4JPRA

Structure of the aslv fusion subunit core
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
YFQGTANLTTSLLGDLLDDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCSFNLSDQSESIQKKFQLMKEHVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of a fusion glycoprotein from a retrovirus that undergoes a hybrid 2-step entry mechanism.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin a)
molecule tags Viral protein
molecule keywords ASLV fusion TM
total genus 28
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jprA00
1DLBA 1QR9A 5HFMA 1DF4A 1JQ0A 4N23A 3B77A 4JPRA 2EZOA 4E2LA 1SZTA 1I5YA 1K33A 5CN0A 2MK3A 2LP7A 1F23A 1JPXA 1DF5A 5CMUA 5KA6A 1EBOA 4FK5C 2X7RB 4JGSA 1MOFA 3P30A 1QR8A 1QBZA 1ENVA 3CP1A 1MG1A 3MHHC 3H01A 3WFVA 1Y4MA 2M7WA 2P6JA 3B8MA 3K9AA 5KA5A 2EBOA 3B8NA 4G2KA 4N21A 3MHSC 1Y66A 4FJCC 1K34A 4FIPC 5H9CA 2EZPA 3GWOA 1I5XA 4JF3A 5HFLA 3CYOA 1QCEA 3M99B 2OT5A
chains in the Genus database with same CATH superfamily
3G6EV 2YIBA 2RCVA 4F6RB 3ABLB 2BOCC 1OCRB 1IURA 2YXLA 3CCLV 3AK2A 3KZIZ 4UVAA 2BE3A 5ITZA 1QVGU 5LP6C 3ETGA 4LF6B 3L74H 5H2FZ 4MVOA 4IIJB 4FPPA 4JI1B 1V54B 4OX9B 2DQ0A 4LF8O 5KHJA 2P7TC 3FYIB 4JAVA 4QE7A 1NZ6A 3H1KH 3CRQA 2MK3A 4DV1B 1XUQA 1VQMV 1VF6C 2X7RB 3G67A 4IYIA 4RAIA 3RWRD 5IWAO 5EIBD 3FX7A 2ZIMA 3SYPA 3P3PA 2HJDA 4C7UA 3HPLC 2V4DA 2KG7B 2JGDB 4R50A 1X4TA 2XAHA 3AK1A 3CSXA 3STLC 3BFRA 4X1IB 2D2CB 2DW4A 2ITCC 3OW2U 1XMOB 1VF5B 2A79B 3SGIA 1T5EA 4LNUB 3JAWA 4JI2O 3M8AA 2DYSB 2EBOA 5LGNA 1PNLA 2UXXA 3K58A 2CGNA 1QR9A 3ASNB 4QJFB 4HAMA 1IZ3A 2GUZB 1YIJV 3AG2B 1TUBB 4I55A 5DM6V 1H8EG 1GN4A 1WB8A 2CTPA 5KHKA 1HR0O 2E5LO 1PP9H 1R6TA 4KFMA 1GO3F 2WLLA 1Y4MA 1XNRB 1QQCA 3BA8A 3UO2A 4KHPB 5LXTA 4X66B 4LF6O 3OT7A 1NR7A 3ASOC 1QNMA 2WLKA 4B7EA 1SQPH 3SJAC 4JI8O 4I0XB 2F4VB 1E1RG 1EFRG 4GX5A 4K8XA 3H9VA 3UO3A 5CMUA 2AGAA 1WPBA 1FXVA 4O4JB 1SA0B 3BRCA 1R3JC 3B8MA 5LMNO 3W7SA 4J9YB 5IJ9B 2NR5A 1FYJA 5CA1B 4PA7A 1J5EO 3H1IH 2Q7EA 1NTZH 2YSUB 3K59A 2GUZA 3E89A 3A0BZ 2XUMA 4NKGB 1VQ9V 1OCCB 3JATB 2UU9O 5EBLC 3CCUV 1Q6IA 3G71V 1AB3A 4IYHA 1M93A 5LHIA 4FM1A 3JALB 4O4LB 4WBNB 4JASA 1VMGA 1SQVH 4O4IA 2B9ZA 4DV2O 5D5QA 3LSUA 1N36O 5FL7G 2KG7A 2JGDA 3FAVB 2RJZA 2HHHO 5B1BB 5IY5C 3AG4C 4I55B 2CE4A 2YIDA 1OV9A 4U3JA 2W0FC 1ROPA 4FFBB 4TV9A 4B3MO 3UCSC 3UM7A 2R9RB 5C8YA 4PV1B 2JEUA 3THOA 3WG7C 2Q67A 2X6BA 3CMAV 4QIWF 4PA6A 3D3IA 4CH5A 2D3OW 4TOIA 2NLJC 2XT9A 3F5TA 4LWSA 2Q7HA 3JASA 4DR3O 4WFGA 3SYOA 2E74B 2LFSA 2ZNIA 5CA0B 2H3OA 1XEQA 4LFCB 1S3JA 3WB2A 1P84F 5LOVB 2QWQB 4MW8A 5B5EZ 4FLTA 3S3XA 2N04A 1IBLB 4ZI7A 3VQXA 1FFTB 2EIJC 1XNRO 2DYRB 3AG3B 3SPHA 1PL0A 3RW0A 4DUYB 1YTFB 4DK0A 2P4KA 4UCVA 3K06A 4NTXA 1S72V 4GKKO 2P22C 4DXWA 5KMGB 4DV3B 1FKAO 1GH6A 1ZUQA 2QE7G 3CB2A 3LDDA 5K1XA 3STZC 1I0HA 1HNZO 2UUCB 2WLNA 3RYHA 4DRXA 1SQQH 1JFFB 1AI5A 4RUEA 4TSFG 1GN3A 1NH2D 4ZBMA 3L70H 2PI5A 4RO2A 5B1AC 4PHZA 5IYZB 1K92A 5IWAB 1ORQC 4JI4B 3LDEA 2WLMA 1MG1A 1PKXA 3MHHC 2WAMA 4UCOA 4I50B 2V1DA 1KMIZ 2X6AA 2UUBO 1K34A 1N32O 5IJ0B 3A8TA 3ZEDA 2LJ2A 1DF4A 4B3RB 1AJQA 4DV7B 4X1KA 2ADPA 2QM4A 1GMGA 4GKKB 3ZHQA 4MVMA 4R6ZA 1JVMA 1QR8A 2H94A 2QWRB 3JALA 4FFKA 2GBOA 2VQEO 3RYFA 3CCVV 1BQ0A 2YI8A 4U3FH 1OZ0A 4ZOLA 3CCQV 4B3MB 1KU9A 2IJHA 2R72A 1TA8A 2G38A 1Z2GA 4X1KB 5KA6A 4BR6A 3A0HZ 1KBHA 4JGSA 1L8DA 2CTWA 1VF6A 4OPAA 2VWKA 5TISZ 5H6RA 1P49A 4P30A 3OGIB 2IW5A 3L72H 4J10A 2Q6AA 2B1IA 2UXBB 4G2KA 1F4MA 2HLDG 3DC6A 3E2EA 3B40A 2A9HA 3ABMB 3ZMSA 2E76B 1K4DC 2DJVA 5CA3A 2JJ2G 3W7XA 1COWG 1N32B 3AG4B 2H8PC 5IYZA 4IHJB 1XL6A 3FB7C 3K08A 4DW1A 5EBWC 4Q20A 2P67A 1FFXB 4YHHO 2MW2B 3WFVA 1WNSA 2NN4A 4LF8B 1WN7A 1J5EB 1BT8A 3R66A 3PN1A 4I7ZB 3NXSA 2F43G 3W7TA 4X62O 1D5AA 2KQXA 4HNAA 5L3FA 1YZBA 2ZKOA 3JARB 4LF5O 2AZ2A 4CH3A 1IX9A 4DR6B 3WB1A 3QVNA 2EINB 5KAFZ 1IBMB 2WLHA 3SYAA 4LFBB 5IYBO 1GM7A 1XREA 4J7KA 2V7QG 2YXHA 3ZBHA 3RYIA 3K5NA 5IYCO 1BGYH 1M57C 4DV7O 1LUVA 4EKWA 1GN6A 4R7CA 2LW1A 4DR7O 4NTYA 3H1HH 4LNUA 1ENVA 2UXDO 4JV5O 1V55C 2QKSA 2XNDG 5LA6A 2KKWA 1VP7A 3IC7A 3HKCB 4DV6B 1F4NA 3GB7C 3SR2C 1SRYA 3ETQA 4PDMA 4X65O 4LF5B 5B3SB 1FXKA 1MZEA 5K1PA 2UUAO 1MMMA 1OJHA 3FD9A 2Q8VA 4RWUA 4X88A 4O4LA 4PDVA 4PJ0Z 4K0KB 4ZOLB 4N23A 2ZR2A 4X1YA 3X2QB 3IAYA 1WAZA 4U3JB 4W4LA 3AG3C 1RSOA 4JZ2A 1MOFA 2LW7A 3SJQC 1R1BA 1EN4A 2K1EA 5FNVB 2GDSA 4DUYO 4J7ZA 5AG2A 2ODMA 5CBFA 4YHHB 5A9GA 5KAIZ 4UB8Z 5E1AC 1FD9A 3P3NA 1SA0A 2Y48A 4UFZA 1K9MW 3LUTB 4MVQA 2A3QA 4FLZA 2QGNA 3B8NA 3HKEA 5B1NA 5KHGA 2Q69A 5JQGA 2QWOB 4FM0A 4MVZA 4F6RA 1K4CC 3ZCCA 5IT9N 3SPIA 4MW3A 4PA3A 4GLXA 4QPKA 4JI5B 4D7SA 1QBZA 3JASB 3L71H 1BHAA 1PV0A 2PF4E 1X59A 4MVUA 2JIZG 2OTLV 3HKDB 2WWWA 4Q6GA 4YJ3B 3OMNB 5JQGB 5KHHA 3CP1A 1XQ8A 3E83A 1ZWIC 4DR1B 1S77D 3ABLC 2W0XA 3JD0A 5BMVA 2CUGA 1OHHG 1H2LA 2IJIA 4OGQB 4DR7B 5GW7A 1K5QA 3FB8C 3K9AA 4N21A 1O9GA 1H2SB 5FNVA 2EX3A 3P32A 3L75H 2ZINA 4DV1O 3KCXA 1XOUA 5E79Z 1AI6A 4GKJB 1Q6UA 1YTFD 4UV8A 3KG2A 1NR1A 2YS8A 4JI6B 3G6BA 1N4CA 2JK5C 3ZHVA 4JYBA 1Q8IA 4FIPC 1JFFA 3H1LH 5C93A 2XHBA 4ICGA 4WCEV 1EN5A 3ZN1A 4LC1A 2BTOA 2ZT9B 3ZHRA 1XHXA 1HR0B 3GWKC 3ML0A 1R73A 3JCZA 3VBBA 3K5LA 3RN4A 3RYHB 3WU2Z 1QVFU 4FJCC 3SPGA 1K7DA 4U7OA 1MA1A 1SF9A 2ZNJA 4L8JA 1NH2B 2IH1C 5D5PA 1YJWV 3B77A 1VQKV 2GHYA 3G80A 4IT5A 1TUEB 2Z0AA 1BL8A 4H33A 4WFBV 1FJGO 4DV0O 3RYCB 3U11A 5GTIZ 3CC7V 4DUZO 1SC5B 1VQLV 2ZD9A 3MDSA 1CEZA 3T1HB 4JI8B 2HFEC 3HKBB 3QF7A 4P2ZA 4YY3O 4X20A 2FTKA 1OCOC 1IVSA 4GUNA 3RBZA 2ARHA 1AROP 4FZ1A 4MTGA 2FB5A 1AP6A 3QTCA 3HKEB 4I4TA 4UVBA 1VQNV 4NXNB 4X1IA 4O2BA 3JCUZ 5L3GA 3CRRA 1RPRA 2HG5C 3ZHSA 4I9WA 3N2GA 3AG7A 1N36B 2OCCB 1I5XA 2OWOA 4DUZB 2QJ1A 4J11A 4JI0O 1BZKA 3JYCA 4B7KA 5EZYA 1K33A 1W2BU 1OCRC 3ABTA 1W59A 2CK3G 3IC9A 4B3SB 3M7MX 5FPOA 2DYRC 1YHQV 1AJNA 3N2GB 4J7JA 1P7BA 4O4IB 4BW5A 2ZXWC 1K97A 2QR4A 1M56B 3WG7B 5LMUB 3I55V 3ZJZA 2YIAA 2M6YA 4UVCA 4X64O 4OX9O 4DR2O 3CCSV 1AJPA 1DF5A 4BWAA 2AXTZ 4UCTA 5L3EA 3JAKB 2Y0IA 3IFXA 1V55B 1ZAUA 4RUFA 2EILB 5IJ0A 3ICXA 2PYLA 2WLIB 4B3TB 3SJCC 5GONA 4JI5O 2Q9LA 4MTXA 3TJTA 5JWPA 2QM8A 2LFRA 2DOSA 4JYAO 1GKFA 1AILA 1MNGA 1H2MA 1L1FA 1YJ9V 3E8BA 1FFXA 5LHGA 3CJHA 3CCJV 1JA8A 4NVPA 4EB6B 5L3BA 3N2KA 1TGOA 2N74A 4PD4F 5H9CA 2HVJC 3GWOA 1XMQO 4EFBA 2EIMC 1YCIA 2BTQB 3EVKA 4K0KO 4JI2B 1EZJA 3SJBC 3ZRVA 1JJOA 3OTFA 1MABG 1VQPV 4DV6O 4YJ2A 2AZ0A 2XTAA 4H0LB 3K9SA 3W7UA 1N0NA 1W0KG 3JD4A 3K79A 4JI3B 3T1YO 2CH7A 2YIBD 1K73W 2Z3YA 1OCOB 2CTQA 3OTOO 1WA8A 3K03A 1WJZA 4PELA 1Q81W 1JOYA 3LSQA 4LCUC 1HNXO 1URFA 1Q82W 1YI2V 3J81N 4J41A 3BEHA 3C3SA 3CS5A 4FVMA 4GYCB 4P9PA 4DR3B 4AQYO 2Q68A 2A0LA 1RP3B 2DMXA 3ZMZA 4A5UB 3B2EE 3LNMB 1SZTA 1S5HC 1I5YA 1KB9F 2QEXV 5BR8B 4W4KA 4TUYA 2Y0PA 1FXKB 4O4HB 3E8GA 1WP7A 4PDLA 4MVSA 3FB6C 4JI7B 4CS3A 5EBMC 2ZXWB 1PD3A 3ZX6A 3RYFB 3A0RA 2ZIOA 2ZDIC 2AHZA 3HKCA 5CBGA 2OCCC 3MAQA 4LF9O 3OM3B 1M56C 1F7YA 3B09A 3CD6V 4X9QA 1YVWA 1CPYA 4GX0A 4JAAA 1I7FA 4DR5B 1M90W 2IH3C 3EFFK 3CRAA 5EIBC 4UCUA 5LMUO 1UFIA 2VWJA 5CA1A 2EILC 4BIZA 2YUAA 4ASUG 4OXSA 4TWKA 1NJIW 1V54C 1J95A 1BS3A 3FB5C 5CBHA 4MTFA 1VEWA 5A2QN 2Q4PA 1MZFA 2YC0A 4TV8B 3Q4HB 2FYUH 1GN2A 1HW7A 3ZRSA 3QO5A 4PI0A 4WFFA 3CC2V 2E75B 1KECA 3RGBA 3E35A 3K04A 1BE3H 4CC6A 2WLIA 2HHHB 1JMKC 5DECA 4QNHB 5B1BC 5BXZA 2DE0X 4XDKA 4Z2WA 4GKJO 5LBQA 1Z5VA 5B1AB 5JH7B 1GRJA 4CH4A 1S5LZ 3QNEA 1N33B 1RSOB 2DQ3A 4IGGA 1NVPB 4O2AA 1A32A 4NB5A 1Q5OA 1DTOA 1SQFA 2XASA 3CCEV 3VQWA 2O57A 2K9PA 4LH7A 1R6NA 3K3WA 3OGCC 1EBOA 3D3QA 4KXRA 4FFBA 1I94O 4E4EA 1KP3A 3RVYA 1KP2A 1IBKB 3OUFA 3SDLA 5CA0A 1S5JA 1BQZA 2EIMB 1SQXH 4BW9A 1YF2A 2HEPA 1FAFA 1LR1A 4PA9A 5JCOC 2ZE5A 5BMVB 5BR8O 1H2GA 2WPDG 4LF7O 4WFHA 3KKYA 4X8AA 1Q7YW 1GAXA 1ZSPA 4QE9A 2AW9A 3VQYA 2XOKG 4JI4O 4WBNA 2XAQA 3OMAB 4LFAB 2FMLA 1LNQA 3O65A 1PM9A 2XAGA 3HR0A 5FPRA 4TT3G 1O9HA 1M9NA 4JI7O 4NTWA 1JQ0A 1G1XB 1B04A 1SERA 2KSDA 4FLWA 2F93B 2WSSG 2LP7A 2EINC 3NR7A 3JSNA 5DN6G 3CRCA 4DW0A 1OCZB 4TV9B 2LO1A 3OEHG 3OMIB 2P4VA 5KA5A 3DTUB 1AI4A 4DR4B 4YJ3A 4QPJA 2P90A 2QKCA 4G27B 4Z1VA 4DO2A 2VQEB 3CYOA 4I0XA 3FAVA 1AR1B 1B6QA 5HFMA 3APQA 1XNQO 2QSAA 4EEQA 1KKDA 4YXWG 5KMGA 4LH6A 4NXMO 3K57A 4XDLA 1BMFG 1M4UA 4JYYA 3RYCA 2WLLB 2E3CA 4LBEC 2ILMA 1YJNV 1U96A 3DXRB 2Y4UA 4EB6A 4K8ZA 1Q43A 2ZM6B 2GSMB 1VQ8V 2Y69C 4HNAB 4I9QA 2YEVB 4KL1A 3T1HO 1VQ6V 4B3SO 1R3LC 3CXHF 1BCCH 4TV8A 4LWSB 1HNWO 2UXCB 1XI1A 5IYDO 4B3TO 4DR1O 5JVDB 1EN6A 1ZLZA 2YICA 1LUWA 4FMTA 1PL4A 2Q0OC 1QLEC 2IBZH 2PGGA 5CB4A 4FLXA 5LL6Y 2OT5A 2RNBA 3K0GA 2UUCO 5GONB 3L9DA 1N33O 3CXCU 2PZSA 5KHIA 1TVKB 3CWBH 2EULA 3AEIA 1KKCA 3J80N 5JJEB 4UB6Z 2EIKB 1SESA 4D7TA 3OAAG 3EXAA 2UXNA 1IDSA 4ZHQB 1UJWB 2BSKA 3BHPA 4MTOA 4GX2A 2HJFC 3H1JH 5F2VO 3FYEB 1JR9A 1SS3A 1SETA 2Y4TA 5ITZB 1KUQA 4I50A 2UXCO 3QG5A 5LHHA 1YDXA 1N8RW 3T4DA 3A2FA 5HFLA 1AVMA 4RQEA 4LP8A 1XBLA 2QTSA 4CS4A 2PYJA 4HYOA 4AI8A 1NU1H 1VF7A 5L3CA 4DV5B 3TCUA 3QO8A 4EFEA 2HR3A 2OTJV 2UU9B 1YXBA 3SYCA 2ZE6A 4FZ0A 5BY1A 3OFNG 3GVMA 5JVDA 1H2NA 3FKSG 4HZ3A 1XL4A 2RQ6A 1BSMA 2OIEA 5LP6B 1VIBA 4I4TB 3F5WC 1VQOV 2DYSC 1L0LH 1N0JA 1R3KC 2QM7A 1XNQB 1E79G 1H8HG 1HWYA 3JAMN 2JRIA 3S3WA 3AG2C 3HKBA 2VS0A 4K35A 2UUAB 3OTOB 4DR6O 5IDJA 3ABUA 4JYCA 1US6A 3T4ZA 1VARA 2UXDB 4JI3O 3H01A 4AQYB 2YXYA 5H5NA 4UCRA 5LP6A 4NXMB 2IJKA 1GM9A 3ZIAG 3ZRWA 1HNXB 4QGPA 3BVOA 4AHCA 3LDCA 1THZA 4DV3O 4DR5O 5J2TB 3K0DA 1KYOF 2IJJA 1I08A 2A06H 2OIGA 5J2UB 3ABMC 1NKDA 1NBMG 1QCEA 1Z5WA 1XHZA 4KP4A 3JD3A 1SKVA 5FLXN 4LF4O 1MSDA 4O4HA 2P5OA 3HB3B 1Q90D 1Y74A 1XMQB 3OUSA 1N34O 3MHSC 2PY5A 1RFYA 4UV9A 2ADQB 2PTMA 1RM1C 4WFAV 5LGUA 5EYPB 3TXQA 3OE7G 3CX5F 1WA8B 1BHBA 1H38A 3SPCA 4O2AB 4YY3B 4LF4B 3F7VC 2RDCA 2ZE8A 3BABA 3D8CA 3RYIB 4HBNA 5EZYB 2EZOA 2L35A 2IU0A 1VQ4V 4UXNA 5B1OA 2WLJA 3DC5A 3LSSA 4Z1MG 1EZVH 2IU3A 1NT2B 5JJNB 4ZIBA 4LF7B 4JYAB 3DXRA 1FXHA 2LGWA 3B4SA 2BOBC 3HKDA 4I5SA 4KHPO 4DV5O 1NI8A 4B3RO 1Q3EA 3SPJA 4O2BB 1TAEA 5JH7A 1Y76B 4WF9V 2A7WA 2JS3A 2DN9A 2RMKB 1Q86W 4JTDB 4P9OA 1AI7A 3CHXA 3E22B 1P4RA 4FM2A 3T1YB 3IGAC 1YEWA 1JCHA 4GZRB 4GCZA 2UXBO 4U7NA 1M5IA 4JF3A 3TK1A 1NVPD 1HP8A 1VQ5V 2KB1A 1D2DA 2CTRA 3CCRV 1QU7A 2ZCEA 4X1YB 4X20B 3L73H 3APOA 3E86A 2JEXA 1K3EA 1EM1A 3D36A 4ABMA 3ZHUA 3E8HA 5J9PC 2QWNB 2GV9A 3K5MA 2HVKC 1M1KW 3RVZA 2FKXA 2QKAA 2R70A 1XILA 2VQFO 3ETDA 5BZBA 4CBCA 2Q5ZA 4YIOA 2RN9A 4ZI7B 1GTOA 4TQFA 2JGUA 4GT1A 3P30A 1IBMO 2Q7GA 1W0JG 2CAZC 2ITDC 3ZS8C 1QLEB 1N34B 3KCYA 1RM1B 5J2UA 1FS0G 4BAYA 2X6CA 3FFQA 1PNKA 3ZMVA 4LFCO 3ZMUA 1PPJH 3C3TA 1HDJA 5EYPA 2EIJB 3LNNA 3SYQA 5KLVH 1G4YB 2W6JG 1OCZC 3BAAA 2QA4V 4J80A 2P6JA 2ZM6O 2ZE7A 4YIPA 1KQSU 3I5DA 5C8YB 1PNMA 2OYQA 4DRXB 4XDJA 1DGSA 5DEDA 4LFBO 2P06A 2PUSA 1E1QG 3JARA 5GTHZ 4JI1O 4JPRA 5LGTA 1IXBA 1AR4A 3E8FA 4G28B 4FLYA 4UCSA 1R3IC 3UKMA 5LA6B 2F1MA 5L3DA 3OR6C 2ZDIA 4GX1A 4H13B 3BA9A 3OR7C 4UUJC 4CS2A 3ASOB 3BY6A 4JV5B 4TQDA 5LYJB 5JJJB 2EJRA 1Q6HA 4BIOA 1VQ7V 2C2AA 1NS1A 4DR2B 2PI4A 3JD2A 4X89A 4JAUA 1WB7A 2JJ1G 3UQ8A 1JJ2U 4CC5A 2ATKC 3QO7A 3N2KB 3WB0A 3AG1C 1XDCA 4PA4A 2JDIG 2YEVA 3UT5A 1DLBA 1NTMH 1K5SA 4DYLA 4AILC 2QWPB 2F23A 4IHJA 2R9AA 4R8CA 1KD1W 2OCHA 1ZTEA 5EK0A 4RQFA 1OCCC 5KX5A 4CZZA 3CE2A 2X0LA 1AP5A 3JSLA 4IL6Z 2Q73A 2GTAA 1HNWB 5EC1C 2WA3A 5KUMA 4F4LA 1L0NH 4XBFA 3O9OA 2UUBB 3ABKB 5LOVA 4JI0B 1I94B 4JTCB 4X66O 1R6KA 1WLEA 2YDEA 4LFAO 3JD1A 1G6UA 3G4SV 1TVKA 3VOUA 3CC4V 2VRZA 3ZN0A 3CRMA 1GK9A 3ABKC 3T1CA 4X64B 3AK3A 3ASNC 3TETA 3M99B 4BIUA 1H2KA 3DSQA 2B5UA 2CH7B 4CH6A 1RPOA 3JATA 2N05A 2QDOA 2JVDA 2DWDC 1KC8W 1IXMA 1QHTA 1SZXA 2M7WA 5B3SC 4J42A 2Q0AA 4DR4O 4FLVA 4DK1A 2BTQA 3ZRWB 3RT3C 5JCOA 4JZGA 1ZX3A 2Y69B 4X65B 4E2LA 1CP9A 3TGUH 5CN0A 1ZL8B 3CMEV 1YSCA 5J2TA 1JX9A 2L6LA 1FPOA 1G8MA 2EJ7A 5CB4B 2EZPA 4H37A 2QTOA 3DGEA 3TXSA 3OD4A 1F23A 2F95B 1Y6XA 4D6TH 3EHBB 3CCMV 3K5OA 4MVRA 4LF9B 1GM8A 4X62B 4PDRA 2FL4A 2F66C 2DWEC 2R9IA 1NQTA 1IBKO 5IY5B 4JI6O 3U10A 1QLNA 4LR3A 3C90A 2Z5UA 1K8AW 3X2QC 2AHYA 2CGOA 4NR1A 3CEIA 3JAWB 3E22A 4H44B 5H6QA 1FXKC 4JTAB 5KUKA 1Y66A 3BPZA 4B08A 3J7AU 4K3AA 3I56V 1JPXA 4FLUA 3W7WA 2JS5A 2NNUA 3MD0A 3BCCH 2GTSA 4TUYB 2ZR3A 4DV0B 3JAKA 1S0VA 1DK1A 2IM9A 2CDYA 3D36C 5EC2C 5B66Z 3OEEG 1MSWD 1XMOO 4IIJA 3IJ4A 3ZRXA 4ZHQA 1IBLO 2LQTA 2ETNA 1Y67A 4MS2A 4DV2B 1WP8A 1FJGB 3ZMTA 3F7YC 2LGQA 4DV4O 1SQGA 1AR5A 4PI2A 3RFRA 3N27A 2YI9A 1Y74B 5IJ9A 4NXNO 3PJSK 1YITV 1F51A 2BSKB 4KUMA 4ZKIA 4L87A 3R65A 4FK5C 3CPWU 3Q4HA 2HKOA 3CJHB 4O4JA 2F4VO 1NTKH 3T2MA 3AG1B 3ZHTA 1UPGA 2BCCH 5IE9A 1B3QA 2HP8A 2VQFB 3UT5B 2B1GA 1CXZB 3VQVA 5LYJA 4J9ZB 1U97A 1TUBA 1Y76A 1ZL8A 1WPXA 2E5LB 1M57B 5KX5B 1V9PA 2XAFA 1S76D 1P7GA 4YJ2B 2EIKC 1SQBH 1B06A 2W6IG 4DV4B 2WA4A 5LXTB 3U0ZA 4F6EA 4NYKA 3ETEA 4MSWC 1D5NA 4OPHA 5LMNB 2ZQMA 4WFEA 2XAJA 1HNZB 4MT8A
chains in the Genus database with same CATH topology
1M56C 1F4NA 3G6EV 3SPJA 3GB7C 3ABLB 2BOCC 4WF9V 1OCRB 3CD6V 1CPYA 3CCLV 1SRYA 4GX0A 1Q86W 4JTDB 4PDMA 4P9OA 1AI7A 1M90W 2IH3C 1FXKA 1P4RA 4UVAA 5B3SB 3EFFK 1QVGU 3ETGA 3IGAC 4X88A 1JCHA 4MVOA 4GCZA 4PDVA 4U7NA 2EILC 4BIZA 4ASUG 4FPPA 1V54B 4OXSA 2DQ0A 4TWKA 4JF3A 3TK1A 1V54C 1J95A 1NJIW 1NVPD 1VQ5V 2KB1A 2P7TC 3FB5C 4MTFA 5CBHA 3FYIB 3CCRV 4JAVA 4N23A 2ZR2A 4QE7A 3X2QB 2MK3A 3E86A 2JEXA 1K3EA 3AG3C 1VQMV 2X7RB 1MOFA 3D36A 4RAIA 5J9PC 3E8HA 3ZRSA 3QO5A 3SJQC 3SYPA 2HVKC 4WFFA 3CC2V 1KECA 3HPLC 3RVZA 1M1KW 3E35A 2K1EA 3K04A 4R50A 2XAHA 2WLIA 3ETDA 4QNHB 3STLC 5BZBA 5B1BC 4XDKA 4CBCA 2DW4A 2ITCC 5LBQA 5B1AB 3OW2U 5CBFA 3QNEA 1GTOA 2A79B 2DQ3A 4GT1A 3P30A 5E1AC 1W0JG 1NVPB 2Y48A 2ITDC 1K9MW 2DYSB 3LUTB 4MVQA 2EBOA 1QLEB 3B8NA 5LGNA 1PNLA 2UXXA 5B1NA 2Q69A 1RM1B 1DTOA 1FS0G 2XASA 4BAYA 3CCEV 2X6CA 1QR9A 3ASNB 4MVZA 4QJFB 1PNKA 4HAMA 1YIJV 1K4CC 3ZMVA 3AG2B 3ZCCA 1R6NA 3ZMUA 5DM6V 1H8EG 3K3WA 3SPIA 3OGCC 1EBOA 4MW3A 2EIJB 4KFMA 4PA3A 3SYQA 1G4YB 2W6JG 4QPKA 1OCZC 1GO3F 1QBZA 2WLLA 2QA4V 1BHAA 1Y4MA 2P6JA 1KP3A 3RVYA 4MVUA 1KQSU 1KP2A 3OUFA 2JIZG 2OTLV 1PNMA 2WWWA 2EIMB 1NR7A 3ASOC 3OMNB 4XDJA 2WLKA 3CP1A 1E1RG 1EFRG 3E83A 4PA9A 1E1QG 1ZWIC 5LGTA 4JPRA 4GX5A 1S77D 3ABLC 3JD0A 1H2GA 2WPDG 4WFHA 5CMUA 3E8FA 1OHHG 4X8AA 2IJIA 1Q7YW 4G28B 1FXVA 5GW7A 1K5QA 3FB8C 4QE9A 1R3IC 3UKMA 2XOKG 1R3JC 3B8MA 3W7SA 3K9AA 2XAQA 4J9YB 3OMAB 5L3DA 3OR6C 2ZDIA 4GX1A 1LNQA 4N21A 3OR7C 2XAGA 4PA7A 4UUJC 3ASOB 4TT3G 1M9NA 3BY6A 2YSUB 2EJRA 3P32A 1JQ0A 3E89A 1VQ7V 1SERA 2WSSG 2LP7A 2EINC 2C2AA 5DN6G 1VQ9V 1OCCB 1AI6A 1OCZB 2PI4A 3JD2A 5EBLC 4X89A 3CCUV 1YTFD 4UV8A 3KG2A 1NR1A 4JAUA 3G71V 2JJ1G 3OEHG 3OMIB 2JK5C 1JJ2U 5LHIA 2ATKC 3QO7A 5KA5A 4JASA 3DTUB 4JYBA 1AI4A 3AG1C 4FIPC 4QPJA 2P90A 4G27B 5FL7G 4PA4A 4DO2A 2JDIG 5C93A 3CYOA 2YEVA 1AR1B 1B6QA 1DLBA 5HFMA 5B1BB 4WCEV 1K5SA 5IY5C 3AG4C 1KKDA 4YXWG 4R8CA 1KD1W 2W0FC 5EK0A 4XDLA 1BMFG 4RQFA 1OCCC 1ROPA 3ZN1A 4CZZA 4LC1A 2WLLB 2X0LA 4LBEC 3UM7A 2R9RB 5EC1C 1YJNV 3ML0A 5KUMA 4F4LA 2JEUA 1R73A 3JCZA 3VBBA 4XBFA 1QVFU 4FJCC 3SPGA 3ABKB 3WG7C 2X6BA 2Q67A 1K7DA 4U7OA 2GSMB 1VQ8V 2Y69C 4JTCB 1NH2B 2YEVB 2IH1C 3CMAV 4QIWF 1YJWV 4PA6A 3D3IA 1R6KA 3B77A 1VQKV 1WLEA 1R3LC 2GHYA 1VQ6V 1TUEB 2D3OW 3JD1A 3G4SV 1BL8A 2NLJC 4H33A 4WFBV 5IYDO 3VOUA 3CC4V 3ZN0A 4WFGA 3CC7V 3SYOA 2LFSA 1GK9A 3ABKC 4FMTA 1VQLV 3T1CA 2ZD9A 1QLEC 1S3JA 1CEZA 3ASNC 3TETA 3M99B 2OT5A 4MW8A 2HFEC 3K0GA 4BIUA 3CXCU 4P2ZA 2B5UA 2FTKA 1OCOC 1RPOA 1FFTB 2EIJC 2DYRB 2DWDC 3AG3B 1KC8W 1IXMA 3AEIA 3RBZA 3SPHA 1PL0A 3RW0A 1AROP 2M7WA 5B3SC 2EIKB 1SESA 4MTGA 1YTFB 3OAAG 2UXNA 4UVBA 1VQNV 1UJWB 3K06A 3ZRWB 1S72V 4MTOA 2Y69B 2HJFC 4GX2A 4DXWA 4E2LA 1CP9A 5CN0A 3FYEB 5L3GA 1RPRA 2HG5C 3CMEV 2QE7G 3LDDA 1YSCA 1SETA 3STZC 4I9WA 1JX9A 2WLNA 1G8MA 5LHHA 2OCCB 1N8RW 2EZPA 3T4DA 1I5XA 5HFLA 4H37A 4RQEA 4LP8A 1AI5A 2QTOA 3DGEA 4HYOA 5L3CA 4RUEA 4TSFG 3TCUA 3QO8A 2HR3A 1NH2D 3JYCA 4ZBMA 1W2BU 1K33A 2OTJV 2PI5A 4RO2A 3SYCA 1F23A 1OCRC 5B1AC 1K92A 3ABTA 1ORQC 3EHBB 3OFNG 2CK3G 3LDEA 3CCMV 2WLMA 3FKSG 4HZ3A 1XL4A 1MG1A 1PKXA 2DYRC 2WAMA 1AJNA 3MHHC 4MVRA 2V1DA 1YHQV 1P7BA 1GM8A 4PDRA 3F5WC 4BW5A 2X6AA 1VQOV 2DYSC 2DWEC 1K34A 1R3KC 2ZXWC 2R9IA 1K97A 2QM7A 1NQTA 1E79G 1M56B 3WG7B 3I55V 1H8HG 3ZJZA 5IY5B 1HWYA 4UVCA 3AG2C 1DF4A 1QLNA 1AJQA 5IDJA 2Z5UA 1K8AW 3X2QC 2AHYA 3CCSV 1AJPA 1DF5A 3ABUA 4JYCA 1GMGA 3T4ZA 5L3EA 4MVMA 4R6ZA 1JVMA 1QR8A 2H94A 5H6QA 1FXKC 3H01A 4JTAB 5KUKA 3IFXA 1V55B 2IJKA 3CCVV 1Y66A 1GM9A 4RUFA 2EILB 3ZIAG 3ZRWA 2WLIB 1OZ0A 3CCQV 2IJHA 3I56V 4MTXA 2QM8A 1JPXA 2LFRA 5KA6A 3W7WA 2NNUA 1GKFA 3LDCA 1THZA 3MD0A 1YJ9V 4JGSA 1L1FA 2ZR3A 3E8BA 1S0VA 5LHGA 5H6RA 5EC2C 3K0DA 3CCJV 3OEEG 4P30A 2IW5A 2IJJA 1MSWD 2Q6AA 5L3BA 2B1IA 4G2KA 1F4MA 2HLDG 3E2EA 3ZRXA 5H9CA 2A9HA 2HVJC 3ABMB 3GWOA 3ZMSA 3ABMC 1NKDA 1NBMG 1QCEA 2EIMC 1K4DC 5CA3A 2JJ2G 4MS2A 3W7XA 1EZJA 1COWG 4KP4A 3JD3A 3AG4B 2H8PC 3ZMTA 3F7YC 3ZRVA 1XL6A 3FB7C 3K08A 1MABG 5EBWC 4Q20A 1VQPV 2P67A 3HB3B 3WFVA 3OUSA 3PJSK 3W7UA 3MHSC 1YITV 1F51A 1W0KG 3JD4A 3NXSA 4UV9A 2F43G 3W7TA 4KUMA 4ZKIA 4MT8A 1RM1C 5L3FA 3K79A 4L87A 4WFAV 2Z3YA 1K73W 3R65A 4FK5C 5LGUA 1OCOB 3CPWU 2EINB 3K03A 3OE7G 2HKOA 4PELA 1Q81W 1JOYA 1BHBA 3LSQA 4LCUC 2WLHA 3SYAA 1Q82W 1H38A 1YI2V 3SPCA 3BEHA 3T2MA 3AG1B 5IYBO 3F7VC 1GM7A 2V7QG 4P9PA 2Q68A 2B1GA 2A0LA 5IYCO 4J9ZB 3ZMZA 2EZOA 3LNMB 1S5HC 1SZTA 1I5YA 2IU0A 2QEXV 1VQ4V 1M57C 1WPXA 4UXNA 5B1OA 1M57B 2WLJA 4EKWA 2XAFA 3LSSA 4R7CA 1FXKB 1S76D 3E8GA 4Z1MG 2EIKC 4PDLA 4MVSA 3FB6C 2IU3A 2W6IG 1ENVA 1V55C 2QKSA 2XNDG 5EBMC 1FXHA 2ZXWB 1PD3A 2BOBC 4I5SA 3IC7A 3A0RA 3ETEA 4MSWC 2ZDIC 2AHZA 2ZQMA 4WFEA 5CBGA 2OCCC 2XAJA 3OM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DLB A;  1QR9 A;  5HFM A;  1DF4 A;  1JQ0 A;  4N23 A;  3B77 A;  4JPR A;  2EZO A;  4E2L A;  1SZT A;  1I5Y A;  1K33 A;  5CN0 A;  2MK3 A;  2LP7 A;  1F23 A;  1JPX A;  1DF5 A;  5CMU A;  5KA6 A;  1EBO A;  4FK5 C;  2X7R B;  4JGS A;  1MOF A;  3P30 A;  1QR8 A;  1QBZ A;  1ENV A;  3CP1 A;  1MG1 A;  3MHH C;  3H01 A;  3WFV A;  1Y4M A;  2M7W A;  2P6J A;  3B8M A;  3K9A A;  5KA5 A;  2EBO A;  3B8N A;  4G2K A;  4N21 A;  3MHS C;  1Y66 A;  4FJC C;  1K34 A;  4FIP C;  5H9C A;  2EZP A;  3GWO A;  1I5X A;  4JF3 A;  5HFL A;  3CYO A;  1QCE A;  3M99 B;  2OT5 A; 
#chains in the Genus database with same CATH topology
 3G6E V;  2YIB A;  2RCV A;  4F6R B;  3ABL B;  2BOC C;  1OCR B;  1IUR A;  2YXL A;  3CCL V;  3AK2 A;  3KZI Z;  4UVA A;  2BE3 A;  5ITZ A;  1QVG U;  5LP6 C;  3ETG A;  4LF6 B;  3L74 H;  5H2F Z;  4MVO A;  4IIJ B;  4FPP A;  4JI1 B;  1V54 B;  4OX9 B;  2DQ0 A;  4LF8 O;  5KHJ A;  2P7T C;  3FYI B;  4JAV A;  4QE7 A;  1NZ6 A;  3H1K H;  3CRQ A;  2MK3 A;  4DV1 B;  1XUQ A;  1VQM V;  1VF6 C;  2X7R B;  3G67 A;  4IYI A;  4RAI A;  3RWR D;  5IWA O;  5EIB D;  3FX7 A;  2ZIM A;  3SYP A;  3P3P A;  2HJD A;  4C7U A;  3HPL C;  2V4D A;  2KG7 B;  2JGD B;  4R50 A;  1X4T A;  2XAH A;  3AK1 A;  3CSX A;  3STL C;  3BFR A;  4X1I B;  2D2C B;  2DW4 A;  2ITC C;  3OW2 U;  1XMO B;  1VF5 B;  2A79 B;  3SGI A;  1T5E A;  4LNU B;  3JAW A;  4JI2 O;  3M8A A;  2DYS B;  2EBO A;  5LGN A;  1PNL A;  2UXX A;  3K58 A;  2CGN A;  1QR9 A;  3ASN B;  4QJF B;  4HAM A;  1IZ3 A;  2GUZ B;  1YIJ V;  3AG2 B;  1TUB B;  4I55 A;  5DM6 V;  1H8E G;  1GN4 A;  1WB8 A;  2CTP A;  5KHK A;  1HR0 O;  2E5L O;  1PP9 H;  1R6T A;  4KFM A;  1GO3 F;  2WLL A;  1Y4M A;  1XNR B;  1QQC A;  3BA8 A;  3UO2 A;  4KHP B;  5LXT A;  4X66 B;  4LF6 O;  3OT7 A;  1NR7 A;  3ASO C;  1QNM A;  2WLK A;  4B7E A;  1SQP H;  3SJA C;  4JI8 O;  4I0X B;  2F4V B;  1E1R G;  1EFR G;  4GX5 A;  4K8X A;  3H9V A;  3UO3 A;  5CMU A;  2AGA A;  1WPB A;  1FXV A;  4O4J B;  1SA0 B;  3BRC A;  1R3J C;  3B8M A;  5LMN O;  3W7S A;  4J9Y B;  5IJ9 B;  2NR5 A;  1FYJ A;  5CA1 B;  4PA7 A;  1J5E O;  3H1I H;  2Q7E A;  1NTZ H;  2YSU B;  3K59 A;  2GUZ A;  3E89 A;  3A0B Z;  2XUM A;  4NKG B;  1VQ9 V;  1OCC B;  3JAT B;  2UU9 O;  5EBL C;  3CCU V;  1Q6I A;  3G71 V;  1AB3 A;  4IYH A;  1M93 A;  5LHI A;  4FM1 A;  3JAL B;  4O4L B;  4WBN B;  4JAS A;  1VMG A;  1SQV H;  4O4I A;  2B9Z A;  4DV2 O;  5D5Q A;  3LSU A;  1N36 O;  5FL7 G;  2KG7 A;  2JGD A;  3FAV B;  2RJZ A;  2HHH O;  5B1B B;  5IY5 C;  3AG4 C;  4I55 B;  2CE4 A;  2YID A;  1OV9 A;  4U3J A;  2W0F C;  1ROP A;  4FFB B;  4TV9 A;  4B3M O;  3UCS C;  3UM7 A;  2R9R B;  5C8Y A;  4PV1 B;  2JEU A;  3THO A;  3WG7 C;  2Q67 A;  2X6B A;  3CMA V;  4QIW F;  4PA6 A;  3D3I A;  4CH5 A;  2D3O W;  4TOI A;  2NLJ C;  2XT9 A;  3F5T A;  4LWS A;  2Q7H A;  3JAS A;  4DR3 O;  4WFG A;  3SYO A;  2E74 B;  2LFS A;  2ZNI A;  5CA0 B;  2H3O A;  1XEQ A;  4LFC B;  1S3J A;  3WB2 A;  1P84 F;  5LOV B;  2QWQ B;  4MW8 A;  5B5E Z;  4FLT A;  3S3X A;  2N04 A;  1IBL B;  4ZI7 A;  3VQX A;  1FFT B;  2EIJ C;  1XNR O;  2DYR B;  3AG3 B;  3SPH A;  1PL0 A;  3RW0 A;  4DUY B;  1YTF B;  4DK0 A;  2P4K A;  4UCV A;  3K06 A;  4NTX A;  1S72 V;  4GKK O;  2P22 C;  4DXW A;  5KMG B;  4DV3 B;  1FKA O;  1GH6 A;  1ZUQ A;  2QE7 G;  3CB2 A;  3LDD A;  5K1X A;  3STZ C;  1I0H A;  1HNZ O;  2UUC B;  2WLN A;  3RYH A;  4DRX A;  1SQQ H;  1JFF B;  1AI5 A;  4RUE A;  4TSF G;  1GN3 A;  1NH2 D;  4ZBM A;  3L70 H;  2PI5 A;  4RO2 A;  5B1A C;  4PHZ A;  5IYZ B;  1K92 A;  5IWA B;  1ORQ C;  4JI4 B;  3LDE A;  2WLM A;  1MG1 A;  1PKX A;  3MHH C;  2WAM A;  4UCO A;  4I50 B;  2V1D A;  1KMI Z;  2X6A A;  2UUB O;  1K34 A;  1N32 O;  5IJ0 B;  3A8T A;  3ZED A;  2LJ2 A;  1DF4 A;  4B3R B;  1AJQ A;  4DV7 B;  4X1K A;  2ADP A;  2QM4 A;  1GMG A;  4GKK B;  3ZHQ A;  4MVM A;  4R6Z A;  1JVM A;  1QR8 A;  2H94 A;  2QWR B;  3JAL A;  4FFK A;  2GBO A;  2VQE O;  3RYF A;  3CCV V;  1BQ0 A;  2YI8 A;  4U3F H;  1OZ0 A;  4ZOL A;  3CCQ V;  4B3M B;  1KU9 A;  2IJH A;  2R72 A;  1TA8 A;  2G38 A;  1Z2G A;  4X1K B;  5KA6 A;  4BR6 A;  3A0H Z;  1KBH A;  4JGS A;  1L8D A;  2CTW A;  1VF6 A;  4OPA A;  2VWK A;  5TIS Z;  5H6R A;  1P49 A;  4P30 A;  3OGI B;  2IW5 A;  3L72 H;  4J10 A;  2Q6A A;  2B1I A;  2UXB B;  4G2K A;  1F4M A;  2HLD G;  3DC6 A;  3E2E A;  3B40 A;  2A9H A;  3ABM B;  3ZMS A;  2E76 B;  1K4D C;  2DJV A;  5CA3 A;  2JJ2 G;  3W7X A;  1COW G;  1N32 B;  3AG4 B;  2H8P C;  5IYZ A;  4IHJ B;  1XL6 A;  3FB7 C;  3K08 A;  4DW1 A;  5EBW C;  4Q20 A;  2P67 A;  1FFX B;  4YHH O;  2MW2 B;  3WFV A;  1WNS A;  2NN4 A;  4LF8 B;  1WN7 A;  1J5E B;  1BT8 A;  3R66 A;  3PN1 A;  4I7Z B;  3NXS A;  2F43 G;  3W7T A;  4X62 O;  1D5A A;  2KQX A;  4HNA A;  5L3F A;  1YZB A;  2ZKO A;  3JAR B;  4LF5 O;  2AZ2 A;  4CH3 A;  1IX9 A;  4DR6 B;  3WB1 A;  3QVN A;  2EIN B;  5KAF Z;  1IBM B;  2WLH A;  3SYA A;  4LFB B;  5IYB O;  1GM7 A;  1XRE A;  4J7K A;  2V7Q G;  2YXH A;  3ZBH A;  3RYI A;  3K5N A;  5IYC O;  1BGY H;  1M57 C;  4DV7 O;  1LUV A;  4EKW A;  1GN6 A;  4R7C A;  2LW1 A;  4DR7 O;  4NTY A;  3H1H H;  4LNU A;  1ENV A;  2UXD O;  4JV5 O;  1V55 C;  2QKS A;  2XND G;  5LA6 A;  2KKW A;  1VP7 A;  3IC7 A;  3HKC B;  4DV6 B;  1F4N A;  3GB7 C;  3SR2 C;  1SRY A;  3ETQ A;  4PDM A;  4X65 O;  4LF5 B;  5B3S B;  1FXK A;  1MZE A;  5K1P A;  2UUA O;  1MMM A;  1OJH A;  3FD9 A;  2Q8V A;  4RWU A;  4X88 A;  4O4L A;  4PDV A;  4PJ0 Z;  4K0K B;  4ZOL B;  4N23 A;  2ZR2 A;  4X1Y A;  3X2Q B;  3IAY A;  1WAZ A;  4U3J B;  4W4L A;  3AG3 C;  1RSO A;  4JZ2 A;  1MOF A;  2LW7 A;  3SJQ C;  1R1B A;  1EN4 A;  2K1E A;  5FNV B;  2GDS A;  4DUY O;  4J7Z A;  5AG2 A;  2ODM A;  5CBF A;  4YHH B;  5A9G A;  5KAI Z;  4UB8 Z;  5E1A C;  1FD9 A;  3P3N A;  1SA0 A;  2Y48 A;  4UFZ A;  1K9M W;  3LUT B;  4MVQ A;  2A3Q A;  4FLZ A;  2QGN A;  3B8N A;  3HKE A;  5B1N A;  5KHG A;  2Q69 A;  5JQG A;  2QWO B;  4FM0 A;  4MVZ A;  4F6R A;  1K4C C;  3ZCC A;  5IT9 N;  3SPI A;  4MW3 A;  4PA3 A;  4GLX A;  4QPK A;  4JI5 B;  4D7S A;  1QBZ A;  3JAS B;  3L71 H;  1BHA A;  1PV0 A;  2PF4 E;  1X59 A;  4MVU A;  2JIZ G;  2OTL V;  3HKD B;  2WWW A;  4Q6G A;  4YJ3 B;  3OMN B;  5JQG B;  5KHH A;  3CP1 A;  1XQ8 A;  3E83 A;  1ZWI C;  4DR1 B;  1S77 D;  3ABL C;  2W0X A;  3JD0 A;  5BMV A;  2CUG A;  1OHH G;  1H2L A;  2IJI A;  4OGQ B;  4DR7 B;  5GW7 A;  1K5Q A;  3FB8 C;  3K9A A;  4N21 A;  1O9G A;  1H2S B;  5FNV A;  2EX3 A;  3P32 A;  3L75 H;  2ZIN A;  4DV1 O;  3KCX A;  1XOU A;  5E79 Z;  1AI6 A;  4GKJ B;  1Q6U A;  1YTF D;  4UV8 A;  3KG2 A;  1NR1 A;  2YS8 A;  4JI6 B;  3G6B A;  1N4C A;  2JK5 C;  3ZHV A;  4JYB A;  1Q8I A;  4FIP C;  1JFF A;  3H1L H;  5C93 A;  2XHB A;  4ICG A;  4WCE V;  1EN5 A;  3ZN1 A;  4LC1 A;  2BTO A;  2ZT9 B;  3ZHR A;  1XHX A;  1HR0 B;  3GWK C;  3ML0 A;  1R73 A;  3JCZ A;  3VBB A;  3K5L A;  3RN4 A;  3RYH B;  3WU2 Z;  1QVF U;  4FJC C;  3SPG A;  1K7D A;  4U7O A;  1MA1 A;  1SF9 A;  2ZNJ A;  4L8J A;  1NH2 B;  2IH1 C;  5D5P A;  1YJW V;  3B77 A;  1VQK V;  2GHY A;  3G80 A;  4IT5 A;  1TUE B;  2Z0A A;  1BL8 A;  4H33 A;  4WFB V;  1FJG O;  4DV0 O;  3RYC B;  3U11 A;  5GTI Z;  3CC7 V;  4DUZ O;  1SC5 B;  1VQL V;  2ZD9 A;  3MDS A;  1CEZ A;  3T1H B;  4JI8 B;  2HFE C;  3HKB B;  3QF7 A;  4P2Z A;  4YY3 O;  4X20 A;  2FTK A;  1OCO C;  1IVS A;  4GUN A;  3RBZ A;  2ARH A;  1ARO P;  4FZ1 A;  4MTG A;  2FB5 A;  1AP6 A;  3QTC A;  3HKE B;  4I4T A;  4UVB A;  1VQN V;  4NXN B;  4X1I A;  4O2B A;  3JCU Z;  5L3G A;  3CRR A;  1RPR A;  2HG5 C;  3ZHS A;  4I9W A;  3N2G A;  3AG7 A;  1N36 B;  2OCC B;  1I5X A;  2OWO A;  4DUZ B;  2QJ1 A;  4J11 A;  4JI0 O;  1BZK A;  3JYC A;  4B7K A;  5EZY A;  1K33 A;  1W2B U;  1OCR C;  3ABT A;  1W59 A;  2CK3 G;  3IC9 A;  4B3S B;  3M7M X;  5FPO A;  2DYR C;  1YHQ V;  1AJN A;  3N2G B;  4J7J A;  1P7B A;  4O4I B;  4BW5 A;  2ZXW C;  1K97 A;  2QR4 A;  1M56 B;  3WG7 B;  5LMU B;  3I55 V;  3ZJZ A;  2YIA A;  2M6Y A;  4UVC A;  4X64 O;  4OX9 O;  4DR2 O;  3CCS V;  1AJP A;  1DF5 A;  4BWA A;  2AXT Z;  4UCT A;  5L3E A;  3JAK B;  2Y0I A;  3IFX A;  1V55 B;  1ZAU A;  4RUF A;  2EIL B;  5IJ0 A;  3ICX A;  2PYL A;  2WLI B;  4B3T B;  3SJC C;  5GON A;  4JI5 O;  2Q9L A;  4MTX A;  3TJT A;  5JWP A;  2QM8 A;  2LFR A;  2DOS A;  4JYA O;  1GKF A;  1AIL A;  1MNG A;  1H2M A;  1L1F A;  1YJ9 V;  3E8B A;  1FFX A;  5LHG A;  3CJH A;  3CCJ V;  1JA8 A;  4NVP A;  4EB6 B;  5L3B A;  3N2K A;  1TGO A;  2N74 A;  4PD4 F;  5H9C A;  2HVJ C;  3GWO A;  1XMQ O;  4EFB A;  2EIM C;  1YCI A;  2BTQ B;  3EVK A;  4K0K O;  4JI2 B;  1EZJ A;  3SJB C;  3ZRV A;  1JJO A;  3OTF A;  1MAB G;  1VQP V;  4DV6 O;  4YJ2 A;  2AZ0 A;  2XTA A;  4H0L B;  3K9S A;  3W7U A;  1N0N A;  1W0K G;  3JD4 A;  3K79 A;  4JI3 B;  3T1Y O;  2CH7 A;  2YIB D;  1K73 W;  2Z3Y A;  1OCO B;  2CTQ A;  3OTO O;  1WA8 A;  3K03 A;  1WJZ A;  4PEL A;  1Q81 W;  1JOY A;  3LSQ A;  4LCU C;  1HNX O;  1URF A;  1Q82 W;  1YI2 V;  3J81 N;  4J41 A;  3BEH A;  3C3S A;  3CS5 A;  4FVM A;  4GYC B;  4P9P A;  4DR3 B;  4AQY O;  2Q68 A;  2A0L A;  1RP3 B;  2DMX A;  3ZMZ A;  4A5U B;  3B2E E;  3LNM B;  1SZT A;  1S5H C;  1I5Y A;  1KB9 F;  2QEX V;  5BR8 B;  4W4K A;  4TUY A;  2Y0P A;  1FXK B;  4O4H B;  3E8G A;  1WP7 A;  4PDL A;  4MVS A;  3FB6 C;  4JI7 B;  4CS3 A;  5EBM C;  2ZXW B;  1PD3 A;  3ZX6 A;  3RYF B;  3A0R A;  2ZIO A;  2ZDI C;  2AHZ A;  3HKC A;  5CBG A;  2OCC C;  3MAQ A;  4LF9 O;  3OM3 B;  1M56 C;  1F7Y A;  3B09 A;  3CD6 V;  4X9Q A;  1YVW A;  1CPY A;  4GX0 A;  4JAA A;  1I7F A;  4DR5 B;  1M90 W;  2IH3 C;  3EFF K;  3CRA A;  5EIB C;  4UCU A;  5LMU O;  1UFI A;  2VWJ A;  5CA1 A;  2EIL C;  4BIZ A;  2YUA A;  4ASU G;  4OXS A;  4TWK A;  1NJI W;  1V54 C;  1J95 A;  1BS3 A;  3FB5 C;  5CBH A;  4MTF A;  1VEW A;  5A2Q N;  2Q4P A;  1MZF A;  2YC0 A;  4TV8 B;  3Q4H B;  2FYU H;  1GN2 A;  1HW7 A;  3ZRS A;  3QO5 A;  4PI0 A;  4WFF A;  3CC2 V;  2E75 B;  1KEC A;  3RGB A;  3E35 A;  3K04 A;  1BE3 H;  4CC6 A;  2WLI A;  2HHH B;  1JMK C;  5DEC A;  4QNH B;  5B1B C;  5BXZ A;  2DE0 X;  4XDK A;  4Z2W A;  4GKJ O;  5LBQ A;  1Z5V A;  5B1A B;  5JH7 B;  1GRJ A;  4CH4 A;  1S5L Z;  3QNE A;  1N33 B;  1RSO B;  2DQ3 A;  4IGG A;  1NVP B;  4O2A A;  1A32 A;  4NB5 A;  1Q5O A;  1DTO A;  1SQF A;  2XAS A;  3CCE V;  3VQW A;  2O57 A;  2K9P A;  4LH7 A;  1R6N A;  3K3W A;  3OGC C;  1EBO A;  3D3Q A;  4KXR A;  4FFB A;  1I94 O;  4E4E A;  1KP3 A;  3RVY A;  1KP2 A;  1IBK B;  3OUF A;  3SDL A;  5CA0 A;  1S5J A;  1BQZ A;  2EIM B;  1SQX H;  4BW9 A;  1YF2 A;  2HEP A;  1FAF A;  1LR1 A;  4PA9 A;  5JCO C;  2ZE5 A;  5BMV B;  5BR8 O;  1H2G A;  2WPD G;  4LF7 O;  4WFH A;  3KKY A;  4X8A A;  1Q7Y W;  1GAX A;  1ZSP A;  4QE9 A;  2AW9 A;  3VQY A;  2XOK G;  4JI4 O;  4WBN A;  2XAQ A;  3OMA B;  4LFA B;  2FML A;  1LNQ A;  3O65 A;  1PM9 A;  2XAG A;  3HR0 A;  5FPR A;  4TT3 G;  1O9H A;  1M9N A;  4JI7 O;  4NTW A;  1JQ0 A;  1G1X B;  1B04 A;  1SER A;  2KSD A;  4FLW A;  2F93 B;  2WSS G;  2LP7 A;  2EIN C;  3NR7 A;  3JSN A;  5DN6 G;  3CRC A;  4DW0 A;  1OCZ B;  4TV9 B;  2LO1 A;  3OEH G;  3OMI B;  2P4V A;  5KA5 A;  3DTU B;  1AI4 A;  4DR4 B;  4YJ3 A;  4QPJ A;  2P90 A;  2QKC A;  4G27 B;  4Z1V A;  4DO2 A;  2VQE B;  3CYO A;  4I0X A;  3FAV A;  1AR1 B;  1B6Q A;  5HFM A;  3APQ A;  1XNQ O;  2QSA A;  4EEQ A;  1KKD A;  4YXW G;  5KMG A;  4LH6 A;  4NXM O;  3K57 A;  4XDL A;  1BMF G;  1M4U A;  4JYY A;  3RYC A;  2WLL B;  2E3C A;  4LBE C;  2ILM A;  1YJN V;  1U96 A;  3DXR B;  2Y4U A;  4EB6 A;  4K8Z A;  1Q43 A;  2ZM6 B;  2GSM B;  1VQ8 V;  2Y69 C;  4HNA B;  4I9Q A;  2YEV B;  4KL1 A;  3T1H O;  1VQ6 V;  4B3S O;  1R3L C;  3CXH F;  1BCC H;  4TV8 A;  4LWS B;  1HNW O;  2UXC B;  1XI1 A;  5IYD O;  4B3T O;  4DR1 O;  5JVD B;  1EN6 A;  1ZLZ A;  2YIC A;  1LUW A;  4FMT A;  1PL4 A;  2Q0O C;  1QLE C;  2IBZ H;  2PGG A;  5CB4 A;  4FLX A;  5LL6 Y;  2OT5 A;  2RNB A;  3K0G A;  2UUC O;  5GON B;  3L9D A;  1N33 O;  3CXC U;  2PZS A;  5KHI A;  1TVK B;  3CWB H;  2EUL A;  3AEI A;  1KKC A;  3J80 N;  5JJE B;  4UB6 Z;  2EIK B;  1SES A;  4D7T A;  3OAA G;  3EXA A;  2UXN A;  1IDS A;  4ZHQ B;  1UJW B;  2BSK A;  3BHP A;  4MTO A;  4GX2 A;  2HJF C;  3H1J H;  5F2V O;  3FYE B;  1JR9 A;  1SS3 A;  1SET A;  2Y4T A;  5ITZ B;  1KUQ A;  4I50 A;  2UXC O;  3QG5 A;  5LHH A;  1YDX A;  1N8R W;  3T4D A;  3A2F A;  5HFL A;  1AVM A;  4RQE A;  4LP8 A;  1XBL A;  2QTS A;  4CS4 A;  2PYJ A;  4HYO A;  4AI8 A;  1NU1 H;  1VF7 A;  5L3C A;  4DV5 B;  3TCU A;  3QO8 A;  4EFE A;  2HR3 A;  2OTJ V;  2UU9 B;  1YXB A;  3SYC A;  2ZE6 A;  4FZ0 A;  5BY1 A;  3OFN G;  3GVM A;  5JVD A;  1H2N A;  3FKS G;  4HZ3 A;  1XL4 A;  2RQ6 A;  1BSM A;  2OIE A;  5LP6 B;  1VIB A;  4I4T B;  3F5W C;  1VQO V;  2DYS C;  1L0L H;  1N0J A;  1R3K C;  2QM7 A;  1XNQ B;  1E79 G;  1H8H G;  1HWY A;  3JAM N;  2JRI A;  3S3W A;  3AG2 C;  3HKB A;  2VS0 A;  4K35 A;  2UUA B;  3OTO B;  4DR6 O;  5IDJ A;  3ABU A;  4JYC A;  1US6 A;  3T4Z A;  1VAR A;  2UXD B;  4JI3 O;  3H01 A;  4AQY B;  2YXY A;  5H5N A;  4UCR A;  5LP6 A;  4NXM B;  2IJK A;  1GM9 A;  3ZIA G;  3ZRW A;  1HNX B;  4QGP A;  3BVO A;  4AHC A;  3LDC A;  1THZ A;  4DV3 O;  4DR5 O;  5J2T B;  3K0D A;  1KYO F;  2IJJ A;  1I08 A;  2A06 H;  2OIG A;  5J2U B;  3ABM C;  1NKD A;  1NBM G;  1QCE A;  1Z5W A;  1XHZ A;  4KP4 A;  3JD3 A;  1SKV A;  5FLX N;  4LF4 O;  1MSD A;  4O4H A;  2P5O A;  3HB3 B;  1Q90 D;  1Y74 A;  1XMQ B;  3OUS A;  1N34 O;  3MHS C;  2PY5 A;  1RFY A;  4UV9 A;  2ADQ B;  2PTM A;  1RM1 C;  4WFA V;  5LGU A;  5EYP B;  3TXQ A;  3OE7 G;  3CX5 F;  1WA8 B;  1BHB A;  1H38 A;  3SPC A;  4O2A B;  4YY3 B;  4LF4 B;  3F7V C;  2RDC A;  2ZE8 A;  3BAB A;  3D8C A;  3RYI B;  4HBN A;  5EZY B;  2EZO A;  2L35 A;  2IU0 A;  1VQ4 V;  4UXN A;  5B1O A;  2WLJ A;  3DC5 A;  3LSS A;  4Z1M G;  1EZV H;  2IU3 A;  1NT2 B;  5JJN B;  4ZIB A;  4LF7 B;  4JYA B;  3DXR A;  1FXH A;  2LGW A;  3B4S A;  2BOB C;  3HKD A;  4I5S A;  4KHP O;  4DV5 O;  1NI8 A;  4B3R O;  1Q3E A;  3SPJ A;  4O2B B;  1TAE A;  5JH7 A;  1Y76 B;  4WF9 V;  2A7W A;  2JS3 A;  2DN9 A;  2RMK B;  1Q86 W;  4JTD B;  4P9O A;  1AI7 A;  3CHX A;  3E22 B;  1P4R A;  4FM2 A;  3T1Y B;  3IGA C;  1YEW A;  1JCH A;  4GZR B;  4GCZ A;  2UXB O;  4U7N A;  1M5I A;  4JF3 A;  3TK1 A;  1NVP D;  1HP8 A;  1VQ5 V;  2KB1 A;  1D2D A;  2CTR A;  3CCR V;  1QU7 A;  2ZCE A;  4X1Y B;  4X20 B;  3L73 H;  3APO A;  3E86 A;  2JEX A;  1K3E A;  1EM1 A;  3D36 A;  4ABM A;  3ZHU A;  3E8H A;  5J9P C;  2QWN B;  2GV9 A;  3K5M A;  2HVK C;  1M1K W;  3RVZ A;  2FKX A;  2QKA A;  2R70 A;  1XIL A;  2VQF O;  3ETD A;  5BZB A;  4CBC A;  2Q5Z A;  4YIO A;  2RN9 A;  4ZI7 B;  1GTO A;  4TQF A;  2JGU A;  4GT1 A;  3P30 A;  1IBM O;  2Q7G A;  1W0J G;  2CAZ C;  2ITD C;  3ZS8 C;  1QLE B;  1N34 B;  3KCY A;  1RM1 B;  5J2U A;  1FS0 G;  4BAY A;  2X6C A;  3FFQ A;  1PNK A;  3ZMV A;  4LFC O;  3ZMU A;  1PPJ H;  3C3T A;  1HDJ A;  5EYP A;  2EIJ B;  3LNN A;  3SYQ A;  5KLV H;  1G4Y B;  2W6J G;  1OCZ C;  3BAA A;  2QA4 V;  4J80 A;  2P6J A;  2ZM6 O;  2ZE7 A;  4YIP A;  1KQS U;  3I5D A;  5C8Y B;  1PNM A;  2OYQ A;  4DRX B;  4XDJ A;  1DGS A;  5DED A;  4LFB O;  2P06 A;  2PUS A;  1E1Q G;  3JAR A;  5GTH Z;  4JI1 O;  4JPR A;  5LGT A;  1IXB A;  1AR4 A;  3E8F A;  4G28 B;  4FLY A;  4UCS A;  1R3I C;  3UKM A;  5LA6 B;  2F1M A;  5L3D A;  3OR6 C;  2ZDI A;  4GX1 A;  4H13 B;  3BA9 A;  3OR7 C;  4UUJ C;  4CS2 A;  3ASO B;  3BY6 A;  4JV5 B;  4TQD A;  5LYJ B;  5JJJ B;  2EJR A;  1Q6H A;  4BIO A;  1VQ7 V;  2C2A A;  1NS1 A;  4DR2 B;  2PI4 A;  3JD2 A;  4X89 A;  4JAU A;  1WB7 A;  2JJ1 G;  3UQ8 A;  1JJ2 U;  4CC5 A;  2ATK C;  3QO7 A;  3N2K B;  3WB0 A;  3AG1 C;  1XDC A;  4PA4 A;  2JDI G;  2YEV A;  3UT5 A;  1DLB A;  1NTM H;  1K5S A;  4DYL A;  4AIL C;  2QWP B;  2F23 A;  4IHJ A;  2R9A A;  4R8C A;  1KD1 W;  2OCH A;  1ZTE A;  5EK0 A;  4RQF A;  1OCC C;  5KX5 A;  4CZZ A;  3CE2 A;  2X0L A;  1AP5 A;  3JSL A;  4IL6 Z;  2Q73 A;  2GTA A;  1HNW B;  5EC1 C;  2WA3 A;  5KUM A;  4F4L A;  1L0N H;  4XBF A;  3O9O A;  2UUB B;  3ABK B;  5LOV A;  4JI0 B;  1I94 B;  4JTC B;  4X66 O;  1R6K A;  1WLE A;  2YDE A;  4LFA O;  3JD1 A;  1G6U A;  3G4S V;  1TVK A;  3VOU A;  3CC4 V;  2VRZ A;  3ZN0 A;  3CRM A;  1GK9 A;  3ABK C;  3T1C A;  4X64 B;  3AK3 A;  3ASN C;  3TET A;  3M99 B;  4BIU A;  1H2K A;  3DSQ A;  2B5U A;  2CH7 B;  4CH6 A;  1RPO A;  3JAT A;  2N05 A;  2QDO A;  2JVD A;  2DWD C;  1KC8 W;  1IXM A;  1QHT A;  1SZX A;  2M7W A;  5B3S C;  4J42 A;  2Q0A A;  4DR4 O;  4FLV A;  4DK1 A;  2BTQ A;  3ZRW B;  3RT3 C;  5JCO A;  4JZG A;  1ZX3 A;  2Y69 B;  4X65 B;  4E2L A;  1CP9 A;  3TGU H;  5CN0 A;  1ZL8 B;  3CME V;  1YSC A;  5J2T A;  1JX9 A;  2L6L A;  1FPO A;  1G8M A;  2EJ7 A;  5CB4 B;  2EZP A;  4H37 A;  2QTO A;  3DGE A;  3TXS A;  3OD4 A;  1F23 A;  2F95 B;  1Y6X A;  4D6T H;  3EHB B;  3CCM V;  3K5O A;  4MVR A;  4LF9 B;  1GM8 A;  4X62 B;  4PDR A;  2FL4 A;  2F66 C;  2DWE C;  2R9I A;  1NQT A;  1IBK O;  5IY5 B;  4JI6 O;  3U10 A;  1QLN A;  4LR3 A;  3C90 A;  2Z5U A;  1K8A W;  3X2Q C;  2AHY A;  2CGO A;  4NR1 A;  3CEI A;  3JAW B;  3E22 A;  4H44 B;  5H6Q A;  1FXK C;  4JTA B;  5KUK A;  1Y66 A;  3BPZ A;  4B08 A;  3J7A U;  4K3A A;  3I56 V;  1JPX A;  4FLU A;  3W7W A;  2JS5 A;  2NNU A;  3MD0 A;  3BCC H;  2GTS A;  4TUY B;  2ZR3 A;  4DV0 B;  3JAK A;  1S0V A;  1DK1 A;  2IM9 A;  2CDY A;  3D36 C;  5EC2 C;  5B66 Z;  3OEE G;  1MSW D;  1XMO O;  4IIJ A;  3IJ4 A;  3ZRX A;  4ZHQ A;  1IBL O;  2LQT A;  2ETN A;  1Y67 A;  4MS2 A;  4DV2 B;  1WP8 A;  1FJG B;  3ZMT A;  3F7Y C;  2LGQ A;  4DV4 O;  1SQG A;  1AR5 A;  4PI2 A;  3RFR A;  3N27 A;  2YI9 A;  1Y74 B;  5IJ9 A;  4NXN O;  3PJS K;  1YIT V;  1F51 A;  2BSK B;  4KUM A;  4ZKI A;  4L87 A;  3R65 A;  4FK5 C;  3CPW U;  3Q4H A;  2HKO A;  3CJH B;  4O4J A;  2F4V O;  1NTK H;  3T2M A;  3AG1 B;  3ZHT A;  1UPG A;  2BCC H;  5IE9 A;  1B3Q A;  2HP8 A;  2VQF B;  3UT5 B;  2B1G A;  1CXZ B;  3VQV A;  5LYJ A;  4J9Z B;  1U97 A;  1TUB A;  1Y76 A;  1ZL8 A;  1WPX A;  2E5L B;  1M57 B;  5KX5 B;  1V9P A;  2XAF A;  1S76 D;  1P7G A;  4YJ2 B;  2EIK C;  1SQB H;  1B06 A;  2W6I G;  4DV4 B;  2WA4 A;  5LXT B;  3U0Z A;  4F6E A;  4NYK A;  3ETE A;  4MSW C;  1D5N A;  4OPH A;  5LMN B;  2ZQM A;  4WFE A;  2XAJ A;  1HNZ B;  4MT8 A; 
#chains in the Genus database with same CATH homology
 1M56 C;  1F4N A;  3G6E V;  3SPJ A;  3GB7 C;  3ABL B;  2BOC C;  4WF9 V;  1OCR B;  3CD6 V;  1CPY A;  3CCL V;  1SRY A;  4GX0 A;  1Q86 W;  4JTD B;  4PDM A;  4P9O A;  1AI7 A;  1M90 W;  2IH3 C;  1FXK A;  1P4R A;  4UVA A;  5B3S B;  3EFF K;  1QVG U;  3ETG A;  3IGA C;  4X88 A;  1JCH A;  4MVO A;  4GCZ A;  4PDV A;  4U7N A;  2EIL C;  4BIZ A;  4ASU G;  4FPP A;  1V54 B;  4OXS A;  2DQ0 A;  4TWK A;  4JF3 A;  3TK1 A;  1V54 C;  1J95 A;  1NJI W;  1NVP D;  1VQ5 V;  2KB1 A;  2P7T C;  3FB5 C;  4MTF A;  5CBH A;  3FYI B;  3CCR V;  4JAV A;  4N23 A;  2ZR2 A;  4QE7 A;  3X2Q B;  2MK3 A;  3E86 A;  2JEX A;  1K3E A;  3AG3 C;  1VQM V;  2X7R B;  1MOF A;  3D36 A;  4RAI A;  5J9P C;  3E8H A;  3ZRS A;  3QO5 A;  3SJQ C;  3SYP A;  2HVK C;  4WFF A;  3CC2 V;  1KEC A;  3HPL C;  3RVZ A;  1M1K W;  3E35 A;  2K1E A;  3K04 A;  4R50 A;  2XAH A;  2WLI A;  3ETD A;  4QNH B;  3STL C;  5BZB A;  5B1B C;  4XDK A;  4CBC A;  2DW4 A;  2ITC C;  5LBQ A;  5B1A B;  3OW2 U;  5CBF A;  3QNE A;  1GTO A;  2A79 B;  2DQ3 A;  4GT1 A;  3P30 A;  5E1A C;  1W0J G;  1NVP B;  2Y48 A;  2ITD C;  1K9M W;  2DYS B;  3LUT B;  4MVQ A;  2EBO A;  1QLE B;  3B8N A;  5LGN A;  1PNL A;  2UXX A;  5B1N A;  2Q69 A;  1RM1 B;  1DTO A;  1FS0 G;  2XAS A;  4BAY A;  3CCE V;  2X6C A;  1QR9 A;  3ASN B;  4MVZ A;  4QJF B;  1PNK A;  4HAM A;  1YIJ V;  1K4C C;  3ZMV A;  3AG2 B;  3ZCC A;  1R6N A;  3ZMU A;  5DM6 V;  1H8E G;  3K3W A;  3SPI A;  3OGC C;  1EBO A;  4MW3 A;  2EIJ B;  4KFM A;  4PA3 A;  3SYQ A;  1G4Y B;  2W6J G;  4QPK A;  1OCZ C;  1GO3 F;  1QBZ A;  2WLL A;  2QA4 V;  1BHA A;  1Y4M A;  2P6J A;  1KP3 A;  3RVY A;  4MVU A;  1KQS U;  1KP2 A;  3OUF A;  2JIZ G;  2OTL V;  1PNM A;  2WWW A;  2EIM B;  1NR7 A;  3ASO C;  3OMN B;  4XDJ A;  2WLK A;  3CP1 A;  1E1R G;  1EFR G;  3E83 A;  4PA9 A;  1E1Q G;  1ZWI C;  5LGT A;  4JPR A;  4GX5 A;  1S77 D;  3ABL C;  3JD0 A;  1H2G A;  2WPD G;  4WFH A;  5CMU A;  3E8F A;  1OHH G;  4X8A A;  2IJI A;  1Q7Y W;  4G28 B;  1FXV A;  5GW7 A;  1K5Q A;  3FB8 C;  4QE9 A;  1R3I C;  3UKM A;  2XOK G;  1R3J C;  3B8M A;  3W7S A;  3K9A A;  2XAQ A;  4J9Y B;  3OMA B;  5L3D A;  3OR6 C;  2ZDI A;  4GX1 A;  1LNQ A;  4N21 A;  3OR7 C;  2XAG A;  4PA7 A;  4UUJ C;  3ASO B;  4TT3 G;  1M9N A;  3BY6 A;  2YSU B;  2EJR A;  3P32 A;  1JQ0 A;  3E89 A;  1VQ7 V;  1SER A;  2WSS G;  2LP7 A;  2EIN C;  2C2A A;  5DN6 G;  1VQ9 V;  1OCC B;  1AI6 A;  1OCZ B;  2PI4 A;  3JD2 A;  5EBL C;  4X89 A;  3CCU V;  1YTF D;  4UV8 A;  3KG2 A;  1NR1 A;  4JAU A;  3G71 V;  2JJ1 G;  3OEH G;  3OMI B;  2JK5 C;  1JJ2 U;  5LHI A;  2ATK C;  3QO7 A;  5KA5 A;  4JAS A;  3DTU B;  4JYB A;  1AI4 A;  3AG1 C;  4FIP C;  4QPJ A;  2P90 A;  4G27 B;  5FL7 G;  4PA4 A;  4DO2 A;  2JDI G;  5C93 A;  3CYO A;  2YEV A;  1AR1 B;  1B6Q A;  1DLB A;  5HFM A;  5B1B B;  4WCE V;  1K5S A;  5IY5 C;  3AG4 C;  1KKD A;  4YXW G;  4R8C A;  1KD1 W;  2W0F C;  5EK0 A;  4XDL A;  1BMF G;  4RQF A;  1OCC C;  1ROP A;  3ZN1 A;  4CZZ A;  4LC1 A;  2WLL B;  2X0L A;  4LBE C;  3UM7 A;  2R9R B;  5EC1 C;  1YJN V;  3ML0 A;  5KUM A;  4F4L A;  2JEU A;  1R73 A;  3JCZ A;  3VBB A;  4XBF A;  1QVF U;  4FJC C;  3SPG A;  3ABK B;  3WG7 C;  2X6B A;  2Q67 A;  1K7D A;  4U7O A;  2GSM B;  1VQ8 V;  2Y69 C;  4JTC B;  1NH2 B;  2YEV B;  2IH1 C;  3CMA V;  4QIW F;  1YJW V;  4PA6 A;  3D3I A;  1R6K A;  3B77 A;  1VQK V;  1WLE A;  1R3L C;  2GHY A;  1VQ6 V;  1TUE B;  2D3O W;  3JD1 A;  3G4S V;  1BL8 A;  2NLJ C;  4H33 A;  4WFB V;  5IYD O;  3VOU A;  3CC4 V;  3ZN0 A;  4WFG A;  3CC7 V;  3SYO A;  2LFS A;  1GK9 A;  3ABK C;  4FMT A;  1VQL V;  3T1C A;  2ZD9 A;  1QLE C;  1S3J A;  1CEZ A;  3ASN C;  3TET A;  3M99 B;  2OT5 A;  4MW8 A;  2HFE C;  3K0G A;  4BIU A;  3CXC U;  4P2Z A;  2B5U A;  2FTK A;  1OCO C;  1RPO A;  1FFT B;  2EIJ C;  2DYR B;  2DWD C;  3AG3 B;  1KC8 W;  1IXM A;  3AEI A;  3RBZ A;  3SPH A;  1PL0 A;  3RW0 A;  1ARO P;  2M7W A;  5B3S C;  2EIK B;  1SES A;  4MTG A;  1YTF B;  3OAA G;  2UXN A;  4UVB A;  1VQN V;  1UJW B;  3K06 A;  3ZRW B;  1S72 V;  4MTO A;  2Y69 B;  2HJF C;  4GX2 A;  4DXW A;  4E2L A;  1CP9 A;  5CN0 A;  3FYE B;  5L3G A;  1RPR A;  2HG5 C;  3CME V;  2QE7 G;  3LDD A;  1YSC A;  1SET A;  3STZ C;  4I9W A;  1JX9 A;  2WLN A;  1G8M A;  5LHH A;  2OCC B;  1N8R W;  2EZP A;  3T4D A;  1I5X A;  5HFL A;  4H37 A;  4RQE A;  4LP8 A;  1AI5 A;  2QTO A;  3DGE A;  4HYO A;  5L3C A;  4RUE A;  4TSF G;  3TCU A;  3QO8 A;  2HR3 A;  1NH2 D;  3JYC A;  4ZBM A;  1W2B U;  1K33 A;  2OTJ V;  2PI5 A;  4RO2 A;  3SYC A;  1F23 A;  1OCR C;  5B1A C;  1K92 A;  3ABT A;  1ORQ C;  3EHB B;  3OFN G;  2CK3 G;  3LDE A;  3CCM V;  2WLM A;  3FKS G;  4HZ3 A;  1XL4 A;  1MG1 A;  1PKX A;  2DYR C;  2WAM A;  1AJN A;  3MHH C;  4MVR A;  2V1D A;  1YHQ V;  1P7B A;  1GM8 A;  4PDR A;  3F5W C;  4BW5 A;  2X6A A;  1VQO V;  2DYS C;  2DWE C;  1K34 A;  1R3K C;  2ZXW C;  2R9I A;  1K97 A;  2QM7 A;  1NQT A;  1E79 G;  1M56 B;  3WG7 B;  3I55 V;  1H8H G;  3ZJZ A;  5IY5 B;  1HWY A;  4UVC A;  3AG2 C;  1DF4 A;  1QLN A;  1AJQ A;  5IDJ A;  2Z5U A;  1K8A W;  3X2Q C;  2AHY A;  3CCS V;  1AJP A;  1DF5 A;  3ABU A;  4JYC A;  1GMG A;  3T4Z A;  5L3E A;  4MVM A;  4R6Z A;  1JVM A;  1QR8 A;  2H94 A;  5H6Q A;  1FXK C;  3H01 A;  4JTA B;  5KUK A;  3IFX A;  1V55 B;  2IJK A;  3CCV V;  1Y66 A;  1GM9 A;  4RUF A;  2EIL B;  3ZIA G;  3ZRW A;  2WLI B;  1OZ0 A;  3CCQ V;  2IJH A;  3I56 V;  4MTX A;  2QM8 A;  1JPX A;  2LFR A;  5KA6 A;  3W7W A;  2NNU A;  1GKF A;  3LDC A;  1THZ A;  3MD0 A;  1YJ9 V;  4JGS A;  1L1F A;  2ZR3 A;  3E8B A;  1S0V A;  5LHG A;  5H6R A;  5EC2 C;  3K0D A;  3CCJ V;  3OEE G;  4P30 A;  2IW5 A;  2IJJ A;  1MSW D;  2Q6A A;  5L3B A;  2B1I A;  4G2K A;  1F4M A;  2HLD G;  3E2E A;  3ZRX A;  5H9C A;  2A9H A;  2HVJ C;  3ABM B;  3GWO A;  3ZMS A;  3ABM C;  1NKD A;  1NBM G;  1QCE A;  2EIM C;  1K4D C;  5CA3 A;  2JJ2 G;  4MS2 A;  3W7X A;  1EZJ A;  1COW G;  4KP4 A;  3JD3 A;  3AG4 B;  2H8P C;  3ZMT A;  3F7Y C;  3ZRV A;  1XL6 A;  3FB7 C;  3K08 A;  1MAB G;  5EBW C;  4Q20 A;  1VQP V;  2P67 A;  3HB3 B;  3WFV A;  3OUS A;  3PJS K;  3W7U A;  3MHS C;  1YIT V;  1F51 A;  1W0K G;  3JD4 A;  3NXS A;  4UV9 A;  2F43 G;  3W7T A;  4KUM A;  4ZKI A;  4MT8 A;  1RM1 C;  5L3F A;  3K79 A;  4L87 A;  4WFA V;  2Z3Y A;  1K73 W;  3R65 A;  4FK5 C;  5LGU A;  1OCO B;  3CPW U;  2EIN B;  3K03 A;  3OE7 G;  2HKO A;  4PEL A;  1Q81 W;  1JOY A;  1BHB A;  3LSQ A;  4LCU C;  2WLH A;  3SYA A;  1Q82 W;  1H38 A;  1YI2 V;  3SPC A;  3BEH A;  3T2M A;  3AG1 B;  5IYB O;  3F7V C;  1GM7 A;  2V7Q G;  4P9P A;  2Q68 A;  2B1G A;  2A0L A;  5IYC O;  4J9Z B;  3ZMZ A;  2EZO A;  3LNM B;  1S5H C;  1SZT A;  1I5Y A;  2IU0 A;  2QEX V;  1VQ4 V;  1M57 C;  1WPX A;  4UXN A;  5B1O A;  1M57 B;  2WLJ A;  4EKW A;  2XAF A;  3LSS A;  4R7C A;  1FXK B;  1S76 D;  3E8G A;  4Z1M G;  2EIK C;  4PDL A;  4MVS A;  3FB6 C;  2IU3 A;  2W6I G;  1ENV A;  1V55 C;  2QKS A;  2XND G;  5EBM C;  1FXH A;  2ZXW B;  1PD3 A;  2BOB C;  4I5S A;  3IC7 A;  3A0R A;  3ETE A;  4MSW C;  2ZDI C;  2AHZ A;  2ZQM A;  4WFE A;  5CBG A;  2OCC C;  2XAJ A;  3OM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...