4JPRA

Structure of the aslv fusion subunit core
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
YFQGTANLTTSLLGDLLDDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCSFNLSDQSESIQKKFQLMKEHVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ASLV fusion TM
publication title Structural characterization of a fusion glycoprotein from a retrovirus that undergoes a hybrid 2-step entry mechanism.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin a)
molecule tags Viral protein
total genus 28
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jprA00
1QR9A 3B8NA 1QR8A 2EZOA 1JPXA 2P6JA 1DF5A 1EBOA 2M7WA 3WFVA 1SZTA 4JF3A 5HFMA 3M99B 4FJCC 1ENVA 3MHHC 1I5XA 3H01A 3MHSC 2OT5A 2MK3A 1MOFA 1I5YA 4JPRA 2EZPA 3GWOA 3P30A 4N23A 4FK5C 4G2KA 3CP1A 1Y66A 5CN0A 1Y4MA 4FIPC 5CMUA 5H9CA 3K9AA 5HFLA 3B8MA 1F23A 1JQ0A 4N21A 1QBZA 4JGSA 1QCEA 2EBOA 3CYOA 4E2LA 5KA6A 5KA5A 1MG1A 1K33A 1K34A 2X7RB 1DF4A 2LP7A 3B77A 1DLBA
chains in the Genus database with same CATH superfamily
2QKAA 1NI8A 3R65A 4DR4O 1IURA 1HNXB 3H01A 1B6QA 4I9WA 3LSSA 1P49A 4RQFA 4LF4B 3SGIA 1S72V 4IYIA 2A0LA 4N21A 2AHYA 2AZ2A 3SYPA 3I55V 3UKMA 4DUYO 1Q81W 2VS0A 3HKEB 4DR3B 3CE2A 1M9NA 1K5QA 1Q6IA 2B1IA 1AI5A 4W4KA 2QKSA 1O9GA 1GN2A 1QVGU 2Q0OC 1K4DC 2VQFB 5K1XA 2PI4A 3QG5A 4J10A 2DE0X 5KA6A 4FPPA 1M93A 2ZE6A 3ZBHA 2BSKA 3IGAC 1KP3A 2IBZH 3JARB 3TCUA 5EK0A 4WFEA 4MVUA 4DV6B 5KUMA 3K79A 5LGTA 3P30A 4R50A 1GM7A 2DW4A 3JD1A 2W0FC 2XAFA 3RYCA 3K08A 1N32B 4GCZA 4U7NA 1MG1A 2BOCC 2WSSG 1GRJA 1BGYH 1D2DA 4I4TA 3OEEG 3LUTB 1XDCA 4FFKA 3JCZA 3ABTA 2R72A 2OCCB 3ZHQA 1HNWO 3GB7C 3FAVB 3SJBC 3HB3B 4O2AA 5KUKA 4PA4A 2CTRA 1L8DA 3KKYA 1QCEA 2KSDA 3VQXA 3JAWB 1I0HA 2PZSA 5KMGA 2V4DA 2JEUA 3EXAA 1FJGB 4J42A 1Y66A 4P30A 1YJWV 2ZNJA 1AVMA 2F1MA 2FL4A 2P5OA 4F4LA 4JI1O 1AP6A 1WAZA 2BCCH 3JSLA 4GT1A 1JPXA 1HNZO 4DUZO 5H6QA 4H13B 4O4IB 3MHHC 5CBHA 2XAHA 1K7DA 4LFCB 4BWAA 3PN1A 4ICGA 3ZMZA 1YF2A 1IBKO 3DGEA 3F5TA 2VWJA 3E89A 2A7WA 3AG2C 2GUZA 3BPZA 3T1YB 4HNAA 2H94A 3HR0A 1EN6A 2E75B 2F93B 1OCRC 2PF4E 2E74B 4TV8A 5JH7A 1K9MW 3B09A 1JX9A 1VF6C 1KECA 1H2KA 3LDDA 3WB1A 3KG2A 4O4HA 1N33O 3OEHG 2XASA 1VQPV 3H1IH 2YIBD 4NXNO 1Y76B 4HAMA 1WPBA 1KKCA 4JI6O 1BQZA 4JAUA 4TT3G 4NYKA 4PDRA 4ZOLA 3FYEB 4I7ZB 1NTMH 5DECA 2F95B 3DC6A 1IZ3A 5B66Z 1BZKA 2BOBC 5L3EA 4WFGA 2Z0AA 3JATA 5CBGA 5H6RA 2GTAA 2AGAA 4UCVA 1K92A 4IIJA 4B3SO 1SA0B 3IC7A 4O4JA 4DR1B 3E8HA 1YDXA 1QLEC 2R9AA 4JAAA 1GMGA 4LP8A 3CCQV 4FLYA 1P7GA 1U96A 3WFVA 4B08A 3H1LH 2XNDG 2HR3A 5LMUO 2EZPA 4MSWC 2ILMA 4DR4B 1XBLA 4G27B 4MVSA 1BSMA 4JI2O 5H2FZ 3BCCH 2JRIA 2X7RB 5LGNA 4FFBB 3CCSV 5LYJA 3J7AU 2LW1A 1WP8A 1SESA 4MVRA 2O57A 4U7OA 3OD4A 4CZZA 3VQVA 3OR7C 1V54B 4DUYB 2Q8VA 2M6YA 4CBCA 2CGNA 2Q67A 3OGIB 2EILC 3OMNB 2UU9O 3AG2B 2IU3A 2BTQB 3D36A 1ZLZA 1FD9A 5DN6G 2P6JA 4UVBA 2OWOA 4UCRA 1NKDA 3CCMV 5JWPA 5IYZB 4IHJA 2X6CA 3CCRV 3G6BA 4JYCA 3CJHB 3FB6C 4GZRB 2OIGA 3B8MA 1EZVH 3F7YC 2WPDG 4PA9A 5IJ9A 3G4SV 4XBFA 4AILC 5F2VO 1PNMA 3JD3A 3CC2V 4DRXB 1QVFU 1RM1C 1F4NA 2H3OA 1VARA 2PY5A 1Q6UA 4KXRA 3I56V 4WFAV 1P84F 4KHPO 1G1XB 4D7SA 4QPJA 1YITV 1GN6A 3CMEV 1SQGA 3GWKC 1HNWB 3CCEV 4JZGA 4GYCB 3APQA 1F4MA 3NR7A 2PYJA 2FMLA 3LDEA 2IJHA 1KC8W 4GLXA 4CH6A 5J2UB 3S3XA 2CTQA 3M7MX 3VBBA 2OTLV 1SZXA 1QLNA 3HKCA 2E3CA 5CA1B 3CS5A 4JTAB 5CN0A 5IJ0A 2ITDC 4LWSA 1YVWA 1H2SB 3B77A 4TOIA 1SQXH 3M8AA 4U3JB 3FB7C 4LF4O 4JI7O 4ZHQA 4JI1B 4X64O 3TJTA 3MDSA 1RPRA 5KHKA 3W7SA 3ABMC 4JI0O 4ZIBA 3RGBA 5LMNO 1HNZB 5KLVH 4CH4A 1BHAA 2QKCA 4DUZB 2EILB 4JV5O 4LH6A 3VQYA 4WCEV 1IBKB 4LF8O 5GONA 3K0GA 1XL4A 4JYAO 2PUSA 4YJ3B 2QWOB 3DXRA 4FJCC 1ENVA 2VQFO 3CSXA 4JTCB 1KP2A 3L9DA 3ZRXA 5JJEB 3OTOO 1D5NA 1YJNV 2QTSA 2X0LA 4FLXA 1N33B 5KX5B 3MD0A 2Y69B 1NU1H 1DGSA 1Z2GA 4NXNB 1QR9A 2V1DA 1FAFA 1XNQO 1FFXA 4TQFA 4JI6B 2FKXA 3N2KB 4I55B 2ATKC 1RM1B 3APOA 1OHHG 4FK5C 1WPXA 4DV4O 3DTUB 3UO3A 4Q6GA 4LNUA 5LHGA 4FLZA 5KHIA 4B3SB 1V55C 4EEQA 1YSCA 2Q68A 3UT5B 2ZDIC 3ETQA 4QPKA 2KQXA 2OT5A 2A79B 4D7TA 1WB8A 1TAEA 4N23A 3RYFB 5GTIZ 1NQTA 1DK1A 2YS8A 3HKEA 4KP4A 4CC5A 3E8BA 5LXTB 4OXSA 1Y74B 1XHZA 1Q43A 5LMUB 3E22B 4X1YB 2VQEO 4DV1O 1DTOA 2GSMB 4B7KA 3SDLA 4FZ1A 4JI2B 2WLLB 2CTPA 5EZYB 3TK1A 2ZR3A 4MTGA 2EIMC 3ABMB 1NTZH 1KU9A 2IH1C 4PJ0Z 4EFBA 1NJIW 1YTFB 5L3FA 2QJ1A 5CB4B 3JALB 4JZ2A 4HZ3A 2UU9B 5EIBC 5EYPB 3I5DA 2CK3G 2F23A 2RN9A 1GH6A 4MW3A 2CGOA 2Q5ZA 3ZMVA 1NBMG 3CCJV 4FLVA 3CRAA 4K35A 4LBEC 1BL8A 2A06H 4JYBA 1S3JA 4J7KA 1K33A 1IVSA 4UCOA 5IYBO 1WA8B 3CRRA 3CCVV 2QA4V 1VQLV 3FAVA 4ZKIA 1PL0A 2G38A 3RYIA 2E76B 5L3CA 1FXKC 4GKJO 4UCUA 4GX1A 3ZMUA 2E5LO 4DV0O 5CMUA 3A0BZ 4RUFA 1JQ0A 4ABMA 4IT5A 4RWUA 3CMAV 1JJ2U 1GM8A 1V9PA 4KHPB 3C3TA 1PM9A 1V55B 3QO7A 4P2ZA 1IXBA 4LC1A 1OJHA 4MTOA 1VQOV 2QEXV 4OX9O 4J7JA 1NR1A 4UVAA 4DR2O 2YXLA 4JASA 4NXMO 2JS3A 4FLWA 1KUQA 4O4IA 4A5UB 3JAKB 5KA5A 4UFZA 3HKDB 4JI4B 1ZX3A 3CXHF 3E2EA 1MOFA 1N34O 1PPJH 2HVKC 4JI7B 3UCSC 2D2CB 2EIMB 2Q7EA 4X64B 2N74A 4EB6B 1TGOA 3FKSG 5LA6B 4JI0B 3K58A 5LMNB 1R3KC 1Y76A 3TXQA 4JV5B 1SQPH 4NTYA 4LF8B 4JPRA 4KL1A 4X1IA 4MTFA 3SPHA 4JYAB 5JJNB 3VOUA 1K4CC 1TUBB 2ZCEA 5GW7A 3ZHVA 4E2LA 2XAQA 4FLTA 3OTOB 4ZBMA 1XNRO 1L1FA 2LGQA 4I0XB 2IJJA 5B1BC 1MABG 3ETDA 1SA0A 1MMMA 1Y6XA 3W7UA 3BFRA 1GN3A 1VMGA 1XNQB 3JSNA 2IM9A 1IBMO 2KG7A 1FXKB 2Q7HA 4UV9A 4CS4A 1R73A 4DR6O 2ZM6B 4FM0A 2LQTA 2K1EA 1VF5B 1SC5B 3AG4C 3E8GA 3RYHB 2ZE7A 1OV9A 4DV4B 4NTXA 1Q90D 2DQ3A 1S5HC 3QNEA 3ABLC 3UO2A 5BMVB 2Y4UA 1CPYA 1WNSA 4U3FH 3H1KH 1JMKC 3Q4HB 1G4YB 1W0JG 1M56C 1ZWIC 2Q0AA 4L87A 1N0NA 2JDIG 2LGWA 3K57A 1OCOC 2B5UA 4MT8A 3T1CA 1S0VA 1BMFG 5JQGA 1JCHA 1KMIZ 3CX5F 3FD9A 1M57C 1R3JC 5LHHA 2VQEB 4DV1B 3PJSK 3AEIA 3N27A 4MVZA 1YXBA 1KYOF 3HPLC 1F23A 3BRCA 5BR8O 2QE7G 1VQ8V 5IYZA 1VF6A 1XEQA 1I08A 1FXHA 3CJHA 1S5JA 1N36O 2RJZA 1V54C 5JVDB 2VRZA 2ARHA 3EHBB 2QM4A 1W0KG 2UUCB 4DRXA 2W6JG 3STZC 4GX2A 3P32A 3SJQC 4CC6A 1QHTA 2UXDB 4X89A 1MA1A 4DK1A 4UB6Z 5B1BB 3AG1C 5E79Z 4P9PA 2P4KA 4JI8O 4YJ2A 2GDSA 4X65O 1U97A 1E1RG 2LO1A 1VQ9V 1XREA 3WG7C 3ZEDA 2WLNA 2KB1A 5J2UA 4BW9A 2LP7A 2ZINA 4GKJB 2DWEC 4QNHB 4DR7O 1M4UA 2UXXA 3JD2A 5CA1A 4DV0B 3CHXA 2E5LB 3AG4B 4GKKO 2RNBA 2RMKB 1YEWA 5FPOA 2JIZG 1SRYA 1G6UA 2HJFC 2Q6AA 3ABKC 3ABLB 1OCZC 3FYIB 2ZR2A 4IYHA 4G28B 4L8JA 3B40A 3HKBB 4J7ZA 1FS0G 4OX9B 1M56B 4X1KA 4DR2B 2QSAA 2JGUA 4ZI7A 4NXMB 1SZTA 2ZNIA 1OCOB 2CUGA 5EBWC 5IE9A 3O9OA 3L72H 3SPIA 1I7FA 1M57B 2NR5A 3OGCC 4YJ3A 3JYCA 1TVKB 3BY6A 3JASA 4UCTA 2EX3A 1R6NA 2PGGA 3VQWA 1N34B 3ZMTA 4JI5O 1MZFA 1TUEB 4I50B 1PNLA 3RYCB 2C2AA 5TISZ 2M7WA 3BAAA 1SS3A 4FM1A 5ITZB 1Z5VA 3OT7A 2YI8A 4EFEA 2YIDA 5KX5A 1VQNV 2V7QG 1Q8IA 2HLDG 1NH2B 4R7CA 2YICA 2DOSA 1J5EO 1YCIA 1E1QG 2WLMA 3X2QC 3N2KA 3FFQA 4UUJC 2PYLA 3THOA 5EC1C 2W6IG 2ZE8A 4O2AB 1CP9A 3H1HH 1GN4A 1NVPB 1HWYA 3CCUV 1ZSPA 3MHSC 1AILA 3CD6V 2XT9A 4F6RB 5C8YB 1XNRB 3EVKA 3UQ8A 3AG1B 1R3LC 2IH3C 3IJ4A 5H9CA 4LFBO 3ZRWB 3CC4V 2Y69C 3WG7B 4QE9A 1IBMB 4DV2O 3LSQA 4J80A 5IT9N 1K3EA 2OTJV 4DR6B 5LXTA 3K06A 3J81N 1Y74A 3A8TA 3F7VC 2Q73A 3CPWU 3ZJZA 3JAMN 1S5LZ 1NR7A 1ROPA 2HVJC 3C90A 2HG5C 3IAYA 3ABKB 2WLLA 1JOYA 1OCZB 4H33A 3SYOA 1K34A 5EZYA 2WLKA 3ETGA 5CBFA 3ABUA 3B8NA 1VF7A 3QF7A 2Q7GA 2PTMA 4X8AA 2Z5UA 4DW0A 2N05A 4OPHA 4K8XA 4BIUA 5CB4A 2P7TC 3CC7V 5JH7B 1VEWA 2ZQMA 4Z2WA 5EYPA 4JI4O 4PDMA 1PV0A 2Y0IA 2IJKA 2ZE5A 3AG3C 2YIAA 3QO8A 4ASUG 1LUWA 4BW5A 3U10A 2JS5A 2NN4A 2PI5A 4PV1B 5LOVB 5BR8B 3A0RA 1K8AW 5FL7G 1N36B 2ZT9B 3OTFA 4WBNB 4DR5O 5H5NA 5A9GA 3CYOA 3R66A 3WB2A 3X2QB 5IYDO 3STLC 5CA0A 5LGUA 1B3QA 2QR4A 2IJIA 3AK2A 5IY5C 1RP3B 2YC0A 4NKGB 3SJCC 2AZ0A 2UXCO 4DYLA 5IDJA 1H38A 4QE7A 3SR2C 1CEZA 4DXWA 5E1AC 4K3AA 3ASNC 2DN9A 2ZDIA 4X9QA 2HHHO 1M5IA 3BA9A 4PHZA 5LP6A 4JI8B 3K5LA 2QM7A 4X65B 1K97A 2WLIB 1QR8A 1AI7A 1PD3A 4MW8A 3T4ZA 3U11A 1JR9A 2HEPA 5B3SC 2DYRC 5BXZA 4MVMA 3JAKA 4YIPA 3UM7A 2QWPB 3AK1A 4DR7B 2ZM6O 3AK3A 3N2GB 3HKDA 4LR3A 4E4EA 4GKKB 1OCCC 1NZ6A 2AHZA 2JJ2G 5JCOC 1WP7A 2XAJA 2RDCA 3FB5C 2GBOA 3LNMB 2R9RB 1Q5OA 4GUNA 1GTOA 4EB6A 2LFSA 5LA6A 1AP5A 5A2QN 4H0LB 1WJZA 1Q86W 1VQ5V 3ICXA 4FIPC 5DEDA 4UXNA 5B5EZ 3W7TA 2B9ZA 4YXWG 3L74H 4O2BB 1DF4A 1WLEA 1AJNA 3AG3B 3ETEA 3WU2Z 2WAMA 3ZMSA 5EBLC 3T4DA 4JI5B 3ZRVA 4LFAB 3OM3B 4LF5O 4FVMA 1Y67A 3RN4A 1LNQA 1L0NH 2F4VB 1R6TA 2L35A 3JARA 4RAIA 4DV3O 3E35A 2HP8A 1GM9A 1YHQV 2YEVB 1RSOB 4JI3O 1J5EB 3K5NA 3BHPA 1EFRG 1FXKA 2UUCO 2A9HA 4B3MO 1SQQH 3E8FA 5IY5B 1PP9H 2BE3A 1R1BA 2QWRB 4RUEA 2W0XA 2UXDO 3BEHA 1Z5WA 3ASNB 1GAXA 2WA4A 3H9VA 4LWSB 3G71V 5BMVA 1ZAUA 2IW5A 4EKWA 1VQ6V 4LFBB 1BE3H 3Q4HA 2H8PC 2CTWA 1B06A 4YY3O 4X62O 5B3SB 2DYRB 4DV2B 2FB5A 3ML0A 4TV9B 3JAWA 1YJ9V 3NXSA 4X20B 2AXTZ 2HJDA 4TQDA 2EJ7A 5J2TB 1OCCB 2ZIOA 2P90A 3K5MA 4LF9O 4HYOA 1XMQO 5C93A 2JGDB 1KKDA 2X6AA 5GONB 4B3RO 1X4TA 3J80N 2X6BA 4DW1A 2K9PA 1KBHA 5HFLA 4PA7A 1QBZA 1ZUQA 3K0DA 5JVDA 3ZN1A 4UCSA 4NTWA 5AG2A 4JTDB 1E79G 1KD1W 1YTFD 1P7BA 3RT3C 2RCVA 3TGUH 4RQEA 1S77D 2XHBA 1AR5A 4TWKA 1VP7A 1Y4MA 2BTOA 1CXZB 1K73W 2ETNA 1XHXA 2YI9A 3BVOA 4LF7O 1DLBA 2ADPA 4DR5B 2ODMA 4LNUB 2AW9A 3RVYA 4XDJA 5KHGA 5IYCO 3RVZA 4QIWF 1H8EG 3KCYA 1VQ7V 1J95A 2LW7A 1SKVA 3E83A 5LBQA 3GVMA 1SETA 2YSUB 1AR1B 2UXCB 1M1KW 4DV7O 1DF5A 5FNVB 1SQFA 2B1GA 2HHHB 1B04A 1FXVA 3HKBA 3ZHTA 2DWDC 4J41A 1F7YA 1AROP 1HP8A 1ZL8B 2P4VA 1MSDA 5GTHZ 1JFFB 3ZRSA 4PDLA 3L70H 3CRMA 5KAFZ 1NTKH 1TVKA 4DV5O 5BY1A 4TSFG 3JD0A 4WFFA 4UVCA 2EIKC 4I50A 2JEXA 3OR6C 4FFBA 3L73H 1BT8A 1UFIA 4PA3A 2DYSC 4LF6O 5ITZA 5IWAB 1L0LH 3RBZA 1XMOO 4DO2A 4MVQA 4O4LB 4P9OA 5JJJB 4H44B 4CH3A 2BTQA 3OW2U 3JCUZ 4HBNA 1O9HA 5EIBD 3RYIB 1AJPA 1H2LA 1US6A 4QJFB 1LR1A 1PKXA 5BZBA 4TUYB 4LF5B 3C3SA 4RO2A 3W7WA 4F6RA 5C8YA 2IU0A 3CWBH 4K0KO 2KKWA 3ZRWA 1URFA 1R3IC 4DV3B 3RWRD 4JI3B 2Q4PA 2R70A 2EIJC 2RQ6A 2CH7B 4B3MB 2EINC 2ZIMA 4NB5A 1NS1A 3G80A 4B3TO 4KUMA 1FKAO 2Q9LA 1KQSU 4QGPA 1BS3A 4XDLA 4YIOA 4Z1VA 3QVNA 5J9PC 3P3NA 4UB8Z 1N4CA 3JD4A 4NVPA 1I94O 2UUAO 4YY3B 2A3QA 4YHHO 4X62B 4JYYA 3W7XA 2OCHA 4AI8A 3OUSA 2UXBO 2DJVA 1A32A 1H2GA 1YZBA 1AI6A 3OMIB 4LF9B 1XMQB 3LDCA 1K5SA 4U3JA 4F6EA 2EIKB 4B3RB 1IBLO 4X1IB 5LOVA 3U0ZA 3ZIAG 4J9YB 4PD4F 2DYSB 1SQVH 1RPOA 1AI4A 4FLUA 1Q82W 4WBNA 3ZHRA 2HFEC 3EFFK 3CXCU 3GWOA 1XQ8A 2BSKB 3QTCA 2QWNB 3K9AA 2GTSA 1S76D 1IDSA 2QWQB 1FYJA 3K9SA 3AG7A 1HR0O 4LFAO 2KG7B 2VWKA 5KAIZ 3IC9A 3QO5A 2LJ2A 4K8ZA 2D3OW 2Q69A 2F4VO 2UXNA 2XTAA 3KZIZ 1I5YA 3D8CA 2XUMA 4LF7B 1SQBH 2QTOA 1EZJA 4I4TB 2WLIA 1QU7A 2JK5C 1G8MA 2EIJB 4D6TH 5EBMC 2EINB 4I55A 3BA8A 1GO3F 3TXSA 2CDYA 3N2GA 1EBOA 2R9IA 1PL4A 3L75H 2XAGA 1SERA 2ADQB 5L3GA 4GX0A 4C7UA 5KMGB 4DV7B 1MZEA 2FYUH 5JQGB 3O65A 3UT5A 1HW7A 3CEIA 4J9ZB 2EULA 5L3DA 1OCRB 3K03A 4PI0A 3RYFA 3T1HO 2YXYA 3A0HZ 2ZKOA 5CA3A 2F43G 4X88A 3FX7A 2OYQA 4O2BA 4AQYO 4NR1A 3CRCA 3E22A 3A2FA 3IFXA 4X1YA 2NNUA 5B1NA 3G67A 3L71H 4OPAA 4DV5B 4WF9V 4H37A 5D5PA 5K1PA 4PDVA 5FPRA 1VIBA 2EJRA 1QQCA 2GUZB 2EZOA 4X66O 1YI2V 3D36C 4CS2A 1ORQC 4HNAB 5HFMA 4LF6B 1BHBA 1TA8A 3SJAC 1XMOB 4MVOA 1THZA 3CP1A 1PNKA 2YEVA 3JALA 5LL6Y 1RSOA 4TV8B 2JJ1G 4LCUC 4O4HB 4YJ2B 3SYAA 1NH2D 3OFNG 1QLEB 3ZN0A 1RFYA 4GX5A 3RW0A 2UUBO 4ZOLB 1EN4A 3ASOC 3K5OA 2Y0PA 3D3IA 1SF9A 4K0KB 2Y48A 2L6LA 2YXHA 3JATB 4I9QA 1NVPD 1WA8A 3KCXA 4IL6Z 1WB7A 5KHJA 2WA3A 4PA6A 5B1OA 1HNXO 2ZD9A 2WWWA 4WFHA 4Q20A 3ZX6A 1JJOA 4IIJB 1OZ0A 4TV9A 4O4JB 1NT2B 4X20A 1IXMA 5J2TA 4X1KB 2LFRA 4B3TB 1AR4A 4ZI7B 5JCOA 3G6EV 1BCCH 2Z3YA 3E86A 2QM8A 3B2EE 4DR3O 2JGDA 2ZXWC 1QNMA 5B1AC 1EN5A 4OGQB 1XILA 3CCLV 2P06A 3JASB 4PELA 1VQ4V 1P4RA 1I94B 5LHIA 2UUAB 4YHHB 3CRQA 1N8RW 2N04A 4FZ0A 4W4LA 5LYJB 4MS2A 2UXBB 3SPJA 2P67A 1H2MA 2EBOA 1XOUA 3S3WA 1UJWB 4DV6O 1D5AA 1XL6A 1GKFA 1EM1A 2CAZC 4JF3A 1IBLB 3K04A 2NLJC 1N32O 1COWG 1HDJA 4AHCA 3K3WA 4CH5A 5IWAO 1X59A 1R6KA 4R8CA 1GK9A 5L3BA 4FM2A 4XDKA 2Y4TA 1YIJV 3ZHUA 4CS3A 4IHJB 4WFBV 2MW2B 4MTXA 5LP6C 1FPOA 3MAQA 1TUBA 1HR0B 5IJ9B 1VQMV 2YDEA 4R6ZA 3ASOB 2GHYA 2WLHA 2JVDA 4FMTA 4PI2A 3WB0A 5FNVA 4I0XA 1AJQA 2XOKG 4B7EA 3H1JH 3F5WC 3P3PA 2FTKA 2QGNA 1FJGO 1ZTEA 1MSWD 3LSUA 5DM6V 1Q3EA 1XUQA 3M99B 1JVMA 3SYCA 1ZL8A 3SPCA 5KHHA 4G2KA 3FB8C 1JFFA 3RYHA 4IGGA 4BR6A 3ZHSA 2ZXWB 1IX9A 4LFCO 3ZS8C 3HKCB 5B1AB 3B4SA 5IJ0B 1Q6HA 1I5XA 1Q7YW 3T1YO 2MK3A 4UV8A 4LH7A 3OUFA 3SYQA 3ZCCA 1AB3A 3T1HB 4ZHQB 2DMXA 3D3QA 4O4LA 2YIBA 3RFRA 2P22C 1MNGA 1WN7A 4AQYB 3CB2A 3K59A 1XI1A 1N0JA 2YUAA 2F66C 1BQ0A 5D5QA 3OMAB 2WLJA 4BIZA 1UPGA 4TUYA 3OAAG 5CA0B 4BAYA 4I5SA 1W59A 3BABA 4X66B 3DXRB 2DQ0A 5FLXN 4DK0A 4JGSA 1F51A 3SPGA 3DC5A 2OIEA 1W2BU 1VQKV 2QDOA 2CH7A 2OCCC 5EC2C 3T2MA 5LP6B 4DR1O 1LUVA 2HKOA 4Z1MG 2GV9A 1FFXB 3LNNA 1T5EA 3TETA 1JA8A 1H2NA 3DSQA 2UUBB 4KFMA 4BIOA 1KB9F 3OE7G 1FFTB 4JAVA 1M90W 2CE4A 2ITCC 4J11A 1H8HG
chains in the Genus database with same CATH topology
3R65A 1KQSU 1YSCA 3LSQA 2Q68A 1K3EA 2ZDIC 2OTJV 4QPKA 3H01A 1B6QA 4I9WA 2OT5A 3LSSA 3K06A 2A79B 3F7VC 4RQFA 4N23A 3CPWU 4XDLA 3ZJZA 1NQTA 1S72V 1NR7A 1ROPA 4KP4A 5J9PC 3E8BA 2HVJC 2A0LA 2HG5C 4N21A 4OXSA 2AHYA 2WLLA 3ABKB 3JD4A 1JOYA 1OCZB 4H33A 3SYOA 1K34A 3SYPA 3I55V 2WLKA 3UKMA 3ETGA 5CBFA 1Q81W 3ABUA 3W7XA 3B8NA 1DTOA 3OUSA 2GSMB 1M9NA 4X8AA 1K5QA 2Z5UA 2B1IA 1AI5A 1H2GA 2WLLB 2QKSA 1AI6A 3OMIB 3TK1A 2ZR3A 4BIUA 1QVGU 3LDCA 4MTGA 1K4DC 2EIMC 2P7TC 3ABMB 1K5SA 3CC7V 2EIKB 2ZQMA 2IH1C 2PI4A 4PDMA 1NJIW 1YTFB 5KA6A 3ZIAG 2IJKA 4FPPA 4J9YB 5L3FA 3AG3C 2DYSB 3QO8A 4ASUG 4HZ3A 1RPOA 4BW5A 3IGAC 1KP3A 3TCUA 1AI4A 2CK3G 5EK0A 2PI5A 1Q82W 4WFEA 3A0RA 4MW3A 1K8AW 2HFEC 1NBMG 3EFFK 4MVUA 5FL7G 3K79A 5KUMA 3GWOA 3P30A 3ZMVA 5LGTA 3CCJV 4R50A 1GM7A 2DW4A 3JD1A 2W0FC 1BL8A 2XAFA 4LBEC 3K08A 3K9AA 4JYBA 1S3JA 1S76D 4GCZA 3CYOA 4U7NA 1MG1A 1K33A 2BOCC 3X2QB 5IYDO 2WSSG 3STLC 5IYBO 5LGUA 2IJIA 3OEEG 3LUTB 3CCVV 2QA4V 1VQLV 3QO5A 4ZKIA 5IY5C 2Q69A 2D3OW 4KUMA 1PL0A 2UXNA 1I5YA 3JCZA 3ABTA 2OCCB 2QTOA 1EZJA 5L3CA 1FXKC 4GX1A 5IDJA 3GB7C 3ZMUA 2WLIA 1H38A 4QE7A 1CEZA 4DXWA 2JK5C 3HB3B 5CMUA 5E1AC 5KUKA 4RUFA 4PA4A 1JQ0A 1G8MA 2EIJB 5EBMC 3ASNC 1QCEA 2ZDIA 2EINB 3CMAV 1JJ2U 1GM8A 2QM7A 1K97A 2WLIB 1QR8A 1AI7A 1GO3F 1PD3A 4MW8A 3T4ZA 1EBOA 1V55B 2R9IA 3QO7A 4P2ZA 4LC1A 2XAGA 4MTOA 2JEUA 1VQOV 5B3SC 1SERA 2DYRC 4MVMA 5L3GA 4GX0A 3UM7A 2QEXV 1NR1A 4UVAA 1Y66A 4P30A 1YJWV 4JASA 1OCCC 2AHZA 4F4LA 2JJ2G 5KA5A 2XAJA 4J9ZB 3FB5C 5L3DA 1OCRB 3K03A 4GT1A 1JPXA 3LNMB 5CA3A 2R9RB 5H6QA 2F43G 3MHHC 5CBHA 1GTOA 2XAHA 4X88A 1K7DA 3E2EA 1MOFA 2LFSA 3ZMZA 2HVKC 3DGEA 3E89A 1Q86W 1VQ5V 3AG2C 3IFXA 4FIPC 2NNUA 2EIMB 5B1NA 4UXNA 4WF9V 2H94A 3W7TA 4H37A 3FKSG 4YXWG 4PDVA 1DF4A 2EJRA 1OCRC 1WLEA 1AJNA 3AG3B 3ETEA 2EZOA 1YI2V 2WAMA 1R3KC 3ZMSA 1ORQC 5EBLC 3T4DA 5HFMA 1K9MW 1BHBA 1JX9A 1KECA 3LDDA 3ZRVA 3KG2A 3OM3B 4JPRA 4MTFA 4MVOA 3SPHA 3OEHG 2XASA 1THZA 1VQPV 3CP1A 1PNKA 2YEVA 4HAMA 3VOUA 1LNQA 2JJ1G 1K4CC 4JAUA 4LCUC 4TT3G 5GW7A 4PDRA 4RAIA 4E2LA 3FYEB 2XAQA 3E35A 3SYAA 4ZBMA 1NH2D 3OFNG 1GM9A 1YHQV 1QLEB 2YEVB 2BOBC 1L1FA 5L3EA 4WFGA 3ZN0A 4GX5A 2IJJA 1EFRG 5B1BC 5CBGA 1MABG 3ETDA 5H6RA 1FXKA 3RW0A 2A9HA 3E8FA 3ASOC 5IY5B 3D3IA 3W7UA 2Y48A 1K92A 4RUEA 1NVPD 1FXKB 4UV9A 3IC7A 3BEHA 4PA6A 1R73A 5B1OA 2ZD9A 3E8HA 2WWWA 4WFHA 4Q20A 1QLEC 2K1EA 3ASNB 1OZ0A 1GMGA 3AG4C 3E8GA 4LP8A 3CCQV 3G71V 3WFVA 2IW5A 4EKWA 1VQ6V 1IXMA 2H8PC 2XNDG 2DQ3A 2LFRA 2HR3A 1S5HC 2EZPA 5B3SB 4MSWC 3QNEA 3G6EV 2DYRB 3ABLC 3ML0A 2Z3YA 1YJ9V 3E86A 1CPYA 2QM8A 3NXSA 4G27B 4MVSA 1G4YB 2ZXWC 1W0JG 1M56C 1OCCB 1ZWIC 5B1AC 2P90A 4L87A 2X7RB 5LGNA 4HYOA 2JDIG 3CCSV 3CCLV 5C93A 1OCOC 2B5UA 4PELA 1SESA 4MT8A 1P4RA 4MVRA 1VQ4V 1KKDA 3T1CA 4U7OA 1BMFG 5LHIA 2X6AA 1JCHA 1S0VA 4CZZA 3OR7C 1V54B 2X6BA 1N8RW 1M57C 1R3JC 5LHHA 4CBCA 2Q67A 3PJSK 3AEIA 4MS2A 2EILC 4MVZA 3SPJA 3OMNB 2P67A 5HFLA 3HPLC 4PA7A 1F23A 3AG2B 2IU3A 1QBZA 2EBOA 3D36A 3K0DA 2QE7G 1VQ8V 3ZN1A 1UJWB 5DN6G 1FXHA 1XL6A 2P6JA 4JTDB 4UVBA 1GKFA 1E79G 1KD1W 1YTFD 1P7BA 4JF3A 3K04A 2NLJC 1V54C 1NKDA 4RQEA 3CCMV 1COWG 1S77D 3K3WA 3EHBB 2X6CA 3CCRV 1R6KA 1W0KG 4TWKA 4JYCA 4R8CA 1Y4MA 1GK9A 3FB6C 5L3BA 4XDKA 2W6JG 3B8MA 3STZC 1K73W 1YIJV 4GX2A 3P32A 3F7YC 4WFBV 2WPDG 4PA9A 1DLBA 3G4SV 3SJQC 4XBFA 4MTXA 1PNMA 3JD3A 4X89A 3CC2V 1QVFU 1RM1C 1F4NA 3RVYA 5B1BB 4XDJA 5IYCO 3AG1C 3RVZA 1VQMV 4P9PA 1H8EG 4QIWF 4R6ZA 3ASOB 3I56V 4WFAV 1VQ7V 2GHYA 2WLHA 4FMTA 1J95A 4QPJA 3CXCU 1E1RG 1YITV 3CMEV 1VQ9V 3WG7C 3E83A 1AJQA 2XOKG 5LBQA 1SETA 2YSUB 2WLNA 2KB1A 3F5WC 1AR1B 2LP7A 2FTKA 2DWEC 1M1KW 3CCEV 4QNHB 1MSWD 1F4MA 2UXXA 3JD2A 1DF5A 3LDEA 2IJHA 1KC8W 3AG4B 5DM6V 3M99B 2B1GA 1JVMA 3SYCA 1FXVA 3VBBA 2OTLV 3SPCA 1QLNA 2DWDC 2JIZG 4G2KA 1SRYA 4JTAB 5CN0A 3FB8C 2HJFC 2Q6AA 3ABKC 3ABLB 2ITDC 1OCZC 3FYIB 2ZR2A 1AROP 4G28B 1FS0G 2ZXWB 3B77A 1M56B 5B1AB 3FB7C 3ZRSA 4PDLA 1SZTA 1I5XA 1Q7YW 1OCOB 5EBWC 2MK3A 4UV8A 1RPRA 4TSFG 3W7SA 3ABMC 3JD0A 3OUFA 4WFFA 4UVCA 3SYQA 3ZCCA 2EIKC 2JEXA 1BHAA 3OR6C 3SPIA 1M57B 3OGCC 3JYCA 2EILB 3BY6A 4PA3A 2DYSC 1R6NA 3ZMTA 4WCEV 1TUEB 1PNLA 3RBZA 3K0GA 2C2AA 4DO2A 1XL4A 4MVQA 4P9OA 2M7WA 4FJCC 1ENVA 3OMAB 2WLJA 4JTCB 1KP2A 4BIZA 3OAAG 1VQNV 3OW2U 4BAYA 3ZRXA 4I5SA 2V7QG 2HLDG 1YJNV 1NH2B 4R7CA 2X0LA 1AJPA 1E1QG 2DQ0A 2WLMA 3X2QC 4QJFB 1PKXA 4JGSA 5BZBA 4UUJC 4RO2A 3W7WA 3MD0A 2Y69B 5EC1C 2IU0A 2W6IG 1QR9A 2V1DA 1F51A 3SPGA 1CP9A 1W2BU 1NVPB 1HWYA 3CCUV 1VQKV 2OCCC 5EC2C 3MHSC 2ATKC 3T2MA 3ZRWA 1R3IC 1RM1B 3CD6V 2HKOA 4Z1MG 1OHHG 4FK5C 1WPXA 3TETA 3AG1B 1R3LC 2EIJC 2IH3C 5H9CA 2EINC 4KFMA 3ZRWB 3DTUB 3OE7G 1FFTB 3CC4V 4JAVA 1M90W 2Y69C 3WG7B 5LHGA 2ITCC 1H8HG 4QE9A 1V55C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QR9 A;  3B8N A;  1QR8 A;  2EZO A;  1JPX A;  2P6J A;  1DF5 A;  1EBO A;  2M7W A;  3WFV A;  1SZT A;  4JF3 A;  5HFM A;  3M99 B;  4FJC C;  1ENV A;  3MHH C;  1I5X A;  3H01 A;  3MHS C;  2OT5 A;  2MK3 A;  1MOF A;  1I5Y A;  4JPR A;  2EZP A;  3GWO A;  3P30 A;  4N23 A;  4FK5 C;  4G2K A;  3CP1 A;  1Y66 A;  5CN0 A;  1Y4M A;  4FIP C;  5CMU A;  5H9C A;  3K9A A;  5HFL A;  3B8M A;  1F23 A;  1JQ0 A;  4N21 A;  1QBZ A;  4JGS A;  1QCE A;  2EBO A;  3CYO A;  4E2L A;  5KA6 A;  5KA5 A;  1MG1 A;  1K33 A;  1K34 A;  2X7R B;  1DF4 A;  2LP7 A;  3B77 A;  1DLB A; 
#chains in the Genus database with same CATH topology
 2QKA A;  1NI8 A;  3R65 A;  4DR4 O;  1IUR A;  1HNX B;  3H01 A;  1B6Q A;  4I9W A;  3LSS A;  1P49 A;  4RQF A;  4LF4 B;  3SGI A;  1S72 V;  4IYI A;  2A0L A;  4N21 A;  2AHY A;  2AZ2 A;  3SYP A;  3I55 V;  3UKM A;  4DUY O;  1Q81 W;  2VS0 A;  3HKE B;  4DR3 B;  3CE2 A;  1M9N A;  1K5Q A;  1Q6I A;  2B1I A;  1AI5 A;  4W4K A;  2QKS A;  1O9G A;  1GN2 A;  1QVG U;  2Q0O C;  1K4D C;  2VQF B;  5K1X A;  2PI4 A;  3QG5 A;  4J10 A;  2DE0 X;  5KA6 A;  4FPP A;  1M93 A;  2ZE6 A;  3ZBH A;  2BSK A;  3IGA C;  1KP3 A;  2IBZ H;  3JAR B;  3TCU A;  5EK0 A;  4WFE A;  4MVU A;  4DV6 B;  5KUM A;  3K79 A;  5LGT A;  3P30 A;  4R50 A;  1GM7 A;  2DW4 A;  3JD1 A;  2W0F C;  2XAF A;  3RYC A;  3K08 A;  1N32 B;  4GCZ A;  4U7N A;  1MG1 A;  2BOC C;  2WSS G;  1GRJ A;  1BGY H;  1D2D A;  4I4T A;  3OEE G;  3LUT B;  1XDC A;  4FFK A;  3JCZ A;  3ABT A;  2R72 A;  2OCC B;  3ZHQ A;  1HNW O;  3GB7 C;  3FAV B;  3SJB C;  3HB3 B;  4O2A A;  5KUK A;  4PA4 A;  2CTR A;  1L8D A;  3KKY A;  1QCE A;  2KSD A;  3VQX A;  3JAW B;  1I0H A;  2PZS A;  5KMG A;  2V4D A;  2JEU A;  3EXA A;  1FJG B;  4J42 A;  1Y66 A;  4P30 A;  1YJW V;  2ZNJ A;  1AVM A;  2F1M A;  2FL4 A;  2P5O A;  4F4L A;  4JI1 O;  1AP6 A;  1WAZ A;  2BCC H;  3JSL A;  4GT1 A;  1JPX A;  1HNZ O;  4DUZ O;  5H6Q A;  4H13 B;  4O4I B;  3MHH C;  5CBH A;  2XAH A;  1K7D A;  4LFC B;  4BWA A;  3PN1 A;  4ICG A;  3ZMZ A;  1YF2 A;  1IBK O;  3DGE A;  3F5T A;  2VWJ A;  3E89 A;  2A7W A;  3AG2 C;  2GUZ A;  3BPZ A;  3T1Y B;  4HNA A;  2H94 A;  3HR0 A;  1EN6 A;  2E75 B;  2F93 B;  1OCR C;  2PF4 E;  2E74 B;  4TV8 A;  5JH7 A;  1K9M W;  3B09 A;  1JX9 A;  1VF6 C;  1KEC A;  1H2K A;  3LDD A;  3WB1 A;  3KG2 A;  4O4H A;  1N33 O;  3OEH G;  2XAS A;  1VQP V;  3H1I H;  2YIB D;  4NXN O;  1Y76 B;  4HAM A;  1WPB A;  1KKC A;  4JI6 O;  1BQZ A;  4JAU A;  4TT3 G;  4NYK A;  4PDR A;  4ZOL A;  3FYE B;  4I7Z B;  1NTM H;  5DEC A;  2F95 B;  3DC6 A;  1IZ3 A;  5B66 Z;  1BZK A;  2BOB C;  5L3E A;  4WFG A;  2Z0A A;  3JAT A;  5CBG A;  5H6R A;  2GTA A;  2AGA A;  4UCV A;  1K92 A;  4IIJ A;  4B3S O;  1SA0 B;  3IC7 A;  4O4J A;  4DR1 B;  3E8H A;  1YDX A;  1QLE C;  2R9A A;  4JAA A;  1GMG A;  4LP8 A;  3CCQ V;  4FLY A;  1P7G A;  1U96 A;  3WFV A;  4B08 A;  3H1L H;  2XND G;  2HR3 A;  5LMU O;  2EZP A;  4MSW C;  2ILM A;  4DR4 B;  1XBL A;  4G27 B;  4MVS A;  1BSM A;  4JI2 O;  5H2F Z;  3BCC H;  2JRI A;  2X7R B;  5LGN A;  4FFB B;  3CCS V;  5LYJ A;  3J7A U;  2LW1 A;  1WP8 A;  1SES A;  4MVR A;  2O57 A;  4U7O A;  3OD4 A;  4CZZ A;  3VQV A;  3OR7 C;  1V54 B;  4DUY B;  2Q8V A;  2M6Y A;  4CBC A;  2CGN A;  2Q67 A;  3OGI B;  2EIL C;  3OMN B;  2UU9 O;  3AG2 B;  2IU3 A;  2BTQ B;  3D36 A;  1ZLZ A;  1FD9 A;  5DN6 G;  2P6J A;  4UVB A;  2OWO A;  4UCR A;  1NKD A;  3CCM V;  5JWP A;  5IYZ B;  4IHJ A;  2X6C A;  3CCR V;  3G6B A;  4JYC A;  3CJH B;  3FB6 C;  4GZR B;  2OIG A;  3B8M A;  1EZV H;  3F7Y C;  2WPD G;  4PA9 A;  5IJ9 A;  3G4S V;  4XBF A;  4AIL C;  5F2V O;  1PNM A;  3JD3 A;  3CC2 V;  4DRX B;  1QVF U;  1RM1 C;  1F4N A;  2H3O A;  1VAR A;  2PY5 A;  1Q6U A;  4KXR A;  3I56 V;  4WFA V;  1P84 F;  4KHP O;  1G1X B;  4D7S A;  4QPJ A;  1YIT V;  1GN6 A;  3CME V;  1SQG A;  3GWK C;  1HNW B;  3CCE V;  4JZG A;  4GYC B;  3APQ A;  1F4M A;  3NR7 A;  2PYJ A;  2FML A;  3LDE A;  2IJH A;  1KC8 W;  4GLX A;  4CH6 A;  5J2U B;  3S3X A;  2CTQ A;  3M7M X;  3VBB A;  2OTL V;  1SZX A;  1QLN A;  3HKC A;  2E3C A;  5CA1 B;  3CS5 A;  4JTA B;  5CN0 A;  5IJ0 A;  2ITD C;  4LWS A;  1YVW A;  1H2S B;  3B77 A;  4TOI A;  1SQX H;  3M8A A;  4U3J B;  3FB7 C;  4LF4 O;  4JI7 O;  4ZHQ A;  4JI1 B;  4X64 O;  3TJT A;  3MDS A;  1RPR A;  5KHK A;  3W7S A;  3ABM C;  4JI0 O;  4ZIB A;  3RGB A;  5LMN O;  1HNZ B;  5KLV H;  4CH4 A;  1BHA A;  2QKC A;  4DUZ B;  2EIL B;  4JV5 O;  4LH6 A;  3VQY A;  4WCE V;  1IBK B;  4LF8 O;  5GON A;  3K0G A;  1XL4 A;  4JYA O;  2PUS A;  4YJ3 B;  2QWO B;  3DXR A;  4FJC C;  1ENV A;  2VQF O;  3CSX A;  4JTC B;  1KP2 A;  3L9D A;  3ZRX A;  5JJE B;  3OTO O;  1D5N A;  1YJN V;  2QTS A;  2X0L A;  4FLX A;  1N33 B;  5KX5 B;  3MD0 A;  2Y69 B;  1NU1 H;  1DGS A;  1Z2G A;  4NXN B;  1QR9 A;  2V1D A;  1FAF A;  1XNQ O;  1FFX A;  4TQF A;  4JI6 B;  2FKX A;  3N2K B;  4I55 B;  2ATK C;  1RM1 B;  3APO A;  1OHH G;  4FK5 C;  1WPX A;  4DV4 O;  3DTU B;  3UO3 A;  4Q6G A;  4LNU A;  5LHG A;  4FLZ A;  5KHI A;  4B3S B;  1V55 C;  4EEQ A;  1YSC A;  2Q68 A;  3UT5 B;  2ZDI C;  3ETQ A;  4QPK A;  2KQX A;  2OT5 A;  2A79 B;  4D7T A;  1WB8 A;  1TAE A;  4N23 A;  3RYF B;  5GTI Z;  1NQT A;  1DK1 A;  2YS8 A;  3HKE A;  4KP4 A;  4CC5 A;  3E8B A;  5LXT B;  4OXS A;  1Y74 B;  1XHZ A;  1Q43 A;  5LMU B;  3E22 B;  4X1Y B;  2VQE O;  4DV1 O;  1DTO A;  2GSM B;  4B7K A;  3SDL A;  4FZ1 A;  4JI2 B;  2WLL B;  2CTP A;  5EZY B;  3TK1 A;  2ZR3 A;  4MTG A;  2EIM C;  3ABM B;  1NTZ H;  1KU9 A;  2IH1 C;  4PJ0 Z;  4EFB A;  1NJI W;  1YTF B;  5L3F A;  2QJ1 A;  5CB4 B;  3JAL B;  4JZ2 A;  4HZ3 A;  2UU9 B;  5EIB C;  5EYP B;  3I5D A;  2CK3 G;  2F23 A;  2RN9 A;  1GH6 A;  4MW3 A;  2CGO A;  2Q5Z A;  3ZMV A;  1NBM G;  3CCJ V;  4FLV A;  3CRA A;  4K35 A;  4LBE C;  1BL8 A;  2A06 H;  4JYB A;  1S3J A;  4J7K A;  1K33 A;  1IVS A;  4UCO A;  5IYB O;  1WA8 B;  3CRR A;  3CCV V;  2QA4 V;  1VQL V;  3FAV A;  4ZKI A;  1PL0 A;  2G38 A;  3RYI A;  2E76 B;  5L3C A;  1FXK C;  4GKJ O;  4UCU A;  4GX1 A;  3ZMU A;  2E5L O;  4DV0 O;  5CMU A;  3A0B Z;  4RUF A;  1JQ0 A;  4ABM A;  4IT5 A;  4RWU A;  3CMA V;  1JJ2 U;  1GM8 A;  1V9P A;  4KHP B;  3C3T A;  1PM9 A;  1V55 B;  3QO7 A;  4P2Z A;  1IXB A;  4LC1 A;  1OJH A;  4MTO A;  1VQO V;  2QEX V;  4OX9 O;  4J7J A;  1NR1 A;  4UVA A;  4DR2 O;  2YXL A;  4JAS A;  4NXM O;  2JS3 A;  4FLW A;  1KUQ A;  4O4I A;  4A5U B;  3JAK B;  5KA5 A;  4UFZ A;  3HKD B;  4JI4 B;  1ZX3 A;  3CXH F;  3E2E A;  1MOF A;  1N34 O;  1PPJ H;  2HVK C;  4JI7 B;  3UCS C;  2D2C B;  2EIM B;  2Q7E A;  4X64 B;  2N74 A;  4EB6 B;  1TGO A;  3FKS G;  5LA6 B;  4JI0 B;  3K58 A;  5LMN B;  1R3K C;  1Y76 A;  3TXQ A;  4JV5 B;  1SQP H;  4NTY A;  4LF8 B;  4JPR A;  4KL1 A;  4X1I A;  4MTF A;  3SPH A;  4JYA B;  5JJN B;  3VOU A;  1K4C C;  1TUB B;  2ZCE A;  5GW7 A;  3ZHV A;  4E2L A;  2XAQ A;  4FLT A;  3OTO B;  4ZBM A;  1XNR O;  1L1F A;  2LGQ A;  4I0X B;  2IJJ A;  5B1B C;  1MAB G;  3ETD A;  1SA0 A;  1MMM A;  1Y6X A;  3W7U A;  3BFR A;  1GN3 A;  1VMG A;  1XNQ B;  3JSN A;  2IM9 A;  1IBM O;  2KG7 A;  1FXK B;  2Q7H A;  4UV9 A;  4CS4 A;  1R73 A;  4DR6 O;  2ZM6 B;  4FM0 A;  2LQT A;  2K1E A;  1VF5 B;  1SC5 B;  3AG4 C;  3E8G A;  3RYH B;  2ZE7 A;  1OV9 A;  4DV4 B;  4NTX A;  1Q90 D;  2DQ3 A;  1S5H C;  3QNE A;  3ABL C;  3UO2 A;  5BMV B;  2Y4U A;  1CPY A;  1WNS A;  4U3F H;  3H1K H;  1JMK C;  3Q4H B;  1G4Y B;  1W0J G;  1M56 C;  1ZWI C;  2Q0A A;  4L87 A;  1N0N A;  2JDI G;  2LGW A;  3K57 A;  1OCO C;  2B5U A;  4MT8 A;  3T1C A;  1S0V A;  1BMF G;  5JQG A;  1JCH A;  1KMI Z;  3CX5 F;  3FD9 A;  1M57 C;  1R3J C;  5LHH A;  2VQE B;  4DV1 B;  3PJS K;  3AEI A;  3N27 A;  4MVZ A;  1YXB A;  1KYO F;  3HPL C;  1F23 A;  3BRC A;  5BR8 O;  2QE7 G;  1VQ8 V;  5IYZ A;  1VF6 A;  1XEQ A;  1I08 A;  1FXH A;  3CJH A;  1S5J A;  1N36 O;  2RJZ A;  1V54 C;  5JVD B;  2VRZ A;  2ARH A;  3EHB B;  2QM4 A;  1W0K G;  2UUC B;  4DRX A;  2W6J G;  3STZ C;  4GX2 A;  3P32 A;  3SJQ C;  4CC6 A;  1QHT A;  2UXD B;  4X89 A;  1MA1 A;  4DK1 A;  4UB6 Z;  5B1B B;  3AG1 C;  5E79 Z;  4P9P A;  2P4K A;  4JI8 O;  4YJ2 A;  2GDS A;  4X65 O;  1U97 A;  1E1R G;  2LO1 A;  1VQ9 V;  1XRE A;  3WG7 C;  3ZED A;  2WLN A;  2KB1 A;  5J2U A;  4BW9 A;  2LP7 A;  2ZIN A;  4GKJ B;  2DWE C;  4QNH B;  4DR7 O;  1M4U A;  2UXX A;  3JD2 A;  5CA1 A;  4DV0 B;  3CHX A;  2E5L B;  3AG4 B;  4GKK O;  2RNB A;  2RMK B;  1YEW A;  5FPO A;  2JIZ G;  1SRY A;  1G6U A;  2HJF C;  2Q6A A;  3ABK C;  3ABL B;  1OCZ C;  3FYI B;  2ZR2 A;  4IYH A;  4G28 B;  4L8J A;  3B40 A;  3HKB B;  4J7Z A;  1FS0 G;  4OX9 B;  1M56 B;  4X1K A;  4DR2 B;  2QSA A;  2JGU A;  4ZI7 A;  4NXM B;  1SZT A;  2ZNI A;  1OCO B;  2CUG A;  5EBW C;  5IE9 A;  3O9O A;  3L72 H;  3SPI A;  1I7F A;  1M57 B;  2NR5 A;  3OGC C;  4YJ3 A;  3JYC A;  1TVK B;  3BY6 A;  3JAS A;  4UCT A;  2EX3 A;  1R6N A;  2PGG A;  3VQW A;  1N34 B;  3ZMT A;  4JI5 O;  1MZF A;  1TUE B;  4I50 B;  1PNL A;  3RYC B;  2C2A A;  5TIS Z;  2M7W A;  3BAA A;  1SS3 A;  4FM1 A;  5ITZ B;  1Z5V A;  3OT7 A;  2YI8 A;  4EFE A;  2YID A;  5KX5 A;  1VQN V;  2V7Q G;  1Q8I A;  2HLD G;  1NH2 B;  4R7C A;  2YIC A;  2DOS A;  1J5E O;  1YCI A;  1E1Q G;  2WLM A;  3X2Q C;  3N2K A;  3FFQ A;  4UUJ C;  2PYL A;  3THO A;  5EC1 C;  2W6I G;  2ZE8 A;  4O2A B;  1CP9 A;  3H1H H;  1GN4 A;  1NVP B;  1HWY A;  3CCU V;  1ZSP A;  3MHS C;  1AIL A;  3CD6 V;  2XT9 A;  4F6R B;  5C8Y B;  1XNR B;  3EVK A;  3UQ8 A;  3AG1 B;  1R3L C;  2IH3 C;  3IJ4 A;  5H9C A;  4LFB O;  3ZRW B;  3CC4 V;  2Y69 C;  3WG7 B;  4QE9 A;  1IBM B;  4DV2 O;  3LSQ A;  4J80 A;  5IT9 N;  1K3E A;  2OTJ V;  4DR6 B;  5LXT A;  3K06 A;  3J81 N;  1Y74 A;  3A8T A;  3F7V C;  2Q73 A;  3CPW U;  3ZJZ A;  3JAM N;  1S5L Z;  1NR7 A;  1ROP A;  2HVJ C;  3C90 A;  2HG5 C;  3IAY A;  3ABK B;  2WLL A;  1JOY A;  1OCZ B;  4H33 A;  3SYO A;  1K34 A;  5EZY A;  2WLK A;  3ETG A;  5CBF A;  3ABU A;  3B8N A;  1VF7 A;  3QF7 A;  2Q7G A;  2PTM A;  4X8A A;  2Z5U A;  4DW0 A;  2N05 A;  4OPH A;  4K8X A;  4BIU A;  5CB4 A;  2P7T C;  3CC7 V;  5JH7 B;  1VEW A;  2ZQM A;  4Z2W A;  5EYP A;  4JI4 O;  4PDM A;  1PV0 A;  2Y0I A;  2IJK A;  2ZE5 A;  3AG3 C;  2YIA A;  3QO8 A;  4ASU G;  1LUW A;  4BW5 A;  3U10 A;  2JS5 A;  2NN4 A;  2PI5 A;  4PV1 B;  5LOV B;  5BR8 B;  3A0R A;  1K8A W;  5FL7 G;  1N36 B;  2ZT9 B;  3OTF A;  4WBN B;  4DR5 O;  5H5N A;  5A9G A;  3CYO A;  3R66 A;  3WB2 A;  3X2Q B;  5IYD O;  3STL C;  5CA0 A;  5LGU A;  1B3Q A;  2QR4 A;  2IJI A;  3AK2 A;  5IY5 C;  1RP3 B;  2YC0 A;  4NKG B;  3SJC C;  2AZ0 A;  2UXC O;  4DYL A;  5IDJ A;  1H38 A;  4QE7 A;  3SR2 C;  1CEZ A;  4DXW A;  5E1A C;  4K3A A;  3ASN C;  2DN9 A;  2ZDI A;  4X9Q A;  2HHH O;  1M5I A;  3BA9 A;  4PHZ A;  5LP6 A;  4JI8 B;  3K5L A;  2QM7 A;  4X65 B;  1K97 A;  2WLI B;  1QR8 A;  1AI7 A;  1PD3 A;  4MW8 A;  3T4Z A;  3U11 A;  1JR9 A;  2HEP A;  5B3S C;  2DYR C;  5BXZ A;  4MVM A;  3JAK A;  4YIP A;  3UM7 A;  2QWP B;  3AK1 A;  4DR7 B;  2ZM6 O;  3AK3 A;  3N2G B;  3HKD A;  4LR3 A;  4E4E A;  4GKK B;  1OCC C;  1NZ6 A;  2AHZ A;  2JJ2 G;  5JCO C;  1WP7 A;  2XAJ A;  2RDC A;  3FB5 C;  2GBO A;  3LNM B;  2R9R B;  1Q5O A;  4GUN A;  1GTO A;  4EB6 A;  2LFS A;  5LA6 A;  1AP5 A;  5A2Q N;  4H0L B;  1WJZ A;  1Q86 W;  1VQ5 V;  3ICX A;  4FIP C;  5DED A;  4UXN A;  5B5E Z;  3W7T A;  2B9Z A;  4YXW G;  3L74 H;  4O2B B;  1DF4 A;  1WLE A;  1AJN A;  3AG3 B;  3ETE A;  3WU2 Z;  2WAM A;  3ZMS A;  5EBL C;  3T4D A;  4JI5 B;  3ZRV A;  4LFA B;  3OM3 B;  4LF5 O;  4FVM A;  1Y67 A;  3RN4 A;  1LNQ A;  1L0N H;  2F4V B;  1R6T A;  2L35 A;  3JAR A;  4RAI A;  4DV3 O;  3E35 A;  2HP8 A;  1GM9 A;  1YHQ V;  2YEV B;  1RSO B;  4JI3 O;  1J5E B;  3K5N A;  3BHP A;  1EFR G;  1FXK A;  2UUC O;  2A9H A;  4B3M O;  1SQQ H;  3E8F A;  5IY5 B;  1PP9 H;  2BE3 A;  1R1B A;  2QWR B;  4RUE A;  2W0X A;  2UXD O;  3BEH A;  1Z5W A;  3ASN B;  1GAX A;  2WA4 A;  3H9V A;  4LWS B;  3G71 V;  5BMV A;  1ZAU A;  2IW5 A;  4EKW A;  1VQ6 V;  4LFB B;  1BE3 H;  3Q4H A;  2H8P C;  2CTW A;  1B06 A;  4YY3 O;  4X62 O;  5B3S B;  2DYR B;  4DV2 B;  2FB5 A;  3ML0 A;  4TV9 B;  3JAW A;  1YJ9 V;  3NXS A;  4X20 B;  2AXT Z;  2HJD A;  4TQD A;  2EJ7 A;  5J2T B;  1OCC B;  2ZIO A;  2P90 A;  3K5M A;  4LF9 O;  4HYO A;  1XMQ O;  5C93 A;  2JGD B;  1KKD A;  2X6A A;  5GON B;  4B3R O;  1X4T A;  3J80 N;  2X6B A;  4DW1 A;  2K9P A;  1KBH A;  5HFL A;  4PA7 A;  1QBZ A;  1ZUQ A;  3K0D A;  5JVD A;  3ZN1 A;  4UCS A;  4NTW A;  5AG2 A;  4JTD B;  1E79 G;  1KD1 W;  1YTF D;  1P7B A;  3RT3 C;  2RCV A;  3TGU H;  4RQE A;  1S77 D;  2XHB A;  1AR5 A;  4TWK A;  1VP7 A;  1Y4M A;  2BTO A;  1CXZ B;  1K73 W;  2ETN A;  1XHX A;  2YI9 A;  3BVO A;  4LF7 O;  1DLB A;  2ADP A;  4DR5 B;  2ODM A;  4LNU B;  2AW9 A;  3RVY A;  4XDJ A;  5KHG A;  5IYC O;  3RVZ A;  4QIW F;  1H8E G;  3KCY A;  1VQ7 V;  1J95 A;  2LW7 A;  1SKV A;  3E83 A;  5LBQ A;  3GVM A;  1SET A;  2YSU B;  1AR1 B;  2UXC B;  1M1K W;  4DV7 O;  1DF5 A;  5FNV B;  1SQF A;  2B1G A;  2HHH B;  1B04 A;  1FXV A;  3HKB A;  3ZHT A;  2DWD C;  4J41 A;  1F7Y A;  1ARO P;  1HP8 A;  1ZL8 B;  2P4V A;  1MSD A;  5GTH Z;  1JFF B;  3ZRS A;  4PDL A;  3L70 H;  3CRM A;  5KAF Z;  1NTK H;  1TVK A;  4DV5 O;  5BY1 A;  4TSF G;  3JD0 A;  4WFF A;  4UVC A;  2EIK C;  4I50 A;  2JEX A;  3OR6 C;  4FFB A;  3L73 H;  1BT8 A;  1UFI A;  4PA3 A;  2DYS C;  4LF6 O;  5ITZ A;  5IWA B;  1L0L H;  3RBZ A;  1XMO O;  4DO2 A;  4MVQ A;  4O4L B;  4P9O A;  5JJJ B;  4H44 B;  4CH3 A;  2BTQ A;  3OW2 U;  3JCU Z;  4HBN A;  1O9H A;  5EIB D;  3RYI B;  1AJP A;  1H2L A;  1US6 A;  4QJF B;  1LR1 A;  1PKX A;  5BZB A;  4TUY B;  4LF5 B;  3C3S A;  4RO2 A;  3W7W A;  4F6R A;  5C8Y A;  2IU0 A;  3CWB H;  4K0K O;  2KKW A;  3ZRW A;  1URF A;  1R3I C;  4DV3 B;  3RWR D;  4JI3 B;  2Q4P A;  2R70 A;  2EIJ C;  2RQ6 A;  2CH7 B;  4B3M B;  2EIN C;  2ZIM A;  4NB5 A;  1NS1 A;  3G80 A;  4B3T O;  4KUM A;  1FKA O;  2Q9L A;  1KQS U;  4QGP A;  1BS3 A;  4XDL A;  4YIO A;  4Z1V A;  3QVN A;  5J9P C;  3P3N A;  4UB8 Z;  1N4C A;  3JD4 A;  4NVP A;  1I94 O;  2UUA O;  4YY3 B;  2A3Q A;  4YHH O;  4X62 B;  4JYY A;  3W7X A;  2OCH A;  4AI8 A;  3OUS A;  2UXB O;  2DJV A;  1A32 A;  1H2G A;  1YZB A;  1AI6 A;  3OMI B;  4LF9 B;  1XMQ B;  3LDC A;  1K5S A;  4U3J A;  4F6E A;  2EIK B;  4B3R B;  1IBL O;  4X1I B;  5LOV A;  3U0Z A;  3ZIA G;  4J9Y B;  4PD4 F;  2DYS B;  1SQV H;  1RPO A;  1AI4 A;  4FLU A;  1Q82 W;  4WBN A;  3ZHR A;  2HFE C;  3EFF K;  3CXC U;  3GWO A;  1XQ8 A;  2BSK B;  3QTC A;  2QWN B;  3K9A A;  2GTS A;  1S76 D;  1IDS A;  2QWQ B;  1FYJ A;  3K9S A;  3AG7 A;  1HR0 O;  4LFA O;  2KG7 B;  2VWK A;  5KAI Z;  3IC9 A;  3QO5 A;  2LJ2 A;  4K8Z A;  2D3O W;  2Q69 A;  2F4V O;  2UXN A;  2XTA A;  3KZI Z;  1I5Y A;  3D8C A;  2XUM A;  4LF7 B;  1SQB H;  2QTO A;  1EZJ A;  4I4T B;  2WLI A;  1QU7 A;  2JK5 C;  1G8M A;  2EIJ B;  4D6T H;  5EBM C;  2EIN B;  4I55 A;  3BA8 A;  1GO3 F;  3TXS A;  2CDY A;  3N2G A;  1EBO A;  2R9I A;  1PL4 A;  3L75 H;  2XAG A;  1SER A;  2ADQ B;  5L3G A;  4GX0 A;  4C7U A;  5KMG B;  4DV7 B;  1MZE A;  2FYU H;  5JQG B;  3O65 A;  3UT5 A;  1HW7 A;  3CEI A;  4J9Z B;  2EUL A;  5L3D A;  1OCR B;  3K03 A;  4PI0 A;  3RYF A;  3T1H O;  2YXY A;  3A0H Z;  2ZKO A;  5CA3 A;  2F43 G;  4X88 A;  3FX7 A;  2OYQ A;  4O2B A;  4AQY O;  4NR1 A;  3CRC A;  3E22 A;  3A2F A;  3IFX A;  4X1Y A;  2NNU A;  5B1N A;  3G67 A;  3L71 H;  4OPA A;  4DV5 B;  4WF9 V;  4H37 A;  5D5P A;  5K1P A;  4PDV A;  5FPR A;  1VIB A;  2EJR A;  1QQC A;  2GUZ B;  2EZO A;  4X66 O;  1YI2 V;  3D36 C;  4CS2 A;  1ORQ C;  4HNA B;  5HFM A;  4LF6 B;  1BHB A;  1TA8 A;  3SJA C;  1XMO B;  4MVO A;  1THZ A;  3CP1 A;  1PNK A;  2YEV A;  3JAL A;  5LL6 Y;  1RSO A;  4TV8 B;  2JJ1 G;  4LCU C;  4O4H B;  4YJ2 B;  3SYA A;  1NH2 D;  3OFN G;  1QLE B;  3ZN0 A;  1RFY A;  4GX5 A;  3RW0 A;  2UUB O;  4ZOL B;  1EN4 A;  3ASO C;  3K5O A;  2Y0P A;  3D3I A;  1SF9 A;  4K0K B;  2Y48 A;  2L6L A;  2YXH A;  3JAT B;  4I9Q A;  1NVP D;  1WA8 A;  3KCX A;  4IL6 Z;  1WB7 A;  5KHJ A;  2WA3 A;  4PA6 A;  5B1O A;  1HNX O;  2ZD9 A;  2WWW A;  4WFH A;  4Q20 A;  3ZX6 A;  1JJO A;  4IIJ B;  1OZ0 A;  4TV9 A;  4O4J B;  1NT2 B;  4X20 A;  1IXM A;  5J2T A;  4X1K B;  2LFR A;  4B3T B;  1AR4 A;  4ZI7 B;  5JCO A;  3G6E V;  1BCC H;  2Z3Y A;  3E86 A;  2QM8 A;  3B2E E;  4DR3 O;  2JGD A;  2ZXW C;  1QNM A;  5B1A C;  1EN5 A;  4OGQ B;  1XIL A;  3CCL V;  2P06 A;  3JAS B;  4PEL A;  1VQ4 V;  1P4R A;  1I94 B;  5LHI A;  2UUA B;  4YHH B;  3CRQ A;  1N8R W;  2N04 A;  4FZ0 A;  4W4L A;  5LYJ B;  4MS2 A;  2UXB B;  3SPJ A;  2P67 A;  1H2M A;  2EBO A;  1XOU A;  3S3W A;  1UJW B;  4DV6 O;  1D5A A;  1XL6 A;  1GKF A;  1EM1 A;  2CAZ C;  4JF3 A;  1IBL B;  3K04 A;  2NLJ C;  1N32 O;  1COW G;  1HDJ A;  4AHC A;  3K3W A;  4CH5 A;  5IWA O;  1X59 A;  1R6K A;  4R8C A;  1GK9 A;  5L3B A;  4FM2 A;  4XDK A;  2Y4T A;  1YIJ V;  3ZHU A;  4CS3 A;  4IHJ B;  4WFB V;  2MW2 B;  4MTX A;  5LP6 C;  1FPO A;  3MAQ A;  1TUB A;  1HR0 B;  5IJ9 B;  1VQM V;  2YDE A;  4R6Z A;  3ASO B;  2GHY A;  2WLH A;  2JVD A;  4FMT A;  4PI2 A;  3WB0 A;  5FNV A;  4I0X A;  1AJQ A;  2XOK G;  4B7E A;  3H1J H;  3F5W C;  3P3P A;  2FTK A;  2QGN A;  1FJG O;  1ZTE A;  1MSW D;  3LSU A;  5DM6 V;  1Q3E A;  1XUQ A;  3M99 B;  1JVM A;  3SYC A;  1ZL8 A;  3SPC A;  5KHH A;  4G2K A;  3FB8 C;  1JFF A;  3RYH A;  4IGG A;  4BR6 A;  3ZHS A;  2ZXW B;  1IX9 A;  4LFC O;  3ZS8 C;  3HKC B;  5B1A B;  3B4S A;  5IJ0 B;  1Q6H A;  1I5X A;  1Q7Y W;  3T1Y O;  2MK3 A;  4UV8 A;  4LH7 A;  3OUF A;  3SYQ A;  3ZCC A;  1AB3 A;  3T1H B;  4ZHQ B;  2DMX A;  3D3Q A;  4O4L A;  2YIB A;  3RFR A;  2P22 C;  1MNG A;  1WN7 A;  4AQY B;  3CB2 A;  3K59 A;  1XI1 A;  1N0J A;  2YUA A;  2F66 C;  1BQ0 A;  5D5Q A;  3OMA B;  2WLJ A;  4BIZ A;  1UPG A;  4TUY A;  3OAA G;  5CA0 B;  4BAY A;  4I5S A;  1W59 A;  3BAB A;  4X66 B;  3DXR B;  2DQ0 A;  5FLX N;  4DK0 A;  4JGS A;  1F51 A;  3SPG A;  3DC5 A;  2OIE A;  1W2B U;  1VQK V;  2QDO A;  2CH7 A;  2OCC C;  5EC2 C;  3T2M A;  5LP6 B;  4DR1 O;  1LUV A;  2HKO A;  4Z1M G;  2GV9 A;  1FFX B;  3LNN A;  1T5E A;  3TET A;  1JA8 A;  1H2N A;  3DSQ A;  2UUB B;  4KFM A;  4BIO A;  1KB9 F;  3OE7 G;  1FFT B;  4JAV A;  1M90 W;  2CE4 A;  2ITC C;  4J11 A;  1H8H G; 
#chains in the Genus database with same CATH homology
 3R65 A;  1KQS U;  1YSC A;  3LSQ A;  2Q68 A;  1K3E A;  2ZDI C;  2OTJ V;  4QPK A;  3H01 A;  1B6Q A;  4I9W A;  2OT5 A;  3LSS A;  3K06 A;  2A79 B;  3F7V C;  4RQF A;  4N23 A;  3CPW U;  4XDL A;  3ZJZ A;  1NQT A;  1S72 V;  1NR7 A;  1ROP A;  4KP4 A;  5J9P C;  3E8B A;  2HVJ C;  2A0L A;  2HG5 C;  4N21 A;  4OXS A;  2AHY A;  2WLL A;  3ABK B;  3JD4 A;  1JOY A;  1OCZ B;  4H33 A;  3SYO A;  1K34 A;  3SYP A;  3I55 V;  2WLK A;  3UKM A;  3ETG A;  5CBF A;  1Q81 W;  3ABU A;  3W7X A;  3B8N A;  1DTO A;  3OUS A;  2GSM B;  1M9N A;  4X8A A;  1K5Q A;  2Z5U A;  2B1I A;  1AI5 A;  1H2G A;  2WLL B;  2QKS A;  1AI6 A;  3OMI B;  3TK1 A;  2ZR3 A;  4BIU A;  1QVG U;  3LDC A;  4MTG A;  1K4D C;  2EIM C;  2P7T C;  3ABM B;  1K5S A;  3CC7 V;  2EIK B;  2ZQM A;  2IH1 C;  2PI4 A;  4PDM A;  1NJI W;  1YTF B;  5KA6 A;  3ZIA G;  2IJK A;  4FPP A;  4J9Y B;  5L3F A;  3AG3 C;  2DYS B;  3QO8 A;  4ASU G;  4HZ3 A;  1RPO A;  4BW5 A;  3IGA C;  1KP3 A;  3TCU A;  1AI4 A;  2CK3 G;  5EK0 A;  2PI5 A;  1Q82 W;  4WFE A;  3A0R A;  4MW3 A;  1K8A W;  2HFE C;  1NBM G;  3EFF K;  4MVU A;  5FL7 G;  3K79 A;  5KUM A;  3GWO A;  3P30 A;  3ZMV A;  5LGT A;  3CCJ V;  4R50 A;  1GM7 A;  2DW4 A;  3JD1 A;  2W0F C;  1BL8 A;  2XAF A;  4LBE C;  3K08 A;  3K9A A;  4JYB A;  1S3J A;  1S76 D;  4GCZ A;  3CYO A;  4U7N A;  1MG1 A;  1K33 A;  2BOC C;  3X2Q B;  5IYD O;  2WSS G;  3STL C;  5IYB O;  5LGU A;  2IJI A;  3OEE G;  3LUT B;  3CCV V;  2QA4 V;  1VQL V;  3QO5 A;  4ZKI A;  5IY5 C;  2Q69 A;  2D3O W;  4KUM A;  1PL0 A;  2UXN A;  1I5Y A;  3JCZ A;  3ABT A;  2OCC B;  2QTO A;  1EZJ A;  5L3C A;  1FXK C;  4GX1 A;  5IDJ A;  3GB7 C;  3ZMU A;  2WLI A;  1H38 A;  4QE7 A;  1CEZ A;  4DXW A;  2JK5 C;  3HB3 B;  5CMU A;  5E1A C;  5KUK A;  4RUF A;  4PA4 A;  1JQ0 A;  1G8M A;  2EIJ B;  5EBM C;  3ASN C;  1QCE A;  2ZDI A;  2EIN B;  3CMA V;  1JJ2 U;  1GM8 A;  2QM7 A;  1K97 A;  2WLI B;  1QR8 A;  1AI7 A;  1GO3 F;  1PD3 A;  4MW8 A;  3T4Z A;  1EBO A;  1V55 B;  2R9I A;  3QO7 A;  4P2Z A;  4LC1 A;  2XAG A;  4MTO A;  2JEU A;  1VQO V;  5B3S C;  1SER A;  2DYR C;  4MVM A;  5L3G A;  4GX0 A;  3UM7 A;  2QEX V;  1NR1 A;  4UVA A;  1Y66 A;  4P30 A;  1YJW V;  4JAS A;  1OCC C;  2AHZ A;  4F4L A;  2JJ2 G;  5KA5 A;  2XAJ A;  4J9Z B;  3FB5 C;  5L3D A;  1OCR B;  3K03 A;  4GT1 A;  1JPX A;  3LNM B;  5CA3 A;  2R9R B;  5H6Q A;  2F43 G;  3MHH C;  5CBH A;  1GTO A;  2XAH A;  4X88 A;  1K7D A;  3E2E A;  1MOF A;  2LFS A;  3ZMZ A;  2HVK C;  3DGE A;  3E89 A;  1Q86 W;  1VQ5 V;  3AG2 C;  3IFX A;  4FIP C;  2NNU A;  2EIM B;  5B1N A;  4UXN A;  4WF9 V;  2H94 A;  3W7T A;  4H37 A;  3FKS G;  4YXW G;  4PDV A;  1DF4 A;  2EJR A;  1OCR C;  1WLE A;  1AJN A;  3AG3 B;  3ETE A;  2EZO A;  1YI2 V;  2WAM A;  1R3K C;  3ZMS A;  1ORQ C;  5EBL C;  3T4D A;  5HFM A;  1K9M W;  1BHB A;  1JX9 A;  1KEC A;  3LDD A;  3ZRV A;  3KG2 A;  3OM3 B;  4JPR A;  4MTF A;  4MVO A;  3SPH A;  3OEH G;  2XAS A;  1THZ A;  1VQP V;  3CP1 A;  1PNK A;  2YEV A;  4HAM A;  3VOU A;  1LNQ A;  2JJ1 G;  1K4C C;  4JAU A;  4LCU C;  4TT3 G;  5GW7 A;  4PDR A;  4RAI A;  4E2L A;  3FYE B;  2XAQ A;  3E35 A;  3SYA A;  4ZBM A;  1NH2 D;  3OFN G;  1GM9 A;  1YHQ V;  1QLE B;  2YEV B;  2BOB C;  1L1F A;  5L3E A;  4WFG A;  3ZN0 A;  4GX5 A;  2IJJ A;  1EFR G;  5B1B C;  5CBG A;  1MAB G;  3ETD A;  5H6R A;  1FXK A;  3RW0 A;  2A9H A;  3E8F A;  3ASO C;  5IY5 B;  3D3I A;  3W7U A;  2Y48 A;  1K92 A;  4RUE A;  1NVP D;  1FXK B;  4UV9 A;  3IC7 A;  3BEH A;  4PA6 A;  1R73 A;  5B1O A;  2ZD9 A;  3E8H A;  2WWW A;  4WFH A;  4Q20 A;  1QLE C;  2K1E A;  3ASN B;  1OZ0 A;  1GMG A;  3AG4 C;  3E8G A;  4LP8 A;  3CCQ V;  3G71 V;  3WFV A;  2IW5 A;  4EKW A;  1VQ6 V;  1IXM A;  2H8P C;  2XND G;  2DQ3 A;  2LFR A;  2HR3 A;  1S5H C;  2EZP A;  5B3S B;  4MSW C;  3QNE A;  3G6E V;  2DYR B;  3ABL C;  3ML0 A;  2Z3Y A;  1YJ9 V;  3E86 A;  1CPY A;  2QM8 A;  3NXS A;  4G27 B;  4MVS A;  1G4Y B;  2ZXW C;  1W0J G;  1M56 C;  1OCC B;  1ZWI C;  5B1A C;  2P90 A;  4L87 A;  2X7R B;  5LGN A;  4HYO A;  2JDI G;  3CCS V;  3CCL V;  5C93 A;  1OCO C;  2B5U A;  4PEL A;  1SES A;  4MT8 A;  1P4R A;  4MVR A;  1VQ4 V;  1KKD A;  3T1C A;  4U7O A;  1BMF G;  5LHI A;  2X6A A;  1JCH A;  1S0V A;  4CZZ A;  3OR7 C;  1V54 B;  2X6B A;  1N8R W;  1M57 C;  1R3J C;  5LHH A;  4CBC A;  2Q67 A;  3PJS K;  3AEI A;  4MS2 A;  2EIL C;  4MVZ A;  3SPJ A;  3OMN B;  2P67 A;  5HFL A;  3HPL C;  4PA7 A;  1F23 A;  3AG2 B;  2IU3 A;  1QBZ A;  2EBO A;  3D36 A;  3K0D A;  2QE7 G;  1VQ8 V;  3ZN1 A;  1UJW B;  5DN6 G;  1FXH A;  1XL6 A;  2P6J A;  4JTD B;  4UVB A;  1GKF A;  1E79 G;  1KD1 W;  1YTF D;  1P7B A;  4JF3 A;  3K04 A;  2NLJ C;  1V54 C;  1NKD A;  4RQE A;  3CCM V;  1COW G;  1S77 D;  3K3W A;  3EHB B;  2X6C A;  3CCR V;  1R6K A;  1W0K G;  4TWK A;  4JYC A;  4R8C A;  1Y4M A;  1GK9 A;  3FB6 C;  5L3B A;  4XDK A;  2W6J G;  3B8M A;  3STZ C;  1K73 W;  1YIJ V;  4GX2 A;  3P32 A;  3F7Y C;  4WFB V;  2WPD G;  4PA9 A;  1DLB A;  3G4S V;  3SJQ C;  4XBF A;  4MTX A;  1PNM A;  3JD3 A;  4X89 A;  3CC2 V;  1QVF U;  1RM1 C;  1F4N A;  3RVY A;  5B1B B;  4XDJ A;  5IYC O;  3AG1 C;  3RVZ A;  1VQM V;  4P9P A;  1H8E G;  4QIW F;  4R6Z A;  3ASO B;  3I56 V;  4WFA V;  1VQ7 V;  2GHY A;  2WLH A;  4FMT A;  1J95 A;  4QPJ A;  3CXC U;  1E1R G;  1YIT V;  3CME V;  1VQ9 V;  3WG7 C;  3E83 A;  1AJQ A;  2XOK G;  5LBQ A;  1SET A;  2YSU B;  2WLN A;  2KB1 A;  3F5W C;  1AR1 B;  2LP7 A;  2FTK A;  2DWE C;  1M1K W;  3CCE V;  4QNH B;  1MSW D;  1F4M A;  2UXX A;  3JD2 A;  1DF5 A;  3LDE A;  2IJH A;  1KC8 W;  3AG4 B;  5DM6 V;  3M99 B;  2B1G A;  1JVM A;  3SYC A;  1FXV A;  3VBB A;  2OTL V;  3SPC A;  1QLN A;  2DWD C;  2JIZ G;  4G2K A;  1SRY A;  4JTA B;  5CN0 A;  3FB8 C;  2HJF C;  2Q6A A;  3ABK C;  3ABL B;  2ITD C;  1OCZ C;  3FYI B;  2ZR2 A;  1ARO P;  4G28 B;  1FS0 G;  2ZXW B;  3B77 A;  1M56 B;  5B1A B;  3FB7 C;  3ZRS A;  4PDL A;  1SZT A;  1I5X A;  1Q7Y W;  1OCO B;  5EBW C;  2MK3 A;  4UV8 A;  1RPR A;  4TSF G;  3W7S A;  3ABM C;  3JD0 A;  3OUF A;  4WFF A;  4UVC A;  3SYQ A;  3ZCC A;  2EIK C;  2JEX A;  1BHA A;  3OR6 C;  3SPI A;  1M57 B;  3OGC C;  3JYC A;  2EIL B;  3BY6 A;  4PA3 A;  2DYS C;  1R6N A;  3ZMT A;  4WCE V;  1TUE B;  1PNL A;  3RBZ A;  3K0G A;  2C2A A;  4DO2 A;  1XL4 A;  4MVQ A;  4P9O A;  2M7W A;  4FJC C;  1ENV A;  3OMA B;  2WLJ A;  4JTC B;  1KP2 A;  4BIZ A;  3OAA G;  1VQN V;  3OW2 U;  4BAY A;  3ZRX A;  4I5S A;  2V7Q G;  2HLD G;  1YJN V;  1NH2 B;  4R7C A;  2X0L A;  1AJP A;  1E1Q G;  2DQ0 A;  2WLM A;  3X2Q C;  4QJF B;  1PKX A;  4JGS A;  5BZB A;  4UUJ C;  4RO2 A;  3W7W A;  3MD0 A;  2Y69 B;  5EC1 C;  2IU0 A;  2W6I G;  1QR9 A;  2V1D A;  1F51 A;  3SPG A;  1CP9 A;  1W2B U;  1NVP B;  1HWY A;  3CCU V;  1VQK V;  2OCC C;  5EC2 C;  3MHS C;  2ATK C;  3T2M A;  3ZRW A;  1R3I C;  1RM1 B;  3CD6 V;  2HKO A;  4Z1M G;  1OHH G;  4FK5 C;  1WPX A;  3TET A;  3AG1 B;  1R3L C;  2EIJ C;  2IH3 C;  5H9C A;  2EIN C;  4KFM A;  3ZRW B;  3DTU B;  3OE7 G;  1FFT B;  3CC4 V;  4JAV A;  1M90 W;  2Y69 C;  3WG7 B;  5LHG A;  2ITC C;  1H8H G;  4QE9 A;  1V55 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...