4JO5A

Cbm3a-l domain with flanking linkers from scaffoldin cipa of cellulosome of clostridium thermocellum
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
170
structure length
170
Chain Sequence
NTPVSGNLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRFAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWGKEPGGSVVPSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a family 3a carbohydrate-binding module from the cellulosomal scaffoldin CipA of Clostridium thermocellum with flanking linkers: implications for cellulosome structure.
pubmed doi rcsb
molecule keywords Cellulosome anchoring protein cohesin region
source organism Clostridium thermocellum
molecule tags Cellulose binding protein
total genus 38
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4jo5A00
2YLKA 1NBCA 4B9FA 2WOBA 4B96A 1KFGA 3TF4A 1GA2A 2WO4A 3ZU8A 3ZQWA 4TF4A 2L8AA 1G43A 1TF4A 1G87A 4B9CA 2XFGB 1K72A 2XBTA 4B97A 3ZQXA 1JS4A 2WNXA 3ZUCA 4JO5A 4C8XA 4B9PA
chains in the Genus database with same CATH superfamily
4G70B 4LU5L 4TN9A 2VDNB 4TVPD 1MHEB 2B16A 4GG6B 1MUJB 3ZIYA 2OCCB 4U1KB 1SDAB 3LNHA 1FO0A 3TPUA 3EADA 3K4DA 3VFRB 2VTFA 4P4KA 1MCSA 1HI6B 3HEIB 1GGBL 1U36A 2VLRD 4GBXD 4MMXC 2EIBA 2B5IB 3OQ3B 4OCWL 4ZFFB 3MI6A 3HNVL 2NX5D 1A7NL 3SO3C 2GKIA 1YPZA 4Y4KC 2PPEA 4RZKA 3CLEL 3BN9D 4IJTA 3SYPA 4KBPA 3ARBB 5CSZB 1WT5A 4YSTA 2I60L 2TRHA 2AV1B 3F04A 1A6WL 4IS6A 1GAFL 1WK0A 3D07A 4APQD 4J3UA 3RWIB 3L1OH 1HH6A 2XI9A 3K4ZA 4OZFG 2VLKD 3V5DB 5FUCE 4M93C 2HWZL 5D5ME 3RTQD 4NXKA 3WNMA 4BGDA 3STZB 4K5LA 1W72L 4XC3H 2G4EA 5MENB 1ZK9A 4F2EA 2DIAA 3AREC 4LRIC 4NN5C 3A6BH 3VI3E 1PW3A 3EYFA 4GRLD 5C7ZA 2JCCF 3EJPA 2X2UA 1NDMB 4TLSA 5BS0A 1BBJB 4OIIH 1RVFL 1FRGH 2FZ3A 2LE9A 2YAQA 3MUY1 3RB5A 4X4ZA 2EEBA 3SZ6A 3BVNB 3UYOD 3VXMA 1TQBB 3KPRD 1XSJA 4OD3L 3TZVC 1BYPA 1CFTA 2QSTA 1AYOA 4LLDB 1JXGA 3RGBA 5C0RL 4XI5D 1X5MA 1MRDH 3H9YA 3P4MA 1URLA 4DKDC 1RPKA 3ZR5A 5DURD 4URKA 2Z31D 2ERJB 3FQUB 1NPNA 5FYLL 5AWNH 4HIEB 4LLQA 1U2YA 1VENA 3FFCE 1KJMA 5D55A 1YJDL 1KB5H 4N0YH 1T1XB 5DQ9B 1FAKT 3WNJA 2YARA 2WLLA 5EBLA 3ZUNC 3N6YA 2MKLC 3OKEA 4YFLF 5FGBC 2NW2A 3N9GH 2VT0A 3TNNA 3HZVA 1KTLB 2FSEA 4QXTA 4NIYE 2IH1B 4A04A 4DO4A 4KKLC 3D8MA 2VRQA 5JOPE 1QFOA 4BYHA 3QNZB 3VWKB 5LXGH 4PV9B 1PU0A 2JIXA 2O6EA 4FX5A 4I5BB 5SX5H 4AQAA 2MSPA 5TE6L 2IDCA 4E2OA 2ZSVB 3OLDA 1FGVL 1PQZB 1CDIA 1NBCA 1BWWA 2XV6B 1EEZB 1FNFA 4U6HB 1RFDL 1CF8H 1RJYB 1AKJD 4YHNA 1MWAB 5E2TH 4MQ7B 1ZSHA 5C6TL 4ZUVB 4YOKA 1JCVA 1QFWI 5F0LB 3QO1B 5J1AB 5B1AB 4IIQB 2J12B 5DHMC 2Q7YB 3WLBB 2BCKA 2ICCA 1SXCA 4EXKA 3FOLB 2ITCA 1X9RA 4WF7A 3DX2A 4ODSH 4QRAA 4Z3FA 4W9ZA 2XQYK 4G9FD 3ZDXB 2UWEE 1FG2A 5L8JB 2EDYA 4PREB 2P7TB 4OLVH 3PNRB 3BAEH 3EJUA 4KJPC 3F8UB 1H5BB 2BHYA 3D0LA 1OARL 5CGTA 2YKLH 3UJTL 4P9HC 4RX4D 2OZ4L 1YG9A 1OL0A 5JQHC 3R4RA 1IAMA 1X5AA 2EIEA 1Q9KA 4FQJH 4QLRA 3F6IA 4P46D 4Z7WB 4J4PA 1SN2A 3PGCB 2NSXA 2Y5TA 4RDQG 1QTSA 4MSWB 1FH2A 1QEWB 3GO1H 4UOW1 4GOSA 3T2QA 4R2GC 3VXNA 4OJEH 5F21B 3U1PA 5TGBA 2ZXAA 3D25B 4OCRH 3BO8B 5I1LB 1AR1D 2WQSA 3L3GA 3MA9H 4JR9L 1E40A 4TTDC 5GGQL 4NWTH 4UV4H 1XZWA 4XVTH 2HKAA 1T5WA 1BAGA 4FQCL 4N26A 4QHLA 5EU7E 5DVLA 5F1IB 2VDRH 3BDBA 4NKIH 3KGUA 4B5ZA 4CUCA 3QRFM 1IMHC 2A9MH 5BO1L 4GT7A 4P3WA 4RMBA 1M6UA 1KY7A 5I19H 3IDIA 2DWEA 2BZ7A 4P8QA 5J5EA 4PBVC 4R6UA 4WI6A 1SEQL 4IJ3C 1OAUL 3K6OA 2AQRA 3WS3B 3ETBF 2EVJA 1BXXA 3R0NA 2YA1A 1XVSA 2E27H 4NQQA 3QYCA 3O45B 3M7OA 2DYSB 4JFDE 5C0ND 5I17A 3FUHA 1U8CA 1JZDC 2VH5H 3D6GA 4HPYH 4HP5A 1S9WA 2AK1L 3GIVA 3GJFK 2JK5A 1O5DT 4Z7VB 1MFVA 4ZNCD 4H25A 3H9SA 3D9AH 3I75B 4NO0A 1N7MH 3HG1B 3CN4A 4HPOH 4XC1H 1A6VH 1MAML 3SGEI 4EIUA 1TFHA 3ZTJH 4AEIH 2P8PA 3NCBB 5D96C 5FA3A 3TTSA 3CVIH 3LRSB 2BFVL 4MFHA 1TMQA 1L9OA 2I24N 3LS5L 1U8HA 1E4KC 4MB4A 2UUDH 4YHZL 2VISB 5EEUA 2RCSH 4GG6E 4FS0A 3TFBA 3LKNA 3W9EA 1LGVA 4BXSV 1PZ5B 4Z18A 3CSYA 2OV0A 4PJFA 4I3SH 1I1YA 4FP8H 4JM4L 3WUWG 12E8H 4CDGC 2JI3A 3S37H 1EXUB 2AJVH 3GZQA 5EEZA 1IIIA 4G42B 3AY4A 4GQQA 1KXVA 3RVUD 1E4XL 4NZTH 1F2QA 1KB9K 1AD0A 4GKLA 5A6IA 3IN0A 3L9EA 3HHSA 4R4FH 1M1XA 3ARFD 4M56A 4TL5A 2C1OB 1LE9A 2Y7QA 2BOBA 2W9DH 2HLFD 1TPXB 3E8UH 2NCEA 1BOYA 3BE1L 4E42A 2QHRH 1P7HL 3V2AR 1Z0NA 1N9PA 3Q2NA 4YHOH 5IR1B 3ASOB 4JANB 4YE4L 4PJ5A 4XN7A 4PLKC 3VA6A 4IOSD 2K8QA 4ZX6A 4ORZC 3QPQD 4R96B 1UYWL 5DR5L 2FH8A 3HNSL 5D70L 3U6XS 43C9A 5MENE 1HILA 1ODAA 3HRZA 3Q9PA 1CYWA 4PJ9B 2DLEA 2WQWA 4QOKB 5FYKD 3KDMA 4A55A 4JVPA 4UU9B 4X83A 4KKCD 1DVFC 1YY9D 3I6GA 2JF1A 2ED8A 4G43B 4P23A 3WFDL 3WN6A 4WEMB 3D34A 2AXGB 5MEPA 3NBNA 2XWJA 3RWJA 4WI0B 4KMTL 5DHVH 3WHE1 3ZQWA 2WTRB 1M2OA 3FF7A 4MWFA 4F7PB 5I5IA 4E68A 1VGKB 3NACH 1ML0A 2F54D 5EOQH 3TA3B 1U4EA 4QY8A 1TJGH 4K5PA 3SGDI 5CAYB 1INDL 2E7DA 4U1LA 4AKPA 5DO2C 1I3VA 4YSAA 1FH5L 4IDLA 2GW5A 1QBLH 3D09A 1RIVH 3MLYH 3RVXD 3DV4A 4GW4B 4KXZH 4LCIL 1OPGL 4KJQD 5JXAL 1AO7D 2QZQA 4PJIB 4G1EB 2BW4A 5IZ7A 3OB8A 3MV7A 3REVB 5FO8B 1J8SA 5I76B 4KH9A 3DMMA 3OF6A 4Y2NA 1E5YA 4M6ML 4XPAH 1YPZF 3OVUB 4HHWA 3ZGIA 2BP0B 1IM9D 5F7FA 2VR3A 3L4UA 1U6AH 2DQJL 4RMUA 1FPTL 5GRXG 1JK9B 5IK3B 3CPLB 3RIAK 2WM0A 3EYUH 1IE5A 1V7MH 3O8XB 5BNXD 4LAQL 4XNBA 3FN0H 4RMRA 4PBDA 4GMSL 3K2IA 5D9SB 3CFKB 4X99A 3F12B 2BRQA 4GSUA 1TQVA 3RWHA 1B0WA 2J57A 4AMKL 5EF2A 2VM9A 2WKLA 4QHNA 4AUYA 1EDQA 2D9CA 2ZE0A 3QAZB 3N04A 2E4TA 4NKMA 5DD1L 5GGUB 3B7YA 4UILH 5CJOL 4QXGH 5DZLA 3T0EE 4NKOA 4EBQL 4E0RB 2XZZA 2TAAA 4PJXA 1GSKA 4G5ZH 1F3JA 4AEFA 1EGJA 1FFNA 4UV7L 4IGBD 5DJ0A 4YX2H 1KF9B 4OM0H 2F5AH 4AM0A 4HUCA 2R1XA 1G5GA 4TUUA 3ZYZA 5KBLA 5HY9B 2VDKL 4BE5A 4BZ1A 4BFJA 1GYCA 4N9OB 5C0EA 1L9TA 4KY1H 4L4TD 4GH7B 1RL1A 5ICUA 3AT8A 2AQ1A 2PR4H 2I26N 2ICWI 3LS4L 4K7PY 3GSNH 3QDJD 4FXLA 1MFEL 4D0CB 4X6CA 4P3CH 3UTSB 2K6ZA 1WT5C 1IFRA 4JCWA 1H3PL 1EJFA 4U7MA 5IP4A 1XGQB 2EVHA 2ZOLB 3T6XA 2G75B 4GQ9H 3D2UD 5C0AE 2XUWA 5AZUA 4EZKA 2DQCH 5JA8B 1C5DA 4Z7WE 1TLMA 1DVQA 1E2ZA 1VLXA 3BC9A 5AL0A 2BNQA 1CD1B 1OK0A 4UNUA 3N42B 4GKOA 1SY6L 3GSUA 3WY4A 1UWEL 2KZKA 5BVPL 4K23L 4Z78A 4LSRH 3QFJB 3IJ9A 4ZFZA 4Y8AA 1F4XL 3SY6A 4F57H 5AW1B 5DD5L 4MAUL 2X4UB 1PZSA 1CLOL 4DZ8B 3MV8A 1WCQA 3E0GA 4JG5A 1K4DA 5D1ZI 3ZKND 5AB2A 4I89A 3VDBA 4K3EL 4NAQA 3BLPX 4QJ4B 3QQDA 4O00A 4LCUA 5AEAA 4JO2L 3RUGE 2JB6A 1SNRA 1U21A 4OZGA 1H3WM 4PJAE 5I24A 1SFHA 3H3PH 2VLRA 4IBLT 3PHOB 1YSOA 1ZT4A 5JIPA 4X4XA 2VKWA 5CP7A 1DO5A 3GI8H 3RVTD 3B2VH 1Q0YL 2NX5A 3ZSSA 4CMHC 3K72A 4MHHG 2A4ZA 4YZWA 3M6DA 5AG8A 2QSCL 1B6UA 3ET9F 4N8CL 1B0GA 1DFXA 1OSZB 3MRFA 1G9NH 1BCIA 4Z7VE 3RY5A 3EG9B 4LPXA 4FABL 2FBOJ 4HSQA 4APQA 1A64A 3FO0L 5C2BL 2FX8H 1JHTA 2R59A 2VLKA 3LPWA 1A3LH 2EXSA 5KSBA 1E0OB 3RTQA 4J8RB 1SQMA 5MHSD 2N4IA 4TUOB 3KXFA 3HI6H 2PWEA 3L81A 5EPMB 4GRLA 3FUEA 5HDBE 4TTGA 2Z7UA 4IOFC 3RX9A 4HUUA 2FATH 3MBWB 1F97A 3WG7B 3DVNA 4N20A 2CKBH 1I9IH 2HUHA 5GS0D 2RFXA 4AQEB 3ELAT 3ZE1F 1CS6A 5MEOB 3QUXD 1XHHA 3GXDA 5GRZA 3UGEA 2BDNH 3QI9D 3ERXA 4JVUA 3OQRA 5DJAA 5HP5A 2APFA 1HINL 2OCFD 3BKYH 3U1QA 1CLYH 3BXNA 2Z31A 3CU7A 1XAKA 3QZWG 2OK0L 4GG8B 1NOLA 3ABZA 4MX7B 1BIIA 3KPLB 5F3HA 1FDLL 3HC3H 1NGXA 2K1MA 4MJ6A 4W4NA 5ICZB 2ZWSA 2XV0A 4H8QA 3QDAA 4N0FA 5ENWB 1M56B 3H9HA 4O4YH 4NP4H 2AK4D 5DZVA 3BCFA 1UURA 3FU7A 2BSED 3LB6C 2I07B 4U0QB 1JNHA 4HALA 5LAPA 2R15A 4LIQL 3UPRB 3FYIB 2EDHA 3MBXL 3L3OB 2NDGA 1WLHA 5E2UH 2A77L 3VXUB 2FVNA 3R19A 1RP9A 1WFMA 3HRPA 4JDVA 4RRPG 5KN5A 3FO1A 1BOGB 1OAQH 5K33A 3DK2A 4OQTH 3D08A 2J7LA 4F7EB 1NBYA 4LF3A 3QFDB 5HYQA 1E5BA 3BJ91 4QHKJ 1EEUA 4YZFE 1HWGB 1YQVH 4AQ8A 1H8NA 2A38A 2FQGA 1BMZA 4OZFA 1PFCA 4AV0A 1DSYA 2R9HC 1QZ1A 2LU5A 2YBRA 3ABKB 3DWTA 3PWLB 3RZWA 3ZKXB 3DGGA 4UIMA 1JGVH 1K5NA 4YQXL 4H0HB 1CO1A 5CILL 2H9GA 4HGMA 4ELDA 1T6BX 3RWDB 4JN2B 4B9IA 2LTQC 2YPVA 4ZTPH 2EDMA 4PMEA 4FXKB 3WY1A 2VIRB 3RVVD 5GRJH 2Y5EA 3VSQA 4DN3L 4ODBD 4PJIE 4G9FA 1TQTA 4ZMVA 4CKVX 4NN6C 3BJLA 1S7WA 2GTQA 3EUDA 4QKTA 5DJXB 4UDUB 1I7TB 5ACLA 5IBLD 1HZLA 3D51A 4WTZG 3TBWB 3PJLA 5TF1H 4MNGE 1OF2A 1KCRL 1ZHNB 3CK0H 5HJBA 4DKTA 4TNWF 3WTWA 3RURA 3VRJB 3FQNA 3IFLH 5KBMA 5C0IB 1T2QH 1FZJA 2P28B 3WFEH 2HJFB 2XBZA 4OI9A 2UXVA 1GYAA 3ETSA 2IOIA 4P46A 1UTDA 4R8WL 1QHQA 1WBYA 4QHUA 4UT7H 4U1SA 4C56B 4Y1AD 3HC2A 4YHPB 2ICES 1OTSD 3U4EA 1NLBH 5FO7B 4L37B 1GXEA 4TULL 2XZQL 3IF1A 4F91B 4I13B 3UH8A 2AXFB 4UAOC 3I02A 5EIVA 4POZC 1GH7A 3X17A 2EVIA 4MQXD 8FABB 1ED3A 3KLAB 4XZ4A 3AY4C 2GBAA 1P2CA 3PWPD 4MDJB 4PB9H 3OTTA 2IALA 4L0YA 1KXVC 1HCZA 3KYKH 4NEHB 2L4OA 4ANVA 5LWYL 4K8RH 2B39A 3P02A 4LFHD 3P54A 3PABA 4FCAA 1MW2A 4QTIH 4ZZFA 1NMCB 1VF5C 2JWYA 4J6RL 3G9VA 5D8JH 2BSSB 4IEFB 4M8QA 4P5RA 4ODXA 1I3UA 4RFNC 3DRTA 2BNRE 3O2DL 2OYKA 5LGKA 1J88A 2OI9B 1EUUA 5ERWA 1T22A 5GGRA 3MRNB 1AJ7L 1YEGL 2QADC 1G4RA 2J2ZB 1NAMH 2AERT 1INEH 3BEWB 1G7QA 5AVTB 3EOAA 1FO0H 3QIBB 5LJYH 3HRZC 2AKRB 4UI2A 1MQKH 3HLAB 4LP5A 3LZOA 2HT4D 3OAZK 5D7IE 5JR1H 3KHOA 1EHNA 5E00B 2DWYA 2EDTA 3Q3GA 3QFJE 4P23C 4BH7B 4WKZA 3WNLA 4UUJB 1ORSA 2Q9OA 1YEFL 3P2TA 2I9LA 2N1TE 4BUHA 3WYRA 4OZHA 3L9BA 3ULUD 1NCJA 1YRKA 2CGRH 3DA0A 1BZ7A 3MGOB 4JRYB 3FRUA 3QUMA 1P6FA 4OGYL 2EYRB 3P0YH 2VO5A 1CB4A 1CGSH 3MTRA 5FYJU 3D0VA 1YNKH 3U0WH 5EEVA 4HH9A 4PJXF 1HQRA 4JKNA 4XMKH 2A0LD 1BFSA 1FGNL 4JY5L 4KV5E 3ISRA 4XPHH 2VDOB 4UQCA 5FGCB 3DMMC 4JDTL 2C9UA 1KGXA 3LNIA 2P43B 2WIMA 3V52L 2WLHA 3TJHC 3CZGA 4K15A 1OOAA 1RH8A 3P11H 4X6CF 4K7PX 5SX4I 3FTWA 1U8KB 4TSCL 4EDWL 5TDOB 5JHAA 4IOSA 5I1KH 1OB1B 4JVWA 3N5AA 2AJZB 1IKOP 4XMZA 4KUZL 1UB5A 3MXVL 3OGCA 4TOYL 1QYGL 2H6PB 5DYOA 1UXSA 1IGIH 3M07A 3DJZA 5F7AA 1AGCB 1RZQA 3EOTL 4LNRA 2Q0ZX 3P9MB 2UY6B 4KO5A 2O5XL 3BH9A 3EH4B 3ELQA 5CGYD 1I8IB 4BQCA 1WZ1L 2GK0A 3REWB 1D5ZB 1KN4H 2AGJL 1ACXA 1XEUA 1FIGL 2QFRA 2EDXA 3KJ4B 4KPHL 1QLEL 1GGCH 1SF5A 2BOCB 2YIHA 1A22B 4ORGB 2NT0A 4OB5L 1CL7I 4W81A 3BKMH 2YXFA 3RBSA 3ARWA 3MCKA 5FF6B 3EFFB 1BJ1H 3BT2L 1J12A 3TNMB 2JKTM 3UTZA 3VGHA 2ENJA 2R29A 4OZGF 5GS1A 4MXWH 1AO7A 3DIDA 3GS0A 1BXUA 1XF1A 2CIKA 4A6YB 5IY5B 4KQ3L 3WIHL 1FWXA 4QRRD 3HC0A 1U8OB 3VCLB 3WUWA 3KPQA 4C57C 1NGWB 4L8DA 3FCTA 1W8OA 5DJ8A 2APSA 2R0LH 4G6JL 3CZLA 1IM9A 1F02I 5T3XL 2C9XA 2W9EH 1DCEA 2WD0A 4B95C 5C8JA 3GHBH 1PG7X 2DMBA 3VXUE 3T9WA 1L0YA 3PWVB 2OSXA 3LRGA 1CBVL 1FFOB 3G08A 3UJIL 4LLUB 4ZUSA 4E9YA 2K4AA 2FH6A 1JXJA 1A6UL 2YGQA 2EYSB 4RAUA 3NG5A 5KSBF 1UXWB 3OKNA 4G8AC 5BRZB 5CR8A 3VMPA 1JPST 1MI5E 3HE7D 3C2AL 3DX9B 4L8SB 3ZKMC 1ZKAA 2WQAA 5EF3A 3I74A 4M7KL 5DRWA 4KXAA 4LCYA 3P9LB 5KJRL 4WKXA 2VSKB 2EKSB 4XWGL 2PW2A 5JNYB 1QP1A 4RIRB 2FGWL 3MUHL 4L9DA 5JOPD 1TJIH 1D6VH 3DO4A 3P4NA 3T2LA 2DBLH 4IKNA 3SGKA 4IGBA 1OCWL 3U9PL 4PGCB 3ZVVA 4C59B 1U2HA 2VDLB 2X89D 3BUPA 4PIRF 3CVHL 2A9NL 5DEZA 3QXUA 1D5XA 2KKQA 3Q5OA 2WCGA 4L4TA 2ESVE 2YBGA 4RWYH 2FHCA 3IJSB 4RWHA 4D0BA 1JNJA 3D39D 3QDJA 5FAAA 3BN9C 5JOFB 3KYNA 1RJZA 4FFYL 2MQCA 2EADA 2ICWB 2LGNA 1ADQL 4FEIA 1MCPH 1T21A 2V9UA 4NHCH 4EN3A 3SD5A 5HPOA 5DUBB 3LQZB 2EDKA 4MD0A 5AAWA 1YUHA 4IHOA 4A37A 4HT1H 4UF7C 3RTQC 3WEMA 4TXVB 4NSKA 1DVTA 2CDGA 4LKCA 4Z7AA 5TK2A 2N7BA 1Z66A 4N1CA 4GRLC 2FIKB 1D5BB 2DI7A 1Y0LA 5I1CL 1B4TA 1ODUA 1QWUA 4HBQA 4JFPB 4NZUL 1N0LB 3E7JA 5LGJB 3HAEH 4AH2A 3MRDB 3TYFA 2KH2B 3JWOL 4G8IB 3TBSB 3WE6B 4OY9A 5DTFA 4FQXB 4HOWA 2YEZA 3I9AA 1TSRA 4XI5C 1MN4A 1XSOA 1BQ5A 3PUCA 3MU3A 1D9KD 5D1ZB 3BHBB 1OWRM 4FN0A 4DOHB 4PJDA 2Z31C 2FK9A 3PWUA 3K74B 5IOPB 5IQ7L 1LK2B 4MJIB 4PJEA 4QRSA 3IFPB 5HYSA 1NIBA 2K7QA 1MHCB 2Z1KA 4LSQL 1U92B 3B9KB 4OJYA 3THML 1BJ1J 2CLZB 3GJFB 4YL4A 5T1DH 2K9UA 4Y2DB 5KSAB 1DBKL 1WIPA 2XJKA 4APXA 3AS1A 3P3UA 4BSVA 1K4CA 1PZ2A 2W60B 4L4VA 3U4KA 5FO9B 2VL4A 3ZTNH 4PGBB 1DEEA 3LOWA 3GEFA 3PGFL 1F6AA 1ASPA 5DJCA 2VDQL 5HYIA 3OXRA 3MLSH 4JM2D 4PJHB 5A6LA 2JELL 4ZS7L 1C5BH 3IU3A 4G8GB 2EIJB 2F9BT 2ITEA 5LCVL 3V4PB 5T33L 1GSMA 4K7FA 3D33A 1HL4A 2WB7A 3ZLQC 1G94A 1PBYA 3LKRA 2ODHA 1X5JA 1C5CH 2GT9B 4MQTB 5T3ZE 2JKWA 2VN3A 5DD0H 3O6KH 4XMVA 4K5MA 4AQ8C 3C6EA 4LBEB 3CC1A 1OZTG 4ZUTB 4JRYE 3VFMA 2ILLA 4H0IA 1G7PA 5EZOH 1NOAA 4LOVA 1GIGH 4FHBD 4JRXB 4L1BA 4BDVA 2ZXQA 2OTUB 4KQ4L 5E1QA 4M43L 4ZDHB 3RFRA 5MERA 2NY6D 4GAGL 3D3VD 3ZZQA 2RA1A 5GIRB 1MSPA 2R1YB 3QUXA 2OMZA 5I1DB 1S5IL 3MRMB 2AANA 5INDB 1X5YA 1SRDA 1VGEH 2BZCA 4YHKL 1WAPA 4X6BB 5C0CB 1JZ5A 3BP7B 2SEBA 1MOEA 4G6FB 1UUSA 2E59A 5FGCE 4O02B 4WW2F 1IAIL 1KY6A 4BA0A 2D3VA 3BZ4B 1QFHA 5CF3A 5JYLA 2YSSB 3AITA 1ZK5A 3PU7A 1CQYA 4RFOH 5EU6E 5ICYA 2ADFH 2ARWA 2DM7A 2YAFA 4NUJA 3CV5A 3LZFL 2AK4A 2R0ZH 3FO2B 4UZSA 3DPBB 1H15B 4P46C 5F1SA 4N6RB 3HTLX 3F7YA 3HG0A 4AI7A 2QPSA 4R4BA 4ZW8A 2BC4B 1QA9B 4EOWH 4NYLA 2PO6C 3ARBD 2HRHA 2F74B 3MLZL 5IW6A 2AJXH 1NICA 2ETWA 1AR1C 2OMXB 1BD2E 3F05A 4MDIB 4BZ2A 3DX0A 3MUUA 3BP6B 1KEMH 3ULVH 3EGSB 4XNUL 1J1OL 1A6TB 1SXNA 5MEND 4OZHF 2PTTB 1IVTA 2XIBA 4MD4B 2CNZA 4F7MB 1R5IB 4WW2C 4PGDB 1RXLA 4AM0Q 3QG6A 1KZQA 3GXTA 4WUKH 5L4JA 3HI1B 4X4KA 3HUJB 4RDQF 3F85A 4UBDC 1RERA 4NM4H 1PJWA 4AQZA 4HCRA 3VFUB 1Z3RA 2PXYD 5IB1A 4Z95L 1IFHL 1YMHA 4DSYA 1JV5A 3WTTA 3SGJA 1IGFL 1XF5A 3BKJL 1ZANL 4K7PL 5C0NC 4WEEA 2AITA 3U1SH 2XXGA 1WBXB 4AYGA 3LH2L 2WXFA 1SHXA 2PN5A 4KNTA 3QZWA 4NS0A 4NQCE 4ELMB 2FWOB 4P2RB 4ZYKA 4N0CD 4AK2A 3QIUA 5CN2A 3H53A 2J1WA 4X5WB 4BRJA 4HJ0D 3RJQB 5JQ6L 1MW3A 1S7XB 2Y0SA 3MJWA 1PLGL 1E27A 1ZHBA 2DJ4A 3QWQB 1D5RA 1HOCA 2APTA 2EXWC 4Y1AA 1DBML 4ZNEA 2V17H 3ML9A 2WKOA 3SJVB 3NCYP 4XB8A 2Y7OA 4M62L 4AJWA 2R0WL 1K6QH 4G11A 2WUBH 1FFRA 3LHPL 3U9UA 3UMNA 3FT2A 5CD5D 4WWPA 3UZVA 1JAEA 3BUIA 3VWKD 1IQDA 1OWWA 4BFIB 2IANE 4ZOCA 4OLUH 5HYJB 3DTXA 1VB9A 4RRPA 5AKVA 4JJHA 4KITB 2WLIA 1AZRA 3PWPA 5BVJB 5E99L 5HVFB 4TQEH 2XOTA 3LMJL 3VE0A 1DQLH 3RDJA 1PYWB 1OAXL 5C09B 4FQ2H 3MROA 5LN8A 1IUZA 1AGFA 4AE1A 4HWUA 2M8XA 1NGQH 5DJYA 5DHYA 1F58H 3AG3B 2BHUA 2HLFC 2XA8H 2Q8AL 4EVNB 3LTVA 5ANMA 1RZ7H 3ISWA 4Z77A 5LDSA 1NDTA 2OYMA 3CFEB 4L1TA 5D1QB 4TVPH 2HH0L 1JK8A 2DLHA 2K3TA 3QPQC 5FKAB 1R0AH 3UBGA 1A02N 2XJLA 2MMXA 2WNWA 4YHMH 1EZSA 1NUDA 1FFQA 3QRBA 3SDAC 4ONFL 4KKCC 1YY9C 3U7WL 4G6ML 3V9FA 5CSBA 3DDFA 4XN8A 2WP3O 5H35A 1ZVSB 4QHKI 4LL1A 5D71L 5I2IB 4XP4H 4U3SB 2J55A 3RKPA 2A4EA 3VSVA 3WSQH 2HX9A 1OTTD 4DOHE 4F15C 1DQQB 3IEAA 3VG0L 2GVYA 3CLFH 4ODTL 2ZP9A 3HA0A 4XE0A 3LQMA 1NGZA 2EVGA 3L3IB 3FOMA 4UIKH 2GUOA 5GS1C 4KJQC 1SN5A 4DP0X 3GK8H 3MR9A 3B2DC 5IHHA 4CJ1A 5I18L 2V0AA 3W5MA 2HSIA 3SOTA 2OXHB 1T1ZA 2CIIA 2J3SA 1CIUA 3HNTL 3NA9L 5EC1A 4OIAA 3R06A 4PYHA 3G5VA 2BIOA 3C60B 3KPTA 1BEYL 1G6RL 3P77A 4N2AA 2YUZA 3GBEA 1OSPL 1F6LL 1R6VA 1X5FA 2C3XA 4G8GE 4KKQA 2IAAC 3VRIA 1NC2B 2W95A 1HK6A 4LLMB 3RWFB 4CN1A 1B4RA 4FXTA 1B90A 4WFFE 5AVUB 5ID0B 4YJZL 3VGBA 1NFDA 2YD5A 2D73A 2UZPA 1LEGB 2QVIA 2V2WA 5TDPB 5KTEL 1BZQK 4XOBA 1DVYA 3KW8A 5CS7A 1OK8A 3LEYH 5DK0A 5KSUA 4JG1H 5C07E 4I48B 3JXAA 1F3DH 1PG7W 1U8IA 1KTKE 4BCYA 1KIUA 2OAAA 4M4RB 1FLRH 1LO2H 3HG1D 4ZJ9A 5B8CA 4JQXA 3SGKC 5D5MA 4QRPB 4F3FB 1T03H 4TYUA 5D2NC 2X38A 4BFOA 5C0CE 2EECA 2DIBA 3MRQB 3HS0B 4AQOA 3MC0A 3PY9A 3UAFA 4PJDF 2XTSA 1VACB 5AOJA 1MFNA 3DK0A 3KW7A 5I8KL 3TJEH 3EFOA 4AXWA 2X4NB 1J9CT 3MLTA 4PJEF 3F7KA 3CQFA 4IU3A 1JZFA 2JTYA 5D7SH 3W82A 5E9AA 4XMPH 3ZMNA 4EN3C 2MOGA 4JS7A 4ZQKA 4QRRA 2ZUXA 1O7DE 4CC4A 5C7XH 1NCWH 3LN4A 4N2NA 5ESVA 4PUBH 2BSTB 3HPLB 1TEFA 4OZFH 2CKNA 3QB7C 5IQLA 4W9IC 5AAWC 4D7PA 2E9JA 2ED9A 5KEZA 1I7ZA 3H6JA 5A43C 1E6OL 3OD3A 4XMUA 3F5WA 2DJMA 1UH4A 2Y25A 2YPVH 4NGHH 1D7CA 4P0DA 3L5WB 3H4HA 3ZO9A 1V55B 2L8AA 5AVVB 4DP9X 4QNPE 1T83A 3NJLA 4OKVB 1T4KB 1B0RB 1HYSD 3FQWB 1ROWA 1YJDC 5HHVL 2WWMD 3HE7A 4F33B 3QQ9D 2WQXA 2IH9A 2BJMH 1LMIA 4WSJA 5EA0H 3OSVA 3K7UA 5C6PB 2Q87A 1IC7H 2UXGA 4WRLA 4PJ9D 2Y24A 4QOKD 4X6FB 4MCZB 5TF0A 2HVKB 1UZGA 3KH3A 4BKLA 5SWSB 2DQIL 2MHAA 1BVKB 1TTCA 2X89A 3IU4H 2CDFA 3T8VA 4BFGA 2OA9A 4U4IA 2CBPA 4HOZA 3QWOB 4XN2A 4OJAA 4IKJA 2ZAGA 3GKWL 1JD7A 3SQBB 1NQBA 5AOZA 3SDYL 4DHLA 5FHAL 4W4OA 3TA3D 3U36B 3B2MA 4A2DA 4LO9A 5BQDA 2RR3A 3D39A 3TPKA 1A14L 4DW2L 4L5FE 1VZHA 4FYRA 1ZE3C 5D7LE 2IWEA 5D6CA 2NR6D 5IQNA 4DPCX 3AJ7A 3CDGA 2B08A 4QXUL 4ELME 1Q9WB 4GQZA 4XCCL 2Z35B 4GW1A 4O5LH 4PHZA 4GYBA 4YAQB 2BY3A 3D69A 4GKZA 4FG6D 2I7SA 1WAAE 5BZXA 1D5IL 2UWEA 4ZSOE 1EO5A 3QXVA 1UT9A 5A7EA 3Q6FA 5AW9B 2BVTA 2Z92B 4GXFA 4KO9A 3SJVE 2BPBA 2C9SA 3H2WA 3KBPA 3FTGB 1SLWA 1ZS2A 1PY0A 1AGBB 4FFZA 4YEFA 1MHHA 1EHLH 2ZXBA 1YNLH 4AIZB 3MOBL 1IZJA 1E42A 3O8XD 1FQ9C 1I3GH 4RMSA 5J4MA 2BVQA 4B9PA 3NPSB 3OR7B 4FQ1L 4PPTA 4BD4A 2OTPA 3MNVA 4BK4A 1F3DJ 3QUXC 4HV8A 1A4KA 2HJKB 4XZUB 5AKSA 4ZMAT 5BV7C 3IMVA 3DSNB 1SBBA 1D9KA 1JRHL 3HMXL 4HKZA 5C09E 4E9TA 1URZA 3OX8B 1F4AA 1P1VA 3EJZC 3ZHFA 5K1JA 5FLUA 2AMGA 2EJ1A 5DZPA 4UQEA 3EOYG 2H8PB 5EOTB 3WXVH 3RY6A 1IQWH 4BWTA 1C08A 3HFML 2Y7MA 3O3UN 3MJ7A 5E8OA 5ITFB 1HHHA 1X4XA 1A7PH 2WXPA 4M1DL 1BAFL 2QV4A 5DJ2A 1IVLA 4OFKA 1WBZA 3QUMH 1UM6H 2IH3A 1S5HA 3JWNH 1E9PA 1OGSA 1YC8A 5D1XB 3FQTA 2OZNA 3RNQB 3E6FA 1Y1UA 3N44F 1A1MA 4QHMB 4JM2A 4QIRA 3K4AA 4GIAA 4X2UA 3VXQA 1L6PA 3UTSD 4BKSC 3GMPB 3U46A 1L7IL 4X9FA 2VJ0A 5AZ2H 1T3FA 3VXRE 3ZRFC 4ECNA 1I53A 3CG8A 5DUJA 4JNXA 4FQQB 3M1OA 1QQDB 3DV6B 4NQVB 2RJMA 4M3JA 3EBAA 2Z93A 2WKOF 4YFEA 2WPGA 2GYSA 4EI6A 4G83A 1ACYH 4M7LL 1XGUB 1EMTH 1A1OA 2CU9A 3I50H 4CADB 2X0UA 5IWLA 4H26A 1TQCC 2YR3A 3D3VA 4PG9B 3S5LB 3TBVB 1DSWA 1L9RA 3Q1SL 2PTVA 1QFUL 1TQUA 4YR6B 4R83A 2NY1B 3WDHA 3LH9A 3BRGC 5I5JA 2NSMA 1XIWB 3RVVC 1A3RL 4H40A 4HS8H 2PYFA 2WXRA 3AT9A 1MH5B 1BZOA 5FK9A 1YYLH 1DBAH 1H0DA 3MNZA 4XP1L 5TJWK 5IBLC 4HK0B 1MHEA 2NYZA 2XNAB 5HVHB 1MNNA 2YUVA 4FNUA 1R1CA 4QWWD 3ESPA 5ACMA 1FNSH 2FJGB 1MUJA 4U1KA 2IPTL 3GF8A 1UOKA 3BVXA 4KROB 1OPOA 4DFHA 1EXHA 1AQHA 2CO6B 3LXUX 5C86A 1RIHL 3VFRA 4OF3A 7PCYA 1T7WA 3IFOB 1BP3B 1HI6A 1OE2A 5CXPA 2X1PA 4V1DB 4RGOH 5EORL 3WEOA 5I6XC 5KVGH 4XN4A 1MCRA 5LNEA 1LO0H 3MA7A 3O6FB 3QIUC 3O3BB 5AW8B 3TT1L 1E4JA 2O6DA 4I87A 2HKFL 2XA3A 4ZFFA 1AP2B 5F72S 3QJHB 1ZGLB 2VR9A 3BQUB 3DVGB 4PSPA 4IRZH 4GRMB 2EH8H 5HJGA 1OTSC 3ALXA 4UTAA 4ZTEA 4LARH 3ARBA 3MOAH 5CSZA 3LRKA 2BMKA 2OJ1A 3BGAA 4M48L 2AV1A 1R5WA 2QBWA 2JXMA 4HULB 3VJ6B 3JYCA 4AIOA 3N50A 1QBML 3GSXB 3A23A 1X7QA 4QO1A 5FUOL 5I1EH 3KWXA 3V5DA 1XCQB 4FMKA 3VDAA 5CUSH 3UC2A 3O2DA 4QRPE 2XIIA 2IQAB 3FT1A 1IGMH 2ZWZA 3STZA 5EMYA 5MENA 3IJHB 3ULUF 1D3CA 2EXTA 1HKLL 2OCJA 3J07A 3N1MC 4X7DC 1V27A 4XPBH 2AZUA 4KFZC 2IIJA 4PMFA 1BBJA 5IG7B 4ADIA 2IAMD 1CFNB 3BVNA 3LV3B 2GHWB 2PXYA 5TK4A 1JPTL 2DQ6A 1K3ZA 3ATEA 3V0HA 4PWIA 1PX3A 2IPUK 4PCSA 4P59L 2G5RA 3PXLA 4X9YA 5CJXA 1V3JA 1PLCA 1YC7A 1W9XA 3FUKA 4PJ8B 1WUNT 2ZUVA 3CHQA 3IGAB 1YYCA 3GD1C 4Z7OF 3FQUA 3QSKB 3NCXA 5JUEL 1P1ZB 2EINB 2HT4C 2VRAA 1NCCH 2XKNB 3IMWA 3E1ZA 1QKZH 3EYSL 4QCIB 3H7BB 3WO4B 1LDPH 5J89A 5B1CA 5E2VH 3EXJA 4N85A 3ECBB 1RMFL 3CZUB 4URTB 1CI5A 1KTLA 1NFDF 4JGJA 1XR8B 2IH1A 4KHTL 3ULUC 2H47C 1VPOH 3VXUD 4G7RB 3NJFA 5BJTB 4S1RH 4U6VL 4NPKA 3VWKA 3GMRB 4RAVB 2CLRB 5IHZA 4L23A 4ZUUA 4HLZH 4I5BA 5DJZB 5SWSE 5K9QI 4NN7B 1UD3A 2C9VA 4DESA 3IDJB 2A0LC 2ZSVA 5DUML 1DCLA 5A2FA 3Q06A 2XZCL 1EEZA 2AV7B 3V9EA 3VNYA 4DAGL 3IM1A 4DERA 1RJYA 3RQ3A 2WK2A 1MWAA 4X7SH 3N06B 2UVEA 2F53B 3LXCA 4ZUVA 3NIFB 3QUZB 5IKCB 1RURH 4UAHA 2J6EL 3N43B 4F7TA 4IIQA 2Q7YA 4P2YA 4X8JB 4HGKC 2DV6A 3WLBA 5JQIB 1O75A 3JT0A 4R7VA 5KOVC 1J1PL 1UC6A 4LEOA 4AOFA 2VUKA 3FOLA 3WNOA 5TE7H 4F93B 5F8QC 4QRFA 3VO0A 2YPLB 1QI4A 2GB2A 4GRWF 1DJZA 5FV2A 2MPAH 1IILE 3B5TA 3PYCA 4PREA 5AB1A 3GSNB 4Z8FH 2QPDB 4M3KB 2NYYC 3VFPA 1P4UA 5HDOA 1H5BA 4TVSa 4HVBA 5EIIB 1XH0A 1FAIL 5HI3C 3X2QB 3C9NB 2A74B 3LY6A 4ZPVB 5F71A 1JHKL 4ERSL 2FO1A 3ZTCC 3CXHJ 3VFGL 2VUYA 3EO1B 1AAJA 5CGYC 2GC4C 2XPYA 3IGFA 2GPZA 1S7VB 3QHZL 4JQXC 1A7OH 4Z7WA 4FLHA 4Z0XB 1T6WA 4EIGB 1ZE3H 5AUMB 1DN0B 4YS4A 4C56D 2AF2A 3RKDD 3UP6A 5AVRB 4MSWA 1ZDSA 5D93C 3V55A 2Q3AA 4EQ2A 4IRJB 1CI3M 1QEWA 2H1PL 3IJEB 4RRPM 5DMGD 1ANUA 1XGYH 1MFUA 1GGYA 3MNMA 1C12B 2OL3B 4TVUA 1MY5A 1T5KA 3D25A 5B3JF 3MJ9H 5I1LA 3VD0A 2Y7LA 4JPKH 3SSGA 4XMXA 1WTGT 4BELD 2YOAA 4KKAC 3LX9A 4Y4FA 4CNIA 2CHWA 1HH9B 3L16A 4WJKB 3G7TA 4CC4C 2EO7A 2X1OA 4K2UL 4NOFA 5F1IA 4FQLH 2AI0H 2YZ8A 5D1XE 3BPNC 4L0ZA 3QUKB 5GS0H 1MVYA 4BINA 2W0PA 4JFSA 5DZ9A 2IFFH 1SVZA 4MXVF 5FFOA 2MCAA 3WKNA 1WH0A 3APMA 3NABH 3FN3A 5BV7H 1W0VB 1N19A 2FYVA 4JM0A 4ONHB 3WS3A 3MLVH 3M46A 1XGTB 3V79C 1X9LA 3HE7C 4AEHH 5B7MA 1W8EA 4JHUA 1Z3GH 3ZTEA 1WISA 3JV4B 1ZLDA 5FGSA 5J3HD 3VYPA 1FBIL 1KCVH 5D2LB 2PWFA 3I75A 3OKLB 4WFHE 3HG1A 1L6XA 4Q6KA 2CSPA 4HA1A 1N64L 1A25A 3LRSA 2FO8A 4WI7A 2ATKB 3RRQA 4AKOA 4OF7A 2CKBB 2J88L 1CLVA 2VISA 4TQPA 3VGAC 3A6CH 3LEXB 5LO7A 4CILA 4JRYD 2EEXA 5F0MB 2AXHA 5K9JH 2VXSL 4W4OC 1PZ5A 4B7LA 1C1EH 2VZVA 5BZDB 2FB4L 3V6BR 3HG4A 5FB8A 5JHDB 2HFFA 2BSRA 3O6ML 5F1OB 4KRPB 3NCEB 5IM7B 4YHYB 3BAYA 5E6IB 4BZ2H 2OMVB 3G5YB 1EXUA 3S96B 1BM7A 3MN8A 3TGXA 4G42A 5IB4B 3S8GB 1NINA 2EAEA 2ZG1A 2VSMB 3QQ4B 3C5SB 5CLZA 3DJSA 1KCSL 5GQBA 5T5NG 4PY7A 1ZLUH 4CC0A 2Y9RT 1QI5A 1P0SE 1TYRA 3C09B 1JJUA 3SYCA 3WXWL 1A6AB 1DJGA 4JM2F 3O0RL 1MAJA 5E8DL 2JKSA 1UXLA 4HCRH 4ODHL 1JBJA 4XNDA 3NEOA 1AQDB 4JANA 2Y36H 2N1KA 2L7QA 1RZFH 1LP9F 1SOSA 1F4WL 5HDQH 1XAUA 4R96A 5H2BB 1OLZA 3HMWL 2CXKA 3UG4A 3X12B 1YZZA 4PJ9A 4S1DD 4QOKA 4GAFB 1KELL 1GOHA 5JTWA 4F7KA 3DURB 4UU9A 1XBRA 2DQHL 4GFTB 1W2KT 3S35H 5B4MC 2AXGA 2EKJA 5A2LH 2BY1A 5IQOA 3RY6C 5A3IC 4WEBL 4WI0A 5LCVA 4Y5VB 3X11B 3S37X 3KHQA 2WTRA 3INUH 3EDDA 4ZXBC 2NNAB 4F7PA 1D5MB 1MCWW 5IHUH 2VDPH 4A63A 1VGKA 1CCZA 1OT1A 3CH8A 4M5YH 2NUTB 3TA3A 4XGZB 1TU2B 3ILPA 3BWUF 4UQBA 1N5AB 3OZKA 3HB3C 4D3CL 2NR6A 2FEJA 4AIEA 4NUMA 3GM8A 4JM2C 3SBQA 4GW4A 1WA0X 4QRUB 2DQDL 4NQUA 4FD0A 4PJIA 4G1EA 5F0JB 1Z6JT 3G6DL 3REVA 4DKEL 5I76A 1TUPA 4J12A 3NFSL 2A5UA 1E9QB 2RIKA 1FG9C 4A67A 4XP5H 3KYOB 4LPYA 1X5XA 5AALA 2BP0A 3UEQA 1VEPA 4M61B 1GZQB 4E9WA 1SBSH 1U2CA 1JK9A 1XXFC 4YBHA 3CPLA 2XBDA 2HN7A 5IK3A 2ZCKH 1G87A 5IWLC 4IBYA 2P46B 3LN9A 3HN3A 1IARB 1CDJA 1MDTA 5D9SA 5B7FA 2ICEA 3CFKA 3OMNB 3F12A 5BRZD 2PABA 4JFZH 4PWFA 1NTDA 5HYFA 4I85A 4YN3A 5J56B 2WLZA 2W92A 2DMGA 2MCPH 3O3DA 1LDSA 4I4WB 5E0FA 1USQA 1TZHB 4M8VA 4OZ4B 4KMLB 3BWUC 4OVUA 3RI5F 2FL5B 5FUZL 1QLRB 5GS3A 4E0RA 1XR9B 2VC2H 2PUQT 2WYIA 4KKZA 4HJUA 1DQJA 4KGJA 1Q0XH 4IW4C 3DX6B 3X13B 1A5FL 2WYZA 5KBNC 1KCWA 3J2PA 2YPLE 3ULUH 2CD0A 5CCKH 4JE0A 2H2SC 3MCYA 3BZDA 5C9KA 1AI1H 2B5IC 3PP4H 1J5DA 2NRDA 1P4LB 4H44C 2PPAA 3L1OL 4ODWA 2ALWA 1CVSC 1JWMB 3GGWB 2ITDB 4IHBA 4D0CA 4P9MH 1BLNB 1NBZB 3ARBC 3UTSA 5B7EA 3T77A 4XC3L 4HWNA 5IFHH 5IQ9A 2ZOLA 3A6BL 1AGDB 1GYWA 2VB5A 3SE4A 2G75A 5TPWH 5GGTL 3QJSB 3RIKA 3LEVH 4NQDB 4N2MA 4OIIL 1DJWA 1QO3B 5C2UB 1FRGL 2VW7A 1H3XA 3JV0A 2VDMB 3SE8H 2CGZA 5IF0B 3L13A 4PLJD 3RFZB 1YMMB 4YXLH 3CX2A 1HT6A 3PPEA 1E3ZA 2LAGB 1MRDL 1UM4H 4KH2A 1QATA 1G7HB 4FHJA 1SM3H 2P8LB 3IDMA 4DGVH 3OKMB 4ATTA 2X4UA 2PXYC 2WMPB 3KPNB 3NJMA 4DZ8A 3WEXB 4FQXD 2EQDA 3DYMA 3WBDA 5AWNL 5IVXB 5HPMB 3RP1A 1X6LA 2QVTA 4KJWC 4UNIA 2ENSA 5D1ZD 4ZMQA 5CJXC 1KB5L 4N0YL 1FFTB 2NDFA 3BOVA 2OSWA 2B9AA 2V5MA 2XKUA 2ERJC 1EWHA 2E9GA 1Z5YD 3VUAA 4MJID 4MMYB 3UTPE 2V8LA 1LEIB 5ETUA 4N0CC 3PHOA 4UINH 3B9KD 3S4SB 1FNGB 1ZTXE 5JPNA 2JKJA 3ZDXF 4Y2DD 5KSAD 4HUMB 4HZLB 1IBYA 4NFDA 4LVNB 3KVPA 1QUNA 5LXGL 3N85H 4AYBA 1TYJA 1B9KA 2FWLB 3N3EA 4PP1D 4HS3B 3VYOA 1OSZA 1RZKH 4NZDA 4L8CB 3EG9A 2FUQA 5PAZA 5CD5C 4OZIB 3LVTA 3VWKC 3EGDB 1PD6A 4XCFH 1CF8L 1YAIA 1MCIA 5E2TL 2CZNA 2ZOKB 5FFGA 3VB8A 4TUOA 1HHKB 2F7QA 1GKEA 5E5LA 4WFFD 3UMTA 4N28A 1CT8A 5EB9A 5ITBH 4PJGE 5FCSH 1O6TA 4P3DB 1J05B 3UYRL 3MBWA 3QC6X 3CXHK 3QDMB 4PTUB 4JRXD 4ODSL 4EUPH 3WL9A 2P8MA 5JHDE 2IAMA 2F7RA 5TH2B 4AQEA 1MAKA 4OLVL 4N2CA 3ZTDC 3BH4A 3BAEL 4MA3A 1WF5A 1CU4H 2O5NA 1RK0B 2BSDA 3L48A 5C0CD 5DMKB 3BZEA 5I73B 4G6FD 1P7KB 4GG8A 1KC5H 4I0PB 5EZJA 2DLFH 1R34A 2Q3ZA 4MX7A 2BVYA 2ZOWA 3KL3A 3KPLA 4BWWA 4F2MB 1ADWA 2L04A 4FQJL 2XTJB 4C4KO 5ICZA 5J11B 2BLFA 1HAWA 5I28A 2ARJB 2JCWA 2DQGH 5ENWA 3VW3H 2W59A 3WENA 2CAKA 2X10A 3GO1L 1S7TB 1CWVA 5JIQA 2VJXA 1BZ9B 3QPKA 5G2NA 5IQMA 3NCCB 2I07A 1MCHA 1BEXA 1GS7A 1OANA 4N2EA 4NLAA 4OCRL 2F19H 3UPRA 4HJEA 3F7PC 2XN9B 3UYPB 4G7SB 3L3OA 3MA9L 4RGNE 3VVVA 5DEGB 2XG4B 2WWKT 3VSTA 1Y7VA 2YLKA 2DL9A 1ROCA 4F8OA 2JSFA 4UV4L 1J5CA 1TG8A 2Z7WA 4XVTL 4YXKH 3DHUA 4MGXA 4XNXH 4Y9FA 2P5WA 1VADB 5E94B 4F7EA 5F93C 4U1MB 2VDRL 4NKIL 3QFDA 1WIUA 5GSVA 3WAJA 3FN9A 2B2XH 2A9ML 3V8CA 1TSHA 4FFVD 1V7NH 4Y4FC 5I19L 2D7TH 3B43A 3PWLA 2WSKA 3R1GH 2P4AB 5A16A 1YQ2A 3EZ8A 3FSAA 3TN0B 3TCLA 4ZMPA 2Q76B 2W8CA 2YOCA 1YLBB 3VD3A 3RWDA 2E27L 4JN2A 4X98B 2IDTA 1OAKH 4PJBE 5ID1B 1J9QA 4MJJA 2VH5L 1PLAA 4XCYB 3ML8A 3P4OA 4HPYL 3QR0A 4X0KB 5FYKU 3VMNA 4JZOA 2BHFA 1A6ZB 3V4VB 2ENYA 3H54A 1D2OA 3D9AL 3SDDB 3TBWA 4ZMZA 3KGSA 1DJSA 1MVUA 2NYKA 3I84A 1N5YH 1N7ML 1ZHNA 4XC1L 1A6VL 3CH1B 2AQ3A 4Z0BH 1MJ8H 4B9KC 3NEEA 4AEIL 4DT2A 5IFJB 3VRJA 3IS1X 4YE0A 5C0IA 3CVIL 5E03A 5FLVA 3UOAB 1U4FA 4YSRA 1PX8A 3KLSA 1BVOA 3T08A 2W07B 2ZX7A 3IT8D 4P2RD 5SWZB 4Q6IB 4WV1B 2L0DA 3VXOA 2RCSL 3QEQB 1O0VA 4WNQB 4S1QH 4I3SL 4FP8L 4C56A 5FWRA 3VFNB 5H94B 4YHPA 4Z76A 5JHLL 12E8L 3PS6A 3SJVD 3HAEB 3VQ1C 3NJVA 3S37L 2AJVL 5JZ7D 2FEDD 1M2VB 4UTBH 3S2AA 3MRRA 2P48B 2HTKD 3MRCB 4NZTL 2AXFA 2CBQA 2DM4A 2NY5L 2CBTA 3F64A 4ZPTB 4E9LA 4J28A 5HYJD 5J12B 1I1AA 1BBDH 4R4FL 8FABA 3KLAA 4XCNB 1LWJA 2NY3B 4P5MB 4KAQH 1PZDA 2VMDA 4B9ZA 1EHKB 2EDWA 2W9DL 3E8UL 3WU1A 3K6NA 3BSZH 2P52A 2QHRL 3NJGA 5C09D 3U4BH 3ATDA 2WLJA 1QASA 4YHOL 1AGEB 2N59A 4DZBB 2COVD 2VABB 4NQXB 3O4LA 4EZJA 4JHBA 4NO5B 3ARGB 2JB5H 1TPXC 1NIDA 1YEEH 4IEFA 3UJJH 3E2HC 2JH2A 2X3AA 1TKWB 4LEEA 1NCIA 4A2GA 3UACA 4MS8D 1HYSC 4JUSA 1RKRA 2VDNH 3HCVB 4LHUB 3DJ9A 2QPEB 2WWMC 3BIKA 3CCHB 3MRNA 3QQ9C 5SV3A 5F6IB 2RBLA 4M3HA 4WSGA 4NQDE 4X7CC 3IMUA 3LIZH 1YEIH 1JNNL 4ZW3A 3CDZB 3VYNA 2AKRA 3LRHA 2H3KA 3HLAA 1KGIA 3O2WH 4PJ9C 1YMME 3LYRA 1SHWA 4GY4A 5E00A 1IGJA 2HX8A 3NACL 1AS6A 1FZMA 3PWJA 1P5UA 5EOQL 5CFHA 1WA1X 4NOBA 5CZXD 1TJGL 4UUJA 4LHQB 3GI9H 3NP3A 2ZX9A 4QI3A 3O11B 1QBLL 2R83A 1RIVL 3MLYL 4OF6A 2IF7A 4H8WH 5IVXE 1A2YB 1VCAA 4JRYA 3MGOA 3LSOA 1MELA 3EUUA 5FDWB 3TA3C 1JMZA 2EYRA 4OR1A 1TTBA 2WWOA 4ZK8A 3LNEA 5IB3B 2XX0A 2NR6C 2VR7A 1J8HA 4XPAL 3WIFA 4H5SB 3WAKA 3R8QA 2P24B 2IVFC 3RGVC 2UXFA 1OM9A 2V8MA 3QULA 3SY0B 1U6AL 3TOPA 5ADPH 1F4YH 4WSKA 2I5YH 4CAGA 1BYOA 1UA3A 3EYUL 1V7ML 4X5XB 5HGGS 4TL4A 4YGVB 4V33A 3DOSB 3B2XA 4YUEH 3FN0L 4PV8B 3RDTB 1JN6B 1Q90A 4NC1C 3C60D 3NZUA 2KS0A 4MASA 4FYTA 1PSKH 1U8KA 4DN4H 1OIOA 2YAOA 1CFBA 4PCTA 5TDOA 1I1FB 1ZLVH 2XWEA 4QRTB 1NC2D 2AJZA 4ONGH 8PAZA 4QXGL 2ICEC 6PAZA 4G5ZL 4PI2A 2CRYA 2HG5B 1AGCA 2B1AH 3QAZC 4YX2L 4NENB 1SOQA 4JCLA 4OM0L 2F5AL 3N42F 4WO4B 3EO9L 3P9MA 4L3CA 2UY6A 1NZRA 3K0WA 3Q2CA 1I8IA 2DKUA 3GYRA 3REWA 1D5ZA 4K71B 1D7DA 4XOEA 1HEJC 1E5UI 3C5ZB 4KY1L 5EWIH 5IVZA 2EYTB 4HFUH 3LXAA 2KZBA 4QRPD 2PR4L 2BOCA 3T6ZA 5L9DH 4ORGA 2XC8A 2YAEA 5DC9B 2V37A 4P3CL 3EHBC 1N8OE 3B7TA 1FCGA 1MJUH 1XB6A 5FF6A 3EFFA 1G0XA 1OM3L 1NPJA 3TNMA 4HIJB 5EN2B 4ZFOB 1RI8A 2WANA 2XTJE 2DQCL 2XX1A 4CGUB 5AVZB 2OM5A 4HISA 1IBZA 4R0LB 4A6YA 2MQ3A 2ED7A 1JV2A 3NN8B 3KM2A 1UUNA 3QFGA 4WAFA 1U8OA 1WJ3A 3U30B 4LE8A 4NXSA 1NGWA 5EO0B 2WNXA 3X1FA 3QJVB 5I1JL 1MWAH 4NB7A 1CDGA 3K2KA 4PHXA 2DICA 4LSRL 2GJPA 2XN9E 4X80H 2OR8A 3ARDB 1YAZA 2E7LA 3DGDA 3PWVA 4F57L 4Y19B 3SDXB 4LLUA 2YAPA 3N55A 3QVAA 3KPSB 1VDGA 3ZDWA 3UFIA 2EYSA 3UX9B 3BH8B 1DN2A 2X0WA 5BRZA 1CFVH 1P7QB 2PR9A 3NYKA 3HZMB 1OGAE 3Q48A 3U82B 1NCHA 1QSFB 2KBGA 1ET8A 2YMTA 3AU0A 4WHYH 5I8OH 3P9LA 2EKSA 1VRSA 3HS9A 4I0CC 5IHWA 2EP6A 4QWWC 4RIRA 3H3PL 3AAZB 3V6ZB 2XICA 3L95B 2XQYA 1MEXH 4N8VB 3GI8L 3B2VL 2QPUA 4N2BA 4PGCA 1PF3A 2YJQA 3VXSE 4WCYH 2JJSA 1AHWB 1T2JA 1G9NL 3LPOA 3G6AB 2MNJB 3LKPA 1JF5A 5JPNC 3NAAH 4J27A 5JXED 5L7XH 3T3PB 1CFSB 3IJSA 1IGCL 2FX8L 1A3LL 1HXMB 3ZE0E 3VU2A 4R7NB 2ICWA 4FRWA 1HCYA 3HI6L 3MFGB 4GINA 2WCPA 4AZ8B 5DUBA 1CTNA 1IAIM 5I8CB 2FATL 3QEQE 5E70A 3MV11 3E3QE 3ZTJG 4KU1A 1I9IL 4YLQT 4DEPC 3CIQA 1NC4B 3AGWA 2D31A 3ZE2B 2ALAA 3UG3A 5CCJA 3VI4B 1LD9A 2FIKA 3II2A 1ZV5A 5FOBB 4UT6A 4HIHB 3NJIA 4JFPA 5LGJA 4R26H 3MRDA 4X7FC 2BM3A 3QISA 3BKYL 4WGVB 2DWDA 1CLYL 2IAMC 2XPGB 3HZKA 4G8IA 4X9IA 5E8PB 3WJMB 1DFBH 1EFXB 1PIFA 1NCOA 4FQXA 5ILTH 3SBWA 3HC3L 3ZW3A 4PS7A 5AZEH 4XX1G 1HE8A 5CD3B 2AJSH 2HA1A 3DDGA 5D1ZA 4MBRA 4KK5C 4B7IA 2YLHA 4IBWA 1KYAA 5IOPA 5E9DB 1LK2A 3OXSB 4MJIA 5AD0B 1CGTA 4JAMA 4O4YL 4NP4L 5CGMA 3DX3A 3LDBB 2VMJA 1FZKA 5CGBA 2J1YA 3VX0A 1MHCA 1U92A 2KMWA 5JW4M 1JS4A 3W39B 3GJFA 1DQDH 2XPZA 3EYVA 5E2UL 4Y2DA 4HCFA 5EF1A 5KSAA 3AUVA 2OQJB 1E5ZA 4FXGC 1HNFA 3OJVC 3NJNA 1OAQL 4QHPA 2W60A 4OQTL 5FO9A 5D1XD 3V0VA 4PGBA 4UNTA 3DKHA 1V10A 4P5TB 4X4YB 4PJHA 3IBEA 1UB6B 1R17A 1YQVL 1UA6H 3NSDA 1A3QA 4BFEA 4P49A 1DQKA 5F7LB 2NTSP 1S4IA 2CMRH 2FBRA 2PWHA 4JL2A 2GJ6B 3MTXA 2ZUTA 1JGVL 2GT9A 5KS9E 5IMMB 1BMGA 2P5EB 3MACH 1I4FA 2AABH 4LBEA 5G4MA 1BM3L 5J7CC 3WEAA 4ZUTA 5B39B 1QPKA 5GRJL 4JRXA 1KJ3L 2J21A 3ZKXC 1CC3A 2OTUA 1MREL 2G2RB 4WU5B 2R51A 4RBPH 4ZDHA 3UABA 4PRNB 4WFHD 1QEXA 2PPDA 3QQ3B 5JW5A 5GIRA 5F7MC 2R1YA 1RHHB 2DLIA 5TF1L 2NY1D 1BG9A 1A7RH 1CDHA 3OC5A 3MRMA 3CK0L 1XIWD 2DIEA 2P49B 3Q2LA 1TXKA 3H0TB 4E9VA 4X6BA 3ME0B 3IFLL 2IV8A 3BP7A 3GHEH 4O02A 1AZNA 5GSRB 3LNGA 4RSYA 1B2WL 3BZ4A 5I6OA 4M8UA 2MPVA 3P9WB 4KROD 2DTMH 3U0TA 4YDLB 4I3RH 1VFAB 1S3KL 4DTGH 4UT7L 1CE1H 4XTRD 4OGXH 3ZOAA 3V5HA 4MZRA 4V1DD 1PY9A 4MNHA 1QNIA 3ZQ9A 3S8FB 2C26A 3U6RB 1L4IA 4F9LA 1NIAA 4KRLB 3O6FD 1TIUA 3IDGA 3FO2A 1OSEA 2QQNH 3DPBA 1H15A 1WG3A 4N6RA 3BQUD 3CFJB 3WMPA 2BC4A 1QA9A 4E5XB 3B9DA 5DCCA 4N1HB 4KUCD 5J9PB 5K9KB 4KVCH 2VLJB 3ECVA 1W0WB 4XAKD 3KBEA 5DMGC 1UVQB 1U3ZA 2BP3A 2FX7H 4AJYV 4Y2LA 2F74A 3S34H 4YFLI 3LXBA 1H3TA 1GHFH 3NSXA 3MGTB 3KYKL 2OMXA 5E8NB 2WXLA 4K8RL 2UX7A 4HKXA 4WHTB 1I1AC 3BP6A 1YEJH 3EGSA 2KQMA 3GXIA 4IDJH 4J6IA 2PTTA 2R0KH 1F3RB 4MD4A 3LN5B 4YDKH 5D8JL 1G9MH 3TV8A 4F7MA 1QFPA 2ZCLH 3BZ5A 4ZOBA 2F68X 3PE9A 1IBBA 2R4RH 4PGDA 2XWXA 4AV4A 3QCVL 1UQSB 3MRLA 1HAUA 3HI1A 2W0FA 3HUJA 3P0VH 5AOIA 1O7VA 3ZL1A 9CGTA 3VFUA 4KWUA 1LQBC 1NAML 3JV6B 1KYOJ 4PFEA 5JW4Q 3VNZA 3LQAC 1U3YA 4JO8A 4JREB 1FO0L 4HEME 5DO8A 3ZXAC 2WOBA 1JVLA 1IAOA 1MQKL 5EIIG 2OI9C 5ESAB 1HHJB 3TVMB 3WJLA 1V05A 3V0EA 5JR1L 1WBXA 4XNQA 5HI4C 2QSQA 4PJ8D 3Q8CA 1QW9A 3B2UD 4LKXB 3SKNB 4M7ZC 4JGMA 4ELMA 3Q8AA 2FWOA 4P2RA 3Q01A 5C97A 3KPSE 4W6XB 5FWQA 3H85A 2CGRL 1WAAA 4WFEE 1S7XA 2EIZB 1P5UC 4Y4HA 4I77L 3P0YL 3SO5A 2FD6H 1K8DB 5EOCJ 1WGVA 1QSFE 1CGSL 3I2CH 1YNKL 3U0WL 3SJVA 3NCYS 2GJJA 5FDYA 3UBXG 4XMKL 1FVDB 1SQ2N 3CVDA 1X9QA 3EH2A 1RLWA 2NZ9D 4XPHL 5EZLA 1CICB 1NCUA 3S8WA 2XQBH 3WS6A 2C3VA 4BFIA 1PJ9A 5HYJA 5KYNA 3C6SB 3O9WA 3FJTA 2WXKA 1M9SA 3DX7A 4AENB 2Y3AA 4QXVA 3DPDA 1DR9A 2AEIT 2HCZX 1PYWA 3QH3A 1QFWM 3FQ4A 3NIDB 3P11L 4N86A 3B4NA 3W0WE 1JGLH 1M71B 2QLVB 1SF3A 2F53D 2VXQA 3L1FA 3P69A 5I1KL 3NIGB 2IDSA 2XVBA 3QUZD 3UDWA 3OWRA 4YWGH 1DQIA 5KANI 2B3IA 3H7LA 2BVPB 5GGVH 4KK8D 2R56H 4L3EE 3OHMB 4G8FA 1IGIL 4PLNC 5D1QA 3OBAA 5EZIL 2YPLD 1WWAX 3P30H 3E6HB 3ZDYB 3X3GH 4R4ND 1LLAA 5FKAA 1G7IB 1IC5H 4FLRA 4G71B 3AB0B 3KCWA 3EYOA 3AXHA 4B3VA 3VI4E 5CZVH 1KN4L 5T5NF 4K3DH 2DQMA 2B4CH 3CZNA 4MA7H 3KS0H 4O2CB 2EC9U 1GGCL 2I85A 4LEXH 1T7XA 1Z9MA 3UZEA 3BKML 4WI9A 1TZGL 4HMDA 2JLPA 3MV9B 1MFAH 2Q7AA 1ZVSA 3GLDA 1I85A 1FI8C 2DIJA 3KJ4C 5I2IA 4U3SA 4MXWL 2UY7B 1MRCH 4PRPB 3DBXB 4OFYD 4IRJD 1I8KB 5CHNB 3QIWA 1AVAA 2Z0BA 1RUPH 2YS4A 3L3IA 1LE5B 2R0LL 4XAWH 1HKFA 1T6VN 1OOWA 3GHBL 4KDTA 3KWWB 3RHWF 5I0YA 1A3ZA 1IL1B 1FYTB 1RY7B 2E9WA 5BXFB 2EEAA 2VERA 2OXHA 2F5BH 4JY6A 4PS4H 4I9WE 4X6DB 4ELKA 3C60A 1HTYA 2DWSA 2GUYA 5CINH 3RPBA 2E7LC 2DM2A 3ZHNA 5KYWB 1W8NA 4I18A 3FZUD 5HGBB 1S7QA 1V54B 4NI3A 1TMCB 2EIMB 1NC2A 3DXAE 2GJ6E 1J10A 4LLMA 3RWFA 1WE5A 2J72A 2I69A 4M1CD 5ADOH 5ID0A 2VWEE 1TJIL 1D6VL 2P5EE 3GZKA 3QS2A 4GSXA 3MKGA 1J9SA 2DBLL 2IQ9H 2ZYHA 4AC4A 4LSVH 4AGNA 1KBVA 2FHFA 3CVBA 4XO9A 1HXKA 3GNMH 2UZIH 4Z7UB 1IBHA 1ZHKB 4M4RA 4YHLH 3GB7B 4K5NA 4ZS6D 4XE5B 3OZ9H 3IDUA 1EUTA 2AXJA 1ZLVK 5AG9A 3O6LH 3TONA 4BXVA 4BJLA 2EIDA 3PAYA 1M7IB 4JFOB 2JJSC 1EAPB 3MRQA 2WO2B 1DVXA 4NRZA 2HMID 5AVQB 4NHCL 1MCPL 3OAUH 5EO1B 2GSMB 1T1YA 4WENB 5FO2A 1VACA 5L2KB 4WK0B 4ZOAA 5EUKB 3T8XA 5JHDD 2YK1H 2QELA 4HT1L 1KXQA 5IBTH 4KRPD 3TO2B 3GJEB 5E6ID 2JMRA 4U2ZA 2OYLA 3DNKA 2BSTA 3HPLA 4ILDA 3SD2A 1XL4A 5EDSA 3KLDA 4UYPA 5ISZB 2HJLB 2CLVB 3POCA 2V7NB 1T5XB 5M7QA 4KFMA 5T5FH 3G5ZB 3WELA 1QFWH 1WFTA 3T3MB 4OI8A 5DI8A 2VLJE 1MNUH 3PQYB 4PJHF 1FP5A 1NCAH 2B59B 2M26A 5IHLB 5C08E 4F80A 2ODIA 3ZKSD 1QD0A 1T4KA 5JW4N 3GFUA 3FQWA 1ND0A 3KS0J 4F33A 3FT4A 3E9UA 2YQGA 4X5RA 4FQXC 1GW0A 5MI0B 1WFIA 3SBWC 2G5BB 4M7JH 4L05A 4LDOB 4WFGE 1W15A 4O58H 5D1ZC 2Y07H 2ZONA 4PCKA 3EF7A 3GWJA 5T1DL 3HZ3A 4MCZA 5HD8D 5IIEB 3VTTA 4YXHH 4Z7NE 3LVEA 4G1MB 2HT2C 4K3GA 3H1ZA 4N0UB 4TNFA 1R47A 2HFEB 1KZYA 4JX0A 2A99A 5AOKA 3SE3A 3CFBA 1IGYA 3QWOA 4PVNA 3T1WA 1EJOH 3SQBA 5JXEA 1SJEB 2OP4H 4Y2DC 1XTMA 3OAWA 4X4ME 5KSAC 1IX2A 2W1NA 5CEZD 1O6SB 1VKXB 4ETQB 4PP1C 2VAAB 4N5ED 2BVOA 1PIGA 2DAVA 3FC8A 3U7AA 4FL4B 1C5CL 3BYTA 4JGNA 1HZKA 1Q9WA 2Z35A 4LPCA 5DD0L 3O6KL 4YAQA 4YIQB 2ZWYA 5EZOL 1GIGL 4DH2A 4TRPH 4JFQB 5CMAB 3TWCH 3NJKA 2NW3A 4ZG1A 32C2A 1H8OA 4AY0A 1CXHA 3AWGA 3KH4A 3FTGA 1AGBA 4JO4H 3MREA 5HHNB 3F7VB 3LQAH 4AIZA 3QDGB 4MMXB 4WUUB 3O2VL 1T4WA 3OR7A 2N7AA 3QBTB 1PD0A 3SO3B 2HTLD 1XZ0B 3QCUH 4LEBA 3HLKA 2HJKA 5G4NA 3OAYH 3DSNA 1SEBA 5ALCH 2OSLA 3T4YB 3NIDE 1CE6B 3LHAA 3QARA 4RFOL 2ADFL 5KJ4A 2O5ZH 4YNYA 1FNEB 5BQ7B 3NIGE 5EOTA 2G3XA 2X3BA 2EZ0D 4XXDA 5KVEE 3HUJF 4Z7QB 2R0ZL 3BQVA 2I32A 3B3BA 3SGEH 1QABA 5ITFA 1A6WH 3RAJH 5T3ZH 2AW2A 3WFHA 2ZTBA 3QJTB 2DWXA 4K9EH 2IXQB 4EOWL 5BRQA 3QJXA 4X5QA 3RIAF 1KFAH 1KIQB 1NBQA 3ZDYE 4F9LC 2HWZH 5GZNA 2VMCA 4B3EA 5D1XA 2DQTH 3RNQA 2VXTH 1M53A 3KDPB 3VRLF 1R24B 2AJXL 3HBPA 5KUMA 3ZGHA 4QHMA 5KZCB 4B9FA 3TEUA 4W9CC 5F6HJ 1KYOK 2UZYA 1KEML 5C0BB 2JLLA 3ULVL 2IMNA 3GMPA 4YH6A 2W94A 2ATPA 1XFPA 3MV9E 2MOVA 3CX5J 1URIA 3BWSA 5FYJE 4YHIB 1TCMA 4OD3H 1KBGH 4FQQA 1QQDA 2VN7A 3DV6A 4WUKL 4NQDD 2HXAA 4FFVC 4LQ1A 4MXQC 4NM4L 1KLUB 4NUQA 3FB8B 4XOCA 2F6AA 4QR7A 2PETA 4CADA 1QX1A 1OT4A 2ORBH 4FZEH 4PG9A 1YMMD 3S5LA 3TBVA 5IJVB 3B6SB 2NXYC 2CHXA 4YR6A 2ZXCA 5JW3H 3GIZL 4UQIM 5FECB 1XIWA 5BZWA 3U1SL 1VZIA 4GPVA 1HHGB 2HRPH 1MH5A 2EDOA 2BIIA 4UT9A 4IBQA 1A9BB 3FFDB 1XF4B 1ZEAH 4OD2B 5DS8B 2FJGA 1OCZB 3OR6A 3V5KB 2IGLA 3WJLC 2YXMA 2ZIDA 3BW9B 4X6DE 3RU8L 3GMQB 3QQXA 3FSZA 2CO6A 1P7BA 3MJGX 1LK3L 2VMEA 3FHAA 3IFOA 4N4YB 2V17L 4V1DA 4PN6A 1SZNA 3O6FA 1KTDB 3O3BA 5TFSH 1RK1B 4LSPH 1K6QL 2HLAB 2WUBL 1ZGLA 4Y4HC 5A7BA 1IO4C 3BQUA 3DVGA 4ACPA 3D87B 1S7SB 3SGDH 1ILSA 2R23B 2WCSA 1FNAA 1Q0EA 4GRMA 3BP4B 4OLUL 1I8UA 4PS8A 4J3OD 4WW1B 1N3NB 1RFDH 2JJWA 3V7AE 2FEDC 3GMOA 3JTSB 4HJJH 3VJ6A 4TQEL 4A6YH 4HUKB 3C08L 1DQLL 2HTKC 3QZBA 5L88L 1GYVA 1MFDH 1KB3A 4HW6A 4KI1A 5KVDH 1AY1H 4FQ2L 1XCQA 3WS6C 3B1UA 3MCLH 4FULA 2IQAA 3V6OE 3O9WC 1NGQL 3ARXA 4FLSA 4JQVC 1ZWIB 5E6YA 1IJNA 1F58L 1KPRB 5AVWB 3RJDA 3MQIA 2R2EB 3QXAA 3RWGB 3UCRA 1RZ7L 3BWZA 4MNQB 3QDMD 4TVPL 1ORQB 2BNUB 3UDWC 5DMJB 3LV3A 1R0AL 1IFGA 3GBLA 4TSAH 2XWRA 2R2HB 2QFPA 5DVNA 3BIBX 4R2GB 5D1QC 3GXMA 3EJCA 4KI5E 2XHNA 4GSQA 1U58B 5BZZA 4DO6A 2Z91B 3IGAA 2O6CA 4I0PD 5E4OA 1PZBA 3T8MA 4M5ZH 5DZJA 4HX1B 2VDLH 1LO4H 1HWHB 2XKNA 2VNCA 1QSEB 4PRIE 4QCIA 1FHGA 4A2EA 3H7BA 2HVJB 3WSQL 1OQXA 3UZEC 3HAEG 3G6JA 5ICXB 4HZ1A 3ECBA 5HGHA 4U1NB 1Q94B 3GDCA 1XR8A 1I85C 4V2CB 2LOEA 5DUPH 1AMXA 4UIKL 3CLWA 2C1PB 2CR3A 2CUIA 2XN9D 5I26A 5BJTA 6PCYA 1TZIB 3L4VA 5GRUH 3IGKA 2E47A 3GK8L 3GMRA 1MHPH 2CLRA 2WNKA 3FCSA 3L7FB 4RAVA 5E6UB 3T6WA 3QIWC 3TIEB 5J0BA 2E75C 3BN3B 3I85A 3OKOA 4YDVB 3AU1B 2BP8A 4RMWA 3IDJA 4F8NA 3VD5A 3VFOB 2EO1A 4FMVA 1ACCA 4RZCB 4WQOA 1E5AA 3UAEA 1DLFH 2Y7NA 3RVWD 1U93B 3FXIC 3FRPB 4LP4A 4H20H 2Y1YA 4KDTC 1FF5A 4L18A 3N91A 4PJCE 1P6AB 2PCYA 4ZI8A 3GT6A 4NZ8A 2J8UB 2F53A 4UT6H 5BCAA 3KLHD 3QUZA 3TN0D 1NWPA 4KK6D 1A21A 1UGKA 4KZCA 4FG4A 4KKNA 1WCBA 4X8JA 4Q97A 4LHUG 4IM8A 3TO4A 2XYCA 1TENA 3KR3H 2KT6A 4I18C 5HHMB 3LEYL 4MB3A 4JG1L 4HHGA 4QUOA 1CD8A 2NZIA 1X4ZA 3GSNA 4AMWA 4JDZA 3SDDD 4NJ9H 5T1MB 1FLRL 5KUKA 1LO2L 5EEWA 5DQJB 1F00I 4YHZH 2NNCA 5EIIA 4I2XB 4ZMLA 1ETJA 2A74A 2AEWA 4JPWH 4ZPVA 5D7JB 1T03L 2O6FA 1BQHB 3QDGE 4H1LB 4HFWB 1PX4A 3EO1A 3GJFH 5SWZD 4M1GH 4N2DA 1MCEA 3TH3T 1PZCA 1DEDA 2WXGA 3QEQD 4UNVA 1DDHB 4NHUB 3GSWB 4OKDA 3TJEL 5DLLA 5DEFB 2ZXDA 5AUMA 1DN0A 5EN3A 2UV3A 5D7SL 4ANUA 1KIRA 4IRJA 3IJEA 3OKDB 3FB5A 4XMPL 3MJ6A 2CK0H 2JE8A 5C70A 2OL3A 2Z1PA 4JCMA 1NCWL 4QYOB 5IT2H 3VFTA 4PUBL 4NC0B 3V4PH 4LDLB 3QRLA 2DS4A 4KGLA 2ZYSA 3N40F 4YEEA 5CEXA 4DUVA 5DGQA 2NY3D 2OMWB 1BDYA 1HH9A 3EH5B 1VFBB 4AK1A 2CNYA 3UBFA 2YPVL 4NGHL 2RB8A 1IBFA 3WNNA 3BX7C 5DWUH 5DR5H 5F70A 4NLHA 5B38B 5E24E 3K2MC 4ENED 3QUKA 3EF4A 2R69A 2J8OA 5CN3A 2ZD0A 1KYFA 4GUOA 3ARGD 4I1NB 2XV2A 2A1WL 2C7UB 3WKMH 2MRYA 2ROXA 1HC1A 5EA0L 2YO3A 1K3IA 4ONHA 4N90E 2Z34A 1YEKH 1IC4H 4BWUA 1IC7L 1XGTA 3FQ2A 2V5YA 4P05A 1MKFA 1AS7A 1MLBA 1OHZA 4LHUD 2IADB 2IPUG 1BAWA 5HHQB 4FERA 4XWOD 2H32B 4WO0A 4ABWA 1GMEA 4PRDB 2AJ3B 3IU4L 3K6IA 4ODVH 5D2LA 5GGSY 4AW7A 5AB9A 3OKLA 3IGLA 4U7SA 1FH5H 2ZUUA 1WICA 2DB8A 1NLDH 4IBUA 3U4AA 2OMTB 1CLZL 4HWZA 1T20A 4OF5A 4LLVB 4N2HA 1JZIA 2ATKA 4N2KA 5GRVL 3MRGB 4KXBA 3IDNB 3FFCB 3IPEA 3N1FC 3SE3C 2CKBA 5I75C 2JCCE 3LEXA 5JXEC 5DD6B 5T1LB 2Y06H 2Y1ZA 4TKWA 5C0JB 5A2CA 4Q2ZB 3UERA 5BZDA 3TBTB 5F7HA 3OHXA 1MF2H 5IM7A 5E6IA 3WNKA 2OMVA 1FC1A 2H0EA 3C5JB 2ENQA 5IB4A 3CFNA 2TRYA 4EZMA 5IB5A 4PS3A 3C5SA 3ZSTA 5ELIA 4LCWE 1HNGA 4JFHE 1B4JH 2Z0UA 4XN5A 4HXAH 1EHLL 2VUOA 1F8TH 1YNLL 2YN5A 4G59C 5J13B 1I3GL 2CE6A 3ORJA 5EBMB 1NEUA 3RDTD 1A6AA 3MRPA 4XO8A 1O9VA 4GO6B 1CG9B 1XTLA 1TR7A 5CJOH 2DWTA 1MG2C 1QRNB 4UV7H 3EJYD 1YPZB 1J0KA 3PJSA 4YLCA 1IQWL 4L5FH 3X12A 4M5SA 4OQTA 3DI3B 2VDKH 1G43A 2BZDA 4J2QA 2VR4A 5AVYB 1RV6X 4IS6B 3MJ8B 4X9BA 2GSIB 1A7PL 5IFAH 1OXYA 3DURA 3WTSA 3RL1B 1LJMA 4LPWA 3CX5K 1FL3B 2BS8A 5CKGA 1R3JB 1HH6B 2W65A 2K45A 4QKXB 4U3XA 3QUML 1BJ8A 1UM6L 2CJTA 4Y5VA 2HT3D 4PRAB 3C5ZD 4ENZA 2NNAA 4LNVA 1D5MA 2HRLA 1P5VA 3EYFB 3GBNH 5JW4R 2NUTA 1FORL 2H26B 1TU2A 4XPFH 1XH3B 2H2PD 4EF3A 5D7KE 5GZNC 2B0SH 5JMRA 1LXMA 4L1SA 2FZ3B 5AZ2L 4XXCA 3VXMB 5A2BA 4QRUA 1QSEE 3QR2A 4WI5A 2DEXX 2GJZA 1AIFB 2X9XA 1ACYL 1F11B 3TYGH 1EMTL 3PXJA 4YPJA 1E9QA 4U3CA 3IWUA 1XGPB 3KYOA 1R3LB 2VXQH 1YN7B 3ILQC 3L08A 1IB5A 1GZQA 3S3DB 1JGIA 3GSVA 2H0JA 3ARDD 4CW1B 1X5KA 4HS8L 4Y19D 1A4JB 3K71B 1UACH 2WLLB 1YYLL 1DBAL 3KPSD 4BFNA 1MFBL 5GISH 4CMHB 1LO5B 3S35X 3M45A 3W57A 2NY1C 4AG4L 3TNNB 1XIWC 3CHPA 1P7QD 1RJLB 2NLJB 2W88A 4QXTB 1QSFD 1TJMA 4I4WA 5DDHB 2X6CA 4CMMB 4PV1C 5LBSA 4OZ4A 2ZWKA 5HVHC 3CZJA 4RGOL 5KVGL 4OTXH 1Q1PA 3K6SB 4GUCA 2FL5A 1QLRA 1LO0L 1XR9A 2JIXB 1IM3A 5BOZG 1FE8L 4AQAB 3CSFA 1CGVA 3QA3A 4KROC 3EXLA 2H45A 3DX6A 3X13A 1HSBB 4QYAA 1KLGB 3EO0B 2PP7A 1I75A 1RSYA 1OY3B 3DTUB 1UOVA 2EH8L 1EV2E 1XO8A 4PJ7F 2QLYA 4LARL 3MOAL 1HCFX 2R27A 4LQFH 4A2MA 3O6FC 2FECI 1UWGL 3V0WH 4ZFQA 3BMVA 1P4LA 3BQUC 5I1EL 4HLEA 3GGWA 4I2XE 1AACA 2ITDA 5CUSL 3BPOC 2UYLA 1BLNA 1IGML 2EH7H 4KRNA 5CJQH 1S78D 4G82A 1NAMA 3G6JF 1Q4NX 4XPBL 2J1ZA 4AKQA 3RE0A 4WI8A 2FEEI 5KYYB 5KYUB 1JFQH 1NC4D 4NT6B 4BBWA 4QXWA 1RZGB 3VFWA 5DEJA 2LLGA 1NUGA 2YAMA 2ADYA 4HIQA 5IF0A 1YMMA 3ESNA 4UM9B 3UXFA 3TCXA 4AZUA 3UZQB 4JKPH 1JDDA 1G7HA 2P8LA 2HYMA 5SX4H 1FDLH 1Q9KB 4JQIA 4JKLA 3OKMA 1KJ2B 4JFXA 3H8NA 4WTQA 1EFXD 3KPNA 3WEXA 2X1QA 1DDTA 3CN3A 2Y5TB 2GAZA 5IVXA 3QRGH 3L1EA 5HPMA 4KVNH 3P1VA 3VXNB 15C8L 1NCCL 4GNKB 3KPOB 2XWDA 1QKZL 2F15A 2QV2A 3NIFF 4XMTA 1LDPL 2A83B 1KLFB 1R3IH 3N43F 4MMYA 5E9DD 5LAXA 3MBXH 3L3GB 4JFEA 5E2VL 1M9WA 5FM8A 1LEIA 3S4SA 1NA8A 4DPRA 4XNZB 1FNGA 3DRQB 1T5WB 2ENPA 1VPOL 1GCFA 4QHLB 4E5XG 2DQFB 4S1RL 4LP8A 3HKZA 1CL7H 2DYRB 3VGFA 5C0DB 3PRZA 3CZFA 1TZAA 4JKMA 2UX6A 2Q5BA 3FYEB 4HS3A 2LTQB 1NEZB 2QVMA 4I9WD 2O26U 3IDIB 2Q2LA 5GJSL 1AQKH 4L8CA 2DWEB 1NH6A 2A7BA 4P5TD 4OZIA 1AHMA 1HYRC 5E6RB 2NZ9C 1SUJA 4CJ0A 3B8SA 5CN1A 1QUPA 3FTZA 4X7SL 3K3QA 2XTLA 1RIUH 3VMOA 2ZOKA 4NN7C 3GSQB 4W1TA 2CCWA 2GJ6D 3FH7A 1RURL 4AGQA 1UCTA 4ZO8A 3K8MA 5CP3A 4E9QA 2P5ED 2VZ1A 4KMQA 4WNSA 4U1HB 1T66D 2JK5B 4P3DA 1YECH 1M1SA 5TE7L 3H9SB 3QDMA 4PTUA 4FJ6A 4UOQA 4YL9A 4Q0XH 1NWOA 4NO0B 1KCRH 4QTHA 3QUZC 3QWRD 4RCAA 4CRPA 5TH2A 2P8PB 2MPAL 4B9JA 1TVBB 4Z8FL 3B9EA 3TO4C 4IMKA 1RK0A 5GHWH 5EFIA 1HSAA 4HU8A 3F01A 1UKSA 4X9HA 2GITB 1DL7L 1SUHA 5E5UB 2L7EA 5L2JB 5E8EB 3CSYB 1QPXA 4D2NA 4UAOB 4Z3IA 4E41B 3AQXA 4F2MA 3R0MA 2YN3A 2Q8BH 1VEMA 3N40P 1GJUA 1Q8MA 1UENA 1A7OL 3F58H 2XZQH 5F6HI 2NZ1A 1ZGLM 2A74C 2AQPA 2ARJA 1BF2A 4R9HA 4PR5B 5DSCB 1QRNE 1Y6KR 2UXTA 3T0EB 4JG0H 3ZRCC 4LHJB 4OM1H 1S7TA 4GW5B 1XGYL 3EBIA 4KXCA 4OLYH 1UKTA 1YPZE 1U91B 1GTFA 5DMIH 1HX0A 3DX8A 1IV8A 2O30A 2XN2A 3WNPA 1G4MA 2Y7QB 3UYPA 4JPKL 2J1KA 2NNXA 5DEGA 2D9QB 4NCC2 1ID2A 4IRJC 2VLJD 1RK7A 5D2LF 4XP9L 2OX5B 1TTGA 1JPSH 1R33A 5E94A 4U1MA 3ABGA 4FQLL 4NNYB 2AI0L 2V3EA 3UTQB 2G0KA 2K6WA 2ROYA 1WS8A 43C9B 5GS0L 3HRZB 2IFFL 4OUOA 5D7HA 1FNHA 3NABL 1J86A 5BV7L 1FL6B 1NDGB 3KDMB 1AQ8A 3F6JA 4MA8H 3TN0A 5C0AB 3TEWA 3AG2B 2Q76A 4F24A 5BS0E 4FF9A 5C3IA 3JWNG 4S11A 3MLVL 3VXME 1XCTB 4X98A 3RWJB 4JFFB 4KHXL 5ID1A 4PH8A 2LVEA 1Z3GL 4MWFB 4WJG3 4X0KA 1MPAH 1QHPA 5G4OA 3FUFA 1BMWA 3CDFA 3V4VA 1GGUA 1U95B 3SDDA 4M1CC 3TLRA 3TVMD 1G9NC 3CQPA 3CH1A 2J43A 1NGYB 5IFJA 2EDNA 3M1BB 4LSTH 2WGNB