B 5HYQA 1UUNA 2P7TA 4UV4L 4X7DC 5D72L 1XGTA 5EOCL 1XCXA 3BFOA 5FYJE 5CJOH 5T1LD 1UCBL 3WMQA 1KJMB 1RJCA 1XGQB 3ISYA 1ZEAH 3SQBA 1XCWA 4OD1H 3HHMA 4ZUUB 3G6AA 1TTUA 1XIWB 1YG9A 1A14L 1MAML 4QT5A 1OCWH 4EDWL 1JPGB 5DD3L 2CJSA 2WVVA 1UA6H 1FFQA 2VSDA 1ET5A 5DFTA 3ULAB 3FJTA 3RWHA 5SWSA 4IIQB 2VQ1B 3TVMC 2P28B 3QWOB 5CCHE 1KFGA 2PO6D 4ZI8A 4E68A 1DQDL 5DRWB 1SLVA 4AQ8A 2WIIB 4BFEA 1LE9B 2WANA 5EEWA 3HLAB 3WXVH 5IJCC 4N5EC 1P84K 3VDBA 3IKCA 4JDZA 3FBQA 5TK2A 3VXME 3WFZA 2GUOA 2XG5A 4KXCA 5AW8B 2VB5A 2IWGA 4OCWL 3TEZA 4GRMB 4QRRE 3MR9A 4PJEF 3TF4A 4OUUB 3NFPA 4Y19B 2QBWA 4HJGB 5GISH 3KL3A 1RJYA 4PJ8A 4FXKC 2KPNA 1BFOB 2VDPL 3BIBX 3GBNL 3HRZB 4PJBF 2DS4A 2XN2A 3QUXB 4NM4L 5MEOA 1H5BB 3WY3A 4NQXA 5JHDD 4EDXB 4FQ1H 2YD0A 1RZJC 3DXAD 3FT4B 1F58H 4IMLB 1ESOA 4MWFB 1LNUB 3VI4E 4F15C 3J27A 2A4ZA 5IGXL 3VXUD 1KELH 4JRXE 4OCRH 3KEDA 2OMNA 2YFOA 1ZANH 1FJ1B 1NGQL 3FB8A 4OFVA 4AOFA 1UKTA 3WKQA 4GKOA 4PGBA 2DMBA 5D7EA 3HG0A 4H26B 1C9SA 1R5VA 2J5LC 1GKEA 4ODUB 5DK0B 3KYMA 4OFIA 3DOHA 1MZYA 2CCLA 3A4EA 3AWEA 4FI7A 4JY6A 4LCCA 3VD7A 1ZVSA 4JG9A 2NY3B 2W60A 2DQIL 1SPDA 4KXZI 4JDTH 3ZZLA 3B9AA 4MVBD 5B22A 5EZOH 4L4TD 3H9HB 1DHKA 3KLHC 1U8HA 2EEDA 1NCBL 2MPAL 4JRYB 2JTYA 1BMGA 3IK2A 4EF3A 2YSSA 1QA9B 5FS5A 4X7TA 1UH2A 2VABB 4HWBA 4GG8A 1K9TA 3FTVA 2DQCH 2H1PL 5JLZB 3SDAB 1FRGL 5L7XL 4LSDA 1WBYA 2G60L 4YDZA 2ZJSH 1L9QA 1N7ML 1DN0B 4HBCH 5CBEB 1TCRA 5TE6H 3BDYH 1HOCA 1PG7X 3IDMA 4IS6A 5J6SA 3WD5H 4C56B 5CSZA 1CICC 4ZUWA 3U0TB 1XCQA 3FQUB 2O6CA 2VLJD 1W72L 3GIZH 1BZ9B 3KXFB 3TL5A 2Y7QB 1TVBB 5EC2B 4JHAH 2XZQH 3VFSA 4KTEL 5IVXE 4IBZA 5DHEA 5AENA 3L3DB 3QZPA 2KDGA 2F19L 3KM1A 1L0YA 5DMJB 3X3GH 1GJIA 2NRDA 4KOBA 3K6NA 5JPMC 4KK8C 5T1KA 1HZHL 2E9WA 3ULSA 1EAPB 2IH3A 2HRLA 3EJYC 4YHKH 3MAWA 5HDQH 2Q2LA 2TAAA 1BM7A 1X4ZA 1LEKB 5CZKA 3PU7A 5ESVB 1NCCL 4FYTA 1UGNA 2QVTA 4A2EA 3RVUC 1XSKA 4LCYA 3OAUL 2AK1L 4Y9FA 1T21B 4AJWA 1CLYH 3O8XC 5F9AC 4UDUA 1FVDA 5AVTB 1ZOXA 1E40A 5BRZE 2OPCA 4P5KA 2EDNA 4WENB 1DQJA 2RTTA 1U33A 2VDNL 4KKAC 4DTGL 5IHHA 1I7TB 1C5DB 3DVIA 3GRWA 3IBOA 4NQQA 3O4LE 1LL1A 3RI5K 3QQXA 4WV1B 2NYKA 2IXQB 4OCSL 3N55A 4ZDHA 3PFUA 5EH1A 3GHEL 2NSXA 3UTTD 1T04A 3R0MA 4FCAA 4HF5H 5DUJA 4FQXA 4MMZC 1G7MA 4N2EA 5LGHH 2VDQH 4YIQB 3SQRA 4DO5A 3BIKB 3AXLA 2NXYB 4KY2A 4IHOB 2R27A 1TIUA 1T83A 3CVHA 5DZ9A 3U9UB 2ZIDA 1D7BA 1VKXB 3BUYA 1JBJA 1AHKA 1CC3A 3O45A 2FLBT 4Z7IA 3JSSA 3VXMB 4L8CA 2AQ2A 4G80A 4NO0D 4TSCH 1M6OB 1EEQA 2QADD 3NCEB 4QRRB 5DYFA 3RTQC 5DJDA 3DX8A 1OE3A 1YNTB 3VFUB 1XIWC 1PKQA 3CAFA 5C0AD 1MCJA 1XSIA 1C5CL 3QJSB 3R0NA 1K4DA 2EDFA 1CBVL 1NCDL 1TJIH 1P1ZA 2J57A 1A7OL 2MIZA 2UWEA 3OLEA 4UM9A 4ATWA 2XC8A 2P8LB 5CJXC 2O93L 1XR9B 2D73A 1JGLH 2I9TA 1DO5A 4X7EC 4IIQC 3GMQB 4JRXB 3GMNB 3MREA 2DWDA 2R69L 4LP4A 1O7DC 5IHUL 1VRSA 2NY2D 1GIGL 1LO4H 4FFWD 1JZFA 3E38A 2CUIA 2QEJA 4R4BA 1I3GH 4ODHL 5EOQL 4R7NB 3SCMB 2F7RA 1P0SE 5D2NE 3FO9B 4HUWB 4L4TE 1NMBL 2NLJB 4FYQA 4AMXA 2JJSC 5AB0A 2K0RA 2ENPA 3BP4B 4R83A 4IU2A 2DQHL 3IRPX 2COVD 3LHAA 5FFOA 2J6EA 3KWVA 3QIWB 3ZR6A 3TYGH 2ZXWB 5HHPB 2EDDA 4CNIA 5GRVK 2G2RB 2W0FA 3QUXC 4ENZA 1A6VH 1T7ZA 1X9UA 2DY2A 3KD4A 4AGPA 4CVUA 2YD9A 3U82B 1CMOA 1SOXA 3U46B 2R83A 3V0VB 4JY4A 4LU5L 3LB6C 1NBQA 3LN5A 2VLJE 3RGVB 2FLRT 3UIZA 3IMRA 1A4AA 3ARQA 4X6BB 2YFNA 4FP8L 2DTSA 4OF0A 3KPOB 4WWKB 3OHMB 4GH7B 1O6SA 2H5UA 4HSAC 2HJKA 4NZRH 4RZCA 2CAKA 3M17B 2X1OA 1QSZA 1HJCA 4G6JL 2V2XA 4AH2A 6PCYA 4DN4H 5AQ0A 3FCTA 4Y4FB 5JDSA 1RULL 1G4MA 1AGCA 2ZYIA 4PJEB 3BRGC 1T1WA 1KUMA 1KEMH 3OAZH 5A3IC 1UFGA 3K7UA 3VG0L 5JXAL 4PJBB 1YNLH 2OJEA 3CSGA 5FGSA 2EIDA 1KSRA 2ZF8A 1J10A 1PF3A 1KCKA 1WQVT 4Z7VF 4MD0A 3T2LA 1RJLA 3EO0B 2I60L 1K5NA 5T1LB 2C3VB 4Y2OB 3C6LB 3MLPA 1GAFH 1KPRA 1VFOA 2VE6B 4TUOA 4W9CC 1JXFA 3TH3T 2OTPA 4XN1A 3LQAC 4F58L 2IIJA 4OVUA 5J6GA 3IGKA 2AW2A 5T5FH 1RI8A 4ZNEA 3CIAA 5I16A 4XHJC 1OAKL 1L5GA 4ZS7L 3MMEA 1T0MA 1X7SA 2CHNA 1Q0YH 2ZXGA 4RBPH 3T5WA 2WLMA 2VMFA 4NUJA 3STZB 5EORL 2X6CA 2BH0A 5BW7C 1HCZA 3VFWA 2PO6B 3S3JA 4NKDA 3RL1A 3C5ZD 3ECUA 5IQMA 4MCZB 2MCG1 1KXVC 1U8QB 5C3LD 4OLZL 3O4OC 4ABQA 4CC1A 1ETZA 2VTFA 3EH5B 1OW0A