4JP1A

Mg2+ bound structure of vibrio cholerae chey3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
b'ANKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title Conformational barrier of CheY3 and inability of CheY4 to bind FliM control the flagellar motor action in Vibrio cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jp1A00
3NHMA 4QYMA 1QO0D 1W25A 3N0RA 2WJAA 1E6LA 3F73A 2FEWB 3LUJA 3QELB 4W5TA 2R4QA 2W42A 1FFWA 4RZSA 4LE0A 3OMWA 4EYOA 3SQNA 1PEYA 4H3KB 4KQCA 1E6KA 5EWJB 4KREA 3LUAA 5CHYA 1RZRA 2HPHA 3R0JA 4YP9A 2PUGA 3QK7A 3W9SA 3LUKA 1FFSA 3GYBA 3RH0A 4HYEA 1F4VA 3OO0A 2PKXA 5KWSA 3G85A 5FWXB 5HQJA 2PJUA 1H9CA 4P1ZA 1VRVA 2QZJA 3N53A 5B3JA 3JTEA 2RJOA 5JNRA 5BR1A 3RVSA 3SNKA 2LBPA 3T6KA 3T95A 3KLNA 3IP9A 4EY3A 4XARA 3LTEA 2FMHA 2GWRA 3C6QA 3C3MA 1TM2A 3L6UA 4LE2A 4YWHA 3T8YA 2FKAA 4F8JA 4UHKA 4TLLB 4RU1A 1C4WA 4Z4CA 1QP7A 2XDYA 4G97A 1ISSA 4IGAA 4UHJA 3MQ4A 3EQ2A 4XXHA 4JP1A 3CTPA 5F64A 4KRFA 2QSJA 3ILYA 1VLZA 2PL9A 2FMIA 3HM9A 3HDGA 4MQFA 2FW0A 2QVGA 4EGSA 2PUFA 3H5TA 3RVNA 1ZITA 1M2EA 3BREA 4XAQA 2F8TA 5TE9A 4KV7A 4EYKA 3RVPA 4HNQA 1NXXA 3IP5A 2GKGA 2LIVA 3FGZA 4KMRA 4LDAA 4WXEA 4KPYA 4E7OA 4N0PA 3UUGA 2FVYA 1W9HA 4MS3A 4TLMB 1Z15A 2JBAA 2HQBA 3G1WA 3IP7A 1JDPA 2M1ZA 3JVDA 3Q7SA 5JNWA 4G0PA 1ZHHA 1Z25A 3K4HA 5TQ0B 1PEAA 3KYJB 3GV0A 1DCMA 1MB3A 1USGA 4LRQA 3MM4A 3LKBA 4G0YA 1YVUA 4NQRA 3Q41A 3NBMA 4Q7EA 1CEYA 1OXBB 3H5LA 3KG2A 1D1PA 2HSGA 2V0NA 4ZPJA 4MS1B 3H5IA 3BILA 2ZWMA 3LUCA 2QXYA 3C3KA 4MR8A 3JS5A 2NZVG 4O5AA 3K9CA 4ZMRA 1M5UA 1Z12A 3OQMA 1TLFA 2VUIB 3NHZA 2MSWA 3QLVA 4WUTA 2E4XA 4W5NA 4RK4A 1GLGA 2FN9A 1P2FA 4ETNA 4W5RA 3LFTA 3OLYA 3TMYA 2QVCA 2JRLA 3GL9A 2JVIA 4KVFA 1P6UA 1CYEA 1ZAYA 3EJWA 4G0QA 1GUDA 1JYEA 1ZESA 1ZVVA 5PNTA 3KS9A 3QEMA 3O2QB 1A04A 3BRQA 4XASA 1NXOA 5TPZD 5KI6A 4EYGA 1QP0A 2IPAB 1JX6A 1QNLA 3HV2A 2H0AA 3HUUA 3OLXA 1USKA 4H60A 3O74A 3RVRA 3SM9A 3LUGA 3QLUA 1MB0A 4YGXB 3LUDA 4IRXA 5DGCA 3S99A 4S05A 4NICA 2MYPA 1JFSA 2E4ZA 1JL3A 4RY8A 4D6XA 1NTRA 2ID7A 3GT7A 4FE4A 5HKOA 4D6YA 4YR7A 3NNSA 4F11A 1AB6A 1DCFA 4Z99A 5BQ3A 3CHYA 3QX9A 3HZHA 2AYZA 4RK1A 3JPWA 4JASB 2KYRA 5BRJA 5JNTA 5JS1A 1B00A 4KZKA 1MVOA 4TN5A 1BAPA 5IUJC 5CNIA 4MRMA 3M9XA 3DGFC 1HEYA 2CWDA 5IUKC 3UK0A 4DN6A 1CHNA 4IILA 2L19A 3EGCA 3KTOA 3CNBA 4G0XA 3RVOA 1RNLA 3B2NA 3H5OA 2JB9A 2QU7A 4MQFB 5ABPA 3HVRA 3C3WA 1ABFA 5JS2A 1DCKA 3DBIA 2B1JA 4P98A 4D74A 4EVRA 2CD7A 5B3JC 1DBWA 5T3YA 1SXIA 5KC9A 3A0UA 3LKVA 4IF4A 2AYXA 3MIZA 2WRZA 5IULC 2PUBA 4MS3B 5IBQA 2L18A 2DRIA 2JBAB 3CRNA 4LZLA 1D2AA 1K68A 3F6CA 3VNAA 2RJNA 4OTZA 3OLZA 1FQWA 3GWGA 5I4CA 1DBPA 2IYNA 2GX6A 1MIHA 4Z4EA 4PICA 1KRXA 4MS4A 4RSMA 4MGEA 1DG9A 4GPAA 2E4WA 1Z2EA 2F8SA 1NXTA 4EVQA 4F12A 4RWEA 1LJUA 2QW1A 1Z26A 4ETIA 2MSKA 3KHTA 3KKEA 1YS7A 4JAVC 3KCNA 3SG0A 4RXTA 4RXMA 4MR8B 1YMUA 2MYTA 3H5WA 4N03A 1NATA 3HDVA 4M88A 5TQ2B 1A2OA 1L5YA 2PUAA 1JBEA 1SRRA 2JK1A 4N41A 3DLBA 2CHFA 1E6MA 5JNUA 3H1GA 4G0MA 1JHZA 1D1QA 3FFWA 1YS6A 2VK2A 2PLNA 4MLCA 4OLAA 2IKSA 8ABPA 3CKMA 2H3HA 2MSLA 3OQOA 3TX6A 2LUOA 3A0RB 6CHYA 3HK2A 3JPYA 3RVMA 1K66A 4JA2A 4W5OA 4OG2A 2R48A 1Z18A 2NT3A 4KQ9A 5HSGA 3T38A 2GBPA 2NT4A 4Y9TA 1EWVA 5DTEA 3RVQA 9ABPA 4H3HB 5KQMA 1PHRA 1VPWA 5DLEA 3DGEC 3QEMB 1BDHA 5FWYA 2JVKA 1ZH2A 1NXWA 1RXIA 2GI4A 2B4AA 4FE7A 4XFKA 4Z0NA 2FQXA 2FMKA 1VKRA 3H5VA 3E3MA 3I09A 3FMVA 4MQEA 5CNKA 5FWXA 5TPWA 3TD9A 2PE5A 3QLVC 2IPNA 4RKRA 3N0WA 4YLEA 1YTUA 5FBHA 3FFTA 3E61A 1DZ3A 1BDJA 4WXMA 5JNVA 4EUKA 4OATA 5GOTA 5T7BA 4RK7A 1LJLA 4N47A 1QP4A 1M5TA 2OQRA 2X7XA 5IEBA 4MLDA 4PZ0A 4RKQA 3HJFA 1J56A 3H1FA 1DC7A 1PUXA 1FFGA 2FLKA 2Q5CA 4LDZA 4MYRA 1USIA 2HQRA 2LPMA 7ABPA 3Q7TA 4MRMB 5JNSA 4YV7A 3HEBA 3Q7RA 2R47A 3QLUC 4JB2A 2VYCA 3EQZA 4G86A 4NV3A 3JVIA 1ISRA 3GRCA 4RS3A 5KQLA 1EWKA 3Q9SA 3DZDA 1YMVA 1SD5A 1DJMA 2R25B 1DBQA 3O21A 3CZCA 2TMYA 2JVJA 3KLOA 3L49A 1MAVA 2PL1A 5FBKA 5EWLA 1DC8A 2NUBA 2QR3A 3GBPA 3CG4A 5TQ0A 3HUTA 4XLTA 3UKJA 3O75A 1EAYA 1ABEA 1KGSA 1JWLA 1ZGGA 4Z4FA 1FSPA 3CS3A 4O1IA 4MS4B 4Q6WA 4Z9BA 5IEJA 1XWWA 3CU5A 2LP4Y 3NNDA 4RK5A 3N8IA 3LMKA 4NCBA 4LX8A 4F06A 1ZN2A 4TMYA 4S04A 3EDCA 1URPA 4YO7A 3OM0A 5KQPA 4KK4A 4RXUA 1YIOA 1XHFA 1JDNA 2FN8A 3OQNA 4NCAA 1P8AA 3HXMA 1P6QA 4MR9A 1IIBA 1SXGA 3F7NA 4RK0A 3SAJA 4QICA 1KRWA 1QO0A 1WETA 3JY6A 2FEPA 3KJXA 2OENG 1EFAA 1ZDMA 1KMIY 3LOPA 1TVMA 1RPJA 4ZMSA 5C5CA 3IPAA 4MPTA 4OLBA 1NXPA 1RZRD 1AB5A 4PE5B 2YHAA 4EVSA 4YS6A 3LUFA 3RVLA 1JFTA 1DP4A 3ILHA 3C97A 3MYYA 2I6FA 3LUHA 2HJ9A 4N0QA 3M6MD 2FSPA 4MR7A 2MYUA 3N6VA 2FTKE 5FWYB 3IPCA 1QKKA 2JCGA 3ROFA 4EYQA 1Y1LA 3QLTA 3BBLA 1GCGA 1UDRA 5IX8A 1R8JA 1D5WA 4MQEB 2E4UA 3MF4A 3QEKA 5TPWB 2N9UA 4WT7A 5HM6A 1QMPA 3VNBA 1EWTA 3I42A 4HNSA 4E7PA 1SXHA 3HCWA 2HQOA 4FB4A 2IPMA 5BRAA 4G0ZA 3ROTA 3QX8A 3M9WA 3O1IC 4RY0A 2QV0A 2ID9A 2CHEA 2FXIA 1QQAA 4KK3A 4ZJPA 2RDMA 4Z4IA 1OXKB 3GA5A 1T34A 1Z16A 2FLWA 4IMIB 5EWMA 2A9PA 3HO1A 1Z13A 4CBVA 4JOQA 2WWVD 4PYRA 3QELA 3O1HB 4L85A 3OLVA 3URMA 1BA2A 5EWJA 3MMNA 5ED4A 4B09A 1Z2DA 3A10A 5CNJA 4Z4HA 2PUCA 2FMFA 4G0OA 5D2CA 1EHCA 2FQWA 4JB0A 4Z4GA 2WJWA 3SY8A 6ABPA 3I5AA 1DRJA 2NZUG 3TO5A 1JLKA 2IDMA 1U04A 5E3JA 3EULA 4RV5A 4DQDA 4F3TA 4OBBA 3MA0A 2IOYA 5EWLB 1U2QA 1XHEA 3HSYA 1GCAA 3OLWA 1NY5A 1PNTA 3F6PA 1JFVA 3RVJA 1ZY2A 1QPZA 4MAAA 1YK1A 5CNMA 1LBIA 1U8TA 3OO1A 3HS3A 5GQSA 1GUBA 3OM1A 1APBA 3P9YA 2E4VA 1ZGZA 4WWHA 4DADA 1PNRA 3DLHA 2MYNA 1LBHA 3H1EA 3NNNA 3O1JC 2FEKA 3FFXA 4KNYA 3OMXA 4Q6BA 1U0SY 1BVHA 1C0EA 4W5QA 1NXSA 1DRKA 4QPJC 1NXVA 1JF8A 4RY9A 3RVKA 4YRZA 3EODA 1LK0A 1I3CA 5IUNC 2WY2D 4L4UA 5TQJA 2M98A 5TQ2A 4HNRA 1JH9A 1F51E 1TMYA 4ETMA 3CFYA 4MR9B 2J48A 4RDCA 1S8NA 3KSMA 1BDIA 4PEVA 1Z17A 1ZH4A 2ZAYA 5KC8A 2P9HA 3O2SB 5TPZA 1JYFA 1U2PA 3A3KA 3BRSA 3N75A 4WZZA 3RQIA 2A9OA 2A9RA 5KQGA 4N76A 2L17A 2VUHB 3FDFA 3N0XA 2PUDA 2FQYA 3H6HA 3IP6A 4Z9AA 2IPLA 2O20A 5IC5A 3TB6A 2WMYA 2RGYA 2P4UA 2WB4A 1TJYA 2PMCA 4MR7B 2PUEA 3D02A 3EAFA 4ZYLA 1D4ZA 2E4YA 5DCLA 3I45A 2YHBA 4RK6A 2PAFA 2BGGA 4MS1A 4O1HA 4YCSA 1E2BA 3CZ5A 3IDOA 3KYIB 4IMJB 5DKFA 4LE1A 3Q15C 4KFCA 1RXEA 3GBVA 1L5ZA 3D8UA 4QYWA 3H6GA 4ML3A 5C5EA 1M2FA 1YK0A 3CG0A 4GNRA 1A0OA 3H75A 3O2JA 3CLKA 1QQBA 2A9QA 2L2QA 5EWMB
chains in the Genus database with same CATH superfamily
3D5EA 1GU7A 1KP2A 3SHQA 3DAGA 1GTJ1 4L75A 2JFWA 3PX2A 2BM1A 1NVVQ 1JIIA 3SQNA 1PEYA 5CFNA 4ZO8A 2K4MA 1N1MA 4ZHQA 2WIJA 3HR8A 4QHYA 1CUUA 3ZY2A 4L6IA 4C7VA 2PBZA 4G9BA 4EHHA 2CK3D 3MB8A 1CF2O 2KQUA 1GY8A 1FLVA 4O59O 1DADA 4MGZR 2V5VA 4FONA 3U9SA 4B8WA 2X2OA 3LL7A 2GN9A 2IUFA 1YIDA 1J0XO 3NDJA 3O3NB 3RS3A 4D0RA 4P1ZA 4UDNA 1U3UA 4ASUD 1UPBA 5AUPB 2WHQA 4EFMA 1X0VA 2H07A 3SNKA 2YVUA 5AXBA 2ZZMA 1A1SA 5AKYA 1ZNZA 2OC9A 1I4LD 4W7HA 3KKOA 2REQB 3GCDA 1SB8A 4QULA 2WICA 4DEXA 5LLDA 2AE1A 3L6UA 5LMCA 4CT4B 3DKRA 1ZJZA 3ZH9B 4UAJA 1SCAA 2R7NA 1GPH1 4RIIA 3VPFA 2PX0A 4BO5A 4KFTA 5EZ5A 4D8TA 2VH5R 4E88A 1ISSA 4F3CA 3AU9A 3AZOA 1Y3DE 3EQ2A 5AHOA 4AZTA 3T9DA 4BC0A 1SC9A 4DUPA 5KZMB 1JR3E 2YKGA 1JHPA 5CDFE 1R0RE 1TM3E 3FVVA 4WKOA 3RT9A 1MJNA 1U81A 4AB1A 4BVAA 1CUEA 1ZG3A 4I5IA 4XD7A 1NG1A 1K2WA 2GETA 3V4SA 4RQBA 4B33A 4AX4A 2ZRNA 5GONB 4BAUA 1YQUA 1XCLA 3W1VA 1MJHA 4TN1A 3FPAA 4LVOA 4PFQA 2JIQA 1M76A 1FFXB 1W9HA 3DCJA 1H85A 1HNZB 3DOIA 3IS3A 1JDPA 1YZNA 4N40A 4TKMA 3FN4A 3W4KA 2LCQA 1X1RA 2QP3A 1L5WA 4IIBA 1Z4QA 1VSBA 3NH6A 1BS1A 3WX0A 5IYZA 2H65A 2I4IA 4EI8A 3ZCPA 1E0DA 4Z0PA 5LQNA 5DI3A 3ZVMA 1IOVA 1OLUB 4NBTA 5AH0A 4FHZA 2J59A 3T06B 1C0KA 3ZQUA 5K8IA 1WUJS 2H63A 1Q17A 4B3JA 1NPYA 1C2YA 2AFIB 4O1MA 2C98A 3M4XA 2NV2B 3GUZA 4OIFA 2XF8A 3MOGA 3ZKAA 2H5JA 1CIVA 3PV0A 5ETJA 5IT9A 3HA2A 3HUEA 1M9NA 1N5MA 3NHZA 2H1IA 1OR8A 1GLVA 1P80A 1E4EB 1U80A 1YBMA 2HLPA 3F78A 3GH3A 1THMA 3H1TA 1LVUA 5A5EA 4HXFB 4E33A 5F21A 3RK4A 2B98A 5UKDA 2IHUA 3VGJA 1N2BA 1BVRA 4K3VA 4J4BA 2PSSA 4P3PA 4AJ4A 3DH0A 4BO0A 3IIMA 3RHZA 1XZMA 4DIOA 2B2CA 1G6Q1 2D62A 4L3WA 4Q4LA 1QVRA 1GUDA 1JYEA 4F7DA 4PSAA 1QGOA 3O2QB 2EQBA 2JRCA 5JALA 2QTLA 2HRBA 2EJBA 4C2BA 4WJLA 1X7XA 5IPFA 2PLWA 3ETGA 3C70A 2PLRA 2NYUA 2P79A 3OZBA 2XE6A 4QRDA 4RZQA 3MUNA 4IL5A 4IRXA 3I6ZA 2Y1OA 1D8AA 1J39A 3FH0A 4DXAA 2JGRA 3KQYA 4BO7A 5F9MA 3IIKA 2XE4A 4KAFA 2H9IA 4MW4A 2I2XB 4UFPA 4FE4A 3TXXA 3MSXA 1ZRSA 4IIHA 1ACJA 3K2BA 4UXIA 1RDFA 2JFGA 4X3PA 4DV6B 1SQFA 2K2WA 4N3GA 1D6NA 1OROA 1YWGO 3HCAA 1K7FB 5JAZA 2O06A 3GFOA 3ZHCA 1KZ7B 3GLIE 3RC2A 5K6AC 2AYZA 3R5KA 3G5UA 3AV3A 1YZFA 3GVPA 3BCRA 4HYTA 1FP6A 3HYSA 3Q7EA 4IWNA 3U40A 3BZUA 3GCXA 1I7SB 4DV7B 4KHPB 4YLYA 2OHIA 1N3LA 5NLLA 4RPIA 1LPNA 5B36A 5IK2D 1IPEA 3P45A 1KZ6A 4UOZA 2CWDA 4DCOA 5ITWA 4RJLA 1JG4A 4S1VA 4FSXA 4OI1A 3ZE0B 2D6FA 1XXHB 2BN4A 4UMFA 4EK9A 3BWCA 3ZGNA 2WJ4A 5A6VA 1EBUA 3MWLA 1GRVA 3RRBA 5IT5A 2IITA 1MJGM 3NR2A 4OJYA 1LSOA 5JS2A 3KKNA 4EKYA 4JYZA 4WXHA 3THXB 2JARA 2IXTA 1GFSA 1ZI8A 2DHEA 2EU8A 1OASA 4EKIA 2JF0A 3GRVA 2QF7A 1T1RA 3FOBA 3SHVA 3KEOA 5EJ8A 4FX5A 5E3IA 1SFRA 1U31A 1PJ8A 1W5AA 4MA4A 4NIMA 4Z9FA 5IULC 3T9BA 1FJXA 2PUBA 4X6UA 3FRJA 3F6CA 4Q9NA 3O3MB 1NGSA 1OBHA 1QRRA 3VSBA 3O9MA 3PIDA 2HT6A 4UHBA 2VAXA 2VTKA 3U1VA 4HVLA 2J5XA 1MIHA 5K03A 5KYNA 1P1FA 2CXPA 3EH1A 2FSHA 3M6XA 4HWTA 3UCFA 1UL1X 1G8AA 5CK5A 2PKQP 1VLHA 3E18A 2WJGA 4RNDB 4NR0A 3ZWNA 5LU9A 2QW1A 3NBKA 3ZH2A 2Y1CA 5JCOA 4G65A 4FGUA 1L5GB 1BCRB 2I2WA 3CBQA 3KCNA 5NULA 3GLVA 1WCYA 2GZDA 3HSKA 1GDHA 4QJBA 3INNA 4MCJA 1TKRA 2XGJA 1E4OA 4POAA 3SF0A 3C4VA 3DXXA 2QN8A 3PNPA 3KVYA 2W2VA 1D1QA 2YIJA 1T1EA 2ZI6A 4MLCA 4Y67A 4BO1A 3H05A 1C7RA 1XZBA 2XZTA 2OFXA 1QSGA 2YXLA 4WL0A 1C3OB 1U0OC 2FPWA 3DMGA 1YUNA 2BMFA 3AOEA 1H6CA 4MV3A 1C4XA 3T38A 3EUFA 3H9QA 5D5HA 1JZQA 4IOLA 4J0JA 3I92A 3DA8A 4TL9A 1TADA 1Y0BA 1ZUIA 3RVQA 9ABPA 1E9AA 3U09A 4C6RA 4ECEA 2DHCA 3B36A 1FUKA 2V5UA 5HIKA 4Z7NB 5L6LB 1F4LA 5DE3A 4G1BA 4HBZA 1BXZA 1O9BA 4AF6A 3SQMA 1U0TA 2QSUA 1VKRA 1TUBB 5CVUA 3I09A 4K2AA 3AB3A 4UHEA 4P3NA 1IDN1 1UBKS 1Z0FA 1YTUA 2X9GA 1TF7A 1Y4UA 2V6JA 4I5GA 3VZDA 5T4BA 4E5PA 5AFSA 4YJFB 2BFCB 4KSYA 3S2UA 1D6JA 2KLHA 1Y82A 3DT9A 2NYVA 3TDKA 1TT5A 4I8DA 3RRJA 1RRCA 1E2FA 3NWOA 4XA8A 1RPZA 1M5TA 3BSSA 1TYDE 4OMCA 2DF8A 1RWWA 1U1IA 3ZQKA 3W5BA 2A84A 3FOAA 4M1YA 2XQIA 3FSGA 1I3NA 2NZ2A 1PJLA 1MA0A 1S4QA 1ECJA 4I9GA 5CW1A 7MHTA 2EARA 1ZRHA 5EP4A 4LY9A 4QAQA 4HN2A 5DK4A 4CKCA 4D4KA 3QF4B 4WKCA 2AEMA 3VO9A 2IDZA 5CTAA 2QTBA 2POQX 2VJPA 3GIDA 1FNNA 3PD0A 4FMCB 1YMQA 4G86A 3OZAA 4V2IA 1CS0B 2W6CX 5CJ2A 3WGGA 1XUOA 3GB9A 3QOWA 1GDDA 3BG5A 2ZIXB 1OU0A 4M98A 2RK4A 4C7OB 3FMOB 2D2FA 1WTCA 1QF6A 4RHCA 1XNHA 3OBBA 1PZXA 4KXLA 1KHHA 2M6LA 3T9AA 3O92A 4DFDA 2ESRA 5EP1A 4JLJA 1CDOA 3K0CC 2YZ7A 2E82A 3N7TA 1UBSB 1XD9A 4PF1A 1PW5A 3HHPA 3KKZA 4JBWA 3RSLA 1XC7A 1DC8A 1EUCB 3IPLA 4FC6A 1NP7A 2I2FA 3RTGA 1T6XA 4FM9A 1WCIA 5CDTA 1MH1A 1L7DA 4NBSA 1U6KA 4W1SA 3BB1A 2CYBA 2VH1A 3KJQA 3ITDA 4LK3A 4K8RB 4PN3A 3HCCA 4BC1A 4HNTA 4M6WB 4YP7A 4L07A 5T41A 2VP6A 2Z8YA 3WAGA 2A1UB 4LKRA 5JQWA 3PGA1 1YOVB 2NSYA 4A26A 4EUNA 5J5AA 1AKTA 4H3VA 3IRVA 2HHAA 4TTSA 2Y6UA 3DB2A 1EGHA 2QY6A 3I39X 3VU0A 4JBYA 4EM6A 1Q6ZA 1HXHA 2JGIA 3OQPA 5FNZA 2AG5A 4NE2A 4CEHB 5IMBA 3PFWO 2Q2OA 4WEOA 3ZV7A 2X1VA 3PX7A 1B8PA 1CJVC 3WRYA 2QZ9A 5KJEA 1PSZA 3OFNA 2P90A 3K70D 1CIJA 3JY6A 1LPPA 2UZ3A 3CT4A 3GT4A 4HQRA 2FR1A 1P4SA 2I2CA 4KVZA 3V1MA 4RTOA 5IMSA 1TVMA 1RPJA 3FWYA 1WWKA 2XE7A 1RKVA 9MHTA 1U2RA 4G4SP 5DGTA 1I0ZA 3FCUB 2NUAA 2WSIA 2WW8A 2VTVA 5IM5A 4F21A 2I62A 2L42A 4TMTA 3SDSA 1RD4A 5BWNA 5CLJA 4KPEC 5GADl 1ND6A 3JWHA 3OF2A 3LUHA 4KQ1A 1SXQA 1Z7GA 2IYXA 4GL4A 1P2BA 2I7XA 3ENNA 4UBLA 3I2JA 5AJVB 1X2BA 2XVXA 1V16A 1B14A 1I2AA 2J4CA 2WZBA 4E03A 2E1PA 4JODA 4CLOB 1I3LA 2B2XA 2JGLA 2GTPA 3LK6A 4IDOA 5FIUA 5JVDA 2ZFUA 1HEIA 3DV0A 2E4UA 1CQIB 2X4DA 5HM6A 1EFRA 4GKKB 2YC2C 2XECA 3G1UA 1N4DA 4LKOA 3V42A 1EWTA 2QRJA 1ETUA 1CBUA 4XWTA 3GLFA 4BZPA 4ZZ2A 4JROA 1EZ4A 3AOEC 4FGLA 4QNNA 2KX7A 4F4HA 1HETA 4Y7DA 4B3BA 2DFDA 3NHFA 4KGDA 5CU7A 2XDQA 3OM8A 3PI6A 4HFMA 1NVFA 2HMAA 5KWIA 2I2AA 2RKOA 4EHBA 1KQGA 2DSNA 2QYTA 4PC1A 3NMUF 2HJSA 2HBZA 1AZWA 2FZVA 4NC9A 2DCUA 3IDZA 2VNHA 5ALTA 3DMHA 1LS1A 3AB8A 3AEUA 2IHTA 4Q3DA 2BRUC 3GD7A 4NENA 5ILOA 3MMNA 1WU8A 1W19A 1Z2DA 2JJ1D 4EKDA 1H4SA 3Q7QA 3VPXA 4WPGA 2BKUA 2FFAA 1SD1A 3SX0A 1PT6A 2LRHA 3AM5A 1DJPA 5C1BA 1P72A 3LT0A 2Y0DA 4NRDA 3QY9A 4O8CA 2QTFA 5E3JA 1FFBA 2BGMA 3WISA 3MD0A 3RFTA 5F9HA 4Q1DA 4RIEA 5C7IO 5CXSA 2EW8A 3AHHA 3L7KA 1QRTA 5I7WA 3L07A 1KJ8A 3WIEA 4HATA 3E35A 1T1JA 5FBWB 4YAWA 3IA7A 3B3QA 4JEHA 1OTYA 5FV4A 2Z4RA 2WQ6A 5P8WA 1P0FA 1E32A 1S2GA 1QHHA 1VCIA 3CH5A 3MQFA 2YDXA 3P9YA 4R3UC 2JLRA 3V4RA 2PCJA 2WUVA 2BGIA 1MQ9A 4WZBE 4V24A 5EMKA 3A32A 3C1AA 2XY4A 4OY3A 1TECE 4RD0A 4QTZA 4PFJA 3FYUA 3N07A 1DKRA 1U1DA 2WQZA 4TVKA 5C31A 2WPNA 1BE8A 1MN6A 2MMCA 1SMKA 1UXGA 4RD3A 3BXXA 3RYFA 4NKRA 3A25A 4P4LA 2HRQA 3AW8A 4XGQA 5IUNC 5K7SA 1KNQA 1TRKA 5EMHA 4OI0A 3TTUA 1W0KD 1P9OA 1JH9A 3ND5A 4DRXB 2Y1XA 1WB9A 4X1IA 4U2BA 3MB5A 1JU9A 2WD9A 2O8BB 4KLAA 2DUNA 5GP1A 1UT5A 2W6OA 3CPSA 5KNDA 1LTQA 2QMUA 1OFHA 2RC6A 2W2KB 3H3JA 2Q5IA 3RCBA 4IUDS 2MTBA 3RSSA 1Z3CA 3ZUGA 4LDQA 4CUJA 5ADUS 4HFJA 5ESXA 3TEFA 3UYKA 1NI4A 2TYSB 5AM1A 4C6TB 3DOHA 1GTG1 2C97A 4WVLA 3T7KA 1FYFA 3LBHA 3O3CA 3QNWA 1UKAA 5TXGA 3I9V6 1X86B 3VTAA 2XBUA 4TOIA 3NWBA 3UA3A 3ULKA 1PT8A 4DCVA 5GPBA 1CF4A 2IPLA 2P2GA 2C2HA 4BZQA 1Y8CA 2WMYA 3A05A 1JP7A 3EZGA 1R7RA 2O7QA 3PFHA 2VPPA 3OPVA 4LJ4A 4R9UC 3WB1A 5BWBA 5JT1A 3V6MA 4I4NA 2J3KA 5A4FS 3I9FA 3A2NA 3LT2A 4ER3A 2KMLA 3M1YA 1Y1QA 2PAFA 1NJ8A 1BXRB 1QRAA 3ODPA 1SKUA 3C8MA 4OU4A 3C2QA 3F49S 1LSSA 2P9EA 1R6BX 2EYQA 4O1HA 3QUTA 3W4JA 4EG8A 5FUQA 5HZGA 1Z0SA 4FQ7A 4CKEA 4GXRA 4Q3KA 2ZTUA 3IVRA 5KAMA 3IDSA 4P22A 5F5NA 5I48A 4PPGA 3ETLA 3ZYZA 3DDUA 3I32A 3QPVA 1QJ4A 1NDQA 2OM6A 4IZHA 4NDNE 3WYEA 1T5TA 1HT1E 2PYDA 2HIMA 2HUNA 4IMRA 4X6YA 1E8MA 4R3NA 5DHSA 1IBSA 3B2QA 4YP6A 1FZTA 1JEEA 4O2BF 4JSTA 3OTOB 1G21E 2O8DA 3ETJA 3V2UA 2A9QA 3IP8A 2JD0A 3PSHA 3HY6A 3OPYA 2GERA 5IAKA 5AUNB 3TGLA 1XWIA 4WACA 4WLFA 3T3IA 4XJXA 3DE4X 3O8QA 4ZP1A 1JDTA 3LUJA 2YHIA 4N18A 1CDEA 2N75A 1QJCA 3N87A 3OZDA 3OUTA 3PNOA 4MINA 3U81A 4CTOA 2A58A 4IEFB 1JQJC 4MA5A 4KREA 3ZDEA 5CEFA 3L7OA 2G28A 3S40A 1KO1A 1TZKA 3TXAA 2NTNA 4RVFA 4FB5A 3Q3GE 2MINB 2PKXA 4B83A 5K8CA 1UODA 1Y7TA 4BIMA 3F67A 3GLIB 2W2LD 1FVOA 4FJ2A 4ILEA 4A8PA 5H4GA 3PL1A 4PG4A 5ECDA 4DV5B 3I0NA 1E1KA 4QQFA 4ZCQA 2CLDX 2LBPA 4UNNA 3T6KA 4B80A 5B5SA 1DAEA 4XX0B 3PDWA 1Q0UA 4XQ0A 1FU8A 1QCZA 1GJRA 4X95A 4E4TA 2CJPA 3I4LA 1TM2A 4LE2A 4PWYA 3TCKA 2RONA 3UMGA 5A7FA 5KQSA 3VU8A 1VKHA 1VJCA 3QYFA 4AO7A 1C1HA 4UBMA 5FLKA 3IVAA 1HTBA 1NRWA 2BMDA 2P6NA 5BYAA 4XVQA 5CM8B 1OXVA 2B3TA 4FINA 1YC5A 4M0PA 1SBIA 1N8NA 4QPNA 4G56A 3HDGA 3B1YA 4MQFA 2X76A 4NYIR 4Y6PA 4BMVA 1Q44A 4MRSA 4Y6SA 5BV2P 2J9FB 1KARA 1SM4A 4Y6RA 3U6BA 4X8HA 4IFBA 4M83A 2QMZA 4D82A 4TV9A 4ZOLB 4MQUA 1MO3A 3C48A 4PYLA 5MGBA 5KWJA 1S7GA 1B8VA 2A9KA 2DUJA 3BS4A 3NOOA 4Q03A 4KPYA 3IBSA 4OQZA 1D3AA 1STOA 2PH7A 1W59A 2I6QA 3PUYA 1F8XA 4TX1A 3CPHA 2C9YA 3F2VA 1L5LA 3WJAA 4OKSA 1KAQA 4NXMB 1ECBA 1ZMRA 2GPYA 4Z8XA 1J49A 2CXOA 3ECCA 2ORED 3HBAA 1Z5VA 4DDHA 1VLVA 5KYWA 3KAPA 4FJ1A 4MV6A 1HDCA 2R1UA 4HN9A 1TQ6A 4BX9A 4NOLA 4DV4B 2E6KA 4RVOA 4B47A 2IHVA 1OZHA 3OZIA 3S7TA 1JTVA 4HMPA 1VE1A 3ED1A 1W96A 2ANCA 3EPLA 4CM1A 3OFSA 5JI3E 1YGPA 3A27A 4I1YA 1RPTA 3PC7A 4MS1B 2GAFA 3M49A 2EP7A 3C3AA 1SIOA 4CI0B 3B85A 3QE9Y 1BD3A 3OD5A 4ANFA 2O2XA 4EL5A 3GP3A 5LQSA 3SS9X 4YUYA 2JPDA 3G0DA 3FNGA 4KXUA 3KPWA 4M9SA 3EBOA 4WFKA 4WUVA 2D0PB 2OCYC 2QTVA 4OCZA 4QBGB 4RO0A 4RK4A 4YHBA 4ZCRA 1W29A 3IAS1 4H31A 1QIIA 3RADC 2X5OA 3COSA 3OLYA 1AUVA 3TMYA 2JRLA 2WP0A 4HCJA 3BMCB 4M7PA 4IJMA 4BCBA 2BMAA 4U0KA 3RE1A 3NW9A 1DUSA 5JZBA 4R9SA 5IZCA 1NQVA 2V4ZA 2C3OA 3B1ZA 3BK1A 5K0BA 3ZGVA 2P9JA 3BRQA 2MCFA 1N0HA 4H6VA 3FDZB 3JAWA 3JQEA 9LDTA 1Z4MA 4A16A 3VPAA 1SKQA 3ICPA 1I6WA 1PR3A 1SPXA 1XL1A 2VWGA 3SVTA 2XNSA 4LXGA 4S05A 1Z5NA 1YONA 2V8OA 3DLPX 3PNYA 4IEIA 3T35A 1UP4A 3TL3A 1EX6A 4CM9D 4X66B 4GMHA 5FNVB 3UIEA 3ND9A 3WJ7A 1LV8A 3ORHA 1OX4A 1SUSA 1RAIA 3NNSA 3VPGA 4YR9A 5M2QA 2J0UA 1W1UA 3RRMA 1VHLA 2NMVA 3WG9A 1CUHA 1XAHA 1Z6YA 2OZVA 4AURA 4L0DA 4KTVE 3ZW8A 1COWA 1KK0A 2H5IA 3IOEA 4RK1A 3ISTA 3IEMA 3V4ZA 4WBNA 3OZ7A 2AJDA 1L7QA 1U2EA 1Y9EA 4K6GA 1UINA 2Q5QA 3FOEC 3VOSA 3UWSA 1P5FA 1L8AA 2GXQA 1R6VA 4PO9A 3W06A 4IG9A 3T9CA 3KTOA 2VXBA 3RRXA 2IBSA 3H8VA 3LT1A 2C7RA 3DZKA 2LVBA 2IXFA 3CSDA 2VRCD 4IDCA 1E2LA 4J76A 4PO3X 1XNQB 2JIPA 3ELYA 2I1VB 3VTZA 2QYHA 3QKWA 3ZS9A 1RFGE 1LX6A 1HYBA 3OIDA 4DQLA 4DJAA 4YBRA 3RO7A 4MGHA 4U4AA 1VC2A 1SVIA 5K0FA 1CRWG 1D2MA 1DE0A 5DGHA 3TLMA 3CKLA 1OTHA 3A0UA 3FUWA 1T2CA 1W36D 3LNCA 5FOXA 2AN3A 2BE9A 4W63A 5HUJA 3WL3A 4PG8A 1P0QA 4KIUA 4ZYZA 3FNIA 2O57A 2FEXA 2VDUE 3QXHA 4FHFA 3SR0A 1RI1A 5KHOC 1R4NB 1K68A 1JEQA 2JJQA 3QE4A 3SVZA 2KW5A 4UU8A 1OZGA 3GJ6A 4YYEA 2FSGA 4CQLB 2R7LA 3T3EA 2HA5A 4BWVA 1YKFA 3AHDA 3Q5DA 4DIMA 5J58A 3O93A 5FX2A 1E3EA 3ZE2B 1KJZA 2G1JA 1ECLA 3D31A 3H9BA 3CF0A 1C5KA 2C8KA 3ABZA 3JD0A 3OEWA 4Q19A 1M2JA 5H3CA 1KOGA 2FRVA 4RADA 5JDIA 1JR2A 1QIDA 1X15A 1EQUA 2WFAA 3NJRA 3KKEA 3OOJA 4KXXA 3VDMA 5HVNA 1OIVA 3H6KA 3CUWA 5ADVA 1TEZA 1XCGB 3QSGA 1US8B 5GGYA 3TR0A 1Z56C 3GFFA 2BGUA 3UK7A 3LDGA 3N70A 1FY2A 4GXTA 5F77A 5TQ2B 1N0VC 4HH4A 1W6RA 1V8FA 4Y3UA 4AJOA 5FOSA 3EGEA 1Q1AA 3KVNA 3VH4A 2DR2A 2Q0XA 4K05A 5F33A 3KZVA 5K0SA 2NU8A 2H9YA 2RIRA 4OGFA 3TSZA 2G1KA 4IDAA 2OOSA 2YX1A 4BRZA 2A0YA 3NT2A 4BLUA 5ICGA 2NT3A 3CH4B 4JU8A 2VXOA 2J33A 5FR1A 2LGJA 4EA7A 3CRQA 1X80B 3QPUA 1CSEE 1T5SA 3IV6A 1AOXA 2FFHA 1N5RA 4NCIA 1V95A 4FI3C 2J9ZB 3FPHA 1WKCA 4ZO9A 2GK6A 4EHJA 4ZGWA 4R1OA 1PWXA 3LCVB 4RPKA 2Q3JA 3K8OE 4INJA 4B4OA 3T1YB 3DDWA 1F12A 3FMFA 3EFHA 4S1TA 5A3SA 4YV1A 4KXYA 2HADA 2Q46A 3HBMA 2GO1A 3ES9A 2Y6VA 3NTUA 5DTMA 4F6LA 3DD5A 3CW8X 3ZU3A 5MN6A 2J5KA 1UXJA 4O33A 4AI6A 3RIMA 1PVVA 2PWBA 1O6CA 2FDRA 3U39A 4R8LA 3EDMA 4B34A 3S2GA 5DLQC 1H2AS 1ULHA 1ZP6A 4MUHA 4M0MA 4FYPA 1LJLA 3UJCA 4P4SA 4UTNA 1BD4A 5IZCC 3L8HA 3LPAA 3NORA 2GCIA 3E9YA 3EZYA 2PBFA 3DMFA 3DAYA 4AMBA 1S01A 5E9JA 3T3OA 5LM3A 3EFOB 1GKIA 1JAXA 1TYCA 1Y89A 1Z38A 2ATXA 3GMTA 4K26A 3ZY5A 2P40A 1KYZA 1AE1A 2CKMA 4N5HX 1H69A 3HHEA 4BECA 2PTHA 3KFXA 4O3FA 4P82A 2PWZA 1T2EA 4MP8A 1M8PA 2BFBA 3FWPA 1LDMA 1RQGA 3INYA 5AI8A 3SF8B 4Q9KA 4QLBA 2R25B 1QFMA 1V43A 1T4MA 2NQTA 2ZRLA 3GAAA 2ZWAA 5CMLA 1KZGB 1WOYA 2QP9X 2VI5A 1SEPA 2AZDA 2GFIA 3ZUPA 2DWQA 2Q6VA 3WLTA 1OXXK 3GWZA 5BRNA 2B5VA 1J9GA 1Y1SA 3G5TA 4KH1A 5ALYA 4G5OA 1OHHD 2P2NA 2XVZA 1DIGA 5ER9A 4CDNA 5BMVF 5CA1A 1BOFA 2QQGA 5DRTA 4JC5A 1MB4A 4WZBB 4HNAB 2YV3A 5L3SA 3GP8A 4CR8A 4WOBA 3QKIA 3FPEA 2R8RA 3UXHA 1NOIA 4W4TA 4EI7A 3AERB 1DWPA 3G9TA 1MDFA 3QMWA 1RXVA 1S1CA 4TSFD 4OMUA 1TTPB 3MAAC 7REQA 4LHWA 5C46F 4XLZA 4BMDA 5JI2E 3KWMA 4Z7QB 1HM5A 1O89A 1UXKA 3EW9A 4WCFB 4FS3A 5CLQA 3OQHA 5HKKA 3PUJA 5DEIA 4EGCB 1R0YA 2RI1A 5D5QA 3PPWA 2KLBA 5E7IA 4KK4A 3WRYC 3W9YA 5E38A 4PPFA 3UC9A 3WOHA 2GA8A 2A78A 4BOYA 1YB1A 1K6IA 4HBGA 3F7NA 4JJKA 1KRWA 2NO0A 1RU3A 3RASA 2FRDA 3AVPA 1PDVA 1XMVA 4Z9XA 1X19A 4PNEA 1F14A 1PJZA 1ZCJA 2OAGA 4S2UA 1GEEA 1OCEA 3VYRB 4AM8A 3K9FC 1QC5A 4D0SA 4PSDA 4TM7A 4YIHA 3L6RA 3QOFA 1NR1A 1F8GA 4Y1GA 3PDJA 4X3CA 2ORWA 4YJ2F 1IXZA 4NZPA 1RW4A 2AJCA 4PNZA 5HIMA 5A71A 1X7GA 2IHJA 3FUCA 2H4YA 3FX2A 1SR8A 2XMDA 4LHEA 4EATA 4D9CA 4HMOA 3TINA 4BUJA 4CQJA 2JI6A 2OXRA 2Y1FA 3IBCA 4PGFA 4D97A 5KTOA 3PUHA 3QLTA 5FYDA 1GO2A 4NVRA 1CPYA 1G2PA 4ZMBA 1H1LA 1JFRA 4NBNA 2ES4A 1QF9A 1WPXA 1VJRA 5REQB 1G3MA 2CE2X 2NADA 4PQRA 4ARAA 2H51A 1HH4A 3R4VA 2ZIUB 3EVTA 1C9EA 1SVOA 4KCGA 2N1BA 3UBTA 2IGBA 1PR4A 2CVFA 3OFJA 1OAAA 1N8SA 1VG1A 1OWLA 5FBRB 3D81A 2QV0A 3ACDA 4CLRA 2Q29A 3HKCB 4OQXA 2QTWB 1CRLA 1RLJA 3GVXA 3NIFB 3K0HA 4JDUA 4U1RA 4J1QA 5LL6P 5G0UA 1G8SA 1J2YA 3WRXA 4A6EA 4DT1B 4QZVA 4RTJA 1ZOIA 3EYAA 1WMDA 1G38A 1YOBA 2BFEA 3PTZA 4OLHA 2NTVA 3RRNA 3O3OB 1RVV1 3CUVA 5CNJA 2E2WA 1T8WA 1WS6A 4Y30A 3OI7A 1PWEA 1SHJA 4RJKA 2C4TA 2XD4A 3L1JA 3K15A 3ZVKA 1ADBA 2QQ5A 2ZVQX 1JDBC 5LA6F 3W7AA 1XTJA 1E64A 2P5TB 2VQ6A 3L79A 4M0DA 4J9UE 4X92A 2M1XA 1JU3A 3FLEA 1MOPA 1DDOA 4MX8A 1I0IA 1NC1A 1CW2B 3R9XA 1SCKA 3KOMA 1U8TA 2J7PA 2JCSA 2OBLA 1YAHA 2Y1GA 4B6PA 2Z1NA 3H11A 4JQOA 4WWHA 4L6CA 2ZSBA 2P9ZA 3SFTA 2X7JA 4A2WA 2WPDD 4MDEA 4F3YA 4RZIA 1Q21A 3F5MA 1DB3A 4WFQA 2CVHA 3GN2A 2GN4A 4GSYA 4AYXA 1K8ZB 4ND3A 4W5QA 1DRKA 2JJYA 4DA9A 4HK4A 3RVKA 5LKRA 2OV2A 4BBJA 3GYGA 5KKAA 3GLHE 2GHTA 1BHSA 2ZDGA 3QPBA 2X15A 5AOBA 3EAQA 5F12A 3WLLA 1RLIA 3PPYA 1CE8B 2OP1A 3ZE1B 2WAYA 2WF6A 2GYVA 5ITSA 1LNQA 3TUIC 1P2TA 1TF5A 4ETMA 4WRRA 2WT4A 1ZH4A 3MUOA 3TD2A 2IEIA 2PX2A 3BIXA 1NW7A 3ETNA 3BMNA 1ADGA 1MUUA 2Q8QA 3ZHTA 2PMBA 4W1RA 5A62A 2IZ6A 1UPXA 4XWGA 2QRUA 2R4TA 4HSEA 4WADA 5SY4A 4C76A 1Z5UA 4ENRA 1WG8A 1Z6TA 1NV9A 1GTZA 3HA3A 1VG9B 1YR8A 4IIUA 1QIGA 3W77A 4NOKA 4EEZA 1MIOB 3IIIA 1XD2B 2IOQA 2QU8A 2Z9BA 4BNMA 5AVXA 5EJEA 5I3ZA 4O4JF 3N8NA 5IKMA 4PBTA 1Q50A 2SCUA 3B3AA 3D02A 3L8GA 4F7WA 5KTMA 1JA1A 4KQEA 4LRYA 1VIDA 4DAOA 4WLEA 2QYOA 1XZQA 1IZ0A 2XKJE 3F4BA 3X1ZA 2IH2A 4JYAB 2XVAA 1AQJA 1EK1A 3BGOS 4YLGA 4GE3A 4C29A 3GK3A 1JE0A 1KFKB 1XQXA 1W73A 3FYTA 3VPBA 1GN8A 1EVQA 4ZTUB 1TKAA 3I9OA 3EUEA 3KSUA 4UCFA 3W5SA 1GPAA 4CM8B 2PU5A 3DCIA 5E7QA 1ONOA 1CUWA 3HYNA 4A36A 2H54A 2BBSA 3CR3C 5MFZA 1VSTA 3ENKA 3L0SA 3V7UA 1KK3A 3L4SO 3HYTA 5CA0A 1YNOA 2NX2A 3RHSA 2NNLD 4P32A 1P0MA 2WTAA 2B20A 4MB6A 1Q20A 4TXLA 1J7JA 1JZTA 4QELA 1RJFA 5HR5A 4M87A 5HS4A 3TKLA 2PGNA 1OYWA 1PJTA 2JIZA 3N0RA 4K9RA 4HF7A 5D51S 4AYTA 3F73A 3P5SA 2O7NA 1IUOA 4QOHA 1WBDA 1YZUA 2C42A 4A0HA 4IGKA 5M7EA 3HLTA 4IHAA 4X61A 5EJAA 2Q5JA 3CW9A 1TCUA 5ALNA 3LZ6A 3QK7A 4DSOA 3GYBA 2ZS8A 5K3OA 4NQZA 4C0WA 4RL6A 1XKLA 3OO0A 2Q0HA 4NMMA 5D6NA 3UGQA 2P5SA 1ZMBA 5HQJA 1B73A 3UV3A 1JDSA 1L3IA 4O8ZA 5BVGA 2DFPA 1TFUA 4LZPA 4ENUA 1AC5A 3VR3D 5HRCA 4Q0MA 2Q4RA 4G67A 5CT4A 2GZSA 2VHUA 5ICSA 2QSYA 5IZ4A 3JWIA 1DARA 1GRQA 3AFOA 3HI4A 3PR1A 3S2FA 2Z4TA 4ZEMA 1XAIA 2Q9AA 3C6QA 1ACMA 2OK7A 1QWOA 1UJ6A 3KZ1E 2O0JA 3VUFA 3PHIA 2J67A 3I4CA 1CUAA 2IL1A 5JRZA 6GPBA 2OK8A 4YECA 4OQDA 4KLZA 3U9TA 1IM8A 2C1EA 3KYCB 4Z8YA 3DHYA 3FUVA 3N0VA 1Q7GA 3NBQA 2WUFA 4P31A 3CTPA 4ZARA 3RC9A 3TQSA 5FEUA 2UYQA 3OQ6A 4XWAA 3IEPA 5F3DA 3NTRA 2IUUA 9ATCA 1PCXA 2PMWB 1TVKA 3AJDA 2X77A 3AF1A 2RCYA 1ULZA 2ATCA 2DBRA 4J6FA 1CUBA 1MTZA 1WZNA 1ZOOA 2IWHA 1SUAA 2GVZC 2G4VA 2HZ7A 1M0TA 1TXGA 3FNRA 1CEXA 3KU4A 5JEEA 2H7YA 3AY6A 1N32B 1HLFA 1W4BA 1XP5A 2PMDA 4YBZA 4KMSA 5C81A 3E6AA 2ACVA 5GM2A 2YY7A 3BF7A 1V7ZA 4JL6A 1YZKA 1GSHA 3QWFA 1AX9A 3KSZO 3AHFA 3L7BA 1A9TA 1PL8A 3M9LA 5FULA 3P2YA 1CNFA 5F3WB 2GBLC 3Q3JB 2WT9A 2I65A 4GKBA 1UC9A 3GO4A 1X1SA 2CL0X 1NUHA 2GB4A 3TSAA 2A1TR 4C0XA 3CO5A 3EJ6A 2G5CA 1E2KA 3SXUA 3C98A 4RH3A 4S1PA 1XLWA 3SZRA 2JAQA 1JHXA 2UXCB 4BTLA 1NUSA 3H5IA 1QBKC 2ZULA 3LUCA 4UXHA 1BMDA 3WWYA 2GCOB 3OC0A 4I9FA 4B79A 3RG2A 1LB1B 2GLTA 2HK6A 1AA6A 2CWWA 2Z56A 2JC3A 1VFPA 3NDRA 2MSWA 3QKSB 2NZJA 1ZC4A 1LH0A 4X9XA 5A4MS 1H5QA 1T25A 4W5NA 1GLGA 1ODJA 1YE5A 3BC1A 2R6CA 2PD3A 3NIWA 3OOWA 4DS3A 4F71A 4W5RA 4AT1A 4YCLA 1T10A 4E1AA 4B9AA 3KB8A 1N9GA 3X1XA 1WUHS 4D1YA 4I6JA 1ZJJA 1SOVA 1MX1A 1SU7A 1FNBA 1F5NA 1G8GA 4IW3B 4LJ7A 2G08A 2IF2A 1ZYUA 4U7WA 1CD5A 2EWMA 1GXSB 1XCMA 5G40A 3NOQA 2QD4A 3R8XA 3SIXA 5LKAA 2HAEA 1EXVA 3BJZA 4J3FA 4BGEA 4W7SA 4Y2YA 4DEVA 2NU9B 1FFDA 4HTFA 2HOQA 3LUGA 2BM8A 3B1JA 3LX8A 4B45A 4KP7A 3UAZA 4WW0A 3WGVA 1A9XA 4ISCA 2B6NA 4NICA 1TAUA 2QL6A 3V80A 1JFSA 2Y0EA 4GX0A 5BO5A 2D2IA 1ONNA 3R2JA 5FKJA 4CQMA 5JXHA 4BXOB 2A0KA 2IPOA 2R7KA 4FFOA 3UT5B 3P2JA 1T0UA 4NECA 1QH8A 2RGGA 1XCBA 2BVNA 4B3TB 1ZD9A 3ZX5A 1LLDA 2RHCA 4PR3A 4R81A 5BV8A 1XVAA 5JCJD 5EPEA 1HZZA 1VE6A 1EFUA 5DN6A 4XYLA 5JS1A 5BOSB 2VZ0A 2OHGA 2X6TA 3RODA 3A6PC 2HX1A 5IKPA 3AF0A 2QPOA 2QI9C 4MO9A 2P3OA 3NXKA 3ZV3A 2J4FA 5EIEA 5LU8A 3QXXA 2FU5C 4YX9A 1TCBA 2ZAIA 1NLUA 2ZBDA 2F3SA 1HEYA 2GF9A 2B8EA 3ZZMA 4H3SA 3ZK9A 1XCOA 3GT0A 2L19A 4GSKA 2VDQB 2BY4A 3DL7A 4EKEA 1L7EA 4EHNA 1UWLA 5DX1A 3RG8A 2Q6OA 2B8NA 3SJ7A 3VR0A 4RGQA 2JB9A 2OXEA 4O25A 3C3WA 4MWCA 2GD0A 4JI6B 1QIMA 4JKYA 4CEIA 1FJHA 1DAFA 4J7UA 4HX5A 2B1JA 1EK6A 5TEVA 2CD7A 3RGWS 3PNQA 5LD2B 4IDNA 2JGEA 4JUCA 4TL8A 4QIHA 1C1YA 4YA6A 5EP3A 5A9SB 3AF6A 4CEJB 4CCYB 4G26A 4KNVA 3DL2A 3JQAA 2BTOA 2WVJA 2AYXA 3REGA 2BFOA 4G41A 2DRIA 4L8GA 1ACLA 4LZLA 5E4JA 1XJCA 5A2QA 3HSSA 1QFYA 1Q74A 2HA0A 3LFUA 4XUEA 1PV4A 3NVMB 3VSAA 4MWTA 1ZNQO 1FQWA 1QGAA 5F2NA 3FPCA 2ZCVA 3V8MA 4HOYA 4HDCA 1K4KA 1P7VA 1KBOA 2DBYA 2EJTA 3RWBA 4Z4EA 3UTCA 4R2HA 1N2GA 2I7TA 1K63A 2HLDD 1KOJA 3Q6IA 1AHNA 4BVGA 3PEUA 4IXNA 1AQ6A 5DDIP 1U3TA 4MLZA 2JIDA 1W5FA 4RXTA 4C6SA 3NBXX 1SVMA 1VJGA 2OBNA 4JLUA 4F1WA 1ZK1A 3ZCRA 3C5WP 3PENA 3I2IA 1DOHA 4UVHA 3W5IA 2CNBA 4C0BA 3TL6A 2UUCB 2JGNA 1R6UA 3V3TA 3QHAA 1KYYA 3UAVA 1QYIA 3H9UA 1E1QD 3I6BA 1YZGA 5KB3A 4QA9A 1ZUHA 2C29D 1I3MA 4QVKA 8AT1A 5KTTA 4MPRA 2JS7A 1RJWA 3CUSA 5EZYA 2GZAA 2GHRA 1D09A 3EPPA 3O84A 5IVIA 1E5TA 2ZU0C 3E7FA 5CLLA 1QYRA 5J1TB 1PJCA 4B82A 2AOUA 4MDHA 5JSQA 2Q62A 4HHEA 5K0TA 3G1TA 1SULA 3HVUA 4OJTA 1V39A 3E0QA 1GNTA 1LDNA 1JECA 3R74A 1ULBA 1NXQA 3W6OA 3L7LA 2C20A 4ZQFA 2GI4A 2DE0X 3K0AB 2V7XA 3NHKA 3QJYA 4XFKA 5JTTA 3COJA 2H8GA 3EAGA 3IO5A 4QASA 4DQUA 3CMMA 4OQPA 3B9BA 3NRBA 2EFJA 2RGRA 1CEQA 3PP8A 1ONBA 3E61A 4G1VA 4H7FA 3CNQS 4NZ9A 3LL4A 3CT6A 5ALOA 2ET6A 4XDYA 3OF5A 1D2GA 4LXXA 4LVUA 4MPJA 5ALMA 3PKIA 1Z34A 3SZ3A 1Q14A 1QP4A 1C3LA 2O2JA 2OHVA 2P0EA 2WEKA 4DHWA 2JI9A 4IWYA 4MLDA 2FWRA 3ZGOA 1ZJWA 1HYQA 3IVMA 1DC7A 3F8WA 4L5JA 1GQSA 2GPWA 2VXYA 2WKSA 4B2PA 1P5HA 5LBIA 5F23A 3EZXA 4V3BA 2HQRA 4UXJA 4R0MA 3VR5D 3Q7TA 1B8UA 2AMFA 2WKWA 3IA2A 4PCLA 5HA5A 4RVNA 1BFDA 1YHZA 3TTVA 2J3QA 1ULTA 3HO8A 4ME6A 2C2ZA 2OHXA 4MTLA 3PICA 1WE2A 4O2BB 2V8BA 2ZYRA 3GA0A 4Q4JA 5K2MA 5BUCA 1RRPA 3EA5A 5BQXA 1DBIA 4OXRA 4CV3A 5B7NA 5BORA 1W4RA 4LDPA 4UD2A 1DJMA 2N0SA 2Z57A 1Q19A 1UDWA 4WLOA 1G3IA 3VR6D 1IOZA 1DTWA 1ZWLA 4MUXA 4MUBA 1H0KA 4X91A 5BMVB 5BV1A 3LH5A 4I66A 2QEQA 1MAVA 1TW2A 3AJ9A 5K0JA 1GPJA 3QG1A 5T6MA 3PR2B 3EXG1 3HU2A 3W6PA 1MPXA 3DULA 5HF9A 3ZQ6A 4PX2A 3LPMA 2O8FB 4JP3A 1WV1A 1XN4A 2ZUEA 1DINA 2C78A 3HUFA 4V1CB 4RIHA 3GBPA 4JLWA 2RAUA 3UB4A 4A0FA 4DABA 3QNUA 4LXQA 1RI3A 3VRHA 2GRUA 2ORIA 1F06A 1A9OA 2W93A 1QOQB 3D0OA 4LY0A 4NYIQ 4P7BA 2AXNA 2AUMA 4PLFA 3AUKA 2VNAA 1M6VA 1V0JA 3NFRA 4JKIA 4U7HA 5DMHA 5DNVA 2BM9A 4MW0A 4QO8A 5E7JA 3VNRA 3CS3A 1JWLA 4IIEA 2G1AA 5FOQA 4EHKA 1E61A 4DKXA 3GLHB 1PFQA 1SVNA 2P1RA 2YWRA 3RAPR 1XWWA 2ZR7A 4YMHA 3SK0A 3W2GA 3F3MA 5DNWA 4ENPA 5DBEX 1N2CE 3W34A 2IOHA 3HN2A 4YGYA 3JATA 1KU0A 1USWA 1K89A 2PHZA 3QP9A 1QAMA 1SJ9A 4US0R 1BN6A 2WP8J 5FBZA 2C2XA 2HPAA 4RMHA 2V7WA 3K6SA 2W58A 3A9SA 3IILA 4HLUA 3L04A 3MRSA 4GGPA 5DBOA 3RLIA 4K6CA 1J6UA 3PFFA 5JAOA 4JL5A 2DPGA 1Y6FA 4MIKA 3ZXXA 1M1UA 1BKYA 2JNWA 4DDMA 1RI2A 4RLQA 1YD7A 4HNUA 3KK0A 3G7NA 5DP1A 4EKGA 4MWBA 4A10A 4HWSA 2J0SA 1ODCA 2AQKA 3A2LA 3QMMA 4ND7A 2MR5A 4UTXA 3PUKA 3LUFA 4MCIA 4YS6A 3KWJA 2QJFA 2E5FA 1XA0A 3C97A 2R1TB 3FNHA 4MJXA 5IVDA 3RABA 5A9RA 2OZEA 2FSPA 1LRJA 3MT7A 2PZ8A 4HEA6 4UHCA 1KXJA 4AP9A 5COAA 4PHCA 4HH3C 1EQAA 1QUEA 4LHYA 3BBLA 5AMXA 4BNGA 1F20A 4P5DA 2QN1A 5U9CA 5AVTA 5I7VA 4WTOA 5AUQA 5CB4A 1CY7A 3WGZA 4YMVA 2CY0A 1JLLB 1U8YA 4WT7A 4G9GA 3LV8A 1O87A 2WIDA 3LI2A 4E70A 3CM0A 4EYEA 1M34B 4I50A 2C57A 2EKLA 2F59A 3C3CA 3GEBA 2WJIA 1RZUA 1DQRA 3NETA 2YXEA 1QR2A 4MYTA 5J23A 4R8RA 3ZLBA 4F0JA 3OEHD 1PG2A 2JLXA 5ENDA 4X7MA 3KT3A 2Z6QA 4O4IA 5I7HA 1SOWA 2FXIA 2H4HA 2VF7A 5FFNA 2HU2A 2ZYIA 4KK3A 3ZCTA 2JCXA 1B2RA 4B44A 1LDYA 3JCZA 1MXHA 2YRWA 3MERA 4G4JA 4HMQA 4IMIB 4XB2A 3EVBA 5E1OA 4JI1B 1MRSA 5LJIA 4XTCS 4RE5A 4QBIA 3ABQB 3V46A 1EJ0A 2CBZA 4US1R 4W9NA 4DIKA 3TD6A 1CP3A 1XU7A 1IUPA 1P7WA 1A95A 3GCWA 3FTCA 1QGUA 4ERXA 3L8DA 1E1CB 3RSFA 1MTOA 3UJ6A 2GK7A 3OQIB 2JANA 2H1CA 1GG5A 1FEZA 1OVGA 3TIXB 1NSFA 3I5AA 4CMHA 2V98A 4UZEA 2M6KA 2OVBA 1E3DA 1DJLA 5J2UA 3D7MA 3C6MA 5DIZA 3VKHA 4GT1A 2ZT7A 4REQA 1TM7E 4B7CA 3AKZA 3RKSA 3ILXA 1QPZA 1LDBA 3RI3A 1E5QA 3I2HA 2NVBA 3R3JA 4HZUA 1RQRA 3PBKA 4GO1A 2WQ7A 2CLLB 4RMNA 3BKXA 1X7ZA 1EX9A 1GVHA 3WXMA 3P0FA 1ZGZA 1MD9A 1L5NA 3ZWPA 1ISJA 1ZFNA 2ECKA 3ZI7A 2ZKLA 1JALA 2A59A 4A03A 1JVSA 1IVSA 4HGPA 4JBIA 3CH7A 1DO0A 3KZOA 3NHYA 4HTAA 4J49A 4LWPA 5K4GA 2ZWIA 3BD7A 3EPKA 5D87A 5A9TA 3RM3A 3PGJA 2F00A 4DTIA 1V7QA 3P1JA 4QBHA 1L9KA 2NYAA 3LWBA 1D04A 4YFVA 4BQNA 4IJ5A 2PD4A 5TQJA 4XWKA 3I3SR 4RLSA 3WYBA 3UMJA 1I5RA 5CX1A 4S1WA 4YRPA 4EG0A 3HCEA 3QVLA 4F2HA 5DO9A 1TIPA 4BCCA 2Q3FA 4CDMA 1MABB 3JQPA 1T0PA 3DEJA 1TUGA 3MS4A 1QGDA 1IHYA 2R8EA 4AFNA 3FB4A 2I8CA 1QZXA 4Q9DA 1QH1B 2AFRA 1VJDA 1TKBA 1C14A 2Q1WA 2QM8A 4D3SA 4BMOB 1KTIA 1VBNA 2BD0A 1SA0A 1JAYA 1XYYA 1JS1X 3A1EA 3ZXYA 2ZOSA 4CTMA 2AD5A 2IY9A 3OHSX 1L4YA 1V1RB 3DTNA 4DPKA 2RD2A 1EGMB 3VBEA 2ENWA 4R8VA 2Z98A 1O5OA 4G07A 3R9IA 2FPMA 2J5RA 4UC0A 3CVVA 1V2HE 4CUZA 2O9JA 2BE7A 2WD7A 4B3CA 3FLAA 2ZIWB 2QM0A 4G84A 1QXSA 2P4QA 4HQOA 1D9XA 3VV2A 3FY4A 5AHKA 2TMKA 4UDXX 3AB7A 4HLUC 4WNYA 5PGMA 2QPAA 3PKZA 4IDEA 1Q0HA 3C7CB 4S24A 1KFEB 5IK2A 2IH5A 3F5DA 1YUBA 3IERA 1AGPA 4KIJA 4IJKA 3I9KA 5FPHA 1YR6A 3UOGA 3ESZA 1YJAA 5JCXA 4KYTA 1DXYA 1SBYA 3QE0A 1YK0A 4H4CA 2I99A 4FNAA 2VDLB 1J06A 4LV8B 5JD6A 4NBKA 1C0IA 1AQYA 2FPPA 1R18A 1NOJA 3MWKA 1ZBQA 4UTZA 3NHMA 4QYMA 3ND7A 2YHUA 4WESA 5G4KB 3KQQA 5LR6A 5F78A 1XRQA 1CJSA 1GRRA 4OYYA 1G8HA 1OW3B 5G41A 3B9RA 3OMWA 1T2NA 3LXMA 1YU9A 4JQSA 4WGFA 2DLNA 3E2MA 2Q5LA 3AZQA 3PC3A 2IC5A 2O8CB 1M75A 4L22A 2GR9A 4IINA 3W9SA 3HJGA 1Q0SA 5AD1A 3ZWKA 2I3GA 3BQNB 3IQIX 3RSCA 1H9CA 4IO0A 3U7JA 4XSHA 2C2MA 2RAVA 1K08A 4MLPA 1GGFA 3X3HA 5B58T 1PDOA 1SUEA 1Q22A 3K0KA 4US2R 2ZBQA 4QECA 3WL5A 3VFDA 3CLRC 5F98A 5JR3A 2EFGA 4EY3A 1QTRA 1BDMA 4FR2A 3U80A 2FX3A 1HBJA 4BLWA 4HZIA 5P21A 1RI5A 5L4NA 2ZEJA 4B7UA 2ECPA 3NJ8A 3NO4A 5C2JB 2FF7A 2OCKA 4RUKA 2PUJA 4UHKA 4W9NC 1BNCA 2YMMA 1W46A 3EXHA 4YALA 2JBWA 1ULUA 3TQCA 3GFQA 1R0KA 3UW1A 4GL2A 1ZK0A 1JIQA 4FWTA 1NW5A 4C5AA 3BM5A 4KQFA 4Z1OA 5CD9A 1Y1RA 3IBYA 3TNDA 4C03A 2FMIA 4ZIRA 2C9BA 4Y0VA 2IP4A 4EG7A 1J21A 1KVRA 1NQTA 2QVGA 4ZN6A 4HPXB 3IEKA 1PGPA 2J4DA 4BAZA 3U31A 5EMNA 5HJEA 4DRZA 3DDCA 3FMIA 4UE3S 1ZX1A 1GFIA 5JJIA 4FD2A 5KVVA 2Z0MA 2FW7A 3IP3A 1CCWA 4I4LA 4KUGA 4E7OA 4EEXA 3I30X 6LDHA 2ETXA 3AUSA 4KI0A 2O8FA 1Y4ZA 2FUEA 1ILWA 1HI9A 3JRXA 4G9EA 3E3LA 4CFYA 3U3XA 1UZLA 4DLAA 4GEKA 3E58A 5TMBA 3K0SA 2V45A 1V3QE 4QNMA 2EFCB 3OMLA 1Z4PX 3AYZB 2XYPA 4Q3AA 5F3RA 1ZN7A 2VT6A 5M04A 5C3UA 3AVWA 3L01A 1A98A 4JFAA 3RSZA 3FPLA 4YT2A 2AGVA 4Q39A 5D3MB 3UICA 4XRRA 2DHQA 1KH3A 4LFBB 3MD9A 1XTZA 1Y7PA 5IBRA 3IKMB 4H27A 1ENOA 2V7EA 2J46A 1G4AE 1QIHA 3K9CA 4WJKB 4ZYLA 4Z4IA 1BJKA 4OSPA 1TLFA 4YRSA 3A31A 1P61B 4WUTA 1Z29A 4B9EA 2E4XA 2OAP1 1C3XA 1EXNA 3NCTA 4LN1A 1WUKS 2ZSHA 2PNFA 3D4IA 4RY2A 3RFFA 3GGDA 1LSJA 4UM8B 3DMDA 5TT0A 3O91A 1GUAA 2A7QA 2D8AA 3CUKA 5AHXA 3TSWA 3F2IA 3WYNA 4DSNA 2V59A 4HDKB 4JY7A 4I1RA 4UOQA 1WMAA 2MJLA 2VJOA 3A11A 3GIWA 4JP8A 2HBYA 1JA0A 1NRIA 3DR5A 1ZESA 1T8SA 2CFTA 3R3ZA 4B32A 1G55A 1GUZA 1NXOA 4HR7A 5DM1A 1RHJA 5KI6A 4Z2AA 4FLEA 3ANMA 4K40A 1RE0A 2Q3LA 3AFHA 4GPD1 4YJ2B 1B8OA 3CJQA 3SIPA 1G17A 4YWJA 4B85A 3HWWA 1N7JA 2AI1A 3B9PA 5DGCA 1A5TA 1BWQA 1NFFA 1N5DA 3FYDA 4RA9A 5DV9A 1FFHA 2I7DA 3I53A 4LXTA 4JJ7A 2QGZA 4YRTA 2XJ9A 1F2TB 3SZMA 1K75A 1V1MB 2OOKA 4D6XA 1NI5A 3C8HA 3K9WA 3SEQA 2G9NA 1LPMA 4B40A 1R0WA 5D5PA 1T36B 4OSOA 3IHWA 4W7IA 1AZSC 1DCFA 4OBEA 4ZU6X 2WU1A 3T7DA 1VOTA 1TA9A 4BX3A 4BRUA 3UVEA 3SJUA 1WXXA 4KRYA 1Z4LA 1OT5A 2PIAA 2ZKIA 2VNIA 4MIOA 2ZXUA 1UMBA 5EUBA 4ZKEA 2UYHA 1DWOA 2QNRA 4FQ8A 3TPZA 4GWLA 3EZFA 3BDIA 3PQ4A 4H59A 1BAPA 1NDHA 4XR4A 2ONJA 5JSFA 2P6RA 2X5NA 3DO8A 1G98A 1ZU5A 4R31A 3SZLA 1K92A 2VL7A 1S96A 2N47A 4UMEA 1EUQA 2CEAA 2XB9A 2PS0A 3EN0A 1E69A 4LY3A 4V3CA 3TTTA 3UH0A 3W3AD 4EFDA 1BHJA 3G6WA 5GVRA 4C0QC 1S2NA 3GN1A 3OZEA 1AN0A 3K9LA 4M8LA 2Z2ZA 4OD0A 3ER9A 3JWPA 2XNHA 1YI1A 4JUIA 2JJ8A 1Q0LA 3GFGA 2AMVA 2QBYB 2YXPX 4KXMA 4P98A 1T3LA 4BB0A 3HUDA 1INLA 4O4LF 1X3LA 3UHPA 4NARA 4RGBA 1DBWA 5JH7A 1TJ5A 4JR0A 4A91A 4AN1A 5KC9A 1QRUA 2AE2A 3D8RA 2HEIA 3WYFA 1X7WB 4F1JA 2XNDD 1H2ZA 5LA6B 1SZPA 4FLFA 4FFLA 4DJJA 3MTIA 2ZYSA 3QA9A 4MPDA 3T34A 3K0EA 3TOXA 1U0BB 3EXHC 2AG1A 2G5GX 2G0NA 4DG9A 1O96A 1GQQA 1C80A 1NR5A 1N2CB 2BR3A 3CSUA 3OCXA 3K1AA 1VCNA 3L7IA 5IDWA 2GSDA 2Q6LA 4DZRA 2YIDA 4BLOA 1II8B 2WU3A 4M54A 2AFHA 1ISIA 5BR7A 2CXTA 3OF3A 4D9EA 1TTQB 4U6NA 1VMKA 4J4HA 3WADA 4WNAB 3AESB 1E9FA 2I0FA 5KOJA 1M2VB 1NA5A 3KV3O 2NUTA 3YASA 2ZM6B 1A2OA 2X0IA 3G0BA 3QX7A 2DWOA 5B3KA 4JEMA 3FLBA 5CW2A 2B1RA 4DCTA 2LKCA 2QRKA 4V0QA 5JFGA 1Z8HA 2I1WA 3EXEB 1AKQA 5CT5A 1Q0PA 1PE0A 3N86A 3WLJA 2JJ1A 1J4AA 2PZFA 3Q9UA 4G5HA 3IB3A 5KQRA 1C0PA 1W34A 3RSGA 4PC3A 3SP1A 1L5KA 2FMUA 1K7YA 5JEDA 4XVUA 3TQRA 4ESOA 1LQUA 1YACA 4FYKA 4BVJA 1VPWA 2XV1A 4PR0A 4MWGA 5JO9A 1MCZA 2Q6IA 3O73A 3B7WA 4EJMA 3QTTA 3TAHA 3DWIA 1XDBA 3FCAA 1RXIA 2Q3HA 2CSXA 2XGMA 3SZUA 5JARA 3OZFA 1AXRA 1IBMB 1QU3A 1OE0A 5L95A 4O4JB 1I2DA 2PE5A 4LF9B 1BRMA 2QAGC 1U2GA 3EK2A 3FCEA 3NWEA 3V7YA 1KO8A 2P6OA 4OYHA 2C94A 1DKNA 1L6RA 4OATA 2GA9A 3FCOA 4C4XA 4OYLA 5DOZA 4WH0A 4I1IA 4NPHA 3M33A 3V8RA 2WSBA 3VC1A 2Y4OA 3FVWA 4P3YA 3JQ6A 5SYNA 1KIMA 2C5EA 2FNAA 5L8VA 1N34B 3PT9A 1FTQA 4LVNA 4BKPA 3GLGA 2OUIA 1OFUA 3QWIA 1C8LA 1ZHOA 2GWHA 3H1FA 3F1LA 3JQ7A 4JQZA 5AKEA 2ZAGA 5AJUA 5LXTA 1Y8RB 1ZVQA 2CXNA 4KQGA 3AU8A 3T52A 3GP5A 1UBNA 1YAJA 4QYIB 1K6JA 3BVPA 4U9UA 2VAPA 4EI2A 1ZIYA 2KPOA 3R7SA 5ADHA 4D43A 3EQZA 5GIPE 4WK4B 1HNWB 4TKVA 5C51B 3N5CA 4QJ4A 2VT7A 5LDGA 1SXJC 3ZLTA 1PZHA 2Z2XA 1E9SA 1SVUA 4ZC8A 5JE8A 1L1RA 2VYFA 2Z8YM 4LZOA 1JSRA 2I71A 3F4KA 5CR9A 4DA7A 5CGQB 2BZ1A 2C7BA 1OYVA 3NASA 2CXRA 5FBKA 4MVYA 3VISA 4DEYA 4ZZ1A 4G8JA 2IE0A 1OI3A 1H23A 1XMIA 3L7YA 4BCDA 2P2DA 4ZT4A 2DETA 3WWCA 4IG4A 2H57A 2GEFA 3IUYA 3LKZA 4HQNA 4JENA 2F55A 1YCDA 3KQKA 3A3PA 3TIFA 4Q37A 5B7PA 2BJVA 5KYYA 4GYWA 4X65B 4P53A 1FSPA 2OCAA 2Q49A 3BERA 4Q6WA 5K3CA 3DO5A 4P84A 5IEJA 4CM3A 1TEHA 1O95C 3AL3A 1XZLA 1ZK2A 1U1EA 3GLRA 1JA9A 1PQ4A 1QMGA 2UZ1A 2ZW9A 4FBLA 2XTJA 3U7QA 4M0LA 3A4LA 3BQ9A 4IM7A 4WKGA 3P0JA 1A8HA 3MBOA 4CCAA 1KEEB 1HE2A 2C03A 3NH9A 1UAYA 1HYEA 1MQ8B 4QYSA 2C2OA 3I8XA 3PYXA 4K9NA 1Z08A 2WWIA 2PRJA 3U62A 4U3JB 2FEPA 4RZ3A 3UXYA 3WA6A 1P2DA 2YS7A 4J0KA 1M8GA 2W00A 2VQDA 2O2EA 1Y34E 1YR1A 3S1LA 4EPVA 7AT1A 1ZLYA 2V7VA 3T7JA 1VBKA 1R0CA 1J2TA 3CURA 3DFKA 3R7NA 1OGIA 2A6PA 4DBLC 1O94C 2R6GA 4OXKA 5DPMA 3VO8A 2Q21A 1E0AA 2CJWB 1S5PA 3D2AA 3GMSA 1QIJA 4I36A 2GJ4A 1K6MA 5AW5A 1D4AA 1V6CA 2PT6A 5A5DA 1M1NB 2OGZA 3GRKA 2ZI7A 3IT0A 3PFGA 4MCHA 1LRKA 4Q18A 2X4IA 4MHSA 1OU4A 3WGKA 5JDCA 3IPCA 2F9FA 5JVDF 3R44A 2WUEA 3UFXB 3KUDA 4GZMA 1U7DA 2RBKA 1PYOA 2CYAA 3BE8A 1U8EA 2HA4A 3PQ7A 4IX1A 4KRGA 3O4RA 2VHTA 1JB9A 5EHNA 4XYMA 4B3IA 1U9CA 4LMAA 2GBCA 4LOKA 2PS3A 2V65A 4OEHA 1GPYA 4WLUA 2I2DA 1ILEA 3AW9A 1XWFA 4G0ZA 3BJRA 3UMBA 1S3IA 3DMRA 3B52X 1KDTA 5I8PA 1Y3IA 2ECFA 2W90A 3CWQA 5HUQA 4OGGA 5DT9A 4F96A 2GSWA 2HGZA 1QRSA 1RABA 1EVJA 5F51A 2R8OA 2I33A 1A97A 1ST2A 1I5EA 1P31A 2HRZA 5HCIA 5K0LA 1PK9A 1UWCA 3HNOA 2CMDA 4RA6B 1B6TA 1NVGA 2GASA 4E5VA 3DUFA 2W2OA 1UJ5A 2NU7B 2ZBGA 4YEDA 2R5FA 2BCGY 4P80A 1WUYA 3D6HA 4J16A 2BMVA 3OLVA 3LBAA 2B6HA 3JQRA 3KZXA 1ZI6A 5B2FA 1U2GC 3EEQA 4F38A 5EJGA 3HFJA 3KBOA 3HJCA 1Q92A 3HA5A 3KTDA 3K09C 5GAJA 3O6VA 2OPBA 1AQUA 1U04A 4JVLA 3UMFA 3VC2A 3LT4A 4ARBA 3B3GA 3KAJA 3D3WA 3GJQA 3O0DA 3PNVA 5EPUA 1L5HA 2UU9B 2HR1A 1H4QA 1NY5A 3EXIB 1O6ZA 1SRQA 1Y80A 3S2ZA 2G70A 3G5AA 1V9LA 2IIBA 5CNMA 4BNVA 2CVQA 1KI8A 1XVLA 4RE6A 4QRHA 5GQSA 4CHGA 5K1ZA 3MZ0A 2HYIC 2P0YA 1KQFA 1AGRA 1OWPA 3NEYA 5C9ZA 4LQLA 2Q1UA 4TMKA 2ZPTX 4KNYA 4JYCA 4X85A 5JU6A 1PDWA 2ZI5A 3MTGA 3PGKA 1BVHA 1G42A 1WD7A 5HJ2A 1CY1A 1NXSA 2KJQA 2VOJA 3TQHA 1Z82A 4PAWA 3DE1X 3WKAA 4EHIA 5A6SA 3DYIA 4KPGA 4OHZA 1WXFA 2W43A 3L7MA 1FLNA 1DOAA 1YV9A 4KOEC 1U8ZA 3QVVA 4Z53A 3LC2O 3PJDA 2W83A 2GAAA 4DMKA 4IYJA 3DE0X 1H4TA 4II3A 2C2WA 1TMYA 3FAKA 1BFUA 4TYMA 5ECGC 3P0EA 3IB6A 2G07A 3S1AA 4B35A 2G71A 1RWQA 1YR9A 2GZ3A 3OT1A 1HMPA 3A3KA 3FI9A 4A73A 3TRHA 2OUKA 2IQIA 3PR3A 2V9ZA 2XEXA 4N76A 2GLUA 4N39A 2UZIR 1UKVY 2EKZA 4XDHA 4XE5A 3N2GB 4E5MA 1SIUA 5JXJA 5LNK1 4CM9A 4XWWA 4RHUA 3IDFA 5FO1A 2J09A 1Z8DA 1YA8A 1G8FA 2IEAA 1U8AA 3ACCA 1KMHB 3AR8A 3F3SA 3LVFO 1TJNA 3S4YA 2RGYA 1OLXB 5LWQA 3UF0A 3W2FA 3KXDA 1KZYC 1AD2A 1VMAA 1NVEA 2XOKD 4R51A 5ELMA 5I9MA 1M6EX 3NAZA 5KTSA 2PKEA 4JBNA 3P9QA 2HF7A 2B7BA 2CLSA 2YWGA 4GWGA 5JFTA 2L69A 4R3WA 5CAEA 5ES3A 3CGWA 4F93B 3CR7A 4UDOA 3LKDA 4MKGA 3S68A 4JELA 2HJWA 2ODWA 3NTOA 2ZTLA 2G09A 3AP1A 3WYDA 4OAPA 5B1SA 4X1YA 3ER8A 4R4JA 1XZFA 4FMPA 3G23A 4BNYA 6PFKA 1SQSA 1GARA 4INOA 4K46A 2FPUA 3CG0A 4NBVA 1W2GA 1JEDA 1SCNE 3KKKA 4Z5XA 2XMCA 4LBVA 2VRCA 4LOLA 4JQYA 3EX7C 2EVWX 4XLLA 1TUEA 3BIJA 2WTNA 1XKXA 1T4GA 5JDCC 3RW9A 3TPCA 3IKVA 2P68A 4ZANA 3WLHA 2R44A 4GEGA 1VE7A 5JMWA 4LF4B 4BKOA 5M3BA 3PDUA 3Q0IA 3LRTA 3R5TA 4REOA 3VI3B 3ZHVA 1Z0ZA 1LTKA 2BI8A 3E53A 1QFJA 2PUGA 4OLJA 1TCVA 4L5CA 1P1BA 1F4VA 4WERA 1Y8QA 3U5TA 4QJ3A 3R77A 5KWSA 2H48A 3DZ8A 3I61A 4HLDA 4RC9A 5DHTA 4P9NA 2QJTA 3G2HA 1OH6A 1UXIA 2PWYA 3STUA 2PPLA 1G9TA 3GLTA 3JTEA 3JU3A 4LY6A 3VH1A 1FMJA 1IN5A 2ZIEA 4GI2A 4R1MA 4D44A 5K0CA 1KYTA 2REBA 3ESAA 6NULA 4HG2A 1ELOA 2R1VA 3MTAA 1KS2A 1JIXA 1RQ2A 2YXBA 3DQPA 3STXA 1O58A 1Q84A 3C3MA 1DTSA 4YCBA 4F8JA 1T6NA 2DPHA 2W8BA 3V8NA 3U1TA 1GZSA 3ZU5A 4JLDA 1OYYA 3SC3A 1UJCA 3H0KA 4PYMA 3OIGA 2YWXA 4NH0A 5KOIA 3FYSA 3K73O 3MQ4A 2Q4TA 4UHHA 1C3JA 1FDUA 2IDJA 3ENQA 2ASVA 3F74A 3P0RA 2GRJA 1XDZA 1NYTA 2PGDA 3OIUA 4YXWD 3MNFA 1U0LA 2X0JA 2IXAA 3IUBA 3MWDB 2PX5A 1RXSA 3MT8A 1O97D 3P96A 4S1OA 5TE9A 3T7EA 2FWPA 5J2TF 2OGTA 5JOQA 3L82B 3IQWA 1GTRA 2FPLA 1MAWA 3TE7A 2VDWB 4QGGA 3DHEA 4JI4B 4NZZA 1MAAA 3I04A 5B7GA 1PZMA 4PAOA 5DHAA 5HMLA 3QOXA 4L2IA 2GPJA 2I87A 1VL2A 5B58C 3L77A 1EM8A 5HJ7A 1XKQA 5JNWA 3JVDA 4PLHA 4LYHA 3E1GA 1PR6A 1XQYA 4OVKA 3LA8A 2VJDA 3GNTA 3ONNA 1LJ8A 2X19A 4HDMA 2D0DA 3GV0A 4E2WA 1USGA 1G0NA 3HR7A 4B7ZA 2C1ZA 2X9LA 3DVAA 2VHQA 5BWCA 2BF4A 3BDAA 3NPMA 3Q41A 3TRIA 1B4DA 3AEQA 5K51A 1FRZA 1QONA 1V8BA 3QFHA 4ZO7A 4E13A 4EKNB 2XUAA 2ZRDA 2WDPA 5HRAA 2CBGA 1XMOB 2O05A 4EJ6A 3UNXA 4E30A 4QNRA 3GJSA 4MUYA 4G23A 3QXJA 2DBZA 5C8ZA 4ZMRA 1K8XB 4A2QA 1FE8A 3LUBA 3A37A 5IBCA 3ZD6A 2QX6A 3KXPA 3OCJA 1FOEB 1JPUA 1H8ED 1TMKA 2LDBA 4XIGS 1K5DA 1IPHA 2IYVA 2QVCA 4IOMA 3JQ8B 5H80A 1P4GA 2LE0A 4NJMB 1ADYA 3NV9A 1JQKA 3P9PA 4E22A 2QUAA 2VBGA 3COZA 2VUSA 4G37A 2IHKA 3BFXA 1SK8A 5TPZD 5B1HA 3E7DA 4FILA 2VRNA 4BKQA 1ISGA 2B5OA 3AILA 3LT5A 3EWAA 4BE7B 4Q9AA 1NMSA 3HUUA 4PZCA 1MORA 2JKYA 3C4JA 4GOLD 3V8QA 5JAHA 4DNPA 4FFBB 4OJNA 1UFOA 4URFA 4EUFA 4HDNA 1ZXLA 1U6IA 5BSFA 3B6ZA 4ZOBA 5BR8B 1DAOA 3KDPA 3LY7A 3IO3A 3MYRA 3WNDA 1JL3A 3KYDA 4QXOA 3ZIUA 1R74A 2XRFA 2ZRBA 5IANA 4UTRA 1O08A 4TSFA 2FUG6 2K87A 4PGAA 4MEAA 4EA6A 5JBIA 2QTCA 5FFMA 5AJWA 3RLFA 1IVYA 2PH3A 4N3BA 1I51A 4W8GA 3ZLUA 1Q0RA 2X42A 4UUPA 1RE1A 1B00A 3UHAA 4AN4A 3PQ8A 3TFQA 3PVCA 3PNSA 5EJFA 1YNSA 4TKUB 3TQOA 4KIGA 3X1KA 3KETA 4LJRA 3SQDA 3BHNA 4KPUA 2BSXA 1EP9A 2ZK7A 4BFCA 1KR2A 1SHTX 1DBSA 2XDWA 3MINB 3ELDA 3V97A 2R4UA 2QL7A 4PPQA 3CLHA 4IF6A 1HDZA 1PQPA 2OQ2A 3L41A 1PG0A 1UP7A 2V3VA 3B2NA 2BTQA 3JQDA 2PKRA 3EVAA 1G41A 2G80A 4D96A 4IZOA 1RM0A 1DS6A 2HDHA 4RW0A 4I55F 1SCJA 1XGKA 3QKUA 2RGXA 4L74A 5B2EA 1ZMXA 3HP7A 4BNFA 3A4TA 4A8JA 3CRRA 4MWEA 2VYVD 1AKVA 3VX3A 4L72A 4PNPA 3TM4A 3TQIA 4CTKA 1J33A 3U60B 3A2KA 1G16A 1LC3A 2ZJBA 1U2TA 1YRHA 3PG5A 4HXGA 4YRJA 4A3SA 2WRZA 3RKRA 4MS3B 3STVA 2BGNA 2JBAB 3TLJA 1X74A 4CI9A 4CKWA 2CNLA 4RLFA 1RKQA 5K3SA 4TXMA 3VNAA 4D25A 4P7FA 1BZYA 4X45A 4NCXA 3GDHA 3VPHA 3DVRX 1UDXA 1FW6A 2DUMA 2D7CA 4OXYA 1FFAA 4CETA 1XDUA 2PRYA 3EDYA 3DVLA 3TGPA 1JIKA 2E4WA 2CHUA 4I6GA 1DWQA 1Q1GA 1UM9A 2OR3A 2OV8A 2O7VA 4RWEA 4KXFB 3RFVA 1VL6A 1CLUA 2VZEA 5LQJA 1EFCA 2BR4A 3IQFA 4MB0A 4BLVA 4JSYA 4DMHA 4YQYA 2FMXA 2PBRA 1KP9A 1CY0A 4OQNA 3IALA 4P36A 4JBXA 3K0FB 2REOA 1RPAA 4W8OA 3Q6MA 1YZQA 4Z3DA 4WEQA 4F8EA 2XVYA 2PUAA 1B23P 4D56A 5TMPA 3F97A 4UVGA 4HYYA 3FFWA 1YS6A 1YL5A 2PLNA 4Y1RB 5H68A 3IUSA 2FGKA 5KPJA 2BEUA 1R9NA 4JGIA 3TX6A 1VDMA 3C45A 6CHYA 1UMDA 2WABA 2GNOA 4MKFA 2UYGA 5IWCA 2GBPA 1H6AA 1YJ5A 3I72A 3PXGA 2F8LA 2DP4E 3ED5A 3JARB 4L78A 4NPAA 3T94A 1PHRA 2JI7A 3DM9B 4L8YA 4M89A 3QEMB 5EOVA 4F5ZA 4IKPA 1D07A 2RGUA 4WBSA 2PVCA 4GH5A 1O4VA 1A76A 4QYTA 3AUYA 4UVDA 2YW9A 2XITA 2FZWA 1U5AA 2IX9A 3WGOA 1GDTA 1EFKA 4MQEA 3ENVA 1TC2A 2IUYA 4RSGA 4CG0A 5E0OA 4XPIA 2ZREA 3FFBA 2WF7A 2YWEA 4IXTA 4KH0A 4N6NA 3ZWDA 4QOIA 2ZRGA 3FFTA 1D03A 3HVHA 3WFIA 4GBGA 2WPDA 1U5BA 2OV6A 3W8EA 3Q85A 1Y3AA 3ZTYA 4DJTA 1R66A 2NOAA 2OQRA 1IJFA 1G8MA 4X20B 3J7TA 4PZ0A 5JHGB 3B82A 1TGVA 3RFXA 3PWZA