4JQ4A

Akr1c2 complex with indomethacin
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C2
total genus 112
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq4A00
2FZ8A 1AH0A 3EB4A 2FZBA 2R9RA 2CLPA 2PDCA 2BP1A 3M0IA 3O0KA 3RX4A 3V36A 4Q3MA 4JQAA 4XVEA 4WDUA 2IKGA 3LN3A 2FZDA 3GUGA 3EB3A 4XZMX 2F2KA 2NVCA 1VBJA 2BGSA 5C7HA 1ZQ5A 3WBXA 2DV0A 1X96A 3M4HA 5DANA 4ASTA 4WDWA 2ACQA 1IEIA 2IPWA 3R8HA 4QX4A 3UZYA 1VP5A 3QKZA 4IGSA 3V35A 3BURA 3CV7A 3DOPA 1QWKA 3H4GA 1S1PA 4JTRA 3R7MA 1PZ0A 2PDIA 2IPJA 2PDBA 3O3RA 2VDGA 2PDKA 1YE4A 2BGQA 4GQ0A 2HE8A 3KRBA 4XAPA 4R9OA 3MC5A 3FX4A 4FALA 1ZGDA 2PDYA 4XZIA 3R6IA 4ZFCA 1ZSXA 4F40A 2DUZA 4JTQA 4WGHA 1PYFA 1US0A 4GACA 3N2TA 1JEZA 1HW6A 2WZMA 3CASA 1RALA 3LENA 5KETA 4PUWA 2DUXA 1YE6A 3Q65A 2ACRA 3VXGA 1UR3M 4RPQA 1C9WA 4XZNX 3DN5A 1RY0A 1GVEA 1ADSA 3NTYA 3RX2A 4IJRA 2ALRA 3CAQA 5AZ0A 4YVVA 4GA8A 1SM9A 3COTA 4G5DA 4LAUA 1EXBA 1LQAA 4GQGA 4L1XA 4WRHA 3F7JA 2F38A 2INEA 1Z3NA 3WCZA 4HMNA 1MZRA 1XF0A 5LIYX 5HNUA 1AH4A 4PR4A 5HA7A 2QXWA 2INZA 3UWEA 4L1WA 3RX3A 1EKOA 4JQ4A 4FAMA 2ACSA 2ISFA 1S1RA 1Z8AA 3H7UA 3UP8A 3CV6A 3ONBA 4LBSA 1M9HA 2J8TA 1AZ1A 3V0SA 4FA3A 2IQDA 2PFHA 3G1RA 1PWLA 1RY8A 3LZ3A 1A80A 4HBKA 4JIHA 3UGRA 3UZXA 3BCJA 4XO6A 4JQ3A 4ICCX 3LBOA 2PDNA 1EF3A 3R58A 4YVPA 1XJBA 4JTDA 2PDLA 2FZ9A 2PD5A 4JTCA 1XGDA 1IHIA 3GHSA 4JTAA 5M2FX 4LAZA 3LZ5A 3Q67A 4LB4A 2AGTA 3V0TA 2PDHA 2PZNA 2WZTA 3BUVA 3R8GA 4WDTA 2HVNA 4QXIA 4H7CA 5JH1A 4XK2A 4YS1A 3LNMA 3GHUA 5HNTA 1S2CA 3UZZA 4PRRA 1Z9AA 4PUUA 3LQLA 5JH2A 4JIIX 2NVDA 2FVLA 5AZ1A 3G5EA 4DBWA 4XVDA 1S2AA 1X98A 3UG8A 4GABA 1J96A 2I16A 1LWIA 1PZ1A 2PDQA 3ONCA 2PDXA 1AZ2A 4OTKA 3BV7A 2PD9A 4NKCA 3R94A 4PMJA 4GIEA 2IKJA 3EAUA 2P5NA 1Q13A 3UYIA 3C3UA 4XZHA 1ZUAX 4JQ1A 3GHTA 1YNPA 3WBWA 3LEPA 2IQ0A 2R24A 2A79A 1HQTA 2FGBA 4QBXA 3ERPA 4QR6A 1OG6A 1EL3A 5LIUX 4LB3A 2HE5A 2PEVA 1X97A 4DZ5A 2IKIA 2PDGA 3LQGA 1AH3A 3P2VA 2PDJA 1Z89A 3MB9A 1Q5MA 2C91A 3CAVA 2PDUA 4AUBA 1QRQA 1MI3A 4EXBA 2HDJA 3D3FA 5LIWX 4XO7A 4JIRA 2PDWA 2I17A 2HEJA 4WEVX 1R38A 2PF8A 2IPFA 4LBRA 3R43A 2ACUA 4IJCA 2HVOA 4Q7BA 5LIXX 3FJNA 4DBUA 4MHBA 2PDPA 5LIKX 3LUTA 2IPGA 3V0UA 2HV5A 4JQ2A 4GCAA 3S3GA 4XZLX 1AFSA 3GHRA 4YVXA 1PWMA 2PDMA 4YU1A 4I5XA 4H8NA 3WG6A 2IKHA 4DBSA 3T42A 4PRTA 3B3DA 1YNQA 3LD5A 3CMFA 3WBYA 3N6QA 1MRQA 3UFYA 1T40A 1K8CA 2IS7A 4WDXA 1FRBA 1T41A 3H7RA 3U2CA 4EXAA 4FZIA 3M64A 3UZWA 2PDFA
chains in the Genus database with same CATH superfamily
1GOOA 1KRCC 1OK6A 1PBGA 1V93A 2EPNA 3M16A 2R9RA 4NJIA 4JNYA 4A4AA 5I3GA 3V36A 3W9ZA 3IUIA 3EWZA 1KRBC 1XYMA 5BCAA 3EWCA 3W7KA 1GVIA 4FX6M 3U6WA 1XISA 2ON3A 1R47A 1KBIA 4TQTA 5DBUA 4MF4A 1OZMA 5CPTA 2FYMA 4Q4PA 2Y85A 3EKZA 1W0MA 5FF2A 1H5VA 5ABTA 4XD3A 6XIMA 3S4TA 2PURA 2HROA 3IAPA 4LU0A 4ONVA 1I2RA 2J75A 2OLHA 4MB1A 1SFSA 4RW5A 3LCIA 1MMFA 1ZU8A 1QOQA 1KM6A 1CIUA 3HMCA 1EWEA 3ABSA 3AYVA 1CXKA 3FHQA 2WZEA 1NDWA 2VX4A 4IWWA 3G0SA 1E9LA 1PZ0A 3P0WA 1XCWA 1RVGA 2QPSA 3N1AA 3WFLA 3TEVA 4ALDA 4PMVA 2JIWA 1D8WA 2X0HA 2ZXBA 1TPVA 2BDQA 1LZOA 3GD6A 5FEZA 1JDFA 3MU7A 4JFTA 1RLCL 2VZUA 3HG2A 4QAIA 3NURA 5CPOA 1OB0A 3N18A 4F40A 2DUZA 4FMVA 3CO4A 1ITCA 2REQA 1XSKA 3L5LA 1C90A 4GACA 1HW6A 3CEUA 4IIFA 3P84A 3PC0A 2HXTA 4LT9A 3W00A 2X30A 1F3EA 1NOUA 1UH4A 1P43A 4FNSA 3W7HA 4CQBA 4FLQA 2OCZA 1EXPA 1MSSA 3MSYA 4BK9A 3ARQA 3FKRA 4GUGA 1PIGA 1CPUA 2J7GA 3LBCA 4XWUA 4DWSA 3SFKA 4I7UA 3G24A 4B2DD 2PMQA 3HU7A 3PBGA 1BHGA 4MTVA 3V7PA 1XYBA 3M1ZA 4AW7A 1WBJA 2PE4A 2W5FA 2D2GA 2PSNA 1K7XA 1GOKA 1UZDA 4H9VA 4RW3A 5REQA 4GNJA 5A8GA 3KOWA 2XHYA 2ATMA 2VQTA 4PR4A 1ZAJA 2A4AA 2A7NA 1WDQA 1DQUA 4JNZA 1J0KA 3P5YA 2ACSA 1Z8AA 2J9XA 4IICA 3P62A 2J9ZA 1FH9A 3QMSA 3KBMA 3ONBA 3W87A 1JF5A 1M9HA 5I6SA 4JPGA 3G1RA 1EJXC 3V75A 1JYXA 3SCOA 5EKYA 1EP2A 2UY5A 1YLVA 4GRSA 3UZXA 1NF7A 1AW1A 3BCJA 2J8FA 3C8FA 1OGBA 3BO9A 1YHTA 5B7ZA 3AJ7A 4H3DA 4QNEA 3QZ6A 2FPVA 4JTAA 1FP9A 2RJHA 3Q45A 3R2GA 4LF2A 3LZ5A 2I1OA 2DVUA 2GK1B 1U22A 1UR8A 2OSXA 2C7FA 1HXJA 2C0AA 3WLRA 4TVDA 2GGEA 3FDGA 1Q6RA 2DJLA 3WLNA 4GO9A 5EU9A 2OU4A 1EO7A 1LT7A 4Y9PA 2ADAA 3BAWA 2VTFA 1JDCA 2XIQA 4D71A 4GKLA 5HMDA 3WDRA 3QC3A 3KWSA 4C7FA 4QG6A 1NELA 2EO7A 4N2YA 1QI4A 1FWNA 1FXQA 2I16A 1UWSA 1I0BA 2GZXA 4AB4A 1YDYA 4MKVA 1LUCA 1W5QA 3TNOA 3OJGA 4J3VA 3W22A 2QMKA 4X3ZA 3TTSA 1SZNA 1XPGA 3GKAA 4KF1A 2Z7KA 4F2TA 1AQHA 3BJFA 2PTZA 1Q13A 3L23A 1XQKA 1BF2A 1VIZA 3PAOA 2ZZ5A 3EOSA 4AD5A 5H2ZA 1FX6A 1REQB 1H7PA 3WUFA 3W75A 5AC6A 4OBTA 4PN2A 2V5DA 3TONA 1TMLA 3ORWA 1A50A 3R5EA 3BGGA 1ME7A 3N4AA 3APYA 4JAWA 4Z2JA 3EA2A 1KLZA 2OEMA 4JICA 3GNXA 2OVLA 5LHFA 4FP1A 4BWLA 2PDJA 3IJ9A 4M82A 4GYPC 5KZMA 5EMYA 2NV1A 1CWYA 4UOZA 3L4YA 1AQ0A 1V6WA 1L6WA 3LGDA 1YQ2A 1W1YA 2A7RA 1XUZA 3G0XA 1F73A 3G1DA 4HTYA 1XYFA 2XN0A 3L4VA 3C8NA 1IE7C 1UR1A 2D24A 4K8HA 3Q2DA 3KL0A 2XWEA 3S1UA 1FCQA 5E09A 4IFOA 2E40A 4GIRA 4UTJA 3BG9A 2WLZA 3H26A 1F61A 3QBUA 5ABHA 1FWIC 1US2A 5AC4A 4WY0F 4TX6A 4JTLA 5AYYA 3FYOA 1ZP4A 4MHBA 3ZVHB 1RD5A 3LSCA 2XN2A 1SJCA 2ZXQA 4QLJA 2OOFA 3DESA 4AVFA 5DY2A 4H9UA 4LXFA 5I06A 3Q58A 3PFMA 1SJBA 4ZQRA 4GCAA 1UMLA 3EPOA 2GJRA 1SZGA 4H6EA 1JFXA 3B8SA 1WXJA 1E0UA 3DCPA 3MWCA 4PMRA 3W38A 4QQ3A 5CJ5A 3H70A 3UBPC 8TIMA 4DO4A 1XKJA 1KBJA 2OZ8A 3HPXA 3R0UA 1PZ3A 1UWRA 4DN1A 4MM1A 2ZXDA 1KFKA 2Q8XA 3A3WA 4LY4A 1GHRA 1ISXA 4UFLA 3GK0A 3H7RA 2PTDA 3CPUA 1SU5A 4KPLA 3B0PA 3IUHA 4W7VA 3RO6A 3MI2A 2PDFA 2D0GA 4JCMA 3W88A 1CGYA 4FNTA 3LGEA 5DLCA 1WXZA 3M0IA 1P0KA 4N9BA 4GH3A 2BTMA 3TYEA 4UWMA 4WDUA 1LRTA 1E6XM 2DZBA 3M0LA 1F3TA 3SSJA 4XZMX 2FPTA 2ZVIA 5C7HA 1ISYA 2A3BA 1XXXA 3CQHA 5CSUA 1F6KA 4O57A 4W8LA 4L4LA 4ASTA 3AXMA 1NEYA 1N8FA 2GGIA 4MADA 4Q7NA 1O5QA 1R9YA 1IEIA 5B7YA 3PF3A 2E6FA 3VO0A 4HOZA 1ESWA 1H60A 3M0XA 2BX7A 2PBGA 3P82A 3OEXA 2HS8A 4HK6A 4J9JA 3VNJA 3EGJA 2PDBA 3T2PA 1BD0A 4WSHA 1VBGA 2BGQA 2RKXA 3AS1A 2HE8A 3B8DA 1C93A 1EF2A 3E0IA 3WLSA 1EB3A 1Q65A 5EMUA 4ORMA 1PPIA 3VCRA 1W32A 3CAKA 1CEOA 2A3EA 3WLPA 5I02A 4MFDA 4R5EA 6TIMA 4IHCA 3MCMA 3SAZA 1B54A 5F1UA 4OOUA 4AY7A 2WZMA 1S5VA 4XAGA 1UC5A 3VNLA 3BLEA 1KQZA 1W56A 2CHNA 2CPUA 5M3WA 2AOSA 4Q8UA 1CI1A 1CXIA 5B80A 2BASA 3MCNA 4US6A 3M41A 1FWBC 3DU0A 1BF6A 5LSMA 4PCNA 4RE3A 1UKTA 1VEOA 1UJPA 1E9YB 4UTLA 3EWUA 4EAMA 3V5OA 3WQPA 1O7AA 1KD0A 4FNRA 4HMNA 3W2MA 3THUA 4CQDA 4GOAA 1VJZA 3BMWA 1EZWA 4RK8A 3DHPA 2ISFA 4CD5A 1S1RA 3PZGA 1B31A 3MUY1 3LTSA 1JF6A 2Z1VA 1L6SA 1FH7A 4QG8A 3ZLHA 2CBIA 4NXKA 3VIHA 1S5NA 2OKOA 2GYIA 1YDNA 1AZ1A 4DAIA 4GY7A 1CXHA 3TU9A 4P8WA 2H6RA 1PWLA 1J10A 4R3UA 3EX4A 4HA3A 1V6UA 3VCCA 4KWWA 3V1PA 1SO4A 4QNWA 3LBOA 2Q3RA 3E2RA 1XJBA 5H8UA 4S3GA 4FNPA 5HWNA 3FOKA 4HYVA 2VCBA 2GVJA 4YTUA 2R1NA 1XGDA 1IHIA 4NILA 3C2EA 2W0UA 1VBUA 1VBHA 3F1QA 3W7CA 2F9RA 1TTQA 2W79A 1QK2A 3UF9A 3R8GA 4Y90A 3VZZA 3DGRA 4LPCA 4F2UA 1VEPA 1DL3A 2EAWA 2BHYA 2R1KA 1TA3A 5FJUA 1E9ZB 2DSUA 3T2OA 2W63A 1DJYA 1A5LC 9XIAA 1QPKA 3KAOA 4LEFA 2NQ9A 1OX4B 3SY8A 3MMWA 4FO4A 3VILA 4GISA 1FDYA 4L6OA 1OJXA 2GSEA 3CHDA 1PZ1A 4ZL1A 3SN0A 1E6NA 2I56A 1IXQA 2GJXA 4UXDA 3MW7A 4X9SA 4E3VA 3UXKA 1ECEA 4X63A 2A21A 3RHGA 3BJSA 3CV2A 3EDDA 3IARA 1PX4A 3OZMA 1HJQA 1Q6CA 1XBYA 4CNUA 2VR4A 1XLCA 2CLIA 5CPNA 4IMEA 4NRSA 2V2DA 3UERA 3HF3A 3PBVA 1KR0A 5HATA 3RPTA 3ZLGA 4Q4MA 3KZPA 3PJTA 4H9XA 2BY2A 3QFWA 3MUZ1 2G3JA 4C6OA 1U33A 1LL7A 2XGBA 1OHLA 2Z28A 3LRMA 2OT0A 5CG0A 5H1WA 4NVTA 4LALA 3P2VA 2H9AB 3U2ZA 3GC2A 1RAKA 1XD1A 1Z32X 4X60A 3QSTA 3ZJ8A 4H6KA 3L68A 1Q5MA 2OJPA 1AMKA 1FHUA 3K1GA 3WQVA 1GVFA 4O10A 3GTNA 1QHOA 1QRQA 1TZ7A 3ZQ9A 1X6LA 3SR7A 4F8XA 4H7ZA 4M6PA 1HG3A 3SIZA 2Y70A 1R38A 4FLOA 1O66A 3T0CA 4ZEPA 1KWGA 1FWGC 3A12A 1DJZA 3QH2A 2P0OA 4I8YA 3VKDA 3SM0A 2YBTA 2ABBA 4HNUA 4N6EA 3G6LA 3BW2A 4HYRA 2YCLA 3M43A 1EHNA 3WH5A 1RR2A 5HBFA 5K7JA 3AI0A 1A5SA 3TA9A 3RF9A 3LERA 5K9CA 3ZLFA 1TPFA 1E6PA 1EA0A 2CU0A 3TC3A 3AIVA 2XGIA 4GH1A 3UJSA 4XSMA 4Q7IA 1VCFA 1YYAA 3SSZA 3QV8A 2WAGA 3NQ7A 3VX1A 4E5TA 2D2OA 2BY0A 5I23A 2PDCA 3I6EA 3ARPA 4N7QA 1KKRA 2ZC1A 1KM4A 4KWOA 1YIXA 3HPZA 2QPUA 3A4AA 2X40A 1GOQA 3PZOA 2PLCA 2F2KA 1QXLA 2PP1A 1GVQA 5CEWA 1WDDA 3IIOA 5HULA 3H21A 3RPDA 1OD0A 2XZ7A 4LCRA 2TODA 3A21A 1FXPA 2D1ZA 5HK4A 4LS1A 5D2XA 3CB3A 3CL6A 2CETA 2EPMX 5I3HA 3FXGA 2PLMA 4W9TA 4PMZA 1DJGA 3IJDA 5MHBA 3JZEA 1GG0A 3CV7A 3L5AA 1XIGA 1QWKA 3UR7A 2XIOA 3H4XA 4JTKA 4KWSA 3O3RA 4XX6A 1SJDA 2WLYA 1R87A 3LHZA 5HDRA 9RUBA 4DXXA 3A3HA 4UTIA 4NZ4A 1WB0A 2FHCA 3AJXA 4XIMA 3S5YA 4JX5A 3EOOA 2BV9A 1TV2A 3WQ5A 3VC5A 4XTDA 5FF7A 4DEFA 4CD7A 5CBBA 4KCUA 1G4SA 1OZQA 3NPXA 4L4PA 1TKKA 3T7VA 1PYFA 1US0A 1WZAA 4D6DA 1J0HA 4JR5A 1ME9A 1J01A 4O1CA 4XZWA 3T07A 2AQOA 1UP0A 4EWND 1EUAA 4JTHA 2YYTA 2DIJA 1XDLA 3PHAA 2BODX 4UTFA 3GE7A 1E6SM 1X7IA 4YYCA 1SM9A 4PUJA 3TXVA 2RDXA 1M7PA 1W5OA 1DWHM 5FL0A 1TV4A 4CKQA 3ITOA 4E4UA 5HINA 1SMDA 4JFSA 3GXIA 3W02A 4PCTA 4CU8A 4AEOA 1F2JA 1OG0A 3VUPA 3AZRA 1HGYA 1NFGA 1W3HA 5A8MA 4FAMA 3ZWTA 2OODA 5AVNA 5FA5A 4Z1AA 4OFCA 1H0IA 1TJRA 5HWJA 5TD4A 5F1VA 2HTMA 4W8BA 3NXLA 1XLLA 2EG7A 1HJXA 2BOGX 4M6UA 3GKFA 3SCUA 2BSLA 4HSHA 4DYJA 2Y5EA 4YVPA 1RPXA 2QAFA 1AJ2A 2CC0A 1TJ2A 3LHWA 5M2FX 1XIHA 3CZLA 3LCXA 3BPWA 4L64A 5C2XA 2CBJA 1Q85A 4ZR8A 5I77A 4NNBA 1A5MC 4ES4A 2FJKA 4QXIA 3U8GA 1DE5A 2DW6A 1GVYA 1GYLA 1ONEA 3PSVA 4YS1A 5EFFA 5M1TA 4AH7A 3OVGA 5ABFB 5TF0A 1WZMA 2HWGA 4GI8A 1TR1A 3T81A 3FA5A 4ATLA 1VYSX 4JIIX 3QV9A 5AZ1A 3TTOA 3VNKA 3RLHA 4TMCA 4D6FA 2WMJA 1BVZA 3C6CA 4KFOA 3ZIZA 4L6DA 3CQIA 2V68A 5H6HA 1RCOB 5J8LA 3C2OA 4GUHA 3NXFA 1BAGA 3U4FA 5C54A 1R6WA 3W7EA 1BGAA 2DORA 5BZAA 3W7LA 1Z48A 2UWFA 3QYQA 3VDHA 3VZYA 4HNVA 1WBHA 3SRFA 3VIOA 4MSSA 3E0LA 4G7EB 3CMJA 1RA0A 4WZHA 4JDBA 5A5WA 3UESA 2Y7GA 1HJVA 1J2BA 2WM1A 3AAMA 4QE5A 5C9WA 1MUCA 5DN1A 1EC9A 1WCGA 5CZKA 4DJEA 1XHGA 3U4AA 4KCTA 3KCLA 1GTEA 5HUOA 4O14A 2W6RA 3UWUA 1OY0A 3V3WA 4ZB0A 3QN3A 3A13A 4URIA 3IGHX 3E5BA 2NV9A 1W5PA 3POHA 1Z89A 4PFHA 1PKMA 4LYQA 1HFBA 2YB1A 2PBOA 4CU7A 3F2DA 2ZICA 2DFAA 4PTDA 1GKRA 1X8CA 4GJIA 2P1FA 1XBXA 3CAVA 4M0XA 5DT5A 4AIUA 5BRBA 1JUBA 1U5HA 1AJZA 2JF6A 2GPTA 1KXTA 1UR2A 3H12A 2QGHA 1DJHA 4OUIA 2B0MA 3UY8A 3RIKA 2GWGA 2PF8A 3VVGA 2YKKA 1JYVA 3HGOA 4CLMA 4PBEA 4YHGA 3ZXWA 4Q4KA 1NQ6A 3A4WA 4QQUA 3TYCA 3GIYA 1QDSA 5HJXA 4DM1A 2VZVA 4FF7A 3G1VA 3MSDA 3VDBA 5D33A 3P5ZA 4NQ1A 3QHNA 1RJQA 5G4WA 2V82A 3S2NA 3LCHA 3P81A 2YCLB 2ZX9A 1VIWA 3BLOA 2PDMA 1XINA 2ZDSA 4DBEA 4DUWA 1S2WA 2QJNA 4E4PA 3O0FA 1GTHA 1D3CA 4OE7A 3ZOAA 4CNPA 3OLIA 4DRSA 1TJ0A 1YNQA 4YTQA 4WCJA 1MRQA 3SCWA 1HJSA 5FAGA 5DMYA 2ZDRA 1K8CA 2IS7A 3DI0A 4MWAD 4P5UA 1E6QM 3G1YA 3HGSA 3K4DA 1JRCA 4GWEA 1CXFA 3MP5A 4EXAA 5I2UA 3M64A 3OGRA 2A1YA 2FZ8A 1KV8A 3W72A 2VEFA 1E1CA 1I9CB 4IZGA 1MXDA 3P67A 3GTFA 3LTPA 4I5UA 4QRNA 2ZRXA 3QPZA 1H61A 3IANA 1SO6A 4EF9A 4YTTA 1VFOA 4E8CA 3DKJA 4G1NA 2X1RA 1U1JA 3LSBA 3E2VA 2GLKA 3DHDA 3CO8A 3DFPA 1NWTA 4NNCA 4C6IA 3BAIA 4UFMA 3W37A 3C61A 2FTYA 3M5XA 4BQ4A 1ITQA 3LCWA 1XLAA 2O7SA 3EXSA 4ROPA 4JYFA 3R13A 3L4TA 2WZIA 4GLEA 2V69A 2ISDA 1UD5A 3C0QA 5HR7A 3LA4A 5FJRA 1XICA 4AC1X 3QKZA 2ZKMX 3H2AA 1WA3A 2GK1A 2EGZA 4P8XA 3C4UA 3LM7A 5CAHA 4MWAB 3PG9A 3IVUA 4ZOEA 1KTBA 1DWFM 2PWUA 4FF5A 1XWYA 1LOLA 2VCAA 3R1ZA 4PEEA 4W4QA 3G0UA 2CNCA 2DZVA 4I90A 3PZUA 4MOZA 2YL9A 1JZ5A 3PTDA 4UQEA 2V2CA 3BAXA 2ZFAA 2X05A 3HN3A 3OQ8A 1FWSA 3RGTA 3LLFA 2FIQA 5BMWA 4W84A 3MI6A 4MJMA 1EJVC 1EDQA 1NQKA 4D6HA 4EACA 4KFPA 1B30A 2R1LA 1FHDA 2NVAA 3VPLA 1JCMP 4W8AA 5DQPA 2QEZA 2HRWA 2Y4SA 2X1SA 4PTNA 2V9DA 3WLOA 2VFIA 1R3YA 4BEQA 1E1CB 2F8QA 1VLIA 1HN1A 3UR2A 1EGZA 3BAJA 4QISA 1GOMA 3S5OA 1A5BA 3ZSSA 4LAUA 1WAUA 1LM1A 3OG3A 3II1A 2V63A 3E6EA 3KVJA 3B05A 1BQGA 5A6KA 3G3MA 3GDRA 2F38A 2INEA 1LL4A 1SUXA 5HJYA 5AC7A 3UWZA 3WJZA 2E8ZA 4PSPA 2NQ5A 1ZL1A 4ADTA 1IYXA 2CBVA 4O4VA 3ALFA 1GUVA 1HX0A 4E8DA 2VELA 1MQPA 5G5IA 1V3KA 2H3DA 2JF7A 4TOQA 3AZSA 3GBEA 4FA3A 1A3HA 3VGBA 5HANA 3AROA 1AQFA 3M7WA 1FFRA 3MUIA 3C52A 2PWDA 2Z1SA 3CU2A 3FLUA 3LHTA 4E8GA 4ICCX 1UROA 1EDGA 3HJZA 4BF9A 1GHSA 2I5IA 3VM7A 3LV6A 1DXEA 5AVHA 1QNOA 4LAZA 1WAWA 2QW5A 3SRHA 4KBXA 1TX2A 3Q4DA 1RV8A 4AWTA 3IRDA 1MZHA 1LJYA 1UD3A 3F2CA 4JYEA 2RH9A 4HB7A 3UVIA 4MY8A 3WMBA 2J66A 4H8UA 3TOYA 1HKMA 3BSHA 3W2UA 4Z2IA 4GZEA 3FGCB 2QDDA 4ZOCA 3MVIA 5LA0A 3BLKA 2Y62A 3N9RA 3H24A 2J79A 4HU8A 1EPVA 3MBDA 2CHOA 2HS6A 3LI1A 5LNUA 2V3EA 1OIMA 2WMIA 3TLQA 5JVLA 4UFJA 4E2DA 2QCDB 1O68A 2PAJA 3W2NA 1MW1A 5I5RA 3Q37A 5HMSA 2DZPA 4GIYA 1TVNA 4G7EA 5BRQA 4KRUA 4ZODA 2QUVA 4HPNA 4U3AA 4FNUA 3EMQA 4QSFA 3ZJ7A 3CL7A 3LY0A 4O50A 1FY6A 2YX0A 3MMUA 5HUPA 4M7TA 3RJYA 1IV8A 1GYMA 4F9JA 1YNPA 1EWDA 6REQB 4DVOA 1AG1O 2Q3OA 3NYDA 2A79A 4WQ6A 1GJUA 1RK6A 2E09A 1TWIA 1JCYA 1QK0A 2TSYA 5JIPA 3AMDA 4LB3A 3SI9A 2E28A 1DKWA 1OINA 4KERA 3DECA 2DIKA 3UJFA 3M5ZA 1XIMA 3QW4B 3ZS4A 3UPBA 3VD4A 3W71A 1JDEA 2R91A 3L4XA 1HL8A 2PDUA 4ZTYA 5EY5A 2VUNA 4Z2LA 3W1LA 5F4SA 2J6VA 3H4WA 4M19A 1JXJA 4ZA0A 4W5UA 3MZ2A 3QZAA 3E12A 4QJ1A 5BOEA 4LV4A 1TRIA 1L2QA 4DUOA 2IPFA 4AIEA 2E9LA 4WJ8A 2HVOA 3WUGA 5AHIA 1YDOA 7TAAA 3URAA 5FKYA 4US5A 3AIQA 3ITYA 1S39A 2QCGA 1BXBA 4UR7A 5TNVA 4I9TA 1MQRA 5C0QA 4TV6A 4ML9A 3E3HA 4EXQA 4CU6A 1T0OA 2I5GA 1H09A 2A2IA 1GKQA 2V5LA 4YU1A 7REQB 4H8NA 2QCCA 5GVJA 1L6GA 1N82A 1X8FA 2VNCA 1UD4A 1NDZA 4OBRA 1ML1A 4C6BA 4BJHA 1QOPA 1M04A 1UZHA 3HV9A 1WNOA 3B4UA 4IIEA 3U2CA 5FD0A 4PEKA 4Q4QA 5M03A 1M53A 1J79A 1C8QA 3RDKA 3RLVA 2CZ5A 1UD2A 4BCEA 2ASHA 4JN7A 4BI6A 1XIIA 3OA5A 3VYLA 3SQMA 3FAWA 4MNMA 3GZAA 2QJGA 3CUGA 4XQ6A 1VFLA 1Q6FA 1CNVA 3SO7A 2EBNA 1VYRA 1XH2A 3BK0A 1OFRA 4Y6GA 4JKLA 1K9TA 2WNZA 4IMCA 1UIOA 3HBLA 5DBTA 3NL2A 4JEJA 1YPIA 3R8HA 3L2LA 5C2GA 4P61A 3VC6A 3N29A 4WJEA 3PZTA 2FJUB 3BSGA 3ARSA 2HISA 4MY9A 4P7LA 4QE1A 2VRKA 1VC4A 4EK7A 3FEMA 3BDKA 1SR9A 4DLFA 1A3XA 5DO8A 1UH2A 4YXGA 2WSYA 3MC5A 2VC9A 3WQEA 3G3DA 3BH4A 1U5VA 1V4YA 1OGGA 3ARYA 3GSMA 1Y8BA 4GFSA 3LPPA 1LF1A 2G3FA 1UUOA 2O0TA 1TZ9A 3EKGA 3QSRA 5C5YA 2QVHA 3QZEA 4OGZA 3SN4A 3R4IA 4JTQA 4J5NA 1WV2A 3GW0A 5JUVA 2ZRYA 1IXPA 3WLLA 1W1A1 1LT8A 3WNKA 1ZJAA 2Q8ZA 4JTJA 5DCDA 1V0KA 2ACRA 3TX9A 2ZOXA 4RPQA 3DBNA 2E7FA 4GG9A 1KGUA 5AYXA 1LCOA 5FAJA 1ZBCA 3W2LA 1OFBA 1SYTA 1W31A 3N11A 3MBFA 4W88A 3JU2A 1Q7ZA 3S6TA 2OO6A 4ZTXA 4HPGA 2DT1A 2E9MA 2PCQA 1FCBA 3C5QA 4KGLA 4F0SA 5HNUA 4KW2A 1QT1A 1U2YA 1VCGA 1H63A 2CBUA 4M8UA 1FWHC 3LPOA 1NSJA 5C9ZA 3TQPA 4MYXA 1EYWA 3N4FA 2YOCA 2CZEA 4XBKA 5FF4A 4AF0B 1W9XA 3UP8A 4GXMA 1G4PA 4LVFA 3ZJKA 4AD3A 4HTBA 1LQ0A 4HKPA 3GQYA 2PRHA 4FR6A 5C70A 4HCLA 3NPUA 4U28A 5D30A 2JGYA 2VCCA 2J13A 5LZLA 4GVHA 4JTCA 2CCRA 2P76A 4GUIA 1EX1A 4RL3A 4IIBA 2Y61A 2YXGA 3VIKA 1OX4A 3ZMRA 1NOWA 1V8EA 1XLKA 4O16A 4ZZ9A 4WDTA 1SFLA 4TIMA 4ZQMA 1U1HA 4GNKB 4O8AA 1AMYA 3QLLA 3GHUA 3GNPA 4IX0A 3LRKA 4PUUA 1PDZA 3LX9A 1Y5VA 5A6MA 3ES7A 3WDHA 2VFFA 2QT3A 3AISA 2NVDA 3E2QA 5EYWA 4UC5A 5CQ1A 1VENA 5KZ6A 4M80A 1RA5A 4CD4A 3OLGA 4AXKA 3B4YA 4GABA 1AVAA 4S3EA 5FESA 1B9BA 4B90A 4MMWA 3TV8A 1GVRA 4NZ1A 5DEZA 3R94A 4U2YA 4JN6A 4PUMA 4P2VA 1E3ZA 3QPYA 5FEWA 4GO8A 1UBPC 1OWQA 2X0YA 3ID7A 5HR6A 3MUXA 5BXTA 1W1VA 4PL2A 4R33A 3W81A 1JI1A 4HOWA 4MNKA 3H2EA 1D9EA 3ZYZA 3ABXA 4O0ZA 1JGIA 3P3BA 3ZWSA 2OQHA 1K9FA 4DM2A 4ADUA 5LA1A 3QGAC 5K9DA 1OM0A 1K77A 5K4XA 1OYBA 4GI9A 4OBSA 1E15A 3TMQA 1BWKA 4DUVA 2DSWA 4DJDA 1XFCA 3L0NA 2EJ1A 4LVAA 7ENLA 3HM7A 3R11A 3VOGA 4QBXA 1OC6A 5ABEA 1F8MA 4A3RA 1CTNA 2G4FA 2V5JA 4LV9A 3EDFA 4EKJA 2FFCA 1Q45A 3VDCA 3I6TA 3RNDA 5DXXA 1WDPA 1REQA 2DUAA 1HTIA 3MDUA 1H50A 4ZB2A 1JAKA 3THQA 4ENLA 4AY1A 1MI3A 4B5WA 1JCJA 3ABQA 3HPFA 3BW4A 3C2FA 1O4UA 2NUWA 4ZSTA 2QULA 4AHQA 1SZEA 4RZ6A 2DSVA 3HZ3A 4M24A 3W6MA 8CGTA 1Q6LA 5BXRA 2GQ9A 3HG4A 1XLEA 2PZ0A 3PWIA 2D0FA 1XS2A 2ZX7A 4IT1A 3RRAA 4KGJA 1PZ2A 3T09A 4O1EA 3QLDA 4EAYA 4NJGA 1NH6A 1H1YA 1WPCA 2GOUA 1KFEA 5DFAA 3W82A 1ELSA 3WNPA 5A6TC 2L5HA 3NPVA 4DF2A 2VGGA 1GVSA 1LBMA 3GFYA 3VCNA 1UD8A 1HJWA 4J27A 1GZJA 1TJPA 2IKHA 4R53A 1OEPA 3T42A 1ZAHA 1VBRA 1VLWA 4W7UA 1GOWA 5DY3A 2HBVA 2BGNE 2VC5A 1VD6A 5A2CA 1PHQA 4HZ8A 4M6QA 4S2CA 3HA1A 4FZIA 3K1DA 1I8JA 1UJQA 4I7VA 2Z1BA 5BU9A 2YFOA 4AWSA 2QV4A 3VDGA 1XYCA 3B8TA 2CLPA 1MFUA 3EB2A 3AS2A 3MKKA 3WD2A 4U5KA 4LUSB 4XD6A 3NEVA 5D2YA 2VURA 4UCFA 1MEIA 1KB3A 1TO3A 1D8CA 2Z00A 3VIFA 1J5TA 1KGXA 5FF0A 4ICNA 3WQCA 4PCPA 5D8ZA 2AQVA 3IJ7A 2KAUC 2XINA 3CWHA 4WKAA 4AIBA 3G1AA 3SUUA 7CGTA 3TP4A 4B5SA 1XSJA 3NGFA 1XYAA 4XZ9A 3MT1A 3M46A 4GI6A 5JBFA 1H1ZA 4LBUA 3QY8A 2BY3A 4O1BA 1PYMA 1QNSA 2WCAA 1OC5A 2DZWA 4EPKA 4WJXA 3W7JA 1QBBA 3ZO9A 1XRTA 4Z1BA 3RO8A 3SJ3A 4Q8WA 4G6CA 4Z1DA 3WYZA 1KKOA 3BV4A 1N8IA 1TIMA 4OIFA 3CHEA 1CLVA 3JR2A 3G2GA 2OWWA 2QCHA 3PPHA 4DF1A 4F3HA 4G8TA 2E0PA 1E51A 3R6IA 2CLEA 3QR3A 1ZSXA 3B8IA 2EPHA 2C15A 1EBGA 5A2AA 3N2TA 2ISVA 1UW9A 2G41A 3C56A 7A3HA 3N2XA 1CYGA 1F4HA 4K38A 1YE6A 3LCFA 1GW1A 2PU0A 3W76A 4P7RA 3GTIA 3QR1A 4M51A 3LTYA 4D8AA 3RX2A 4H2HA 1ONWA 3IUDA 3EXTA 1C8VA 2ALRA 4A3UA 2VX7A 2WSRA 1ZZMA 2EXOA 1CXLA 1JXKA 4P7QA 1P6BA 3F03K 5CBJA 3TH6A 4GQGA 3O15A 4L5ZA 1N2VA 4D6GA 4NYUA 2POZA 2FQIA 2O7QA 4O54A 4NZJA 2MANA 1AA1B 1AD4A 3V5FA 1IEWA 3WZ0E 5CGMA 1FUYA 3WJWA 5DELA 5C6MA 3GBDA 3W1MA 4QAWA 4HVXA 5FOOA 3T6CA 1Z7AA 2QZRA 3H8AA 3RYSA 4IQDA 1WDSA 3CV6A 1LOSA 3EOEA 3T1GA 5IHRA 3OP2A 4DLMA 3UCDA 2ICSA 3BAYA 1SO5A 1R2SA 3ATZA 1R3QA 3R0KA 3GG1A 4R88A 3HGRA 1H7NA 5KINA 2YA2A 4O1AA 4F9DA 1S46A 1XIBA 2FZ9A 3LLXA 1OCNA 1A3WA 5ABFA 2CWNA 1MEWA 3WSUA 2HBXA 3DXIA 1QI3A 1IGSA 4MFEA 3S1GA 4TVCA 2PWEA 1KFLA 4IPPA 1KFWA 1V3HA 4L65A 3QHOA 4XD4A 5BOFA 3L4ZA 1FH8A 2OSYA 3BGAA 3UCQA 1ZBWA 2NXGA 1RJRA 4PCSA 3TKFA 3NGJA 2OYLA 1LOQA 2Q6ZA 4CQ9A 5MKGA 3E02A 3MYOA 3BOXA 4Y8EA 2GVLA 4OV4A 4PRRA 1T5AA 1TV7A 1ODUA 3P60A 2NV2A 3TROA 1NP2A 2D2HA 4L4OA 2E25A 2A3CA 4I6VA 1LLOA 2R1MA 1J96A 3TUUA 1V0MA 3VABA 3EMZA 1V02A 3QKEA 4JX4A 2XTKA 5BU6A 1UWUA 2ZE0A 1POJA 5E6ZA 3CHFA 3OG2A 4BF5A 4AZCB 4OUEA 1RCQA 1VFUA 3I3EA 1EHAA 3QOMA 4BEUA 2Y0FA 2XGZA 2CLOA 1YBQA 4MWAE 3I3BA 3RU8X 4DPPA 4MUPA 3UXIA 3CZJA 5BYWA 3AIWA 3NSXA 1NM9A 2WK2A 4KCVA 2GL5A 4MNJA 4YIWA 2GSHA 4IGNA 4C6LA 2BMBA 1HKKA 3C2YA 1G5AA 3N34A 3CZ8A 3GDTA 4XZBA 3GH7A 3SY1A 3UG5A 2I14A 1M6JA 3EDJA 4ACZB 4S3KA 4PBFA 3C0LA 5CC7A 1E0VA 5U4NA 3MWAA 4UQBA 1BEUA 4P8VA 5G1MA 4CQ8A 5XIAA 2QIWA 3MYPA 3MB9A 2ZX5A 2XFFA 2C91A 1GK8A 1GQJA 1IZJA 3E74A 3MVTA 1M01A 1AW2A 3CEPA 3T0BA 4S3AA 4DHGA 1ICSA 4U10A 3ZT5A 3H53A 2ZYFA 3PS7A 2YDAA 3LDVA 1CGTA 4H8VA 3IK2A 4ZO9A 2YXXA 5L9FA 3TE9A 1BVNP 5CZJA 4K1WA 3QPEA 4YTSA 5J5DA 1H7OA 4TTUA 4K1GA 2FDMA 3W73A 3CZGA 1UCWA 3TCSA 2OQYA 3WEZA 3KM8A 4AHOA 5A6JA 3OTRA 5IFTA 4MAVA 2FH8A 1IEVA 3NVTA 1NIUA 3EPNA 1UKOA 3INPA 1AFSA 4DUXA 1PWMA 4ROQA 3PNZA 4QJ4B 4RV3A 3VIIA 2EKCA 3ZVIA 2QIIA 1Q8JA 4C1NB 2QDGA 4YPJA 1G4EA 4ML4A 1FWRA 2Z0IA 4OVXA 1JVNA 1N55A 1FRBA 4RE2A 1E5NA 4X2PA 3SY5A 3FJ4A 6REQA 1UR4A 1I2OA 2BVDA 5XINA 5C7VA 6A3HA 1O5KA 4REQB 4GGHA 4N4QA 2X0SA 2BP1A 1P0NA 1MNZA 4BR1A 3CQ0A 4AX7A 1JQVA 5H8PA 5H8MA 1WUEA 2WHLA 4F0KA 3A47A 1DOSA 3CAWA 1TWSA 1FWTA 5A8NA 2C18A 2WSQA 3UXAA 2V3DA 1BYCA 1S38A 1YTEA 3QYSA 4WIWA 4HNNA 3CC1A 4R9XA 4IL2A 4DJDD 4XBSA 4Q8VA 4O8RA 4QJ5B 4DWDA 2D22A 1DTUA 1TFVA 4GNVA 4NY2A 3OOQA 3WQFA 4BA0A 2WVVA 1IF2A 3BE7A 1JCXA 1GEQA 1UD6A 1MW2A 5A95A 4MB4A 3EWXA 4LSBA 1B90A 3MO7A 4ZO7A 3RPMA 4JTRA 3A6OA 1VFFA 3S83A 3WY1A 1YX1A 2E5BA 2GUUA 1UIPA 1PKNA 2SFPA 4PTWA 2O9PA 4IXHA 3AO0A 1P1MA 1J0IA 1OYAA 2HVMA 2Y6ZA 1J0YA 4R9OA 3TFXA 3S5NA 3GH5A 4N4PA 1MDLA 4ZOAA 2OYKA 1PE1A 3FV9A 5BMXA 1TYGA 4MYAA 3WDIA 1K7FA 1OFEA 3ZT7A 2HJPA 3T9PA 2ZUUA 1BKSA 4OKDA 2GJXB 3S42A 4WGHA 1AW5A 2A5HA 3KBWA 2BVWA 4LVGA 4H1ZA 2DUXA 3S5SA 4C6JA 1W8SA 2X2YA 1CLXA 4LS0A 3TN3A 3OGSA 3DN5A 2CITA 4HU0A 4IPJA 1RY0A 3W25A 1ADSA 2OMAA 1VRDA 3GR7A 2I7GA 3L4WA 1G01A 2OZ0A 2YDQA 2BHUA 2YZRA 4GJ1A 5D9PA 1QFEA 1OC7A 1FWEC 3HFYA 1J11A 3VOJA 4QJ3B 3NM3A 2XISA 4WXZA 1KBBA 1G6CA 1TR9A 1DQWA 1HP5A 1MZRA 4DELA 4ZBCA 2CZDA 3QHMA 5E5CA 1MYRA 1CGUA 3F4VA 3UVAA 4D6JA 2WKLA 3ZR5A 4RZBA 1MXGA 2AKMA 3UNTA 1FHLA 3WBEA 1Q6DA 5HOSA 3EWWA 1E43A 4PYSA 3U48A 1TMQA 4J2PA 3TA6A 3R79A 4U33A 1IT0A 3QXBA 3G77A 2XH7A 3SQSA 3KP1A 3H23A 2W3ZA 3VIPA 3LZ3A 3SGUA 4ZE4A 4JIHA 3UWVA 4B3KA 3H2NA 2VVSA 4S3FA 1ZENA 3NQ6A 1KCXA 3VE7A 1FVPA 1SW7A 3H2MA 4UUIA 4A6GA 5JMUA 5EBAA 3W7RA 4EOUA 4JDYA 3E0FA 4PMDA 5FJOA 1QPNA 3LYEA 1Y65A 4Q8MA 4D1JA 2PZNA 4AWEA 3GG8A 3D46A 3W2KA 2FH6A 1HJUA 2HVNA 5AOUA 3GY1A 1TV3A 5JH1A 3LNMA 1IT8A 2E3ZA 3OPSA 1FHVA 1V3LA 4JIEA 4JCLA 4PMQA 4D8ZA 5D09A 2A7PA 4FSAA 2PGEA 4E0CA 1UZ1A 3G5EA 1ZHAA 3IAQA 2VUYA 4BHYA 1O6IA 3AS3A 3MDWA 2Y2WA 1TWZA 1RQEA 4P7NA 2PD9A 3C0JA 4K8EA 1F9CA 1W9VA 4KEUA 1KFCA 1XRSA 1Y7VA 2C71A 1I45A 2XN1A 4AC7C 4C90A 3FAXA 4FHAA 4Z0JA 4IMFA 4DJFD 2VEPA 5EMKA 2Y7FA 3UYIA 4PBGA 4Q22A 1E1FA 2B4GA 3M44A 4JXCA 3FCPA 3C3UA 2ZA3A 2WC4A 4K7VA 3T0AA 2LLEA 3TYBA 4CN4A 1XSIA 3WBWA 4GZ7A 3DC0A 1EOKA 2YGYA 3NPWA 3I4KA 2PI6A 1GKPA 3THDA 1A5NC 2FGBA 1BG9A 2VL4A 1WQ5A 3W7OA 3RN6A 2E6YA 5DMLA 3K8MA 3HFTA 3GU9A 5CKSA 1J6OA 3GIPA 1J2WA 2PEVA 4DZ5A 5I0DA 4DO7A 1H3GA 1EEPA 4UQ9A 1EPXA 1Z44A 4CCEA 1LROA 5IRPA 1PJ9A 3GR8A 4FXJA 3W53A 4ZGYA 3W1PA 3AQUA 4AUBA 4DJED 1DIDA 3SCSA 4H4IA 1K4HA 5LIWX 3FJ6A 3WDJA 4A8IA 1ICQA 3GU2A 4WEVX 4WUIA 4U3CA 3U2OA 2C16A 1JNEA 1C7TA 1G0CA 3DERA 3F4DA 3RUBL 3W01A 3TOPA 1IXNA 4FXFA 3TJLA 1MUMA 4G7FA 1W3NA 4JD4A 2P8CA 4H6RA 5ABGA 3TQ0A 3M5VA 5AKQA 3MCOA 4GX9A 3PP7A 3STFA 3DEQA 3SW6A 3W3OA 4TU1A 1CB2A 4GBDA 4K7YA 3OQEA 4UZSA 4YCPA 5LNVA 2WPGA 2Z1XA 3GRIA 3FKKA 3B3DA 4H41A 3OODA 3WBYA 2PRLA 3B06A 1DBTA 2FZMA 3F4WA 2VEKA 4I5RA 4UBPC 1W9DM 5E0CA 2QJMA 4DBDA 1OFOA 1K03A 1EBHA 2NSOA 2E68A 1C9DA 2GVYA 3HOJA 3LB0A 3MKCA 3N9SA 2AQWA 1JYWA 4M1RA 1W91A 1DV7A 5KITA 3AZTA 1Z6KA 3IVSA 3DYMA 3RXZA 1P0EA 3YPIA 4Z17A 4O0QA 3LN3A 4HHPA 2VFEA 4S2BA 3KCOA 1VBJA 3A23A 1E4IA 4L7ZA 3B40A 2AAAA 2BGSA 4QROA 3W29A 1ZQ5A 3GNOA 2DV0A 1PEZA 1JDDA 4IJBA 3I10A 5A8OA 1NTHA 4J35A 2FMNA 3TSDA 4ZCWA 3PBMA 2IPWA 4LYRA 3VOCA 1H0GA 4ZVJA 1YXYA 2ZZ1A 1NVMA 3DOPA 1B3OA 4WY0B 2YXOA 2F6UA 1UUQA 1CECA 2BBFA 4KH2A 1LUCB 1FCVA 3W83A 1BRLA 2ZX8A 2WV8A 1TPH1 2TRSA 2JQXA 4A3QA 1HZYA 1ISVA 5HNNA 4I9AA 5CSRA 5A69A 4PL1A 4FALA 1WP6A 5DXYA 3O16A 2GDVA 3USZA 3S8HA 5KZDA 3LHYA 4LEQA 1GW9A 3WQGA 1GWJA 3BL3A 4QDWA 1XL9A 4Q4SA 1OX6A 3KTCA 1CLKA 1TB3A 4XV0A 2C8NA 1XLIA 5DF0A 1RALA 3L9CA 5CC6A 1JIBA 5F4XA 1BXNA 3M0HA 4ZQCA 3LENA 3MHGA 1SFTA 4CQAA 3AWNA 1MW0A 4GYFA 4LUTA 1B4EA 2FZNA 4RPPA 4C6NA 4B5XA 1C9WA 4HMEA 2WHKA 2TMDA 3NDOA 1HP4A 3KLLA 3QW3A 4TXEA 2YR1A 1VPQA 3UCCA 2YCIX 4IISA 5F2MA 2PB1A 6CGTA 1J93A 4YVVA 4DIAA 3LHUA 2YB4A 5A3HA 3S6DA 4AYGA 4UFIA 2WMHA 2YL6A 4L1XA 1H1NA 4IM4A 3IACA 5AC5A 4M1BA 4NNAA 3PJWA 1YMYA 1XIJA 3IWPA 4N9EA 4UOJA 1B2YA 1FWCC 1WZKA 3GAYA 5G2WA 3E38A 3QQ0A 1DTNA 3GR4A 3HJEA 1O94A 2TYSA 3GYEA 4H6QA 3F4NA 2OX1A 3TYUA 1UP2A 3QC0A 3KXQA 1BQCA 4S1FA 1H51A 1Q4NX 1QI2A 4W7WA 4NF7A 1UH3A 2HPMA 3VD7A 4BI5A 1V77A 1VRXA 4IX2A 3WF4A 2CEQA 5GNXA 4NP7A 1XV8A 1NP0A 4XISA 4REQA 5AHEA 3MI3A 2PDLA 3SRDA 1EFZA 1A5CA 3WF1A 5A6LA 3ARTA 3FHAA 3V0TA 4K2SA 2WZTA 2PTXA 5CPQA 1W3LA 4IFKA 4KWVA 2VEMA 3W70A 4ZFMA 4XK2A 1ZCOA 5C8BB 2R14A 2O56A 2WJFA 1O1ZA 2PS2A 2D2JA 3KVKA 1NWUA 2FVLA 1FBAA 2WVVB 1N8WA 2PA6A 1V7YA 2J7CA 3W2JA 3CNYA 3TQKA 1VKFA 2B81A 4O1FA 4LJ3A 1EC7A 1KV5A 4CGTA 2WSKA 2W67A 1R46A 2J74A 3A3XA 3W1AA 3BW3A 3M0ZA 4ZE5A 3DKLA 2WSPA 4O12A 1KCZA 4YMZA 3OVQA 3EA3A 1QO2A 4IP5A 3O1NA 2WWDA 3GDMA 4FXSA 1C92A 2P3EA 5HXMA 2QUUA 1L8NA 3F4CA 3K2GA 3KLKA 1GJWA 5C2CA 1OGSA 3HURA 5BXSA 3WDQA 3N19B 5ENLA 1G4TA 3RFAA 3CHVA 1XCXA 4OECA 1X97A 1AH3A 1ISWA 4MGGA 4K3ZA 3VFLA 1QVBA 3S2LA 3PSWA 3UG4A 3P93A 4UTWC 2VGIA 4WOZA 1NWRA 4RXFA 1B1YA 4F0RA 5D9MA 1DJXA 1I6NA 1ZRQA 4FX7A 2ZZ7A 5FEXA 4HYWA 3L5MA 1XDMA 1KW1A 4EPDC 4INFA 1HL2A 3DFTA 3PAJA 1A4MA 2R6OA 4ZQOA 2ZWYA 3OZPA 2XH0A 4BF7A 3M0KA 4GJJA 2QUMA 1UG6A 2GGHA 3GDBA 1C29A 3LHVA 4HHLA 3UD6A 3KBJA 2CLKA 3CS2A 3S3GA 1PVNA 1S5TA 4PUNA 3B0YA 2NXIA 3WNOA 4I5XA 3GYCA 4TUFA 1Q4WA 3N73A 4AX6A 3H2CA 5AHMA 4J28A 1SZFA 1W3IA 3VKKA 1Y0EA 3LD5A 3HPSA 1EJRC 4EWJA 4HMDA 2KX9A 4NSBA 1UWQA 3SCQA 4B16A 3S2MA 4O28A 3G6MA 1P6WA 4AD0A 4I8DA 1FTXA 3AMLA 1GCYA 3QV7A 4A35A 5GNYA 1AL8A 3M0VA 4E2BA 3MP3A 1BPLB 2WZHA 4E6MA 1DVJA 3T55A 4K39A 1F8IA 4JX6A 1PV8A 3NQFA 2OKTA 3GFZA 3LXAA 2W61A 3K4WA 3B8UA 5CAKA 3BMXA 3SRKA 3M7SA 2ZE3A 2IKGA 3GB6A 1Q6OA 2FDSA 5T9CE 2VXNA 3EMCA 3KZSA 4J4KA 3RU6A 3UEQA 3DH7A 4ERAA 4UTTC 2FB2A 3WIJA 3C3NA 1Z69A 4LVDA 3E9AA 1UB3A 3N13A 5CBIA 2BOEX 1G94A 2YJQA 5DANA 1EGVA 1EQCA 3MSGA 3OLEA 3NDYA 3NAVA 1H62A 1EP3A 1UMYA 1F6PA 4PRWA 2J88A 4Z0SA 4L80A 3WD1A 2V3GA 5A6BD 4NL1A 4IGSA 3N12A 2W27A 1LL6A 2WNWA 4MVAA 1UKPA 2Z25A 4DWSD 3GDKA 4HSNA 1KXQA 2XVNA 1J9YA 2G97A 3SDOA 2V8ZA 3STGA 3V16A 1BRLB 4RNHA 4NUWA 4ORIA 4LWWA 4X2RA 3JVAA 2Y63A 3O6AA 3OBAA 1V02E 1DXIA 4DO6A 4LUYA 5F7UA 1UC4A 3LCGA 5CC5A 5CXPA 4XSLA 4LF1A 2V6AA 2X1UA 4ZENA 1UWTA 1DIOA 3VOFA 3PB0A 3O7UA 1U1UA 3KTSA 4IH3A 3LM3A 3WN6A 2DSZA 5KETA 4PUWA 3FK4A 3WD3A 1QNQA 1RPKA 4J3WA 1NY1A 3J7HA 4TVUA 4D8LA 2IMRA 3EZ4A 1GVEA 3EOUA 4DF0A 5KZEA 3O06A 2WHJA 3PZQA 5I09A 1SMAA 4X0NA 3D6NA 1LWHA 3NQ2A 2TAAA 3BXWA 3ARUA 1BWVA 1OQFA 4WRHA 2E1WA 3F7JA 1R3SA 5HMEA 3WCZA 3MMTA 2WPBA 1WUFA 3UXLA 3S9YA 1NJJA 1V5XA 5C55A 1L6FA 5HA7A 2J4GA 5BROA 3JRKA 2OOGA 1EKOA 3WK3A 3VE9A 2QCMA 3T08A 1WOAA 1UHVA 2Q09A 4BY3A 1UASA 4AAJA 2CLMA 5E93A 3NQDA 4NZ3A 4QS5A 2BVTA 1EQPA 3V0SA 1EDTA 4JKKA 4R7WA 1XCFA 4EIVA 1VZWA 1O95A 4FLSA 1BWLA 3W07A 4JIQA 4UNIA 2DH3A 3P61A 2DU2A 4JQ3A 3C86A 3UJRA 8A3HA 5LGZA 2PDNA 2AL2B 4J3XA 2ZBTA 4QCFA 2WVTA 3XISA 2Y5JA 2BNJA 3WF3A 1EJWC 5CC3A 4UNKA 2E77A 3HQNA 3DUGA 4RE4A 2CYGA 2YBVA 1A0DA 3E0WA 4YWSA 2AGTA 4O11A 3TK7A 3P6LA 1QUMA 4RDVA 3DZ1A 3KE0A 4V27A 1ZTVA 4A29A 3PG8A 3KDOA 3KDNA 3RILA 1K6AA 3L67A 3BC9A 2WNNA 4GIAA 1KTCA 1QMLA 1K6WA 5JH2A 3JUGA 2G95A 2I9EA 4PGLA 3VGEA 2BOFX 4JTSA 1DHPA 1HO1A 1P0BA 4GBUA 4BQ2A 2O9OA 3IVTA 4CNNA 3LI0A 2PDXA 2I5QA 2GVEA 1X1ZA 4K68A 1RQHA 4MZ8A 4XUGA 3KRUA 2QPXA 4HK5A 3URNA 4Y96A 1PIIA 3KRSA 1V0NA 1XLHA 5FI8A 1XIEA 2NW0A 3EDKA 3TTYA 3IJIA 1K02A 4LUIA 3TDFA 4D72A 1I75A 1EYEA 1L2UA 4GMEA 4UMBA 3FS2A 5D2WA 2WJDA 3PR2A 3FIGA 3WFZA 4V33A 1PKYA 3DFQA 5JBDA 3H7VA 1CGVA 1XYLA 1G9HA 3ERPA 4B5TA 1GQNA 2JBMA 3LG3A 5LIUX 3ISIX 4UZUA 1YADA 3ZM8A 1LG2A 2YCJA 3CPRA 3A5FA 1TRDA 1TG7A 1A0CA 3KBNA 4HCDA 2QDHA 4C7GA 5FF3A 2VD8A 3EBVA 4RE0A 3ITTA 4CUCA 1KO0A 3DFYA 3D3FA 2F84A 4QG9A 4H19A 4H2CA 1IWBA 1P4CA 4HU4A 2J7HA 1R3WA 2ZRWA 4YL2A 5CJNA 4RV8A 4IJCA 1DYSA 1Q63A 1V7AA 2XU2A 2ZRUA 4DBUA 2X7VA 1QO5A 1W1PA 1O1HA 1KM5A 1T7LA 1Q2RA 3UYCA 3B9DA 2EKGA 3TVAA 5I07A 1EZ2A 3E96A 3NR0A 3B03A 3TCEA 1XDJA 2G3IA 4LC6A 2VGFA 4H83A 3FXYA 1GQKA 1B0IA 1K9EA 2HSAA 4UB9A 3OIXA 3UR5A 3S46A 5BNKA 1GGOA 4JTFA 3OU8A 1NAL1 3CUJA 3FEQA 5T91A 1E4LA 5AHLA 3LOTA 4MB3A 3AWOA 4QDMA 2W66A 3OIHA 3R12A 4G56A 3VM5A 3NCOA 2FZBA 3NL5A 3BANA 1QI0A 3IIZA 3GXFA 1NARA 2H8ZA 3N2OA 2VJXA 4HHMA 4MAZA 4L9YA 4PC8A 1ZY9A 1TPC1 1DJIA 2DT2A 3AIUA 3FYYA 1RXOB 1G1YA 4LRTA 5E70A 4BWLC 2ZZ3A 4E4FA 5TQLA 3W1QA 4PB4A 1GOIA 2FTWA 3AHXA 3MP4A 3LU2A 3AIBA 3OHIA 1DPMA 3UETA 1JZ7A 4CCZA 1PCKA 2BXZA 2OEKA 3MV11 3CM4A 4Q32A 4CVWA 3BLFA 2ESCA 1VS1A 1T99A 1TIWA 3CPGA 1OFDA 4ICMA 3GXNA 2Z1KA 3XIMA 3AIEA 4B5VA 4DXVA 2PDIA 5DCEA 2J7BA 4XBJA 2PDKA 3VIMA 2Z1WA 3F5LA 3WLMA 2D3NA 1TVPA 2OR2A 5GNZA 3RM9A 5AB3A 1W17A 2WMGA 1OSEA 1SVDA 2VWSA 4K37A 4RLIA 4PMNA 3CMGA 3R89A 1H41A 2QNEA 1U83A 2PU1A 2WKJA 1RBLA 1RJPA 3C0SA 2ZRZA 1FOBA 3WJXA 2J7DA 4BZYA 3AUOA 3B9EA 1VEMA 3IGSA 4RNFA 3A9IA 3VTRA 2OXNA 3A4XA 2XFRA 3CH0A 2VI0A 4D6IA 3WJYA 1H49A 1D3GA 1E4NA 4WF7A 3CTLA 1UR3M 1B3WA 3KL3A 4XZNX 1IT7A 4AG0A 1TTIA 4DZIA 3AOFA 4N9CA 4GVFA 2VENA 4IJRA 4GD0A 3ZR6A 3COTA 4G5DA 1WYIA 1UBSA 2QJIA 3WF2A 2GQ8A 4DNHA 4PZVA 4KT2A 1SGJA 3GS6A 3M5YA 3CIVA 1BFNA 2J78A 4HN4A 1XF0A 4BI7A 2C79A 1TWWA 3FVDA 3ABRA 2OT1A 3MTWA 3WLQA 1K3UA 3KBVA 2FLIA 3VFCA 5GPRA 4UR9A 3NVDA 4GVGA 3PK7A 5G4EA 3EWDA 3RMEA 2HCVA 1JG9A 3N4EA 2DVTA 3DC8A 3B04A 3KOXA 3RJXA 5H91A 1VCVA 3KP0A 4AZGA 3UGRA 3QY6A 5CPMA 3M9YA 4LH8A 3MHUA 4JTDA 4IIHA 5HAOA 3NYZA 4D9PA 3W6YA 2PP3A 3GU1A 3GHSA 1KTNA 1BSIA 2DVXA 1W1IE 2ZZ2A 3VNYA 1XLGA 2EPKX 3UG3A 4GUFA 4KIRA 1TWDA 1KM3A 5F2IA 2DW7A 1UA7A 3GXMA 1JPMA 2R82A 4N42A 3L2MA 4IQJA 4HPXA 3W7DA 3NQBA 2ZRVA 3OO2A 5CZTA 1ZALA 3VMPA 3AALA 1VFSA 3W1RA 1EH9A 1DEDA 4O53A 2WOQA 5C9XA 3QMRA 1Q8AA 2YIHA 2J24A 1X98A 1C7SA 4KEZA 3BLIA 4XUYA 1EA9C 5F4WA 4MJ4A 2VOTA 2FB3A 4C6CA 1DWIM 2AKZA 4LFYA 2UBPC 3VMNA 4LTSA 5MKGB 1XH1A 3UWYA 1F07A 4IUGA 4NXSA 2GJLA 5AYBA 4QP0A 3BLDA 2DIEA 4NIRA 1A49A 2YDSA 1PL9A 4RNIA 4ILSA 1J0ZA 4F48A 4O19A 1ZB5A 4KCWA 3DDMA 4QEHA 4KRZA 3ARVA 1GYNA 3CUIA 2HNHA 3NL3A 2QV5A 4HP5A 2Y1HA 2GGGA 4Q4RA 1PUDA 2ZADA 2GOKA 3VGHA 3B9AA 2HE5A 3WLHA 3AS0A 2PDGA 3LQGA 7REQA 3B8WA 1ENUA 1XRFA 3ZSTA 3SECA 2A3HA 1J5SA 3LXBA 1VPYA 4HD5A 4OOZA 2DPEA 3WF0A 3NZ1A 3QOKA 2W4XA 3PTQA 2J25A 1GZGA 1A4LA 4M3PA 3W24A 4XO7A 6ALDA 3T4CA 1UYQA 2WJZA 3GTXA 1QPOA 3CL8A 3WQ4A 4UTUA 5IDZA 3PUGA 4LBRA 1VJSA 3WK0A 3NZRA 3HMJG 3SFWA 5LGXA 4CD8A 1J18A 2IPGA 1D3HA 1XLFA 2DZTA 1K8ZA 1K8XA 4KKXA 3RRXA 2V30A 3WEOA 2XVLA 3DHUA 4K36A 4AZIA 4GYPA 4Q33A 2DZXA 1E6RA 1M5WA 1W8GA 1WZLA 4J2MA 4GC3A 1GZ1A 1RVKA 2VFGA 1EC8A 1I1WA 4E2VA 3HQ1A 5TBOA 4IP4A 2VT0A 3GDLA 5TAOA 4JY9A 1RHCA 1Z42A 3EDEA 2Y5SA 3HV8A 4PB5A 1X6NA 3V1HA 4OZOA 3A22A 1GVOA 4AEEA 1HVXA 3KVLA 3ATYA 4HOXA 3STCA 2ZCGA 3VOIA 2WBGA 1U5JA 4PUDA 3PB2A 3O0KA 3SZ8A 3PM6A 2OELA 4W5ZA 3VU2A 1SJAA 4YYFA 1QWGA 2EEXA 5I78A 1DP0A 1FA2A 1F76A 2OTDA 1XBVA 1E72M 3DFSA 3N3MA 4Y9MA 2R8WA 1CBGA 3AYTA 4S3JA 8RUCA 3WLKX 4DZAA 2O9TA 5IOBA 2Z26A 1TMHA 4JN8A 4JYDA 3CB8A 3BVJA 1NDVA 2WMKA 1GPFA 3BOFA 2JK2A 2G4JA 3M6YA 3FSTA 1DQXA 3LS9A 3G8RA 2QMJA 3U9IA 4IMAA 1MO0A 3C2RA 2GDUA 4IFKB 2ZZ4A 3PTMA 1ISZA 1S1PA 4GXPA 2OQLA 4B9YA 3GXPA 3UA4A 2YL8A 1W3KA 1PTGA 2Y8UA 1WO2A 3GO2A 3UR8A 4XAPA 3KWXA 2ZUNA 2QAPA 1LG1A 4IL0A 4HA1A 2R94A 5I3JA 1YBQB 4GX8A 1R3VA 1ZBKA 3E0VA 4FB7A 4WK9A 4DX3A 3U57A 2Z2BA 4GFIA 1TQXA 3RM4A 4AISA 1JEZA 1SQ7A 2P3ZA 3CASA 3AFBA 2WW5A 3TR9A 4PB3A 4NZ5A 4LUJA 5FACA 4KMQA 3IEBA 4OHQA 1XKYA 4LNCA 4AMAA 1HVQA 3PBUA 3RM8A 2P53A 4P7OA 1LORA 3PZMA 3VKAA 2XIMA 2JKPA 3QFEA 3ARRA 1X1NA 4GC4A 5E6YA 2FVKA 1R2TA 3VAVA 3FDKA 4I6KA 1EIBA 1DWGM 1LQAA 3H6OA 1Z3NA 2X09A 1KM1A 2Z24A 3DX5A 2IW0A 1XI3A 5LIYX 3AUJA 2QLYA 4X61A 1IIGA 2NUYA 4NG3A 2ZQ0A 2WC7A 1QPQA 1XG4A 1ZFJA 2YZ5A 3WDPP 4K6AA 3D47A 3WNNA 1K8YA 4GZJA 3P7YA 4RCXA 3BZGA 3DHFA 1OADA 5IBXA 1IWAA 1W9UA 1JQXA 4B4FA 4N9DA 5K4ZA 1MRAA 3GUWA 2J8TA 3B97A 1JYNA 1FWJC 1KWKA 3W1XA 4QCEA 4XD5A 2OZTA 3NJ3A 3VUSA 3ARXA 2YL5A 4B4HA 3ZT6A 2WKGA 2PWHA 3OA3A 3CHCA 3OGVA 3VNIA 4M7SA 1ICPA 1EF3A 1HF6A 3VKJA 1SSGA 2O4MA 4EVZA 2YYUA 4WHBA 1WKFA 3SUWA 3NQAA 2WB5A 2PC8A 2ODOA 3GAKA 1JPHA 1VJIA 4NX5A 3H54A 4OT7A 5CSSA 1JPKA 2PDHA 4KS0A 1W3JA 1PHWA 4MJ2A 4AHPA 3I65A 1P7TB 3L21A 4P8UA 1NDYA 3W26A 4JTGA 1QNVA 5I3DA 3L4UA 1B3VA 1M41A 1FKXA 1ADOA 4NX0A 1YNYA 1Q6GA 3S6OA 4IMGA 2X42A 1JCTA 3TQVA 1ZJIA 1S2AA 2PLJA 1B3ZA 3UZJA 2OFJA 3VI2A 4FK9A 3M6DA 1XQLA 3KL5A 1F3XA 1W2VA 1X38A 2QCDA 2QYGA 3FJLA 3WQOA 1FP8A 1XLBA 2VO5A 4NI3A 2A6NA 1AJ0A 4Z2KA 1PXGA 1YPXA 3UJEA 3U7BA 2XFWA 4GKTA 4GQQA 4CNSA 1H7XA 2CKRA 3WJSA 5AECA 3LBMA 1F6YA 3IJ6A 3C2VA 3QR0A 4YLWA 2EQDA 2P8BA 1DWJM 1BTCA 3T2QA 1JD9A 1H4PA 1HGWA 1V6TA 3CWOX 2EHHA 2QHAA 3OYXA 3PZ9A 2YLLA 5G2HA 2GJNA 2XSBA 1OCBA 2R1PA 2Q02A 3WFAA 2Y24A 3TSBA 5CCZA 3D5HA 5K9XA 4DJFA 1HIZA 1ONRA 3ANUA 2QQ6A 3REQB 4E2OA 4AZ7A 1OBAA 4UTHA 1UKSA 1NF0A 2ZZ6A 4WOQA 1W9PA 1B4KA 1DIEA 3H22A 1OYCA 3M0MA 5FJIA 3PUEA 2I17A 4GQRA 4C1LA 2DT0A 3O6DA 3AMGA 5LIXX 3VA8A 3DI1A 4QITA 4HNLA 3KRZA 4HSOA 3SUSA 5A2BA 1YRRA 4ERGA 1GPWA 3PUOA 3APTA 3SEPA 3I4EA 1YXDA 4KEVA 2VC7A 4TR9A 2DEPA 2D0HA 4CCCA 3GHRA 3SURA 4JL1A 2Z27A 1IR2A 3D3AA 1ODZA 1TUXA 4J40A 1RLDA 4I9MA 4B5UA 3ARZA 2XIJA 4DBSA 1F3WA 1T6MA 1E71M 2PUZA 3A24A 1D7FA 7TIMA 1YKWA 5AHNA 4X0VA 2DZAA 2Z2AA 1E56A 2YA0A 4WDXA 2F7FA 2E8YA 3CBWA 4NJHA 1AH0A 1F05A 5D4YA 1FWFC 4V28A 3TN4A 2INFA 1BXCA 3GWQA 3BZJA 1UPPA 3W7NA 3H2OA 3IJQA 3NQMA 4PTVA 3OZOA 2ZXAA 3WL1A 4KFNA 3KVMA 3VDAA 5EMMA 3NM1A 3UT0A 2NZLA 4LYPA 3B0XA 3EB3A 5EA9A 3I7QA 1SO3A 3GW3A 4Z1YA 3IJLA 3NDZA 2VQUA 3I7SA 4DQWA 1SW0A 3CIWA 4MKNA 1TCMA 2BLEA 2GUYA 4NAFA 3QTGA 3WL0A 3WKZA 2DJXA 1VGAA 3GZ3A 3CWNA 4WDWA 2H90A 3M0YA 3VX0A 2NQHA 2RDUA 1V6YA 2KZHA 3DG7A 4WSJA 2DT3A 4FNQA 5CLWA 3SADA 3W85A 4QX4A 2XSAA 2ISWA 4NZFA 3BURA 4HHHA 3TN5A 7ODCA 3KCJA 4F0MA 3NZPA 3WMCA 1XFBA 3FA4A 4U5IA 3TJXA 5HQMA 2OEJA 3CGTA 2GGJA 1JZ8A 2VDGA 4HPHA 1S5WA 4GQ0A 4S38A 2D23A 2C1HA 3KRBA 4RUBA 1XUUA 3N2BA 1FDJA 3VIGA 3ITCA 2BS9A 4QFUA 1RCXB 2EPLX 4GK8A 5D8WA 2CLFA 3RAOA 2YSWA 2VR5A 3LPFA 4ZFCA 3GLCA 5A94A 4B15A 3I6RA 4HQVA 2CWXA 1AODA 1T8XA 2JGQA 3OHMB 3RMJA 4GZIA 3QGVA 4PODA 3UJ2A 2W91A 3UNDA 1I0DA 2ZTJA 1LWJA 1VFHA 1XX1A 2BFGA 3VXGA 5D38A 3NEHA 5IM51 2X7WA 3DG3A 1B57A 4ZOBA 3S5ZA 3MMDA 5HMFA 1C8XA 5AYZA 1M7OA 3USBA 4NYYA 3CT2A 4AZHA 4ERIA 4ZMGA 2PP0A 4QSHA 1XC4A 5I00A 1SW3A 1AH4A 3D0CA 3O63A 1W6TA 1A5UA 3UWEA 1XGZA 2BB0A 1POKA 1M68A 4JQ4A 4J3ZA 1TPB1 1Q6QA 4DO5A 3VNMA 1GQLA 4IG2A 2AL2A 1I2QA 4U2ZA 1QPRA 3K4AA 3B0UX 1BYBA 1A80A 4HBKA 2IXUA 3BG3A 3K30A 1OFPA 1P48A 1MQQA 3FYPA 1V51A 3KFTA 1VH7A 3R58A 2P50A 3KS5A 3ZZ1A 1R2RA 5LNRA 2PD5A 1C91A 2H3BA 2YBUA 4O13A 2AMGA 4JNMA 3ALGA 3W86A 1BGGA 2QVNA 1XIDA 3W1TA 3T0DA 3NQCA 4DZHA 3VGDA 4M81A 3PZVA 5FL1A 1W5MA 3THCA 3LMYA 3DYOA 3WH6A 1EO5A 4H9MA 4L9XA 2CZVA 3CT7A 3LQLA 1A47A 1KFBA 4IFRA 3W23A 2FFIA 5CPSA 3GIQA 3TZFA 3W7GA 4DBWA 3DAQA 2PGRA 5A1AA 4WR3A 3UA3A 3UG8A 1Q7MA 2PGFA 1RBAA 4H01A 3FNDA 4RKAA 5KSWA 1MEHA 2BXVA 1EJTC 3MA8A 4A21A 7XIMA 1V3JA 1YEYA 4Z08A 1QW7A 1X6UA 2GQAA 5I79A 2B7QA 5F2GA 3GH4A 4XKYB 3M0JA 1VHNA 4CCDA 5A6AA 2GQ3A 2WO5A 4TX8A 4B2DA 1V03A 3CYJA 1QAPA 2V67A 2VOMA 4WY0A 3TC6A 1TPUA 1EOMA 2C14A 1O60A 4JFWA 2YFNA 4PTMA 3TW7A 3MKVA 1T96A 9XIMA 4H00A 2Y7EA 3R25A 1V0LA 1IXOA 3AMCA 3G1HA 3QQWA 4CVUA 2PWFA 4LAOA 3P74A 4QGCA 3Q94A 2XVGA 4GE8A 2HK0A 1RBOB 2P88A 3LLDA 2ZIDA 4LC8A 5K3VA 2ZVRA 3AHZA 1SZRA 3OBEA 4C6MA 3TLLA 1FWAC 3R8RA 3CK5A 4XKYA 2VEGA 2NUXA 4JTEA 4MZ1A 4UIOA 3LNPA 1HO4A 3T78A 3LPGA 4IQLA 1QHZA 3BMVA 1LRNA 4CD6A 4HZ6A 2AAMA 1AUSL 4HT3A 2D69A 1OCJA 3GG0A 5G1TA 5HJLA 3FJNA 2V3FA 1S2UA 4AXNA 5I24A 3SCPA 3IIVA 1Y5XA 4PULA 5D04C 4JQ2A 3MV01 1X7FA 5TIMA 1ME8A 1TTPA 4HGXA 5U7SA 4Z2HA 2EJAA 4ADSA 1TZZA 3F2BA 3E2SA 1UQZA 2WVSA 3LK6A 4GQBA 3PN8A 4UQCA 1QTWA 4W93A 3R0DA 2VRQA 3BSMA 4CN6A 3WG6A 3FY1A 3WBAA 1OF8A 4PRTA 1QOXA 4FI4A 4CN1A 4AQLA 2I9UA 1F5ZA 4LS2A 1B5TA 2A85A 3H2FA 4M56A 3T05A 2NQJA 4U31A 4GUJA 2FHBA 4HZMA 1I4NA 2NX9A 1RP8A 1KBLA 1OX5A 1AK5A 3HGJA 3UWQA 1QASA 1OCQA 3UZWA 3S9ZA 2VEIA 5E0KA 1NFPA 4US5D 3S1VA 2NWSA 4UFKA 1F74A 2HZGA 2P10A 4ZXLA 3S2CA 2XDFA 1FFQA 4V1YA 3GNNA 5FEPA 2CXEA 4Q3MA 4JQAA 2XIBA 1VYPX 3BCDA 3GUGA 3OYZA 2G50A 3OZYA 3N3TA 4NAEB 5MF5A 4C6PA 2MUCA 4QTGA 2EG6A 3TYDA 2YW4A 1D7KA 1X96A 4H9ZA 2XPKA 4ZXOA 2OG9A 2PWVA 4C7DA 5RUBA 1SFJA 3FVMA 1M3UA 2QR6A 1WKYA 2IXVA 3B9NA 3NQGA 2F6KA 2QUNA 4LGXA 4HN8A 3T44A 1B9ZA 3F5KA 2DQWA 5FSDC 4N02A 1KNWA 1IIHA 3TN6A 1VR6A 3NSNA 3QRHA 3W7QA 3KOFA 2Y7DA 2O4QA 1W1ZA 3MZNA 1JNDA 4I3GA 5XIMA 2MNRA 8XIMA 4CNOA 4MDPA 2QF8A 1TX0A 1GEHA 2V5BA 3KTXA 5G1YA 1KC7A 1AQMA 1OIFA 3G18A 4KEMA 3W74A 1S2TA 3PBYA 4FR1A 3URQA 1DJQA 2F61A 3G1FA 1EJ7L 4IPNB 4RJEA 1TELA 1WXYA 3GM8A 1MFVA 1TCDA 1JCNA 3NOEA 2OB3A 3T40A 1KCKA 4JHMA 2W92A 5HPOA 4JTTA 3U0HA 3B0VC 3GVRA 1QJWA 3SCNA 1ONXA 3EX3A 3S9IA 3TW6A 4PE8A 3MSRA 2ZWZA 4LVBA 5FJTA 4UQAA 1ZJBA 5I3KA 4B91A 3TYZA 2RAGA 3UZ5A 4ZQNA 3O07A 3PJXA 3GXTA 1KM0A 1V3MA 3VNDA 1KXVA 4Q6JA 4HA4A 1P1XA 4LCSA 3KOYA 1QR7A 1JL8A 1KRMA 4HCHA 5BXPA 2EG8A 1W54A 1K9DA 4JOMA 4X22A 1PX3A 3TWAA 1J6PA 4HMCA 2H8XA 4Z2GA 3ICJA 2J47A 3TWBA 3A5VA 1V6VA 3CH9A 3A4JA 4C5YA 1NWSA 3NQ8A 4GY0A 3UY7A 4S39A 4HK7A 3NQEA 3VIJA 1J4EA 2WJEA 3I7RA 3MS8A 3L12A 5AC8A 4LCQA 2IQDA 1HKVA 1KCLA 1UOZA 3IIXA 3GVWA 1YPFA 4UR8A 2Y8VA 1CGXA 3NO1A 5REQB 2VM8A 2B7PA 1H7RA 5FCZA 4XO6A 4M5PA 3FFSA 5C9UA 3O8AA 2OWXA 5F2LA 3CZEA 5HWMA 3BJTA 3MUCA 4DNMA 4W89A 2Z29A 3LGGA 3M07A 5A8PA 5BWFA 4RDZA 4C1NA 3V4BA 1IGWA 1X1OA 5T26A 2GSJA 4RDWA 2NT1A 1THFD 1HL9A 3VMOA 5DMNA 2J7FA 2WVUA 4UQDA 4ZO8A 5I3FA 1JZ3A 1FKWA 4AZBA 3O2LA 6XIAA 5HNTA 1QNRA 1N7KA 1J0JA 3KHJA 4HA0A 3CYVA 1TE1A 3IGUA 1H2JA 1K70A 5BOOA 3W6LA 3E49A 2ZX6A 2NLIA 3SCTA 1R7OA 2GVGA 1ZP3A 4JL2A 5I03A 1UWAA 3OBKA 4QEEA 4O17A 4AVOA 2YA1A 3BV7A 4BQ3A 2VHLA 1RK5A 3N6JA 3WH8A 2FTPA 7PTDA 3CUZA 4PMJA 1UKQA 3W1UA 2XFYA 3SUTA 2EPOA 4HNTA 3GVGA 5KTLA 3GTHA 1TSIA 2OGYA 1BSLA 2XH4A 3TTQA 2F6XA 1G67A 3CLMA 4NJKA 5CLTA 4DY1A 1CZ1A 3LEPA 4UTMA 3U2EA 1HKJA 2R24A 4PUKA 4FLRA 1ALDA 3EOLA 2XZ9A 4B3LA 3LRLA 1KM2A 1O5RA 1R85A 3BAKA 2OPJA 5CSYA 5IHSA 5LNSA 4JIPA 2PWGA 1M1BA 4PFMA 3TIMA 1Q66A 4FOUA 3DENA 3A9BA 3N6HA 4XIAA 4H04A 2DY3A 3T4WA 5DRIA 1XH0A 3BTNA 3AXIA 4PH6A 4HNOA 3UPMA 5LXEA 1PX8A 4Q8OA 4EXBA 1W1B1 2J7EA 4JIRA 4KETA 1XD0A 4HJFA 2Y89A 4AFYA 3NFUA 3BWWA 2ACUA 2YLAA 2GWNA 2REQB 1QBAA 1AL7A 3T0TA 1TVLA 2CHRA 5EMJA 3O9NA 3BQ6A 4AY8A 2NXHA 2HV5A 4LANA 1QU4A 3OW1A 1ZAIA 3RR1A 4L9ZA 3PNUA 3KS6A 4PMOA 4A2SA 3ELFA 3BLLA 1XIFA 1TV5A 4UOQA 1JFHA 4WLCA 2V0TA 2UY2A 4YVXA 4KWUA 5D2TA 4MZYA 2YW3A 3U5UA 3V5CA 2Q8LA 3W4RA 4IPIA 1VPXA 2RUSA 4B3ZA 1RD6A 3P0XA 4G1KA 4JTIA 3CMFA 2CLHA 3QF0A 5D37A 4C1KA 3VKCA 3EWYA 4IP7A 4GCXA 3S0CA 4Y2WA 1ADDA 1JDAA 1QATA 4ATWA 1UP3A 4Q8NA 3L0KA 3WQ8A 2X41A 4MUZA 5KMYA 3EYPA 4DAFA 4C6FA 4HZ7A 5LNWA 3B8VA 4DXKA 4F0LA 3APGA 4XVEA 3N25A 2UV8G 4GYJA 4NAEA 2ZUMA 4F79A 2C1GA 4AD4A 2CXGA 3RLUA 2JKAA 5EFDA 3DBPA 2NVCA 1LP6A 1S5MA 4AWUA 1YXCA 4JGDA 2ONEA 3RR4A 3SN1A 4H9YA 3WBXA 4W87A 1VFMA 2WNQA 4UFHA 2XUCA 2QCNA 3TJ4A 1E0TA 4CEXC 2O9RA 3LCLA 4FIQA 2POTA 1A5OC 2B31A 3DG6A 2CZFA 3KUMA 4WX2A 1TE6A 1TJ1A 3TSMA 4AZ5A 2BG5A 2ZTKA 1I60A 1LQ2A 1L0PA 4JY8A 2BY1A 4Q8PA 4NT0A 2CFFA 3CTTA 3NIYA 1P5BA 3GVVA 5K2ZA 2OX4A 5D05A 5FIPA 2Q71A 4U4MA 1OT1A 1E0WA 4MLJA 3EEGA 3EX1A 1LBLA 3EPMA 2H9AA 2WWCA 1ZGDA 2PDYA 4RZ5A 2VX5A 4GHRA 1AD1A 1ZNNA 4KRTA 4FOJA 2ZA2A 4LY8A 2QJHA 3V18A 3QY7A 3VINA 5L6UA 4H8HA 4J7RA 1UR0A 4J3SA 1HNYA 2EF9A 1G7UA 4XAZA 5JXQA 2G3MA 2ZA1A 3Q65A 3TC7A 1LLWA 1WKDA 3T8LA 1UUMA 3W28A 4O15A 1ITXA 2XVKA 4GA8A 3L7RA 1R5YA 2J77A 3DGBA 2Z4GA 3S47A 5IBXC 1W5NA 3AXHA 3GNDA 2YPIA 3JS3A 5FJJA 3HTWA 3S1XA 4CNTA 1H5YA 1OFQA 2WQPA 3HQPA 4AD1A 4QE4A 5AHFA 4POCA 3MY9A 2QXWA 2OZ3A 3NWRA 3HB9A 4L56A 4XAYA 4DWSC 4MLRA 1K1DA 3L2IA 2X8RA 4QDPA 1HKIA 2FGZA 3NL6A 3P80A 3ME3A 2XM1A 4TO8A 1U30A 3U5YA 2YCKX 2PFHA 3CZKA 3ZVHA 4C6QA 1LDCA 5LA2A 5HPCA 3PANA 4NZCA 3CIXA 1JPDX 4FPSA 2FGLA 3GG7A 1QNPA 4Y7EA 5EBUA 3WEMA 2C1IA 2QKFA 4PTXA 3BOLA 2AL1A 3BQ5A 3WK1A 4G9PA 2JE8A 4PCFA 3OB8A 5FSEC 3FSUA 3H55A 4PMUA 4WVXA 5AN7A 3RLGA 3WMSA 3EKLA 1I2PA 2JFEX 2VDHA 4ECLA 5JIWA 3GX9A 4MB5A 4IXXA 3WLIA 2C6QA 3SCRA 1GQIA 4Y8FA 2XWDA 4H7CA 1CB7B 4Q4OA 4MJZA 4W86A 1CCWB 3N9KA 4A05A 1FCUA 1S2CA 3UU0A 1PKLA 2UZ9A 3MO4A 1NFBA 5CZSA 2PLKA 3ITVA 2BXYA 1LLZA 4HPJA 2ALDA 2XVPA 1GOXA 1KR1A 4UTTA 4XVDA 4IF2A 1SSDA 4L1GA 1BVWA 2A0NA 3N2CA 3ONCA 3CV1A 4OTKA 3QM3A 3ITLA 3PPGA 4D6CA 1ZLPA 2NQLA 1PIFA 4GYKA 2XYLA 3KX6A 4NKCA 1C8YA 1MXSA 2PCEA 3U3HA 3E1F1 4E3TA 1CX9A 1VQTA 3DIPA 2VZSA 2CW6A 1ECQA 2F2HA 1SR0A 2IKJA 3NA8A 4MPQA 1QI5A 5HNRA 2DSKA 2P5NA 1T8QA 3VOHA 5G4HC 3NNTA 4JQ1A 3GHTA 4UMAA 3SJNA 2IQ0A 2WMFA 3GFXA 4JZ5A 4AEFA 1YDVA 2IQTA 4O52A 1HT6A 4A3YA 2D3LA 1RH9A 1UWIA 3O05A 4MY1A 3TXZA 1ZCCA 2AGKA 1D2KA 1OG6A 2UY3A 2D20A 2IKIA 4IGMA 3AMKA 1QHPA 3EX6A 3QTPA 3ECQA 3TFCA 1XG3A 2OLAA 1E6ZA 1LTDA 3K8KA 1MDRA 4D6EA 1KFJA 1Z41A 4JTUA 1PO9A 4LQ1A 4AZCA 1JRBA 3PPFA 1US3A 3RCNA 2ANUA 1XM3A 4O0KA 5E9XA 4JBRA 4ATDA 1GORA 2CIPA 3ANYA 1F4AA 5ECUA 1R8LA 4M6VA 3WUBA 6TAAA 4O1DA 2PDWA 4HNCA 3GVQA 1EX5A 3HQOA 3IV3A 2ZC8A 2C3ZA 5CGTA 4RNJA 1P0DA 1S2VA 3FGCA 3R43A 3NQVA 3TJIA 5A8QA 4TTGA 2O92A 2E1DA 1I1XA 2ISSA 3PWAA 4D2JA 2PDPA 2QS8A 1OF6A 5IFPA 4YCOA 1DJWA 4XG1A 4XZLX 3F5JA 4ACZA 1A53A 5D02A 1B3XA 1JULA 2J27A 2WANA 3SB0A 5LHEA 1XR2A 5M5DA 2WCSA 3W7MA 4C6EA 3AU2A 3EWBX 5SWUA 3UQNA 2WM0A 3WK2A 1XLMA 4N0RA 4IIDA 4RZ4A 2ZUWA 2V81A 3PZNA 2DH2A 2OLSA 2RHGA 4DI9A 1WX0A 2P0IA 2W9MA 1T41A 1H11A 4W85A 3RG6A 1XYZA 3DFHA 2FHFA 4YHEA 5FJPA 2HQAA 1DWAM 2Q01A 3T8QA 3HIJA 3ANVA 3M47A 4DYKA 2JEPA 1ZBVA 3RX4A 1UZ4A 2PTYA 3ES8A 2FZDA 2XH2A 3URBA 1LRQA 1IR1A 5ECVA 1GNXA 2Y88A 4AYSA 3G22A 2AMXA 2VWTA 2E6AA 1IZCA 1RSCA 1TPDA 3SBFA 3JZUA 3SUVA 2VYOA 4L6HA 3QV6A 3M4HA 2G0WA 2GUBA 1X39A 2FVMA 1IEQA 1TA3B 2G8ZA 2O55A 3MANA 2E9BA 2A3AA 4WXYA 4JKMA 1OK4A 3QMTA 1P6CA 5JU6A