4JPZA

Voltage-gated sodium channel 1.2 c-terminal domain in complex with fgf13u and ca2+/calmodulin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
148
Chain Sequence
PQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 13
publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 29
structure length 148
sequence length 148
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4jpzA00
4ZBVB 2AQZA 1DFCA 3FJDA 1HWNB 1Q03A 1Z4SA 3VT1A 3BAOA 4EKXB 3O4AA 3FJAA 3VWCA 1ISVA 1WBAA 5BOWA 4EFPA 2LIQA 4ZKTB 2FFUA 1YYNA 3IM7A 2MC2A 2DRZA 2IHOA 2NVHA 1Z2VA 4I6IA 3V79C 3CU1B 3BAHA 2QYIB 5I1BA 2NYYA 4LO3C 5D61A 4P0LA 3O4DA 1CVSA 1DQOA 3VEQA 4ZOTA 5F8YA 1YXWA 4I3NA 3TC2A 4IZXA 3QYDA 3F1RA 4Q9GA 4I1EA 4Z8SB 1HWPB 1JLYA 1MD6A 3AJ6A 1G9CA 4G6MA 1HCEA 4J2SA 5JMCA 3PG0A 3BAGA 5BXRA 3OJMA 3HMYA 1JT7A 3RMXA 3BTAA 3C9ZA 4A7ZA 3B9UA 4I4XA 4H04A 4P6AA 5F8SA 3CA0A 3NBCA 4FVVA 1AVUA 3PMEA 1IRAX 3IAGC 3UDAA 1PC8B 1RMLA 2QN4A 5BXTA 4AN6A 1AXMA 3AZWA 1BFCA 1ISZA 3FJ8A 4KEIA 2X2TA 1TIEA 2D7IA 1P63A 4A7YA 2I1BA 4G1RA 4P0KA 5DVHA 2LIEA 3FJEA 2Y9FA 3AKHA 3FJKA 4IONA 3NBNA 4I37A 3WA1A 2D43A 7I1BA 1DQGA 3VSZA 3Q7WA 1T4QA 1FQ9A 3ZC9A 4Q91A 1JT5A 3VSFA 3NJ5A 1JT3A 4QKRA 1RG8A 3CA3A 4QKSA 4I4PA 3SNVA 4IY9A 1JTCA 3HBWA 2AFGA 3HALA 1S0FA 5FZZA 3VUOA 1TTUA 3MPPG 1CE7B 3O3QA 2KI6B 2L5XA 5D63A 1GGPB 4GOYA 1FMMS 4KEKA 3CRIA 3FUOA 1DIWA 1FGAA 1EV2A 1JT4A 1A8DA 3BRDA 3R4UA 2Y9GA 3O4OA 2WRYA 1SR4A 1DFQA 1NZKA 1XZZA 1QXMA 4IQPA 1KNMA 3Q7XA 2KLLA 2VLCA 1D0HA 2HWAA 1IILA 4L4HA 2HZ9A 4I1BA 3HN1A 1HWMB 3A21A 3H6QA 4L4IA 4TLPA 2HWMA 4J23B 2AAIB 6I1BA 4QD2B 3CA6A 3ZX7A 3WO2A 2VUAA 1II4A 3RTJB 3BRFA 1W3FA 2UUSA 4LO1A 4QD2C 3V0AB 2NM1A 4X37A 4OWJA 2RQ9A 1I1EA 4OWKA 4XKIA 3EF2A 1BLAA 4GAIA 4G9MA 2Y9WC 3I2XA 4ENDA 2KI4A 1YBIA 1HKNA 3O4CA 2KH2A 4KEJA 3HOMA 2Z49A 2D7RA 3RTIB 2ZR1B 1SZ6B 3BAQA 1AVWB 4J2YA 4LO2A 2FDBM 4I4VA 1G9BA 1ITBA 3IM5A 1Z0HA 4I8MA 3I29B 4I4RA 1ISYA 3V0AA 1V6XA 3T8SA 1OQLB 2FFVA 3FFZA 2MIBA 1HIBA 1BARA 1IOBA 3AH2A 1QQLA 4QALA 3AKGA 4XFUA 4EB2B 3CRHA 1S0CA 5EC5A 1DLLA 3AZVA 3N7MA 2Q9XA 1RZOB 3BX1C 1PWAA 3FJCA 1Q04A 2F2FA 1BASA 4GOVA 1G9DA 3FJIA 3BAVA 1BA7A 3FUQA 3O49A 4LO0A 2BEAA 1ONKB 5BP5A 1M2TB 3CQAA 1PUUB 3VT2A 2F8XC 4F83A 4XFTA 5BQUA 5DZUA 2D22A 3H6RB 2E4MA 3S8KA 4J2XA 2IWTB 3OBRA 3UD7A 1FN0A 1TOOA 1S0BA 1DZCA 3S8JA 2ESUA 1PZZA 2X2SA 3QR5A 2RSTA 4I4SA 4GAFA 2P23A 3WINA 3P6IA 3UJ4A 1S0GA 3CRGA 1SR4C 4YOLA 3FJJA 1ISXA 3KMVA 4J2KA 3AH1A 3PUBA 3FJ9A 41BIA 1WD3A 4I4YA 1YTOA 2D20A 1W3AA 3H6RA 4KBBA 1JY0A 2Y9XE 3OJ2A 2BEBA 1BFGA 1Q1UA 3N7JA 4IHZA 3FJBA 4I2SA 3FGMA 4DEPA 2GZBA 5F90A 1G9AA 4I96A 3A22A 2VXTI 1V6UA 3BA7A 1E0OA 3R4SA 3OGGA 4H9WA 4GP3A 1TFMB 3LLPA 4LO7B 3H6SE 4I4OA 4OWLA 5D62A 4F34A 4WBCA 1G82A 4X38A 2FGFA 4HJJA 4LO1C 2P39A 4Q9PA 4ZA3B 4EFQA 2ET2A 1S0EA 2BFHA 4II0A 1UPSA 4LO7C 4JKQA 2AXMA 4QBVA 2HW9A 2KKIA 4I7IA 4AN7B 1V6WA 1JLXA 4I0YA 5DSSB 3WMUA 3CAHA 2DREA 31BIA 4ZFUB 2Z48A 1DJSB 3UJ0A 9ILBA 1FV3A 2K4AB 3K1XA 8I1BA 5JLVA 1HCDA 2ZQOA 3LTQA 4LO2C 3AJ5A 5B2HA 3N7LA 3N0KA 1NUNA 1YF8B 4EFRA 2MLLB 3ZC8A 3O5WB 2RG9B 4HR6C 3CA1A 1R8OA 1S0DA 4XFSA 3OBTA 4IY8A 4JRAA 5BXSA 1AFCA 4JQ0A 3MALA 1EYLA 4IYBA 4G9NA 1EVTA 4PC4A 5HPZA 2ERMA 3Q7YA 1DZDA 3O4BA 3JRRA 2F2FC 4ISRA 3D7WB 4X3AA 4DCKC 1N4KA 3BA5A 3OJVA 1AF9A 4D8HA 5BP5C 4LO0C 4QO3A 4P0JA 2ZQNA 3AH4A 4EEEB 3RMYA 3W9TA 3WO3A 4JP0A 1WD4A 4OUJA 5BQUC 1V6VA 2D1ZA 3I2AA 4DENA 1IT0A 4I4QA 3N7KA 3AKIA 4JAWA 2E4MC 1ILR1 4ZGRB 2M49A 1ABRB 1JQZA 1W3GA 1HWOB 4QBCA 1FMZA 1IJTA 4JKXB 4OW4A 3VT0A 1K5VA 4LO3A 5E24E 3FJFA 2XOAA 1I1BA 3HSMA 3WINC 4USOA 4USPA 1AVAC 1L2HA 3BB2A 2NTDA 4IZEA 4JPZA 2D23A 2R9KB 3A23A 1BFFA 1RY7A 1PUMB 2DRYA 3F62B 3RSJA 1F31A 3O44A 4ZLBB 3JUTA 3OGFA 3CA5A 3ZXDA 1MC9A 5FZUA 4A7KA 4LO8B 2J3PA 2Q3NB 3NBEA 3A07A 2YUGA 2VXRA 4OEFA 5FNXA 2WBCA 21BIA 1TWMA 1FWUA 3ILAA 1XG6A 3UD8A 4G6JA 4FGFA 3WMVA 3P6JA 5G00A 3ZXGA 1WBCA 3BRGC 2DS0A 4R6UB 3V0BB 1FWVA 4QC4A 5FZYA 5BXPA 2K8RA 4D0TA 4ZFYB 2NZ9A 4D0ZA 2VSEA 3POKA 2GO2A 1ISWA 4OEGA 3P53A 5EHAA 2VSAA 4ZFWB 2NP0A 1M16A 1IRPA 3NBDA 1XYFA 3BADA 1IHKA 1S0LA 3BA4A 3AKFA 3CA4A 4OEEA 5FNWA 5GAQA 1K5UA 4I4UA 2D24A 4HA2A 4ISQA 2VU9A 1XHBA 3UD9A 1AVXB 3V0BA 5EG6C 1TWEA 4KC3A 3E8LC 1TP0A 1VCLA 5BVPI 3BAUA 1FV2A 3PHZA 5F8WA 2D44A 4CJMA 2K43A 1BLDA 3IIRA 5DUYA 4Z9WB 3FJHA 4X39A 2FO1A 1J0SA 4GP0A 1EPWA 3IM6A 1QQKA 1R8NA 1BFBA 3WO4A 1T9FA
chains in the Genus database with same CATH superfamily
4ZBVB 2AQZA 1DFCA 3FJDA 1HWNB 1Q03A 1Z4SA 3VT1A 3BAOA 4EKXB 3O4AA 3FJAA 3VWCA 1ISVA 1WBAA 5BOWA 4EFPA 2LIQA 4ZKTB 2FFUA 1YYNA 3IM7A 2MC2A 2DRZA 2IHOA 2NVHA 1Z2VA 4I6IA 3V79C 3CU1B 3BAHA 2QYIB 5I1BA 2NYYA 4LO3C 5D61A 4P0LA 3O4DA 1CVSA 1DQOA 3VEQA 4ZOTA 5F8YA 1YXWA 4I3NA 3TC2A 4IZXA 3QYDA 3F1RA 4Q9GA 4I1EA 4Z8SB 1HWPB 1JLYA 1MD6A 3AJ6A 1G9CA 4G6MA 1HCEA 4J2SA 5JMCA 3PG0A 3BAGA 4UY4A 5BXRA 3OJMA 3HMYA 1JT7A 3RMXA 3BTAA 3C9ZA 4A7ZA 3B9UA 4I4XA 4H04A 4P6AA 5F8SA 3CA0A 3NBCA 4FVVA 1AVUA 3PMEA 1IRAX 3IAGC 3UDAA 1PC8B 1RMLA 2QN4A 5BXTA 4AN6A 1AXMA 3AZWA 1BFCA 1ISZA 3FJ8A 4KEIA 2X2TA 1TIEA 2D7IA 1P63A 4A7YA 2I1BA 4G1RA 4P0KA 5DVHA 2LIEA 3FJEA 2Y9FA 3AKHA 3FJKA 4IONA 3NBNA 4I37A 3WA1A 2D43A 7I1BA 1DQGA 3VSZA 3Q7WA 1T4QA 1FQ9A 3ZC9A 2NS2A 4Q91A 1JT5A 3VSFA 3NJ5A 1JT3A 4QKRA 1RG8A 3CA3A 4QKSA 4I4PA 3SNVA 4IY9A 1JTCA 3HBWA 2AFGA 3HALA 1S0FA 5FZZA 3VUOA 1TTUA 3MPPG 1CE7B 3O3QA 2KI6B 2L5XA 5D63A 1GGPB 4GOYA 1FMMS 4KEKA 3CRIA 3FUOA 1DIWA 1FGAA 1EV2A 1JT4A 1A8DA 3BRDA 3R4UA 2Y9GA 3O4OA 2WRYA 1SR4A 1DFQA 1NZKA 1XZZA 1QXMA 4IQPA 1KNMA 3Q7XA 2KLLA 2VLCA 1D0HA 2HWAA 1IILA 4L4HA 2HZ9A 4I1BA 3HN1A 1HWMB 3A21A 3H6QA 4L4IA 4TLPA 2HWMA 4J23B 2AAIB 6I1BA 4QD2B 3CA6A 3ZX7A 3WO2A 2VUAA 1II4A 4MZHA 3RTJB 3BRFA 1W3FA 2UUSA 4LO1A 4QD2C 3V0AB 2NM1A 4X37A 4OWJA 2RQ9A 1I1EA 4OWKA 4XKIA 3EF2A 1BLAA 4GAIA 4G9MA 2Y9WC 3I2XA 4ENDA 2KI4A 1YBIA 1HKNA 3O4CA 2KH2A 4KEJA 3HOMA 2Z49A 2D7RA 3RTIB 2ZR1B 1SZ6B 3BAQA 1AVWB 4J2YA 4LO2A 2FDBM 4I4VA 1G9BA 1ITBA 3IM5A 1Z0HA 4I8MA 3I29B 4I4RA 1ISYA 3V0AA 1V6XA 3T8SA 1OQLB 2FFVA 3FFZA 2MIBA 1HIBA 1BARA 4H75A 1IOBA 3AH2A 1QQLA 4QALA 3AKGA 4XFUA 4EB2B 3CRHA 1S0CA 5EC5A 1DLLA 3AZVA 3N7MA 2Q9XA 1RZOB 3BX1C 1PWAA 3FJCA 1Q04A 2F2FA 1BASA 4GOVA 1G9DA 3FJIA 3BAVA 1BA7A 3FUQA 3O49A 4LO0A 2BEAA 1ONKB 5BP5A 1M2TB 3CQAA 1PUUB 3VT2A 2F8XC 4F83A 4XFTA 5BQUA 5DZUA 2D22A 3H6RB 2E4MA 3S8KA 4J2XA 2IWTB 3OBRA 3UD7A 1FN0A 1TOOA 1S0BA 1DZCA 3S8JA 2ESUA 1PZZA 2X2SA 3QR5A 2RSTA 4I4SA 4GAFA 2P23A 3WINA 3P6IA 3UJ4A 1S0GA 3CRGA 1SR4C 4YOLA 3FJJA 1ISXA 3KMVA 4J2KA 3AH1A 3PUBA 3FJ9A 41BIA 1WD3A 4I4YA 1YTOA 2D20A 1W3AA 3H6RA 4KBBA 1JY0A 2Y9XE 3OJ2A 2BEBA 1BFGA 1Q1UA 3N7JA 4IHZA 3FJBA 4I2SA 3FGMA 4DEPA 2GZBA 5F90A 1G9AA 4I96A 3A22A 2VXTI 1V6UA 3BA7A 1E0OA 3R4SA 3OGGA 4H9WA 4GP3A 1TFMB 3LLPA 4LO7B 3H6SE 4I4OA 4OWLA 5D62A 4F34A 4WBCA 1G82A 4X38A 2FGFA 4HJJA 4LO1C 2P39A 4Q9PA 4ZA3B 4EFQA 2ET2A 1S0EA 2BFHA 4II0A 1UPSA 4LO7C 4JKQA 2AXMA 4QBVA 2HW9A 2KKIA 4I7IA 4AN7B 1V6WA 1JLXA 4I0YA 5DSSB 3WMUA 3CAHA 2DREA 31BIA 4ZFUB 2Z48A 1DJSB 3UJ0A 9ILBA 1FV3A 2K4AB 3K1XA 8I1BA 5JLVA 1HCDA 2ZQOA 3LTQA 4LO2C 3AJ5A 5B2HA 3N7LA 3N0KA 1NUNA 1YF8B 4EFRA 2MLLB 3ZC8A 3O5WB 2RG9B 4HR6C 3CA1A 1R8OA 1S0DA 4XFSA 3OBTA 4IY8A 4JRAA 5BXSA 1AFCA 4JQ0A 3MALA 1EYLA 4IYBA 4G9NA 1EVTA 4PC4A 5HPZA 2ERMA 3Q7YA 1DZDA 3O4BA 3JRRA 2F2FC 4ISRA 3D7WB 4X3AA 4DCKC 1N4KA 3BA5A 3OJVA 1AF9A 4D8HA 5BP5C 4LO0C 4QO3A 4P0JA 2ZQNA 3AH4A 4EEEB 3RMYA 3W9TA 3WO3A 4JP0A 1WD4A 4OUJA 5BQUC 1V6VA 2D1ZA 4MZGB 3I2AA 4DENA 1IT0A 4I4QA 3N7KA 3AKIA 4JAWA 2E4MC 1ILR1 4ZGRB 2M49A 1ABRB 1JQZA 1W3GA 1HWOB 4QBCA 1FMZA 1IJTA 4JKXB 4OW4A 3VT0A 1K5VA 4LO3A 5E24E 3FJFA 2XOAA 1I1BA 3HSMA 3WINC 4USOA 4USPA 1AVAC 1L2HA 3BB2A 2NTDA 4IZEA 4JPZA 2D23A 2R9KB 3A23A 1BFFA 1RY7A 1PUMB 2DRYA 3F62B 3RSJA 1F31A 3O44A 4ZLBB 3JUTA 3OGFA 3CA5A 3ZXDA 1MC9A 5FZUA 4A7KA 4LO8B 2J3PA 2Q3NB 3NBEA 3A07A 2YUGA 2VXRA 4OEFA 5FNXA 2WBCA 21BIA 1TWMA 1FWUA 3ILAA 4MZFB 1XG6A 3UD8A 4G6JA 4FGFA 3WMVA 3P6JA 5G00A 3ZXGA 1WBCA 3BRGC 2DS0A 4R6UB 3V0BB 1FWVA 4QC4A 5FZYA 5BXPA 2K8RA 4D0TA 4ZFYB 2NZ9A 4D0ZA 2VSEA 3POKA 2GO2A 1ISWA 4OEGA 3P53A 5EHAA 2VSAA 4ZFWB 2NP0A 1M16A 1IRPA 3NBDA 1XYFA 3BADA 1IHKA 1S0LA 3BA4A 3AKFA 3CA4A 4OEEA 5FNWA 5GAQA 1K5UA 4I4UA 2D24A 4HA2A 4ISQA 2VU9A 1XHBA 3UD9A 1AVXB 3V0BA 5EG6C 1TWEA 4KC3A 3E8LC 1TP0A 1VCLA 5BVPI 3BAUA 1FV2A 3PHZA 5F8WA 2D44A 4CJMA 2K43A 1BLDA 3IIRA 5DUYA 4Z9WB 3FJHA 4X39A 2FO1A 1J0SA 4GP0A 1EPWA 3IM6A 1QQKA 1R8NA 1BFBA 3WO4A 1T9FA
chains in the Genus database with same CATH topology
4ZBVB 2AQZA 1DFCA 3FJDA 1HWNB 1Q03A 1Z4SA 3VT1A 3BAOA 4EKXB 3O4AA 3FJAA 3VWCA 1ISVA 1WBAA 5BOWA 4EFPA 2LIQA 4ZKTB 2FFUA 1YYNA 3IM7A 2MC2A 2DRZA 2IHOA 2NVHA 1Z2VA 4I6IA 3V79C 3CU1B 3BAHA 2QYIB 5I1BA 2NYYA 4LO3C 5D61A 4P0LA 3O4DA 1CVSA 1DQOA 3VEQA 4ZOTA 5F8YA 1YXWA 4I3NA 3TC2A 4IZXA 3QYDA 3F1RA 4Q9GA 4I1EA 4Z8SB 1HWPB 1JLYA 1MD6A 3AJ6A 1G9CA 4G6MA 1HCEA 4J2SA 5JMCA 3PG0A 3BAGA 4UY4A 5BXRA 3OJMA 3HMYA 1JT7A 3RMXA 3BTAA 3C9ZA 4A7ZA 3B9UA 4I4XA 4H04A 4P6AA 5F8SA 3CA0A 3NBCA 4FVVA 1AVUA 3PMEA 1IRAX 3IAGC 3UDAA 1PC8B 1RMLA 2QN4A 5BXTA 4AN6A 1AXMA 3AZWA 1BFCA 1ISZA 3FJ8A 4KEIA 2X2TA 1TIEA 2D7IA 1P63A 4A7YA 2I1BA 4G1RA 4P0KA 5DVHA 2LIEA 3FJEA 2Y9FA 3AKHA 3FJKA 4IONA 3NBNA 4I37A 3WA1A 2D43A 7I1BA 1DQGA 3VSZA 3Q7WA 1T4QA 1FQ9A 3ZC9A 2NS2A 4Q91A 1JT5A 3VSFA 3NJ5A 1JT3A 4QKRA 1RG8A 3CA3A 4QKSA 4I4PA 3SNVA 4IY9A 1JTCA 3HBWA 2AFGA 3HALA 1S0FA 5FZZA 3VUOA 1TTUA 3MPPG 1CE7B 3O3QA 2KI6B 2L5XA 5D63A 1GGPB 4GOYA 1FMMS 4KEKA 3CRIA 3FUOA 1DIWA 1FGAA 1EV2A 1JT4A 1A8DA 3BRDA 3R4UA 2Y9GA 3O4OA 2WRYA 1SR4A 1DFQA 1NZKA 1XZZA 1QXMA 4IQPA 1KNMA 3Q7XA 2KLLA 2VLCA 1D0HA 2HWAA 1IILA 4L4HA 2HZ9A 4I1BA 3HN1A 1HWMB 3A21A 3H6QA 4L4IA 4TLPA 2HWMA 4J23B 2AAIB 6I1BA 4QD2B 3CA6A 3ZX7A 3WO2A 2VUAA 1II4A 4MZHA 3RTJB 3BRFA 1W3FA 2UUSA 4LO1A 4QD2C 3V0AB 2NM1A 4X37A 4OWJA 2RQ9A 1I1EA 4OWKA 4XKIA 3EF2A 1BLAA 4GAIA 4G9MA 2Y9WC 3I2XA 4ENDA 2KI4A 1YBIA 1HKNA 3O4CA 2KH2A 4KEJA 3HOMA 2Z49A 2D7RA 3RTIB 2ZR1B 1SZ6B 3BAQA 1AVWB 4J2YA 4LO2A 2FDBM 4I4VA 1G9BA 1ITBA 3IM5A 1Z0HA 4I8MA 3I29B 4I4RA 1ISYA 3V0AA 1V6XA 3T8SA 1OQLB 2FFVA 3FFZA 2MIBA 1HIBA 1BARA 4H75A 1IOBA 3AH2A 1QQLA 4QALA 3AKGA 4XFUA 4EB2B 3CRHA 1S0CA 5EC5A 1DLLA 3AZVA 3N7MA 2Q9XA 1RZOB 3BX1C 1PWAA 3FJCA 1Q04A 2F2FA 1BASA 4GOVA 1G9DA 3FJIA 3BAVA 1BA7A 3FUQA 3O49A 4LO0A 2BEAA 1ONKB 5BP5A 1M2TB 3CQAA 1PUUB 3VT2A 2F8XC 4F83A 4XFTA 5BQUA 5DZUA 2D22A 3H6RB 2E4MA 3S8KA 4J2XA 2IWTB 3OBRA 3UD7A 1FN0A 1TOOA 1S0BA 1DZCA 3S8JA 2ESUA 1PZZA 2X2SA 3QR5A 2RSTA 4I4SA 4GAFA 2P23A 3WINA 3P6IA 3UJ4A 1S0GA 3CRGA 1SR4C 4YOLA 3FJJA 1ISXA 3KMVA 4J2KA 3AH1A 3PUBA 3FJ9A 41BIA 1WD3A 4I4YA 1YTOA 2D20A 1W3AA 3H6RA 4KBBA 1JY0A 2Y9XE 3OJ2A 2BEBA 1BFGA 1Q1UA 3N7JA 4IHZA 3FJBA 4I2SA 3FGMA 4DEPA 2GZBA 5F90A 1G9AA 4I96A 3A22A 2VXTI 1V6UA 3BA7A 1E0OA 3R4SA 3OGGA 4H9WA 4GP3A 1TFMB 3LLPA 4LO7B 3H6SE 4I4OA 4OWLA 5D62A 4F34A 4WBCA 1G82A 4X38A 2FGFA 4HJJA 4LO1C 2P39A 4Q9PA 4ZA3B 4EFQA 2ET2A 1S0EA 2BFHA 4II0A 1UPSA 4LO7C 4JKQA 2AXMA 4QBVA 2HW9A 2KKIA 4I7IA 4AN7B 1V6WA 1JLXA 4I0YA 5DSSB 3WMUA 3CAHA 2DREA 31BIA 4ZFUB 2Z48A 1DJSB 3UJ0A 9ILBA 1FV3A 2K4AB 3K1XA 8I1BA 5JLVA 1HCDA 2ZQOA 3LTQA 4LO2C 3AJ5A 5B2HA 3N7LA 3N0KA 1NUNA 1YF8B 4EFRA 2MLLB 3ZC8A 3O5WB 2RG9B 4HR6C 3CA1A 1R8OA 1S0DA 4XFSA 3OBTA 4IY8A 4JRAA 5BXSA 1AFCA 4JQ0A 3MALA 1EYLA 4IYBA 4G9NA 1EVTA 4PC4A 5HPZA 2ERMA 3Q7YA 1DZDA 3O4BA 3JRRA 2F2FC 4ISRA 3D7WB 4X3AA 4DCKC 1N4KA 3BA5A 3OJVA 1AF9A 4D8HA 5BP5C 4LO0C 4QO3A 4P0JA 2ZQNA 3AH4A 4EEEB 3RMYA 3W9TA 3WO3A 4JP0A 1WD4A 4OUJA 5BQUC 1V6VA 2D1ZA 4MZGB 3I2AA 4DENA 1IT0A 4I4QA 3N7KA 3AKIA 4JAWA 2E4MC 1ILR1 4ZGRB 2M49A 1ABRB 1JQZA 1W3GA 1HWOB 4QBCA 1FMZA 1IJTA 4JKXB 4OW4A 3VT0A 1K5VA 4LO3A 5E24E 3FJFA 2XOAA 1I1BA 3HSMA 3WINC 4USOA 4USPA 1AVAC 1L2HA 3BB2A 2NTDA 4IZEA 4JPZA 2D23A 2R9KB 3A23A 1BFFA 1RY7A 1PUMB 2DRYA 3F62B 3RSJA 1F31A 3O44A 4ZLBB 3JUTA 3OGFA 3CA5A 3ZXDA 1MC9A 5FZUA 4A7KA 4LO8B 2J3PA 2Q3NB 3NBEA 3A07A 2YUGA 2VXRA 4OEFA 5FNXA 2WBCA 21BIA 1TWMA 1FWUA 3ILAA 4MZFB 1XG6A 3UD8A 4G6JA 4FGFA 3WMVA 3P6JA 5G00A 3ZXGA 1WBCA 3BRGC 2DS0A 4R6UB 3V0BB 1FWVA 4QC4A 5FZYA 5BXPA 2K8RA 4D0TA 4ZFYB 2NZ9A 4D0ZA 2VSEA 3POKA 2GO2A 1ISWA 4OEGA 3P53A 5EHAA 2VSAA 4ZFWB 2NP0A 1M16A 1IRPA 3NBDA 1XYFA 3BADA 1IHKA 1S0LA 3BA4A 3AKFA 3CA4A 4OEEA 5FNWA 5GAQA 1K5UA 4I4UA 2D24A 4HA2A 4ISQA 2VU9A 1XHBA 3UD9A 1AVXB 3V0BA 5EG6C 1TWEA 4KC3A 3E8LC 1TP0A 1VCLA 5BVPI 3BAUA 1FV2A 3PHZA 5F8WA 2D44A 4CJMA 2K43A 1BLDA 3IIRA 5DUYA 4Z9WB 3FJHA 4X39A 2FO1A 1J0SA 4GP0A 1EPWA 3IM6A 1QQKA 1R8NA 1BFBA 3WO4A 1T9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZBV B;  2AQZ A;  1DFC A;  3FJD A;  1HWN B;  1Q03 A;  1Z4S A;  3VT1 A;  3BAO A;  4EKX B;  3O4A A;  3FJA A;  3VWC A;  1ISV A;  1WBA A;  5BOW A;  4EFP A;  2LIQ A;  4ZKT B;  2FFU A;  1YYN A;  3IM7 A;  2MC2 A;  2DRZ A;  2IHO A;  2NVH A;  1Z2V A;  4I6I A;  3V79 C;  3CU1 B;  3BAH A;  2QYI B;  5I1B A;  2NYY A;  4LO3 C;  5D61 A;  4P0L A;  3O4D A;  1CVS A;  1DQO A;  3VEQ A;  4ZOT A;  5F8Y A;  1YXW A;  4I3N A;  3TC2 A;  4IZX A;  3QYD A;  3F1R A;  4Q9G A;  4I1E A;  4Z8S B;  1HWP B;  1JLY A;  1MD6 A;  3AJ6 A;  1G9C A;  4G6M A;  1HCE A;  4J2S A;  5JMC A;  3PG0 A;  3BAG A;  5BXR A;  3OJM A;  3HMY A;  1JT7 A;  3RMX A;  3BTA A;  3C9Z A;  4A7Z A;  3B9U A;  4I4X A;  4H04 A;  4P6A A;  5F8S A;  3CA0 A;  3NBC A;  4FVV A;  1AVU A;  3PME A;  1IRA X;  3IAG C;  3UDA A;  1PC8 B;  1RML A;  2QN4 A;  5BXT A;  4AN6 A;  1AXM A;  3AZW A;  1BFC A;  1ISZ A;  3FJ8 A;  4KEI A;  2X2T A;  1TIE A;  2D7I A;  1P63 A;  4A7Y A;  2I1B A;  4G1R A;  4P0K A;  5DVH A;  2LIE A;  3FJE A;  2Y9F A;  3AKH A;  3FJK A;  4ION A;  3NBN A;  4I37 A;  3WA1 A;  2D43 A;  7I1B A;  1DQG A;  3VSZ A;  3Q7W A;  1T4Q A;  1FQ9 A;  3ZC9 A;  4Q91 A;  1JT5 A;  3VSF A;  3NJ5 A;  1JT3 A;  4QKR A;  1RG8 A;  3CA3 A;  4QKS A;  4I4P A;  3SNV A;  4IY9 A;  1JTC A;  3HBW A;  2AFG A;  3HAL A;  1S0F A;  5FZZ A;  3VUO A;  1TTU A;  3MPP G;  1CE7 B;  3O3Q A;  2KI6 B;  2L5X A;  5D63 A;  1GGP B;  4GOY A;  1FMM S;  4KEK A;  3CRI A;  3FUO A;  1DIW A;  1FGA A;  1EV2 A;  1JT4 A;  1A8D A;  3BRD A;  3R4U A;  2Y9G A;  3O4O A;  2WRY A;  1SR4 A;  1DFQ A;  1NZK A;  1XZZ A;  1QXM A;  4IQP A;  1KNM A;  3Q7X A;  2KLL A;  2VLC A;  1D0H A;  2HWA A;  1IIL A;  4L4H A;  2HZ9 A;  4I1B A;  3HN1 A;  1HWM B;  3A21 A;  3H6Q A;  4L4I A;  4TLP A;  2HWM A;  4J23 B;  2AAI B;  6I1B A;  4QD2 B;  3CA6 A;  3ZX7 A;  3WO2 A;  2VUA A;  1II4 A;  3RTJ B;  3BRF A;  1W3F A;  2UUS A;  4LO1 A;  4QD2 C;  3V0A B;  2NM1 A;  4X37 A;  4OWJ A;  2RQ9 A;  1I1E A;  4OWK A;  4XKI A;  3EF2 A;  1BLA A;  4GAI A;  4G9M A;  2Y9W C;  3I2X A;  4END A;  2KI4 A;  1YBI A;  1HKN A;  3O4C A;  2KH2 A;  4KEJ A;  3HOM A;  2Z49 A;  2D7R A;  3RTI B;  2ZR1 B;  1SZ6 B;  3BAQ A;  1AVW B;  4J2Y A;  4LO2 A;  2FDB M;  4I4V A;  1G9B A;  1ITB A;  3IM5 A;  1Z0H A;  4I8M A;  3I29 B;  4I4R A;  1ISY A;  3V0A A;  1V6X A;  3T8S A;  1OQL B;  2FFV A;  3FFZ A;  2MIB A;  1HIB A;  1BAR A;  1IOB A;  3AH2 A;  1QQL A;  4QAL A;  3AKG A;  4XFU A;  4EB2 B;  3CRH A;  1S0C A;  5EC5 A;  1DLL A;  3AZV A;  3N7M A;  2Q9X A;  1RZO B;  3BX1 C;  1PWA A;  3FJC A;  1Q04 A;  2F2F A;  1BAS A;  4GOV A;  1G9D A;  3FJI A;  3BAV A;  1BA7 A;  3FUQ A;  3O49 A;  4LO0 A;  2BEA A;  1ONK B;  5BP5 A;  1M2T B;  3CQA A;  1PUU B;  3VT2 A;  2F8X C;  4F83 A;  4XFT A;  5BQU A;  5DZU A;  2D22 A;  3H6R B;  2E4M A;  3S8K A;  4J2X A;  2IWT B;  3OBR A;  3UD7 A;  1FN0 A;  1TOO A;  1S0B A;  1DZC A;  3S8J A;  2ESU A;  1PZZ A;  2X2S A;  3QR5 A;  2RST A;  4I4S A;  4GAF A;  2P23 A;  3WIN A;  3P6I A;  3UJ4 A;  1S0G A;  3CRG A;  1SR4 C;  4YOL A;  3FJJ A;  1ISX A;  3KMV A;  4J2K A;  3AH1 A;  3PUB A;  3FJ9 A;  41BI A;  1WD3 A;  4I4Y A;  1YTO A;  2D20 A;  1W3A A;  3H6R A;  4KBB A;  1JY0 A;  2Y9X E;  3OJ2 A;  2BEB A;  1BFG A;  1Q1U A;  3N7J A;  4IHZ A;  3FJB A;  4I2S A;  3FGM A;  4DEP A;  2GZB A;  5F90 A;  1G9A A;  4I96 A;  3A22 A;  2VXT I;  1V6U A;  3BA7 A;  1E0O A;  3R4S A;  3OGG A;  4H9W A;  4GP3 A;  1TFM B;  3LLP A;  4LO7 B;  3H6S E;  4I4O A;  4OWL A;  5D62 A;  4F34 A;  4WBC A;  1G82 A;  4X38 A;  2FGF A;  4HJJ A;  4LO1 C;  2P39 A;  4Q9P A;  4ZA3 B;  4EFQ A;  2ET2 A;  1S0E A;  2BFH A;  4II0 A;  1UPS A;  4LO7 C;  4JKQ A;  2AXM A;  4QBV A;  2HW9 A;  2KKI A;  4I7I A;  4AN7 B;  1V6W A;  1JLX A;  4I0Y A;  5DSS B;  3WMU A;  3CAH A;  2DRE A;  31BI A;  4ZFU B;  2Z48 A;  1DJS B;  3UJ0 A;  9ILB A;  1FV3 A;  2K4A B;  3K1X A;  8I1B A;  5JLV A;  1HCD A;  2ZQO A;  3LTQ A;  4LO2 C;  3AJ5 A;  5B2H A;  3N7L A;  3N0K A;  1NUN A;  1YF8 B;  4EFR A;  2MLL B;  3ZC8 A;  3O5W B;  2RG9 B;  4HR6 C;  3CA1 A;  1R8O A;  1S0D A;  4XFS A;  3OBT A;  4IY8 A;  4JRA A;  5BXS A;  1AFC A;  4JQ0 A;  3MAL A;  1EYL A;  4IYB A;  4G9N A;  1EVT A;  4PC4 A;  5HPZ A;  2ERM A;  3Q7Y A;  1DZD A;  3O4B A;  3JRR A;  2F2F C;  4ISR A;  3D7W B;  4X3A A;  4DCK C;  1N4K A;  3BA5 A;  3OJV A;  1AF9 A;  4D8H A;  5BP5 C;  4LO0 C;  4QO3 A;  4P0J A;  2ZQN A;  3AH4 A;  4EEE B;  3RMY A;  3W9T A;  3WO3 A;  4JP0 A;  1WD4 A;  4OUJ A;  5BQU C;  1V6V A;  2D1Z A;  3I2A A;  4DEN A;  1IT0 A;  4I4Q A;  3N7K A;  3AKI A;  4JAW A;  2E4M C;  1ILR 1;  4ZGR B;  2M49 A;  1ABR B;  1JQZ A;  1W3G A;  1HWO B;  4QBC A;  1FMZ A;  1IJT A;  4JKX B;  4OW4 A;  3VT0 A;  1K5V A;  4LO3 A;  5E24 E;  3FJF A;  2XOA A;  1I1B A;  3HSM A;  3WIN C;  4USO A;  4USP A;  1AVA C;  1L2H A;  3BB2 A;  2NTD A;  4IZE A;  4JPZ A;  2D23 A;  2R9K B;  3A23 A;  1BFF A;  1RY7 A;  1PUM B;  2DRY A;  3F62 B;  3RSJ A;  1F31 A;  3O44 A;  4ZLB B;  3JUT A;  3OGF A;  3CA5 A;  3ZXD A;  1MC9 A;  5FZU A;  4A7K A;  4LO8 B;  2J3P A;  2Q3N B;  3NBE A;  3A07 A;  2YUG A;  2VXR A;  4OEF A;  5FNX A;  2WBC A;  21BI A;  1TWM A;  1FWU A;  3ILA A;  1XG6 A;  3UD8 A;  4G6J A;  4FGF A;  3WMV A;  3P6J A;  5G00 A;  3ZXG A;  1WBC A;  3BRG C;  2DS0 A;  4R6U B;  3V0B B;  1FWV A;  4QC4 A;  5FZY A;  5BXP A;  2K8R A;  4D0T A;  4ZFY B;  2NZ9 A;  4D0Z A;  2VSE A;  3POK A;  2GO2 A;  1ISW A;  4OEG A;  3P53 A;  5EHA A;  2VSA A;  4ZFW B;  2NP0 A;  1M16 A;  1IRP A;  3NBD A;  1XYF A;  3BAD A;  1IHK A;  1S0L A;  3BA4 A;  3AKF A;  3CA4 A;  4OEE A;  5FNW A;  5GAQ A;  1K5U A;  4I4U A;  2D24 A;  4HA2 A;  4ISQ A;  2VU9 A;  1XHB A;  3UD9 A;  1AVX B;  3V0B A;  5EG6 C;  1TWE A;  4KC3 A;  3E8L C;  1TP0 A;  1VCL A;  5BVP I;  3BAU A;  1FV2 A;  3PHZ A;  5F8W A;  2D44 A;  4CJM A;  2K43 A;  1BLD A;  3IIR A;  5DUY A;  4Z9W B;  3FJH A;  4X39 A;  2FO1 A;  1J0S A;  4GP0 A;  1EPW A;  3IM6 A;  1QQK A;  1R8N A;  1BFB A;  3WO4 A;  1T9F A; 
#chains in the Genus database with same CATH topology
 4ZBV B;  2AQZ A;  1DFC A;  3FJD A;  1HWN B;  1Q03 A;  1Z4S A;  3VT1 A;  3BAO A;  4EKX B;  3O4A A;  3FJA A;  3VWC A;  1ISV A;  1WBA A;  5BOW A;  4EFP A;  2LIQ A;  4ZKT B;  2FFU A;  1YYN A;  3IM7 A;  2MC2 A;  2DRZ A;  2IHO A;  2NVH A;  1Z2V A;  4I6I A;  3V79 C;  3CU1 B;  3BAH A;  2QYI B;  5I1B A;  2NYY A;  4LO3 C;  5D61 A;  4P0L A;  3O4D A;  1CVS A;  1DQO A;  3VEQ A;  4ZOT A;  5F8Y A;  1YXW A;  4I3N A;  3TC2 A;  4IZX A;  3QYD A;  3F1R A;  4Q9G A;  4I1E A;  4Z8S B;  1HWP B;  1JLY A;  1MD6 A;  3AJ6 A;  1G9C A;  4G6M A;  1HCE A;  4J2S A;  5JMC A;  3PG0 A;  3BAG A;  4UY4 A;  5BXR A;  3OJM A;  3HMY A;  1JT7 A;  3RMX A;  3BTA A;  3C9Z A;  4A7Z A;  3B9U A;  4I4X A;  4H04 A;  4P6A A;  5F8S A;  3CA0 A;  3NBC A;  4FVV A;  1AVU A;  3PME A;  1IRA X;  3IAG C;  3UDA A;  1PC8 B;  1RML A;  2QN4 A;  5BXT A;  4AN6 A;  1AXM A;  3AZW A;  1BFC A;  1ISZ A;  3FJ8 A;  4KEI A;  2X2T A;  1TIE A;  2D7I A;  1P63 A;  4A7Y A;  2I1B A;  4G1R A;  4P0K A;  5DVH A;  2LIE A;  3FJE A;  2Y9F A;  3AKH A;  3FJK A;  4ION A;  3NBN A;  4I37 A;  3WA1 A;  2D43 A;  7I1B A;  1DQG A;  3VSZ A;  3Q7W A;  1T4Q A;  1FQ9 A;  3ZC9 A;  2NS2 A;  4Q91 A;  1JT5 A;  3VSF A;  3NJ5 A;  1JT3 A;  4QKR A;  1RG8 A;  3CA3 A;  4QKS A;  4I4P A;  3SNV A;  4IY9 A;  1JTC A;  3HBW A;  2AFG A;  3HAL A;  1S0F A;  5FZZ A;  3VUO A;  1TTU A;  3MPP G;  1CE7 B;  3O3Q A;  2KI6 B;  2L5X A;  5D63 A;  1GGP B;  4GOY A;  1FMM S;  4KEK A;  3CRI A;  3FUO A;  1DIW A;  1FGA A;  1EV2 A;  1JT4 A;  1A8D A;  3BRD A;  3R4U A;  2Y9G A;  3O4O A;  2WRY A;  1SR4 A;  1DFQ A;  1NZK A;  1XZZ A;  1QXM A;  4IQP A;  1KNM A;  3Q7X A;  2KLL A;  2VLC A;  1D0H A;  2HWA A;  1IIL A;  4L4H A;  2HZ9 A;  4I1B A;  3HN1 A;  1HWM B;  3A21 A;  3H6Q A;  4L4I A;  4TLP A;  2HWM A;  4J23 B;  2AAI B;  6I1B A;  4QD2 B;  3CA6 A;  3ZX7 A;  3WO2 A;  2VUA A;  1II4 A;  4MZH A;  3RTJ B;  3BRF A;  1W3F A;  2UUS A;  4LO1 A;  4QD2 C;  3V0A B;  2NM1 A;  4X37 A;  4OWJ A;  2RQ9 A;  1I1E A;  4OWK A;  4XKI A;  3EF2 A;  1BLA A;  4GAI A;  4G9M A;  2Y9W C;  3I2X A;  4END A;  2KI4 A;  1YBI A;  1HKN A;  3O4C A;  2KH2 A;  4KEJ A;  3HOM A;  2Z49 A;  2D7R A;  3RTI B;  2ZR1 B;  1SZ6 B;  3BAQ A;  1AVW B;  4J2Y A;  4LO2 A;  2FDB M;  4I4V A;  1G9B A;  1ITB A;  3IM5 A;  1Z0H A;  4I8M A;  3I29 B;  4I4R A;  1ISY A;  3V0A A;  1V6X A;  3T8S A;  1OQL B;  2FFV A;  3FFZ A;  2MIB A;  1HIB A;  1BAR A;  4H75 A;  1IOB A;  3AH2 A;  1QQL A;  4QAL A;  3AKG A;  4XFU A;  4EB2 B;  3CRH A;  1S0C A;  5EC5 A;  1DLL A;  3AZV A;  3N7M A;  2Q9X A;  1RZO B;  3BX1 C;  1PWA A;  3FJC A;  1Q04 A;  2F2F A;  1BAS A;  4GOV A;  1G9D A;  3FJI A;  3BAV A;  1BA7 A;  3FUQ A;  3O49 A;  4LO0 A;  2BEA A;  1ONK B;  5BP5 A;  1M2T B;  3CQA A;  1PUU B;  3VT2 A;  2F8X C;  4F83 A;  4XFT A;  5BQU A;  5DZU A;  2D22 A;  3H6R B;  2E4M A;  3S8K A;  4J2X A;  2IWT B;  3OBR A;  3UD7 A;  1FN0 A;  1TOO A;  1S0B A;  1DZC A;  3S8J A;  2ESU A;  1PZZ A;  2X2S A;  3QR5 A;  2RST A;  4I4S A;  4GAF A;  2P23 A;  3WIN A;  3P6I A;  3UJ4 A;  1S0G A;  3CRG A;  1SR4 C;  4YOL A;  3FJJ A;  1ISX A;  3KMV A;  4J2K A;  3AH1 A;  3PUB A;  3FJ9 A;  41BI A;  1WD3 A;  4I4Y A;  1YTO A;  2D20 A;  1W3A A;  3H6R A;  4KBB A;  1JY0 A;  2Y9X E;  3OJ2 A;  2BEB A;  1BFG A;  1Q1U A;  3N7J A;  4IHZ A;  3FJB A;  4I2S A;  3FGM A;  4DEP A;  2GZB A;  5F90 A;  1G9A A;  4I96 A;  3A22 A;  2VXT I;  1V6U A;  3BA7 A;  1E0O A;  3R4S A;  3OGG A;  4H9W A;  4GP3 A;  1TFM B;  3LLP A;  4LO7 B;  3H6S E;  4I4O A;  4OWL A;  5D62 A;  4F34 A;  4WBC A;  1G82 A;  4X38 A;  2FGF A;  4HJJ A;  4LO1 C;  2P39 A;  4Q9P A;  4ZA3 B;  4EFQ A;  2ET2 A;  1S0E A;  2BFH A;  4II0 A;  1UPS A;  4LO7 C;  4JKQ A;  2AXM A;  4QBV A;  2HW9 A;  2KKI A;  4I7I A;  4AN7 B;  1V6W A;  1JLX A;  4I0Y A;  5DSS B;  3WMU A;  3CAH A;  2DRE A;  31BI A;  4ZFU B;  2Z48 A;  1DJS B;  3UJ0 A;  9ILB A;  1FV3 A;  2K4A B;  3K1X A;  8I1B A;  5JLV A;  1HCD A;  2ZQO A;  3LTQ A;  4LO2 C;  3AJ5 A;  5B2H A;  3N7L A;  3N0K A;  1NUN A;  1YF8 B;  4EFR A;  2MLL B;  3ZC8 A;  3O5W B;  2RG9 B;  4HR6 C;  3CA1 A;  1R8O A;  1S0D A;  4XFS A;  3OBT A;  4IY8 A;  4JRA A;  5BXS A;  1AFC A;  4JQ0 A;  3MAL A;  1EYL A;  4IYB A;  4G9N A;  1EVT A;  4PC4 A;  5HPZ A;  2ERM A;  3Q7Y A;  1DZD A;  3O4B A;  3JRR A;  2F2F C;  4ISR A;  3D7W B;  4X3A A;  4DCK C;  1N4K A;  3BA5 A;  3OJV A;  1AF9 A;  4D8H A;  5BP5 C;  4LO0 C;  4QO3 A;  4P0J A;  2ZQN A;  3AH4 A;  4EEE B;  3RMY A;  3W9T A;  3WO3 A;  4JP0 A;  1WD4 A;  4OUJ A;  5BQU C;  1V6V A;  2D1Z A;  4MZG B;  3I2A A;  4DEN A;  1IT0 A;  4I4Q A;  3N7K A;  3AKI A;  4JAW A;  2E4M C;  1ILR 1;  4ZGR B;  2M49 A;  1ABR B;  1JQZ A;  1W3G A;  1HWO B;  4QBC A;  1FMZ A;  1IJT A;  4JKX B;  4OW4 A;  3VT0 A;  1K5V A;  4LO3 A;  5E24 E;  3FJF A;  2XOA A;  1I1B A;  3HSM A;  3WIN C;  4USO A;  4USP A;  1AVA C;  1L2H A;  3BB2 A;  2NTD A;  4IZE A;  4JPZ A;  2D23 A;  2R9K B;  3A23 A;  1BFF A;  1RY7 A;  1PUM B;  2DRY A;  3F62 B;  3RSJ A;  1F31 A;  3O44 A;  4ZLB B;  3JUT A;  3OGF A;  3CA5 A;  3ZXD A;  1MC9 A;  5FZU A;  4A7K A;  4LO8 B;  2J3P A;  2Q3N B;  3NBE A;  3A07 A;  2YUG A;  2VXR A;  4OEF A;  5FNX A;  2WBC A;  21BI A;  1TWM A;  1FWU A;  3ILA A;  4MZF B;  1XG6 A;  3UD8 A;  4G6J A;  4FGF A;  3WMV A;  3P6J A;  5G00 A;  3ZXG A;  1WBC A;  3BRG C;  2DS0 A;  4R6U B;  3V0B B;  1FWV A;  4QC4 A;  5FZY A;  5BXP A;  2K8R A;  4D0T A;  4ZFY B;  2NZ9 A;  4D0Z A;  2VSE A;  3POK A;  2GO2 A;  1ISW A;  4OEG A;  3P53 A;  5EHA A;  2VSA A;  4ZFW B;  2NP0 A;  1M16 A;  1IRP A;  3NBD A;  1XYF A;  3BAD A;  1IHK A;  1S0L A;  3BA4 A;  3AKF A;  3CA4 A;  4OEE A;  5FNW A;  5GAQ A;  1K5U A;  4I4U A;  2D24 A;  4HA2 A;  4ISQ A;  2VU9 A;  1XHB A;  3UD9 A;  1AVX B;  3V0B A;  5EG6 C;  1TWE A;  4KC3 A;  3E8L C;  1TP0 A;  1VCL A;  5BVP I;  3BAU A;  1FV2 A;  3PHZ A;  5F8W A;  2D44 A;  4CJM A;  2K43 A;  1BLD A;  3IIR A;  5DUY A;  4Z9W B;  3FJH A;  4X39 A;  2FO1 A;  1J0S A;  4GP0 A;  1EPW A;  3IM6 A;  1QQK A;  1R8N A;  1BFB A;  3WO4 A;  1T9F A; 
#chains in the Genus database with same CATH homology
 4ZBV B;  2AQZ A;  1DFC A;  3FJD A;  1HWN B;  1Q03 A;  1Z4S A;  3VT1 A;  3BAO A;  4EKX B;  3O4A A;  3FJA A;  3VWC A;  1ISV A;  1WBA A;  5BOW A;  4EFP A;  2LIQ A;  4ZKT B;  2FFU A;  1YYN A;  3IM7 A;  2MC2 A;  2DRZ A;  2IHO A;  2NVH A;  1Z2V A;  4I6I A;  3V79 C;  3CU1 B;  3BAH A;  2QYI B;  5I1B A;  2NYY A;  4LO3 C;  5D61 A;  4P0L A;  3O4D A;  1CVS A;  1DQO A;  3VEQ A;  4ZOT A;  5F8Y A;  1YXW A;  4I3N A;  3TC2 A;  4IZX A;  3QYD A;  3F1R A;  4Q9G A;  4I1E A;  4Z8S B;  1HWP B;  1JLY A;  1MD6 A;  3AJ6 A;  1G9C A;  4G6M A;  1HCE A;  4J2S A;  5JMC A;  3PG0 A;  3BAG A;  4UY4 A;  5BXR A;  3OJM A;  3HMY A;  1JT7 A;  3RMX A;  3BTA A;  3C9Z A;  4A7Z A;  3B9U A;  4I4X A;  4H04 A;  4P6A A;  5F8S A;  3CA0 A;  3NBC A;  4FVV A;  1AVU A;  3PME A;  1IRA X;  3IAG C;  3UDA A;  1PC8 B;  1RML A;  2QN4 A;  5BXT A;  4AN6 A;  1AXM A;  3AZW A;  1BFC A;  1ISZ A;  3FJ8 A;  4KEI A;  2X2T A;  1TIE A;  2D7I A;  1P63 A;  4A7Y A;  2I1B A;  4G1R A;  4P0K A;  5DVH A;  2LIE A;  3FJE A;  2Y9F A;  3AKH A;  3FJK A;  4ION A;  3NBN A;  4I37 A;  3WA1 A;  2D43 A;  7I1B A;  1DQG A;  3VSZ A;  3Q7W A;  1T4Q A;  1FQ9 A;  3ZC9 A;  2NS2 A;  4Q91 A;  1JT5 A;  3VSF A;  3NJ5 A;  1JT3 A;  4QKR A;  1RG8 A;  3CA3 A;  4QKS A;  4I4P A;  3SNV A;  4IY9 A;  1JTC A;  3HBW A;  2AFG A;  3HAL A;  1S0F A;  5FZZ A;  3VUO A;  1TTU A;  3MPP G;  1CE7 B;  3O3Q A;  2KI6 B;  2L5X A;  5D63 A;  1GGP B;  4GOY A;  1FMM S;  4KEK A;  3CRI A;  3FUO A;  1DIW A;  1FGA A;  1EV2 A;  1JT4 A;  1A8D A;  3BRD A;  3R4U A;  2Y9G A;  3O4O A;  2WRY A;  1SR4 A;  1DFQ A;  1NZK A;  1XZZ A;  1QXM A;  4IQP A;  1KNM A;  3Q7X A;  2KLL A;  2VLC A;  1D0H A;  2HWA A;  1IIL A;  4L4H A;  2HZ9 A;  4I1B A;  3HN1 A;  1HWM B;  3A21 A;  3H6Q A;  4L4I A;  4TLP A;  2HWM A;  4J23 B;  2AAI B;  6I1B A;  4QD2 B;  3CA6 A;  3ZX7 A;  3WO2 A;  2VUA A;  1II4 A;  4MZH A;  3RTJ B;  3BRF A;  1W3F A;  2UUS A;  4LO1 A;  4QD2 C;  3V0A B;  2NM1 A;  4X37 A;  4OWJ A;  2RQ9 A;  1I1E A;  4OWK A;  4XKI A;  3EF2 A;  1BLA A;  4GAI A;  4G9M A;  2Y9W C;  3I2X A;  4END A;  2KI4 A;  1YBI A;  1HKN A;  3O4C A;  2KH2 A;  4KEJ A;  3HOM A;  2Z49 A;  2D7R A;  3RTI B;  2ZR1 B;  1SZ6 B;  3BAQ A;  1AVW B;  4J2Y A;  4LO2 A;  2FDB M;  4I4V A;  1G9B A;  1ITB A;  3IM5 A;  1Z0H A;  4I8M A;  3I29 B;  4I4R A;  1ISY A;  3V0A A;  1V6X A;  3T8S A;  1OQL B;  2FFV A;  3FFZ A;  2MIB A;  1HIB A;  1BAR A;  4H75 A;  1IOB A;  3AH2 A;  1QQL A;  4QAL A;  3AKG A;  4XFU A;  4EB2 B;  3CRH A;  1S0C A;  5EC5 A;  1DLL A;  3AZV A;  3N7M A;  2Q9X A;  1RZO B;  3BX1 C;  1PWA A;  3FJC A;  1Q04 A;  2F2F A;  1BAS A;  4GOV A;  1G9D A;  3FJI A;  3BAV A;  1BA7 A;  3FUQ A;  3O49 A;  4LO0 A;  2BEA A;  1ONK B;  5BP5 A;  1M2T B;  3CQA A;  1PUU B;  3VT2 A;  2F8X C;  4F83 A;  4XFT A;  5BQU A;  5DZU A;  2D22 A;  3H6R B;  2E4M A;  3S8K A;  4J2X A;  2IWT B;  3OBR A;  3UD7 A;  1FN0 A;  1TOO A;  1S0B A;  1DZC A;  3S8J A;  2ESU A;  1PZZ A;  2X2S A;  3QR5 A;  2RST A;  4I4S A;  4GAF A;  2P23 A;  3WIN A;  3P6I A;  3UJ4 A;  1S0G A;  3CRG A;  1SR4 C;  4YOL A;  3FJJ A;  1ISX A;  3KMV A;  4J2K A;  3AH1 A;  3PUB A;  3FJ9 A;  41BI A;  1WD3 A;  4I4Y A;  1YTO A;  2D20 A;  1W3A A;  3H6R A;  4KBB A;  1JY0 A;  2Y9X E;  3OJ2 A;  2BEB A;  1BFG A;  1Q1U A;  3N7J A;  4IHZ A;  3FJB A;  4I2S A;  3FGM A;  4DEP A;  2GZB A;  5F90 A;  1G9A A;  4I96 A;  3A22 A;  2VXT I;  1V6U A;  3BA7 A;  1E0O A;  3R4S A;  3OGG A;  4H9W A;  4GP3 A;  1TFM B;  3LLP A;  4LO7 B;  3H6S E;  4I4O A;  4OWL A;  5D62 A;  4F34 A;  4WBC A;  1G82 A;  4X38 A;  2FGF A;  4HJJ A;  4LO1 C;  2P39 A;  4Q9P A;  4ZA3 B;  4EFQ A;  2ET2 A;  1S0E A;  2BFH A;  4II0 A;  1UPS A;  4LO7 C;  4JKQ A;  2AXM A;  4QBV A;  2HW9 A;  2KKI A;  4I7I A;  4AN7 B;  1V6W A;  1JLX A;  4I0Y A;  5DSS B;  3WMU A;  3CAH A;  2DRE A;  31BI A;  4ZFU B;  2Z48 A;  1DJS B;  3UJ0 A;  9ILB A;  1FV3 A;  2K4A B;  3K1X A;  8I1B A;  5JLV A;  1HCD A;  2ZQO A;  3LTQ A;  4LO2 C;  3AJ5 A;  5B2H A;  3N7L A;  3N0K A;  1NUN A;  1YF8 B;  4EFR A;  2MLL B;  3ZC8 A;  3O5W B;  2RG9 B;  4HR6 C;  3CA1 A;  1R8O A;  1S0D A;  4XFS A;  3OBT A;  4IY8 A;  4JRA A;  5BXS A;  1AFC A;  4JQ0 A;  3MAL A;  1EYL A;  4IYB A;  4G9N A;  1EVT A;  4PC4 A;  5HPZ A;  2ERM A;  3Q7Y A;  1DZD A;  3O4B A;  3JRR A;  2F2F C;  4ISR A;  3D7W B;  4X3A A;  4DCK C;  1N4K A;  3BA5 A;  3OJV A;  1AF9 A;  4D8H A;  5BP5 C;  4LO0 C;  4QO3 A;  4P0J A;  2ZQN A;  3AH4 A;  4EEE B;  3RMY A;  3W9T A;  3WO3 A;  4JP0 A;  1WD4 A;  4OUJ A;  5BQU C;  1V6V A;  2D1Z A;  4MZG B;  3I2A A;  4DEN A;  1IT0 A;  4I4Q A;  3N7K A;  3AKI A;  4JAW A;  2E4M C;  1ILR 1;  4ZGR B;  2M49 A;  1ABR B;  1JQZ A;  1W3G A;  1HWO B;  4QBC A;  1FMZ A;  1IJT A;  4JKX B;  4OW4 A;  3VT0 A;  1K5V A;  4LO3 A;  5E24 E;  3FJF A;  2XOA A;  1I1B A;  3HSM A;  3WIN C;  4USO A;  4USP A;  1AVA C;  1L2H A;  3BB2 A;  2NTD A;  4IZE A;  4JPZ A;  2D23 A;  2R9K B;  3A23 A;  1BFF A;  1RY7 A;  1PUM B;  2DRY A;  3F62 B;  3RSJ A;  1F31 A;  3O44 A;  4ZLB B;  3JUT A;  3OGF A;  3CA5 A;  3ZXD A;  1MC9 A;  5FZU A;  4A7K A;  4LO8 B;  2J3P A;  2Q3N B;  3NBE A;  3A07 A;  2YUG A;  2VXR A;  4OEF A;  5FNX A;  2WBC A;  21BI A;  1TWM A;  1FWU A;  3ILA A;  4MZF B;  1XG6 A;  3UD8 A;  4G6J A;  4FGF A;  3WMV A;  3P6J A;  5G00 A;  3ZXG A;  1WBC A;  3BRG C;  2DS0 A;  4R6U B;  3V0B B;  1FWV A;  4QC4 A;  5FZY A;  5BXP A;  2K8R A;  4D0T A;  4ZFY B;  2NZ9 A;  4D0Z A;  2VSE A;  3POK A;  2GO2 A;  1ISW A;  4OEG A;  3P53 A;  5EHA A;  2VSA A;  4ZFW B;  2NP0 A;  1M16 A;  1IRP A;  3NBD A;  1XYF A;  3BAD A;  1IHK A;  1S0L A;  3BA4 A;  3AKF A;  3CA4 A;  4OEE A;  5FNW A;  5GAQ A;  1K5U A;  4I4U A;  2D24 A;  4HA2 A;  4ISQ A;  2VU9 A;  1XHB A;  3UD9 A;  1AVX B;  3V0B A;  5EG6 C;  1TWE A;  4KC3 A;  3E8L C;  1TP0 A;  1VCL A;  5BVP I;  3BAU A;  1FV2 A;  3PHZ A;  5F8W A;  2D44 A;  4CJM A;  2K43 A;  1BLD A;  3IIR A;  5DUY A;  4Z9W B;  3FJH A;  4X39 A;  2FO1 A;  1J0S A;  4GP0 A;  1EPW A;  3IM6 A;  1QQK A;  1R8N A;  1BFB A;  3WO4 A;  1T9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...