4JO5A

Cbm3a-l domain with flanking linkers from scaffoldin cipa of cellulosome of clostridium thermocellum
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
170
structure length
170
Chain Sequence
NTPVSGNLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRFAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWGKEPGGSVVPSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a family 3a carbohydrate-binding module from the cellulosomal scaffoldin CipA of Clostridium thermocellum with flanking linkers: implications for cellulosome structure.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cellulose binding protein
molecule keywords Cellulosome anchoring protein cohesin region
total genus 38
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4jo5A00
1K72A 1G43A 3TF4A 4B9PA 1G87A 3ZQXA 4B9FA 1TF4A 4TF4A 3ZU8A 4B97A 4B96A 3ZQWA 4C8XA 2WO4A 3ZUCA 2WOBA 1GA2A 2WNXA 2XBTA 2XFGB 4JO5A 1JS4A 4B9CA 2YLKA 1NBCA 2L8AA 1KFGA
chains in the Genus database with same CATH superfamily
1NEZG 4P2YA 4L37A 1CXFA 3KYAA 2WQSA 3WJJA 1NANH 2FAUA 2K6ZA 3K5SA 5B8CB 4GH7B 5ECGA 3JVFC 3D3VA 4PTTA 1ZGLM 3L1EA 1KGYE 5L9DH 1WFUA 3RX9A 2WXRA 5IOKA 1F4AA 3AITA 2PN5A 3HLKA 3CFCL 3F6LA 2YSSA 1YY8A 4UQ3B 4NNPL 4M8RA 1WH0A 1XQ4A 1OAZH 3FUDA 2I32A 4NXSA 3PLYA 4FEIA 5C07A 3VRJB 4X7FC 3D1MC 2VM4A 2X10A 4Q0XL 5AG8A 1NH6A 3FB5B 3WFDH 2F5BH 1U93A 2NY0C 4Y2OB 1BFVH 4UM8A 3BXNA 1OT4A 4DPAX 3UTPD 1G6RH 4OFKA 2CALA 3DIFA 1R3KA 1WCBA 3APMA 1AXIB 3VXUE 1J10A 3DTXA 5HHMB 1DE4A 2M2DA 3OAZK 4A7TA 3C60A 4AEIL 2RGSA 1RAMA 3K6NA 5DHYA 2CK0H 4LP8A 5AVYB 3H2PA 4PJCF 2FQFA 4WV1A 1DSYA 3BIAX 3FH8A 3NCYS 4XTRD 1YEIL 4FG6C 4HJUA 3V4VL 4E41E 2OS7A 1D2OA 1DN2A 4F1ZA 1KBKA 5BO0D 5A2LH 1E6OL 5HPMA 3X1FA 5K9KA 4PVBA 3AXLB 3VXMD 2B2XL 2CRYA 3V4UH 1T0PB 2IJ0C 1C8PA 2OQJB 4L3CB 4IM8A 4TVPH 2WV3A 3S4SB 3WEBA 3JV6B 2EUWA 4CBPA 2WQUA 2UY6B 4QDGA 2VQ1B 4WSKA 3MRDB 1CFVH 5EIIB 1LO3H 1QFOA 3QUZA 1U58A 1WHPA 2XN9A 5AQ0A 3L3KB 4NQEA 2VLJD 4S0SD 2NY5C 1AHWB 3HC3L 4MAYB 5IUSA 1RMFH 2OK0L 3QWOB 3GMPB 3L5HA 1EO5A 2YFOA 2OZ4A 5GGVY 1I8LA 2F18A 1IAOA 4OIFA 2DJ4A 3BUIA 1RUQH 1AIZA 2V33A 4HQQH 3UG5A 2DQJL 1G7MA 4RAUB 3G6AA 2KHAA 5GGSY 3QI9D 4FI7A 3HB3C 1XBRA 1XTMA 4PSRA 3ZDWA 4AG4H 4F37K 2YC1B 3JYCA 4TUOA 3H54A 5DJZA 2QDWA 1AC0A 2FL5B 1CB4A 3TS8A 3B9DA 3HUJB 1XAKA 4G70B 2YK1L 1X5MA 4QOKE 5LDUA 4EI6B 3D0VA 1DBKH 3ELAT 5AVWB 3FW6A 4GAFB 4ZD3L 3UH8A 5C0GA 3DX0A 4ZFZA 1A1NB 1IGIL 1X9UA 4LGPB 5EZJA 1HXYB 2F5BL 2YRLA 1DQLL 2W07B 3DX1A 4PJXB 4X0KB 2Y7QB 5E99L 3UYOD 1F6AA 2R27A 3EYSH 4OF5A 4RIRA 5D7LE 1A6WH 2V8MA 1A7RL 1F00I 4DKTA 4MA1B 2XJLA 5IF0A 3UYPB 1DSFL 3QQXA 5FYJU 2NX5A 2HFFA 4JDVA 5AUMA 3MA9H 1FGVL 5MEOA 4NNYB 2DQFA 5ADPL 5DWUH 2BLFA 2W9DL 3NA9H 4ORZC 2PXYC 2IBZX 4MRBA 2GAZA 1DTUA 4XI5D 1DQDL 4YHOL 3I9PA 3VWKD 4Z3EA 4Q9RL 4G5ZL 4LHUD 4MZIA 4BIKA 3B7YA 3EH2A 2UZPA 1N68A 3LKRA 3RI5F 3N1GC 1DN0B 3FZUC 2DBJA 4FFZH 5TTRA 2BY1A 3VXPB 4BKLB 1T21B 1KCUH 4PJDE 1FJ1A 2PW1A 1R46A 1Z9SA 1II4E 1O7VA 3IB4A 4HJSA 3BAWA 2RQ8A 3OAZH 1U8IA 4XAWL 4B3EA 2NYZA 4B41A 3VFSB 4NBYB 4QGTA 4EN3D 3U7WH 4LXFA 3FU9A 4OCYL 3IAQA 1NLDL 3O9WB 5SWSB 3CSTA 3GMOB 1CFQA 4ADIA 5IV2B 2AJUL 1JDDA 2XZAL 2UWEF 4NC2B 5AL8A 4AQEB 3ZZQA 4BSVB 4N0UE 4XN1A 5FHBH 5CEZD 2DKMA 3Q8CA 1X9RA 4HS8L 1FVEA 3OZ9L 4Z7VB 5I28A 4Q6IB 5IVNA 2HVJA 1L0QA 2F54E 4XC1L 2KUTA 4YSRA 4G9DA 5F9OH 3EYQD 2FWOB 2AEOA 4LQFH 5D1XD 3ABGA 3V52H 4CMMB 4JE4B 3VX0A 2F74A 4F8QA 4LLYB 3SKMB 3VSQA 2PO6D 3O0LA 5KAQF 1N6QH 1NLBL 5I9QC 3U2SA 4S1SL 3WKNA 3QJQB 1EAJA 3P0YH 4XXDA 4OIIH 4DZ8B 3K0WA 3RNQB 3I02A 2CRMA 2XT1B 3MCLH 3QEUB 1TEFA 3S5LB 5LG1A 1HSAA 2VZVA 1MCLA 4N0UB 2KKQA 5E94A 2DQCH 1C08B 2G5RA 2VLKB 1BX2A 2HJLA 4JKKA 1RZIB 1Q9KA 3N0AA 3D69A 5KSVB 3BSGA 2DZEA 2LU3A 3Q9PA 5DZ9A 3RL1B 2QGBA 3FFOA 5ID1A 2QHRH 3HOGA 3SDCC 4WK0B 4XO4A 1HDMA 2NNCA 2O6EA 3EYSL 4WU7B 2X9XA 2F53E 4N6RA 1NL0L 3EH1A 3ZL4L 5E2WH 2BXZA 4NWUL 1EJ8A 4MMYA 1INEL 1MVFA 3GMNB 3JQOB 1OAXL 2J1XA 4KX9A 4NFCA 2GJ6A 3T8MA 1IGTA 4NLAA 5KTEH 3MRNB 2C9UA 1HIML 1AXTH 2WWMD 3KYMB 4NSKB 3ZR6A 5C0EA 1IE5A 2VL4A 2F7OA 2ZX7A 3A0OA 2Z93B 3MRFA 4PVNA 1RZPA 1MJUL 4QT5A 5T1KB 2ZSWA 2XA8L 3BPCA 3JXAA 1TQTA 4PW4A 4UILH 3U6RB 4B27A 3N1FC 2CHNA 3FU5A 4R5VA 3P54A 3B7SA 4KJWC 4D3CH 3DYOA 2PWEA 4XC3H 3QORC 3UADA 2JH2A 4YZFE 5C92A 3MJ9A 3UPAA 5INCA 1YEHH 3TIDA 4CW1A 2OMVA 1IZJA 1W9XA 4KKBD 1KXTA 4O4YH 5LGJB 4OD1H 1BSIA 3L9RB 5CKGA 1A4KA 4YDKL 1KEGL 2DWSA 1RULL 3UGEA 4ZX3A 1W0VB 4JKPH 4Q6YA 4GUCA 2XPGB 2IH8A 4JHWL 3VXSB 5JOFB 4N0FB 1PF3A 2ZOKA 1W0WB 4OJFH 3O3BA 3OGOE 1AGEA 2X09A 2YUVA 2FL5A 3G08A 3WTTA 4TL4A 5HGGS 2BP0B 4MS6A 3UAFA 2A6IA 4NAMA 4N2FA 1GA2A 2IPTH 2X89D 4F5CE 3SPIA 4IQHA 3PG2A 4UU9A 4LCUB 4QAWA 1YNKL 4LCYB 3X1GA 4ESKA 4OZIA 1TITA 3LRMA 2C26A 1KF9B 3TEWA 2XWCA 4MTMA 4OFVA 5I66B 4NO0D 4ZNEA 3UL4A 2F7PA 1DE4B 4O02H 5DD3L 3CBKB 4ZAKA 3E9UA 3FRPA 4FFVD 4PMEA 2JJWA 1BVNT 1HHIB 4N0CC 1ZHKA 2CM5A 3POCA 4HK3J 1TEYA 4P5TB 4MJIB 4ACTA 1IT9L 4G1MB 1L7IL 2DQMA 1JV5B 4M43L 1NL0H 5BZWA 2LFGA 3P02A 4ZSOA 2GSGB 4JFXB 2AJVL 1Y18B 2IIJA 2LVEA 2Z7YA 2YMXL 2Y0SA 3UTTE 4CU8A 1HK6A 4W4OA 4ATWA 1PKOA 2FHFA 5E56A 4YDLC 3BOVA 1N2RB 5F7BA 3MACH 2FJHA 5J13B 5HHOE 2TSBA 5BW7A 3NCBB 1J1XH 3QQ4A 4O2CA 4W9LC 4GP8B 1ZLEA 5DUBB 3T8XB 4OI7A 2JJUA 1JVLA 2AJZB 3FCBA 1FFOA 4IKLA 1HS6A 1OM9A 1S5IH 4V1DD 1J9RA 1SJEB 1WEJH 2FB4L 5IVZA 1JPGB 1XZ0B 3L7FA 4CSZA 3K6DA 3TX4A 1KCBA 3OAUL 2YSSB 4GXUN 1MF2H 4JFVA 3LRSB 4H44C 4Q9QL 5LAXA 3VJ6A 1PW3A 4YHZH 2CHXA 4NSKA 1HZHL 2XUWA 3U46A 3W3BA 5DJ8A 4L1HA 4FQXB 5DZPA 3BIBX 3RTQD 4HPOL 2PTTB 3FQRA 3I75A 4QLWA 1KJVB 1ND0A 3FF8A 4GRWH 1G84A 4NUQA 4JFZH 2D0HA 1X9QA 2XWXA 2ZICA 4OVUA 1SUHA 3IKCB 1ADQL 2IWKA 4HFUH 4YQXL 4OZHA 1HQ4B 2MQ0A 3FSVA 2BVPA 4M9PA 3EGDB 3VD9A 1M53A 4NP9A 3ZTJH 4ZFFA 1HJBC 4XMXA 2R7EA 5KOVC 2CSPA 3ZSSA 2VDKL 4TNEA 1UUSA 4LSUH 2I25N 3BWUF 5J6HB 3V4VB 4GQZA 4MX7B 4DUWA 3UROR 4LVEA 8FABB 2C9XA 2O6PA 2AXHA 3QDGD 1BJ1H 2XY2A 4PJGF 3QIWA 5FA3B 3HLAB 3F7VB 4XCEA 1FH2A 3CAFA 3ECBA 3LQMA 1HAUA 5DS2A 3W0WB 3KPRB 2F15A 5I1HH 1AYOA 2VAAB 3SIKA 4UT6H 1NBYB 3MXWH 2EKSB 2SODB 3HN3A 5D2NB 1QSEE 4O02L 3NAAH 5E1GA 3UBGA 3IGKA 2XQYA 1U92A 3DIDA 3VM7A 5K9OA 5CIPH 1JXJA 1CF8H 3QDGB 4K8RL 2KYIA 4R2GC 1FGNH 5FUCE 1NC4A 1GGBL 3BN9D 3JUZA 3FO1A 3KPNB 4Y2OA 1EVTC 2BC4A 2F1BA 4K94H 1KBGL 2VRKA 4KRNA 1MWAH 2XN9D 3CXHK 3SKJH 1UT2A 2V2TA 3K91A 1KG0A 4ZAKB 3SJVD 1YNTB 2YBGA 4OGZA 1NEPA 1FIGH 1D6EA 5GGTH 1A3RL 4GOSA 1DBAL 3QFJD 4PCKA 3US1A 3JWOC 3FUNA 5HJBA 5I15L 2JF1A 4NCC1 4UUJB 2HJKA 4H1LB 5T1DL 1AGBA 3IN0A 1CN4A 5ERWA 1BYPA 5DJZB 3HMWH 3ULUH 1SBSH 1MSPA 5D1QD 1V10A 5TGBB 3L95B 4GQ9H 4JJ5B 4W9DC 1QYGL 1T04B 1R0AL 1UD8A 4MCZB 3OPZL 4BWTA 3VG9C 4BSVA 1A8ZA 1U41A 3AXHA 4M7LT 2GIYA 2DV6A 1JF1B 1XB3A 1W0VA 4PI2A 1UADC 4HUUA 2XQYK 3W2DH 3TNMB 2CXKA 3ZT5A 3IVKB 1QPPA 1DBBL 3QK0A 1X4YA 2ILLA 4NRZA 1CU4L 4I0PA 5CMAB 1F42A 1G1OA 3QUXD 4IRJC 1OGSA 4ACPA 1P7BA 4CA4A 3ZTCC 1ADWA 1SJXA 1X5ZA 4NZRL 4LHUA 3UZEC 4R3SB 1IMHC 1CDJA 3P0GB 1PX8A 3NA9L 4AW4A 5D4HA 5E9NA 1NCUA 1CBVL 4FP8L 5AZ2L 3G5VA 4ELDA 2BVEA 4IBVA 4H8PA 1UXWB 4XCCH 4K0OA 3GJFA 4MJID 2NX5D 2O5ZH 1MREH 4PV9A 2NW3B 5B38A 3UERA 2H26A 4TKWA 3BWUC 3L6FA 4UV4L 5HGDB 1MWAL 5KBNC 4OT1H 2K70A 5JOPD 2YC1A 4LDOB 3TBTB 3I6KA 5I1DA 3IAGC 1F58L 5B1JC 3WJMA 4GAGH 2ATAA 4PAZA 4I85A 5G4OA 5ICUA 3TBWB 4ES9A 5D2LB 4DEWA 3EYUL 3N85L 5EV7A 2BCMA 4NZUH 1FI8C 1ZVSA 2X41A 4N5UA 5IHZA 4NX0A 2W0FB 3PHQA 2WO2B 2VR8A 5CFAA 4R0LC 5BZZA 4K3EL 1MRFL 1WA1X 1NZRA 4POUB 1NFDA 3BXNB 3OZ9H 1K5WA 5F7YC 4MA8L 3LEVL 4MJ4A 2ZWKA 1NCIA 3MBEB 3POHA 4JDZA 5L7XL 4H5SB 3BRDA 1NCNA 1PCXA 1JGDB 3FH5A 1AZNA 3JSSA 4GAJH 5EU6D 3IBOA 3FN9A 4EUPA 2P52A 1EJOH 4LCWD 4QCIB 1TIUA 1WBZA 1U8HA 2YPKA 2DWEA 4MXVE 4B97A 3SE3A 4PWIA 5EWIL 4TVSa 4M48H 5GS3A 3VFPA 3L5WA 1D6EB 1LD9A 1USZA 1D9KD 3KYNA 3MYJA 4BKSC 1AE6H 2P4AB 2NR6D 4FXLA 4XVUD 3PXJA 4LSSL 3U4EA 4P2CG 4QHUA 4NZDA 1N8OE 3QIUA 4R0LB 5DMKA 2F8OA 2Q2EB 2YLHA 3G7TA 4A7GA 1X7TA 4UMGA 5KBLA 4LRIA 2PCFB 3ZE0F 1ZY9A 5EU6B 4U1LB 1U93B 4UOQA 2GI7A 3CHOA 3TJEH 1YEWA 3L54A 2GJZB 4W4NA 5ACMA 4IRZL 4ANUA 4R4BB 5KG9A 5HPOA 4GEJA 4XP5H 4QXUL 4GRMA 2CKBL 2A6DA 3HC3H 4KV5F 3DV4A 3E1ZA 4WUUE 2QZ5A 2EO9A 3W82A 4UB0L 4XX1E 2WNWA 5LXGH 1BLNB 3APDA 5F7HA 4YX2L 5TE4H 1U8OA 3A67H 4JFXA 1T03L 3I50H 4LEBA 2DH3A 3TM6A 5K59E 3BZEB 3ZT7A 1MCKA 3RDTB 1F2QA 3Q05A 1XIWB 4PLKC 1D6VH 1H8SA 2IV9A 1FHGA 5DLMH 3FHAA 3H42L 4U1JB 2FDBP 2PYEB 1A1NA 2VXVL 3REVB 5KAQG 2VXSH 4BRVA 3UTSE 2WXMA 4IIZA 1ORSB 5FB8A 1WBXB 4B9ZA 3PHOA 4XBGA 1P4LB 35C8L 2ZD0A 1M71A 2YD0A 1SN5A 5G5DB 4QLRA 3VG9B 3W9DA 1HHJA 5KVFL 2P49B 4YVUA 1ZT7A 2JE8A 5D8JL 3UTQB 3FU7A 5BZXA 1INQB 3CQQA 4FNUA 2HT3D 5FECB 5SWQA 5GSVA 5E7FA 4LCCA 3GJEA 3HTLX 4C56E 1JTPA 3BESR 2EVJA 1K6QL 1AMYA 5J1AA 1ILSA 2YD3A 1ORSA 4FABH 2ESVD 2FZ3A 4LOFA 4NHUB 5EBGA 4EUPB 4KXBA 1MFAH 5BPPA 4A04A 3L9YA 1HHKA 3BFWA 2V4LA 1FWXA 3GI8H 3O9WC 2EUVA 4P2QD 5CCJA 4LHUB 3GRGA 2Q6WB 5JA9A 4CW1B 4X7DC 3T2LA 4OLWH 5TK2A 1RZFL 3EFDL 4NC1E 5DTFA 1GH7A 3TBCA 4JS7A 2H2PD 5DFVC 4B7IA 1OB0A 2Y22A 4PJGE 3MRMA 1MFUA 4TQEH 3AQYA 4HW6A 5H94B 2IDUA 4X83A 3DX2A 4KPHH 4WKZA 4LQFL 3V52L 3HI6H 1INDH 3QNZB 4ZQKB 4WW1B 4L8SA 3LNEA 3NJVA 3FO9B 4GG6A 2ENPA 2F5AL 1I53A 1H8LA 4WJG3 4ORGB 1YMMA 1RZKL 3LHPH 5E1AB 4D3CL 4JFDA 1JZ4A 3MV8A 3OV6A 3FYIB 1GGIH 4YDIL 2J8HA 1OM3L 5TD4A 1WZMA 6CGTA 4KJPC 1O75A 3TXAA 3I50L 4N85A 3BD5A 1CGYA 1IE4A 2DTMH 2PR4H 4PIBA 4JRFA 4AJVA 1CL7I 5AAMA 2HKAA 2K6YA 3QQ3A 5C09A 2VABA 3SDAD 1ZSDA 3O8XD 4HFUL 2AQTA 4QRQB 1MWAA 3V5DA 2E74C 4P2OD 3U9UB 1RZIA 4N2EA 4YSQA 1FL3B 2J3SA 1PG7X 2ZAIA 1UJ3A 4PRIE 5DVOA 2XTSA 3G6JA 3G6JE 4POZC 4LP5A 2BRRH 1PZUB 5TJWK 4IJ3B 2L7JA 1XGTA 3DPBA 3O6FD 3BHBA 2EECA 3QYMA 2VKWA 3KLSA 1Q94A 4PREB 4WNQB 2L8AA 5CBEA 3L3DA 4G43A 4OUUA 3W5MA 2ATKA 1Z0MA 3HI1B 5IESL 1V55B 1ZOXA 4KZCA 5JZ7C 2J6EL 2R39A 2AKRA 2ZUSA 4DPCX 2P24A 2AZAA 4CVZB 2VLRD 5AKTA 1O7SA 4L8CB 1B4JH 2HVKB 3GBML 4M6NL 5EU5B 5HDRA 2YD7A 2XG5A 2FEEL 3BEWB 3B2XA 3QWQB 5BJTA 3SZKC 1AKJB 2Z31A 5E9DE 2GJRA 1YMME 4YH6A 4GS7C 1Z66A 1P5VA 2D7MA 3VFTB 3MUUA 3GMLB 1F6FB 5E8EA 3LEYH 4KK9C 1KEMH 4NKDB 1IZKA 5KVMC 1Z1WA 3CVBA 4LCWB 4LLMB 4KJYA 4LAQL 4DZBA 3K6IA 4NNPH 1HQ4A 2A74C 1H3UA 3EXLA 4IMLB 4ZXBA 3U2IA 1HHGA 1CLOH 4O58H 5IGXH 2NY2B 4L4TA 4PGZA 2FUTA 4Y2DC 4OD2B 4V2BA 5A2FA 3LNGA 1SF3A 4RAVA 3QI9C 2G60H 3WS6C 4RFNC 4HLEA 4OGAC 5CJQL 1CD9B 3UFIA 1FZOA 3HLAA 3EYOA 1NJ9A 3BSZL 4MXWL 5D6DC 2IXQB 3ARSA 4JFPB 5T1MB 1I1RA 3LB6D 4AIZB 2BK8A 1LO0H 1K8DA 3V9CA 4M1CC 4ONHB 1C9SA 3E6FB 3U0TA 3CGTA 5DJ0A 1A1OA 4P3WA 4Q97A 1Z9PA 4TRPH 1VFBA 1YEJH 3KYOB 4XCFH 2CCVA 4XH2A 1JZGA 5FO7B 7CGTA 2DLGA 3J27A 1D5RA 1TYJA 5IBTL 3WIFB 2GW5A 2OTPA 1E8WA 1X5KA 3GHBL 4RNRB 5EF0A 5SV3A 1L7TL 1CI3M 1Q72L 4IOFD 5I5JA 4RGNB 3NSDA 4R9HA 1EX0A 3FB5A 1FUNA 1RIHL 1EHNA 4FJZA 4XAWH 1BBDL 2FTAA 2ZUVA 4YGAB 1HQRA 1IAKA 1ZA6A 4Y7OC 2JXMB 5M94B 3UYRH 4HKBA 5JW4R 4FQIH 1EO8L 3PPSA 2ZKYA 3BEVB 3EH3B 1OAYH 3N44F 3LXAA 1J8HE 1YC8A 4X6DE 3RYMA 2W5PA 4LPUA 4U3SB 5A16A 3DHUA 1T4WA 3NZHH 4G8FB 4IRJA 4PJFE 2VDRB 4K5PA 4WWKD 4L3AA 3HG1B 1K9TA 1ASQA 2BP5M 2NYYD 3MFGB 4X6DF 4TSCH 4HH9B 2BP0A 4F57H 3IFNL 2EXWD 3T04D 1FL3A 3STLB 5EEZA 3ZQ9A 1DHKA 4KROD 1WFMA 3FOMB 5FX3A 2F53A 5D7JA 1UM5H 1YAZA 3N91A 4WEBH 3KXFE 4NUGL 2E4TA 3I3EA 5D72H 2QV2A 4FNQA 2WB1A 3AG3B 3WTUA 1XF3A 2WIMA 5GSRB 3NIFE 3MJ8A 2K4WA 4IJTA 4IIQA 3WXWH 4HCFA 3LEVH 2I9TA 3MRQA 4ZUVA 4GIAA 2H6OA 3MRDA 3KLLA 3HG2A 3RJQB 2QDVA 3T3MB 4E2OA 5I0DA 3RPKA 1EFXD 5BCAA 1P7QD 3N04A 3B9AA 3OGCB 1ITBB 4PJHB 4EI5B 4OUOA 3Q6GL 4RGMC 1T66C 2AQNA 2LW3A 3UAAA 4U6XB 1ZHNA 3C08L 1BYOA 2X4QB 4ZTPL 4XO5A 3EJPA 3D5OF 2YPKB 4X5WB 5I1HL 3WFEL 3HAEA 4GIPD 4NNXA 2VH5L 2FYVA 5ETUB 1EMTL 3NAAL 1T1YA 1OF0A 2CRIA 1N5YH 3OR7B 4U1KB 2AQPA 4LLVB 4P9MH 5F21B 4KTEH 3MSPA 1WCBB 2ZOUA 1AD9A 1N6UA 1RSFA 5DLLA 3BE1H 5GHWL 4XMZA 4R2GB 2Y06L 1JXGA 5DHYB 3L4CA 2DEWX 4LSQL 3VVVA 1OOAA 1JK9B 2EIKB 3QPXH 2QEJA 3FB6A 4KY1H 3FQTA 1B90A 1YUHA 4YDVB 3TIEA 4TQ8A 2ARJQ 2AXFB 3SE3C 4I4WB 5J12C 2XZCL 1JNNH 1N8ZB 5D2NC 1E2VA 3OKOB 1JZ2A 3SYOA 3DJSA 2MCAA 3P9WB 1A1OB 2EDFA 4V11A 4NUJB 5F3FA 3MVSA 1VACB 1VIWA 1ZA3A 3QJVB 1KIPA 4U1HA 3K71B 1W15A 3SE8L 2A5UA 2P24B 4DEPB 1XX9C 2AKRB 3L08A 3DMMD 1T1WB 5FYLD 2UYLB 3E3QC 2A74A 4K94L 2G2PA 2H0JA 3ATFA 4ZNCD 1GYCA 1KIRA 2IH3A 2N56A 2ED6A 1U8HB 4IEFA 2BNRB 3HBQA 3T65A 3RTQB 4FXKB 1G7HB 3V10A 3ZJAA 3CE1A 1HQRB 1IAKB 1WISA 1M57B 1BEYH 1X9LA 3VU1A 2Y24A 4B5ZA 1IAIL 1EEZB 1FE8H 1NUNB 5EEXA 4DVBA 3MOQA 2ZNXA 4NKMB 1HCZA 4N8VB 3EHBD 4L2YA 3VB8A 1CYWA 5K33A 3S37L 4ONFH 1O5DT 5BRZD 5JW4N 3QCVH 1JFQH 4F7EA 3UBXB 1SUJA 4JL1A 3ATBA 3HMXL 3PWNA 1J8RA 4BK8A 3MHZA 1S8DA 2XIIA 1BXVA 3BI9X 3JWNG 3NIFB 5T1LD 5HHXH 1S46A 4PLOB 2VT0A 1QSZA 3F6JA 3AM8A 3LOWA 3MRGB 3IF1B 4KNUA 3ZGHA 2BHUA 1BXAA 3QZLA 2YWZA 4YDLB 3JWNH 1UURA 3MLUH 1NJ9B 1GJUA 2VDLH 2XPYA 1FVCB 2R1YA 4XB3A 4Y4FB 2J6EA 3UO1L 4NYLB 2W65A 3E2HB 2IAMD 4OZHE 1CXLA 1TR7A 3FH7A 2OCFD 4P2RE 2IDFA 3Q8FA 4H7VA 5EDSA 1HVXA 4ZMLA 2F74B 1OARH 4A1RA 4NQDD 1NCGA 1MI5B 1JDCA 2CO6B 2V37A 1QP1A 2QTEA 1OP3K 2JCCF 5AUMB 4YDJA 1AZBA 1RUKL 3HIZA 4PMFA 4WI8A 4P4RB 5DD6A 4J2QA 4RWYL 1QKZL 2P5WE 3QI9B 1TEGA 2YD9A 5EBMA 1OXYA 3JZ7A 4MA3A 1PZCA 3PWJB 3QR2A 5EBWA 1XF5A 1PLBA 3B2UD 3GBNL 1JGVL 1S7TA 5JHLL 4OQTA 4PGCA 4S10A 1M4KA 3CFBB 4OLYH 4CU6A 2A4EA 2VMDA 1UB5B 5BVJA 4P05A 5CJXC 5K69A 2IPKB 3VXOB 2IH1A 1X7SA 1FNEB 4U1NA 2H32A 1FJ1B 3W1ZA 1FVDA 4XBEL 3RDTD 3HUJA 5CEYB 4L3FA 4FF9A 5BV7L 5ISZB 4IBSA 4PJ7F 3RVWC 3U4KA 1KY7A 1SYVA 2VDLB 1YMMB 2AEWA 3FBQA 5BS0D 1M3JA 1JNHB 3QCVL 5KYXB 4JFED 5IEKA 3CBRA 2OULB 3BAJA 3OC8A 4HIXH 4LL9A 1EGJL 4JFFE 3RBSA 5EBMB 2RH0A 2VRQA 3IU4H 2X4SA 3DVGB 4AVHA 1PS3A 2DEXX 4NKIH 4G8IB 1OPGH 1JZFA 3ESUF 5DHEA 4HUXB 4MQSB 3U7YH 4HX1A 1FNSH 3LQZB 2MIZA 3AB0C 3BGMB 5FV1L 3RI5K 4MLIA 5J9PB 5LCVL 1BG1A 4FERA 5TDOA 2ODHA 4KX7A 1TYEB 3KXFD 4FFZA 1DYZA 2OJZL 4NJAH 3O6FA 2XG4A 2JK5A 1Z5LA 2XRAH 2PTUA 4PRPD 5CN2A 4YPGA 3VDBA 3TBWA 3BIKB 4LVNB 4OGXH 3O3DA 1DFBL 1KJ3L 4YO0B 1ORQB 4PJBF 3RILA 4NM8L 1BFSA 2YD6A 1U92B 2P5WA 3A21A 4AGNA 3CZEA 4YBLB 4QRRE 5GGVL 2D0GA 4AYID 1J9CT 4GXVH 3JVGC 4WNQA 3GXPA 1WIOA 1L7IH 4RBPK 5CP3A 3AY4A 4I1NB 3NABH 4WTZG 4M43H 3SY0A 4UOJA 3C2AH 4GI8A 2EDXA 4OF8A 4AUYA 1LEKB 5F3HA 5F72S 4ZZFA 1J05B 2G4EA 1A2YA 3ZPDA 2R9HC 5KG9B 5JR1H 2UZYA 2BFVL 3WXVL 2KH2B 1G9NH 3UYPA 4NS0A 2OSLB 3B7UX 3PWPB 1AHWC 3ZX1A 1OZUA 3VVWA 1CD1B 4L29B 4X4XB 1MJJA 4WW2A 5F1NB 1A3ZA 1CFQB 1KBBA 1S8DB 4J4PC 3F84A 5I18H 1ZV2A 3C9NB 1VPOL 2G75B 1N8ZA 4OU3A 2ARWA 1WEJL 4GO9A 1TT6A 4OIIL 2DW5A 5A6IA 1CLYL 5J6GB 2LVCA 4ZMNA 3ULUL 5DT1H 4HETA 2IDTA 3BZ5A 5CSZB 3GBDA 4AEIH 4HIXL 1OVZA 4MCZA 2YIHA 2JKRM 3U4EB 2F58L 3KPRA 1PNDA 4XC1H 5F9OL 2A9DA 3ZDYF 4BKLA 2A74B 1GGYA 2UYLA 1A5FH 1UACL 4HH9A 2F0CA 2HX9A 2PCYA 3UGXA 2RJMA 3EW3B 3APFA 4LARL 4JY6A 2BNRA 1ED3A 4XCYA 3K72B 1RURH 4PB0H 4UM9B 1J8HA 1ZTMA 1RKRA 3CN0A 4K7FA 3EO1B 4PGEB 1UXSB 5GS2H 2XXCB 4ISVB 5EUOB 3KLAA 2K45A 5LNGA 1KPUA 1I3GL 4KUZL 5C0BA 2MHAA 2DJSA 4I3SL 2UXTA 3FBKA 3FPXA 3F01A 2FX9H 4LKXB 3M88A 1QRNE 2ADYA 3NK3A 3KLDA 2P48B 3DV6B 3LSOB 2XPGA 1A14H 2K7QA 2PPAA 4XVSH 1HWGB 2AQ1A 3U0PA 4HOWA 5DZVA 4LSTL 1HHKB 4DN3H 4WW2F 3ZOAA 5D70L 3L7EB 1GMIA 4MAYC 5I6LA 4UZSA 3CXDH 3IK2A 2FX8H 1I8MA 1BBDH 1TVHA 5LQBH 4KKNA 4YAQB 3TV3H 2CUHA 2FJSA 5F7EH 5ADOL 4I3RL 4YHKH 5G4MA 1I3RB 2CLVB 2FEJA 3NCMA 5B8CC 3K8MA 3UOAB 4YDKH 2DIEA 4X6BA 1IKFL 3G6AB 2ESVB 2J6WA 3QFGA 4GRWF 4F7PB 2YK1H 3PHOB 2WWKO 1D7CA 4H13C 5IJKC 2PWGA 5C0FB 3NRFA 3PYCA 3CPUA 1AVAA 3DVNB 3NEEA 3VFMB 4X9HA 5I30H 3B34A 1H5BC 3N1MC 1NDGA 3I6GA 3TYGL 1RPQA 3SHSA 3X13B 4O4YL 4XGZB 4XPFH 5ACLA 1PKQB 5I17B 1J8HD 5F6IB 5K9QG 5J4MA 2ZX5A 3QRLA 3MGTB 4GT7A 1QVOA 3MQIA 4HAKA 3DUUA 4OLUL 1HH9A 4TOYL 4Z5RA 4E5XG 1E4WL 3AABA 1LD9B 3BAKA 3LZPA 1ZSHA 4R0LA 5EUKB 4BH7A 4Z7WE 4AV4A 1MJJB 5AVQB 3TEZA 5DMIL 3T1FB 4L4TE 2BIOA 3MTXA 2O1AA 4NENA 1JRHL 1IC7H 5JMRA 1A5FL 1UACH 4NO3B 1LXMA 1JPGA 1XZ0A 3L7FB 3HG3A 3HNVL 1AANA 3LPOA 4M7LL 3FT0A 4DGVL 5BUPA 5IEKB 2AXJA 2VYRE 4CDHA 2YMTA 3MCKB 4F2MA 1JN6A 4F2ME 4JNXA 1F4XL 3DYMA 3GZQA 3LVEA 5GGQL 5FKAB 1J5DA 1QO3A 2OL3A 3OSKA 3HZKB 1MLCA 2JKLA 3C8HA 3EIFA 5BOJA 1OAQH 2XVKA 3GB7A 3H0TB 4NQSA 1D5BA 3S6CA 4HJ0D 1HFUA 3QXVA 5HJ3B 5E8PB 1F1DA 1RPUA 4G7YL 2VUKA 3HI5L 2WTPA 4P3CL 3WCYA 4B50A 3ULUF 3ARWA 4M4RB 5IFAL 3GXUB 4K9JA 4LHJB 1A6TB 1KJ2A 4G59C 2J6EH 3OLIA 4GO6B 5C07B 1ES0A 3K1KC 4DN4L 3ULUE 4JMXA 1RUQL 1KGCE 4OGQC 4PR5B 2ZWNA 3MCG1 2BY2A 3PQYE 2HXAA 3SY0B 1EO7A 3DHJA 1F45A 3IJ7A 2VERA 1J1XL 4WDIA 2DBLL 2BZ7A 3DXAA 5GS0D 2WZ5A 4HS3A 2X44D 4OY9A 1HL8A 5HGAA 4L1BA 1HHGB 1FZJA 1M9WA 1T0OA 2OPCA 4N2GA 4YFDB 4ZRGA 5KYWA 3V79C 3MREB 4R3SA 4DWHA 5E6IA 2B9BA 3MLYL 3L1OH 4R7NB 4GFXA 4F24A 2IQ9H 4ODWA 5EBLA 4HG4J 4LLDA 2BHFA 4PJIE 1CFSA 5F44A 3H9HB 4JFYB 4ELMF 4I5BA 1QRND 3UPCA 1J88A 2ED8A 2ID5A 2C3VA 3F64A 2Y69B 3HZMB 4EZLA 2ATPB 1Q1JH 2WVVB 2D03L 3MUZ1 1S9WB 3EGDA 4U1SA 3RL1A 3UJTL 4EIZC 3D06A 4PS4H 4OV5A 1JS4A 1JAEA 1G7LB 2Q6WA 4R90H 2DAVA 1LYQA 2XNAA 2DM3A 4O2FB 4PJHF 3TCLB 3QGVA 1U91A 3L4XA 5F6HJ 3CBJB 1GC1H 4AVKA 4Q9RH 4JPSA 2XN1A 3DECA 3QUGA 4PI0A 4KKPA 4RGNC 5DVNA 4PJGA 1F13A 1DN0A 2VMCA 4C55A 5GS0C 3HN8A 3U2JA 4QY8B 1T1WA 2DIJA 5E2TH 2B4CL 3BUPA 3MBEA 5KS9A 4ZODA 4PGBB 4NO3A 2K6WA 5FUZL 4FTDA 1UWXH 2NZ9D 5FYJH 3TA3C 4I0PB 4IRZH 4NRZB 4GKNB 3ZKMD 1YN7B 3S96A 1NLDH 3M07A 3O9WA 4N9OB 3QWRA 5TH2A 3QIUD 3CZLA 5T8IA 3QFJA 4DTGH 4KO6A 4MDIB 4G5AA 5PAZA 1QLEH 3NJHA 2F08A 4U7KA 1J9QA 4GNKB 4HGMA 3GS4A 4HIPA 1NCCL 5HJ3A 2Y2WA 1EEZA 3EJRA 5DVKA 1W8OA 3T0BA 1L9SA 3QUZC 1W80A 3EOBB 4L05A 4N87A 5AVSB 3QJHA 4K3HA 3A4DA 5KN5B 2AJ3A 4UT9H 4FEMA 1PIFA 3TO2B 2EADA 4AC2A 3EOTL 4FI8A 3H4HA 5F7WC 3SBQA 4P2QE 4PR5A 2EDLA 3AT9A 3P2BA 3WIIH 3FN0H 4NIKB 3MLYH 1R0AH 5E8OA 2KLRA 5B7FA 3CDYA 4OAWB 4XNUH 3CC5A 4Z3GA 3V0AC 2AI0L 1LO3L 2VLKD 4WRLA 3S5ZA 3WJLC 1UVQA 1NGZB 3T6VA 2O5ZL 4BCXA 3SDDD 4GS7B 1MI5A 1TJIL 4ANKA 4NT6B 1R24B 4AYMC 5E2TL 4GAYB 4ODWB 5F7AA 1N10A 1W16A 2WJ5A 2XN9B 2HJFA 5E6RB 3TU6A 1RHHA 3CZKA 1DJHA 4LL1A 1UZGA 2PO6B 2KZBA 4MQ7B 4ECNA 4JBSA 5KYWB 1PZDA 3VAEA 1WZ1H 3BO8A 1XH1A 5FM5O 4WO0A 4Y5VA 3VSTA 3F83A 4A2EA 2MKWA 3MRLA 1TVBB 4AMKH 4RDQF 4Y9FA 2R4SH 2NY7L 3H7BB 3WE6B 3WENA 2VDMH 3MROB 4Q4EA 3O8XB 4M5SA 1LP9F 4X42A 4J3SA 4RZCB 1G7MB 4RAUA 2DYPB 4F1SA 3DUHA 1OSPL 2OI9C 5K1NA 4AT6B 2P8PB 4HFWB 1LP9E 4XWGL 4M3HA 2ZX9A 1BD2A 1OL0A 1P84J 4Z7AA 4ZMZA 2FJFA 3K74B 1WAAA 4JZNA 5G5DA 3SGEH 3W9DB 4AYSA 4EN3B 4ZMAT 1YECL 2E3VA 1O0VA 1JZDC 3UBFA 2F5AH 3SQOH 4KVCL 4KRPC 2XQYG 3ALXA 4OB5L 4HS6A 4QRPB 3RVXC 2A0LC 1O7DE 1PTZA 4FMFA 1NTDA 1IAIM 1WRFA 1BHGA 2WZPA 5GISH 1SFDA 3TF4A 3PFQA 1R33A 3ESNA 5D55A 4AT6A 3CMGA 5LGJA 2F58H 1VGKA 1ZANH 2YUWA 3VWJC 2AABH 3AXLA 2ROXA 3VWKB 3R18A 2IAMC 3NH7H 3O2WH 5L0QC 3PS6A 1B9KA 1EZLA 2FHBA 1A7QL 4HCGA 5CAYB 1CG9A 1J5HA 1A22B 2EDRA 4A67A 3O3AB 1DSFH 1BGXH 4AQ1B 4EIUA 4X6FB 2D3LA 3HRPA 3SJVE 1J0YA 1BQLH 3QQNA 4K5MA 3IMSA 3WDHA 1U8NA 4G6AD 2IGLA 1JPTH 3E8UH 4NQCA 2BNUB 4X4YA 1BVLA 3HRZA 4BQ8A 4RGOL 4GW5A 3D34A 1T2QL 3AG4B 4QYOB 3QDJD 4HJJL 2X53A 3AJ7A 3P4MB 3DX3A 1RUPL 4MHHI 5IY5B 1LMIA 3N1QC 4G1MA 2BS71 2AK4B 4D9RD 4JUSA 3CV5A 4M5ZH 3CH1A 3T2OA 1HILA 4BRJA 5I1JL 4W70A 4NC0B 4XNBA 4Y5XB 2MOGA 1DUZB 5FCUL 2ETWA 1OAZL 2Z8SA 1S3KH 3HG1A 1NCAH 2AV1A 3GSRB 5HVFB 2GY5A 1CCZA 3E9TA 3BPNC 4BWWA 4N1HB 4J1UA 4Z7UB 3KPPA 3TNNA 3E6HB 1L3NA 3D48R 5E8OB 4I1RA 2Y1YA 3TVMC 2R4SL 3B9EA 3CFEA 1ZKAA 4CILA 1AACA 1BMGA 4F7CB 4ZZKA 3VM5A 5CEXA 5MERA 2BNQD 1ZIAA 3FQNA 1CPUA 2A6JB 5J56B 1H5BB 3CFDB 4KKQA 4W6WB 4AIEA 4KHTH 5J8OA 1QHQA 1W0WA 4GQ9L 1M6OA 4CNIA 4U1NB 5LN4A 5KJ4A 3KS0H 2WW8A 5ICYA 4JFFD 3TT1H 4B3VA 1QFHA 4N8UA 2C9VA 3B37A 4ABVA 4UQIM 1HTYA 3CHSA 1KV7A 1YECH 1JK8B 1OAKH 3S4SG 1K85A 4LIQE 2H4EA 3MLTB 2V8LA 3GIVB 1KTRL 4NKQB 4Z7UE 5CFHA 3ESOA 5ABDE 4YL4A 2B14A 3VFVA 3OKMB 3LRGA 1Q9WA 4HWBH 5C86A 1YN6B 1XGZA 1ZEAH 3K46A 3QEGH 3H8NA 5A2CA 3IPEA 3RJDA 4JPKH 2WNGA 4P5MB 5IB5B 1NFDE 1HXKA 2QFPA 1YNLL 2X7LB 4TV3A 3LQAH 5KSAA 2JKSA 5CWSB 4FQLL 4ZUWA 2WVUA 4R97B 4HIQA 1DEDA 4TQHA 1SEQL 4HAGA 2DQDL 2X4OA 3MR9A 2HKFL 3ECBB 2P5WB 1IGTB 4GMTL 1CZ8H 5J7CC 2GPZA 2NW3A 3P9MA 5IJVB 4U0RC 1HINL 5JR1L 8FABA 4HIHB 1OAQL 3HHSA 4XC3L 2IPKA 3VXOA 2Z92B 4KMQA 3OR6B 2DQJH 1EH9A 4ZS7H 4YXLH 2YD1A 3V5KB 3PF2A 1I8KB 3BGFB 2C3GA 2CCLA 2DQFB 2C1OA 3VSVA 4L0YA 4ICXA 3WFCL 5EORL 5TDPA 1XR8B 2HG0A 3VMOA 2J88L 4JG5A 5IB1B 2H1PH 2JCWA 3DJZA 3ARPA 2QJDA 3P4MA 4PRBB 3GUTB 1RK1B 3VYNA 3I75B 1AJ7L 1ZS8B 4PP1C 1IGIH 1UZ6E 3L3DB 3FSOA 4L4VB 5EC1B 3B5TA 1U8NB 4FQHA 3NJLA 1FG2A 3DXAB 2XKNB 4G6FD 2OSWA 1PVHA 3R06B 3VXTB 3CQPA 4NI6A 3D2UA 4JO5A 3QIWC 2BWQA 4HJGA 3CFQA 3DURB 1FO0L 2F53D 2YPVL 5D7JD 2ZSVB 5BQ7B 4MBOA 3MRRB 4RDQG 3D8MA 3FHQA 4MSWB 2C3HA 5E5MA 3CZJA 3R7QA 1HSBB 5DR5H 2ZUXA 4I87A 5FAAA 3QG6A 3ZR5A 5BW7C 4KDTC 2BVUA 3C6LB 3CSPA 5J6HA 2W60A 4W1TA 2PR4L 4X9IA 5DJYB 5TE6L 1F0LA 1TVDA 2WBJB 4QTHA 3MNVB 1AKPA 3KL5A 3MV11 4K5LA 2CHZA 3AU1B 4WY7H 5I2IB 2GT9B 4D9QD 2LQRA 5LAPA 2X38A 4ZPTA 3ZTJG 5IQOA 4S11A 1G4MA 3VI4A 2G3MA 1XWVA 3VFOA 3RY6A 3ISRA 2ICEC 2WSPA 1VADA 3C8KB 4IMKC 4F80A 4Z7NB 3FTZA 3PWVA 2ZJSH 1CL7H 3CFDA 5K9OB 4LAJH 5L4MA 5LQBL 3RNQA 2W9LA 5AVUB 2H3NB 4EVNA 4RA0C 2WXPA 2Y7OA 1NIDA 5IK3A 3JWDL 4WDIB 2BIPA 4A39A 3I6SA 1ZJBA 1KIQB 3NCJH 4FTVE 4GW4B 5I1AA 3BUYB 5IB5A 2Y5QA 5SX4I 1I3RA 1FFOB 2CLVA 4LT7A 1HINH 5EBWB 4F58L 4PJIB 1Z7JA 1I1FA 3IRCA 4MJ6A 4NO5B 4DO6A 1YN6A 2Z8WC 1F4YL 2Y25A 5TPWL 1HILB 3PJSA 3Q1SL 2NXYB 3TVMA 1HKLL 3BZ4B 3W56A 1PX4A 2CJUH 3MNWB 2WUBH 3O6LL 1GHFL 1Q9LB 1TF4A 1BPLB 4IKIA 4U1MA 2OMYA 2J21A 5F7DB 5C3TA 4ZPVB 1KEML 4PRHE 1Y0LB 5BV7H 4HT1L 2PTTA 2VC2H 1Z9MA 3MODL 3QWOA 4BDVA 1MAKA 4PJ8D 1XSIA 3IJEA 5F0JB 1E9OA 3GSUA 1U6AL 2LGNA 4NNXB 4DESA 4Z8FL 5AB9A 5EZLA 3MBEC 4E9XA 5EU4A 2R1XA 5HYFA 4XNYL 1C1EL 4FLRA 3GYRA 4EUPH 4YR6B 3B2UC 1BD2B 3KCPA 4OCRL 1RFDL 4P23D 4CU7A 2XV6B 4JM2B 2OQJA 3C5XA 1XH3A 3CLEL 3IDUA 5C6PB 4LASH 2GTZB 4IRZA 4CN4A 1UH4A 4MJ2A 3H53A 4KOCA 5K59F 2P9RA 3KYKH 3SYAA 4FHJA 2D9QB 3KWVA 5JNYA 3EAKA 3WIIL 3V4PH 2I69A 4A2DA 2CCWA 3S7GA 3INUH 3WUWB 1B3IA 3MOBH 1DBJH 2X6CA 3B8SA 3BDYH 4NN5B 4ZSOB 5CZXD 2GJ6B 2VXTL 1MRDH 2Q86A 3UYRL 2ADFL 2HTKC 1SMDA 2Z7WA 1FIEA 3QXWA 4IIQB 4M93C 1P7KA 4YNYB 5I24A 5JPNC 1MH5B 3CDGB 4NXKA 1JDAA 1ZHLA 4FLSA 2E75C 3KR3L 2NT1A 3LS4L 4UQBA 3MA7A 5DYOB 5DJYA 3PDOA 4AMXA 2ZT9C 3L3HB 4PCYA 3KHOA 4LOUC 3X2QB 5K9KB 2BNRE 3MLRH 1EWHA 5DRXA 2TAAA 1CURA 2W1NA 4DP4X 4EZJA 4JFDE 1AO7D 3O81A 1IRAY 3AQXA 3QEUA 3SDAA 4TLUA 2IANA 4UNUA 3KLQA 1KTBA 4NB7A 3ABZA 4TVUA 4UB0H 5AAPA 5JORA 1MHEB 4NPYB 4RZCA 4Z3JA 2EH7H 4JFQB 1KGWA 4PJBB 4D0BB 2YR3A 1A47A 4JX0A 4L3ED 3FRUB 3QDMA 4DHLA 4J8RB 4UTBH 2OMXB 2GUOB 3TA3A 5JHAA 4I88A 3GLEA 3N0PB 4OZGF 4OZIE 2LAGB 1JZ7A 1MJ7H 2Z7UA 3Q1SH 4N5EC 3CLFL 3GFUA 4JAMA 3LCYA 5ID0A 3DARA 5J5EA 4Y5VC 4FXGB 2EXTA 2WO3B 3PV6A 4OZGE 4L5FL 3VCLB 3H42H 5AB2A 4J4PD 3FCUB 2BX5A 4AGOA 5IVXE 5TFSH 3E7JA 4ODTL 1OTUC 2WLHA 3F7YA 4F2FA 4J5VA 4XRCA 1KTLB 5LGHH 2CK0L 3WXWL 3FB7B 1GGUA 5JXEA 3BZ4A 3FO0H 5C0IB 1YJDH 2YBRA 4G11A 4NQCD 5EC2B 4KAQL 5I9QB 3WJJC 2FQGA 4U6XA 1Z9SB 3K2UH 3LNIA 4OD3L 3UP1A 1A4CA 1TPXB 4DGYL 5IMMB 1S2EA 1U3YA 2LLLA 3U6RA 3QPXL 4KY1L 4HSAC 5TQ0L 1NM4A 1VFAA 2WAHA 2ZP9A 5J13C 5KVGL 2B2XH 4JFOB 4IMKA 4U1LA 3A5VA 3GJFB 2QLVB 3INUL 1UWEL 1RZ8A 1TJHL 3TN0B 5F89B 5GSRA 4ZXBD 1ZVNA 4JG0H 3AU1A 4HVBA 4D8OA 1YMHA 3ZDYB 2E8ZA 5CILL 2HFFB 3ZTNL 3VI4B 4PUBH 3BJ91 3IDXH 1EBAA 2FR4A 3UO8B 4RGND 1NGPH 3H2WA 3RWEB 2IALA 3ZE2F 4DW2H 1LVEA 1JPFA 1BZ7B 4OGYL 3LB6C 2P5WD 1E8XA 2MTPA 1E5ZA 1T89C 4FKHA 3B5GA 1KIQA 4QXWA 1R3LB 2X05A 3Q8EA 3TYGH 3WEAA 4MD4B 4RCAA 1DQLH 6FABH 4ALAL 5ESVB 3QUXA 3D3VB 5KS9E 1E6JL 3MRCB 3SGEI 5HBBA 3S37H 3IDNB 1ACCA 4PJFA 5DT1L 3S5YA 1CIDA 4CJ0A 1JWMB 3VD2A 1RL1A 3MJ7B 4LCCC 3QZMA 1ICTA 4UINH 1IARB 3HVNA 2Y6SC 1I7UA 2APTA 3IS1X 1FYHB 4P06A 4OCSH 4MASA 2Y5TB 3PXHA 2DQGL 4PJ7B 1MELA 2XFXA 3RIAF 4HXBH 1OCWL 3GBEA 3EYVA 4ODUA 3TWCH 1QWNA 1WD8A 2R2EB 4HIEA 1G0DA 3ROLB 4CSPA 3MNMA 2R2HA 5C08A 2JFCA 3RWJB 4H8UA 4HZAA 3DOSA 1EXGA 1QLRB 2YOAA 1DDHA 3MJ7A 5AL0A 2DQUH 2EC9T 3MRRA 4QYOA 1L0XA 1ML0A 1RIHH 5CZRA 2KT6A 1DQDH 4TLSA 5ANHA 2BZCA 4BCZA 5IBUB 3ZDXB 1J0IA 4O51B 3ZDZB 3UTZB 3NGBB 4ZUWB 5JPNA 5HHPA 1CF1A 1LDPH 1LQBC 3ZBMA 4HCIA 1QFUL 1TSHA 5HPMB 4XMVA 1W6LA 4WAFA 4F7CA 1TZIA 3NCEB 3DWTA 4Y4KC 3H56A 4KK6C 4WGVB 3TEXA 5IQMA 1PY0A 3QNZA 2YPLA 1BWWA 4FYSA 4XP1H 3TV3L 1NCWL 5KZCD 5GGUA 2VERN 1T83A 3G6DL 1T0NA 3N3EA 3TV8A 2MFNA 1QR1B 2XWTA 4YDJB 1RY7B 4JFHD 1N4XH 3VFSA 4WEEA 5BJTB 4Z95L 3FOLA 5ICYB 3FQ2A 4R7NA 4FJYA 5EOCJ 4QTFA 1AP2A 3LN4A 3LIZH 4CSTA 1I7ZB 2P8LA 1RZJH 4YBHA 1OGAD 4OM0L 3AWFA 2GC7C 2X4PA 1VFOA 4JDTL 3FQUB 5DQ9B 5F0LB 1NFKA 3ABMB 4G6AC 5I74C 4HDIB 2CU9A 2AJSL 4D0BA 1WFNA 2EIEA 3Q01A 3TZVA 4NJ9L 2J5LC 5HDLA 3B2PA 2NT0A 4FQPA 3DIVA 3AB0B 1ETB1 1PG7H 2QKSA 2MQCA 2RHEA 3LH2H 4P5MA 2OW6A 3FUMA 4APQB 4MJ5A 4HKZB 3W5NA 3EDFA 1SVCP 2HLFD 4GRLC 4DGWC 1FPTL 3SE6A 3MLWH 1FAKT 5GRWA 1E30A 1FNSL 3FO1B 1JWSA 1RJYB 4P99A 2R56H 5IEHA 1RIVH 3VXSA 1AZVA 4PJXA 4U6YA 2CZNA 2DKUA 1YEDA 5E08H 5DRWA 2VM3A 4QYAA 4QKXB 4LFHG 1FH5H 4Y8AA 1LP9B 2EEDA 1QSFE 2IADB 1XF2A 4LBAA 3DX8B 1WWCA 4JY4B 1BBJA 4N8CH 3Q6FB 3WFBH 1NDGB 2DMGA 3I6GB 1NCWH 2BY3A 1OTSD 2EC8A 1JSYA 3IJHB 4RBPH 2Q8AH 3ZYIA 2WKLA 3LDBB 3EO1A 4M5ZL 2J20A 4ZO6A 1KELL 2FWUA 1G9NC 3SYQA 1VGKB 4V1DB 2F61A 3VRIA 1A64A 3PY9A 4L9LB 1KEGH 4YE4H 5ISZE 3IFNH 3N40F 4OQ1A 3KGTA 3H2QA 1B2YA 3U0PB 3L4WA 1FE8L 3LSOA 5EU7E 3RGBA 3NZUA 4MDRA 1Y1UA 5D71L 5A2JH 3KVDD 5GJSL 2AEPH 1LEIB 3FF7A 3X1EA 1D5MA 1Y0LA 1M7DA 2BNUA 4CMHC 1B0GA 1L0YA 1TTAA 4LU5L 2PKDA 1T0NB 2XTJD 3AS3A 1UG9A 4JFQA 4UTBA 3Q3GA 1GAFL 1BM3H 4NO2B 2BOCA 4BFOA 4WU5A 4XB8A 2X2IA 3MNZA 1H6UA 3EO0B 1G9ML 1PZBA 2QGEA 4JM2A 5DA4A 4F8TA 4Z0XA 1G6RB 1AZCA 1A14L 1OTSC 1Q0XL 4P3DA 4UM9D 4EBQH 1BF2A 4U1GB 2P80A 1PPIA 1I7ZA 3OKKB 5PCYA 3T4YB 5F96L 4NWTL 2UWEA 1V7ML 2IGTA 3U30B 5KYYA 5DWUL 1B4JL 4KUZH 3RHWF 2LABA 4PN6A 2OYLA 3E2HC 2DJMA 3ZTEA 1F11A 4FG4A 4MMZB 5J1SC 2PYEA 4G9FA 3F04A 1SEBB 1TKWA 4Y2DA 3ERXA 3GGWA 1KXVA 3WKYA 5I5RA 5GHWH 4KKCC 4FCHA 1KXQE 1DDHB 3IMRA 3PP4L 1HZKA 3WJLA 4MCYB 4IU3B 3U9PH 2KS0A 2QSVA 1HHIA 1XBDA 3OR7A 4UNIA 1AS8A 3MLZL 2DWYA 1MVUA 1JD9A 1QA9A 3WO4B 1DVTA 1CFSB 4DERA 4FRWA 1MFDL 2OYMA 4PJEB 3GTTA 5H2BB 4GKSB 2VLRE 1OLZA 1EAOA 1TNNA 3FU8A 3TJPA 5LNEA 3SQOL 1TZIB 4LCIH 1TJGL 4XCNB 3FZUD 2IDQA 2GITB 3HS8A 5IB2B 2M1KA 5FOJA 2EINB 1K5NA 4WO4C 3DRQA 3RUGE 4ETYA 3P77A 2H32B 4LBEB 4Q2ZB 4WI4A 5DWPA 2ADGB 2YUXA 5CWSA 3T71A 4KI1A 5C6TL 5KS9F 5T33L 2APXA 1S9XB 3IWVA 4JQIH 3LPGA 5I1KH 3BMVA 4ZS6C 5IHZB 2OR8A 3FK3A 3IJSA 4ZT1A 1YNTA 2W0KA 1Q0XH 2W60B 4JO4H 2P7TB 1IAMA 4G7QB 5E95B 1JHKH 2L0DA 3VH8G 5TDOB 3TBBA 1WTLA 3GHPA 3SGDH 3WBDA 5D1XC 1TQWA 4U6VL 1I9RL 4G8GB 4UF7C 5EH1A 4PD4K 4POZD 3OKNB 3UMNA 4QTIH 4G7YH 4L8CA 4FL4C 4FKEA 4OQTL 1W72B 2A3TA 5E6IB 4C83B 4Y9GA 1RZFH 2Z6FA 5F93C 4PIRF 1NAMA 1P4IL 3BT2L 3CFEB 1CC3A 3HAEG 2A38A 1KNOB 4LNRB 5FYKH 2NXYC 4GMSH 1UKTA 4DT2A 4AWJC 2K7PA 1JF5A 2CR6A 4YXHH 4DGIL 2EDBA 3QUMA 4Z7VF 4G8GA 1E8YA 1FFQA 2N7BA 4NKOB 4EZMA 1AR1D 1IBHA 1VZGA 4MNQD 3RKDD 3TNMA 3SO3B 5HYJB 1P0SE 3RWEA 1MHPL 5MEQB 1AO7B 4KK9D 3NZHL 1LNUA 3H3KA 3COOA 3P30L 4KK5C 4J3WA 2ICWJ 2E7BA 2BSED 3ARFC 4LNRA 1NGWB 3AS0A 2A4ZA 1FCCA 3T77A 4JB9H 2AVGA 3ZDXF 5T3ZL 2BCKA 3RPIA 2O5YH 4GLRI 3QO1A 2WINA 3ZK0A 4MXVF 5CGBA 4NBXB 5HSFA 2MNJB 1HHHA 4N0YL 3LPWA 5ESVA 5AD0A 4D9RE 3B7RL 1IM3D 1ETZA 3P3UA 3BMWA 3SN6N 1NWPA 3QFDA 4UAOB 3N9GH 2ITDA 3X14B 1R5WB 1FNFA 2VDOB 1SBSL 4ATTA 3FQ1A 3NJFA 1WD9A 1MFMA 4OW6A 2WY3B 3LZQA 5AVTB 1Z0NA 4XNZC 5HHVH 2F8VA 1M56B 3ROOB 3TC9A 4OJFL 4D0DB 2IQ9L 5H2BA 4EXKA 1A6TA 3FUFA 5FUOH 3MFFB 1C1EH 1PLAA 2QQKH 2WCSA 4JM2C 4V2CB 4WUKH 2ATPA 3TH3T 4PJEF 5AW1B 3TEYA 3DBSA 1J1OL 4EDXA 1DUYA 1AR1C 2VDNL 4M5YL 4TSBH 3FQWB 5D2LE 1KT2B 1L9PA 1GPOH 3QQDB 5IQ9A 3QH3B 3RX5A 3ILQC 3TBVA 1M1SA 2J73A 3P4LA 2EVIA 5FUZH 1I9EA 3KH3A 1CBVH 4KK5D 2BW4A 3PJNA 3KDPB 3SPCA 5JW5A 2KDYA 4S1QL 5KVFE 2C7UA 3D3VE 1ZT7B 2RALA 4C47A 1TO5A 2N1KA 2M26A 4JY5L 4A7UA 3VXQA 1V3JA 4NQED 1VACA 3HVDA 1A3QA 3CC1A 5IMOB 1ET8A 1KCWA 2CM6A 5BOPA 2CDGB 3OKDA 3KCPB 3O0RH 1A6VL 2OXGB 1DJZA 5LBSA 1AGEB 1NINA 2XYCA 4UI2A 5EO0A 3KWTA 1KULA 3NFSH 2I9TB 4K4KA 3FO2B 4OLVL 5JW4Q 3IMTA 4LP4A 3WDIA 3T0EE 3QHZH 3IMUA 3LKSB 2BFGA 2R23B 3KJ4C 3WD5L 3ULVH 1F90L 4AZ8B 5HI4D 3QPQD 1FORH 2UVEA 1QEWB 4W9HC 2ISDA 2ZOWA 4KFMA 2QPFA 5I17A 3J8F7 4WW2B 5F1NA 3AW5A 5IB3A 3AS1A 5IIEB 5D6DA 3VXUD 4MNHA 2CGYA 1SM3L 3C6LC 4LPXA 4UOZA 4AZUA 3L81A 1TU2B 2X9ZA 3ASWA 2WJ7A 1W8EA 2AQ3A 1LK2A 5D1ZD 4W81A 4OD3H 3TYFB 4RMTA 5HI5C 2C3XA 3E1F1 4FQ2L 4P2OA 2HX8A 3A4AA 5CSGA 4KTGA 2DOCA 5L2JA 4QCIA 4KV5E 1IILE 2IBGA 4ZO9A 2VZUA 4KH9A 5IMLB 2X4UA 3OSVA 1NICA 1R3JB 2Q10A 4TUKL 1CDCA 3QDJE 3KPSE 3DO7B 4XR8C 4YLQT 4EJ1C 2WNKA 1JWSB 1RJYA 1WK0A 4UM8B 5IEHB 4PJ9D 4K7PH 1EVUA 1TTRA 3FRPB 4YWGL 5FUCC 4LRNH 5KVGH 2WQVA 3GLZA 3GO1L 4IJ3C 4QRTB 5TE4L 5JHDA 4YBQD 1KTKE 1L9OA 4F57L 3R4DA 4M7ZC 4Y1TA 3KPRE 2BVOB 5FPIA 3H3BC 1CG9B 4BQ6A 4NQQA 5CJOL 3T9WA 2CBPA 3HG1D 1G7IB 3LZLA 3ROOA 5F1IB 2XICA 4N2LA 4HGWB 3FN3A 1FZOB 3QHZL 2NY1B 2ATKB 2YKLH 3CDZA 2GJZA 2NLJA 4PJGB 2H26B 3ZHFA 4Z7NF 1O6SB 5EZPA 3UZEA 4XPTH 3TZVB 4EPSA 1AP2B 5FDWA 4R97C 5IWLA 1WTGT 4LPWA 4RWHA 5DFWH 2NQ3A 4OCSL 5DHVB 1M05B 3OQ3B 4H0LC 3UBXI 1XFPA 4S1DC 4Q56A 4X9YA 2FHCA 1P53A 4YFEA 4H8QA 1QNZH 3SO5A 3S48A 4J7RA 3AADB 3SPVA 1ZVSB 4OZHF 3DUSB 5DD5H 3LZRA 5CLTA 4RNRA 3ZKSD 4QIRA 2GBUA 2B1OA 4Y9EA 4LCWA 4UIMA 3EOYG 2HB0A 3O4LB 3PHQB 2OXGA 4OBRA 3RIFF 3HZMA 4MJ5B 4PD4J 2H41A 3SE4A 4JRYE 4LOEA 5I1GH 5ISZD 3IFOA 3V6ZA 5D7LD 4DEUA 3BUYA 1NIBA 1BFTA 4LDLB 2AJXL 3V5KA 1MEXL 2ITDB 3X14A 2VDMB 3GSXB 3NJXA 4AENA 2H5UA 4WFHD 4X6DB 1EXHA 3QNXB 1OK8A 3BEVA 1RIUH 1RERA 4FKKA 1AZUA 1Z2KA 1F3DH 5LG6A 3VD3A 1YEEL 1KYOJ 5C0AA 3MV8B 1J5IA 3QJHB 1SYSA 2ZXCA 3T5WA 1Y1DA 2EXYD 5K93A 2AHIA 4EO5A 3SE9H 3NJJA 1IC5L 4IU2B 4JGJA 4H4NA 4DCQA 5DUJA 2BINA 2XRAL 3GF8A 1FFTB 3VW3H 2JKIS 2I5YH 5DS1A 3IJ8A 3M45A 4M03A 4G8AC 4OZGA 5EMYA 3TEUA 4MMYB 2WXHA 2WN2A 1OB1A 5IT2L 3QIBC 1AQ8A 2D2CC 1YNTF 1JHLL 3GBLA 5EOTB 3Q06A 1DUYB 3QE5A 3O45A 4HALA 3ZZ1A 4JRXB 4TNVF 4XT1C 3GNMH 3D39E 4N4YB 4E9WA 3S0PA 5GZOC 1CXHA 3RNKB 2XWRA 4QRRD 4FCAA 3C2AL 2HTKD 5KSBE 3VH8B 3QS3A 3V5DB 4XPTL 4BFFA 4J3OF 2UXFA 5DJ2A 3WNPA 4BEIA 4GI9A 3WJMB 3H7LA 4JJ5A 1E4HA 1OWRM 4DQOL 4LSVH 5EOCH 1F2XK 2B3IA 1LO4L 3KWUA 4R83A 4XOBA 5HI4C 1IM9A 3CFKA 1VPOH 5C8JB 5FHAL 4P04A 3J2PA 4YSCA 3KGSA 1KJMA 2EDQA 4KQ3H 4P23A 3RVUC 5MEPB 4JGMA 1JFQL 4OIAA 4PBXA 5I8OH 3QYNA 3ZE1F 2Q1EA 3ARDC 4GG6B 5KJRH 4HF5H 5C07D 4FI6A 2BOCB 5HYSB 3SKOA 1UFGA 1YJDL 4NN5C 2D7TH 4P4RA 1GW6A 5I74B 1KLGB 1NUFA 5SX5K 5DYOA 1ASOA 1EA9C 2J71A 2HFGH 3M6DA 4UV7H 4PJ8A 1XF5B 2VW4A 1A6ZB 4I4WA 3IAPA 1MHHB 5FO8A 4JVPA 1MVYA 3US0A 2BNRD 3MUY1 3CZUB 3QFJE 2YHGA 3RAJH 4M1GH 1T0MB 4MCYA 3FU6A 3BUQA 5DZJA 5FLUA 4E5XA 4HHGA 4YSDA 2HN7A 5AB0A 2O6FA 1F8TH 1I3GH 3QJRB 4K5NA 1H5BA 4JPIA 3V4LA 4G9FB 1UM6L 3KPRD 4PJEE 5GZND 3KPLA 3NZ8B 3ZL2A 3U7WL 4JREC 2N4IA 2GUOA 3D2UB 5GRZA 1EEYB 3QO0A 3CX5J 3DSNA 3SDCD 1SLVA 2R8SH 5DJAB 5LXVA 3S88L 5E9DA 1PDKA 5CHNA 3BPOC 4DPBX 5A1AA 1U91B 1MLBA 3KAAA 5DMYA 3GRWL 2X3CA 3OF6D 4E9YA 4O2EA 1YZZA 5JXED 3LV3B 9PCYA 2AW2A 2YQBA 4PJEA 3ZL1A 4GUQA 4XO8A 2DWXA 4ZTOL 1NIFA 2ZPKL 3QA3B 1QI3A 3NIFF 1UM4L 3IGFA 1NGQL 3QJTB 5F88B 4JPVH 1I4FB 1DQMH 5AAMC 2FSEB 3GM0A 5E4EC 3ZU8A 5DVLA 3BVNB 5H35A 1XEUA 1YUHB 4NZFA 4YDVA 3O4OB 3TIEB 2EICA 3HNSH 3MYZA 2I27N 2EIBA 3NFNB 4S1DD 3HZ3A 4R4FH 3VJ6B 3GXMA 4TL5A 5I6MA 2JQMA 3CDZB 5B1AB 3BZEA 5LBSH 2YAOA 5AVVB 4BM7A 1OT2A 4KY2A 3K4AA 3MI6A 3QRGH 4IRJB 1XH0A 3PQYD 4L8SB 4XP4H 5AOKA 5FS5A 2OZ4H 2P5EA 4QOKB 5I1AB 1KGXA 3ARBC 4F33A 3T0XA 3EOTH 5HP5A 2IOOA 3KWWB 2WWNA 5FO2A 3TFKC 2YMOA 5F9WC 1WBXA 4R5XA 3OHXC 4PBVC 2YXWA 5HHQA 2QKIC 3QJXA 4ELMB 3MRJB 1I1CA 2GSGA 4ZFOB 4ZFFB 2Z65C 5AOLA 1F56A 1WAAE 4X50A 3ALPA 1BOGA 2ZCHH 2EXYC 1IC7L 3CHQA 1XF4A 4TSAH 4XWOD 5TE6H 5KVEH 1QTYT 3S98A 1OCRB 2ZAGA 2GEEA 4G72B 5D1QA 3U30C 3JWDH 3HC0B 5FW8A 3R1GH 4ZW5A 4Z7IA 5I16B 1N19A 1TQBC 1KIUB 1KBPA 3NCJL 4NT6A 1AQKH 4NLHA 5BUAA 5IQNA 4BHUA 2B39A 3QPKA 2NUPB 3FRUA 3QDMB 3UCQA 4KMLB 4TQEL 1S3KL 5HVGB 1HNYA 1J0HA 3I3BA 4IRSC 4X5XB 4XNXH 4C56B 4JQVC 2OSLA 1KWGA 2GTZA 3L1GA 4OTXH 5F1SA 2CBQA 2OCCB 1KCRH 5HD8C 2ZUQC 3PCYA 1U3HD 2K8MA 3LKOA 2VDRH 2IG2L 4Q9BA 2G0LA 3WFZA 1UEYA 2A6IB 4JFDD 3QZWG 4KQ0A 4MQTB 3F7RA 3QZOA 4OZFB 4YGVB 3KPPB 4FYRA 3TNNB 3U9PL 4BFIA 3GTNA 4MQ7A 4ZS6D 3VXQB 1UCBL 5I0VA 3WKQA 3WG7B 3IPBA 2X4QA 3RE0A 1EHLH 3TO4C 1T89A 3MRHB 1TVBA 2HRGA 2A1WL 2WINB 1TTBA 5D7LA 1CE1H 1H8NA 4H2AA 2CPCA 2R0LL 2EE9A 5KW9L 1NGQH 2VXQA 1XL6A 2OZ4L 4NEHB 5ABZA 1S4IA 2ZF9A 1H6TA 3IJEB 5DU7A 3LRKA 4NKDA 2FJFB 4JZNB 2NY6B 3RIAK 3LV3A 3X1BA 4N25A 2YQ2A 1KLUB 3IRPX 1JHKL 1N12A 2W9EH 4HKXA 2XC8A 4K73A 3PRZA 3UEQA 3X3FL 5CHNB 4G6FB 3GMMA 3NPZB 4HWBA 1CLVA 3JV4A 4QRSB 4AI7A 2JQAA 1WZLA 2Z93A 3MRFB 4TSAL 2B0SH 3GMQA 4QTIL 5A2AA 5HXMA 2BSSB 4M7ZB 1RFDH 3HG4A 3MPCA 2Y06H 1BECA 3WIHA 5JW5B 1NAKH 3UJTH 1DVZA 3GI9L 2Q3ZA 1KN2H 2R2BA 2ZUWA 5MP6L 1RHHB 5I1EH 3CFIC 4WHYH 3WKML 4F91B 3ULUD 4MB1A 3FOLB 4FQXC 1A7PH 3EJTA 1B0WA 1WUNT 3QEQD 1AHKA 4CN6A 5CR1A 1N5YL 4ZS7L 4YXLL 4J6RL 5BS0E 1RH8A 5FO8B 2WCGA 3ARFD 1HI6A 1R5VA 3PWUB 3PL6B 2YJLA 3GXNA 2HN7B 4QJ4B 3MNVA 2CWRA 5D7JC 1QFWH 4KHXL 2Q8AL 4KKRA 1AHMA 2V2TB 2EDEA 3UZVA 1BWMA 1LO2H 4C4KT 1GZHA 3WO4C 1NFDF 5A6MA 2EYSB 3KPQB 3FU3A 3SB3A 3MV8E 3RY5A 2CDGA 2EDTA 2WXJA 4IK6A 4WK4B 4NQTA 4BK4A 5JQIB 2AEIT 5E24E 2NY6D 1WS7A 5IUCA 3KWWA 4K9EL 2NY4B 2O5YL 2WXKA 4OM1H 2E8YA 2DWEB 3VRLE 4NPJA 4XCYB 3G9VA 1OO2A 1Z5YD 3VGBA 1XCWA 2P45B 1BFOB 5CIPA 4TF4A 2DD8H 1EPFA 2VJ0A 4FQJH 4ZQTA 1F4WL 3FQNB 4N28A 3RPIB 5KYUB 2F54A 3B1TA 3UCRA 3PPEA 4Q9QH 4OLXH 5JIMA 4KDWA 2LLGA 4Y9CA 2AQ2A 4ZQKA 5LGYA 1CR9L 3MV9E 4ZD3H 1IQWH 3FMGL 3HKFA 3ZKNC 1AD0B 1Y6KR 1QSFD 4LQ1A 4XOAA 1XGRA 2R69L 2H7WA 5C7XL 3HE7C 1R5IB 3C9NA 3FSZA 3O9WD 4MA3B 1BZ7A 3NJIA 3FFDA 1UWXK 2ZQKA 4IBQA 4NJ9H 4UDTA 5GRYA 4OAWA 1KB5B 1FC1A 4KUCD 3MLVL 4UT7L 3PV7A 3MAWA 4QHMB 1C08A 5T3XE 3RB7A 1M7UA 4HP5A 3MOAL 5LGHL 1G5GA 3A6BH 3N50A 3GIVA 1GGCL 3FS9A 4P23B 3TBTA 4BHUI 5HHOB 2VLRA 3CZFB 4MMZA 4JG0L 2PLTA 5CEYA 3BEWA 2XTJC 1E27B 3GD1C 4PV9B 3HPLA 4ODXA 1JUFA 5FA4B 1VFAB 2I85A 4NQEE 4E9QA 4JO3H 3S34H 1PIGA 3DNKA 5EFIA 5B39G 5I8KH 4M1DH 5DF0A 3V9FA 1AOZA 1ES0B 1PLGL 2HG5B 1JPSL 3BT0A 3ET9F 4NO0A 4B9YA 5F71A 2FYYA 1KCSH 5JHDE 3O41B 4AIOA 1AGDA 3CXFA 4MDIA 4M93B 4PJAB 5FW7A 1JERA 4PRPE 4XVTL 4EZKA 4XOEA 3VDAA 43CAA 2C1OB 4D8PB 2NUPA 2MKLC 1IM3B 2DD8L 2KZKA 3L3OC 4JQIA 2WKGA 1A4JB 4J23A 3ULVL 3O8XC 3C60C 1JK9A 3HNTL 1QKZH 2XG5B 5E51A 1PFOA 5AKSA 4RFOH 4PS8A 4LGRB 1HCYA 4HZLA 5CZXC 3FB8A 4I1PA 1J12A 3RVVD 4WWKA 3V6OE 1OD7A 3OHXB 4HIJB 3VXNA 1EZUA 2B08A 3QIBA 2J4WH 1C5DA 3EBAA 1WC7A 1QRKA 5DI8A 5FA3A 2Q3XA 2FH6A 1NLBH 4JFEE 1DBBH 4TLKA 3PAUA 4EN2A 3SY6A 2VXQL 5T3ZD 2V7HB 2WGNB 4Z76A 3QNXA 2OL3B 2VAAA 1MY7A 5HYQA 1HEJC 1WUZA 2VXVH 2N7AA 2F68X 4KQ3L 4ABWA 5I5IA 4AM0B 2OMWB 1XH3B 2D2OA 2I07A 3TYFA 3A6BL 4P0DA 3EYFB 5FF6B 2EILB 1GKOA 4NM8H 1U8KA 1E3FA 1T22B 5DJCB 2IV8A 2PP8A 3W11D 2KLTA 1JD7A 2X4NB 1WBYB 3QZBA 4LOVA 3MRMB 4P8QA 5DSCB 1E6OH 3A23A 3RURA 3Q8AA 3L16A 2X4UB 4GW5B 4G9FD 3DUUB 1A1MA 5DJ8B 3PWPE 2QL1A 1AYRA 2G9KA 2AK4A 3H4FA 4NRXB 1MCBA 3ARDA 4FQQB 2Y36H 3BP5A 1MDTA 1XO8A 3BKJL 4ZG1A 1KWKA 1WLHA 2ZAHA 1MCPH 4OKVA 3V0EA 5HI3D 1UQSA 1BLIA 2OYKA 2BSTB 2FB4H 2XJKA 1CLYH 1UYWL 3HAEH 3DSNB 3PGDB 1BJMA 2VDPL 5C1MB 5IB3B 2XVBA 5IIEA 2NXZB 3WE1A 3S3PA 1A21A 5FCUH 1VA9A 1XCTB 3I84A 3OKOA 3V8CA 3B3IB 4K23H 3WXVH 4M6MH 5TQ2H 3OXSA 2XI9A 4FHBD 1ZLVK 3U0WL 3NG5A 2HTLC 1R3KB 2Q7AA 2FQDA 1P4LA 2KZWA 4X5XA 4JANB 5DVMA 4ENED 2X6UA 3FSAA 3GKZA 4O02B 4DJMA 1ZHKB 4UT9L 1JI2A 2ZYIA 1CGVA 3K80A 5EWIH 2X89A 1UCTA 3C87A 3WY4A 2NY4C 3B6SA 4KTYA 4TTDC 3U46B 3NIDE 5EA0L 1PG7L 3U4BL 1CICC 3HAEB 1JE6A 2IGFH 2PXYA 2VZ3A 3ZMRA 3FO0L 4IOFC 4GAJL 5DHDA 4WGKA 4Y19D 4FMKA 4NO0B 3VD7A 4ADJA 5AFAA 2OAAA 3UXFA 2H1LM 4ZO8A 1JJUA 5I0WA 2ENQA 2IFFL 2ITFA 1DVXA 2O5NA 2R1XB 1FFRA 4F33B 3DV4B 4FZEH 2J55A 5C9KA 3QH3A 5E00A 3MRPB 1LLAA 2LHAA 3SKMA 1SMAA 3QBTB 1TJHH 4P5KB 1MEXH 4M8UA 4ZK8A 1MCNA 3BO8B 4WUUD 1QVOB 4JFSA 1P4BL 2C3WA 1AHWA 4FQLH 3FB8B 4LIQH 3F2LA 5FYJD 4HK3N 3RDJA 3LXCA 3WNKA 3HR6A 1I9IH 5F9WB 3CPLB 3P0VL 5AEAA 3SE9L 3QUML 3QNFA 2HT3C 5L6YL 4WCYH 1SPDA 1X5HA 2YRZA 4FX5A 4GO8A 4QXTA 4CKVX 3RA7H 3SGJA 2QPUA 1DVYA 5ACZB 2WLZA 1MCDA 4J3BA 3ALWA 4OZ4B 4B5EA 4HHWA 2WTOA 3ECWA 5F7EL 4URTB 5ENWB 1WBZB 4X7CC 1NBVL 1JZ5A 4JKMA 3MV01 3ZVVA 1GSMA 3M17B 4ZUSB 5JMOC 5HDBE 3QNYB 1XF1A 3GLDA 2F8IA 2NTFB 4FQQA 4Y7MA 3RWGA 4H20L 3QUXB 4ELME 1FNHA 3NOIA 4OH2A 5E5RB 4ZNEE 1TOXA 4NQXA 1GAFH 4Z7OF 1A4JA 2QGCA 3C6SA 2B77A 3FQXA 1OW0C 4ICWA 5DMKB 3SDCA 4M3JA 1HYSC 2DQGH 4L8DB 2RAMA 1N0XL 4FLHA 4HZLB 1BV8A 5BVPH 1BVZA 1X44A 3HS0B 5DLML 1F4XH 4LB8A 4L9LC 2YO3A 1X4ZA 3SKOB 3VGHA 3BPOB 4OCXH 3E8UL 1B3JA 1KN4H 1PZ5A 1NC4B 4ZOAA 3T3PE 4BXVA 3MRJA 4ZFOA 1BXXA 1RJZB 1V7MH 1VB9A 1MIEL 4WI5A 3IBEA 2QVKA 3IVKA 3ES6A 1EBPA 2IC2A 4NQXB 1BMZA 1YY9C 1RUPH 2Q76A 4HIHA 1CT8A 4P9HC 4PRID 2YA1A 4UV7L 4Z7QE 3AC0A 2ICEB 3RVWD 4X4ME 3DRQB 2D0FA 4BUGA 2OP4L 5DEGB 5B8CA 4K7PL 1BM7A 5D6CB 4JVWA 3RTQC 4QHKI 1AGBB 3I9IA 1WA0X 1JZ6A 1DVFA 3MXWL 1EAQA 1RU9H 3EYQC 3HPJB 2W0PA 5LN8A 1D5ZA 4BK5A 1OE2A 2EXSA 2Z91A 4QHMA 1XH2A 1F4YH 2AZUA 1OGAE 3QYCA 3BWAB 3ULSB 4PGCB 5HHOA 1CF8L 3D2UD 3VFTA 3FTGB 5A3ID 4GG8A 4PRBA 3UTSD 3GUTA 5DO2D 4BA0A 1D7BA 4I5BB 4PY7A 4XNDA 2PPFA 1MJUH 2PP9A 3VG0L 5GGUB 3CTTA 5AW2B 2J8UA 2G2RB 3U9UA 1S9VA 2FBJH 1S9WA 4U1SB 1DL7H 2QVIA 3QJUB 1FLRH 4O00A 3WKPA 1OD9A 2PP7A 5DXWA 1QW8A 3HA0A 3UTSB 2BVQA 5HDWA 1DVFB 2XFGB 3K0YA 4JQVA 3WTSA 1SJMA 3EYOB 3BP7A 1D5XB 3L3IA 5JHLA 5JXEC 2IOIA 3BQVA 1NCBL 1ECYA 3O4OC 3NFSL 3MRPA 4G6MH 1X3DA 3LEXB 5E4EB 4PJHE 1CE6A 1GHFH 2YD8A 1HEHC 3BKYL 4LEOA 4XPGL 4EIBA 4PJDA 4FQJL 4XWOC 1HESA 3EGSB 2JLPA 2F54B 4GXFA 5CD5C 3T6WA 2E7LC 4ZMQA 3BWSA 4P48A 3V4PL 3K7UA 1YO4A 3UPRA 3CVIH 4YXKL 1QI4A 3NP3A 3QQ4B 2P8MA 3CUPB 2X70B 5GQBA 5IF0B 4ZFQA 1A9BA 1X4XA 4I0KA 4KRPB 4AJWA 4CC4C 1XL4A 3JBG7 3L5IA 2C9PA 1VHPA 3N06B 1FV1B 1GCYA 4ZFGH 3AG2B 4OQTH 1RIVL 2ZXGA 5ECJE 1NC4D 3OX8B 2ZCZA 5EZOL 5JIDA 2DQDH 1F3DJ 1WE5A 3HJ0A 4RMQA 1S7RB 2FEEI 3OXRB 3MGTA 2XN0A 3DK2A 3HG1E 4HEPA 5F7MC 4HZ1A 3E0GA 2HMIC 4XE5B 3CXDL 1K8IB 3W0WA 4FP8H 4MAUH 2VRAA 5AZ2H 2C5DC 1T1YB 4X9BA 1G9HA 2Y72A 4OFDA 2ICES 3MO1A 4RQQA 1WS8A 4IDJL 3KM2A 1ZTXE 2EO7A 3K4DA 3V5HA 4PV8B 4XVSL 4LSQH 3VI3F 3IDJA 3VE0B 3KDMB 3VXRB 1AQKL 4HAFA 3FAXA 5IOPB 3NN8B 2GJJA 3L2MA 4WTQA 3ZYJA 3U25A 4MNQB 4HWEH 2HPOA 1JYWA 3BKML 2H6UA 1H3WM 4HQQL 4I77L 2DM2A 2O61A 5CINH 4F8OA 2QQNH 3ARZA 3NCCB 3CPLA 4IRSD 5D9SB 5DMGC 2CXGA 1NUDA 2VAJA 3D87B 2NW2A 2J72A 5D71H 1M7XA 4Y4HD 5CJ5A 4ZOCA 3FQWA 2XY1A 2LTQC 2UY6A 2VO5A 3N9GL 4D9LH 1OZTG 4HH8A 3S37X 1AY1L 5GZOA 2WLIA 2A4CA 1D2PA 3F8UB 3NJMA 1NPNA 3RB5A 1EDYA 4ZMWA 3L3KA 4FFVC 2WBJC 2J8OA 3J07A 3S3SA 5JHDD 4WTXA 1MCSA 4X5WA 1HYSD 4DP5X 3CJJA 1ND0B 2C4FU 1VGEH 3QARA 1NEZB 3QNYA 4HSCX 5EUOF 1S7QB 1T3FA 4S2SB 4ZUSA 3Q2LA 3BH9B 3AGVA 3CSYA 2PWDA 1QFPA 3IMBA 2GBTA 1GR7A 1HXMA 1IGJA 1XAUA 4QAMB 5KUKA 2P8PA 2VZTA 5EZOH 2BOBA 4L5FH 4WU5B 3NSCA 1QZNA 2YBRB 4J3UA 4QRSA 3WL9B 4WKZB 1YQ2A 4KVNL 5CCHE 3SE4C 3O8XA 2A6DB 4M1GL 3DKHA 1CFTB 1PY9A 3FTYA 1YY9D 5LNDA 5EUKA 1URLA 4BH7B 2DQTH 3BDBA 3ARED 3RY6C 4BA8A 3X3FH 1WWAX 5AW7B 3RVUD 2BJMH 3QEQE 4HS6B 3NIDB 4M7JL 3QUYD 5E6ID 1DQJB 4B7LA 1WFTA 5E4OA 5ICXA 1IJ9A 2F53B 5D7JB 5IFJA 3I9AA 1Y18A 2Y4SA 1K2DA 5LWYH 1EUTA 1SEBA 1TKWB 2H1XA 2CK2A 1HCFX 5D96B 2BMKA 2XA8H 4Y4HC 5DRWB 3ZHNA 3DXAD 1M2VB 1G7QA 2Z35A 4P2AA 1CFTA 3FCGA 3CHPA 4K15A 2PTVA 1MHEA 4NPYA 4PJ9B 3ULUC 3BKJH 4NFBA 2HUHA 2Q5BA 1IC1A 4OCYH 4LSRH 1UQSB 1JZ3A 2XWEA 3UIYA 5DQDH 4XBPB 5KANG 4NUGH 4WI9A 4OB5H 4HUNB 2PF6A 3WLWC 1X5GA 3FUJA 2VC2L 1AY1H 4E9LA 4U0RB 4FA7B 1RV6X 4XMKL 3SGKA 1FBIH 4XVUC 4ETQB 3NFNA 3FTUA 4OBSA 2BVYA 4Z7UF 3OWRA 3M7FB 1S5HA 1A6VH 1LILA 3OMIB 1JPTL 3OXRA 1WC7B 1ZJAA 1PZ2A 1BZ9B 5DI8B 5GZNA 4X5QA 1S7TB 5IMKA 1A65A 1IIIA 5JUEH 2VR9A 1N6QL 4TULL 5F9AC 4AQ1A 1O7DC 3L3OA 4OJYA 4HXBL 4WENB 4HHAB 4CMHB 2WBKA 4Y16C 2C9SA 3HKZA 3OTTA 1WA2X 3Q13A 1YNKH 4FNSA 4Q89A 1LE9A 4WU7A 3GMOA 3WMSA 5E5UB 2R83A 5IM7B 4OFPA 2X4TB 1MLBB 2NDGA 4CC4A 5LKNA 3QDMD 4PJDB 4ODSH 1CXIA 4J2XA 3SO3C 1FYTB 1IBYA 4BJLA 2A73B 1ZAGA 4IRSB 4P4KC 4PW9A 2KPNA 5FOBA 2YXFA 3VXPA 1EHAA 1U8QA 1XGUB 2KBGA 3KEHA 1UH2A 4JO3L 4YWGH 2F19H 4XN9A 2C4FT 1QLFA 4WUUA 4Y5YA 4QT5B 5T1KA 1W72A 4C83A 3IE4A 1JGLL 3UTZA 4YHYB 1OANA 2LR4A 3L2LA 3P69A 4AYFB 2HLAA 1KJ3H 2QMKA 4DUVA 4QNPF 2WLIB 1BIIB 3IKKA 4N90E 4LSRL 5F7DA 2VSMB 3BP6A 1IIKA 1UB6A 3GK8L 4AG4L 1WFJA 2XLLA 4K3DH 3RX7A 1KG0B 3QUMB 4ZMYA 4YC2B 3FU0A 1ZT1A 2IMNA 1MWAB 4KHTL 4UIKH 3MYJB 2WGXA 3ARBB 2WCPA 4F92B 3GGWB 1QHOA 2XDHA 4YHZL 1NCCH 1QNIA 3PUCA 2UZXA 4KQ4H 4HEME 3VE0A 5F8RC 5IBUG 1TTFA 1J8HB 1KPRB 1E5AA 4NFDA 4NZUL 2Y23A 2Z9TA 4Z3FA 4ZW3A 5TGBA 1NMAH 1RULH 2VITA 2X4PB 3HNTH 3H55A </