4JPRA

Structure of the aslv fusion subunit core
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
YFQGTANLTTSLLGDLLDDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCSFNLSDQSESIQKKFQLMKEHVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ASLV fusion TM
publication title Structural characterization of a fusion glycoprotein from a retrovirus that undergoes a hybrid 2-step entry mechanism.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin a)
molecule tags Viral protein
total genus 28
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jprA00
4FIPC 1QR8A 3B8MA 3WFVA 5HFMA 2P6JA 1I5XA 2LP7A 3MHSC 1F23A 4JGSA 1SZTA 5KA6A 2MK3A 2M7WA 1JQ0A 1QCEA 1QR9A 5CN0A 4E2LA 1Y66A 5HFLA 3H01A 1K33A 4JPRA 3B77A 3P30A 1ENVA 2EZOA 3K9AA 3M99B 4FJCC 4JF3A 5KA5A 4G2KA 4N23A 1EBOA 3B8NA 3CP1A 1JPXA 1Y4MA 2EBOA 2X7RB 1K34A 1MG1A 4FK5C 2OT5A 5H9CA 1I5YA 3CYOA 1QBZA 5CMUA 1DF5A 1DLBA 1DF4A 3GWOA 1MOFA 4N21A 3MHHC 2EZPA
chains in the Genus database with same CATH superfamily
1I0HA 3A0HZ 4LNUA 5B66Z 1YJ9V 1FPOA 1OCRC 3AK2A 4X1YB 4UCOA 2PI5A 1FXKC 2QKAA 4A5UB 2MK3A 3ZMUA 1GK9A 3CCEV 1KU9A 1K5SA 3P3NA 3SR2C 1AJQA 3N2GA 3I5DA 4TV9A 5EIBC 4JI3O 1I5XA 3BA9A 2Q69A 3LDDA 4NVPA 3ZS8C 1VQ7V 4KL1A 4NXNO 3B40A 3JALA 4JF3A 3UT5B 4ZKIA 3I55V 1R3KC 2FKXA 1Y6XA 4FLXA 4PV1B 4F6RB 1XILA 4O4HA 2QWQB 1YXBA 3M8AA 2YIBA 3CCRV 1F51A 4JGSA 5LL6Y 5FLXN 2IM9A 1XMQO 1AI4A 2L6LA 1R6TA 3HPLC 1HNZO 1QLEB 2E5LB 5GW7A 5LP6A 5LGNA 3FB5C 1H8EG 2ITDC 3L74H 1PNMA 2ARHA 3OD4A 2KQXA 1EN5A 2ADQB 2CGOA 1ORQC 4J7ZA 4IYIA 1VQPV 2JGDA 4OPAA 3FX7A 5AG2A 5LGUA 2A06H 2XOKG 4UUJC 5JWPA 4BIZA 2ZR3A 4TSFG 1K73W 3K59A 3SYCA 3WB1A 3E35A 1EN4A 1JCHA 1SQPH 1NZ6A 2OWOA 2JRIA 4O2AA 1GH6A 5GTIZ 3ABUA 4DK1A 3CCSV 2A9HA 4LF4B 2QGNA 4GYCB 5IYZB 5FPOA 2KKWA 5L3CA 1OV9A 1FJGB 1PM9A 4PA7A 5KAFZ 1W59A 2KG7A 1EFRG 3ZN0A 3TXSA 1Z5WA 1FXVA 2PYLA 3ZIAG 5LMNO 1PPJH 1N32B 3T1YO 3RGBA 5BMVA 2EINB 5JVDB 1NTMH 4EFEA 1OZ0A 3KG2A 1CP9A 1HNWB 4FLWA 2BTQA 3ZRVA 4RWUA 4PA4A 3SPCA 3CP1A 4ZHQB 3JASB 3EFFK 3CHXA 1ZLZA 4JI0O 1W2BU 3KKYA 3R65A 4LH6A 2P67A 2HHHB 3OGCC 1F23A 3E83A 3CCVV 2VQEB 3J7AU 3BY6A 5EBMC 3E2EA 5KHKA 2P4KA 1D5NA 3JYCA 4ZI7A 5LHHA 1I08A 2Q4PA 4HBNA 5KX5A 2QWOB 3ICXA 2CAZC 4HZ3A 4JTDB 5H5NA 3SDLA 2WLJA 4D7SA 2ODMA 4O4JB 3FB7C 1L0NH 1SQFA 3CC7V 3E8GA 3W7TA 2W6IG 3K5NA 4JI2B 1RSOB 4QE7A 1JFFA 2QWPB 4CH4A 1WLEA 4UV8A 4JI8B 1UFIA 1MABG 1QHTA 4K0KO 2RN9A 4JI7B 2CUGA 3ZRWB 1O9GA 1KUQA 1Q5OA 2M6YA 3SPHA 4O4IA 5FNVA 3RYCB 4NTWA 4NXMB 1I5YA 2QA4V 4J10A 4DV6O 2BOCC 5HFMA 4R8CA 1J5EB 2ZXWB 2AHYA 1HNXB 4I0XB 1COWG 1KP2A 2GV9A 1PL0A 1JVMA 1YJNV 3CSXA 5K1PA 3D36A 1N0JA 1WA8B 1LUVA 2PGGA 2V7QG 3OEEG 1R3LC 3D36C 3E22B 5J9PC 3B8MA 2A7WA 3JARA 2ZIOA 2FL4A 3H1JH 1KMIZ 3JSNA 4CC6A 4UCRA 3OT7A 1IBKO 1GAXA 1NJIW 2EZOA 4QPJA 3U0ZA 2GHYA 3FD9A 1Q43A 3E86A 5B1BC 4RQFA 3E89A 3I56V 3J81N 2EIKC 2HEPA 3UKMA 1XNRO 1K92A 4JV5O 5D5QA 4AILC 3SYQA 2HKOA 2JS3A 1GO3F 1YVWA 1OJHA 4F6EA 5C8YB 2UXBO 3X2QC 4LF7O 5IJ0B 4AQYO 1H2SB 1PL4A 3OE7G 2YDEA 2VWKA 4BR6A 1VARA 4UB8Z 4KXRA 2XAGA 2JK5C 3LSSA 3TETA 4X89A 2HVKC 4IYHA 4PDVA 1B6QA 4DRXB 2WWWA 4YJ2A 5LOVB 2WPDG 3ML0A 3QVNA 5JH7A 4WCEV 3HKDA 4GKJO 3BCCH 4TUYB 3T2MA 3ZHVA 1XI1A 3UQ8A 4DR7B 4DR3O 3SJBC 2RCVA 3BVOA 4FLTA 1CPYA 3AEIA 4IHJA 1VQLV 1IBLB 3HR0A 5EZYB 5ITZB 3OAAG 4B3RO 4X66B 1H2KA 2IH1C 3HKCA 3ZN1A 3K0GA 5KA5A 4O2BB 2XAQA 1OCZC 1YI2V 3WG7B 1EM1A 5CB4B 4UVCA 4NB5A 3U11A 3JSLA 1BCCH 3G67A 2ILMA 3D3IA 2WAMA 4MVZA 1BL8A 2GUZB 4LF9O 4DR5O 1YITV 2Q8VA 3ETQA 4JYBA 1H2MA 4JTCB 1AROP 1Y74B 2DQ0A 3Q4HA 2A3QA 4FM1A 5KAIZ 1VQKV 4DR6B 1ZSPA 3UT5A 1BT8A 3RBZA 3T1HB 2XT9A 5DM6V 4DV4O 2E74B 5LMUO 1M1KW 1V9PA 4U7OA 4WFAV 3F5WC 2D3OW 1ZTEA 4XBFA 4LFBB 1F7YA 1BGYH 1V55B 4WBNB 2LFRA 5K1XA 2JEUA 4X64B 1XHXA 3JD0A 3JCZA 1M5IA 4BWAA 1N33O 1Q7YW 1DF5A 4MTXA 5JQGB 4KHPO 1WN7A 1VQOV 1YTFD 4DV7B 4I55B 2JS5A 5DECA 1QLEC 2PF4E 1RFYA 5LGTA 2R9IA 1BHAA 1XMOB 3N27A 4YHHO 4XDKA 1I94B 2AXTZ 3BFRA 5LA6B 1TVKB 4X65O 3A0BZ 4DR4O 2V4DA 2V1DA 4H37A 2ITCC 3CJHB 4IL6Z 4NTYA 4RO2A 2P5OA 3CB2A 1VQ4V 4UVAA 2JEXA 1Y76B 2P22C 1WPXA 4UFZA 3PN1A 4OX9B 1DTOA 3IGAC 4UCUA 1SQGA 5B5EZ 5IYZA 3RYFA 1VQ6V 2X7RB 2X6AA 5H9CA 1YJWV 2UUAB 2WA4A 1AJPA 1NQTA 3E8HA 4GX5A 4UCVA 4NYKA 2QKCA 5EBWC 4QE9A 4JI4O 5H6QA 1GN2A 3JD2A 4K3AA 3VQWA 1YEWA 5JVDA 1ZAUA 4XDJA 3ETGA 2CE4A 3BRCA 3LUTB 1GN6A 3CXCU 1QQCA 2Y0IA 3QNEA 1MA1A 1Z5VA 2LGWA 4WFFA 1HW7A 2EINC 1S3JA 5IDJA 1VMGA 2PYJA 1Q8IA 3RW0A 3ETDA 2YXHA 3ZHSA 4ZHQA 4NR1A 1K3EA 1GM9A 2W6JG 3NXSA 4DK0A 2CK3G 1AP5A 4DUYO 2QWRB 3M7MX 2VQFB 1N34B 1NT2B 1VP7A 2N05A 5CA0B 1QU7A 1MG1A 2QWNB 1WB8A 2UXDB 3IC7A 1XQ8A 1FS0G 1FXHA 1RP3B 3KZIZ 1WJZA 4O4JA 5B3SB 2VWJA 4J9YB 3B4SA 1RSOA 1NTKH 1BS3A 3OUFA 4OXSA 1NVPB 1OCOB 1BZKA 5IY5B 4CH5A 1NH2B 3DC5A 5EK0A 1SQVH 1YF2A 2PY5A 2DYRB 3ZHRA 5L3EA 3OMNB 3CCLV 3OTFA 3RYCA 1YCIA 5TISZ 2CGNA 4PI2A 4TQDA 2GSMB 5JJEB 5LBQA 3BHPA 4LC1A 2DWEC 3P30A 4LF8B 2HG5C 4U3FH 2PUSA 1QVGU 3G6BA 3TJTA 1HNXO 3SJCC 2ZXWC 3APQA 3B2EE 3LSQA 1K4CC 4IGGA 4IIJB 3A8TA 2YIBD 1WA8A 2UU9O 2A79B 1SA0B 2DYSB 5GONB 1WP8A 2ZIMA 2Y4TA 3E22A 4W4LA 3JAKB 2UUCO 1RPRA 2YI9A 3C90A 1JOYA 3C3SA 3OMIB 2B5UA 2EILB 2GDSA 2OT5A 2Q68A 2HLDG 4LBEC 2ZD9A 3ZMSA 2QEXV 2EZPA 5L3DA 4ZOLB 3ABTA 3FYEB 2YS8A 4JI5B 1JJOA 3AK1A 2LQTA 1S5HC 1K97A 2K9PA 1GM7A 5EYPB 3W7XA 5A2QN 2GBOA 5H2FZ 1ZUQA 1KC8W 1GMGA 2CTPA 5LYJB 1D5AA 4J11A 1SZXA 5C8YA 1VF6A 1PV0A 5IJ0A 1N4CA 4GX2A 1VF6C 2BE3A 4ICGA 3W7SA 1THZA 1SZTA 5IJ9A 4X62O 4I9WA 4DUZO 3K06A 4GKKB 1QLNA 2DE0X 5LOVA 3O65A 1N8RW 4B7KA 1Q81W 1S5JA 4TUYA 4X88A 4YY3B 4RQEA 3HB3B 2Q7GA 2ZNJA 5BXZA 4Z2WA 4CH6A 2OIEA 3K79A 2F4VO 5J2TA 4R7CA 3AK3A 5EZYA 1MZEA 3QO8A 1S72V 4LF5O 2OYQA 4YXWG 4HNAB 3T4ZA 1K8AW 4O2BA 3SGIA 2HJFC 1NR7A 5CB4A 4G28B 4X1IB 2IBZH 2WLNA 4MVQA 2WLLB 1SESA 3K9AA 3WG7C 4B3MO 3EXAA 4TV8A 1M56B 4DR2O 2UUBO 4Q6GA 3AG7A 4PDRA 5CA1B 3K5OA 2GUZA 5LHIA 3CYOA 3LDEA 2B1GA 4LWSB 3F7VC 2M7WA 4KP4A 4JAUA 4DR6O 3TXQA 4LF6B 1P7BA 3CRAA 3W7WA 3CCJV 1OCCB 3K08A 4B3TB 3OMAB 5CMUA 4JAVA 1TUBA 5BR8B 3VBBA 1V55C 4C7UA 2CDYA 3STZC 5JQGA 2XAHA 4DV0B 3BPZA 4I55A 5LHGA 5CA3A 2EBOA 2BSKB 5EBLC 1QBZA 1TVKA 3RFRA 4AI8A 3ZMTA 1BHBA 3TK1A 3S3XA 2AGAA 5L3GA 4B3SB 3OTOO 3CJHA 3AG2B 2HJDA 4ZIBA 2WLIB 4K35A 2X6BA 3CXHF 5LXTB 3G80A 1Y76A 1HR0B 1XOUA 2LW1A 1U97A 4G2KA 4DV2O 2HP8A 4JZ2A 1XHZA 1IBMO 3A0RA 4U7NA 3L72H 4DV3B 5B1AB 4DR1O 4YJ3A 4BW9A 4BW5A 5CBHA 1RPOA 3VOUA 4DV1B 2C2AA 1E1QG 3H1IH 4DV5B 3B8NA 3EVKA 3CD6V 4LP8A 1XBLA 4UB6Z 3DGEA 1YIJV 1IZ3A 2RNBA 1YZBA 2AZ2A 2P4VA 5JJNB 1US6A 1FFTB 1N36O 3GB7C 1QNMA 2H94A 2ETNA 2FB5A 4JYAO 4G27B 4LFCO 1B06A 3FB8C 2FTKA 3P3PA 1SETA 1BQZA 1SS3A 2Q0AA 1GN4A 1M90W 1JA8A 2L35A 4FMTA 5CA0A 1N34O 3FAVB 3K5LA 1X59A 3RYIB 3VQVA 5GTHZ 2KB1A 2WLHA 4JI3B 3U10A 3JATB 2ZM6O 4TV9B 1YHQV 2UXDO 3CPWU 2CH7B 1WP7A 3ASOB 4P9PA 2EIMB 2Q5ZA 4JI6O 1AVMA 5B3SC 3RWRD 3UO2A 4DO2A 4NXNB 4ASUG 1A32A 3JALB 1K9MW 4OPHA 4P9OA 1OCOC 1S5LZ 5IWAO 2LJ2A 5IY5C 2YUAA 4MVOA 4J9ZB 2HR3A 1XUQA 2UXCO 2IJIA 2Z5UA 3L71H 1XMQB 2QKSA 2DYRC 4HAMA 1Q86W 2DWDC 3HKBB 1K34A 1Q82W 4HYOA 1R6KA 3SYPA 1HNZB 4LFAO 3HKEB 2P90A 1V54B 3CS5A 2K1EA 4X1KB 5LP6B 3QF7A 1YSCA 2QM4A 2F23A 4PA6A 3DTUB 4Z1MG 4IIJA 5J2UB 2VRZA 1P49A 4X1YA 5GONA 2JGDB 4B08A 4BAYA 1PNLA 2ZDIC 3AG1B 3FYIB 4FM2A 2G38A 3JAKA 4I50B 1WAZA 2DYSC 1DK1A 1BQ0A 1ROPA 1IURA 2EJRA 3WB0A 4RAIA 3OUSA 2GTSA 3G4SV 5L3BA 2FYUH 3S3WA 4I4TB 4BIOA 4O2AB 1FKAO 4ZOLA 2EILC 1H2LA 3CC4V 4X9QA 2N04A 4P2ZA 3SPIA 2RQ6A 3H9VA 3R66A 3ZMVA 4DXWA 4F6RA 1Q6UA 4GX0A 3WB2A 5LMNB 2PZSA 2Q7HA 1B04A 3T1YB 2YXYA 4MVSA 2WLMA 1IXMA 3K9SA 1ZWIC 3L9DA 3O9OA 2F95B 4GLXA 3K03A 1R6NA 5B1OA 4H33A 2AHZA 3H1HH 5E79Z 2E5LO 1FD9A 2QTOA 3TCUA 2PI4A 5D5PA 3JAMN 1S77D 3ABLB 2ZKOA 2JJ1G 2JVDA 3CCMV 4MSWC 4MVRA 1VQMV 1SF9A 1TGOA 1M93A 1WNSA 1WB7A 2BTOA 4NTXA 2P06A 3E8BA 4HNAA 4R50A 3FB6C 1JQ0A 4UVBA 4EB6B 1MMMA 2QE7G 2P7TC 4K0KB 4X20B 4LF4O 2DW4A 4MVUA 1GRJA 2D2CB 4X8AA 4AHCA 1ZX3A 4Z1VA 3CRMA 2WLLA 4FFBB 1S76D 5A9GA 1FJGO 3WFVA 3ZJZA 3QTCA 5CA1A 1F4NA 3C3TA 4O4IB 5FNVB 4NKGB 4DV6B 1M56C 2YSUB 1N32O 2Y0PA 4JYCA 2OTLV 3ZEDA 2QSAA 1HNWO 1M57B 2Y69B 1PD3A 3D3QA 3DC6A 1H8HG 2QJ1A 4IT5A 3JASA 2GTAA 2E75B 1QR9A 1L8DA 3K0DA 3IAYA 3KCYA 3STLC 3CWBH 1OCCC 2R9AA 1S0VA 4PA3A 1T5EA 3H1KH 4LH7A 1CEZA 3JARB 2HHHO 1JPXA 1G6UA 1IBKB 2VQEO 1BSMA 1J95A 1KP3A 4FIPC 2W0XA 2NLJC 3SJQC 3VQYA 1XEQA 2BSKA 1U96A 4JV5B 2ZNIA 3CMEV 1E79G 4LR3A 3ZHUA 3FKSG 4JI2O 4GCZA 1NS1A 1EBOA 4QIWF 2NR5A 2UXBB 2WLIA 5EIBD 4JI8O 2QDOA 3ZRWA 1VQNV 4R6ZA 5LXTA 1FYJA 4AQYB 4J80A 2ZE8A 4JI7O 3AG2C 1WPBA 2XAFA 3JD3A 1MNGA 1M4UA 1M9NA 1R1BA 1FFXB 2YI8A 3CE2A 5KHHA 4NXMO 3MAQA 4QGPA 3RYHB 1EN6A 2IH3C 4MW8A 1UPGA 1J5EO 4I0XA 4GKJB 1SERA 5B1AC 1KD1W 4TQFA 4K8ZA 2Q67A 3HKDB 1SQQH 3KCXA 2IJKA 5KHGA 4DR3B 1Q3EA 1NI8A 1XNQB 1SQXH 1P84F 4PHZA 4FLUA 1F4MA 5CN0A 4E2LA 3CEIA 1K4DC 2YEVB 1B3QA 2IJHA 4PJ0Z 4B3RB 1Y4MA 5H6RA 1NR1A 1DLBA 1LR1A 4H13B 3MHHC 4U3JB 4CZZA 5C93A 1AR1B 3HKCB 2XUMA 4J7KA 1GN3A 1KECA 4PDMA 3E8FA 4P30A 3OW2U 2LGQA 1KYOF 4JZGA 1HWYA 3GVMA 3FAVA 4I5SA 4LF9B 4DR5B 3RYIA 3UO3A 3JATA 3CCQV 2CH7A 3L75H 3AG3B 5EC1C 3MHSC 4MTGA 4FLVA 1KB9F 1R3JC 3Q4HB 4GUNA 2R72A 4QJFB 3ASOC 4PDLA 4DV4B 2EIMC 1BE3H 5LMUB 3M99B 5L3FA 3SPJA 4DRXA 2OCCB 2X0LA 2JJ2G 5JJJB 5KLVH 1AI5A 4WFGA 3UM7A 1P4RA 3FFQA 2UXXA 3GWOA 4MVMA 5FPRA 4PD4F 1BMFG 3OR7C 4CC5A 3HKBA 4Q20A 1N33B 4KHPB 3ZRSA 1QVFU 1QCEA 3HKEA 4DR7O 3BAAA 1NBMG 2CTWA 4JPRA 5EC2C 1G1XB 4X1KA 2XNDG 4D7TA 1TAEA 1D2DA 1V54C 5ITZA 4TT3G 4YHHB 1GTOA 3SYOA 1IBLO 4X65B 5LP6C 5J2UA 4DW0A 3SYAA 5IYBO 1OHHG 4DR4B 1L1FA 4O4LB 4X66O 4E4EA 3AG4B 1K7DA 3LNMB 4I50A 4RUFA 3AG1C 1ENVA 4UXNA 3W7UA 3BABA 3T4DA 2HFEC 4GX1A 4I4TA 3DSQA 4JI1B 3MDSA 3H1LH 2NN4A 3G71V 3OGIB 3ABKB 4DYLA 2W0FC 2OCHA 5KMGB 2Z0AA 2LP7A 1Y74A 2Q73A 3GWKC 3RYFB 3JAWB 3OEHG 3SPGA 1JMKC 1HP8A 2F93B 4JI4B 2JDIG 3CMAV 3T1HO 1YTFB 3F5TA 2RMKB 2MW2B 1HDJA 3JD1A 2ZCEA 3WU2Z 4WBNA 4LFBO 1URFA 3IJ4A 4X64O 3CCUV 2DMXA 1CXZB 2B9ZA 2O57A 3ASNB 5IE9A 2IU3A 1UJWB 4DV7O 3PJSK 1GKFA 1RM1B 4DUYB 5LA6A 2EJ7A 1XMOO 1I94O 1KKCA 4QNHB 2QM7A 3ABLC 3ZHTA 4YIOA 2QR4A 3DXRB 1AI7A 1ZL8B 3IFXA 2UXNA 2ZE5A 4FM0A 1VQ5V 4EB6A 2ZE7A 4EEQA 3D8CA 1YDXA 4OX9O 4MTOA 3T1CA 2YIDA 3ABMB 4X20A 1W0KG 3JCUZ 5BZBA 2Q6AA 3CRRA 4FFBA 4MW3A 2VS0A 2EIJB 4WFHA 1PP9H 2UUAO 3N2KB 3EHBB 1R73A 2LW7A 3THOA 2ZQMA 2AZ0A 2ATKC 1NVPD 4N21A 1SKVA 3B09A 1VQ8V 1Q6IA 1NU1H 3BEHA 1NH2D 1L0LH 4J41A 5KA6A 2F66C 4FPPA 1OCRB 2UU9B 1FXKB 4ABMA 2Y48A 2DOSA 4LNUB 4RUEA 1M57C 1PNKA 1GM8A 4MS2A 2UUCB 4CS2A 2Y69C 3LSUA 1MOFA 3ZHQA 2YICA 2YIAA 3VQXA 1XREA 1AI6A 2VQFO 1MSDA 3F7YC 4CS4A 1AILA 2Q7EA 1K33A 3N2GB 5DN6G 1TUEB 3TGUH 1KBHA 1JX9A 2FMLA 4WFBV 4XDLA 4PELA 1H2NA 2HVJC 1AR4A 1H2GA 2P6JA 4JYYA 3CC2V 5KUMA 1VQ9V 5IT9N 3RT3C 1IDSA 4O4HB 3UCSC 1VF7A 3APOA 4X62B 4PI0A 1W0JG 5DEDA 1FFXA 1VEWA 4DUZB 5IJ9B 2BOBC 4QPKA 2F1MA 1IX9A 3RYHA 3RN4A 4TOIA 2YXLA 2DQ3A 2AW9A 4LF8O 5KHIA 3QO5A 2XTAA 2OTJV 2WSSG 1KQSU 2R9RB 2DN9A 1SRYA 3BA8A 4L87A 2H3OA 2ZDIA 1SA0A 5BY1A 4PA9A 3J80N 2ZE6A 2F4VB 1XNQO 2IU0A 1AP6A 2YEVA 1FAFA 2ZT9B 5J2TB 5FL7G 3LDCA 4H0LB 4LF5B 5E1AC 3K3WA 2R70A 1VIBA 2WLKA 1LNQA 2Y4UA 1IXBA 1XL6A 4U3JA 5IYDO 3P32A 5CBGA 3K57A 2YC0A 4MT8A 1EZVH 4JI5O 4EKWA 4B3MB 1DF4A 2RJZA 5EYPA 2UUBB 4DR2B 3G6EV 3L70H 1JR9A 5LYJA 4TV8B 2E3CA 2KG7B 1DGSA 3CRCA 1Z2GA 1AB3A 3JD4A 1JJ2U 2JIZG 4ZBMA 1SC5B 4J7JA 5BMVB 4N23A 3AG3C 1NKDA 2BTQB 2PTMA 3MD0A 3ZRXA 4GKKO 1AR5A 4JI0B 2OCCC 2Z3YA 2X6CA 3L73H 1O9HA 4OGQB 4FVMA 1G4YB 4KFMA 4YY3O 1MSWD 5KUKA 4W4KA 1TUBB 4I7ZB 2F43G 2B1IA 5IYCO 4UV9A 2NNUA 4ZI7B 1PKXA 2DJVA 3CRQA 4H44B 1VF5B 5KX5B 4FLZA 2XHBA 4L8JA 2ADPA 3CX5F 3H01A 2N74A 4J42A 4O4LA 4WFEA 4F4LA 4FLYA 3OTOB 1JFFB 4X1IA 4B7EA 3AG4C 4BIUA 4JASA 3NR7A 4FZ1A 4DV2B 1G8MA 3RVYA 1N0NA 2LFSA 1IBMB 1X4TA 1TA8A 5JCOA 1NTZH 2E76B 4JI1O 4GZRB 4FZ0A 3B77A 5KMGA 4LWSA 4DR1B 4CS3A 5JCOC 1XL4A 3ABKC 2A0LA 4YJ3B 1Q6HA 3JAWA 2QM8A 2EX3A 3RVZA 4WF9V 4JTAB 5B1NA 1SQBH 3ZCCA 4LF6O 3K04A 3OFNG 3K5MA 4FFKA 1Y66A 1Q90D 1K5QA 4B3TO 2KSDA 4JAAA 1N36B 1IVSA 4UCTA 5BR8O 4JYAB 4LFCB 3QO7A 2OIGA 3LNNA 5B1BB 1I7FA 4I9QA 2Q9LA 1QR8A 2JGUA 4DV0O 2BCCH 5CBFA 2EIKB 5F2VO 3ASNC 4D6TH 1H38A 1P7GA 1XNRB 4TWKA 2QTSA 3OM3B 3QG5A 2RDCA 1AJNA 1LUWA 4GT1A 4FJCC 1EZJA 1RM1C 2WA3A 3X2QB 3OR6C 4UCSA 4MTFA 4CH3A 3DXRA 4FK5C 2ZM6B 5KHJA 4B3SO 2Q0OC 3SJAC 4LF7B 4CBCA 1ZL8A 1R3IC 2XAJA 3ZX6A 2IW5A 4JI6B 1HR0O 4LCUC 2H8PC 1XDCA 2IJJA 3K58A 5IWAB 4DV3O 3ABMC 2UXCB 3IC9A 1E1RG 4YJ2B 3N2KA 5JH7B 3ZMZA 4DV1O 2EIJC 2XASA 4LFAB 3A2FA 3ZBHA 2CTQA 4DV5O 3ETEA 1MZFA 5HFLA 4KUMA 4YIPA 4K8XA 2LO1A 4IHJB 4DW1A 1KKDA 2EULA 4EFBA 1Y67A 2ZINA 2CTRA 1FXKA 2ZR2A 1OCZB
chains in the Genus database with same CATH topology
1VQ4V 4UVAA 2JEXA 1YJ9V 1OCRC 1K9MW 1WPXA 2PI5A 1FXKC 4P9OA 1OCOC 2MK3A 3CCUV 5IY5C 4MVOA 4J9ZB 2HR3A 1GK9A 3ZMUA 3ASNB 3CCEV 1DTOA 1K5SA 3IGAC 2IU3A 2IJIA 2Z5UA 1UJWB 2QKSA 1VQ6V 2DYRC 2X7RB 4HAMA 1AJQA 2DWDC 1K34A 3PJSK 2X6AA 5H9CA 1GKFA 4HYOA 1YJWV 1Q82W 1R6KA 3SYPA 1AJPA 1NQTA 3E8HA 1RM1B 4GX5A 2P90A 1V54B 2K1EA 1I5XA 2Q69A 3LDDA 1YSCA 5EBWC 4QE9A 4QNHB 2QM7A 5H6QA 3ABLC 3JD2A 4PA6A 3DTUB 4Z1MG 1AI7A 1VQ7V 4XDJA 3ETGA 3LUTB 3IFXA 4JF3A 2UXNA 4ZKIA 3CXCU 3QNEA 3I55V 1R3KC 4WFFA 1PNLA 4BAYA 1VQ5V 2EINC 2ZDIC 3AG1B 3FYIB 1S3JA 5IDJA 2DYSC 1ROPA 2EJRA 3RW0A 3ETDA 4MTOA 3T1CA 3ABMB 3CCRV 4RAIA 1F51A 3OUSA 1W0KG 4JGSA 3G4SV 1K3EA 5BZBA 1GM9A 5L3BA 2Q6AA 2W6JG 3NXSA 4MW3A 1AI4A 2EIJB 4WFHA 2CK3G 2EILC 3HPLC 1QLEB 5GW7A 3CC4V 3EHBB 1R73A 5LGNA 3FB5C 1H8EG 2ZQMA 2ITDC 4P2ZA 1PNMA 2ATKC 1MG1A 3SPIA 1NVPD 4N21A 3IC7A 1FS0G 1FXHA 1ORQC 1VQ8V 1VQPV 3ZMVA 5B3SB 3BEHA 5LGUA 4J9YB 1NH2D 2XOKG 4UUJC 4DXWA 5KA6A 4BIZA 4GX0A 2ZR3A 4TSFG 4FPPA 1OCRB 1K73W 4MVSA 3SYCA 3E35A 3OUFA 4OXSA 1NVPB 1FXKB 1OCOB 1JCHA 2Y48A 5IY5B 4RUEA 1M57C 1PNKA 2WLMA 1IXMA 1NH2B 1GM8A 4MS2A 5EK0A 1ZWIC 2Y69C 3K03A 1MOFA 1R6NA 3ABUA 5B1OA 3CCSV 2DYRB 4H33A 3OMNB 5L3EA 2A9HA 3CCLV 2AHZA 1AI6A 2QTOA 5L3CA 2GSMB 3TCUA 5LBQA 3F7YC 2PI4A 4PA7A 1K33A 4LC1A 2DWEC 3P30A 5DN6G 1TUEB 1S77D 3ABLB 1EFRG 2HG5C 3ZN0A 2JJ1G 1QVGU 3CCMV 1JX9A 4MSWC 4MVRA 4WFBV 4XDLA 4PELA 1VQMV 1FXVA 2HVJC 2ZXWC 3LSQA 1K4CC 3ZIAG 2EINB 1H2GA 2A79B 2P6JA 1OZ0A 3KG2A 2DYSB 3CC2V 3E8BA 5KUMA 1CP9A 1VQ9V 4R50A 3FB6C 1JQ0A 3ZRVA 4UVBA 1RPRA 2QE7G 4PA4A 1JOYA 3SPCA 2P7TC 3OMIB 1W0JG 3CP1A 2B5UA 2EILB 3EFFK 2DW4A 2BOBC 4MVUA 4X8AA 2OT5A 4QPKA 1W2BU 2Q68A 2WLLA 3R65A 2HLDG 4LBEC 2ZD9A 3ZMSA 2QEXV 1S76D 2EZPA 5L3DA 2P67A 3ABTA 3WFVA 3FYEB 3ZJZA 2DQ3A 3OGCC 1F23A 1F4NA 3E83A 3CCVV 3QO5A 3BY6A 5EBMC 3E2EA 2OTJV 1S5HC 2WSSG 1M56C 2R9RB 3JYCA 5LHHA 1KQSU 1SRYA 1K97A 2YSUB 4L87A 1GM7A 3W7XA 2ZDIA 4HZ3A 4JTDB 2WLJA 1GMGA 4PA9A 1KC8W 3FB7C 4JYCA 3CC7V 2IU0A 2OTLV 3E8GA 3W7TA 2YEVA 2W6IG 1M57B 4GX2A 5FL7G 3LDCA 4QE7A 1WLEA 2Y69B 1PD3A 4UV8A 3W7SA 1H8HG 1THZA 1SZTA 5E1AC 3K3WA 4I9WA 1MABG 1LNQA 2WLKA 1QR9A 1XL6A 3K0DA 5IYDO 3ZRWB 3P32A 3STLC 5CBGA 1OCCC 3K06A 1S0VA 4PA3A 4MT8A 3SPHA 1QLNA 1CEZA 1JPXA 1N8RW 1I5YA 1Q81W 4EKWA 4X88A 2QA4V 1DF4A 4RQEA 2BOCC 1J95A 3HB3B 1KP3A 4FIPC 5HFMA 3G6EV 4R8CA 2NLJC 2ZXWB 3SJQC 2AHYA 1COWG 3K79A 3CMEV 1E79G 1KP2A 3JD4A 1JJ2U 1PL0A 1JVMA 2JIZG 4ZBMA 3FKSG 4R7CA 1YJNV 3D36A 4GCZA 4N23A 1EBOA 4QIWF 3AG3C 3QO8A 1S72V 2WLIA 2V7QG 4YXWG 3OEEG 3ZRWA 1VQNV 4R6ZA 1R3LC 1NKDA 3T4ZA 1K8AW 3AG2C 3MD0A 3ZRXA 5J9PC 3B8MA 2XAFA 3JD3A 1M9NA 2HJFC 1NR7A 4G28B 2OCCC 2Z3YA 2WLNA 4MVQA 2X6CA 2WLLB 1SESA 1NJIW 3K9AA 2EZOA 4QPJA 3WG7C 1G4YB 2GHYA 4KFMA 1MSWD 2IH3C 5KUKA 3E86A 1M56B 4MW8A 5B1BC 4RQFA 3E89A 4PDRA 2F43G 3I56V 2B1IA 5IYCO 2EIKC 5LHIA 3UKMA 1SERA 1K92A 4UV9A 5B1AC 3CYOA 1KD1W 2NNUA 2Q67A 3LDEA 1PKXA 3SYQA 2B1GA 2IJKA 2HKOA 3F7VC 1GO3F 1F4MA 2M7WA 5CN0A 4E2LA 4KP4A 1K4DC 3X2QC 3H01A 2YEVB 4JAUA 4WFEA 4F4LA 3OE7G 2IJHA 1P7BA 1Y4MA 3W7WA 3CCJV 1OCCB 3K08A 5H6RA 3AG4C 1NR1A 3OMAB 5CMUA 1DLBA 2XAGA 4BIUA 2JK5C 4JAVA 3MHHC 3LSSA 4JASA 4CZZA 5C93A 3TETA 4X89A 1G8MA 3RVYA 1AR1B 2HVKC 4PDVA 3VBBA 1B6QA 2LFSA 1KECA 1V55C 2WWWA 3E8FA 4P30A 4PDMA 3OW2U 3STZC 1HWYA 2WPDG 2XAHA 3ML0A 4WCEV 3B77A 3T2MA 5LHGA 5CA3A 1XL4A 3ABKC 2A0LA 4I5SA 2EBOA 2QM8A 5EBLC 3CCQV 1QBZA 3RVZA 1CPYA 1BHBA 3AEIA 3ZMTA 3AG3B 5EC1C 4WF9V 3TK1A 4JTAB 5B1NA 3MHSC 4MTGA 5L3GA 1VQLV 3ZCCA 1R3JC 3K04A 3OFNG 3AG2B 3OAAG 4QJFB 3ASOC 1Y66A 2WLIB 4PDLA 2EIMC 1K5QA 2X6BA 2IH1C 3M99B 3ZN1A 3K0GA 5KA5A 5L3FA 3SPJA 4G2KA 2OCCB 2XAQA 1OCZC 1YI2V 2X0LA 2JJ2G 3WG7B 1AI5A 4WFGA 3QO7A 3UM7A 1P4RA 3A0RA 4U7NA 4UVCA 2UXXA 3GWOA 5B1BB 4MVMA 1QR8A 1BMFG 5CBFA 2EIKB 3OR7C 3ASNC 5B1AB 1H38A 3D3IA 2WAMA 4Q20A 4MVZA 4BW5A 3ZRSA 4TWKA 5CBHA 1QVFU 3OM3B 1BL8A 1QCEA 1RPOA 4GT1A 1AJNA 3VOUA 1NBMG 4JPRA 5EC2C 2C2AA 1YITV 1E1QG 4FJCC 2XNDG 1EZJA 4JYBA 1RM1C 4JTCB 3B8NA 1AROP 3X2QB 1V54C 2DQ0A 3OR6C 4LP8A 4MTFA 4TT3G 1GTOA 3SYOA 3CD6V 3DGEA 1YIJV 4FK5C 4CBCA 3SYAA 5IYBO 1VQKV 1OHHG 1R3IC 2XAJA 1L1FA 3RBZA 5DM6V 2IW5A 3AG4B 1FFTB 1M1KW 1K7DA 4U7OA 3LNMB 4WFAV 3F5WC 4LCUC 2D3OW 2H8PC 1Q86W 4XBFA 4RUFA 3GB7C 2H94A 4G27B 1V55B 3AG1C 1ENVA 2IJJA 4UXNA 3W7UA 2LFRA 2JEUA 3FB8C 3T4DA 2FTKA 1SETA 2HFEC 4GX1A 3JD0A 3JCZA 3ABMC 4ASUG 1E1RG 1Q7YW 3G71V 1DF5A 4MTXA 1M90W 3ABKB 2W0FC 1VQOV 1YTFD 3ZMZA 2EIJC 2LP7A 4FMTA 2XASA 1QLEC 5LGTA 2R9IA 1BHAA 3ETEA 4XDKA 4KUMA 5HFLA 2KB1A 2WLHA 3OEHG 1YHQV 3SPGA 3CPWU 2JDIG 1KKDA 3ASOB 3CMAV 4P9PA 2V1DA 1YTFB 2EIMB 4H37A 2ITCC 5B3SC 3JD1A 4DO2A 1FXKA 2ZR2A 1OCZB 4RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIP C;  1QR8 A;  3B8M A;  3WFV A;  5HFM A;  2P6J A;  1I5X A;  2LP7 A;  3MHS C;  1F23 A;  4JGS A;  1SZT A;  5KA6 A;  2MK3 A;  2M7W A;  1JQ0 A;  1QCE A;  1QR9 A;  5CN0 A;  4E2L A;  1Y66 A;  5HFL A;  3H01 A;  1K33 A;  4JPR A;  3B77 A;  3P30 A;  1ENV A;  2EZO A;  3K9A A;  3M99 B;  4FJC C;  4JF3 A;  5KA5 A;  4G2K A;  4N23 A;  1EBO A;  3B8N A;  3CP1 A;  1JPX A;  1Y4M A;  2EBO A;  2X7R B;  1K34 A;  1MG1 A;  4FK5 C;  2OT5 A;  5H9C A;  1I5Y A;  3CYO A;  1QBZ A;  5CMU A;  1DF5 A;  1DLB A;  1DF4 A;  3GWO A;  1MOF A;  4N21 A;  3MHH C;  2EZP A; 
#chains in the Genus database with same CATH topology
 1I0H A;  3A0H Z;  4LNU A;  5B66 Z;  1YJ9 V;  1FPO A;  1OCR C;  3AK2 A;  4X1Y B;  4UCO A;  2PI5 A;  1FXK C;  2QKA A;  4A5U B;  2MK3 A;  3ZMU A;  1GK9 A;  3CCE V;  1KU9 A;  1K5S A;  3P3N A;  3SR2 C;  1AJQ A;  3N2G A;  3I5D A;  4TV9 A;  5EIB C;  4JI3 O;  1I5X A;  3BA9 A;  2Q69 A;  3LDD A;  4NVP A;  3ZS8 C;  1VQ7 V;  4KL1 A;  4NXN O;  3B40 A;  3JAL A;  4JF3 A;  3UT5 B;  4ZKI A;  3I55 V;  1R3K C;  2FKX A;  1Y6X A;  4FLX A;  4PV1 B;  4F6R B;  1XIL A;  4O4H A;  2QWQ B;  1YXB A;  3M8A A;  2YIB A;  3CCR V;  1F51 A;  4JGS A;  5LL6 Y;  5FLX N;  2IM9 A;  1XMQ O;  1AI4 A;  2L6L A;  1R6T A;  3HPL C;  1HNZ O;  1QLE B;  2E5L B;  5GW7 A;  5LP6 A;  5LGN A;  3FB5 C;  1H8E G;  2ITD C;  3L74 H;  1PNM A;  2ARH A;  3OD4 A;  2KQX A;  1EN5 A;  2ADQ B;  2CGO A;  1ORQ C;  4J7Z A;  4IYI A;  1VQP V;  2JGD A;  4OPA A;  3FX7 A;  5AG2 A;  5LGU A;  2A06 H;  2XOK G;  4UUJ C;  5JWP A;  4BIZ A;  2ZR3 A;  4TSF G;  1K73 W;  3K59 A;  3SYC A;  3WB1 A;  3E35 A;  1EN4 A;  1JCH A;  1SQP H;  1NZ6 A;  2OWO A;  2JRI A;  4O2A A;  1GH6 A;  5GTI Z;  3ABU A;  4DK1 A;  3CCS V;  2A9H A;  4LF4 B;  2QGN A;  4GYC B;  5IYZ B;  5FPO A;  2KKW A;  5L3C A;  1OV9 A;  1FJG B;  1PM9 A;  4PA7 A;  5KAF Z;  1W59 A;  2KG7 A;  1EFR G;  3ZN0 A;  3TXS A;  1Z5W A;  1FXV A;  2PYL A;  3ZIA G;  5LMN O;  1PPJ H;  1N32 B;  3T1Y O;  3RGB A;  5BMV A;  2EIN B;  5JVD B;  1NTM H;  4EFE A;  1OZ0 A;  3KG2 A;  1CP9 A;  1HNW B;  4FLW A;  2BTQ A;  3ZRV A;  4RWU A;  4PA4 A;  3SPC A;  3CP1 A;  4ZHQ B;  3JAS B;  3EFF K;  3CHX A;  1ZLZ A;  4JI0 O;  1W2B U;  3KKY A;  3R65 A;  4LH6 A;  2P67 A;  2HHH B;  3OGC C;  1F23 A;  3E83 A;  3CCV V;  2VQE B;  3J7A U;  3BY6 A;  5EBM C;  3E2E A;  5KHK A;  2P4K A;  1D5N A;  3JYC A;  4ZI7 A;  5LHH A;  1I08 A;  2Q4P A;  4HBN A;  5KX5 A;  2QWO B;  3ICX A;  2CAZ C;  4HZ3 A;  4JTD B;  5H5N A;  3SDL A;  2WLJ A;  4D7S A;  2ODM A;  4O4J B;  3FB7 C;  1L0N H;  1SQF A;  3CC7 V;  3E8G A;  3W7T A;  2W6I G;  3K5N A;  4JI2 B;  1RSO B;  4QE7 A;  1JFF A;  2QWP B;  4CH4 A;  1WLE A;  4UV8 A;  4JI8 B;  1UFI A;  1MAB G;  1QHT A;  4K0K O;  2RN9 A;  4JI7 B;  2CUG A;  3ZRW B;  1O9G A;  1KUQ A;  1Q5O A;  2M6Y A;  3SPH A;  4O4I A;  5FNV A;  3RYC B;  4NTW A;  4NXM B;  1I5Y A;  2QA4 V;  4J10 A;  4DV6 O;  2BOC C;  5HFM A;  4R8C A;  1J5E B;  2ZXW B;  2AHY A;  1HNX B;  4I0X B;  1COW G;  1KP2 A;  2GV9 A;  1PL0 A;  1JVM A;  1YJN V;  3CSX A;  5K1P A;  3D36 A;  1N0J A;  1WA8 B;  1LUV A;  2PGG A;  2V7Q G;  3OEE G;  1R3L C;  3D36 C;  3E22 B;  5J9P C;  3B8M A;  2A7W A;  3JAR A;  2ZIO A;  2FL4 A;  3H1J H;  1KMI Z;  3JSN A;  4CC6 A;  4UCR A;  3OT7 A;  1IBK O;  1GAX A;  1NJI W;  2EZO A;  4QPJ A;  3U0Z A;  2GHY A;  3FD9 A;  1Q43 A;  3E86 A;  5B1B C;  4RQF A;  3E89 A;  3I56 V;  3J81 N;  2EIK C;  2HEP A;  3UKM A;  1XNR O;  1K92 A;  4JV5 O;  5D5Q A;  4AIL C;  3SYQ A;  2HKO A;  2JS3 A;  1GO3 F;  1YVW A;  1OJH A;  4F6E A;  5C8Y B;  2UXB O;  3X2Q C;  4LF7 O;  5IJ0 B;  4AQY O;  1H2S B;  1PL4 A;  3OE7 G;  2YDE A;  2VWK A;  4BR6 A;  1VAR A;  4UB8 Z;  4KXR A;  2XAG A;  2JK5 C;  3LSS A;  3TET A;  4X89 A;  2HVK C;  4IYH A;  4PDV A;  1B6Q A;  4DRX B;  2WWW A;  4YJ2 A;  5LOV B;  2WPD G;  3ML0 A;  3QVN A;  5JH7 A;  4WCE V;  3HKD A;  4GKJ O;  3BCC H;  4TUY B;  3T2M A;  3ZHV A;  1XI1 A;  3UQ8 A;  4DR7 B;  4DR3 O;  3SJB C;  2RCV A;  3BVO A;  4FLT A;  1CPY A;  3AEI A;  4IHJ A;  1VQL V;  1IBL B;  3HR0 A;  5EZY B;  5ITZ B;  3OAA G;  4B3R O;  4X66 B;  1H2K A;  2IH1 C;  3HKC A;  3ZN1 A;  3K0G A;  5KA5 A;  4O2B B;  2XAQ A;  1OCZ C;  1YI2 V;  3WG7 B;  1EM1 A;  5CB4 B;  4UVC A;  4NB5 A;  3U11 A;  3JSL A;  1BCC H;  3G67 A;  2ILM A;  3D3I A;  2WAM A;  4MVZ A;  1BL8 A;  2GUZ B;  4LF9 O;  4DR5 O;  1YIT V;  2Q8V A;  3ETQ A;  4JYB A;  1H2M A;  4JTC B;  1ARO P;  1Y74 B;  2DQ0 A;  3Q4H A;  2A3Q A;  4FM1 A;  5KAI Z;  1VQK V;  4DR6 B;  1ZSP A;  3UT5 A;  1BT8 A;  3RBZ A;  3T1H B;  2XT9 A;  5DM6 V;  4DV4 O;  2E74 B;  5LMU O;  1M1K W;  1V9P A;  4U7O A;  4WFA V;  3F5W C;  2D3O W;  1ZTE A;  4XBF A;  4LFB B;  1F7Y A;  1BGY H;  1V55 B;  4WBN B;  2LFR A;  5K1X A;  2JEU A;  4X64 B;  1XHX A;  3JD0 A;  3JCZ A;  1M5I A;  4BWA A;  1N33 O;  1Q7Y W;  1DF5 A;  4MTX A;  5JQG B;  4KHP O;  1WN7 A;  1VQO V;  1YTF D;  4DV7 B;  4I55 B;  2JS5 A;  5DEC A;  1QLE C;  2PF4 E;  1RFY A;  5LGT A;  2R9I A;  1BHA A;  1XMO B;  3N27 A;  4YHH O;  4XDK A;  1I94 B;  2AXT Z;  3BFR A;  5LA6 B;  1TVK B;  4X65 O;  3A0B Z;  4DR4 O;  2V4D A;  2V1D A;  4H37 A;  2ITC C;  3CJH B;  4IL6 Z;  4NTY A;  4RO2 A;  2P5O A;  3CB2 A;  1VQ4 V;  4UVA A;  2JEX A;  1Y76 B;  2P22 C;  1WPX A;  4UFZ A;  3PN1 A;  4OX9 B;  1DTO A;  3IGA C;  4UCU A;  1SQG A;  5B5E Z;  5IYZ A;  3RYF A;  1VQ6 V;  2X7R B;  2X6A A;  5H9C A;  1YJW V;  2UUA B;  2WA4 A;  1AJP A;  1NQT A;  3E8H A;  4GX5 A;  4UCV A;  4NYK A;  2QKC A;  5EBW C;  4QE9 A;  4JI4 O;  5H6Q A;  1GN2 A;  3JD2 A;  4K3A A;  3VQW A;  1YEW A;  5JVD A;  1ZAU A;  4XDJ A;  3ETG A;  2CE4 A;  3BRC A;  3LUT B;  1GN6 A;  3CXC U;  1QQC A;  2Y0I A;  3QNE A;  1MA1 A;  1Z5V A;  2LGW A;  4WFF A;  1HW7 A;  2EIN C;  1S3J A;  5IDJ A;  1VMG A;  2PYJ A;  1Q8I A;  3RW0 A;  3ETD A;  2YXH A;  3ZHS A;  4ZHQ A;  4NR1 A;  1K3E A;  1GM9 A;  2W6J G;  3NXS A;  4DK0 A;  2CK3 G;  1AP5 A;  4DUY O;  2QWR B;  3M7M X;  2VQF B;  1N34 B;  1NT2 B;  1VP7 A;  2N05 A;  5CA0 B;  1QU7 A;  1MG1 A;  2QWN B;  1WB8 A;  2UXD B;  3IC7 A;  1XQ8 A;  1FS0 G;  1FXH A;  1RP3 B;  3KZI Z;  1WJZ A;  4O4J A;  5B3S B;  2VWJ A;  4J9Y B;  3B4S A;  1RSO A;  1NTK H;  1BS3 A;  3OUF A;  4OXS A;  1NVP B;  1OCO B;  1BZK A;  5IY5 B;  4CH5 A;  1NH2 B;  3DC5 A;  5EK0 A;  1SQV H;  1YF2 A;  2PY5 A;  2DYR B;  3ZHR A;  5L3E A;  3OMN B;  3CCL V;  3OTF A;  3RYC A;  1YCI A;  5TIS Z;  2CGN A;  4PI2 A;  4TQD A;  2GSM B;  5JJE B;  5LBQ A;  3BHP A;  4LC1 A;  2DWE C;  3P30 A;  4LF8 B;  2HG5 C;  4U3F H;  2PUS A;  1QVG U;  3G6B A;  3TJT A;  1HNX O;  3SJC C;  2ZXW C;  3APQ A;  3B2E E;  3LSQ A;  1K4C C;  4IGG A;  4IIJ B;  3A8T A;  2YIB D;  1WA8 A;  2UU9 O;  2A79 B;  1SA0 B;  2DYS B;  5GON B;  1WP8 A;  2ZIM A;  2Y4T A;  3E22 A;  4W4L A;  3JAK B;  2UUC O;  1RPR A;  2YI9 A;  3C90 A;  1JOY A;  3C3S A;  3OMI B;  2B5U A;  2EIL B;  2GDS A;  2OT5 A;  2Q68 A;  2HLD G;  4LBE C;  2ZD9 A;  3ZMS A;  2QEX V;  2EZP A;  5L3D A;  4ZOL B;  3ABT A;  3FYE B;  2YS8 A;  4JI5 B;  1JJO A;  3AK1 A;  2LQT A;  1S5H C;  1K97 A;  2K9P A;  1GM7 A;  5EYP B;  3W7X A;  5A2Q N;  2GBO A;  5H2F Z;  1ZUQ A;  1KC8 W;  1GMG A;  2CTP A;  5LYJ B;  1D5A A;  4J11 A;  1SZX A;  5C8Y A;  1VF6 A;  1PV0 A;  5IJ0 A;  1N4C A;  4GX2 A;  1VF6 C;  2BE3 A;  4ICG A;  3W7S A;  1THZ A;  1SZT A;  5IJ9 A;  4X62 O;  4I9W A;  4DUZ O;  3K06 A;  4GKK B;  1QLN A;  2DE0 X;  5LOV A;  3O65 A;  1N8R W;  4B7K A;  1Q81 W;  1S5J A;  4TUY A;  4X88 A;  4YY3 B;  4RQE A;  3HB3 B;  2Q7G A;  2ZNJ A;  5BXZ A;  4Z2W A;  4CH6 A;  2OIE A;  3K79 A;  2F4V O;  5J2T A;  4R7C A;  3AK3 A;  5EZY A;  1MZE A;  3QO8 A;  1S72 V;  4LF5 O;  2OYQ A;  4YXW G;  4HNA B;  3T4Z A;  1K8A W;  4O2B A;  3SGI A;  2HJF C;  1NR7 A;  5CB4 A;  4G28 B;  4X1I B;  2IBZ H;  2WLN A;  4MVQ A;  2WLL B;  1SES A;  3K9A A;  3WG7 C;  4B3M O;  3EXA A;  4TV8 A;  1M56 B;  4DR2 O;  2UUB O;  4Q6G A;  3AG7 A;  4PDR A;  5CA1 B;  3K5O A;  2GUZ A;  5LHI A;  3CYO A;  3LDE A;  2B1G A;  4LWS B;  3F7V C;  2M7W A;  4KP4 A;  4JAU A;  4DR6 O;  3TXQ A;  4LF6 B;  1P7B A;  3CRA A;  3W7W A;  3CCJ V;  1OCC B;  3K08 A;  4B3T B;  3OMA B;  5CMU A;  4JAV A;  1TUB A;  5BR8 B;  3VBB A;  1V55 C;  4C7U A;  2CDY A;  3STZ C;  5JQG A;  2XAH A;  4DV0 B;  3BPZ A;  4I55 A;  5LHG A;  5CA3 A;  2EBO A;  2BSK B;  5EBL C;  1QBZ A;  1TVK A;  3RFR A;  4AI8 A;  3ZMT A;  1BHB A;  3TK1 A;  3S3X A;  2AGA A;  5L3G A;  4B3S B;  3OTO O;  3CJH A;  3AG2 B;  2HJD A;  4ZIB A;  2WLI B;  4K35 A;  2X6B A;  3CXH F;  5LXT B;  3G80 A;  1Y76 A;  1HR0 B;  1XOU A;  2LW1 A;  1U97 A;  4G2K A;  4DV2 O;  2HP8 A;  4JZ2 A;  1XHZ A;  1IBM O;  3A0R A;  4U7N A;  3L72 H;  4DV3 B;  5B1A B;  4DR1 O;  4YJ3 A;  4BW9 A;  4BW5 A;  5CBH A;  1RPO A;  3VOU A;  4DV1 B;  2C2A A;  1E1Q G;  3H1I H;  4DV5 B;  3B8N A;  3EVK A;  3CD6 V;  4LP8 A;  1XBL A;  4UB6 Z;  3DGE A;  1YIJ V;  1IZ3 A;  2RNB A;  1YZB A;  2AZ2 A;  2P4V A;  5JJN B;  1US6 A;  1FFT B;  1N36 O;  3GB7 C;  1QNM A;  2H94 A;  2ETN A;  2FB5 A;  4JYA O;  4G27 B;  4LFC O;  1B06 A;  3FB8 C;  2FTK A;  3P3P A;  1SET A;  1BQZ A;  1SS3 A;  2Q0A A;  1GN4 A;  1M90 W;  1JA8 A;  2L35 A;  4FMT A;  5CA0 A;  1N34 O;  3FAV B;  3K5L A;  1X59 A;  3RYI B;  3VQV A;  5GTH Z;  2KB1 A;  2WLH A;  4JI3 B;  3U10 A;  3JAT B;  2ZM6 O;  4TV9 B;  1YHQ V;  2UXD O;  3CPW U;  2CH7 B;  1WP7 A;  3ASO B;  4P9P A;  2EIM B;  2Q5Z A;  4JI6 O;  1AVM A;  5B3S C;  3RWR D;  3UO2 A;  4DO2 A;  4NXN B;  4ASU G;  1A32 A;  3JAL B;  1K9M W;  4OPH A;  4P9O A;  1OCO C;  1S5L Z;  5IWA O;  2LJ2 A;  5IY5 C;  2YUA A;  4MVO A;  4J9Z B;  2HR3 A;  1XUQ A;  2UXC O;  2IJI A;  2Z5U A;  3L71 H;  1XMQ B;  2QKS A;  2DYR C;  4HAM A;  1Q86 W;  2DWD C;  3HKB B;  1K34 A;  1Q82 W;  4HYO A;  1R6K A;  3SYP A;  1HNZ B;  4LFA O;  3HKE B;  2P90 A;  1V54 B;  3CS5 A;  2K1E A;  4X1K B;  5LP6 B;  3QF7 A;  1YSC A;  2QM4 A;  2F23 A;  4PA6 A;  3DTU B;  4Z1M G;  4IIJ A;  5J2U B;  2VRZ A;  1P49 A;  4X1Y A;  5GON A;  2JGD B;  4B08 A;  4BAY A;  1PNL A;  2ZDI C;  3AG1 B;  3FYI B;  4FM2 A;  2G38 A;  3JAK A;  4I50 B;  1WAZ A;  2DYS C;  1DK1 A;  1BQ0 A;  1ROP A;  1IUR A;  2EJR A;  3WB0 A;  4RAI A;  3OUS A;  2GTS A;  3G4S V;  5L3B A;  2FYU H;  3S3W A;  4I4T B;  4BIO A;  4O2A B;  1FKA O;  4ZOL A;  2EIL C;  1H2L A;  3CC4 V;  4X9Q A;  2N04 A;  4P2Z A;  3SPI A;  2RQ6 A;  3H9V A;  3R66 A;  3ZMV A;  4DXW A;  4F6R A;  1Q6U A;  4GX0 A;  3WB2 A;  5LMN B;  2PZS A;  2Q7H A;  1B04 A;  3T1Y B;  2YXY A;  4MVS A;  2WLM A;  1IXM A;  3K9S A;  1ZWI C;  3L9D A;  3O9O A;  2F95 B;  4GLX A;  3K03 A;  1R6N A;  5B1O A;  4H33 A;  2AHZ A;  3H1H H;  5E79 Z;  2E5L O;  1FD9 A;  2QTO A;  3TCU A;  2PI4 A;  5D5P A;  3JAM N;  1S77 D;  3ABL B;  2ZKO A;  2JJ1 G;  2JVD A;  3CCM V;  4MSW C;  4MVR A;  1VQM V;  1SF9 A;  1TGO A;  1M93 A;  1WNS A;  1WB7 A;  2BTO A;  4NTX A;  2P06 A;  3E8B A;  4HNA A;  4R50 A;  3FB6 C;  1JQ0 A;  4UVB A;  4EB6 B;  1MMM A;  2QE7 G;  2P7T C;  4K0K B;  4X20 B;  4LF4 O;  2DW4 A;  4MVU A;  1GRJ A;  2D2C B;  4X8A A;  4AHC A;  1ZX3 A;  4Z1V A;  3CRM A;  2WLL A;  4FFB B;  1S76 D;  5A9G A;  1FJG O;  3WFV A;  3ZJZ A;  3QTC A;  5CA1 A;  1F4N A;  3C3T A;  4O4I B;  5FNV B;  4NKG B;  4DV6 B;  1M56 C;  2YSU B;  1N32 O;  2Y0P A;  4JYC A;  2OTL V;  3ZED A;  2QSA A;  1HNW O;  1M57 B;  2Y69 B;  1PD3 A;  3D3Q A;  3DC6 A;  1H8H G;  2QJ1 A;  4IT5 A;  3JAS A;  2GTA A;  2E75 B;  1QR9 A;  1L8D A;  3K0D A;  3IAY A;  3KCY A;  3STL C;  3CWB H;  1OCC C;  2R9A A;  1S0V A;  4PA3 A;  1T5E A;  3H1K H;  4LH7 A;  1CEZ A;  3JAR B;  2HHH O;  1JPX A;  1G6U A;  1IBK B;  2VQE O;  1BSM A;  1J95 A;  1KP3 A;  4FIP C;  2W0X A;  2NLJ C;  3SJQ C;  3VQY A;  1XEQ A;  2BSK A;  1U96 A;  4JV5 B;  2ZNI A;  3CME V;  1E79 G;  4LR3 A;  3ZHU A;  3FKS G;  4JI2 O;  4GCZ A;  1NS1 A;  1EBO A;  4QIW F;  2NR5 A;  2UXB B;  2WLI A;  5EIB D;  4JI8 O;  2QDO A;  3ZRW A;  1VQN V;  4R6Z A;  5LXT A;  1FYJ A;  4AQY B;  4J80 A;  2ZE8 A;  4JI7 O;  3AG2 C;  1WPB A;  2XAF A;  3JD3 A;  1MNG A;  1M4U A;  1M9N A;  1R1B A;  1FFX B;  2YI8 A;  3CE2 A;  5KHH A;  4NXM O;  3MAQ A;  4QGP A;  3RYH B;  1EN6 A;  2IH3 C;  4MW8 A;  1UPG A;  1J5E O;  4I0X A;  4GKJ B;  1SER A;  5B1A C;  1KD1 W;  4TQF A;  4K8Z A;  2Q67 A;  3HKD B;  1SQQ H;  3KCX A;  2IJK A;  5KHG A;  4DR3 B;  1Q3E A;  1NI8 A;  1XNQ B;  1SQX H;  1P84 F;  4PHZ A;  4FLU A;  1F4M A;  5CN0 A;  4E2L A;  3CEI A;  1K4D C;  2YEV B;  1B3Q A;  2IJH A;  4PJ0 Z;  4B3R B;  1Y4M A;  5H6R A;  1NR1 A;  1DLB A;  1LR1 A;  4H13 B;  3MHH C;  4U3J B;  4CZZ A;  5C93 A;  1AR1 B;  3HKC B;  2XUM A;  4J7K A;  1GN3 A;  1KEC A;  4PDM A;  3E8F A;  4P30 A;  3OW2 U;  2LGQ A;  1KYO F;  4JZG A;  1HWY A;  3GVM A;  3FAV A;  4I5S A;  4LF9 B;  4DR5 B;  3RYI A;  3UO3 A;  3JAT A;  3CCQ V;  2CH7 A;  3L75 H;  3AG3 B;  5EC1 C;  3MHS C;  4MTG A;  4FLV A;  1KB9 F;  1R3J C;  3Q4H B;  4GUN A;  2R72 A;  4QJF B;  3ASO C;  4PDL A;  4DV4 B;  2EIM C;  1BE3 H;  5LMU B;  3M99 B;  5L3F A;  3SPJ A;  4DRX A;  2OCC B;  2X0L A;  2JJ2 G;  5JJJ B;  5KLV H;  1AI5 A;  4WFG A;  3UM7 A;  1P4R A;  3FFQ A;  2UXX A;  3GWO A;  4MVM A;  5FPR A;  4PD4 F;  1BMF G;  3OR7 C;  4CC5 A;  3HKB A;  4Q20 A;  1N33 B;  4KHP B;  3ZRS A;  1QVF U;  1QCE A;  3HKE A;  4DR7 O;  3BAA A;  1NBM G;  2CTW A;  4JPR A;  5EC2 C;  1G1X B;  4X1K A;  2XND G;  4D7T A;  1TAE A;  1D2D A;  1V54 C;  5ITZ A;  4TT3 G;  4YHH B;  1GTO A;  3SYO A;  1IBL O;  4X65 B;  5LP6 C;  5J2U A;  4DW0 A;  3SYA A;  5IYB O;  1OHH G;  4DR4 B;  1L1F A;  4O4L B;  4X66 O;  4E4E A;  3AG4 B;  1K7D A;  3LNM B;  4I50 A;  4RUF A;  3AG1 C;  1ENV A;  4UXN A;  3W7U A;  3BAB A;  3T4D A;  2HFE C;  4GX1 A;  4I4T A;  3DSQ A;  4JI1 B;  3MDS A;  3H1L H;  2NN4 A;  3G71 V;  3OGI B;  3ABK B;  4DYL A;  2W0F C;  2OCH A;  5KMG B;  2Z0A A;  2LP7 A;  1Y74 A;  2Q73 A;  3GWK C;  3RYF B;  3JAW B;  3OEH G;  3SPG A;  1JMK C;  1HP8 A;  2F93 B;  4JI4 B;  2JDI G;  3CMA V;  3T1H O;  1YTF B;  3F5T A;  2RMK B;  2MW2 B;  1HDJ A;  3JD1 A;  2ZCE A;  3WU2 Z;  4WBN A;  4LFB O;  1URF A;  3IJ4 A;  4X64 O;  3CCU V;  2DMX A;  1CXZ B;  2B9Z A;  2O57 A;  3ASN B;  5IE9 A;  2IU3 A;  1UJW B;  4DV7 O;  3PJS K;  1GKF A;  1RM1 B;  4DUY B;  5LA6 A;  2EJ7 A;  1XMO O;  1I94 O;  1KKC A;  4QNH B;  2QM7 A;  3ABL C;  3ZHT A;  4YIO A;  2QR4 A;  3DXR B;  1AI7 A;  1ZL8 B;  3IFX A;  2UXN A;  2ZE5 A;  4FM0 A;  1VQ5 V;  4EB6 A;  2ZE7 A;  4EEQ A;  3D8C A;  1YDX A;  4OX9 O;  4MTO A;  3T1C A;  2YID A;  3ABM B;  4X20 A;  1W0K G;  3JCU Z;  5BZB A;  2Q6A A;  3CRR A;  4FFB A;  4MW3 A;  2VS0 A;  2EIJ B;  4WFH A;  1PP9 H;  2UUA O;  3N2K B;  3EHB B;  1R73 A;  2LW7 A;  3THO A;  2ZQM A;  2AZ0 A;  2ATK C;  1NVP D;  4N21 A;  1SKV A;  3B09 A;  1VQ8 V;  1Q6I A;  1NU1 H;  3BEH A;  1NH2 D;  1L0L H;  4J41 A;  5KA6 A;  2F66 C;  4FPP A;  1OCR B;  2UU9 B;  1FXK B;  4ABM A;  2Y48 A;  2DOS A;  4LNU B;  4RUE A;  1M57 C;  1PNK A;  1GM8 A;  4MS2 A;  2UUC B;  4CS2 A;  2Y69 C;  3LSU A;  1MOF A;  3ZHQ A;  2YIC A;  2YIA A;  3VQX A;  1XRE A;  1AI6 A;  2VQF O;  1MSD A;  3F7Y C;  4CS4 A;  1AIL A;  2Q7E A;  1K33 A;  3N2G B;  5DN6 G;  1TUE B;  3TGU H;  1KBH A;  1JX9 A;  2FML A;  4WFB V;  4XDL A;  4PEL A;  1H2N A;  2HVJ C;  1AR4 A;  1H2G A;  2P6J A;  4JYY A;  3CC2 V;  5KUM A;  1VQ9 V;  5IT9 N;  3RT3 C;  1IDS A;  4O4H B;  3UCS C;  1VF7 A;  3APO A;  4X62 B;  4PI0 A;  1W0J G;  5DED A;  1FFX A;  1VEW A;  4DUZ B;  5IJ9 B;  2BOB C;  4QPK A;  2F1M A;  1IX9 A;  3RYH A;  3RN4 A;  4TOI A;  2YXL A;  2DQ3 A;  2AW9 A;  4LF8 O;  5KHI A;  3QO5 A;  2XTA A;  2OTJ V;  2WSS G;  1KQS U;  2R9R B;  2DN9 A;  1SRY A;  3BA8 A;  4L87 A;  2H3O A;  2ZDI A;  1SA0 A;  5BY1 A;  4PA9 A;  3J80 N;  2ZE6 A;  2F4V B;  1XNQ O;  2IU0 A;  1AP6 A;  2YEV A;  1FAF A;  2ZT9 B;  5J2T B;  5FL7 G;  3LDC A;  4H0L B;  4LF5 B;  5E1A C;  3K3W A;  2R70 A;  1VIB A;  2WLK A;  1LNQ A;  2Y4U A;  1IXB A;  1XL6 A;  4U3J A;  5IYD O;  3P32 A;  5CBG A;  3K57 A;  2YC0 A;  4MT8 A;  1EZV H;  4JI5 O;  4EKW A;  4B3M B;  1DF4 A;  2RJZ A;  5EYP A;  2UUB B;  4DR2 B;  3G6E V;  3L70 H;  1JR9 A;  5LYJ A;  4TV8 B;  2E3C A;  2KG7 B;  1DGS A;  3CRC A;  1Z2G A;  1AB3 A;  3JD4 A;  1JJ2 U;  2JIZ G;  4ZBM A;  1SC5 B;  4J7J A;  5BMV B;  4N23 A;  3AG3 C;  1NKD A;  2BTQ B;  2PTM A;  3MD0 A;  3ZRX A;  4GKK O;  1AR5 A;  4JI0 B;  2OCC C;  2Z3Y A;  2X6C A;  3L73 H;  1O9H A;  4OGQ B;  4FVM A;  1G4Y B;  4KFM A;  4YY3 O;  1MSW D;  5KUK A;  4W4K A;  1TUB B;  4I7Z B;  2F43 G;  2B1I A;  5IYC O;  4UV9 A;  2NNU A;  4ZI7 B;  1PKX A;  2DJV A;  3CRQ A;  4H44 B;  1VF5 B;  5KX5 B;  4FLZ A;  2XHB A;  4L8J A;  2ADP A;  3CX5 F;  3H01 A;  2N74 A;  4J42 A;  4O4L A;  4WFE A;  4F4L A;  4FLY A;  3OTO B;  1JFF B;  4X1I A;  4B7E A;  3AG4 C;  4BIU A;  4JAS A;  3NR7 A;  4FZ1 A;  4DV2 B;  1G8M A;  3RVY A;  1N0N A;  2LFS A;  1IBM B;  1X4T A;  1TA8 A;  5JCO A;  1NTZ H;  2E76 B;  4JI1 O;  4GZR B;  4FZ0 A;  3B77 A;  5KMG A;  4LWS A;  4DR1 B;  4CS3 A;  5JCO C;  1XL4 A;  3ABK C;  2A0L A;  4YJ3 B;  1Q6H A;  3JAW A;  2QM8 A;  2EX3 A;  3RVZ A;  4WF9 V;  4JTA B;  5B1N A;  1SQB H;  3ZCC A;  4LF6 O;  3K04 A;  3OFN G;  3K5M A;  4FFK A;  1Y66 A;  1Q90 D;  1K5Q A;  4B3T O;  2KSD A;  4JAA A;  1N36 B;  1IVS A;  4UCT A;  5BR8 O;  4JYA B;  4LFC B;  3QO7 A;  2OIG A;  3LNN A;  5B1B B;  1I7F A;  4I9Q A;  2Q9L A;  1QR8 A;  2JGU A;  4DV0 O;  2BCC H;  5CBF A;  2EIK B;  5F2V O;  3ASN C;  4D6T H;  1H38 A;  1P7G A;  1XNR B;  4TWK A;  2QTS A;  3OM3 B;  3QG5 A;  2RDC A;  1AJN A;  1LUW A;  4GT1 A;  4FJC C;  1EZJ A;  1RM1 C;  2WA3 A;  3X2Q B;  3OR6 C;  4UCS A;  4MTF A;  4CH3 A;  3DXR A;  4FK5 C;  2ZM6 B;  5KHJ A;  4B3S O;  2Q0O C;  3SJA C;  4LF7 B;  4CBC A;  1ZL8 A;  1R3I C;  2XAJ A;  3ZX6 A;  2IW5 A;  4JI6 B;  1HR0 O;  4LCU C;  2H8P C;  1XDC A;  2IJJ A;  3K58 A;  5IWA B;  4DV3 O;  3ABM C;  2UXC B;  3IC9 A;  1E1R G;  4YJ2 B;  3N2K A;  5JH7 B;  3ZMZ A;  4DV1 O;  2EIJ C;  2XAS A;  4LFA B;  3A2F A;  3ZBH A;  2CTQ A;  4DV5 O;  3ETE A;  1MZF A;  5HFL A;  4KUM A;  4YIP A;  4K8X A;  2LO1 A;  4IHJ B;  4DW1 A;  1KKD A;  2EUL A;  4EFB A;  1Y67 A;  2ZIN A;  2CTR A;  1FXK A;  2ZR2 A;  1OCZ B; 
#chains in the Genus database with same CATH homology
 1VQ4 V;  4UVA A;  2JEX A;  1YJ9 V;  1OCR C;  1K9M W;  1WPX A;  2PI5 A;  1FXK C;  4P9O A;  1OCO C;  2MK3 A;  3CCU V;  5IY5 C;  4MVO A;  4J9Z B;  2HR3 A;  1GK9 A;  3ZMU A;  3ASN B;  3CCE V;  1DTO A;  1K5S A;  3IGA C;  2IU3 A;  2IJI A;  2Z5U A;  1UJW B;  2QKS A;  1VQ6 V;  2DYR C;  2X7R B;  4HAM A;  1AJQ A;  2DWD C;  1K34 A;  3PJS K;  2X6A A;  5H9C A;  1GKF A;  4HYO A;  1YJW V;  1Q82 W;  1R6K A;  3SYP A;  1AJP A;  1NQT A;  3E8H A;  1RM1 B;  4GX5 A;  2P90 A;  1V54 B;  2K1E A;  1I5X A;  2Q69 A;  3LDD A;  1YSC A;  5EBW C;  4QE9 A;  4QNH B;  2QM7 A;  5H6Q A;  3ABL C;  3JD2 A;  4PA6 A;  3DTU B;  4Z1M G;  1AI7 A;  1VQ7 V;  4XDJ A;  3ETG A;  3LUT B;  3IFX A;  4JF3 A;  2UXN A;  4ZKI A;  3CXC U;  3QNE A;  3I55 V;  1R3K C;  4WFF A;  1PNL A;  4BAY A;  1VQ5 V;  2EIN C;  2ZDI C;  3AG1 B;  3FYI B;  1S3J A;  5IDJ A;  2DYS C;  1ROP A;  2EJR A;  3RW0 A;  3ETD A;  4MTO A;  3T1C A;  3ABM B;  3CCR V;  4RAI A;  1F51 A;  3OUS A;  1W0K G;  4JGS A;  3G4S V;  1K3E A;  5BZB A;  1GM9 A;  5L3B A;  2Q6A A;  2W6J G;  3NXS A;  4MW3 A;  1AI4 A;  2EIJ B;  4WFH A;  2CK3 G;  2EIL C;  3HPL C;  1QLE B;  5GW7 A;  3CC4 V;  3EHB B;  1R73 A;  5LGN A;  3FB5 C;  1H8E G;  2ZQM A;  2ITD C;  4P2Z A;  1PNM A;  2ATK C;  1MG1 A;  3SPI A;  1NVP D;  4N21 A;  3IC7 A;  1FS0 G;  1FXH A;  1ORQ C;  1VQ8 V;  1VQP V;  3ZMV A;  5B3S B;  3BEH A;  5LGU A;  4J9Y B;  1NH2 D;  2XOK G;  4UUJ C;  4DXW A;  5KA6 A;  4BIZ A;  4GX0 A;  2ZR3 A;  4TSF G;  4FPP A;  1OCR B;  1K73 W;  4MVS A;  3SYC A;  3E35 A;  3OUF A;  4OXS A;  1NVP B;  1FXK B;  1OCO B;  1JCH A;  2Y48 A;  5IY5 B;  4RUE A;  1M57 C;  1PNK A;  2WLM A;  1IXM A;  1NH2 B;  1GM8 A;  4MS2 A;  5EK0 A;  1ZWI C;  2Y69 C;  3K03 A;  1MOF A;  1R6N A;  3ABU A;  5B1O A;  3CCS V;  2DYR B;  4H33 A;  3OMN B;  5L3E A;  2A9H A;  3CCL V;  2AHZ A;  1AI6 A;  2QTO A;  5L3C A;  2GSM B;  3TCU A;  5LBQ A;  3F7Y C;  2PI4 A;  4PA7 A;  1K33 A;  4LC1 A;  2DWE C;  3P30 A;  5DN6 G;  1TUE B;  1S77 D;  3ABL B;  1EFR G;  2HG5 C;  3ZN0 A;  2JJ1 G;  1QVG U;  3CCM V;  1JX9 A;  4MSW C;  4MVR A;  4WFB V;  4XDL A;  4PEL A;  1VQM V;  1FXV A;  2HVJ C;  2ZXW C;  3LSQ A;  1K4C C;  3ZIA G;  2EIN B;  1H2G A;  2A79 B;  2P6J A;  1OZ0 A;  3KG2 A;  2DYS B;  3CC2 V;  3E8B A;  5KUM A;  1CP9 A;  1VQ9 V;  4R50 A;  3FB6 C;  1JQ0 A;  3ZRV A;  4UVB A;  1RPR A;  2QE7 G;  4PA4 A;  1JOY A;  3SPC A;  2P7T C;  3OMI B;  1W0J G;  3CP1 A;  2B5U A;  2EIL B;  3EFF K;  2DW4 A;  2BOB C;  4MVU A;  4X8A A;  2OT5 A;  4QPK A;  1W2B U;  2Q68 A;  2WLL A;  3R65 A;  2HLD G;  4LBE C;  2ZD9 A;  3ZMS A;  2QEX V;  1S76 D;  2EZP A;  5L3D A;  2P67 A;  3ABT A;  3WFV A;  3FYE B;  3ZJZ A;  2DQ3 A;  3OGC C;  1F23 A;  1F4N A;  3E83 A;  3CCV V;  3QO5 A;  3BY6 A;  5EBM C;  3E2E A;  2OTJ V;  1S5H C;  2WSS G;  1M56 C;  2R9R B;  3JYC A;  5LHH A;  1KQS U;  1SRY A;  1K97 A;  2YSU B;  4L87 A;  1GM7 A;  3W7X A;  2ZDI A;  4HZ3 A;  4JTD B;  2WLJ A;  1GMG A;  4PA9 A;  1KC8 W;  3FB7 C;  4JYC A;  3CC7 V;  2IU0 A;  2OTL V;  3E8G A;  3W7T A;  2YEV A;  2W6I G;  1M57 B;  4GX2 A;  5FL7 G;  3LDC A;  4QE7 A;  1WLE A;  2Y69 B;  1PD3 A;  4UV8 A;  3W7S A;  1H8H G;  1THZ A;  1SZT A;  5E1A C;  3K3W A;  4I9W A;  1MAB G;  1LNQ A;  2WLK A;  1QR9 A;  1XL6 A;  3K0D A;  5IYD O;  3ZRW B;  3P32 A;  3STL C;  5CBG A;  1OCC C;  3K06 A;  1S0V A;  4PA3 A;  4MT8 A;  3SPH A;  1QLN A;  1CEZ A;  1JPX A;  1N8R W;  1I5Y A;  1Q81 W;  4EKW A;  4X88 A;  2QA4 V;  1DF4 A;  4RQE A;  2BOC C;  1J95 A;  3HB3 B;  1KP3 A;  4FIP C;  5HFM A;  3G6E V;  4R8C A;  2NLJ C;  2ZXW B;  3SJQ C;  2AHY A;  1COW G;  3K79 A;  3CME V;  1E79 G;  1KP2 A;  3JD4 A;  1JJ2 U;  1PL0 A;  1JVM A;  2JIZ G;  4ZBM A;  3FKS G;  4R7C A;  1YJN V;  3D36 A;  4GCZ A;  4N23 A;  1EBO A;  4QIW F;  3AG3 C;  3QO8 A;  1S72 V;  2WLI A;  2V7Q G;  4YXW G;  3OEE G;  3ZRW A;  1VQN V;  4R6Z A;  1R3L C;  1NKD A;  3T4Z A;  1K8A W;  3AG2 C;  3MD0 A;  3ZRX A;  5J9P C;  3B8M A;  2XAF A;  3JD3 A;  1M9N A;  2HJF C;  1NR7 A;  4G28 B;  2OCC C;  2Z3Y A;  2WLN A;  4MVQ A;  2X6C A;  2WLL B;  1SES A;  1NJI W;  3K9A A;  2EZO A;  4QPJ A;  3WG7 C;  1G4Y B;  2GHY A;  4KFM A;  1MSW D;  2IH3 C;  5KUK A;  3E86 A;  1M56 B;  4MW8 A;  5B1B C;  4RQF A;  3E89 A;  4PDR A;  2F43 G;  3I56 V;  2B1I A;  5IYC O;  2EIK C;  5LHI A;  3UKM A;  1SER A;  1K92 A;  4UV9 A;  5B1A C;  3CYO A;  1KD1 W;  2NNU A;  2Q67 A;  3LDE A;  1PKX A;  3SYQ A;  2B1G A;  2IJK A;  2HKO A;  3F7V C;  1GO3 F;  1F4M A;  2M7W A;  5CN0 A;  4E2L A;  4KP4 A;  1K4D C;  3X2Q C;  3H01 A;  2YEV B;  4JAU A;  4WFE A;  4F4L A;  3OE7 G;  2IJH A;  1P7B A;  1Y4M A;  3W7W A;  3CCJ V;  1OCC B;  3K08 A;  5H6R A;  3AG4 C;  1NR1 A;  3OMA B;  5CMU A;  1DLB A;  2XAG A;  4BIU A;  2JK5 C;  4JAV A;  3MHH C;  3LSS A;  4JAS A;  4CZZ A;  5C93 A;  3TET A;  4X89 A;  1G8M A;  3RVY A;  1AR1 B;  2HVK C;  4PDV A;  3VBB A;  1B6Q A;  2LFS A;  1KEC A;  1V55 C;  2WWW A;  3E8F A;  4P30 A;  4PDM A;  3OW2 U;  3STZ C;  1HWY A;  2WPD G;  2XAH A;  3ML0 A;  4WCE V;  3B77 A;  3T2M A;  5LHG A;  5CA3 A;  1XL4 A;  3ABK C;  2A0L A;  4I5S A;  2EBO A;  2QM8 A;  5EBL C;  3CCQ V;  1QBZ A;  3RVZ A;  1CPY A;  1BHB A;  3AEI A;  3ZMT A;  3AG3 B;  5EC1 C;  4WF9 V;  3TK1 A;  4JTA B;  5B1N A;  3MHS C;  4MTG A;  5L3G A;  1VQL V;  3ZCC A;  1R3J C;  3K04 A;  3OFN G;  3AG2 B;  3OAA G;  4QJF B;  3ASO C;  1Y66 A;  2WLI B;  4PDL A;  2EIM C;  1K5Q A;  2X6B A;  2IH1 C;  3M99 B;  3ZN1 A;  3K0G A;  5KA5 A;  5L3F A;  3SPJ A;  4G2K A;  2OCC B;  2XAQ A;  1OCZ C;  1YI2 V;  2X0L A;  2JJ2 G;  3WG7 B;  1AI5 A;  4WFG A;  3QO7 A;  3UM7 A;  1P4R A;  3A0R A;  4U7N A;  4UVC A;  2UXX A;  3GWO A;  5B1B B;  4MVM A;  1QR8 A;  1BMF G;  5CBF A;  2EIK B;  3OR7 C;  3ASN C;  5B1A B;  1H38 A;  3D3I A;  2WAM A;  4Q20 A;  4MVZ A;  4BW5 A;  3ZRS A;  4TWK A;  5CBH A;  1QVF U;  3OM3 B;  1BL8 A;  1QCE A;  1RPO A;  4GT1 A;  1AJN A;  3VOU A;  1NBM G;  4JPR A;  5EC2 C;  2C2A A;  1YIT V;  1E1Q G;  4FJC C;  2XND G;  1EZJ A;  4JYB A;  1RM1 C;  4JTC B;  3B8N A;  1ARO P;  3X2Q B;  1V54 C;  2DQ0 A;  3OR6 C;  4LP8 A;  4MTF A;  4TT3 G;  1GTO A;  3SYO A;  3CD6 V;  3DGE A;  1YIJ V;  4FK5 C;  4CBC A;  3SYA A;  5IYB O;  1VQK V;  1OHH G;  1R3I C;  2XAJ A;  1L1F A;  3RBZ A;  5DM6 V;  2IW5 A;  3AG4 B;  1FFT B;  1M1K W;  1K7D A;  4U7O A;  3LNM B;  4WFA V;  3F5W C;  4LCU C;  2D3O W;  2H8P C;  1Q86 W;  4XBF A;  4RUF A;  3GB7 C;  2H94 A;  4G27 B;  1V55 B;  3AG1 C;  1ENV A;  2IJJ A;  4UXN A;  3W7U A;  2LFR A;  2JEU A;  3FB8 C;  3T4D A;  2FTK A;  1SET A;  2HFE C;  4GX1 A;  3JD0 A;  3JCZ A;  3ABM C;  4ASU G;  1E1R G;  1Q7Y W;  3G71 V;  1DF5 A;  4MTX A;  1M90 W;  3ABK B;  2W0F C;  1VQO V;  1YTF D;  3ZMZ A;  2EIJ C;  2LP7 A;  4FMT A;  2XAS A;  1QLE C;  5LGT A;  2R9I A;  1BHA A;  3ETE A;  4XDK A;  4KUM A;  5HFL A;  2KB1 A;  2WLH A;  3OEH G;  1YHQ V;  3SPG A;  3CPW U;  2JDI G;  1KKD A;  3ASO B;  3CMA V;  4P9P A;  2V1D A;  1YTF B;  2EIM B;  4H37 A;  2ITC C;  5B3S C;  3JD1 A;  4DO2 A;  1FXK A;  2ZR2 A;  1OCZ B;  4RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...