4JPRA

Structure of the aslv fusion subunit core
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
YFQGTANLTTSLLGDLLDDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCSFNLSDQSESIQKKFQLMKEHVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of a fusion glycoprotein from a retrovirus that undergoes a hybrid 2-step entry mechanism.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin a)
molecule tags Viral protein
molecule keywords ASLV fusion TM
total genus 28
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jprA00
2P6JA 3MHSC 3GWOA 5HFMA 2LP7A 2EZOA 1I5YA 1K33A 3B8NA 1QR9A 1I5XA 4JPRA 2EZPA 1JQ0A 1ENVA 3CYOA 1Y66A 5HFLA 4JF3A 4FK5C 2MK3A 1DF4A 3H01A 3K9AA 5KA5A 5CMUA 4FJCC 1EBOA 1MG1A 1QR8A 1JPXA 1K34A 3CP1A 3P30A 4N23A 2OT5A 4G2KA 4E2LA 2X7RB 1F23A 4N21A 5H9CA 1DF5A 3MHHC 1Y4MA 1DLBA 3M99B 1MOFA 2EBOA 5CN0A 5KA6A 1QBZA 1QCEA 1SZTA 3WFVA 4FIPC 4JGSA 3B77A 2M7WA 3B8MA
chains in the Genus database with same CATH superfamily
4FVMA 1VEWA 1MA1A 3K58A 1XL4A 1YEWA 2NR5A 4QIWF 2Q7EA 5J9PC 1V55B 2PGGA 3NR7A 5JWPA 1MNGA 2HKOA 2DN9A 1K34A 4PHZA 2P5OA 3FYEB 3Q4HB 3QNEA 3I56V 3DTUB 1P4RA 4UCRA 1NT2B 3A8TA 3DSQA 1HDJA 4L8JA 3H1JH 2V7QG 1GO3F 3N2GB 4ZHQB 5IDJA 1P7BA 1TGOA 4WFFA 4LF4B 3WB2A 3ASNC 1TUEB 4JI4O 4TQDA 3DXRB 4FZ0A 4I0XA 4XDLA 2Q7HA 4LR3A 5B66Z 1Q5OA 4G2KA 4I7ZB 4Q20A 4OX9O 4CS3A 2E76B 2R9IA 1YTFB 4DR5O 4ZI7A 4MTGA 5KX5A 4ZBMA 1DK1A 4DUZO 4PDRA 3E86A 1OCRC 2WSSG 5ITZA 1EN5A 1YCIA 2BOBC 1IURA 1G6UA 3AG1B 4DR7B 4X20B 1FFTB 3OT7A 1FFXB 4CH3A 3AK1A 4LBEC 4DV4O 3E8HA 1AR5A 5KUKA 3CCLV 4JTDB 3R66A 1G4YB 2HVJC 2VQFB 1ZX3A 1NH2B 3OR7C 4CS4A 3OEHG 1ORQC 2MK3A 4PI2A 5LXTB 1YSCA 1VMGA 4DR2O 1FXKB 1WB8A 4UB8Z 2DQ3A 4Z1VA 4B7EA 3QO5A 3RW0A 1IBKO 4P30A 1L1FA 5CA3A 3RYHA 1BQZA 1N34O 5E79Z 1NR7A 4GUNA 1ENVA 4JI3O 4JASA 4GKJO 1HR0O 3U0ZA 1IBKB 4ZKIA 2EX3A 3OE7G 3CJHA 5KMGB 3OEEG 1FYJA 3JAWA 3I5DA 1IXMA 2VRZA 1N33O 4IYIA 4LFBO 4DR1B 4OPAA 1Q81W 1OZ0A 1OCOC 2W0XA 5LHIA 3DGEA 2LO1A 2X0LA 2YXLA 3ZJZA 2UUCO 1BE3H 1RPRA 4NR1A 4J9ZB 4KL1A 5LMNO 3ABTA 3RYIA 3X2QB 3K03A 2HHHO 3CB2A 3WB0A 2ZIOA 3KCYA 2HP8A 3SPGA 3BPZA 2QR4A 2YEVB 2QE7G 1NQTA 1PNLA 3FB8C 3Q4HA 1XREA 4ICGA 4XDKA 1RFYA 4GX1A 4LWSB 1TVKB 3ZMVA 2ETNA 1BGYH 3KCXA 3UT5B 3MD0A 2WLNA 3T1HB 3ASOC 1GK9A 4X88A 4X65B 1SESA 4AILC 3SPCA 3F5TA 2NNUA 2W6IG 3E83A 4X64B 1GM8A 4JYAB 4FLZA 1Q90D 2QTOA 4IIJB 3BFRA 1K5SA 3SR2C 4B3RB 2G38A 2DOSA 1BMFG 1FXKA 3QG5A 5LYJB 4X20A 5IJ9A 4U3JB 3SJAC 3CXHF 3E22B 4IL6Z 1W59A 2NLJC 4YXWG 3ZMSA 4FM1A 1XDCA 1JX9A 5E1AC 4DV5O 1GTOA 2OIGA 2YIBD 3SPHA 4FPPA 1S0VA 1Y6XA 2XAGA 2OCCC 2P22C 1RSOB 1SQFA 3ETQA 4UCTA 2GV9A 1OCCC 3FD9A 4DV2B 5CN0A 4JV5B 4B3TO 3RVZA 2MW2B 4UCUA 3OD4A 5B1AB 2LFRA 1SS3A 3ZHVA 3APOA 1VIBA 1DTOA 3ZMUA 3JCZA 4DR2B 1PL0A 4ZOLB 4MVUA 3T1YO 2ZM6O 4KXRA 1ZTEA 1J95A 1HNXB 2H3OA 1XMOB 5IWAO 1WJZA 4PD4F 4JAUA 3SPIA 4X65O 3AK2A 3BA8A 4LNUA 4JI0B 2B9ZA 4L87A 4MVMA 5LBQA 5JVDB 3IC7A 4DUYB 1GM9A 3SJCC 1U96A 4NTYA 3TETA 2JK5C 5LOVA 2YDEA 1VQ8V 1CEZA 2EIMC 3JARA 2EULA 3W7XA 4O4JB 2RMKB 3FB7C 3CD6V 2AXTZ 2HHHB 4GYCB 4F6EA 3MHHC 3WB1A 2P90A 3A2FA 1ZUQA 2UXDB 3OUSA 1KECA 3OUFA 5A2QN 4NKGB 2BTQB 4DV0B 4LF4O 5B1BC 4C7UA 4KHPO 4WFGA 1P49A 3JAKB 1Q86W 2CUGA 5IYZA 1M9NA 1N0NA 4B3MB 1L8DA 2ZNJA 4MTOA 2CTPA 4DV7B 4JZ2A 2QGNA 4ABMA 4X1YB 1N34B 1NVPB 2UXXA 2BCCH 2CTWA 3RYCA 4JZGA 5EBMC 4H33A 4FFBA 3FAVA 4FLXA 3UO2A 1JVMA 3VOUA 3EHBB 2WA4A 1XUQA 5CA0A 2ZE8A 1K97A 4LP8A 4UCOA 1PL4A 2JEXA 3B4SA 4DV2O 4UXNA 2P4KA 4UV8A 4I9WA 1CP9A 4LH6A 3OM3B 2JEUA 1F4MA 1XNRB 2QWRB 2ZNIA 3DC5A 2EJRA 4K35A 1N32O 1NBMG 2RCVA 1YF2A 4LF8B 2P06A 1M90W 4K0KB 4F4LA 5K1XA 3B8NA 5EZYB 5BMVB 4X8AA 4JI5O 1ZL8A 4GKKO 2IM9A 2PYLA 1G1XB 1D2DA 3S3XA 1AB3A 5EBLC 4DO2A 5KHJA 4AQYO 5EYPB 2F93B 1MOFA 2CGOA 5EC2C 2Y4TA 1NTKH 1QLEC 4MS2A 1YTFD 2WA3A 3OW2U 4JI6O 1K8AW 2EZOA 1SQQH 2EINB 3BHPA 1CXZB 1R73A 5C8YB 3E8GA 4FMTA 3B2EE 3D36C 4D6TH 2LFSA 2WLKA 4PA6A 4GKKB 3JSNA 3ZHSA 1R3IC 1H2MA 5KHGA 1VF6C 2YUAA 1SZXA 1NI8A 1GM7A 4J41A 1TAEA 3LNNA 1MSWD 2Q4PA 4BW5A 3CCRV 3TXSA 1Q43A 3OTFA 2RJZA 2ATKC 2QKSA 2OT5A 4JAAA 2YS8A 1FXKC 4UVBA 4Z2WA 1YITV 3B8MA 2ZE7A 4K0KO 5HFMA 3DC6A 4PI0A 3ICXA 2JDIG 4MVRA 4DW0A 1UJWB 2X6CA 1XEQA 1RM1B 4D7TA 4NXNO 1F23A 5L3FA 1DLBA 1MSDA 3E22A 4G28B 2H94A 2XAFA 3LDCA 1S76D 4LWSA 5JH7B 3HKDA 3VQWA 3ZS8C 2PI4A 2OCHA 2VQEB 3J7AU 2LW7A 4O2BB 2XNDG 3G4SV 5B1BB 2A0LA 1M57C 4EEQA 3CCVV 4CZZA 2UU9B 4OPHA 1Q7YW 4EFBA 5KA6A 2IBZH 4J10A 3IJ4A 3K59A 4LF9O 4P2ZA 4YJ3B 2JGDA 3BABA 3CRQA 2JGUA 4NXNB 4B3MO 4YIPA 1S72V 2YIBA 4MTXA 1D5NA 4LF7B 4PV1B 3SDLA 1BSMA 2A9HA 3A0HZ 4U3FH 2P67A 3ABMB 4JI1B 5D5QA 5FLXN 1Q6IA 4TV8A 3S3WA 4RO2A 2YICA 1Z2GA 2FTKA 4B3SO 4JAVA 4J7JA 1FD9A 2GUZA 4R8CA 1PNMA 5LA6A 3H9VA 2C2AA 5DEDA 1Y66A 5J2TB 2HLDG 2EILC 4OX9B 4YJ2A 4PDLA 5IY5C 4RQFA 3ZHRA 1XMOO 1IVSA 3SPJA 3D36A 4U3JA 1SA0A 3QO8A 4DR6O 3QO7A 1VQKV 4K8ZA 4JI1O 5JQGB 5IE9A 1JFFA 5JQGA 1KB9F 3K5MA 1WLEA 2Y4UA 1XL6A 4DV1O 4B3TB 1PV0A 3E35A 2GHYA 4FLWA 2B1GA 5J2UA 2UUAO 2IH1C 1THZA 3RYIB 1M93A 3ZMTA 5IY5B 2ZR2A 1WNSA 3HR0A 1MABG 2UU9O 4O2AA 4AQYB 2HR3A 1QVGU 2Y69C 4X62B 5LXTA 3WG7B 2D3OW 2EZPA 3H1LH 2DYSC 1FS0G 4JV5O 1IBLO 3AK3A 5D5PA 5JCOC 4OGQB 3ZRVA 3AEIA 2L35A 4MVZA 1QCEA 1XNRO 5CBHA 1O9GA 3J81N 2E75B 1NTZH 1PPJH 2CH7B 3K06A 1OCZC 3K79A 3A0RA 2Y69B 1SQXH 4K8XA 4MVOA 1GN4A 5GTHZ 3RGBA 3RT3C 2WLMA 5KA5A 4X89A 2DYSB 3OTOO 1AR4A 3E2EA 4IYHA 1H2KA 3K0GA 4X64O 2WLIA 4LF6O 2LGQA 1H2GA 4Z1MG 2BSKA 3ZRWA 2OWOA 4Q6GA 5B3SC 5B1OA 3SYPA 1QHTA 3TXQA 5LMUO 1Y4MA 4I4TB 2UXNA 4NVPA 1K3EA 1AVMA 2XOKG 2DWEC 4IT5A 3ABKB 2ZE6A 3CE2A 4WF9V 1B04A 3ABLB 2F23A 1H38A 2CTRA 3ETDA 4OXSA 3JD2A 1B06A 1VQLV 1ROPA 4K3AA 3L73H 3J80N 1GMGA 1QR9A 5ITZB 4FFBB 2B5UA 4WBNA 2V1DA 1JMKC 3RYCB 3W7UA 1R3JC 3ZX6A 4LF8O 1NZ6A 5H6RA 1N32B 5EC1C 2Q9LA 3AG2C 1J5EB 1I08A 4B7KA 1O9HA 5KLVH 3W7SA 3ZBHA 3BEHA 3IAYA 5IYCO 4ASUG 4GT1A 3QVNA 3M99B 5IJ9B 3GVMA 5LGTA 2QSAA 3D3QA 3CS5A 3IFXA 3CCQV 5BMVA 1TUBA 2VQFO 1NS1A 4O2BA 1S5JA 1B3QA 1W0KG 2Z0AA 2ZQMA 2RDCA 5HFLA 1ZWIC 2KSDA 1JPXA 3CP1A 1WA8A 4U7OA 3HKBA 1BQ0A 5CA1B 1K4DC 1GN6A 3LUTB 3UO3A 4JI4B 3K5LA 5CA0B 3MHSC 5BZBA 2WWWA 2JJ1G 5BR8O 3OAAG 3CWBH 4QPJA 1BS3A 1JA8A 2PI5A 4FLVA 5EIBC 3H01A 3K9AA 3JYCA 4WFHA 4MW3A 5LGUA 4TV9B 2XTAA 4PA7A 3A0BZ 4AI8A 3BVOA 4RUFA 2ZR3A 3JD3A 2LGWA 3HKEA 4KFMA 2DW4A 3HKCB 1UFIA 3TJTA 4LFAO 1JJ2U 4F6RA 1VF6A 4WBNB 4TUYB 4TUYA 4B08A 4GZRB 3ZIAG 3OTOB 1RSOA 1TA8A 2Q6AA 4GCZA 4TQFA 1Y76A 3CRCA 2O57A 4XDJA 5CA1A 3N27A 2DYRB 4EKWA 4NYKA 1AILA 4LF6B 2ZIMA 4LF5B 1K92A 2QWOB 2ZINA 1DF4A 2IJKA 3K3WA 1FXVA 1AJPA 5B1NA 2RQ6A 1JJOA 1TUBB 3CCEV 4PA3A 4CS2A 2ADPA 3JALA 1AJNA 3APQA 4IGGA 4LF5O 3RWRD 5B5EZ 1YJWV 1SQGA 4JYBA 4DV7O 1A32A 1VARA 3AG4B 3B40A 3ZRXA 4JI8B 1HNWB 2UUAB 1BL8A 2RN9A 4HYOA 2QM4A 1VQ7V 1V55C 1VQ9V 2YEVA 2KG7A 1YJ9V 1US6A 2QKAA 4I4TA 4J80A 2GDSA 5FNVA 2AZ2A 4YHHB 2VWKA 1EFRG 2JJ2G 1SRYA 1QQCA 3H1HH 4NB5A 4I55A 4JPRA 1SC5B 4JI2B 4H37A 1SETA 4JYAO 1S5HC 1EBOA 2F95B 2IW5A 4PA4A 4FLYA 2CH7A 3SYCA 3VBBA 4X66O 4BAYA 5EK0A 2ZDIC 3KZIZ 1PKXA 3M8AA 2IU0A 4ZOLA 2R70A 1XI1A 4HNAB 3ZN0A 3CXCU 3JAWB 3BY6A 1S77D 5IYDO 2UXCB 4DUZB 2ZDIA 4UUJC 3G6BA 1FJGB 3STLC 3BA9A 3CCJV 3T1CA 1NH2D 1K9MW 3T4DA 3AG2B 5L3CA 2GTSA 2KQXA 1M56C 1J5EO 2LJ2A 1NVPD 3F7YC 1TVKA 2BSKB 1Q6UA 5IYBO 1JFFB 2DE0X 3H1KH 2Y48A 3E89A 3SYOA 4IIJA 1KBHA 2HJDA 3JARB 1XMQO 3JASA 1HR0B 4DR3B 1VQOV 4H0LB 3WG7C 1P84F 1D5AA 2HG5C 5LP6A 4LF9B 5J2TA 3EVKA 2RNBA 4DRXB 1YI2V 1I0HA 2AZ0A 5L3GA 4PJ0Z 1MMMA 3OMAB 1I7FA 1XMQB 2H8PC 4TSFG 1SA0B 2YC0A 5LP6C 4GLXA 1UPGA 2EIJC 4QNHB 5KX5B 3RFRA 1VF5B 2VS0A 4HNAA 4TWKA 2YXHA 4B3RO 5KMGA 1LUVA 4PELA 5LGNA 4I9QA 1QNMA 3UKMA 3BCCH 2E3CA 2D2CB 1H8EG 2JGDB 4R6ZA 5BXZA 3TGUH 5K1PA 3SGIA 1IXBA 4ZIBA 4DR7O 1BCCH 1PP9H 4FM2A 1V54B 4RAIA 1KC8W 3BAAA 2DJVA 3VQVA 2UXCO 4UB6Z 1L0LH 2KKWA 5LYJA 5JJNB 1EZJA 2XUMA 5H6QA 2CGNA 4BW9A 4LFCB 3SYQA 1H2LA 4FFKA 1R6TA 1QU7A 5J2UB 3ML0A 2AGAA 1JCHA 4H13B 3L9DA 1KU9A 1I5XA 2WPDG 1HNXO 3K9SA 4LC1A 2Z3YA 2QM8A 3LSQA 1N33B 3BRCA 2CK3G 3HKDB 1Y67A 1F7YA 4QE7A 5LL6Y 4NTXA 1EM1A 1MZEA 2CAZC 3LDEA 3B77A 1IX9A 2Q0AA 3WU2Z 1OJHA 4DR4O 1OCRB 1LUWA 2LP7A 2N04A 1KKDA 2YI9A 2CDYA 5GONA 1HW7A 3OFNG 4DR3O 2Q73A 1WB7A 1VQ5V 2M6YA 4WFBV 1IBLB 1H8HG 4DV1B 2PYJA 1VQPV 2QWPB 5FNVB 2CE4A 4YY3O 2FMLA 5DM6V 4DR6B 4BR6A 2IH3C 1HNZB 3CHXA 4TV9A 1YXBA 4DRXA 3M7MX 4BIOA 3ABMC 2EIKB 3ZHUA 3AG7A 3DXRA 5CBGA 1OCZB 3RVYA 4UFZA 3ASOB 1KMIZ 4JI7O 1FJGO 1K7DA 1SF9A 1BHAA 5JJEB 4X9QA 5LHHA 3D8CA 1ZL8B 1FKAO 5C8YA 4FLTA 2ZXWB 2DMXA 3JSLA 3CMEV 3HKBB 3AG4C 3TCUA 2GSMB 1YVWA 4J42A 2LW1A 4DV0O 1AI4A 3K5OA 3P3NA 2WAMA 2K1EA 2XT9A 4O4LB 2WLHA 3ZEDA 4X66B 2UXDO 3TK1A 3CPWU 3FKSG 4CH6A 1I94O 1XHXA 2E5LO 1PD3A 1WPBA 4B3SB 4GX5A 4X1KA 1XOUA 4D7SA 1FFXA 3L71H 2NN4A 3CC4V 1X59A 3AG1C 4W4LA 4BIZA 2F43G 2FB5A 2YIDA 5KHKA 1SERA 4XBFA 1KKCA 2KB1A 4P9OA 2PF4E 2P4VA 3GB7C 4PDMA 5TISZ 3CYOA 4JYYA 1QLEB 2DYRC 2VQEO 3HKEB 1YIJV 1YDXA 1VQ4V 2A06H 3PJSK 3N2KB 4DK1A 1RM1C 1GAXA 2PTMA 4DK0A 5AG2A 5KHIA 2ODMA 3L70H 3FAVB 3IGAC 1SQVH 4JTAB 2JS3A 2ZE5A 3JAKA 4YY3B 2FL4A 2ILMA 3N2GA 2BTQA 1SQBH 2KG7B 2AW9A 4GX2A 1KP3A 2BTOA 3E8FA 5KUMA 1MG1A 1WA8B 5H9CA 1IZ3A 3PN1A 2EIMB 1ZAUA 3T1YB 1OV9A 3WFVA 4CBCA 3F7VC 3G80A 1B6QA 2F1MA 4NXMO 4IHJB 1K73W 4HBNA 1URFA 4MW8A 3SJQC 4CC6A 2Y0PA 1LR1A 4UCSA 3SJBC 3E8BA 4J11A 4DR5B 4LFAB 2OTLV 4O4HB 2EBOA 2XAQA 1WP8A 2Q0OC 1E79G 3ABUA 3ZRWB 2OYQA 2JIZG 5B3SB 4O4IB 4JI6B 4I50B 4HZ3A 4DR4B 1H2NA 5EIBD 1VF7A 2BE3A 1WPXA 3N2KA 2L6LA 4LFCO 1Z5VA 2PUSA 5L3DA 3CRAA 5BR8B 4YHHO 1HP8A 2JVDA 4PA9A 3CRRA 4LNUB 1VQMV 4UV9A 1AI7A 3AG3B 5FL7G 2EJ7A 4JTCB 2QKCA 3OGIB 4TT3G 1R6KA 3KG2A 1RP3B 3ZMZA 5IJ0A 3KKYA 1SKVA 2X6BA 3G67A 4JI5B 4J7ZA 2K9PA 4LFBB 2WLLB 3I55V 1R1BA 3JD4A 3H1IH 2A7WA 2FYUH 4O4JA 3IC9A 4X1KB 4KP4A 3FX7A 2UUCB 1QR8A 4N23A 2JRIA 3ZHTA 2IJJA 4O4LA 2PZSA 4DV6B 3LSSA 4JI3B 3UT5A 2OCCB 5JVDA 2R72A 2AHYA 2IJIA 2UUBO 1AROP 2B1IA 1FXHA 4EB6A 1GN2A 2CTQA 3O9OA 1K33A 1KQSU 1GH6A 2ITCC 2XAHA 4GX0A 5FPRA 1YZBA 2HJFC 5LOVB 2X7RB 4MVQA 4CH4A 1DF5A 4YJ2B 2E74B 2QDOA 2QWNB 4R50A 4I5SA 3K0DA 4WCEV 1Y74B 2EIJB 2Q67A 4BWAA 3CCMV 3P30A 1R3LC 1N0JA 2WLIB 2GBOA 5H2FZ 4PDVA 3ZN1A 4TOIA 2OTJV 2HEPA 1P7GA 3O65A 4AHCA 1Q8IA 3LDDA 4KHPB 3UQ8A 1NR1A 4MVSA 2OIEA 1OHHG 3CJHB 2M7WA 2E5LB 4H44B 4MSWC 1NJIW 1N36B 1YJNV 2ZKOA 1V54C 1AP6A 1W2BU 1WN7A 1F4NA 4YJ3A 1IBMO 1XNQB 5KHHA 5GONB 4DV4B 1N8RW 1S3JA 4FJCC 3NXSA 1VP7A 3C90A 1N36O 1V9PA 2Y0IA 2ZD9A 3ZCCA 2BOCC 3OMIB 4JYCA 2ZM6B 2X6AA 4P9PA 4W4KA 3FYIB 3CCSV 1AJQA 1QLNA 2QWQB 1WAZA 1I5YA 1NTMH 1R6NA 1E1RG 3LNMB 3UM7A 4WFEA 1JR9A 3C3TA 5JCOA 1Q3EA 3W7WA 2Z5UA 3U10A 3RYHB 1HNZO 2ITDC 2F4VB 1AP5A 3FB5C 4JGSA 2LQTA 2Q68A 1K5QA 3HB3B 5H5NA 3JD0A 2IU3A 3GWKC 5BY1A 4TV8B 3CC2V 3JCUZ 2R9RB 5KAFZ 3CX5F 3T2MA 4X1IA 1FPOA 4JI8O 1HNWO 2UXBO 3P32A 1G8MA 1QBZA 5IT9N 4NTWA 2F4VO 4DV6O 2GUZB 1M56B 2N05A 1EN4A 4E4EA 2ZCEA 1E1QG 5GTIZ 2EIKC 3ETGA 3STZC 3C3SA 3CCUV 2P7TC 4R7CA 4UVCA 3L74H 2YSUB 5DN6G 2ARHA 4X1IB 2DQ0A 1X4TA 2ZT9B 3JASB 3AG3C 4HAMA 2YI8A 1ZLZA 1OCOB 3D3IA 3X2QC 1EZVH 4O2AB 4O4IA 3T1HO 4UVAA 5JH7A 4J9YB 1F51A 1KYOF 1OCCB 3ETEA 5C93A 1M1KW 2V4DA 2XHBA 4I55B 3ZHQA 3JAMN 4CH5A 5F2VO 5LP6B 1YHQV 2ADQB 1IBMB 1XNQO 4O4HA 5EBWC 2VWJA 3SYAA 1KUQA 4ZHQA 3FFQA 4LH7A 4DW1A 4UCVA 1N4CA 1EN6A 3U11A 1CPYA 2DWDC 2XAJA 1AI6A 4QE9A 1HWYA 1T5EA 4QGPA 2WLLA 1AI5A 1COWG 3THOA 4JF3A 3MAQA 2A3QA 3P3PA 2EILB 4MTFA 2QTSA 5IJ0B 4GKJB 4G27B 2Q7GA 1M4UA 3JATA 3QTCA 2IJHA 1Y76B 5LA6B 4DR1O 3CSXA 2UXBB 2P6JA 3GWOA 5CBFA 4RQEA 3K04A 2A79B 5DECA 2QM7A 1LNQA 3VQYA 5CB4A 4QPKA 4DXWA 3G71V 4X62O 4ZI7B 3CC7V 2JS5A 4NXMB 4YIOA 4A5UB 2Q8VA 4N21A 1BHBA 1KP2A 3CRMA 4DV3B 1IDSA 4JI0O 5FPOA 4MT8A 1H2SB 3QF7A 2AHZA 4I50A 1VQNV 1JOYA 1Y74A 1K4CC 3CEIA 1JQ0A 4I0XB 1Q6HA 4KUMA 5B1AC 4F6RB 4RWUA 5CMUA 1BZKA 3EXAA 4BIUA 1PM9A 2YIAA 3HKCA 1M57B 3K57A 3EFFK 1W0JG 2EINC 3JALB 2HVKC 4FIPC 3K08A 4FLUA 4EB6B 5LHGA 3T4ZA 4QJFB 3FB6C 3RBZA 2XASA 5L3BA 1U97A 4DV3O 4DYLA 1BT8A 1SQPH 1QVFU 3L72H 4DV5B 4J7KA 3OR6C 2Q5ZA 1RPOA 1FAFA 1M5IA 4E2LA 1Q82W 3W7TA 3R65A 3RYFA 1Z5WA 1SZTA 3ASNB 3VQXA 3RYFB 4CC5A 1ZSPA 2QJ1A 3OGCC 3K5NA 2YXYA 2ZXWC 1VQ6V 1XQ8A 3UCSC 4IHJA 3F5WC 5KAIZ 4RUEA 1R3KC 3MDSA 4FM0A 2F66C 4LF7O 4U7NA 1NKDA 1I94B 2R9AA 4WFAV 4JI2O 3JD1A 1KD1W 5A9GA 5JJJB 3G6EV 1AR1B 2QA4V 5L3EA 2Q69A 3ZRSA 2FKXA 1XBLA 3ABKC 1GKFA 5GW7A 1GN3A 3HPLC 5CB4B 2WLJA 4FK5C 5LMUB 1WP7A 3ABLC 4JI7B 4X1YA 2UUBB 1L0NH 4DUYO 2W6JG 3LSUA 2N74A 4FZ1A 3RN4A 1MZFA 5LMNB 1XHZA 2HFEC 3L75H 4EFEA 4LCUC 5IWAB 1GRJA 5IYZB 3CMAV 1DGSA 1XILA 5EYPA 3OMNB 2W0FC 1S5LZ 2GTAA 2PY5A 1PNKA 2QEXV 5EZYA 3JATB 3B09A 1NU1H
chains in the Genus database with same CATH topology
1AJNA 1GM7A 4UV9A 1YJWV 1XL4A 1AI7A 3AG3B 5FL7G 4QIWF 1MSWD 5J9PC 4JYBA 4JTCB 1V55B 4BW5A 4TT3G 3CCRV 1R6KA 3KG2A 3AG4B 2HKOA 3ZMZA 3ZRXA 2ATKC 1K34A 2QKSA 1BL8A 3FYEB 2OT5A 4HYOA 3QNEA 3I56V 1VQ7V 1V55C 1VQ9V 3DTUB 1P4RA 2YEVA 2X6BA 1YJ9V 1FXKC 2V7QG 1GO3F 4UVBA 5IDJA 1P7BA 1YITV 3B8MA 2WLLB 3I55V 3JD4A 5HFMA 4WFFA 1EFRG 2JJ2G 2JDIG 3ASNC 1SRYA 1TUEB 4MVRA 4JPRA 4XDLA 4KP4A 4H37A 1UJWB 1SETA 2X6CA 1S5HC 1EBOA 2IW5A 1QR8A 4PA4A 1RM1B 4N23A 4G2KA 3SYCA 1F23A 3VBBA 2IJJA 4Q20A 5L3FA 4BAYA 1DLBA 5EK0A 2ZDIC 4G28B 3LSSA 1PKXA 2OCCB 2AHYA 2H94A 2IJIA 2R9IA 2IU0A 1YTFB 2XAFA 3LDCA 1S76D 1AROP 2B1IA 2PI4A 1FXHA 3ZN0A 3CXCU 4MTGA 4ZBMA 3BY6A 1K33A 2XNDG 5IYDO 3G4SV 1KQSU 1S77D 2ITCC 3E86A 2XAHA 4GX0A 4PDRA 1OCRC 2WSSG 5B1BB 2BOBC 2A0LA 1M57C 2HJFC 3CCVV 2ZDIA 3AG1B 4UUJC 4CZZA 1FFTB 2X7RB 3STLC 4MVQA 1DF5A 1Q7YW 4R50A 4I5SA 5KA6A 3CCJV 3K0DA 4LBEC 3T1CA 1NH2D 3E8HA 1K9MW 4WCEV 3T4DA 5KUKA 2EIJB 2Q67A 4P2ZA 3CCLV 3CCMV 3P30A 1R3LC 4JTDB 2WLIB 1G4YB 2HVJC 1S72V 3AG2B 4PDVA 3ZN1A 5L3CA 2OTJV 1NH2B 3OR7C 4MTXA 1M56C 3OEHG 1NVPD 1ORQC 3F7YC 2MK3A 2A9HA 1YSCA 3LDDA 5IYBO 1NR1A 1FXKB 2P67A 4MVSA 3ABMB 2DQ3A 3QO5A 2Y48A 3RW0A 1OHHG 3E89A 3SYOA 4P30A 1L1FA 4RO2A 5CA3A 2FTKA 2M7WA 4JAVA 4MSWC 1NJIW 1YJNV 1VQOV 1V54C 4R8CA 3WG7C 1W2BU 1NR7A 1F4NA 1PNMA 2HG5C 2C2AA 1ENVA 1N8RW 1Y66A 2HLDG 1S3JA 2EILC 4FJCC 4JASA 4PDLA 1YI2V 5IY5C 3NXSA 4RQFA 5L3GA 3OMAB 3SPJA 2ZD9A 3D36A 2H8PC 4TSFG 3ZCCA 2BOCC 3OMIB 3QO8A 4JYCA 4ZKIA 3QO7A 1VQKV 2X6AA 3OE7G 4P9PA 3FYIB 3OEEG 1AJQA 3CCSV 1QLNA 2EIJC 4QNHB 1IXMA 4TWKA 1I5YA 1Q81W 1WLEA 1XL6A 1R6NA 1E1RG 4PELA 1OZ0A 3LNMB 5LGNA 1OCOC 3UKMA 3DGEA 3UM7A 5LHIA 3E35A 2GHYA 2X0LA 1H8EG 4WFEA 2B1GA 3ZJZA 1RPRA 2IH1C 4J9ZB 2Z5UA 4R6ZA 1THZA 3W7WA 3ZMTA 2ITDC 5IY5B 2ZR2A 3FB5C 4JGSA 3ABTA 2Q68A 3X2QB 3K03A 1MABG 1K5QA 3HB3B 3JD0A 2HR3A 1QVGU 2Y69C 1V54B 4RAIA 3WG7B 3SPGA 2D3OW 2IU3A 1KC8W 2EZPA 2DYSC 1FS0G 3CC2V 2R9RB 2YEVB 2QE7G 1EZJA 1NQTA 1PNLA 3FB8C 3T2MA 3ZRVA 3AEIA 4XDKA 5H6QA 4GX1A 3P32A 1G8MA 3ZMVA 1QBZA 1QCEA 4MVZA 5CBHA 3MD0A 3SYQA 2WLNA 3ASOC 1GK9A 4X88A 1SESA 1M56B 3SPCA 3ML0A 3K06A 1OCZC 1JCHA 2NNUA 2W6IG 3E83A 3K79A 3A0RA 1E1QG 1GM8A 2Y69B 2EIKC 1I5XA 2WPDG 2QTOA 4MVOA 3ETGA 3STZC 1K5SA 3CCUV 2P7TC 4LC1A 2WLMA 2Z3YA 4R7CA 4UVCA 2QM8A 5KA5A 2YSUB 5DN6G 3LSQA 1BMFG 1FXKA 2DQ0A 4X89A 2CK3G 2DYSB 4QE7A 3AG3C 3E2EA 4HAMA 3LDEA 3B77A 3K0GA 1OCOB 2NLJC 3D3IA 4YXWG 3ZMSA 3X2QC 1JX9A 1OCRB 2LP7A 2WLIA 1KKDA 5E1AC 1H2GA 1GTOA 4UVAA 4Z1MG 4J9YB 3ZRWA 1F51A 1OCCB 3ETEA 5C93A 5B3SC 3SPHA 1M1KW 4FPPA 1S0VA 1YHQV 5B1OA 2XAGA 2OCCC 3SYPA 3OFNG 5EBWC 1VQ5V 1OCCC 3SYAA 1Y4MA 4WFBV 1H8HG 5CN0A 3RVZA 2UXNA 1K3EA 5B1AB 2LFRA 1VQPV 2XOKG 1CPYA 2DWDC 2XAJA 1DTOA 2DWEC 3ZMUA 1AI6A 3JCZA 4QE9A 1HWYA 3ABKB 1PL0A 2WLLA 4WF9V 5DM6V 1AI5A 1COWG 4MVUA 3ABLB 1J95A 2IH3C 4JF3A 1H38A 3ETDA 2EILB 4OXSA 3JD2A 4MTFA 4JAUA 3SPIA 1VQLV 4G27B 1ROPA 3ABMC 2EIKB 4L87A 4MVMA 2IJHA 5LBQA 5CBGA 1OCZB 3RVYA 3IC7A 1GM9A 3ASOB 3TETA 2P6JA 2JK5C 3GWOA 5CBFA 4RQEA 1K7DA 1BHAA 3K04A 1VQ8V 1CEZA 2EIMC 2A79B 5LHHA 1GMGA 1QR9A 2QM7A 2ZXWB 1LNQA 3G71V 4QPKA 4DXWA 3W7XA 2B5UA 3CMEV 2V1DA 3FB7C 3AG4C 3TCUA 3W7UA 1R3JC 3CC7V 2GSMB 3CD6V 4N21A 3MHHC 5H6RA 1BHBA 2P90A 5EC1C 1AI4A 1KP2A 3AG2C 2WAMA 2K1EA 2WLHA 4MT8A 2AHZA 3TK1A 3CPWU 1VQNV 3FKSG 3OUSA 1KECA 1PD3A 3OUFA 1JOYA 3W7SA 1K4CC 4GX5A 1JQ0A 3BEHA 4KUMA 5IYCO 5B1AC 4ASUG 5CMUA 3AG1C 3CC4V 4BIUA 4BIZA 2F43G 1M57B 4GT1A 1SERA 4XBFA 4P9OA 2KB1A 5B1BC 3EFFK 1W0JG 2EINC 3M99B 4WFGA 2HVKC 1Q86W 3GB7C 5LGTA 4FIPC 4PDMA 3IFXA 3K08A 3CCQV 3CYOA 1M9NA 1QLEB 5LHGA 2DYRC 3T4ZA 4QJFB 1W0KG 3FB6C 3RBZA 2XASA 5L3BA 4MTOA 1YIJV 1VQ4V 3PJSK 2ZQMA 5HFLA 1ZWIC 1QVFU 1RM1C 1NVPB 1JPXA 3CP1A 2UXXA 3OR6C 1RPOA 4E2LA 1Q82W 3W7TA 3R65A 3IGAC 4U7OA 1SZTA 3ASNB 5EBMC 4H33A 4JTAB 1K4DC 3LUTB 3OGCC 1JVMA 3MHSC 3VOUA 2ZXWC 1VQ6V 5BZBA 3EHBB 2WWWA 2JJ1G 3F5WC 3OAAG 4RUEA 1K97A 4LP8A 4QPJA 1R3KC 2PI5A 4U7NA 1NKDA 2JEXA 4GX2A 3H01A 3K9AA 1KP3A 3E8FA 5KUMA 1MG1A 3JYCA 4UXNA 4WFHA 4MW3A 5LGUA 4UV8A 5H9CA 4I9WA 1CP9A 4WFAV 3OM3B 2JEUA 4PA7A 2EIMB 1F4MA 3JD1A 3WFVA 4CBCA 4RUFA 2ZR3A 2EJRA 3JD3A 1KD1W 3F7VC 1NBMG 1B6QA 4KFMA 2DW4A 3G6EV 1K73W 1AR1B 2QA4V 5L3EA 2Q69A 1M90W 3ZRSA 4F4LA 1JJ2U 3ABKC 4MW8A 3SJQC 1GKFA 3B8NA 5GW7A 4X8AA 3HPLC 3E8BA 2WLJA 4FK5C 3ZIAG 2OTLV 5EBLC 3ABLC 4DO2A 2Q6AA 4GCZA 1MOFA 2EBOA 2W6JG 2XAQA 5EC2C 4XDJA 2DYRB 1E79G 1QLEC 3ABUA 4EKWA 3ZRWB 2HFEC 4MS2A 2JIZG 5B3SB 1YTFD 4HZ3A 4LCUC 3OW2U 1K8AW 2EZOA 1K92A 3CMAV 2EINB 1WPXA 1R73A 3E8GA 4FMTA 5L3DA 1DF4A 2IJKA 3OMNB 3K3WA 2LFSA 1FXVA 2W0FC 2WLKA 1AJPA 5B1NA 4PA9A 4PA6A 3CCEV 1PNKA 4PA3A 1R3IC 2QEXV 1VQMV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6J A;  3MHS C;  3GWO A;  5HFM A;  2LP7 A;  2EZO A;  1I5Y A;  1K33 A;  3B8N A;  1QR9 A;  1I5X A;  4JPR A;  2EZP A;  1JQ0 A;  1ENV A;  3CYO A;  1Y66 A;  5HFL A;  4JF3 A;  4FK5 C;  2MK3 A;  1DF4 A;  3H01 A;  3K9A A;  5KA5 A;  5CMU A;  4FJC C;  1EBO A;  1MG1 A;  1QR8 A;  1JPX A;  1K34 A;  3CP1 A;  3P30 A;  4N23 A;  2OT5 A;  4G2K A;  4E2L A;  2X7R B;  1F23 A;  4N21 A;  5H9C A;  1DF5 A;  3MHH C;  1Y4M A;  1DLB A;  3M99 B;  1MOF A;  2EBO A;  5CN0 A;  5KA6 A;  1QBZ A;  1QCE A;  1SZT A;  3WFV A;  4FIP C;  4JGS A;  3B77 A;  2M7W A;  3B8M A; 
#chains in the Genus database with same CATH topology
 4FVM A;  1VEW A;  1MA1 A;  3K58 A;  1XL4 A;  1YEW A;  2NR5 A;  4QIW F;  2Q7E A;  5J9P C;  1V55 B;  2PGG A;  3NR7 A;  5JWP A;  1MNG A;  2HKO A;  2DN9 A;  1K34 A;  4PHZ A;  2P5O A;  3FYE B;  3Q4H B;  3QNE A;  3I56 V;  3DTU B;  1P4R A;  4UCR A;  1NT2 B;  3A8T A;  3DSQ A;  1HDJ A;  4L8J A;  3H1J H;  2V7Q G;  1GO3 F;  3N2G B;  4ZHQ B;  5IDJ A;  1P7B A;  1TGO A;  4WFF A;  4LF4 B;  3WB2 A;  3ASN C;  1TUE B;  4JI4 O;  4TQD A;  3DXR B;  4FZ0 A;  4I0X A;  4XDL A;  2Q7H A;  4LR3 A;  5B66 Z;  1Q5O A;  4G2K A;  4I7Z B;  4Q20 A;  4OX9 O;  4CS3 A;  2E76 B;  2R9I A;  1YTF B;  4DR5 O;  4ZI7 A;  4MTG A;  5KX5 A;  4ZBM A;  1DK1 A;  4DUZ O;  4PDR A;  3E86 A;  1OCR C;  2WSS G;  5ITZ A;  1EN5 A;  1YCI A;  2BOB C;  1IUR A;  1G6U A;  3AG1 B;  4DR7 B;  4X20 B;  1FFT B;  3OT7 A;  1FFX B;  4CH3 A;  3AK1 A;  4LBE C;  4DV4 O;  3E8H A;  1AR5 A;  5KUK A;  3CCL V;  4JTD B;  3R66 A;  1G4Y B;  2HVJ C;  2VQF B;  1ZX3 A;  1NH2 B;  3OR7 C;  4CS4 A;  3OEH G;  1ORQ C;  2MK3 A;  4PI2 A;  5LXT B;  1YSC A;  1VMG A;  4DR2 O;  1FXK B;  1WB8 A;  4UB8 Z;  2DQ3 A;  4Z1V A;  4B7E A;  3QO5 A;  3RW0 A;  1IBK O;  4P30 A;  1L1F A;  5CA3 A;  3RYH A;  1BQZ A;  1N34 O;  5E79 Z;  1NR7 A;  4GUN A;  1ENV A;  4JI3 O;  4JAS A;  4GKJ O;  1HR0 O;  3U0Z A;  1IBK B;  4ZKI A;  2EX3 A;  3OE7 G;  3CJH A;  5KMG B;  3OEE G;  1FYJ A;  3JAW A;  3I5D A;  1IXM A;  2VRZ A;  1N33 O;  4IYI A;  4LFB O;  4DR1 B;  4OPA A;  1Q81 W;  1OZ0 A;  1OCO C;  2W0X A;  5LHI A;  3DGE A;  2LO1 A;  2X0L A;  2YXL A;  3ZJZ A;  2UUC O;  1BE3 H;  1RPR A;  4NR1 A;  4J9Z B;  4KL1 A;  5LMN O;  3ABT A;  3RYI A;  3X2Q B;  3K03 A;  2HHH O;  3CB2 A;  3WB0 A;  2ZIO A;  3KCY A;  2HP8 A;  3SPG A;  3BPZ A;  2QR4 A;  2YEV B;  2QE7 G;  1NQT A;  1PNL A;  3FB8 C;  3Q4H A;  1XRE A;  4ICG A;  4XDK A;  1RFY A;  4GX1 A;  4LWS B;  1TVK B;  3ZMV A;  2ETN A;  1BGY H;  3KCX A;  3UT5 B;  3MD0 A;  2WLN A;  3T1H B;  3ASO C;  1GK9 A;  4X88 A;  4X65 B;  1SES A;  4AIL C;  3SPC A;  3F5T A;  2NNU A;  2W6I G;  3E83 A;  4X64 B;  1GM8 A;  4JYA B;  4FLZ A;  1Q90 D;  2QTO A;  4IIJ B;  3BFR A;  1K5S A;  3SR2 C;  4B3R B;  2G38 A;  2DOS A;  1BMF G;  1FXK A;  3QG5 A;  5LYJ B;  4X20 A;  5IJ9 A;  4U3J B;  3SJA C;  3CXH F;  3E22 B;  4IL6 Z;  1W59 A;  2NLJ C;  4YXW G;  3ZMS A;  4FM1 A;  1XDC A;  1JX9 A;  5E1A C;  4DV5 O;  1GTO A;  2OIG A;  2YIB D;  3SPH A;  4FPP A;  1S0V A;  1Y6X A;  2XAG A;  2OCC C;  2P22 C;  1RSO B;  1SQF A;  3ETQ A;  4UCT A;  2GV9 A;  1OCC C;  3FD9 A;  4DV2 B;  5CN0 A;  4JV5 B;  4B3T O;  3RVZ A;  2MW2 B;  4UCU A;  3OD4 A;  5B1A B;  2LFR A;  1SS3 A;  3ZHV A;  3APO A;  1VIB A;  1DTO A;  3ZMU A;  3JCZ A;  4DR2 B;  1PL0 A;  4ZOL B;  4MVU A;  3T1Y O;  2ZM6 O;  4KXR A;  1ZTE A;  1J95 A;  1HNX B;  2H3O A;  1XMO B;  5IWA O;  1WJZ A;  4PD4 F;  4JAU A;  3SPI A;  4X65 O;  3AK2 A;  3BA8 A;  4LNU A;  4JI0 B;  2B9Z A;  4L87 A;  4MVM A;  5LBQ A;  5JVD B;  3IC7 A;  4DUY B;  1GM9 A;  3SJC C;  1U96 A;  4NTY A;  3TET A;  2JK5 C;  5LOV A;  2YDE A;  1VQ8 V;  1CEZ A;  2EIM C;  3JAR A;  2EUL A;  3W7X A;  4O4J B;  2RMK B;  3FB7 C;  3CD6 V;  2AXT Z;  2HHH B;  4GYC B;  4F6E A;  3MHH C;  3WB1 A;  2P90 A;  3A2F A;  1ZUQ A;  2UXD B;  3OUS A;  1KEC A;  3OUF A;  5A2Q N;  4NKG B;  2BTQ B;  4DV0 B;  4LF4 O;  5B1B C;  4C7U A;  4KHP O;  4WFG A;  1P49 A;  3JAK B;  1Q86 W;  2CUG A;  5IYZ A;  1M9N A;  1N0N A;  4B3M B;  1L8D A;  2ZNJ A;  4MTO A;  2CTP A;  4DV7 B;  4JZ2 A;  2QGN A;  4ABM A;  4X1Y B;  1N34 B;  1NVP B;  2UXX A;  2BCC H;  2CTW A;  3RYC A;  4JZG A;  5EBM C;  4H33 A;  4FFB A;  3FAV A;  4FLX A;  3UO2 A;  1JVM A;  3VOU A;  3EHB B;  2WA4 A;  1XUQ A;  5CA0 A;  2ZE8 A;  1K97 A;  4LP8 A;  4UCO A;  1PL4 A;  2JEX A;  3B4S A;  4DV2 O;  4UXN A;  2P4K A;  4UV8 A;  4I9W A;  1CP9 A;  4LH6 A;  3OM3 B;  2JEU A;  1F4M A;  1XNR B;  2QWR B;  2ZNI A;  3DC5 A;  2EJR A;  4K35 A;  1N32 O;  1NBM G;  2RCV A;  1YF2 A;  4LF8 B;  2P06 A;  1M90 W;  4K0K B;  4F4L A;  5K1X A;  3B8N A;  5EZY B;  5BMV B;  4X8A A;  4JI5 O;  1ZL8 A;  4GKK O;  2IM9 A;  2PYL A;  1G1X B;  1D2D A;  3S3X A;  1AB3 A;  5EBL C;  4DO2 A;  5KHJ A;  4AQY O;  5EYP B;  2F93 B;  1MOF A;  2CGO A;  5EC2 C;  2Y4T A;  1NTK H;  1QLE C;  4MS2 A;  1YTF D;  2WA3 A;  3OW2 U;  4JI6 O;  1K8A W;  2EZO A;  1SQQ H;  2EIN B;  3BHP A;  1CXZ B;  1R73 A;  5C8Y B;  3E8G A;  4FMT A;  3B2E E;  3D36 C;  4D6T H;  2LFS A;  2WLK A;  4PA6 A;  4GKK B;  3JSN A;  3ZHS A;  1R3I C;  1H2M A;  5KHG A;  1VF6 C;  2YUA A;  1SZX A;  1NI8 A;  1GM7 A;  4J41 A;  1TAE A;  3LNN A;  1MSW D;  2Q4P A;  4BW5 A;  3CCR V;  3TXS A;  1Q43 A;  3OTF A;  2RJZ A;  2ATK C;  2QKS A;  2OT5 A;  4JAA A;  2YS8 A;  1FXK C;  4UVB A;  4Z2W A;  1YIT V;  3B8M A;  2ZE7 A;  4K0K O;  5HFM A;  3DC6 A;  4PI0 A;  3ICX A;  2JDI G;  4MVR A;  4DW0 A;  1UJW B;  2X6C A;  1XEQ A;  1RM1 B;  4D7T A;  4NXN O;  1F23 A;  5L3F A;  1DLB A;  1MSD A;  3E22 A;  4G28 B;  2H94 A;  2XAF A;  3LDC A;  1S76 D;  4LWS A;  5JH7 B;  3HKD A;  3VQW A;  3ZS8 C;  2PI4 A;  2OCH A;  2VQE B;  3J7A U;  2LW7 A;  4O2B B;  2XND G;  3G4S V;  5B1B B;  2A0L A;  1M57 C;  4EEQ A;  3CCV V;  4CZZ A;  2UU9 B;  4OPH A;  1Q7Y W;  4EFB A;  5KA6 A;  2IBZ H;  4J10 A;  3IJ4 A;  3K59 A;  4LF9 O;  4P2Z A;  4YJ3 B;  2JGD A;  3BAB A;  3CRQ A;  2JGU A;  4NXN B;  4B3M O;  4YIP A;  1S72 V;  2YIB A;  4MTX A;  1D5N A;  4LF7 B;  4PV1 B;  3SDL A;  1BSM A;  2A9H A;  3A0H Z;  4U3F H;  2P67 A;  3ABM B;  4JI1 B;  5D5Q A;  5FLX N;  1Q6I A;  4TV8 A;  3S3W A;  4RO2 A;  2YIC A;  1Z2G A;  2FTK A;  4B3S O;  4JAV A;  4J7J A;  1FD9 A;  2GUZ A;  4R8C A;  1PNM A;  5LA6 A;  3H9V A;  2C2A A;  5DED A;  1Y66 A;  5J2T B;  2HLD G;  2EIL C;  4OX9 B;  4YJ2 A;  4PDL A;  5IY5 C;  4RQF A;  3ZHR A;  1XMO O;  1IVS A;  3SPJ A;  3D36 A;  4U3J A;  1SA0 A;  3QO8 A;  4DR6 O;  3QO7 A;  1VQK V;  4K8Z A;  4JI1 O;  5JQG B;  5IE9 A;  1JFF A;  5JQG A;  1KB9 F;  3K5M A;  1WLE A;  2Y4U A;  1XL6 A;  4DV1 O;  4B3T B;  1PV0 A;  3E35 A;  2GHY A;  4FLW A;  2B1G A;  5J2U A;  2UUA O;  2IH1 C;  1THZ A;  3RYI B;  1M93 A;  3ZMT A;  5IY5 B;  2ZR2 A;  1WNS A;  3HR0 A;  1MAB G;  2UU9 O;  4O2A A;  4AQY B;  2HR3 A;  1QVG U;  2Y69 C;  4X62 B;  5LXT A;  3WG7 B;  2D3O W;  2EZP A;  3H1L H;  2DYS C;  1FS0 G;  4JV5 O;  1IBL O;  3AK3 A;  5D5P A;  5JCO C;  4OGQ B;  3ZRV A;  3AEI A;  2L35 A;  4MVZ A;  1QCE A;  1XNR O;  5CBH A;  1O9G A;  3J81 N;  2E75 B;  1NTZ H;  1PPJ H;  2CH7 B;  3K06 A;  1OCZ C;  3K79 A;  3A0R A;  2Y69 B;  1SQX H;  4K8X A;  4MVO A;  1GN4 A;  5GTH Z;  3RGB A;  3RT3 C;  2WLM A;  5KA5 A;  4X89 A;  2DYS B;  3OTO O;  1AR4 A;  3E2E A;  4IYH A;  1H2K A;  3K0G A;  4X64 O;  2WLI A;  4LF6 O;  2LGQ A;  1H2G A;  4Z1M G;  2BSK A;  3ZRW A;  2OWO A;  4Q6G A;  5B3S C;  5B1O A;  3SYP A;  1QHT A;  3TXQ A;  5LMU O;  1Y4M A;  4I4T B;  2UXN A;  4NVP A;  1K3E A;  1AVM A;  2XOK G;  2DWE C;  4IT5 A;  3ABK B;  2ZE6 A;  3CE2 A;  4WF9 V;  1B04 A;  3ABL B;  2F23 A;  1H38 A;  2CTR A;  3ETD A;  4OXS A;  3JD2 A;  1B06 A;  1VQL V;  1ROP A;  4K3A A;  3L73 H;  3J80 N;  1GMG A;  1QR9 A;  5ITZ B;  4FFB B;  2B5U A;  4WBN A;  2V1D A;  1JMK C;  3RYC B;  3W7U A;  1R3J C;  3ZX6 A;  4LF8 O;  1NZ6 A;  5H6R A;  1N32 B;  5EC1 C;  2Q9L A;  3AG2 C;  1J5E B;  1I08 A;  4B7K A;  1O9H A;  5KLV H;  3W7S A;  3ZBH A;  3BEH A;  3IAY A;  5IYC O;  4ASU G;  4GT1 A;  3QVN A;  3M99 B;  5IJ9 B;  3GVM A;  5LGT A;  2QSA A;  3D3Q A;  3CS5 A;  3IFX A;  3CCQ V;  5BMV A;  1TUB A;  2VQF O;  1NS1 A;  4O2B A;  1S5J A;  1B3Q A;  1W0K G;  2Z0A A;  2ZQM A;  2RDC A;  5HFL A;  1ZWI C;  2KSD A;  1JPX A;  3CP1 A;  1WA8 A;  4U7O A;  3HKB A;  1BQ0 A;  5CA1 B;  1K4D C;  1GN6 A;  3LUT B;  3UO3 A;  4JI4 B;  3K5L A;  5CA0 B;  3MHS C;  5BZB A;  2WWW A;  2JJ1 G;  5BR8 O;  3OAA G;  3CWB H;  4QPJ A;  1BS3 A;  1JA8 A;  2PI5 A;  4FLV A;  5EIB C;  3H01 A;  3K9A A;  3JYC A;  4WFH A;  4MW3 A;  5LGU A;  4TV9 B;  2XTA A;  4PA7 A;  3A0B Z;  4AI8 A;  3BVO A;  4RUF A;  2ZR3 A;  3JD3 A;  2LGW A;  3HKE A;  4KFM A;  2DW4 A;  3HKC B;  1UFI A;  3TJT A;  4LFA O;  1JJ2 U;  4F6R A;  1VF6 A;  4WBN B;  4TUY B;  4TUY A;  4B08 A;  4GZR B;  3ZIA G;  3OTO B;  1RSO A;  1TA8 A;  2Q6A A;  4GCZ A;  4TQF A;  1Y76 A;  3CRC A;  2O57 A;  4XDJ A;  5CA1 A;  3N27 A;  2DYR B;  4EKW A;  4NYK A;  1AIL A;  4LF6 B;  2ZIM A;  4LF5 B;  1K92 A;  2QWO B;  2ZIN A;  1DF4 A;  2IJK A;  3K3W A;  1FXV A;  1AJP A;  5B1N A;  2RQ6 A;  1JJO A;  1TUB B;  3CCE V;  4PA3 A;  4CS2 A;  2ADP A;  3JAL A;  1AJN A;  3APQ A;  4IGG A;  4LF5 O;  3RWR D;  5B5E Z;  1YJW V;  1SQG A;  4JYB A;  4DV7 O;  1A32 A;  1VAR A;  3AG4 B;  3B40 A;  3ZRX A;  4JI8 B;  1HNW B;  2UUA B;  1BL8 A;  2RN9 A;  4HYO A;  2QM4 A;  1VQ7 V;  1V55 C;  1VQ9 V;  2YEV A;  2KG7 A;  1YJ9 V;  1US6 A;  2QKA A;  4I4T A;  4J80 A;  2GDS A;  5FNV A;  2AZ2 A;  4YHH B;  2VWK A;  1EFR G;  2JJ2 G;  1SRY A;  1QQC A;  3H1H H;  4NB5 A;  4I55 A;  4JPR A;  1SC5 B;  4JI2 B;  4H37 A;  1SET A;  4JYA O;  1S5H C;  1EBO A;  2F95 B;  2IW5 A;  4PA4 A;  4FLY A;  2CH7 A;  3SYC A;  3VBB A;  4X66 O;  4BAY A;  5EK0 A;  2ZDI C;  3KZI Z;  1PKX A;  3M8A A;  2IU0 A;  4ZOL A;  2R70 A;  1XI1 A;  4HNA B;  3ZN0 A;  3CXC U;  3JAW B;  3BY6 A;  1S77 D;  5IYD O;  2UXC B;  4DUZ B;  2ZDI A;  4UUJ C;  3G6B A;  1FJG B;  3STL C;  3BA9 A;  3CCJ V;  3T1C A;  1NH2 D;  1K9M W;  3T4D A;  3AG2 B;  5L3C A;  2GTS A;  2KQX A;  1M56 C;  1J5E O;  2LJ2 A;  1NVP D;  3F7Y C;  1TVK A;  2BSK B;  1Q6U A;  5IYB O;  1JFF B;  2DE0 X;  3H1K H;  2Y48 A;  3E89 A;  3SYO A;  4IIJ A;  1KBH A;  2HJD A;  3JAR B;  1XMQ O;  3JAS A;  1HR0 B;  4DR3 B;  1VQO V;  4H0L B;  3WG7 C;  1P84 F;  1D5A A;  2HG5 C;  5LP6 A;  4LF9 B;  5J2T A;  3EVK A;  2RNB A;  4DRX B;  1YI2 V;  1I0H A;  2AZ0 A;  5L3G A;  4PJ0 Z;  1MMM A;  3OMA B;  1I7F A;  1XMQ B;  2H8P C;  4TSF G;  1SA0 B;  2YC0 A;  5LP6 C;  4GLX A;  1UPG A;  2EIJ C;  4QNH B;  5KX5 B;  3RFR A;  1VF5 B;  2VS0 A;  4HNA A;  4TWK A;  2YXH A;  4B3R O;  5KMG A;  1LUV A;  4PEL A;  5LGN A;  4I9Q A;  1QNM A;  3UKM A;  3BCC H;  2E3C A;  2D2C B;  1H8E G;  2JGD B;  4R6Z A;  5BXZ A;  3TGU H;  5K1P A;  3SGI A;  1IXB A;  4ZIB A;  4DR7 O;  1BCC H;  1PP9 H;  4FM2 A;  1V54 B;  4RAI A;  1KC8 W;  3BAA A;  2DJV A;  3VQV A;  2UXC O;  4UB6 Z;  1L0L H;  2KKW A;  5LYJ A;  5JJN B;  1EZJ A;  2XUM A;  5H6Q A;  2CGN A;  4BW9 A;  4LFC B;  3SYQ A;  1H2L A;  4FFK A;  1R6T A;  1QU7 A;  5J2U B;  3ML0 A;  2AGA A;  1JCH A;  4H13 B;  3L9D A;  1KU9 A;  1I5X A;  2WPD G;  1HNX O;  3K9S A;  4LC1 A;  2Z3Y A;  2QM8 A;  3LSQ A;  1N33 B;  3BRC A;  2CK3 G;  3HKD B;  1Y67 A;  1F7Y A;  4QE7 A;  5LL6 Y;  4NTX A;  1EM1 A;  1MZE A;  2CAZ C;  3LDE A;  3B77 A;  1IX9 A;  2Q0A A;  3WU2 Z;  1OJH A;  4DR4 O;  1OCR B;  1LUW A;  2LP7 A;  2N04 A;  1KKD A;  2YI9 A;  2CDY A;  5GON A;  1HW7 A;  3OFN G;  4DR3 O;  2Q73 A;  1WB7 A;  1VQ5 V;  2M6Y A;  4WFB V;  1IBL B;  1H8H G;  4DV1 B;  2PYJ A;  1VQP V;  2QWP B;  5FNV B;  2CE4 A;  4YY3 O;  2FML A;  5DM6 V;  4DR6 B;  4BR6 A;  2IH3 C;  1HNZ B;  3CHX A;  4TV9 A;  1YXB A;  4DRX A;  3M7M X;  4BIO A;  3ABM C;  2EIK B;  3ZHU A;  3AG7 A;  3DXR A;  5CBG A;  1OCZ B;  3RVY A;  4UFZ A;  3ASO B;  1KMI Z;  4JI7 O;  1FJG O;  1K7D A;  1SF9 A;  1BHA A;  5JJE B;  4X9Q A;  5LHH A;  3D8C A;  1ZL8 B;  1FKA O;  5C8Y A;  4FLT A;  2ZXW B;  2DMX A;  3JSL A;  3CME V;  3HKB B;  3AG4 C;  3TCU A;  2GSM B;  1YVW A;  4J42 A;  2LW1 A;  4DV0 O;  1AI4 A;  3K5O A;  3P3N A;  2WAM A;  2K1E A;  2XT9 A;  4O4L B;  2WLH A;  3ZED A;  4X66 B;  2UXD O;  3TK1 A;  3CPW U;  3FKS G;  4CH6 A;  1I94 O;  1XHX A;  2E5L O;  1PD3 A;  1WPB A;  4B3S B;  4GX5 A;  4X1K A;  1XOU A;  4D7S A;  1FFX A;  3L71 H;  2NN4 A;  3CC4 V;  1X59 A;  3AG1 C;  4W4L A;  4BIZ A;  2F43 G;  2FB5 A;  2YID A;  5KHK A;  1SER A;  4XBF A;  1KKC A;  2KB1 A;  4P9O A;  2PF4 E;  2P4V A;  3GB7 C;  4PDM A;  5TIS Z;  3CYO A;  4JYY A;  1QLE B;  2DYR C;  2VQE O;  3HKE B;  1YIJ V;  1YDX A;  1VQ4 V;  2A06 H;  3PJS K;  3N2K B;  4DK1 A;  1RM1 C;  1GAX A;  2PTM A;  4DK0 A;  5AG2 A;  5KHI A;  2ODM A;  3L70 H;  3FAV B;  3IGA C;  1SQV H;  4JTA B;  2JS3 A;  2ZE5 A;  3JAK A;  4YY3 B;  2FL4 A;  2ILM A;  3N2G A;  2BTQ A;  1SQB H;  2KG7 B;  2AW9 A;  4GX2 A;  1KP3 A;  2BTO A;  3E8F A;  5KUM A;  1MG1 A;  1WA8 B;  5H9C A;  1IZ3 A;  3PN1 A;  2EIM B;  1ZAU A;  3T1Y B;  1OV9 A;  3WFV A;  4CBC A;  3F7V C;  3G80 A;  1B6Q A;  2F1M A;  4NXM O;  4IHJ B;  1K73 W;  4HBN A;  1URF A;  4MW8 A;  3SJQ C;  4CC6 A;  2Y0P A;  1LR1 A;  4UCS A;  3SJB C;  3E8B A;  4J11 A;  4DR5 B;  4LFA B;  2OTL V;  4O4H B;  2EBO A;  2XAQ A;  1WP8 A;  2Q0O C;  1E79 G;  3ABU A;  3ZRW B;  2OYQ A;  2JIZ G;  5B3S B;  4O4I B;  4JI6 B;  4I50 B;  4HZ3 A;  4DR4 B;  1H2N A;  5EIB D;  1VF7 A;  2BE3 A;  1WPX A;  3N2K A;  2L6L A;  4LFC O;  1Z5V A;  2PUS A;  5L3D A;  3CRA A;  5BR8 B;  4YHH O;  1HP8 A;  2JVD A;  4PA9 A;  3CRR A;  4LNU B;  1VQM V;  4UV9 A;  1AI7 A;  3AG3 B;  5FL7 G;  2EJ7 A;  4JTC B;  2QKC A;  3OGI B;  4TT3 G;  1R6K A;  3KG2 A;  1RP3 B;  3ZMZ A;  5IJ0 A;  3KKY A;  1SKV A;  2X6B A;  3G67 A;  4JI5 B;  4J7Z A;  2K9P A;  4LFB B;  2WLL B;  3I55 V;  1R1B A;  3JD4 A;  3H1I H;  2A7W A;  2FYU H;  4O4J A;  3IC9 A;  4X1K B;  4KP4 A;  3FX7 A;  2UUC B;  1QR8 A;  4N23 A;  2JRI A;  3ZHT A;  2IJJ A;  4O4L A;  2PZS A;  4DV6 B;  3LSS A;  4JI3 B;  3UT5 A;  2OCC B;  5JVD A;  2R72 A;  2AHY A;  2IJI A;  2UUB O;  1ARO P;  2B1I A;  1FXH A;  4EB6 A;  1GN2 A;  2CTQ A;  3O9O A;  1K33 A;  1KQS U;  1GH6 A;  2ITC C;  2XAH A;  4GX0 A;  5FPR A;  1YZB A;  2HJF C;  5LOV B;  2X7R B;  4MVQ A;  4CH4 A;  1DF5 A;  4YJ2 B;  2E74 B;  2QDO A;  2QWN B;  4R50 A;  4I5S A;  3K0D A;  4WCE V;  1Y74 B;  2EIJ B;  2Q67 A;  4BWA A;  3CCM V;  3P30 A;  1R3L C;  1N0J A;  2WLI B;  2GBO A;  5H2F Z;  4PDV A;  3ZN1 A;  4TOI A;  2OTJ V;  2HEP A;  1P7G A;  3O65 A;  4AHC A;  1Q8I A;  3LDD A;  4KHP B;  3UQ8 A;  1NR1 A;  4MVS A;  2OIE A;  1OHH G;  3CJH B;  2M7W A;  2E5L B;  4H44 B;  4MSW C;  1NJI W;  1N36 B;  1YJN V;  2ZKO A;  1V54 C;  1AP6 A;  1W2B U;  1WN7 A;  1F4N A;  4YJ3 A;  1IBM O;  1XNQ B;  5KHH A;  5GON B;  4DV4 B;  1N8R W;  1S3J A;  4FJC C;  3NXS A;  1VP7 A;  3C90 A;  1N36 O;  1V9P A;  2Y0I A;  2ZD9 A;  3ZCC A;  2BOC C;  3OMI B;  4JYC A;  2ZM6 B;  2X6A A;  4P9P A;  4W4K A;  3FYI B;  3CCS V;  1AJQ A;  1QLN A;  2QWQ B;  1WAZ A;  1I5Y A;  1NTM H;  1R6N A;  1E1R G;  3LNM B;  3UM7 A;  4WFE A;  1JR9 A;  3C3T A;  5JCO A;  1Q3E A;  3W7W A;  2Z5U A;  3U10 A;  3RYH B;  1HNZ O;  2ITD C;  2F4V B;  1AP5 A;  3FB5 C;  4JGS A;  2LQT A;  2Q68 A;  1K5Q A;  3HB3 B;  5H5N A;  3JD0 A;  2IU3 A;  3GWK C;  5BY1 A;  4TV8 B;  3CC2 V;  3JCU Z;  2R9R B;  5KAF Z;  3CX5 F;  3T2M A;  4X1I A;  1FPO A;  4JI8 O;  1HNW O;  2UXB O;  3P32 A;  1G8M A;  1QBZ A;  5IT9 N;  4NTW A;  2F4V O;  4DV6 O;  2GUZ B;  1M56 B;  2N05 A;  1EN4 A;  4E4E A;  2ZCE A;  1E1Q G;  5GTI Z;  2EIK C;  3ETG A;  3STZ C;  3C3S A;  3CCU V;  2P7T C;  4R7C A;  4UVC A;  3L74 H;  2YSU B;  5DN6 G;  2ARH A;  4X1I B;  2DQ0 A;  1X4T A;  2ZT9 B;  3JAS B;  3AG3 C;  4HAM A;  2YI8 A;  1ZLZ A;  1OCO B;  3D3I A;  3X2Q C;  1EZV H;  4O2A B;  4O4I A;  3T1H O;  4UVA A;  5JH7 A;  4J9Y B;  1F51 A;  1KYO F;  1OCC B;  3ETE A;  5C93 A;  1M1K W;  2V4D A;  2XHB A;  4I55 B;  3ZHQ A;  3JAM N;  4CH5 A;  5F2V O;  5LP6 B;  1YHQ V;  2ADQ B;  1IBM B;  1XNQ O;  4O4H A;  5EBW C;  2VWJ A;  3SYA A;  1KUQ A;  4ZHQ A;  3FFQ A;  4LH7 A;  4DW1 A;  4UCV A;  1N4C A;  1EN6 A;  3U11 A;  1CPY A;  2DWD C;  2XAJ A;  1AI6 A;  4QE9 A;  1HWY A;  1T5E A;  4QGP A;  2WLL A;  1AI5 A;  1COW G;  3THO A;  4JF3 A;  3MAQ A;  2A3Q A;  3P3P A;  2EIL B;  4MTF A;  2QTS A;  5IJ0 B;  4GKJ B;  4G27 B;  2Q7G A;  1M4U A;  3JAT A;  3QTC A;  2IJH A;  1Y76 B;  5LA6 B;  4DR1 O;  3CSX A;  2UXB B;  2P6J A;  3GWO A;  5CBF A;  4RQE A;  3K04 A;  2A79 B;  5DEC A;  2QM7 A;  1LNQ A;  3VQY A;  5CB4 A;  4QPK A;  4DXW A;  3G71 V;  4X62 O;  4ZI7 B;  3CC7 V;  2JS5 A;  4NXM B;  4YIO A;  4A5U B;  2Q8V A;  4N21 A;  1BHB A;  1KP2 A;  3CRM A;  4DV3 B;  1IDS A;  4JI0 O;  5FPO A;  4MT8 A;  1H2S B;  3QF7 A;  2AHZ A;  4I50 A;  1VQN V;  1JOY A;  1Y74 A;  1K4C C;  3CEI A;  1JQ0 A;  4I0X B;  1Q6H A;  4KUM A;  5B1A C;  4F6R B;  4RWU A;  5CMU A;  1BZK A;  3EXA A;  4BIU A;  1PM9 A;  2YIA A;  3HKC A;  1M57 B;  3K57 A;  3EFF K;  1W0J G;  2EIN C;  3JAL B;  2HVK C;  4FIP C;  3K08 A;  4FLU A;  4EB6 B;  5LHG A;  3T4Z A;  4QJF B;  3FB6 C;  3RBZ A;  2XAS A;  5L3B A;  1U97 A;  4DV3 O;  4DYL A;  1BT8 A;  1SQP H;  1QVF U;  3L72 H;  4DV5 B;  4J7K A;  3OR6 C;  2Q5Z A;  1RPO A;  1FAF A;  1M5I A;  4E2L A;  1Q82 W;  3W7T A;  3R65 A;  3RYF A;  1Z5W A;  1SZT A;  3ASN B;  3VQX A;  3RYF B;  4CC5 A;  1ZSP A;  2QJ1 A;  3OGC C;  3K5N A;  2YXY A;  2ZXW C;  1VQ6 V;  1XQ8 A;  3UCS C;  4IHJ A;  3F5W C;  5KAI Z;  4RUE A;  1R3K C;  3MDS A;  4FM0 A;  2F66 C;  4LF7 O;  4U7N A;  1NKD A;  1I94 B;  2R9A A;  4WFA V;  4JI2 O;  3JD1 A;  1KD1 W;  5A9G A;  5JJJ B;  3G6E V;  1AR1 B;  2QA4 V;  5L3E A;  2Q69 A;  3ZRS A;  2FKX A;  1XBL A;  3ABK C;  1GKF A;  5GW7 A;  1GN3 A;  3HPL C;  5CB4 B;  2WLJ A;  4FK5 C;  5LMU B;  1WP7 A;  3ABL C;  4JI7 B;  4X1Y A;  2UUB B;  1L0N H;  4DUY O;  2W6J G;  3LSU A;  2N74 A;  4FZ1 A;  3RN4 A;  1MZF A;  5LMN B;  1XHZ A;  2HFE C;  3L75 H;  4EFE A;  4LCU C;  5IWA B;  1GRJ A;  5IYZ B;  3CMA V;  1DGS A;  1XIL A;  5EYP A;  3OMN B;  2W0F C;  1S5L Z;  2GTA A;  2PY5 A;  1PNK A;  2QEX V;  5EZY A;  3JAT B;  3B09 A;  1NU1 H; 
#chains in the Genus database with same CATH homology
 1AJN A;  1GM7 A;  4UV9 A;  1YJW V;  1XL4 A;  1AI7 A;  3AG3 B;  5FL7 G;  4QIW F;  1MSW D;  5J9P C;  4JYB A;  4JTC B;  1V55 B;  4BW5 A;  4TT3 G;  3CCR V;  1R6K A;  3KG2 A;  3AG4 B;  2HKO A;  3ZMZ A;  3ZRX A;  2ATK C;  1K34 A;  2QKS A;  1BL8 A;  3FYE B;  2OT5 A;  4HYO A;  3QNE A;  3I56 V;  1VQ7 V;  1V55 C;  1VQ9 V;  3DTU B;  1P4R A;  2YEV A;  2X6B A;  1YJ9 V;  1FXK C;  2V7Q G;  1GO3 F;  4UVB A;  5IDJ A;  1P7B A;  1YIT V;  3B8M A;  2WLL B;  3I55 V;  3JD4 A;  5HFM A;  4WFF A;  1EFR G;  2JJ2 G;  2JDI G;  3ASN C;  1SRY A;  1TUE B;  4MVR A;  4JPR A;  4XDL A;  4KP4 A;  4H37 A;  1UJW B;  1SET A;  2X6C A;  1S5H C;  1EBO A;  2IW5 A;  1QR8 A;  4PA4 A;  1RM1 B;  4N23 A;  4G2K A;  3SYC A;  1F23 A;  3VBB A;  2IJJ A;  4Q20 A;  5L3F A;  4BAY A;  1DLB A;  5EK0 A;  2ZDI C;  4G28 B;  3LSS A;  1PKX A;  2OCC B;  2AHY A;  2H94 A;  2IJI A;  2R9I A;  2IU0 A;  1YTF B;  2XAF A;  3LDC A;  1S76 D;  1ARO P;  2B1I A;  2PI4 A;  1FXH A;  3ZN0 A;  3CXC U;  4MTG A;  4ZBM A;  3BY6 A;  1K33 A;  2XND G;  5IYD O;  3G4S V;  1KQS U;  1S77 D;  2ITC C;  3E86 A;  2XAH A;  4GX0 A;  4PDR A;  1OCR C;  2WSS G;  5B1B B;  2BOB C;  2A0L A;  1M57 C;  2HJF C;  3CCV V;  2ZDI A;  3AG1 B;  4UUJ C;  4CZZ A;  1FFT B;  2X7R B;  3STL C;  4MVQ A;  1DF5 A;  1Q7Y W;  4R50 A;  4I5S A;  5KA6 A;  3CCJ V;  3K0D A;  4LBE C;  3T1C A;  1NH2 D;  3E8H A;  1K9M W;  4WCE V;  3T4D A;  5KUK A;  2EIJ B;  2Q67 A;  4P2Z A;  3CCL V;  3CCM V;  3P30 A;  1R3L C;  4JTD B;  2WLI B;  1G4Y B;  2HVJ C;  1S72 V;  3AG2 B;  4PDV A;  3ZN1 A;  5L3C A;  2OTJ V;  1NH2 B;  3OR7 C;  4MTX A;  1M56 C;  3OEH G;  1NVP D;  1ORQ C;  3F7Y C;  2MK3 A;  2A9H A;  1YSC A;  3LDD A;  5IYB O;  1NR1 A;  1FXK B;  2P67 A;  4MVS A;  3ABM B;  2DQ3 A;  3QO5 A;  2Y48 A;  3RW0 A;  1OHH G;  3E89 A;  3SYO A;  4P30 A;  1L1F A;  4RO2 A;  5CA3 A;  2FTK A;  2M7W A;  4JAV A;  4MSW C;  1NJI W;  1YJN V;  1VQO V;  1V54 C;  4R8C A;  3WG7 C;  1W2B U;  1NR7 A;  1F4N A;  1PNM A;  2HG5 C;  2C2A A;  1ENV A;  1N8R W;  1Y66 A;  2HLD G;  1S3J A;  2EIL C;  4FJC C;  4JAS A;  4PDL A;  1YI2 V;  5IY5 C;  3NXS A;  4RQF A;  5L3G A;  3OMA B;  3SPJ A;  2ZD9 A;  3D36 A;  2H8P C;  4TSF G;  3ZCC A;  2BOC C;  3OMI B;  3QO8 A;  4JYC A;  4ZKI A;  3QO7 A;  1VQK V;  2X6A A;  3OE7 G;  4P9P A;  3FYI B;  3OEE G;  1AJQ A;  3CCS V;  1QLN A;  2EIJ C;  4QNH B;  1IXM A;  4TWK A;  1I5Y A;  1Q81 W;  1WLE A;  1XL6 A;  1R6N A;  1E1R G;  4PEL A;  1OZ0 A;  3LNM B;  5LGN A;  1OCO C;  3UKM A;  3DGE A;  3UM7 A;  5LHI A;  3E35 A;  2GHY A;  2X0L A;  1H8E G;  4WFE A;  2B1G A;  3ZJZ A;  1RPR A;  2IH1 C;  4J9Z B;  2Z5U A;  4R6Z A;  1THZ A;  3W7W A;  3ZMT A;  2ITD C;  5IY5 B;  2ZR2 A;  3FB5 C;  4JGS A;  3ABT A;  2Q68 A;  3X2Q B;  3K03 A;  1MAB G;  1K5Q A;  3HB3 B;  3JD0 A;  2HR3 A;  1QVG U;  2Y69 C;  1V54 B;  4RAI A;  3WG7 B;  3SPG A;  2D3O W;  2IU3 A;  1KC8 W;  2EZP A;  2DYS C;  1FS0 G;  3CC2 V;  2R9R B;  2YEV B;  2QE7 G;  1EZJ A;  1NQT A;  1PNL A;  3FB8 C;  3T2M A;  3ZRV A;  3AEI A;  4XDK A;  5H6Q A;  4GX1 A;  3P32 A;  1G8M A;  3ZMV A;  1QBZ A;  1QCE A;  4MVZ A;  5CBH A;  3MD0 A;  3SYQ A;  2WLN A;  3ASO C;  1GK9 A;  4X88 A;  1SES A;  1M56 B;  3SPC A;  3ML0 A;  3K06 A;  1OCZ C;  1JCH A;  2NNU A;  2W6I G;  3E83 A;  3K79 A;  3A0R A;  1E1Q G;  1GM8 A;  2Y69 B;  2EIK C;  1I5X A;  2WPD G;  2QTO A;  4MVO A;  3ETG A;  3STZ C;  1K5S A;  3CCU V;  2P7T C;  4LC1 A;  2WLM A;  2Z3Y A;  4R7C A;  4UVC A;  2QM8 A;  5KA5 A;  2YSU B;  5DN6 G;  3LSQ A;  1BMF G;  1FXK A;  2DQ0 A;  4X89 A;  2CK3 G;  2DYS B;  4QE7 A;  3AG3 C;  3E2E A;  4HAM A;  3LDE A;  3B77 A;  3K0G A;  1OCO B;  2NLJ C;  3D3I A;  4YXW G;  3ZMS A;  3X2Q C;  1JX9 A;  1OCR B;  2LP7 A;  2WLI A;  1KKD A;  5E1A C;  1H2G A;  1GTO A;  4UVA A;  4Z1M G;  4J9Y B;  3ZRW A;  1F51 A;  1OCC B;  3ETE A;  5C93 A;  5B3S C;  3SPH A;  1M1K W;  4FPP A;  1S0V A;  1YHQ V;  5B1O A;  2XAG A;  2OCC C;  3SYP A;  3OFN G;  5EBW C;  1VQ5 V;  1OCC C;  3SYA A;  1Y4M A;  4WFB V;  1H8H G;  5CN0 A;  3RVZ A;  2UXN A;  1K3E A;  5B1A B;  2LFR A;  1VQP V;  2XOK G;  1CPY A;  2DWD C;  2XAJ A;  1DTO A;  2DWE C;  3ZMU A;  1AI6 A;  3JCZ A;  4QE9 A;  1HWY A;  3ABK B;  1PL0 A;  2WLL A;  4WF9 V;  5DM6 V;  1AI5 A;  1COW G;  4MVU A;  3ABL B;  1J95 A;  2IH3 C;  4JF3 A;  1H38 A;  3ETD A;  2EIL B;  4OXS A;  3JD2 A;  4MTF A;  4JAU A;  3SPI A;  1VQL V;  4G27 B;  1ROP A;  3ABM C;  2EIK B;  4L87 A;  4MVM A;  2IJH A;  5LBQ A;  5CBG A;  1OCZ B;  3RVY A;  3IC7 A;  1GM9 A;  3ASO B;  3TET A;  2P6J A;  2JK5 C;  3GWO A;  5CBF A;  4RQE A;  1K7D A;  1BHA A;  3K04 A;  1VQ8 V;  1CEZ A;  2EIM C;  2A79 B;  5LHH A;  1GMG A;  1QR9 A;  2QM7 A;  2ZXW B;  1LNQ A;  3G71 V;  4QPK A;  4DXW A;  3W7X A;  2B5U A;  3CME V;  2V1D A;  3FB7 C;  3AG4 C;  3TCU A;  3W7U A;  1R3J C;  3CC7 V;  2GSM B;  3CD6 V;  4N21 A;  3MHH C;  5H6R A;  1BHB A;  2P90 A;  5EC1 C;  1AI4 A;  1KP2 A;  3AG2 C;  2WAM A;  2K1E A;  2WLH A;  4MT8 A;  2AHZ A;  3TK1 A;  3CPW U;  1VQN V;  3FKS G;  3OUS A;  1KEC A;  1PD3 A;  3OUF A;  1JOY A;  3W7S A;  1K4C C;  4GX5 A;  1JQ0 A;  3BEH A;  4KUM A;  5IYC O;  5B1A C;  4ASU G;  5CMU A;  3AG1 C;  3CC4 V;  4BIU A;  4BIZ A;  2F43 G;  1M57 B;  4GT1 A;  1SER A;  4XBF A;  4P9O A;  2KB1 A;  5B1B C;  3EFF K;  1W0J G;  2EIN C;  3M99 B;  4WFG A;  2HVK C;  1Q86 W;  3GB7 C;  5LGT A;  4FIP C;  4PDM A;  3IFX A;  3K08 A;  3CCQ V;  3CYO A;  1M9N A;  1QLE B;  5LHG A;  2DYR C;  3T4Z A;  4QJF B;  1W0K G;  3FB6 C;  3RBZ A;  2XAS A;  5L3B A;  4MTO A;  1YIJ V;  1VQ4 V;  3PJS K;  2ZQM A;  5HFL A;  1ZWI C;  1QVF U;  1RM1 C;  1NVP B;  1JPX A;  3CP1 A;  2UXX A;  3OR6 C;  1RPO A;  4E2L A;  1Q82 W;  3W7T A;  3R65 A;  3IGA C;  4U7O A;  1SZT A;  3ASN B;  5EBM C;  4H33 A;  4JTA B;  1K4D C;  3LUT B;  3OGC C;  1JVM A;  3MHS C;  3VOU A;  2ZXW C;  1VQ6 V;  5BZB A;  3EHB B;  2WWW A;  2JJ1 G;  3F5W C;  3OAA G;  4RUE A;  1K97 A;  4LP8 A;  4QPJ A;  1R3K C;  2PI5 A;  4U7N A;  1NKD A;  2JEX A;  4GX2 A;  3H01 A;  3K9A A;  1KP3 A;  3E8F A;  5KUM A;  1MG1 A;  3JYC A;  4UXN A;  4WFH A;  4MW3 A;  5LGU A;  4UV8 A;  5H9C A;  4I9W A;  1CP9 A;  4WFA V;  3OM3 B;  2JEU A;  4PA7 A;  2EIM B;  1F4M A;  3JD1 A;  3WFV A;  4CBC A;  4RUF A;  2ZR3 A;  2EJR A;  3JD3 A;  1KD1 W;  3F7V C;  1NBM G;  1B6Q A;  4KFM A;  2DW4 A;  3G6E V;  1K73 W;  1AR1 B;  2QA4 V;  5L3E A;  2Q69 A;  1M90 W;  3ZRS A;  4F4L A;  1JJ2 U;  3ABK C;  4MW8 A;  3SJQ C;  1GKF A;  3B8N A;  5GW7 A;  4X8A A;  3HPL C;  3E8B A;  2WLJ A;  4FK5 C;  3ZIA G;  2OTL V;  5EBL C;  3ABL C;  4DO2 A;  2Q6A A;  4GCZ A;  1MOF A;  2EBO A;  2W6J G;  2XAQ A;  5EC2 C;  4XDJ A;  2DYR B;  1E79 G;  1QLE C;  3ABU A;  4EKW A;  3ZRW B;  2HFE C;  4MS2 A;  2JIZ G;  5B3S B;  1YTF D;  4HZ3 A;  4LCU C;  3OW2 U;  1K8A W;  2EZO A;  1K92 A;  3CMA V;  2EIN B;  1WPX A;  1R73 A;  3E8G A;  4FMT A;  5L3D A;  1DF4 A;  2IJK A;  3OMN B;  3K3W A;  2LFS A;  1FXV A;  2W0F C;  2WLK A;  1AJP A;  5B1N A;  4PA9 A;  4PA6 A;  3CCE V;  1PNK A;  4PA3 A;  1R3I C;  2QEX V;  1VQM V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...