4JPZA

Voltage-gated sodium channel 1.2 c-terminal domain in complex with fgf13u and ca2+/calmodulin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
148
Chain Sequence
b'PQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 13
publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 29
structure length 148
sequence length 148
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4jpzA00
5BQUA 4XFTA 1ITBA 4A7KA 4I0YA 4QD2B 5JLVA 3CRHA 2DRZA 3BB2A 3AH1A 3AJ6A 5EHAA 3O49A 1DQGA 4QKRA 3CAHA 3O4AA 5JMCA 3FJ9A 1ISVA 3FJHA 1I1BA 3VEQA 1CE7B 2KH2A 2Z48A 1DQOA 4F34A 4JKQA 2NVHA 4R6UB 2Q9XA 2HWAA 1MC9A 5BXTA 3HN1A 1JQZA 3BRFA 5BQUC 5GAQA 6I1BA 4P0LA 3BTAA 2RG9B 3CA3A 3VUOA 4XFSA 1XG6A 3ZC8A 2E4MA 4ZFYB 4IY9A 4F83A 4HA2A 2VSAA 2VXTI 3A07A 1RZOB 1YBIA 2VXRA 4QD2C 4Q9GA 1KNMA 3NBDA 1PC8B 5EG6C 2RSTA 5FNXA 4I4QA 1JT3A 1Q1UA 1TIEA 3UD8A 4HJJA 2ESUA 2FFVA 1I1EA 1FN0A 1XZZA 2MC2A 2UUSA 3ZXDA 1W3FA 1TOOA 1Z4SA 5D61A 3WA1A 1S0CA 1BFFA 2E4MC 4FVVA 1IOBA 3LLPA 1SR4A 3H6SE 3VT1A 3N7KA 1FWVA 1ABRB 3R4UA 3IAGC 3O4DA 3NBCA 3POKA 1SZ6B 3WMUA 1TWMA 1WD3A 2Y9WC 4I2SA 3UJ0A 1P63A 1W3GA 3Q7YA 4IHZA 3HOMA 2AAIB 3MPPG 1DFCA 1DLLA 2X2TA 3N7JA 1WBAA 1RMLA 2KI4A 3O4BA 1FQ9A 4EEEB 3PHZA 2D24A 1DZCA 3K1XA 1D0HA 2LIEA 4JP0A 1ISXA 1N4KA 3IM6A 3AJ5A 1SR4C 3ZX7A 3RSJA 1JT4A 3E8LC 3FJKA 2P23A 4OW4A 3AZWA 1AFCA 3PMEA 4QBVA 1ONKB 2VLCA 3CU1B 4GOYA 2R9KB 3BA7A 4I1EA 3Q7WA 4JQ0A 2LIQA 4ZKTB 2QN4A 4EFQA 1EPWA 4ZBVB 1JLYA 1PZZA 4J23B 4I4UA 1K5VA 4II0A 4I7IA 4QO3A 3H6RB 4J2YA 1AF9A 5DVHA 4I1BA 2VSEA 5BP5A 4GP3A 4EFRA 2D20A 3H6RA 3Q7XA 4I37A 3CA5A 4HR6C 2ERMA 3C9ZA 4QC4A 1J0SA 1HCDA 1VCLA 1HIBA 4X39A 1TWEA 3SNVA 4OWLA 3A23A 3UJ4A 3KMVA 3AH2A 1AVAC 4Q91A 1RY7A 2ET2A 2MIBA 3H6QA 2VUAA 3FFZA 1ILR1 5BP5C 4G9NA 1BFCA 1S0BA 4OUJA 2Y9XE 3I2AA 4KEIA 2I1BA 3FJFA 3UD9A 3BX1C 3BADA 1EV2A 4YOLA 3A21A 4GOVA 1HKNA 2XOAA 1G9CA 4KC3A 1FMZA 3MALA 2IHOA 3RTIB 3BAHA 3BAOA 1BFGA 2FFUA 1YF8B 4J2KA 1II4A 2Z49A 3NBEA 4LO3A 1YTOA 3UD7A 1DZDA 3FJBA 4ZFUB 4PC4A 2KI6B 5F8SA 1W3AA 3S8KA 4I3NA 4EB2B 1GGPB 3W9TA 2K8RA 1QXMA 1G9DA 4D0ZA 4X3AA 4QKSA 2DRYA 1NUNA 1TFMB 1HWPB 4ZOTA 3RMXA 1F31A 3S8JA 4AN6A 1Z2VA 4I4OA 1V6XA 5BXPA 1XYFA 4G9MA 2D22A 1ISYA 2BEAA 2ZQNA 4IZEA 1YYNA 4I8MA 4LO3C 4A7ZA 3V0BB 1HCEA 3BRGC 3FJAA 3WO2A 3CRGA 1S0LA 4TLPA 3TC2A 1DJSB 3AKIA 4I4VA 2NYYA 1AVUA 2YUGA 4XFUA 3V0BA 4USOA 1IRAX 3FJIA 4IQPA 2HZ9A 5BXSA 4A7YA 4D0TA 1AXMA 1TP0A 3FJCA 4Z9WB 4JAWA 4LO7B 2D43A 5F8YA 3HMYA 3FJDA 1RG8A 4JRAA 1M16A 2D7IA 4L4HA 4I4PA 2HW9A 1FWUA 3T8SA 1QQKA 2X2SA 4OEFA 2D23A 3WMVA 2F2FA 2F8XC 3AH4A 3ZXGA 4IY8A 5FZUA 3CA6A 4QALA 2D44A 2Y9GA 1QQLA 4H04A 4OWJA 5E24E 4I4SA 3F62B 3N7MA 3BA5A 1OQLB 1BA7A 2RQ9A 3BAGA 1Q04A 3O5WB 2QYIB 3CQAA 3VT2A 2KLLA 3HSMA 5DUYA 3V79C 3CA1A 1S0DA 5FZYA 3AZVA 3ILAA 5DZUA 4ZFWB 4LO0A 2IWTB 4GP0A 4I96A 3WO4A 3BAUA 3CA0A 1NZKA 2F2FC 3OGGA 4Z8SB 4D8HA 1V6VA 2NM1A 3PG0A 3O4OA 2BEBA 3OJMA 4LO2A 4I6IA 1JTCA 41BIA 1JT7A 2BFHA 5FZZA 4P6AA 3FJEA 1R8NA 2FGFA 31BIA 1DFQA 4KEJA 5F8WA 1V6UA 3OJVA 4G6JA 4LO0C 4ZA3B 1Q03A 4XKIA 1EVTA 1Z0HA 7I1BA 3FUOA 1ISZA 3JUTA 1MD6A 3ZC9A 4KBBA 4GAIA 1BLAA 1FMMS 2WRYA 2K43A 2Q3NB 4IONA 4DENA 2AQZA 1G9AA 4JKXB 4LO2C 4I4XA 1BARA 1YXWA 3IM5A 2FDBM 4GAFA 4J2XA 4EKXB 3RTJB 5I1BA 3CA4A 4AN7B 2KKIA 4JPZA 2DREA 3R4SA 2J3PA 1BFBA 1PUMB 4I4YA 3VSZA 3A22A 3CRIA 1IILA 9ILBA 3RMYA 5BVPI 2FO1A 3UDAA 3IIRA 2D7RA 1PWAA 3N0KA 2ZR1B 3FUQA 2P39A 4I4RA 3P6IA 3LTQA 4X37A 1HWOB 2NTDA 2MLLB 2WBCA 1EYLA 3AKHA 3NJ5A 1AVWB 3D7WB 4ENDA 1JT5A 1K5UA 3N7LA 5BOWA 3BRDA 4H9WA 1FV3A 4L4IA 4USPA 5B2HA 3JRRA 1JY0A 2GO2A 3I29B 4CJMA 1PUUB 1IRPA 1UPSA 3O3QA 2NP0A 2HWMA 3P6JA 4OEGA 3FJJA 3BAVA 3QYDA 1BLDA 1WBCA 3AKGA 4DCKC 4ISQA 3V0AB 3QR5A 4X38A 3HBWA 1R8OA 3IM7A 2AXMA 3O4CA 5F90A 3HALA 3VWCA 1G82A 5D62A 1CVSA 2L5XA 3OBRA 1DIWA 1AVXB 3P53A 4P0JA 5HPZA 3V0AA 1V6WA 3AKFA 3VSFA 1S0GA 5G00A 1JLXA 3OBTA 1IT0A 1WD4A 3WINA 1XHBA 1G9BA 21BIA 4LO8B 4OWKA 4ZLBB 3BAQA 4EFPA 1FGAA 3FJ8A 1FV2A 4ISRA 3O44A 3B9UA 8I1BA 1L2HA 5DSSB 1IJTA 4QBCA 5BXRA 4J2SA 3WO3A 1E0OA 1IHKA 1BASA 4P0KA 1T9FA 4ZGRB 3NBNA 3EF2A 1A8DA 3F1RA 3OGFA 2K4AB 4LO1A 4Q9PA 4IZXA 2GZBA 1S0FA 2D1ZA 2AFGA 3OJ2A 4OEEA 3WINC 4DEPA 3BA4A 1HWMB 2ZQOA 2M49A 1HWNB 3I2XA 5FNWA 3VT0A 4FGFA 1T4QA 1M2TB 2DS0A 1TTUA 1S0EA 3PUBA 4LO7C 4G1RA 2Y9FA 4KEKA 1ISWA 4G6MA 5D63A 2NZ9A 5EC5A 2VU9A 4IYBA 4LO1C 3FGMA 4WBCA
chains in the Genus database with same CATH superfamily
5BQUA 4XFTA 1ITBA 4A7KA 4I0YA 4QD2B 5JLVA 3CRHA 2DRZA 3BB2A 3AH1A 3AJ6A 5EHAA 3O49A 1DQGA 4QKRA 3CAHA 3O4AA 5JMCA 3FJ9A 1ISVA 3FJHA 1I1BA 3VEQA 1CE7B 2KH2A 2Z48A 1DQOA 4F34A 4JKQA 2NVHA 4R6UB 2Q9XA 2HWAA 1MC9A 5BXTA 3HN1A 1JQZA 3BRFA 5BQUC 5GAQA 6I1BA 4P0LA 3BTAA 2RG9B 3CA3A 3VUOA 4XFSA 4UY4A 1XG6A 3ZC8A 2E4MA 4ZFYB 4IY9A 4F83A 4HA2A 2VSAA 2VXTI 3A07A 1RZOB 1YBIA 2VXRA 4QD2C 4Q9GA 1KNMA 3NBDA 1PC8B 5EG6C 2RSTA 5FNXA 4I4QA 1JT3A 1Q1UA 1TIEA 3UD8A 4HJJA 2ESUA 2FFVA 1I1EA 1FN0A 1XZZA 2MC2A 2UUSA 3ZXDA 1W3FA 1TOOA 1Z4SA 5D61A 3WA1A 1S0CA 1BFFA 2E4MC 4FVVA 4MZHA 1IOBA 3LLPA 1SR4A 3H6SE 3VT1A 3N7KA 1FWVA 1ABRB 3R4UA 3IAGC 3O4DA 3NBCA 3POKA 1SZ6B 3WMUA 1TWMA 1WD3A 2Y9WC 4I2SA 3UJ0A 1P63A 1W3GA 3Q7YA 4IHZA 3HOMA 2AAIB 3MPPG 1DFCA 1DLLA 2X2TA 3N7JA 4H75A 1WBAA 1RMLA 2KI4A 3O4BA 1FQ9A 4EEEB 3PHZA 2D24A 1DZCA 3K1XA 1D0HA 2LIEA 4JP0A 1ISXA 1N4KA 3IM6A 3AJ5A 1SR4C 3ZX7A 3RSJA 1JT4A 3E8LC 3FJKA 2P23A 4OW4A 3AZWA 1AFCA 3PMEA 4QBVA 1ONKB 2VLCA 3CU1B 4GOYA 2R9KB 3BA7A 4I1EA 3Q7WA 4JQ0A 2LIQA 4ZKTB 2QN4A 4EFQA 1EPWA 4ZBVB 1JLYA 1PZZA 4J23B 4I4UA 1K5VA 4II0A 4I7IA 4QO3A 3H6RB 4J2YA 1AF9A 5DVHA 4I1BA 2VSEA 5BP5A 4GP3A 4EFRA 2D20A 3H6RA 3Q7XA 4I37A 3CA5A 4HR6C 2ERMA 3C9ZA 4QC4A 1J0SA 1HCDA 1VCLA 1HIBA 4X39A 1TWEA 3SNVA 4OWLA 3A23A 3UJ4A 3KMVA 3AH2A 1AVAC 4Q91A 1RY7A 2ET2A 2MIBA 3H6QA 2VUAA 3FFZA 1ILR1 5BP5C 4G9NA 1BFCA 1S0BA 4OUJA 2Y9XE 3I2AA 4KEIA 2I1BA 3FJFA 3UD9A 3BX1C 3BADA 1EV2A 4YOLA 3A21A 4GOVA 1HKNA 2XOAA 1G9CA 4KC3A 1FMZA 3MALA 2IHOA 3RTIB 3BAHA 3BAOA 1BFGA 2FFUA 1YF8B 4J2KA 1II4A 2Z49A 3NBEA 4LO3A 1YTOA 3UD7A 1DZDA 3FJBA 4ZFUB 4PC4A 2KI6B 5F8SA 1W3AA 3S8KA 4I3NA 4EB2B 1GGPB 3W9TA 2K8RA 1QXMA 1G9DA 4D0ZA 4X3AA 4QKSA 2DRYA 1NUNA 1TFMB 1HWPB 4ZOTA 3RMXA 1F31A 3S8JA 4AN6A 1Z2VA 4I4OA 1V6XA 5BXPA 1XYFA 4G9MA 2D22A 1ISYA 2BEAA 2ZQNA 4IZEA 1YYNA 4I8MA 4LO3C 4A7ZA 3V0BB 1HCEA 3BRGC 3FJAA 3WO2A 3CRGA 1S0LA 4TLPA 3TC2A 1DJSB 3AKIA 4I4VA 2NYYA 4MZFB 1AVUA 2YUGA 4XFUA 3V0BA 4USOA 1IRAX 3FJIA 4IQPA 2HZ9A 5BXSA 4A7YA 4D0TA 1AXMA 1TP0A 3FJCA 4Z9WB 2NS2A 4JAWA 4LO7B 2D43A 5F8YA 3HMYA 3FJDA 1RG8A 4JRAA 1M16A 2D7IA 4L4HA 4I4PA 2HW9A 1FWUA 3T8SA 1QQKA 2X2SA 4OEFA 2D23A 3WMVA 2F2FA 2F8XC 3AH4A 3ZXGA 4IY8A 5FZUA 3CA6A 4QALA 2D44A 2Y9GA 1QQLA 4H04A 4OWJA 5E24E 4I4SA 3F62B 3N7MA 3BA5A 1OQLB 1BA7A 2RQ9A 3BAGA 1Q04A 3O5WB 2QYIB 3CQAA 3VT2A 2KLLA 3HSMA 5DUYA 3V79C 3CA1A 1S0DA 5FZYA 3AZVA 3ILAA 5DZUA 4ZFWB 4LO0A 2IWTB 4GP0A 4I96A 3WO4A 3BAUA 3CA0A 1NZKA 2F2FC 3OGGA 4Z8SB 4D8HA 1V6VA 2NM1A 3PG0A 3O4OA 2BEBA 3OJMA 4LO2A 4I6IA 1JTCA 41BIA 1JT7A 2BFHA 5FZZA 4P6AA 3FJEA 1R8NA 2FGFA 31BIA 1DFQA 4KEJA 5F8WA 1V6UA 3OJVA 4G6JA 4LO0C 4ZA3B 1Q03A 4XKIA 1EVTA 1Z0HA 4MZGB 7I1BA 3FUOA 1ISZA 3JUTA 1MD6A 3ZC9A 4KBBA 4GAIA 1BLAA 1FMMS 2WRYA 2K43A 2Q3NB 4IONA 4DENA 2AQZA 1G9AA 4JKXB 4LO2C 4I4XA 1BARA 1YXWA 3IM5A 2FDBM 4GAFA 4J2XA 4EKXB 3RTJB 5I1BA 3CA4A 4AN7B 2KKIA 4JPZA 2DREA 3R4SA 2J3PA 1BFBA 1PUMB 4I4YA 3VSZA 3A22A 3CRIA 1IILA 9ILBA 3RMYA 5BVPI 2FO1A 3UDAA 3IIRA 2D7RA 1PWAA 3N0KA 2ZR1B 3FUQA 2P39A 4I4RA 3P6IA 3LTQA 4X37A 1HWOB 2NTDA 2MLLB 2WBCA 1EYLA 3AKHA 3NJ5A 1AVWB 3D7WB 4ENDA 1JT5A 1K5UA 3N7LA 5BOWA 3BRDA 4H9WA 1FV3A 4L4IA 4USPA 5B2HA 3JRRA 1JY0A 2GO2A 3I29B 4CJMA 1PUUB 1IRPA 1UPSA 3O3QA 2NP0A 2HWMA 3P6JA 4OEGA 3FJJA 3BAVA 3QYDA 1BLDA 1WBCA 3AKGA 4DCKC 4ISQA 3V0AB 3QR5A 4X38A 3HBWA 1R8OA 3IM7A 2AXMA 3O4CA 5F90A 3HALA 3VWCA 1G82A 5D62A 1CVSA 2L5XA 3OBRA 1DIWA 1AVXB 3P53A 4P0JA 5HPZA 3V0AA 1V6WA 3AKFA 3VSFA 1S0GA 5G00A 1JLXA 3OBTA 1IT0A 1WD4A 3WINA 1XHBA 1G9BA 21BIA 4LO8B 4OWKA 4ZLBB 3BAQA 4EFPA 1FGAA 3FJ8A 1FV2A 4ISRA 3O44A 3B9UA 8I1BA 1L2HA 5DSSB 1IJTA 4QBCA 5BXRA 4J2SA 3WO3A 1E0OA 1IHKA 1BASA 4P0KA 1T9FA 4ZGRB 3NBNA 3EF2A 1A8DA 3F1RA 3OGFA 2K4AB 4LO1A 4Q9PA 4IZXA 2GZBA 1S0FA 2D1ZA 2AFGA 3OJ2A 4OEEA 3WINC 4DEPA 3BA4A 1HWMB 2ZQOA 2M49A 1HWNB 3I2XA 5FNWA 3VT0A 4FGFA 1T4QA 1M2TB 2DS0A 1TTUA 1S0EA 3PUBA 4LO7C 4G1RA 2Y9FA 4KEKA 1ISWA 4G6MA 5D63A 2NZ9A 5EC5A 2VU9A 4IYBA 4LO1C 3FGMA 4WBCA
chains in the Genus database with same CATH topology
5BQUA 4XFTA 1ITBA 4A7KA 4I0YA 4QD2B 5JLVA 3CRHA 2DRZA 3BB2A 3AH1A 3AJ6A 5EHAA 3O49A 1DQGA 4QKRA 3CAHA 3O4AA 5JMCA 3FJ9A 1ISVA 3FJHA 1I1BA 3VEQA 1CE7B 2KH2A 2Z48A 1DQOA 4F34A 4JKQA 2NVHA 4R6UB 2Q9XA 2HWAA 1MC9A 5BXTA 3HN1A 1JQZA 3BRFA 5BQUC 5GAQA 6I1BA 4P0LA 3BTAA 2RG9B 3CA3A 3VUOA 4XFSA 4UY4A 1XG6A 3ZC8A 2E4MA 4ZFYB 4IY9A 4F83A 4HA2A 2VSAA 2VXTI 3A07A 1RZOB 1YBIA 2VXRA 4QD2C 4Q9GA 1KNMA 3NBDA 1PC8B 5EG6C 2RSTA 5FNXA 4I4QA 1JT3A 1Q1UA 1TIEA 3UD8A 4HJJA 2ESUA 2FFVA 1I1EA 1FN0A 1XZZA 2MC2A 2UUSA 3ZXDA 1W3FA 1TOOA 1Z4SA 5D61A 3WA1A 1S0CA 1BFFA 2E4MC 4FVVA 4MZHA 1IOBA 3LLPA 1SR4A 3H6SE 3VT1A 3N7KA 1FWVA 1ABRB 3R4UA 3IAGC 3O4DA 3NBCA 3POKA 1SZ6B 3WMUA 1TWMA 1WD3A 2Y9WC 4I2SA 3UJ0A 1P63A 1W3GA 3Q7YA 4IHZA 3HOMA 2AAIB 3MPPG 1DFCA 1DLLA 2X2TA 3N7JA 4H75A 1WBAA 1RMLA 2KI4A 3O4BA 1FQ9A 4EEEB 3PHZA 2D24A 1DZCA 3K1XA 1D0HA 2LIEA 4JP0A 1ISXA 1N4KA 3IM6A 3AJ5A 1SR4C 3ZX7A 3RSJA 1JT4A 3E8LC 3FJKA 2P23A 4OW4A 3AZWA 1AFCA 3PMEA 4QBVA 1ONKB 2VLCA 3CU1B 4GOYA 2R9KB 3BA7A 4I1EA 3Q7WA 4JQ0A 2LIQA 4ZKTB 2QN4A 4EFQA 1EPWA 4ZBVB 1JLYA 1PZZA 4J23B 4I4UA 1K5VA 4II0A 4I7IA 4QO3A 3H6RB 4J2YA 1AF9A 5DVHA 4I1BA 2VSEA 5BP5A 4GP3A 4EFRA 2D20A 3H6RA 3Q7XA 4I37A 3CA5A 4HR6C 2ERMA 3C9ZA 4QC4A 1J0SA 1HCDA 1VCLA 1HIBA 4X39A 1TWEA 3SNVA 4OWLA 3A23A 3UJ4A 3KMVA 3AH2A 1AVAC 4Q91A 1RY7A 2ET2A 2MIBA 3H6QA 2VUAA 3FFZA 1ILR1 5BP5C 4G9NA 1BFCA 1S0BA 4OUJA 2Y9XE 3I2AA 4KEIA 2I1BA 3FJFA 3UD9A 3BX1C 3BADA 1EV2A 4YOLA 3A21A 4GOVA 1HKNA 2XOAA 1G9CA 4KC3A 1FMZA 3MALA 2IHOA 3RTIB 3BAHA 3BAOA 1BFGA 2FFUA 1YF8B 4J2KA 1II4A 2Z49A 3NBEA 4LO3A 1YTOA 3UD7A 1DZDA 3FJBA 4ZFUB 4PC4A 2KI6B 5F8SA 1W3AA 3S8KA 4I3NA 4EB2B 1GGPB 3W9TA 2K8RA 1QXMA 1G9DA 4D0ZA 4X3AA 4QKSA 2DRYA 1NUNA 1TFMB 1HWPB 4ZOTA 3RMXA 1F31A 3S8JA 4AN6A 1Z2VA 4I4OA 1V6XA 5BXPA 1XYFA 4G9MA 2D22A 1ISYA 2BEAA 2ZQNA 4IZEA 1YYNA 4I8MA 4LO3C 4A7ZA 3V0BB 1HCEA 3BRGC 3FJAA 3WO2A 3CRGA 1S0LA 4TLPA 3TC2A 1DJSB 3AKIA 4I4VA 2NYYA 4MZFB 1AVUA 2YUGA 4XFUA 3V0BA 4USOA 1IRAX 3FJIA 4IQPA 2HZ9A 5BXSA 4A7YA 4D0TA 1AXMA 1TP0A 3FJCA 4Z9WB 2NS2A 4JAWA 4LO7B 2D43A 5F8YA 3HMYA 3FJDA 1RG8A 4JRAA 1M16A 2D7IA 4L4HA 4I4PA 2HW9A 1FWUA 3T8SA 1QQKA 2X2SA 4OEFA 2D23A 3WMVA 2F2FA 2F8XC 3AH4A 3ZXGA 4IY8A 5FZUA 3CA6A 4QALA 2D44A 2Y9GA 1QQLA 4H04A 4OWJA 5E24E 4I4SA 3F62B 3N7MA 3BA5A 1OQLB 1BA7A 2RQ9A 3BAGA 1Q04A 3O5WB 2QYIB 3CQAA 3VT2A 2KLLA 3HSMA 5DUYA 3V79C 3CA1A 1S0DA 5FZYA 3AZVA 3ILAA 5DZUA 4ZFWB 4LO0A 2IWTB 4GP0A 4I96A 3WO4A 3BAUA 3CA0A 1NZKA 2F2FC 3OGGA 4Z8SB 4D8HA 1V6VA 2NM1A 3PG0A 3O4OA 2BEBA 3OJMA 4LO2A 4I6IA 1JTCA 41BIA 1JT7A 2BFHA 5FZZA 4P6AA 3FJEA 1R8NA 2FGFA 31BIA 1DFQA 4KEJA 5F8WA 1V6UA 3OJVA 4G6JA 4LO0C 4ZA3B 1Q03A 4XKIA 1EVTA 1Z0HA 4MZGB 7I1BA 3FUOA 1ISZA 3JUTA 1MD6A 3ZC9A 4KBBA 4GAIA 1BLAA 1FMMS 2WRYA 2K43A 2Q3NB 4IONA 4DENA 2AQZA 1G9AA 4JKXB 4LO2C 4I4XA 1BARA 1YXWA 3IM5A 2FDBM 4GAFA 4J2XA 4EKXB 3RTJB 5I1BA 3CA4A 4AN7B 2KKIA 4JPZA 2DREA 3R4SA 2J3PA 1BFBA 1PUMB 4I4YA 3VSZA 3A22A 3CRIA 1IILA 9ILBA 3RMYA 5BVPI 2FO1A 3UDAA 3IIRA 2D7RA 1PWAA 3N0KA 2ZR1B 3FUQA 2P39A 4I4RA 3P6IA 3LTQA 4X37A 1HWOB 2NTDA 2MLLB 2WBCA 1EYLA 3AKHA 3NJ5A 1AVWB 3D7WB 4ENDA 1JT5A 1K5UA 3N7LA 5BOWA 3BRDA 4H9WA 1FV3A 4L4IA 4USPA 5B2HA 3JRRA 1JY0A 2GO2A 3I29B 4CJMA 1PUUB 1IRPA 1UPSA 3O3QA 2NP0A 2HWMA 3P6JA 4OEGA 3FJJA 3BAVA 3QYDA 1BLDA 1WBCA 3AKGA 4DCKC 4ISQA 3V0AB 3QR5A 4X38A 3HBWA 1R8OA 3IM7A 2AXMA 3O4CA 5F90A 3HALA 3VWCA 1G82A 5D62A 1CVSA 2L5XA 3OBRA 1DIWA 1AVXB 3P53A 4P0JA 5HPZA 3V0AA 1V6WA 3AKFA 3VSFA 1S0GA 5G00A 1JLXA 3OBTA 1IT0A 1WD4A 3WINA 1XHBA 1G9BA 21BIA 4LO8B 4OWKA 4ZLBB 3BAQA 4EFPA 1FGAA 3FJ8A 1FV2A 4ISRA 3O44A 3B9UA 8I1BA 1L2HA 5DSSB 1IJTA 4QBCA 5BXRA 4J2SA 3WO3A 1E0OA 1IHKA 1BASA 4P0KA 1T9FA 4ZGRB 3NBNA 3EF2A 1A8DA 3F1RA 3OGFA 2K4AB 4LO1A 4Q9PA 4IZXA 2GZBA 1S0FA 2D1ZA 2AFGA 3OJ2A 4OEEA 3WINC 4DEPA 3BA4A 1HWMB 2ZQOA 2M49A 1HWNB 3I2XA 5FNWA 3VT0A 4FGFA 1T4QA 1M2TB 2DS0A 1TTUA 1S0EA 3PUBA 4LO7C 4G1RA 2Y9FA 4KEKA 1ISWA 4G6MA 5D63A 2NZ9A 5EC5A 2VU9A 4IYBA 4LO1C 3FGMA 4WBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQU A;  4XFT A;  1ITB A;  4A7K A;  4I0Y A;  4QD2 B;  5JLV A;  3CRH A;  2DRZ A;  3BB2 A;  3AH1 A;  3AJ6 A;  5EHA A;  3O49 A;  1DQG A;  4QKR A;  3CAH A;  3O4A A;  5JMC A;  3FJ9 A;  1ISV A;  3FJH A;  1I1B A;  3VEQ A;  1CE7 B;  2KH2 A;  2Z48 A;  1DQO A;  4F34 A;  4JKQ A;  2NVH A;  4R6U B;  2Q9X A;  2HWA A;  1MC9 A;  5BXT A;  3HN1 A;  1JQZ A;  3BRF A;  5BQU C;  5GAQ A;  6I1B A;  4P0L A;  3BTA A;  2RG9 B;  3CA3 A;  3VUO A;  4XFS A;  1XG6 A;  3ZC8 A;  2E4M A;  4ZFY B;  4IY9 A;  4F83 A;  4HA2 A;  2VSA A;  2VXT I;  3A07 A;  1RZO B;  1YBI A;  2VXR A;  4QD2 C;  4Q9G A;  1KNM A;  3NBD A;  1PC8 B;  5EG6 C;  2RST A;  5FNX A;  4I4Q A;  1JT3 A;  1Q1U A;  1TIE A;  3UD8 A;  4HJJ A;  2ESU A;  2FFV A;  1I1E A;  1FN0 A;  1XZZ A;  2MC2 A;  2UUS A;  3ZXD A;  1W3F A;  1TOO A;  1Z4S A;  5D61 A;  3WA1 A;  1S0C A;  1BFF A;  2E4M C;  4FVV A;  1IOB A;  3LLP A;  1SR4 A;  3H6S E;  3VT1 A;  3N7K A;  1FWV A;  1ABR B;  3R4U A;  3IAG C;  3O4D A;  3NBC A;  3POK A;  1SZ6 B;  3WMU A;  1TWM A;  1WD3 A;  2Y9W C;  4I2S A;  3UJ0 A;  1P63 A;  1W3G A;  3Q7Y A;  4IHZ A;  3HOM A;  2AAI B;  3MPP G;  1DFC A;  1DLL A;  2X2T A;  3N7J A;  1WBA A;  1RML A;  2KI4 A;  3O4B A;  1FQ9 A;  4EEE B;  3PHZ A;  2D24 A;  1DZC A;  3K1X A;  1D0H A;  2LIE A;  4JP0 A;  1ISX A;  1N4K A;  3IM6 A;  3AJ5 A;  1SR4 C;  3ZX7 A;  3RSJ A;  1JT4 A;  3E8L C;  3FJK A;  2P23 A;  4OW4 A;  3AZW A;  1AFC A;  3PME A;  4QBV A;  1ONK B;  2VLC A;  3CU1 B;  4GOY A;  2R9K B;  3BA7 A;  4I1E A;  3Q7W A;  4JQ0 A;  2LIQ A;  4ZKT B;  2QN4 A;  4EFQ A;  1EPW A;  4ZBV B;  1JLY A;  1PZZ A;  4J23 B;  4I4U A;  1K5V A;  4II0 A;  4I7I A;  4QO3 A;  3H6R B;  4J2Y A;  1AF9 A;  5DVH A;  4I1B A;  2VSE A;  5BP5 A;  4GP3 A;  4EFR A;  2D20 A;  3H6R A;  3Q7X A;  4I37 A;  3CA5 A;  4HR6 C;  2ERM A;  3C9Z A;  4QC4 A;  1J0S A;  1HCD A;  1VCL A;  1HIB A;  4X39 A;  1TWE A;  3SNV A;  4OWL A;  3A23 A;  3UJ4 A;  3KMV A;  3AH2 A;  1AVA C;  4Q91 A;  1RY7 A;  2ET2 A;  2MIB A;  3H6Q A;  2VUA A;  3FFZ A;  1ILR 1;  5BP5 C;  4G9N A;  1BFC A;  1S0B A;  4OUJ A;  2Y9X E;  3I2A A;  4KEI A;  2I1B A;  3FJF A;  3UD9 A;  3BX1 C;  3BAD A;  1EV2 A;  4YOL A;  3A21 A;  4GOV A;  1HKN A;  2XOA A;  1G9C A;  4KC3 A;  1FMZ A;  3MAL A;  2IHO A;  3RTI B;  3BAH A;  3BAO A;  1BFG A;  2FFU A;  1YF8 B;  4J2K A;  1II4 A;  2Z49 A;  3NBE A;  4LO3 A;  1YTO A;  3UD7 A;  1DZD A;  3FJB A;  4ZFU B;  4PC4 A;  2KI6 B;  5F8S A;  1W3A A;  3S8K A;  4I3N A;  4EB2 B;  1GGP B;  3W9T A;  2K8R A;  1QXM A;  1G9D A;  4D0Z A;  4X3A A;  4QKS A;  2DRY A;  1NUN A;  1TFM B;  1HWP B;  4ZOT A;  3RMX A;  1F31 A;  3S8J A;  4AN6 A;  1Z2V A;  4I4O A;  1V6X A;  5BXP A;  1XYF A;  4G9M A;  2D22 A;  1ISY A;  2BEA A;  2ZQN A;  4IZE A;  1YYN A;  4I8M A;  4LO3 C;  4A7Z A;  3V0B B;  1HCE A;  3BRG C;  3FJA A;  3WO2 A;  3CRG A;  1S0L A;  4TLP A;  3TC2 A;  1DJS B;  3AKI A;  4I4V A;  2NYY A;  1AVU A;  2YUG A;  4XFU A;  3V0B A;  4USO A;  1IRA X;  3FJI A;  4IQP A;  2HZ9 A;  5BXS A;  4A7Y A;  4D0T A;  1AXM A;  1TP0 A;  3FJC A;  4Z9W B;  4JAW A;  4LO7 B;  2D43 A;  5F8Y A;  3HMY A;  3FJD A;  1RG8 A;  4JRA A;  1M16 A;  2D7I A;  4L4H A;  4I4P A;  2HW9 A;  1FWU A;  3T8S A;  1QQK A;  2X2S A;  4OEF A;  2D23 A;  3WMV A;  2F2F A;  2F8X C;  3AH4 A;  3ZXG A;  4IY8 A;  5FZU A;  3CA6 A;  4QAL A;  2D44 A;  2Y9G A;  1QQL A;  4H04 A;  4OWJ A;  5E24 E;  4I4S A;  3F62 B;  3N7M A;  3BA5 A;  1OQL B;  1BA7 A;  2RQ9 A;  3BAG A;  1Q04 A;  3O5W B;  2QYI B;  3CQA A;  3VT2 A;  2KLL A;  3HSM A;  5DUY A;  3V79 C;  3CA1 A;  1S0D A;  5FZY A;  3AZV A;  3ILA A;  5DZU A;  4ZFW B;  4LO0 A;  2IWT B;  4GP0 A;  4I96 A;  3WO4 A;  3BAU A;  3CA0 A;  1NZK A;  2F2F C;  3OGG A;  4Z8S B;  4D8H A;  1V6V A;  2NM1 A;  3PG0 A;  3O4O A;  2BEB A;  3OJM A;  4LO2 A;  4I6I A;  1JTC A;  41BI A;  1JT7 A;  2BFH A;  5FZZ A;  4P6A A;  3FJE A;  1R8N A;  2FGF A;  31BI A;  1DFQ A;  4KEJ A;  5F8W A;  1V6U A;  3OJV A;  4G6J A;  4LO0 C;  4ZA3 B;  1Q03 A;  4XKI A;  1EVT A;  1Z0H A;  7I1B A;  3FUO A;  1ISZ A;  3JUT A;  1MD6 A;  3ZC9 A;  4KBB A;  4GAI A;  1BLA A;  1FMM S;  2WRY A;  2K43 A;  2Q3N B;  4ION A;  4DEN A;  2AQZ A;  1G9A A;  4JKX B;  4LO2 C;  4I4X A;  1BAR A;  1YXW A;  3IM5 A;  2FDB M;  4GAF A;  4J2X A;  4EKX B;  3RTJ B;  5I1B A;  3CA4 A;  4AN7 B;  2KKI A;  4JPZ A;  2DRE A;  3R4S A;  2J3P A;  1BFB A;  1PUM B;  4I4Y A;  3VSZ A;  3A22 A;  3CRI A;  1IIL A;  9ILB A;  3RMY A;  5BVP I;  2FO1 A;  3UDA A;  3IIR A;  2D7R A;  1PWA A;  3N0K A;  2ZR1 B;  3FUQ A;  2P39 A;  4I4R A;  3P6I A;  3LTQ A;  4X37 A;  1HWO B;  2NTD A;  2MLL B;  2WBC A;  1EYL A;  3AKH A;  3NJ5 A;  1AVW B;  3D7W B;  4END A;  1JT5 A;  1K5U A;  3N7L A;  5BOW A;  3BRD A;  4H9W A;  1FV3 A;  4L4I A;  4USP A;  5B2H A;  3JRR A;  1JY0 A;  2GO2 A;  3I29 B;  4CJM A;  1PUU B;  1IRP A;  1UPS A;  3O3Q A;  2NP0 A;  2HWM A;  3P6J A;  4OEG A;  3FJJ A;  3BAV A;  3QYD A;  1BLD A;  1WBC A;  3AKG A;  4DCK C;  4ISQ A;  3V0A B;  3QR5 A;  4X38 A;  3HBW A;  1R8O A;  3IM7 A;  2AXM A;  3O4C A;  5F90 A;  3HAL A;  3VWC A;  1G82 A;  5D62 A;  1CVS A;  2L5X A;  3OBR A;  1DIW A;  1AVX B;  3P53 A;  4P0J A;  5HPZ A;  3V0A A;  1V6W A;  3AKF A;  3VSF A;  1S0G A;  5G00 A;  1JLX A;  3OBT A;  1IT0 A;  1WD4 A;  3WIN A;  1XHB A;  1G9B A;  21BI A;  4LO8 B;  4OWK A;  4ZLB B;  3BAQ A;  4EFP A;  1FGA A;  3FJ8 A;  1FV2 A;  4ISR A;  3O44 A;  3B9U A;  8I1B A;  1L2H A;  5DSS B;  1IJT A;  4QBC A;  5BXR A;  4J2S A;  3WO3 A;  1E0O A;  1IHK A;  1BAS A;  4P0K A;  1T9F A;  4ZGR B;  3NBN A;  3EF2 A;  1A8D A;  3F1R A;  3OGF A;  2K4A B;  4LO1 A;  4Q9P A;  4IZX A;  2GZB A;  1S0F A;  2D1Z A;  2AFG A;  3OJ2 A;  4OEE A;  3WIN C;  4DEP A;  3BA4 A;  1HWM B;  2ZQO A;  2M49 A;  1HWN B;  3I2X A;  5FNW A;  3VT0 A;  4FGF A;  1T4Q A;  1M2T B;  2DS0 A;  1TTU A;  1S0E A;  3PUB A;  4LO7 C;  4G1R A;  2Y9F A;  4KEK A;  1ISW A;  4G6M A;  5D63 A;  2NZ9 A;  5EC5 A;  2VU9 A;  4IYB A;  4LO1 C;  3FGM A;  4WBC A; 
#chains in the Genus database with same CATH topology
 5BQU A;  4XFT A;  1ITB A;  4A7K A;  4I0Y A;  4QD2 B;  5JLV A;  3CRH A;  2DRZ A;  3BB2 A;  3AH1 A;  3AJ6 A;  5EHA A;  3O49 A;  1DQG A;  4QKR A;  3CAH A;  3O4A A;  5JMC A;  3FJ9 A;  1ISV A;  3FJH A;  1I1B A;  3VEQ A;  1CE7 B;  2KH2 A;  2Z48 A;  1DQO A;  4F34 A;  4JKQ A;  2NVH A;  4R6U B;  2Q9X A;  2HWA A;  1MC9 A;  5BXT A;  3HN1 A;  1JQZ A;  3BRF A;  5BQU C;  5GAQ A;  6I1B A;  4P0L A;  3BTA A;  2RG9 B;  3CA3 A;  3VUO A;  4XFS A;  4UY4 A;  1XG6 A;  3ZC8 A;  2E4M A;  4ZFY B;  4IY9 A;  4F83 A;  4HA2 A;  2VSA A;  2VXT I;  3A07 A;  1RZO B;  1YBI A;  2VXR A;  4QD2 C;  4Q9G A;  1KNM A;  3NBD A;  1PC8 B;  5EG6 C;  2RST A;  5FNX A;  4I4Q A;  1JT3 A;  1Q1U A;  1TIE A;  3UD8 A;  4HJJ A;  2ESU A;  2FFV A;  1I1E A;  1FN0 A;  1XZZ A;  2MC2 A;  2UUS A;  3ZXD A;  1W3F A;  1TOO A;  1Z4S A;  5D61 A;  3WA1 A;  1S0C A;  1BFF A;  2E4M C;  4FVV A;  4MZH A;  1IOB A;  3LLP A;  1SR4 A;  3H6S E;  3VT1 A;  3N7K A;  1FWV A;  1ABR B;  3R4U A;  3IAG C;  3O4D A;  3NBC A;  3POK A;  1SZ6 B;  3WMU A;  1TWM A;  1WD3 A;  2Y9W C;  4I2S A;  3UJ0 A;  1P63 A;  1W3G A;  3Q7Y A;  4IHZ A;  3HOM A;  2AAI B;  3MPP G;  1DFC A;  1DLL A;  2X2T A;  3N7J A;  4H75 A;  1WBA A;  1RML A;  2KI4 A;  3O4B A;  1FQ9 A;  4EEE B;  3PHZ A;  2D24 A;  1DZC A;  3K1X A;  1D0H A;  2LIE A;  4JP0 A;  1ISX A;  1N4K A;  3IM6 A;  3AJ5 A;  1SR4 C;  3ZX7 A;  3RSJ A;  1JT4 A;  3E8L C;  3FJK A;  2P23 A;  4OW4 A;  3AZW A;  1AFC A;  3PME A;  4QBV A;  1ONK B;  2VLC A;  3CU1 B;  4GOY A;  2R9K B;  3BA7 A;  4I1E A;  3Q7W A;  4JQ0 A;  2LIQ A;  4ZKT B;  2QN4 A;  4EFQ A;  1EPW A;  4ZBV B;  1JLY A;  1PZZ A;  4J23 B;  4I4U A;  1K5V A;  4II0 A;  4I7I A;  4QO3 A;  3H6R B;  4J2Y A;  1AF9 A;  5DVH A;  4I1B A;  2VSE A;  5BP5 A;  4GP3 A;  4EFR A;  2D20 A;  3H6R A;  3Q7X A;  4I37 A;  3CA5 A;  4HR6 C;  2ERM A;  3C9Z A;  4QC4 A;  1J0S A;  1HCD A;  1VCL A;  1HIB A;  4X39 A;  1TWE A;  3SNV A;  4OWL A;  3A23 A;  3UJ4 A;  3KMV A;  3AH2 A;  1AVA C;  4Q91 A;  1RY7 A;  2ET2 A;  2MIB A;  3H6Q A;  2VUA A;  3FFZ A;  1ILR 1;  5BP5 C;  4G9N A;  1BFC A;  1S0B A;  4OUJ A;  2Y9X E;  3I2A A;  4KEI A;  2I1B A;  3FJF A;  3UD9 A;  3BX1 C;  3BAD A;  1EV2 A;  4YOL A;  3A21 A;  4GOV A;  1HKN A;  2XOA A;  1G9C A;  4KC3 A;  1FMZ A;  3MAL A;  2IHO A;  3RTI B;  3BAH A;  3BAO A;  1BFG A;  2FFU A;  1YF8 B;  4J2K A;  1II4 A;  2Z49 A;  3NBE A;  4LO3 A;  1YTO A;  3UD7 A;  1DZD A;  3FJB A;  4ZFU B;  4PC4 A;  2KI6 B;  5F8S A;  1W3A A;  3S8K A;  4I3N A;  4EB2 B;  1GGP B;  3W9T A;  2K8R A;  1QXM A;  1G9D A;  4D0Z A;  4X3A A;  4QKS A;  2DRY A;  1NUN A;  1TFM B;  1HWP B;  4ZOT A;  3RMX A;  1F31 A;  3S8J A;  4AN6 A;  1Z2V A;  4I4O A;  1V6X A;  5BXP A;  1XYF A;  4G9M A;  2D22 A;  1ISY A;  2BEA A;  2ZQN A;  4IZE A;  1YYN A;  4I8M A;  4LO3 C;  4A7Z A;  3V0B B;  1HCE A;  3BRG C;  3FJA A;  3WO2 A;  3CRG A;  1S0L A;  4TLP A;  3TC2 A;  1DJS B;  3AKI A;  4I4V A;  2NYY A;  4MZF B;  1AVU A;  2YUG A;  4XFU A;  3V0B A;  4USO A;  1IRA X;  3FJI A;  4IQP A;  2HZ9 A;  5BXS A;  4A7Y A;  4D0T A;  1AXM A;  1TP0 A;  3FJC A;  4Z9W B;  2NS2 A;  4JAW A;  4LO7 B;  2D43 A;  5F8Y A;  3HMY A;  3FJD A;  1RG8 A;  4JRA A;  1M16 A;  2D7I A;  4L4H A;  4I4P A;  2HW9 A;  1FWU A;  3T8S A;  1QQK A;  2X2S A;  4OEF A;  2D23 A;  3WMV A;  2F2F A;  2F8X C;  3AH4 A;  3ZXG A;  4IY8 A;  5FZU A;  3CA6 A;  4QAL A;  2D44 A;  2Y9G A;  1QQL A;  4H04 A;  4OWJ A;  5E24 E;  4I4S A;  3F62 B;  3N7M A;  3BA5 A;  1OQL B;  1BA7 A;  2RQ9 A;  3BAG A;  1Q04 A;  3O5W B;  2QYI B;  3CQA A;  3VT2 A;  2KLL A;  3HSM A;  5DUY A;  3V79 C;  3CA1 A;  1S0D A;  5FZY A;  3AZV A;  3ILA A;  5DZU A;  4ZFW B;  4LO0 A;  2IWT B;  4GP0 A;  4I96 A;  3WO4 A;  3BAU A;  3CA0 A;  1NZK A;  2F2F C;  3OGG A;  4Z8S B;  4D8H A;  1V6V A;  2NM1 A;  3PG0 A;  3O4O A;  2BEB A;  3OJM A;  4LO2 A;  4I6I A;  1JTC A;  41BI A;  1JT7 A;  2BFH A;  5FZZ A;  4P6A A;  3FJE A;  1R8N A;  2FGF A;  31BI A;  1DFQ A;  4KEJ A;  5F8W A;  1V6U A;  3OJV A;  4G6J A;  4LO0 C;  4ZA3 B;  1Q03 A;  4XKI A;  1EVT A;  1Z0H A;  4MZG B;  7I1B A;  3FUO A;  1ISZ A;  3JUT A;  1MD6 A;  3ZC9 A;  4KBB A;  4GAI A;  1BLA A;  1FMM S;  2WRY A;  2K43 A;  2Q3N B;  4ION A;  4DEN A;  2AQZ A;  1G9A A;  4JKX B;  4LO2 C;  4I4X A;  1BAR A;  1YXW A;  3IM5 A;  2FDB M;  4GAF A;  4J2X A;  4EKX B;  3RTJ B;  5I1B A;  3CA4 A;  4AN7 B;  2KKI A;  4JPZ A;  2DRE A;  3R4S A;  2J3P A;  1BFB A;  1PUM B;  4I4Y A;  3VSZ A;  3A22 A;  3CRI A;  1IIL A;  9ILB A;  3RMY A;  5BVP I;  2FO1 A;  3UDA A;  3IIR A;  2D7R A;  1PWA A;  3N0K A;  2ZR1 B;  3FUQ A;  2P39 A;  4I4R A;  3P6I A;  3LTQ A;  4X37 A;  1HWO B;  2NTD A;  2MLL B;  2WBC A;  1EYL A;  3AKH A;  3NJ5 A;  1AVW B;  3D7W B;  4END A;  1JT5 A;  1K5U A;  3N7L A;  5BOW A;  3BRD A;  4H9W A;  1FV3 A;  4L4I A;  4USP A;  5B2H A;  3JRR A;  1JY0 A;  2GO2 A;  3I29 B;  4CJM A;  1PUU B;  1IRP A;  1UPS A;  3O3Q A;  2NP0 A;  2HWM A;  3P6J A;  4OEG A;  3FJJ A;  3BAV A;  3QYD A;  1BLD A;  1WBC A;  3AKG A;  4DCK C;  4ISQ A;  3V0A B;  3QR5 A;  4X38 A;  3HBW A;  1R8O A;  3IM7 A;  2AXM A;  3O4C A;  5F90 A;  3HAL A;  3VWC A;  1G82 A;  5D62 A;  1CVS A;  2L5X A;  3OBR A;  1DIW A;  1AVX B;  3P53 A;  4P0J A;  5HPZ A;  3V0A A;  1V6W A;  3AKF A;  3VSF A;  1S0G A;  5G00 A;  1JLX A;  3OBT A;  1IT0 A;  1WD4 A;  3WIN A;  1XHB A;  1G9B A;  21BI A;  4LO8 B;  4OWK A;  4ZLB B;  3BAQ A;  4EFP A;  1FGA A;  3FJ8 A;  1FV2 A;  4ISR A;  3O44 A;  3B9U A;  8I1B A;  1L2H A;  5DSS B;  1IJT A;  4QBC A;  5BXR A;  4J2S A;  3WO3 A;  1E0O A;  1IHK A;  1BAS A;  4P0K A;  1T9F A;  4ZGR B;  3NBN A;  3EF2 A;  1A8D A;  3F1R A;  3OGF A;  2K4A B;  4LO1 A;  4Q9P A;  4IZX A;  2GZB A;  1S0F A;  2D1Z A;  2AFG A;  3OJ2 A;  4OEE A;  3WIN C;  4DEP A;  3BA4 A;  1HWM B;  2ZQO A;  2M49 A;  1HWN B;  3I2X A;  5FNW A;  3VT0 A;  4FGF A;  1T4Q A;  1M2T B;  2DS0 A;  1TTU A;  1S0E A;  3PUB A;  4LO7 C;  4G1R A;  2Y9F A;  4KEK A;  1ISW A;  4G6M A;  5D63 A;  2NZ9 A;  5EC5 A;  2VU9 A;  4IYB A;  4LO1 C;  3FGM A;  4WBC A; 
#chains in the Genus database with same CATH homology
 5BQU A;  4XFT A;  1ITB A;  4A7K A;  4I0Y A;  4QD2 B;  5JLV A;  3CRH A;  2DRZ A;  3BB2 A;  3AH1 A;  3AJ6 A;  5EHA A;  3O49 A;  1DQG A;  4QKR A;  3CAH A;  3O4A A;  5JMC A;  3FJ9 A;  1ISV A;  3FJH A;  1I1B A;  3VEQ A;  1CE7 B;  2KH2 A;  2Z48 A;  1DQO A;  4F34 A;  4JKQ A;  2NVH A;  4R6U B;  2Q9X A;  2HWA A;  1MC9 A;  5BXT A;  3HN1 A;  1JQZ A;  3BRF A;  5BQU C;  5GAQ A;  6I1B A;  4P0L A;  3BTA A;  2RG9 B;  3CA3 A;  3VUO A;  4XFS A;  4UY4 A;  1XG6 A;  3ZC8 A;  2E4M A;  4ZFY B;  4IY9 A;  4F83 A;  4HA2 A;  2VSA A;  2VXT I;  3A07 A;  1RZO B;  1YBI A;  2VXR A;  4QD2 C;  4Q9G A;  1KNM A;  3NBD A;  1PC8 B;  5EG6 C;  2RST A;  5FNX A;  4I4Q A;  1JT3 A;  1Q1U A;  1TIE A;  3UD8 A;  4HJJ A;  2ESU A;  2FFV A;  1I1E A;  1FN0 A;  1XZZ A;  2MC2 A;  2UUS A;  3ZXD A;  1W3F A;  1TOO A;  1Z4S A;  5D61 A;  3WA1 A;  1S0C A;  1BFF A;  2E4M C;  4FVV A;  4MZH A;  1IOB A;  3LLP A;  1SR4 A;  3H6S E;  3VT1 A;  3N7K A;  1FWV A;  1ABR B;  3R4U A;  3IAG C;  3O4D A;  3NBC A;  3POK A;  1SZ6 B;  3WMU A;  1TWM A;  1WD3 A;  2Y9W C;  4I2S A;  3UJ0 A;  1P63 A;  1W3G A;  3Q7Y A;  4IHZ A;  3HOM A;  2AAI B;  3MPP G;  1DFC A;  1DLL A;  2X2T A;  3N7J A;  4H75 A;  1WBA A;  1RML A;  2KI4 A;  3O4B A;  1FQ9 A;  4EEE B;  3PHZ A;  2D24 A;  1DZC A;  3K1X A;  1D0H A;  2LIE A;  4JP0 A;  1ISX A;  1N4K A;  3IM6 A;  3AJ5 A;  1SR4 C;  3ZX7 A;  3RSJ A;  1JT4 A;  3E8L C;  3FJK A;  2P23 A;  4OW4 A;  3AZW A;  1AFC A;  3PME A;  4QBV A;  1ONK B;  2VLC A;  3CU1 B;  4GOY A;  2R9K B;  3BA7 A;  4I1E A;  3Q7W A;  4JQ0 A;  2LIQ A;  4ZKT B;  2QN4 A;  4EFQ A;  1EPW A;  4ZBV B;  1JLY A;  1PZZ A;  4J23 B;  4I4U A;  1K5V A;  4II0 A;  4I7I A;  4QO3 A;  3H6R B;  4J2Y A;  1AF9 A;  5DVH A;  4I1B A;  2VSE A;  5BP5 A;  4GP3 A;  4EFR A;  2D20 A;  3H6R A;  3Q7X A;  4I37 A;  3CA5 A;  4HR6 C;  2ERM A;  3C9Z A;  4QC4 A;  1J0S A;  1HCD A;  1VCL A;  1HIB A;  4X39 A;  1TWE A;  3SNV A;  4OWL A;  3A23 A;  3UJ4 A;  3KMV A;  3AH2 A;  1AVA C;  4Q91 A;  1RY7 A;  2ET2 A;  2MIB A;  3H6Q A;  2VUA A;  3FFZ A;  1ILR 1;  5BP5 C;  4G9N A;  1BFC A;  1S0B A;  4OUJ A;  2Y9X E;  3I2A A;  4KEI A;  2I1B A;  3FJF A;  3UD9 A;  3BX1 C;  3BAD A;  1EV2 A;  4YOL A;  3A21 A;  4GOV A;  1HKN A;  2XOA A;  1G9C A;  4KC3 A;  1FMZ A;  3MAL A;  2IHO A;  3RTI B;  3BAH A;  3BAO A;  1BFG A;  2FFU A;  1YF8 B;  4J2K A;  1II4 A;  2Z49 A;  3NBE A;  4LO3 A;  1YTO A;  3UD7 A;  1DZD A;  3FJB A;  4ZFU B;  4PC4 A;  2KI6 B;  5F8S A;  1W3A A;  3S8K A;  4I3N A;  4EB2 B;  1GGP B;  3W9T A;  2K8R A;  1QXM A;  1G9D A;  4D0Z A;  4X3A A;  4QKS A;  2DRY A;  1NUN A;  1TFM B;  1HWP B;  4ZOT A;  3RMX A;  1F31 A;  3S8J A;  4AN6 A;  1Z2V A;  4I4O A;  1V6X A;  5BXP A;  1XYF A;  4G9M A;  2D22 A;  1ISY A;  2BEA A;  2ZQN A;  4IZE A;  1YYN A;  4I8M A;  4LO3 C;  4A7Z A;  3V0B B;  1HCE A;  3BRG C;  3FJA A;  3WO2 A;  3CRG A;  1S0L A;  4TLP A;  3TC2 A;  1DJS B;  3AKI A;  4I4V A;  2NYY A;  4MZF B;  1AVU A;  2YUG A;  4XFU A;  3V0B A;  4USO A;  1IRA X;  3FJI A;  4IQP A;  2HZ9 A;  5BXS A;  4A7Y A;  4D0T A;  1AXM A;  1TP0 A;  3FJC A;  4Z9W B;  2NS2 A;  4JAW A;  4LO7 B;  2D43 A;  5F8Y A;  3HMY A;  3FJD A;  1RG8 A;  4JRA A;  1M16 A;  2D7I A;  4L4H A;  4I4P A;  2HW9 A;  1FWU A;  3T8S A;  1QQK A;  2X2S A;  4OEF A;  2D23 A;  3WMV A;  2F2F A;  2F8X C;  3AH4 A;  3ZXG A;  4IY8 A;  5FZU A;  3CA6 A;  4QAL A;  2D44 A;  2Y9G A;  1QQL A;  4H04 A;  4OWJ A;  5E24 E;  4I4S A;  3F62 B;  3N7M A;  3BA5 A;  1OQL B;  1BA7 A;  2RQ9 A;  3BAG A;  1Q04 A;  3O5W B;  2QYI B;  3CQA A;  3VT2 A;  2KLL A;  3HSM A;  5DUY A;  3V79 C;  3CA1 A;  1S0D A;  5FZY A;  3AZV A;  3ILA A;  5DZU A;  4ZFW B;  4LO0 A;  2IWT B;  4GP0 A;  4I96 A;  3WO4 A;  3BAU A;  3CA0 A;  1NZK A;  2F2F C;  3OGG A;  4Z8S B;  4D8H A;  1V6V A;  2NM1 A;  3PG0 A;  3O4O A;  2BEB A;  3OJM A;  4LO2 A;  4I6I A;  1JTC A;  41BI A;  1JT7 A;  2BFH A;  5FZZ A;  4P6A A;  3FJE A;  1R8N A;  2FGF A;  31BI A;  1DFQ A;  4KEJ A;  5F8W A;  1V6U A;  3OJV A;  4G6J A;  4LO0 C;  4ZA3 B;  1Q03 A;  4XKI A;  1EVT A;  1Z0H A;  4MZG B;  7I1B A;  3FUO A;  1ISZ A;  3JUT A;  1MD6 A;  3ZC9 A;  4KBB A;  4GAI A;  1BLA A;  1FMM S;  2WRY A;  2K43 A;  2Q3N B;  4ION A;  4DEN A;  2AQZ A;  1G9A A;  4JKX B;  4LO2 C;  4I4X A;  1BAR A;  1YXW A;  3IM5 A;  2FDB M;  4GAF A;  4J2X A;  4EKX B;  3RTJ B;  5I1B A;  3CA4 A;  4AN7 B;  2KKI A;  4JPZ A;  2DRE A;  3R4S A;  2J3P A;  1BFB A;  1PUM B;  4I4Y A;  3VSZ A;  3A22 A;  3CRI A;  1IIL A;  9ILB A;  3RMY A;  5BVP I;  2FO1 A;  3UDA A;  3IIR A;  2D7R A;  1PWA A;  3N0K A;  2ZR1 B;  3FUQ A;  2P39 A;  4I4R A;  3P6I A;  3LTQ A;  4X37 A;  1HWO B;  2NTD A;  2MLL B;  2WBC A;  1EYL A;  3AKH A;  3NJ5 A;  1AVW B;  3D7W B;  4END A;  1JT5 A;  1K5U A;  3N7L A;  5BOW A;  3BRD A;  4H9W A;  1FV3 A;  4L4I A;  4USP A;  5B2H A;  3JRR A;  1JY0 A;  2GO2 A;  3I29 B;  4CJM A;  1PUU B;  1IRP A;  1UPS A;  3O3Q A;  2NP0 A;  2HWM A;  3P6J A;  4OEG A;  3FJJ A;  3BAV A;  3QYD A;  1BLD A;  1WBC A;  3AKG A;  4DCK C;  4ISQ A;  3V0A B;  3QR5 A;  4X38 A;  3HBW A;  1R8O A;  3IM7 A;  2AXM A;  3O4C A;  5F90 A;  3HAL A;  3VWC A;  1G82 A;  5D62 A;  1CVS A;  2L5X A;  3OBR A;  1DIW A;  1AVX B;  3P53 A;  4P0J A;  5HPZ A;  3V0A A;  1V6W A;  3AKF A;  3VSF A;  1S0G A;  5G00 A;  1JLX A;  3OBT A;  1IT0 A;  1WD4 A;  3WIN A;  1XHB A;  1G9B A;  21BI A;  4LO8 B;  4OWK A;  4ZLB B;  3BAQ A;  4EFP A;  1FGA A;  3FJ8 A;  1FV2 A;  4ISR A;  3O44 A;  3B9U A;  8I1B A;  1L2H A;  5DSS B;  1IJT A;  4QBC A;  5BXR A;  4J2S A;  3WO3 A;  1E0O A;  1IHK A;  1BAS A;  4P0K A;  1T9F A;  4ZGR B;  3NBN A;  3EF2 A;  1A8D A;  3F1R A;  3OGF A;  2K4A B;  4LO1 A;  4Q9P A;  4IZX A;  2GZB A;  1S0F A;  2D1Z A;  2AFG A;  3OJ2 A;  4OEE A;  3WIN C;  4DEP A;  3BA4 A;  1HWM B;  2ZQO A;  2M49 A;  1HWN B;  3I2X A;  5FNW A;  3VT0 A;  4FGF A;  1T4Q A;  1M2T B;  2DS0 A;  1TTU A;  1S0E A;  3PUB A;  4LO7 C;  4G1R A;  2Y9F A;  4KEK A;  1ISW A;  4G6M A;  5D63 A;  2NZ9 A;  5EC5 A;  2VU9 A;  4IYB A;  4LO1 C;  3FGM A;  4WBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...