4JQ4A

Akr1c2 complex with indomethacin
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 112
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq4A00
2P5NA 3C3UA 1S2AA 1Z9AA 1VBJA 2DV0A 3O0KA 1RALA 5DANA 2AGTA 3V35A 1AH4A 3D3FA 4WEVX 2PDJA 1X97A 4Q3MA 4PRRA 4XO6A 2PDWA 3BV7A 4GCAA 3UYIA 3MC5A 2WZTA 3U2CA 2HVOA 3R94A 3GUGA 4JTAA 4WDXA 1XJBA 4YVPA 2CLPA 3UZYA 3UZWA 3MB9A 2C91A 2NVDA 4F40A 4IJCA 3R8HA 3EB3A 3R6IA 3COTA 4YVVA 4DBSA 4PUUA 4PMJA 2ACSA 1YE6A 4QR6A 4GABA 1AFSA 2PDKA 4JIHA 4XZHA 1HW6A 1EKOA 2DUXA 3V0UA 1PZ0A 4GA8A 3WBXA 1Z3NA 1IHIA 4YVXA 1YNQA 4XZNX 1MZRA 1RY0A 4WDWA 1ADSA 4GQ0A 1IEIA 2IPJA 4JIRA 1OG6A 4EXAA 2A79A 1S1PA 5LIKX 3LZ3A 3CMFA 1XF0A 1XGDA 3Q65A 4QBXA 2HEJA 1ZGDA 4JIIX 3GHRA 3GHTA 4WRHA 2PDCA 2HE8A 1MRQA 5HNTA 4XK2A 3R58A 1LWIA 4I5XA 2ALRA 5LIYX 4RPQA 5JH1A 2ACQA 1EL3A 2IKHA 4XZIA 3CV7A 4FA3A 3N2TA 1PZ1A 3G5EA 3V0TA 1C9WA 2F2KA 1K8CA 2PDPA 3UZXA 2IPGA 2I16A 2DUZA 4L1XA 4PRTA 3RX4A 3LD5A 4WDUA 1EXBA 4JTRA 1UR3M 3O3RA 2VDGA 4OTKA 4L1WA 3EB4A 3R7MA 4IJRA 3NTYA 3CAQA 2FGBA 3UZZA 2ACRA 3LN3A 4AUBA 3FJNA 4G5DA 3GHSA 1T40A 1HQTA 1ZQ5A 1PWMA 3LQLA 1T41A 3BUVA 3UWEA 4H8NA 3LBOA 4JQ2A 2ACUA 3LENA 4DZ5A 1A80A 1Q13A 1PYFA 2FZ8A 3UP8A 4JTQA 1GVEA 4ASTA 4PUWA 2WZMA 2PDNA 1Z8AA 2PDMA 3LUTA 3QKZA 4PR4A 4LAZA 3UG8A 2R24A 2PD5A 3WBYA 1YNPA 4JTCA 2PDYA 1AZ1A 3GHUA 3M4HA 3S3GA 2PDUA 1QRQA 4FAMA 4R9OA 3ERPA 4EXBA 5HA7A 3LNMA 4QX4A 1LQAA 3P2VA 2HVNA 2IKIA 5KETA 3LEPA 3WG6A 5M2FX 3V36A 2PD9A 1QWKA 4XZMX 2PDBA 3RX3A 3V0SA 4XO7A 4DBWA 3UFYA 4QXIA 2HE5A 4ZFCA 1X96A 3G1RA 2BP1A 1AH3A 3H7UA 4FZIA 3B3DA 3H7RA 4DBUA 5JH2A 5LIUX 2IQDA 3WBWA 2HV5A 2PDLA 2BGSA 4NKCA 1RY8A 3H4GA 3N6QA 3R8GA 2BGQA 1X98A 2INZA 1US0A 2INEA 4LAUA 3T42A 4JQAA 4JQ1A 3ONBA 1Z89A 4ICCX 4XVEA 2FVLA 4HMNA 5AZ1A 4MHBA 2PF8A 3EAUA 4LBRA 3CV6A 1SM9A 4GACA 5LIXX 4HBKA 3BCJA 2PDXA 1AZ2A 2IS7A 2ISFA 2J8TA 4IGSA 2QXWA 2IPFA 3M64A 3R43A 4GIEA 2HDJA 4FALA 4XVDA 1Q5MA 2PDQA 1FRBA 2FZDA 3DN5A 5AZ0A 2PDGA 1YE4A 1AH0A 1EF3A 2PDHA 2PFHA 4LB3A 4H7CA 4WGHA 3F7JA 3M0IA 3RX2A 4XZLX 2PZNA 4JQ3A 1S1RA 3FX4A 3ONCA 1J96A 4XAPA 5C7HA 4GQGA 2F38A 3Q67A 3WCZA 4JQ4A 1VP5A 1S2CA 4LB4A 3CAVA 4LBSA 2PEVA 4YS1A 2IQ0A 2PDIA 1JEZA 1PWLA 2R9RA 2FZ9A 3VXGA 2NVCA 3LQGA 1ZUAX 2IKGA 1M9HA 1R38A 2I17A 3LZ5A 4WDTA 3CASA 5LIWX 2FZBA 1MI3A 5HNUA 2IKJA 3KRBA 2PDFA 4Q7BA 3UGRA 2IPWA 4JTDA 1ZSXA 3DOPA 4YU1A 3BURA
chains in the Genus database with same CATH superfamily
1O1HA 1S2AA 4CEXC 4EPKA 3OVQA 3T0AA 4ZQCA 1W9XA 3V35A 4IT1A 1E40A 1QATA 2B0MA 3ARTA 3NQ7A 3O6DA 2NWSA 2Q6ZA 3GDTA 4IFRA 3SDOA 3ZZ1A 4GZEA 3WQVA 5EMKA 1XYZA 3W71A 1ZBCA 4NNBA 2P53A 5HMDA 1F05A 3O6CA 1OEPA 2Q3OA 5C2GA 3GFYA 5F1UA 3LPPA 2V3GA 2V5KA 5D2TA 4KEMA 3ZT7A 4B2DA 4OUIA 4JYEA 2GPTA 3P61A 1QPQA 1XBVA 1PKNA 3Q2DA 3N11A 4QLLA 4PMVA 3BAKA 1SR9A 1BYAA 4I5UA 2YXOA 2V63A 4AHQA 3C56A 3RUBL 4GUJA 3GH4A 3P81A 3IIXA 4C6EA 4YTSA 3PBUA 3WLOA 1J5SA 3M0KA 3MHFA 1L8NA 2Q8XA 2PMQA 2J9ZA 3C8FA 2X1RA 2A6LA 2WNWA 2YKKA 5AY7A 4XUGA 2CYGA 2BOFX 1OGSA 3RMEA 3KRZA 1N2VA 4J3VA 2CLHA 4AD4A 3PJXA 3W01A 3MU7A 5LNSA 5H91A 2QCCA 5CAKA 1EA9C 4J2MA 4CNTA 4HNVA 1BKSA 3WF0A 4GBUA 5KMYA 3U4FA 1UUQA 2O4QA 2C0AA 1GQJA 3FAXA 3IS4A 1ZGDA 3E74A 1IIHA 3LV6A 1RP9A 1S2UA 3BG3A 2YXXA 2BXZA 2HE8A 1UH3A 3EKLA 3HBLA 4JY8A 3RCNA 2CHOA 2YCIX 1WXYA 3S1UA 3AYTA 3B8DA 3E2QA 2NX9A 3THCA 5BWFA 1Q4WA 2IUZA 2XZ7A 3I68A 4DWSD 4GZJA 3EOOA 5T9BG 2ANUA 4FB7A 3MV11 2FFCA 1M53A 4U10A 2A3HA 3GIQA 2CWNA 3TXVA 1XRSA 3W0KA 1UD3A 3W2UA 3GTNA 2J13A 4H7VA 3H12A 3SRKA 3UXKA 1UC5A 3ZT5A 3N19B 2NUYA 1A5OC 5DT7A 1EGMA 4QNEA 1QI0A 4LVGA 3OP2A 3VD4A 1IEWA 4MKNA 1H7XA 1XYAA 4EWND 2ACRA 3FJNA 3LA4A 2OYLA 4MYAA 5FJPA 2Y0FA 1TMQA 1UR9A 2BTMA 1YW1A 2O7SA 3AIEA 5EA9A 3ZJ6A 3WLRA 3D0CA 1C7TA 4UQCA 2VNCA 5H8MA 3LENA 2Z25A 3DESA 3HMJG 1CXHA 2FZ8A 4JTQA 3NEHA 5LGXA 2XM2A 3NQMA 3QV6A 5FOOA 1RD5A 1FA2A 3IGSA 4AFYA 4HHPA 2PDMA 2W91A 1KBIA 3KVLA 3G24A 4GPNA 3EX2A 4C5YA 4C5ZA 2PDYA 3PC0A 1AZ1A 4V28A 4HU0A 3N13A 4AXNA 3D5HA 3ERPA 1CI1A 1GJPA 3M07A 2WSYA 5AECA 3IVUA 3U0HA 1DIEA 4WLCA 4AC1X 4J27A 1QI5A 1PHWA 3S5NA 5LA1A 1UP0A 1OY0A 1BHGA 1BTMA 3RX3A 1UZDA 4XO7A 3TC6A 2OR2A 4MFDA 4IMGA 2BP1A 1FX6A 4L6HA 3E6EA 4JTTA 1VCFA 1MW3A 1TFVA 3P62A 1KC7A 3VGHA 3B8WA 3W1LA 4UOQA 3DFNA 7A3HA 3RPMA 1GPFA 2BGSA 3N6QA 3RU8X 4A2SA 3SECA 5AHLA 2ABAA 2J7BA 1ZENA 1H4PA 2UY2A 1XUUA 4C6KA 4JQ1A 1DV7A 2D20A 3KW3A 4GQBA 4MDPA 3B9DA 3S4TA 2AAMA 1RQBA 4HMEA 4MJ2A 2FJUB 4Z08A 3KBMA 3WMBA 1VFUA 5LIXX 4RR4A 3A47A 4TX8A 2PDXA 5HJXA 1IWBA 2BHYA 2HISA 4JFUA 3R43A 3THUA 2OQHA 1LRQA 3SFKA 3NZ1A 1FDZA 4WGXA 1DIOA 4YJ5A 3QOKA 4GVGA 4YHEA 4WSKA 3VGFA 4D72A 5AHEA 2DP3A 4S39A 1TZ9A 1BRLA 2C1IA 1C8XA 1OZQA 4AISA 4M8UA 3RX2A 5K3VA 1UZ4A 4JQ3A 4GY0A 2VEIA 3VCNA 3S1GA 3ITVA 3CC1A 3Q67A 4V2XA 3ZVHB 1I4NA 3DFTA 3KRSA 3W7KA 3NSXA 4JICA 5I78A 1YDNA 2BVYA 1H61A 3OPSA 1B3VA 3JS3A 3A9IA 4BZYA 1B9ZA 4JNZA 4AWTA 2QIWA 1VKFA 2EG8A 3KEHA 4O13A 3AJXA 3TKFA 4GBDA 3EWUA 1HKIA 3RYSA 2V2CA 1OFBA 4L1GA 1SVDA 4ECLA 3AUOA 4R27A 1YPIA 1GJWA 3P67A 1PX4A 1XLLA 3CT2A 3IGHX 4HPNA 5U4NA 4J40A 3LHWA 2BVTA 1A5MC 4S3DA 3USZA 3R2GA 5D37A 1QU4A 3CIVA 2V3FA 1A49A 4O4WA 7PTDA 1V02E 4PB5A 4FNRA 2ZX6A 1TX2A 5D9OA 4PRRA 3QQ1A 2ADAA 1DHPA 1V0NA 2DZUA 2XVNA 4DRSA 3TP4A 3F5LA 4NI8A 1H1YA 1E1FA 3UW6A 2CLIA 2C79A 1T7LA 1ELSA 1UJPA 2W66A 5LSMA 3E2VA 3KBVA 1FDYA 3G8RA 2UZ9A 2YBVA 4OE7A 4QS5A 3WNKA 2INFA 1AL7A 4LNCA 2P8BA 3E0FA 3WQGA 3BVJA 4L4LA 4AF0B 4B92A 4INFA 1QPRA 1OGBA 5EKYA 1VPYA 1LYXA 4CQDA 2H8XA 3MPGA 1FFQA 3W00A 4CN6A 3S6DA 1FWCC 1HVXA 2E67A 2ZX7A 3RLGA 4XD5A 3ATZA 4DWSC 1VLIA 3G2GA 1ZAJA 2HEJA 1W1B1 1OD8A 2AKZA 4JN8A 3WEZA 4N0RA 4RX0A 6REQB 3STEA 4LBUA 3VUPA 2WCSA 3H53A 1I2PA 1MFUA 5CXPA 3FVMA 5A6TC 4GUIA 4R7OA 2FTPA 1BVWA 3LY0A 1W1ZA 1EBGA 3N4FA 4O28A 2ONEA 3QF0A 2EPLX 2NWRA 2VR2A 3G5EA 4D8AA 3UXLA 1C9WA 1JPMA 3NIYA 4HQVA 4HHHA 4HNTA 1DORA 2DH3A 1JDAA 1LRNA 5AC8A 4KEUA 3MKCA 1QPNA 3OTRA 3CTTA 1MXDA 4Q8MA 2NSOA 1MXGA 4NRSA 3PTKA 5EPDA 3OJGA 1RK5A 2OZ0A 2GOUA 1FWIC 3NXLA 1Z41A 4LYQA 1AA1B 3NTYA 1UD4A 5HQEA 4IF2A 2IMRA 2PCQA 1KFWA 3Q45A 1EJWC 3WO8A 4WHBA 4HU4A 4UTMA 1M03A 1EGVA 2WM1A 4JN6A 1KFLA 3OBEA 3RMJA 1E73M 2JFEX 1WAUA 1WBHA 1U30A 2DPEA 3AMGA 4E3TA 1K6AA 2ZKMX 3A3XA 2GJNA 1LOLA 1NELA 3WNOA 3VTRA 3T0BA 4J2PA 1Z8AA 4B3LA 2ZE0A 4LAZA 3N2MA 1K9EA 3MUY1 3KVJA 1UYQA 2WPBA 1MYRA 4P8UA 4JTFA 4OOUA 1KWGA 4DO5A 4JZ5A 1VEPA 3W22A 4L7ZA 1U22A 1GCYA 1SZRA 1A3WA 4Z1DA 2D24A 1YMYA 1P1XA 4W85A 5XIMA 4IP7A 3CWOX 2GYIA 2GL5A 1RSCA 4FX7A 2ZUTA 3GNNA 5T26A 3T9PA 5HQLA 5F2LA 4PSPA 2A3EA 5BMWA 3XISA 1B31A 4UTFA 1KLYA 1U83A 4Z17A 2ZTKA 4CD5A 2QF7A 4RCXA 2OVLA 1E0UA 1X39A 4P7QA 1H62A 1NWTA 1SSDA 4K38A 4ACZA 3N9KA 1UC4A 3E96A 3UWUA 2ZYFA 1EXPA 4DUXA 1RJPA 4B4HA 1WP6A 1JZ7A 1G67A 2VL4A 2YZ5A 5EL1A 4HB7A 4K8EA 1Z89A 3AC0A 2BZNA 2VWTA 4WOQA 3LMYA 2XN2A 3FSTA 1FH8A 1W3HA 3CZKA 1TO3A 3WNPA 2DZBA 3AHYA 4LW7A 3S2MA 2YDSA 4LBRA 4HIBA 2OLAA 4ZODA 2DT3A 4F0MA 3SY1A 1Z42A 2V5BA 3PUOA 2R82A 3T0TA 1FCVA 4IPNB 4WF7A 3GBEA 1JD7A 1PYMA 2GUUA 5ABEA 1Y0EA 1G6CA 3MMWA 2Z2BA 4M6QA 3S2LA 4U2YA 1FRBA 5BRPA 4LANA 4X60A 1LQ0A 1MW0A 4H2CA 3AS2A 3UR2A 4C65A 4NAFA 3J7HA 3UG4A 4IFKB 3EWDA 1LBMA 1OFAA 1D9EA 3UY7A 1GG1A 2RJHA 1E6NA 3IARA 4NU7A 4J3TA 1D8WA 1DPMA 1XL9A 3S5SA 1KTBA 4NIRA 1W1YA 5D8WA 5CG7A 1TV5A 3UT0A 4QG9A 4BCEA 1QK2A 5FSDC 1JEZA 3PWIA 3QZEA 2GWGA 3KS6A 4KGLA 4A8IA 2VO5A 2PU1A 4AZBA 3S5OA 4LOCA 5TD4A 1UG6A 2V30A 4AD1A 1KTNA 3TMQA 4Q8OA 1JDCA 3TJIA 1M9HA 3OOQA 2I17A 4ORMA 5BW6A 3RPTA 5LHFA 3IK4A 4H41A 1TVLA 3OEXA 4MUPA 2HWGA 3VGEA 4N9EA 1N8WA 5BOFA 5A8PA 3T81A 3AICA 4ZTYA 4BS0A 2VX6A 2OSYA 4OV4A 3M41A 3U7BA 3C3UA 4GFSA 1IZJA 1GYNA 1EO5A 2WVVA 3NAVA 5AB3A 1QI3A 2GJXA 2FZMA 2OOGA 4U31A 4IOTA 3LYEA 4IIEA 4XO6A 1BF6A 4P7RA 1Z7AA 3ARUA 1HZYA 3LGEA 1MVYA 3PSWA 4M7TA 5C70A 8A3HA 4ZMGA 1IR1A 1RP8A 1XGZA 4TMCA 3EDDA 3N15A 3TJXA 1AMYA 3VMOA 3PSVA 1KFBA 3GVVA 5G1MA 4UTWC 2CZEA 3KP0A 4X22A 1K3UA 3GZ3A 1DQUA 1W8SA 4ZVJA 3TWBA 3LMZA 5I79A 2WO5A 3K13A 3VOCA 3ME3A 4Z2IA 1E51A 2CBIA 3MZ2A 2QT3A 3H54A 4XIAA 1AFSA 4NJIA 4N9CA 3W85A 4BI6A 1JDEA 3DFQA 1HW6A 3AIUA 3ZM8A 1DIKA 4V1YA 1XBXA 4YCPA 1XH2A 2EJ1A 3AYVA 2OWWA 6TAAA 4FXRA 4OBSA 3W2MA 1JI1A 3EDFA 3UU0A 3KUMA 4V33A 2QMJA 1HJXA 1PZ3A 3KZPA 4B5WA 2I57A 4CKQA 1CLVA 2Z00A 3QH2A 1FP9A 3EKGA 1UB3A 1NDWA 3W1NA 2WKJA 3AXIA 1S1PA 2VOTA 1KRCC 3S9YA 1GHSA 5SWUA 3TZFA 5FF2A 3H26A 4AB4A 4ADUA 4ILSA 4V1XA 3P6LA 4HNNA 1KRBC 3HN3A 1T8QA 4D6IA 1KW1A 1XIHA 1XSKA 3HA1A 4GIAA 1EUNA 1XIBA 1F9CA 5I00A 4IX2A 4MB5A 1SZGA 1WPCA 5TQLA 1M7PA 2QUUA 1TUXA 1XKJA 4PULA 1DJHA 1XHGA 4UR9A 2PWUA 3GFZA 3UWWA 1MEIA 2XH2A 3I7RA 1DXIA 1SW3A 3F4VA 2BB0A 4NG3A 1B3OA 1TPEA 5DO8A 1UQYA 2IPGA 3QR0A 3VM7A 4PRTA 2VRQA 3P3BA 1IZCA 2JGYA 1BVZA 1FUYA 2OWCA 2D23A 4LH8A 3KDOA 2GQ9A 4WDUA 2ZRUA 4GXWA 3AZRA 2DUAA 1SZFA 4JY9A 3EMCA 4L1WA 3SIZA 4UTUA 2J74A 4NZ1A 2VOMA 3DYPA 3CAQA 4I5RA 1UUOA 1AG1O 2XGBA 1D3GA 3LN3A 4QGCA 3CLWA 6CGTA 2E1DA 4U2ZA 3MDUA 3OVRA 3G1YA 4MNLA 4A05A 2CFFA 1DWFM 2XJ7A 1A80A 2I1OA 4PODA 1M7OA 1CEOA 1GVEA 2FKPA 3BW4A 3UESA 2F9RA 4O14A 3VDAA 1RBAA 1VRXA 1YHTA 4ZQRA 2YLAA 1W3JA 3APTA 4OUEA 1H7OA 1S3HA 4AZ6A 1JVNA 5AC4A 5D9MA 1I1WA 5HOSA 2X1TA 8RUCA 1K8XA 5BZAA 3DDMA 3AMLA 2WBGA 3JU2A 1Q7ZA 4UFMA 4AY8A 1EJ7L 4GH3A 1E55A 4FXSA 4ZOAA 2G97A 5DCEA 1ISYA 3NNTA 4M1BA 4UIOA 1K9DA 2REQB 4LCRA 3ZQ9A 4O0QA 2JQXA 3GVGA 3L0KA 3QFEA 2G3FA 4GWEA 3MYPA 2VHLA 5G4HC 3A22A 4XG1A 2HV5A 1HO4A 3SY5A 1N8FA 3HPZA 3WQ6A 1TTJA 3OYZA 3P5ZA 2WC4A 4IGNA 1XINA 2ZFAA 4C6IA 3IVTA 4BQ2A 3M6DA 3TJLA 3MW7A 2I7GA 1T5AA 1WKFA 3VOHA 4LUTA 1EEPA 4FEZA 2QDDA 2Y6ZA 3MBFA 1SJCA 5M5DA 4J3XA 1ZCCA 3OBKA 3OHMB 2EEXA 1UOZA 1TWSA 3PJUA 4BA0A 5KEZA 3C61A 2PRLA 3VUSA 4GACA 1QT1A 3BCJA 4FNQA 2NXGA 1R9ZA 1TB3A 4XBSA 5HUPA 3SQMA 3VX0A 1FWRA 4GIEA 2HDJA 4XKYA 3CEUA 3GXMA 5A6AA 3ZS4A 3PUDA 1OVDA 5FF4A 3QJAA 4IICA 6A3HA 5CEWA 2BMBA 4H6QA 1E6QM 3PS7A 3UWYA 3GYCA 3SQSA 4P7NA 4MYXA 1TJRA 4WGHA 3M0IA 3NQAA 2G50A 5FAGA 3UG5A 2HS6A 1W5QA 1F3EA 3SADA 3WF4A 2H9AA 5LGZA 1K77A 5FF3A 1BWKA 1S2TA 3O7UA 1OCJA 3WNMA 2PWEA 1VF8A 1VP5A 4PBFA 1S5TA 1A5NC 3M5XA 4RDYA 3B9EA 3SN0A 1BWLA 2FQIA 1DQWA 4O1AA 1R9YA 2GGGA 2OZ3A 3AIBA 3WZ0E 1UIPA 3D3AA 1TYGA 2FH8A 4QJ5B 4KRZA 3TAOA 4MUZA 1SFLA 1WKEA 4IUOA 4OOZA 1ALDA 2QCGA 1EF2A 1MI3A 4FLOA 4AAJA 3WBAA 1H63A 1UROA 1HJWA 2NV9A 2EPHA 3UGRA 5DFAA 4LUJA 4D9PA 4AYSA 1M5WA 3R1ZA 4NZ5A 5M17A 1UR8A 3H21A 3ZJ7A 4EANA 1O7AA 1R8LA 1R9XA 3GFXA 1GGOA 1QCWA 2Y7FA 3QQ0A 4HZ6A 4DAIA 4C91A 3W3OA 4MWAA 1EHNA 1JYVA 4QM1A 2DJLA 4TX9A 1RALA 3VIPA 2CKRA 2VKZG 1WZMA 3D3FA 3ATYA 5ABFA 3EXTA 4Q3MA 1SSGA 1GVYA 1GQLA 3HJZA 3HFTA 4H19A 3BV4A 2XWDA 5EMJA 1TTQA 3BTNA 1NU5A 1IQ8A 3MTWA 4WDXA 1DIDA 4NHVA 2X0SA 1MFVA 4UUIA 3TZNA 1V7YA 1THFD 1W3IA 3OZOA 2HBXA 3UZYA 1J0KA 4UFHA 5K4ZA 2Y4SA 4FNUA 2XZ9A 4G1NA 1XLFA 2D1ZA 2E3ZA 1Q4NX 4JDYA 4H2HA 1MO0A 3CL8A 1NP0A 3W1TA 3K46A 2JALA 3MMTA 4GRSA 1FWAC 1H2JA 2ZXBA 3FN9A 3MP5A 1VGAA 4D6JA 4QR6A 4LUTB 3KZSA 1H1ZA 3NXFA 3FFSA 2WCAA 4U5KA 4KRTA 1PZ2A 3V0UA 3RIKA 3B8SA 3VD7A 1P48A 3PZIA 2WJEA 5GQBA 4GZIA 1ME8A 1DWJM 1VCVA 1C9DA 4XZNX 3CMJA 4R7WA 5CSSA 5PTDA 1O5RA 2CIPA 2E9MA 4A4AA 2ZA2A 2B4GA 2DEPA 4WKFA 2X7WA 4RV3A 1T99A 4H3DA 1BG4A 3CH0A 1H5YA 4OT7A 1FWBC 4PCPA 4ZO6A 4GX9A 1IT7A 1YDYA 2O55A 4PMUA 3ZMRA 4GUFA 4V15A 2Z2AA 4WRHA 4QJ3B 1OZMA 2PWGA 3QY8A 1MRQA 1MUCA 3E0IA 3LX9A 4H8VA 4U33A 5A6BA 3HMCA 5CPQA 3VPLA 1XYBA 1EGZA 1EL3A 1W3NA 3ITYA 1AQ0A 4FXJA 1QPKA 4KCTA 3FYOA 2OODA 1TE1A 3L4WA 3WDQA 1DVJA 1WE5A 1BXBA 5EFDA 2VEMA 3SUWA 4WY0F 1OFEA 1M7XA 2OOFA 3AS1A 5D2XA 3DZ1A 4QP0A 2CWXA 5CCZA 5D32A 3IRSA 4LWWA 3TMLA 4ONVA 1HTIA 1JCYA 1BSLA 1KCXA 1ME9A 4TOQA 2YDAA 4DXKA 3SGUA 3H22A 3TOPA 4DVOA 1TV7A 4NAEB 2NV1A 2EF9A 2DORA 2FGBA 3QMSA 3W53A 3ZWSA 3VX1A 1IV8A 5LHEA 1XLJA 4US6A 4DZHA 3EX4A 1US3A 1R7AA 5JQ9A 1RUSA 3T07A 5A2BA 3ARSA 4EWJA 4IX0A 1J12A 3UP8A 1H60A 2CLKA 3A5VA 1UH4A 4KWSA 4CQCA 1ONEA 3ZR5A 4UR7A 3GM8A 4IGHA 2EKGA 1NVMA 2YDRA 3TH6A 1YTKA 1XP3A 4XD4A 1GZJA 4W8BA 3L5MA 2I14A 3UCCA 1A3XA 4O11A 2FGLA 1DJQA 3OGSA 1H7NA 4GISA 2DQXA 1XH0A 3CO4A 3SN4A 2EXOA 5K4XA 1RCOB 3NR0A 1FP8A 2IKIA 4W87A 2OEMA 2J88A 1A5UA 1E0XA 4I6KA 3HG2A 2PD9A 1QWKA 2C71A 1XV8A 4CNNA 3N2CA 2WVTA 3BW2A 3RDKA 3PY2A 2J62A 4FHAA 2PWFA 4C1NA 1LDCA 2X2GA 1LLZA 2XIBA 1MRAA 3WL0A 1XYFA 3WBWA 1TMHA 1OCBA 2FH6A 4TR9A 3KWXA 1CLXA 1QWGA 1IF2A 4GI9A 3M5VA 1US0A 4RE3A 1D3CA 3U6WA 3WNLA 4D6EA 2Q09A 1DOSA 1QMLA 3A13A 4CQ8A 3KE0A 1DL3A 4EF9A 3GVWA 3NDOA 4NX5A 1ISZA 1KCLA 1TPVA 5JXQA 1L6GA 1CXKA 1R85A 1X38A 1HVQA 1VD6A 1H0IA 4Z1BA 2D2GA 1K9TA 2PBOA 1RLCL 3WH5A 1QHZA 3P14A 4PL1A 1QNSA 4Z0JA 1OIFA 1Y5VA 4K3ZA 1AQHA 2ZZ7A 5CJ5A 5HWNA 2AQWA 4B2DD 2ZXQA 4ICNA 4BKNA 4EXQA 1GW9A 1SO3A 1U2YA 1S39A 4CNPA 1AH0A 2ZIDA 4AIUA 3C5QA 4YYCA 1KWKA 1GORA 2R14A 2OFJA 1PAMA 1FWJC 3PB2A 3NL6A 5C0QA 3HZ3A 3WLJA 2E9BA 3ZOAA 3T2QA 1POJA 4WOZA 2P0IA 3B05A 3U8GA 4L56A 4JTGA 2J9YA 2IXUA 3TUUA 1ZBVA 1ZRQA 1L0PA 4GMEA 2BGNE 4GINA 1RQEA 2QVNA 4FOKA 1LBFA 3GR7A 4IIHA 4LY8A 5A6KA 5HANA 4KW2A 3BAXA 2E5DA 2BX7A 8XIMA 4J7RA 3WENA 3N73A 3GU9A 2ZX5A 2PDFA 3PBYA 1I2NA 4Q4RA 1VCGA 2CNCA 1GOOA 3C8NA 2AL1A 5EU9A 4I90A 1KFJA 4IMAA 3K4WA 1JXJA 5H8UA 4NNCA 3S47A 4LEQA 3U48A 4O1FA 1VBJA 4GNJA 3QV8A 1XCXA 3G3DA 2MANA 4Y9MA 1PTGA 1Q3NA 5D33A 1QOXA 4ZB5A 5CC5A 3MMDA 1ML1A 1F4HA 2V5JA 3PZTA 3CLMA 2WYSA 2VELA 3W1UA 2ZZ1A 3PZ9A 3T78A 1G01A 4RDWA 3LCHA 1RPKA 3MC5A 4PGLA 1EOMA 1KFEA 4WQ6A 5T9CE 3DYMA 4REQA 5GJMA 5BRBA 1AVAA 1JIBA 3ZJ8A 1B5TA 1K03A 4GYKA 1UWRA 4JBRA 4F2UA 5REQA 2F2HA 3T1GA 4JR5A 2VEKA 3OA5A 1HL8A 1PCWA 1WZKA 4D6DA 1ZHAA 5D09A 1EJVC 5D9PA 4Z1YA 3PB0A 3R0UA 4G9PA 2Y61A 3W7EA 3PANA 4BI7A 3AFBA 3KS5A 5KTLA 4AY1A 2YCLB 2E8ZA 2GWNA 1F3TA 3TC3A 4YTRA 2PDKA 1ZCOA 4LY4A 2J7CA 2A1YA 4NP7A 4M82A 1ITUA 1PZ0A 4JPGA 2UY3A 3KL5A 2Z1XA 3R5EA 3SCQA 2E25A 4X63A 1OYCA 4IXHA 2AGKA 1LLWA 3IANA 4DO4A 3KCOA 5I3KA 4IFOA 1IEIA 3BWWA 1MQQA 4LVFA 1SW7A 1WQ5A 3PTMA 4K36A 3S2NA 3S9ZA 2DJXA 4HYRA 1H09A 1OYBA 3EXSA 5FJUA 2CPUA 4HA4A 1R3SA 1ZZMA 1V3LA 4F2TA 1UZ1A 2WXDM 1OG0A 4YLWA 2ZA3A 1B54A 5JMUA 4BQ5A 3RO6A 2BVDA 5TNVA 3QGAC 1TRIA 3DENA 1TZZA 1XIEA 3ITGA 3N2TA 4C60A 3M1ZA 1IEQA 2YGYA 1K8CA 4K8GA 1OHLA 3NYZA 3N9SA 3T09A 3FJ4A 5FI8A 1J8VA 2C14A 2ZRVA 1HGWA 1UBPC 3RU6A 1W5MA 3U2EA 2R1NA 1I2QA 4LVAA 3N4EA 4MZ8A 1CYGA 1JGIA 1HFBA 5KITA 3R8RA 3CWNA 3QW3A 4PN2A 2WKLA 2ZC8A 2CZFA 2EHHA 4QLKA 3VA8A 4ZOBA 4RE0A 4A8RA 4ENLA 1HUVA 3UWVA 2VGFA 3BLLA 4B5TA 1SYTA 3BPWA 4IHCA 4AWEA 4R5EA 1V3MA 2DIEA 5DY3A 4TIMA 3RR1A 2FMNA 3TR2A 3CHFA 1OT1A 3SIMA 3KOXA 1B3WA 1WZLA 1IGWA 2PP0A 2QJHA 3EPNA 3M43A 4AHPA 5M3WA 3LUTA 3BG9A 1TIMA 2PF0A 3AMKA 3WUBA 1BQCA 1NM9A 2WV8A 3TSBA 3DAQA 3WQOA 1ONRA 3AISA 1RVGA 3MYOA 3PZQA 1FHDA 3AS3A 3NQVA 3GU1A 1RK6A 3LNMA 4B5VA 4AX7A 4AVFA 5I09A 4QE4A 2QJNA 4N4PA 2BY2A 3VYLA 1MWOA 3PG9A 1NDYA 4G7EA 2PDBA 3SRHA 1EP2A 2VDIA 3C2RA 3M0JA 4U3CA 1X96A 1TPH1 3EA2A 3WN6A 1XLKA 3O1NA 4GE8A 2VJXA 4DBUA 3M0HA 1B0IA 1Q6EA 4KMQA 4ZA0A 1IIGA 1CGVA 1UZHA 3PBMA 3PBWA 3FSUA 1EX1A 4BQ3A 2G96A 1ITQA 3W7QA 4Q8TA 3GKAA 1H49A 4D1JA 1YKWA 1N55A 2KAUC 3NQ6A 1L2QA 1QAPA 4Y90A 1NOFA 4LAUA 3IJLA 1Y5XA 4JQAA 4M3PA 1UPPA 1J10A 2VFIA 5HUOA 1CW2A 3UVAA 4C6NA 3E2RA 5AZ1A 1G4TA 4GNKB 4QSHA 1XG4A 5MF5A 2QJMA 5KSWA 5HPOA 3VC5A 3BZJA 3L4TA 4O12A 1TZ7A 2ZRXA 3N3MA 1SM9A 4HBKA 4JKLA 1F6PA 4B5NA 3BLFA 3N12A 2WAGA 3N3TA 5H1WA 5I03A 2ATSA 3Q94A 3W82A 3O06A 4PUMA 3QC0A 2PDGA 4POCA 2JE8A 4RNFA 3TTQA 4ZXLA 4L9YA 1XGEA 1LORA 4DJDA 1FWHC 2Z2UA 1RA0A 3AYSA 1U33A 1S2VA 2Y7DA 5A8GA 5I06A 4R34A 4HOWA 1FHUA 3S6TA 4KFOA 4FS9A 4N7QA 4PE8A 1GOWA 3FX4A 4DELA 3DFPA 3UQNA 4EE9A 2RHGA 3BC9A 1W3TA 2YA2A 1YEYA 1KM4A 2JGQA 4NUWA 1P5BA 3CAVA 2OT0A 4F3HA 1OK6A 1JCXA 4LBSA 4LVBA 1RLDA 4GYPA 3HV8A 3SSZA 3PWGA 3GR4A 4ERGA 1UKPA 4O17A 3WFLA 4K1GA 2X7VA 3MI6A 2XIMA 1KFCA 4GGBA 4LUSA 3TEVA 3G6MA 1ZUAX 1KM0A 3MSYA 4S3KA 1LTDA 4CU7A 1R38A 2GJPA 1NFPA 5AYZA 3C3NA 4ML9A 4DBDA 3APGA 1HKKA 5I3GA 1MW2A 2CKSA 2CU0A 4C6BA 3HG3A 4GLEA 2VEGA 2PB1A 5AYYA 1UD6A 2IKJA 3KRBA 3P5YA 3F5KA 4AC7C 1KXQA 4LNYA 1FY6A 4A22A 3R10A 4AZHA 2CHRA 3ABSA 4XZ9A 2QAFA 3BOXA 5FL0A 2EPKX 2QV5A 4YXGA 3KOWA 1IEVA 2PA6A 1OFRA 3GC2A 3MP4A 4XV0A 1JCLA 3O2LA 4ZEPA 3HPXA 1XIMA 1RD6A 3JW7A 2NV2A 2ZX9A 2XUCA 4B5SA 3B8UA 4WEVX 3BOLA 5K9DA 4AIOA 3SW6A 5I2UA 3S1WA 3GXDA 5LZLA 2O4MA 3W7RA 2DZVA 2VFDA 2QGYA 3M44A 3VNIA 3IIVA 2H3BA 3S2JA 4W7WA 3UYIA 4IUGA 4DM2A 2HVOA 3WK2A 1ISXA 3MCOA 3VGDA 1EX5A 4YVPA 3NZPA 2CEQA 5BMXA 1NP2A 3VFCA 4JAWA 2O9OA 2ZVRA 3C2OA 3ALGA 3MB9A 5HINA 3SJ3A 2VX7A 3MCNA 3W26A 3VILA 4G1KA 4PYSA 2ZDSA 1V0LA 3WUFA 2YBUA 1L9WA 3AQUA 1L6FA 1P6CA 1YXCA 2V2HA 5D8ZA 1NOWA 2DVTA 5A5WA 4GIYA 3IV3A 1OF8A 3NCOA 1YE6A 4XWUA 1EA0A 3KTCA 3IIZA 4TTGA 1JNDA 1M7JA 3W9ZA 1SZEA 1JUBA 3OB8A 1LLOA 1LOSA 3FGCA 4GA8A 7REQB 1CNVA 4M0XA 3H4WA 4YVXA 1XH1A 1E0TA 2NVAA 5IDZA 2GGEA 1M1BA 1TV8A 1TWZA 1LP6A 5JU6A 4HN8A 4IM4A 3GW0A 2A3LA 5HMEA 1Q6LA 3M0YA 3ARQA 3W7JA 3NUKA 1NQKA 5FEZA 4Q7IA 5HBFA 4J3WA 3MS8A 3LZ3A 3E3HA 4AIEA 5A95A 3ISIX 5CZJA 3SUUA 3UA4A 2ODOA 3OQEA 1IZKA 3SQLA 1OX6A 5BOOA 3BGAA 3EEZA 1DE6A 2PUZA 1OX4B 3ITXA 1D2KA 1QNQA 2VCCA 3IGUA 3GVRA 4O8AA 4HHMA 4F0SA 5JH1A 2ZUVA 2I9EA 2EPNA 2XM1A 1KV8A 2XH4A 1VFOA 3OLGA 5IDIA 2C18A 4CQ9A 1RZMA 3LHUA 3S83A 4JDBA 2JBMA 2ZA1A 3LLXA 4G7FA 5GJPA 2DUZA 3LD5A 4MM1A 4D71A 1QW8A 1GKQA 2V68A 3WLQA 1BQGA 3D6NA 5F2IA 2VR5A 2QUVA 4ZQPA 2YL6A 3RLVA 5I5RA 3UR5A 3DC0A 3ABRA 3GDRA 1UIOA 2ZXAA 4IJRA 1EO7A 4OBRA 4DAFA 1VHCA 1ODZA 4G5DA 2D0GA 3ANYA 3C2VA 2UV8G 3AXMA 1DWGM 3G0SA 2OZTA 1GTHA 3CZ8A 1JZ5A 4IPPA 3BAWA 2EG7A 1PKMA 1MUWA 2BDQA 4YTUA 1LUCB 4DEFA 1XLGA 1JZ8A 2E40A 3FY1A 3VNMA 4UBPC 4XD3A 1KR1A 3UJRA 2Y5EA 3MBDA 1B9BA 4M6PA 2ZUMA 1UKSA 1LG2A 3PFMA 1Q6RA 3WQPA 4FLSA 1VENA 4NZ3A 1GJUA 4LCQA 5GNYA 3PPGA 1QRQA 4J3UA 3BXWA 3HGSA 4Y6GA 4XB3A 3QV9A 4MNMA 4I8DA 3P2VA 2DVXA 4LS1A 1MQPA 3SAZA 2A7NA 1WDQA 4GZ7A 1WOAA 4DLFA 1WUEA 3BLOA 2Q8ZA 3A5FA 4F0KA 4B9YA 1CGXA 2FTWA 1VFHA 1LWJA 1TPC1 4HOZA 2NW0A 1XYCA 2E0PA 1UR1A 3EGJA 1I6NA 3O6YX 4S3BA 2JEPA 5C9UA 1XQKA 3QR3A 5BNKA 5L6UA 3CTLA 3NPUA 3F5JA 4O18A 1TVPA 4XAYA 2DDXA 1E1CB 3EX3A 3G6LA 4X2PA 2WWDA 3KBWA 4ZQOA 1JYNA 2TSYA 2PRHA 1E4NA 1J2WA 1FFRA 1XFCA 2J78A 3HPFA 1DE5A 3LCGA 1E3XA 4HOXA 4RKAA 4H6RA 3ARVA 5GNXA 4B15A 1GWJA 1XRVA 1HF6A 1YDVA 3C0QA 1S38A 3QPEA 1FHVA 3PVFA 3RAOA 4FMVA 3BMXA 1DJWA 4N4QA 4AXKA 3LS9A 3AO0A 3KBNA 5EBAA 3O07A 5HAOA 5LA2A 2VX4A 4XVDA 2GDVA 3IIOA 1NY1A 3QR1A 5A69A 3QYSA 2CITA 1Q8AA 2QF8A 1VZWA 2V6AA 3ONCA 1YTDA 2EPOA 4ZXOA 4JEJA 4PMNA 4QCEA 3B06A 1S2CA 3NOEA 2A0NA 2QGHA 1UWTA 2PRMA 3FLUA 4D6GA 2V5DA 1ZALA 4ZO7A 1W91A 3PZMA 1A53A 2YJQA 3PPFA 1NARA 5GPRA 3GTFA 2FZ9A 5E93A 3VXGA 3LQGA 1OD0A 3BOFA 1XC6A 2QW5A 3CS2A 2ZWZA 3ITCA 1BEUA 4DUOA 5EMMA 2AL2A 2HPIA 3LLDA 5ABGA 6XIAA 1UWAA 4CLMA 4RK8A 4E5TA 5HNUA 3QZ6A 4JTHA 4IGMA 4KESA 3B4UA 3VINA 1LWHA 1RQHA 1RV8A 2RUSA 3TWAA 1XICA 4H9XA 4XKMA 4X3ZA 3W70A 2WW5A 4XAZA 1F74A 2R8WA 2QCMA 2Y85A 3VIOA 5K9XA 1UP3A 3HB9A 4MB1A 4AIBA 2NQ5A 1ICQA 1CCWB 3W6LA 3K4DA 3PZOA 2CLPA 3AI0A 4O53A 2VR4A 5CBIA 4GI6A 1LZOA 2NVDA 1X8FA 4HP5A 3L2MA 1JG9A 4X9SA 4E4FA 1R3YA 2P10A 4PMDA 5H8PA 4QRNA 1PBGA 2QCEA 2G4JA 4F4RA 1MEWA 4Y7EA 4QROA 1UKTA 1E1EA 5AHMA 4YNGA 4X0NA 5CC7A 4H6EA 3TQVA 1PXGA 4JIHA 4XZHA 1ME7A 1YBQA 3MDWA 1MUMA 2C1GA 2EBNA 3IJ8A 1EDQA 4JXCA 1Q45A 1UD2A 1V6VA 1EJXC 3B9OA 2E8YA 3MCMA 2PGRA 1PUDA 2CLMA 1MDLA 3T7VA 3EWYA 1EUAA 3L7RA 4XIMA 4P8XA 5DCDA 1C90A 5IRPA 5CZTA 3SJNA 4E8GA 3Q65A 4KF1A 9XIAA 4TX6A 2WC3A 3MUIA 5C7VA 2KX9A 4CNSA 3ABOA 4XQ6A 3PR2A 4GXPA 2HNEA 4QAIA 1HNYA 1KFKA 3ZSTA 2ALRA 1HJQA 3OZPA 1CENA 1R2RA 5BRQA 4CCCA 4L61A 4Z2HA 4O54A 4Q33A 2G3JA 3CL6A 4IWWA 3DG7A 4DO7A 2V9DA 4PBGA 3DKJA 4BWLA 2GLKA 2YLLA 3CHCA 3QMRA 1Q65A 1XSJA 2DZXA 3CGTA 3LU2A 5F4XA 5ABTA 1K7FA 2QCDA 1TA3B 1NFBA 2J4GA 3CPGA 3AHTA 4IIBA 5BXSA 4DUWA 4UTLA 2ZUNA 2OGYA 4JTRA 5CLWA 1TKKA 2DSUA 4G2DA 2XIJA 7TAAA 3U2ZA 1DHKA 2H8ZA 1F4AA 4DWSB 4IH3A 2GUBA 1H7PA 3IUDA 1RAKA 3TFXA 5LXEA 3SURA 1YDOA 3APYA 4S3FA 1ZQ5A 4XD6A 1C92A 2VP8A 3ARZA 1AW1A 1S46A 3UWEA 1ADOA 4XTIA 2YFNA 3B03A 3GXFA 1QXLA 5E6ZA 3F4WA 2GUYA 4Q8VA 1G1YA 3BAIA 1JXKA 1OFQA 2WZMA 4GO8A 1ECQA 1B1YA 1LJYA 1GT8A 3D46A 3AXXA 3CIXA 3OODA 1UBSA 4NYUA 1MQRA 3MKKA 2VX5A 1EBHA 1KBLA 4HJFA 2F6KA 3VU2A 3W76A 5JBEA 3BGJA 3QKEA 1PKYA 1V6YA 3NPVA 3TW6A 3FXGA 1I2OA 3SCWA 1JPIA 4C6LA 1JUEA 4B91A 2HXTA 2WVUA 3QY7A 1UQZA 3NO3A 3V18A 4PEEA 1KBKA 1C91A 2DSWA 4GQQA 4AWSA 3T8LA 1EC9A 3L23A 3ELFA 1YBQB 2GOKA 2WLYA 5EB8A 8XIAA 1P1MA 4HPHA 3G1RA 2FB3A 4IMFA 1A3HA 4IMEA 3PAOA 3H7RA 1V93A 3VDBA 4K8HA 1WDDA 3SRDA 1QR7A 1VR6A 1J0IA 1FOBA 1E9LA 3CHEA 1JZ6A 1W3LA 2FMOA 5IXEA 4XSLA 2CZDA 4MWAD 4W84A 1WDSA 1BKHA 3A6OA 4UFIA 3ZWTA 5HPCA 4MPQA 2OKOA 3M0LA 3C2YA 2OG9A 4ZTXA 4NNAA 4XBJA 2XVPA 1SMAA 3REQB 6ENLA 4HMNA 3QMTA 4H01A 3EAUA 1Q63A 1W32A 1JQVA 3HPSA 5XINA 1RR2A 3DBPA 1SQ7A 3STFA 1PIGA 3BDKA 3TCSA 3LM7A 4IPIA 4GJJA 3QOMA 4MWAE 4H83A 3MVTA 3BE7A 1KM6A 1WB0A 2PWHA 4K68A 3K4AA 3WJYA 2NXHA 3T4CA 5D38A 2QCDB 4GUHA 3SGZA 4H04A 3TTYA 3W87A 1K8YA 1B30A 4HMCA 4BK9A 4RW5A 5IBXA 2PZNA 2DW7A 4RNHA 3GW3A 1DJYA 3FKKA 4D8LA 3HV9A 4MNKA 1IXNA 4AZ7A 3LCIA 4Z42C 3SO7A 1GNXA 4TQTA 1J6OA 3TC7A 1TV2A 1F3XA 4RZ4A 4RV8A 1QUMA 1EOKA 4HCHA 2E6YA 5LA0A 3W38A 4PTXA 1WA3A 5JBDA 1JULA 1H41A 5F4SA 1DWHM 3EDKA 2HCVA 3T4WA 2BHUA 5HJLA 3QSRA 2IPWA 5AYIA 3TNOA 2CERA 5A6BD 3QFWA 3VAVA 2XN0A 1I1XA 3BLPX 5DMLA 1Z9AA 5HATA 2EPMX 4G56A 4LEFA 3W84A 4FP1A 4LU0A 3CPRA 1GKRA 3BCDA 1W17A 3PZUA 3R13A 3CM4A 4QJ1A 3VMPA 4FK9A 4DXXA 4OU1A 2RJGA 3W2LA 4KQNA 1Q6OA 2ZZ2A 5JIWA 4GCAA 2G3IA 5HNRA 4XBKA 1SJDA 3B0XA 1QJWA 3K1DA 1H11A 2E28A 2VZTA 1HJUA 5AC7A 4JGDA 5BCAA 2BHZA 1LT8A 1V7AA 1RVKA 4M7SA 3RCYA 1TPFA 4TU1A 3ORWA 3VIKA 3ZVHA 3BAYA 2RH9A 2YYUA 9RUBA 1JCTA 1BGAA 5E9AA 4NZ4A 2UY4A 4S3EA 2EG6A 3RFAA 2TRSA 2QEZA 3DFSA 1IWPA 1IYXA 2GQAA 1O95A 1LCOA 3THQA 4XZBA 3WF2A 1GVRA 5ENLA 1OFDA 2ZTJA 3Q37A 3F4CA 4KWOA 3VCCA 2R1KA 4MSSA 4GGHA 4CNOA 3F2CA 4WDWA 4B16A 4OWGA 1ADSA 1UA3A 4I7WA 4MB4A 2W4XA 1B57A 4PMZA 4HPJA 1VB9A 3OLIA 3JZEA 3Q4DA 1BSIA 3DH7A 2A3AA 3BMVA 1O4UA 1QDSA 3T08A 3WLSA 1J79A 1S5MA 2WWCA 1GOIA 3CH9A 3CUZA 1QO5A 3QRHA 1PKLA 1HP4A 5LKYA 2F8QA 1OF6A 4UQEA 5KZEA 3WUEA 2VQUA 3AHXA 2ACQA 5CH9A 1I45A 4RNIA 5EYWA 4FA3A 1PZ1A 4L9XA 4LSBA 3WMSA 1BXCA 2OCZA 4A3QA 3ZYZA 3MZNA 4GC4A 3VOJA 3WDRA 4C6PA 4WKHA 3CB3A 2JF7A 1XDJA 3MI3A 1E4IA 4UMAA 2DZTA 3I3BA 4UCGA 1G5AA 4AF0A 5I6SA 3NSMA 3A12A 1FWDC 4Q4QA 4OTKA 1NH6A 1MEHA 1W1PA 2BFGA 2XVKA 4J3ZA 3TTEA 4ZZ9A 1R3WA 3W27A 4Y96A 4NVTA 5LYRA 3QZAA 2V5LA 1QK0A 3AYRA 5DCBA 3QPYA 3LXCA 1KTCA 2YCKX 4ES4A 1T40A 4I9JA 1AK5A 3TYZA 1OX5A 1VYSX 4CEUC 1YQ2A 2ON3A 3M16A 1E71M 4DZ5A 2JKPA 3A4XA 3GWQA 1V0MA 3VOGA 1A4MA 2JEQA 3KDNA 5CLTA 4HK5A 3R25A 2Z6JA 5RUBA 4JKKA 6REQA 4DJEC 1MDRA 1GG0A 3CZJA 3MUXA 2XGIA 3TN4A 3WBYA 5C55A 3OHIA 5E0KA 1HG3A 1EP1A 2BXYA 2VEPA 4TVDA 3M4HA 2B7NA 3HQOA 1ZU8A 4F0LA 1WYIA 3DX5A 4XAGA 3KCLA 3LXAA 2I5QA 1KM1A 2X40A 1E9IA 2Y8VA 4LVDA 2HVNA 4MWAC 1OCQA 5KETA 1W2VA 5FF7A 3GZAA 4BF7A 4WXYA 2OWXA 2PGEA 1ITCA 4CN1A 4KERA 3C2EA 3M46A 1H7WA 1UWUA 3UFYA 1KXVA 3VKJA 2NQZA 2Z1BA 1KQYA 1UWIA 1EYEA 4IQJA 4JTSA 4EIVA 4IQDA 3WQEA 1RY8A 3W07A 1NSJA 1ESWA 1UASA 2INZA 2DSKA 1ZS2A 2INEA 3R0KA 3E02A 3VKAA 3EMZA 4LT9A 1EZ2A 4JFSA 2LLEA 2QCHA 4R33A 3GBDA 4ATWA 2TYSA 2OKTA 2ISSA 1R3QA 3EWXA 3A4WA 1CLKA 2H3DA 3FAWA 1TJ2A 3IRDA 3L67A 2A5HA 4LX4A 4Q8NA 3RM9A 3GH5A 4Q8WA 4UFJA 2IQTA 2OO6A 3GG1A 3SCNA 2DZPA 4JTLA 4QNWA 3VKDA 4NASA 1EC8A 3MWAA 3LLFA 2QJGA 4Z2LA 1Y5WA 5J8LA 3VIJA 3IUHA 3SBFA 4D8ZA 1VFMA 3ZXWA 5JBFA 1GOMA 4KWWA 1EF3A 3PM6A 1CPUA 3G18A 1UHVA 5CG0A 2J7HA 4S2CA 1XWYA 2GSJA 2FZNA 5C9RA 4Q8UA 1JDDA 4UFKA 4C6CA 5DY2A 4V27A 1SO5A 4KT2A 4C6MA 5A6MA 4XAPA 3HJEA 3ENLA 2PI6A 3WCZA 2RAGA 1HO1A 1VIZA 3PUEA 3CAKA 4KEZA 4F9DA 4ZCWA 1A5KC 4PMRA 4GXMA 1PWLA 3VIIA 5C8BB 1Q6CA 2P1FA 4J1OA 3MJYA 5K9CA 4KEVA 5C5YA 3WQ5A 4A6GA 1JPKA 3U3HA 4KFNA 2GVLA 4PTWA 1TG7A 2AMXA 1W2PA 4OFCA 3CUXA 1XYMA 2WHKA 4BF9A 4GUGA 3L2LA 4DI9A 3PWAA 4PCSA 1TIWA 3WD0A 1X7IA 5A8NA 1OT2A 1KR0A 4K37A 1CB7B 4GKLA 3ARYA 1VRDA 3W1PA 2OLSA 4AMAA 1W37A 2W5FA 1AL8A 5CPSA 1XISA 4LJ3A 3UERA 3OU8A 2QIIA 1GQNA 3F1QA 2VGIA 3IJ7A 1X6UA 3LHVA 3QQWA 4JTAA 5G2IA 4IFKA 3ALFA 3TROA 4D6HA 2WJDA 1A5AA 3N34A 3G1XA 3WD3A 1Q6QA 4DWDA 1SMDA 4UTKA 5D03A 1GHRA 4AH7A 1GVSA 2XIIA 3KTSA 1HKVA 1ZJIA 3A3HA 2FHFA 3FA3A 1VIWA 3FNDA 1M6JA 3DHPA 2DUXA 3VD5A 2Z28A 3KAOA 3DHFA 2E77A 3NWRA 4K1WA 3GC5A 2RGLA 4UQ9A 4GC3A 1CXIA 1REQB 2POTA 1OM0A 4YWIA 2CBUA 4HNLA 4GG9A 4PMXA 2GK1B 1P0BA 2DVUA 4J3SA 1O5QA 4IMDA 2VURA 1H7RA 5AKQA 5FSEC 1WO2A 3QTGA 4PRWA 1HN1A 1ZJAA 1V3KA 1OG6A 4NQ1A 1KV5A 2XSXA 3DIPA 3VGBA 4DI8A 2CLOA 1R46A 4DF1A 3IPWA 4B90A 2PDCA 3U4AA 1I2RA 1ZP3A 4C6FA 3F2DA 2OSWA 5TIMA 2DH2A 4AU0A 5F4WA 4RXGA 1W1TA 3N2OA 3SR7A 4I5XA 2L5HA 1K4GA 4NJJA 3W1RA 2VD8A 4RPQA 5CSYA 5KZMA 1RPXA 4EKJA 2CXEA 4MB3A 3VOFA 2YL5A 2CZ5A 1ZL1A 3UNTA 5LNWA 3CUJA 1JPHA 3CO8A 2PGFA 1H51A 2YB1A 3GO2A 4BEQA 3WD4A 3N17A 1CGTA 2QCNA 1TWDA 2CLEA 1X1NA 3IGXA 4KGJA 5GVJA 4DNMA 2E09A 4WX2A 3WH6A 2EQDA 3FJ6A 3H2OA 4N9DA 2YFOA 1UJQA 2VFHA 3YPIA 1UMLA 4RZBA 1QO2A 3KOYA 3VNJA 2ATMA 3TTOA 4J5NA 3UXDA 1Y8BA 4NX0A 4TTUA 3TW9A 2ZZ6A 3FKRA 1GEHA 5C6MA 5TBOA 3FDGA 3U7VA 1FDJA 4HYWA 1LROA 2AMGA 1A0DA 3AIVA 2QDGA 1EZWA 1NDVA 3M0MA 1IWAA 2ACUA 1F61A 4ZB0A 3WLMA 1M04A 3W7DA 2AOSA 4QHRA 3IUIA 1GTEA 4DJDD 3VOIA 4UNIA 4R85A 5MKGA 1O60A 3RR4A 6ALDA 3F03K 1ZB5A 1UWQA 1FH7A 3UR8A 4PR4A 3WDPP 3GD6A 2I56A 1P7TB 3W2JA 4N6FA 2JIWA 5D02A 2VT0A 1HXJA 2BBFA 4QE1A 3KCJA 2P88A 3CZLA 1YNPA 4JTCA 3GLCA 1QOPA 3L4ZA 2WMKA 3NURA 5AVHA 1ZLPA 3ZO9A 1W9UA 3PTQA 4RW3A 5D05A 3B0YA 3LI0A 1SO6A 3PBGA 2B31A 3QTPA 2VZSA 2HMCA 1VQTA 4FPSA 4ICMA 3G0UA 5XIAA 2G5WA 3BQ5A 3GRIA 1GUVA 2OT1A 5IHSA 3CHDA 4LF2A 5E0FA 3QLLA 4MMWA 3KHDA 2R6OA 3GXPA 1TELA 1Z6KA 1GVIA 3F4DA 5A3HA 4UZSA 2VEFA 1ENUA 5T8GA 3KOZA 3AJ7A 3NPWA 3VD3A 4C90A 4IG2B 1X98A 1ZTVA 1W5NA 3VDHA 1NIUA 1QHPA 4K6AA 1WOBA 1PTAA 1KM5A 3LDVA 2OELA 1ZJHA 1XIIA 1VLWA 2RDWA 3ONBA 2VQTA 4HGXA 3UR7A 3O9NA 3BO9A 5IFTA 1W9BM 1TUFA 4F66A 5B80A 3P84A 3FW6A 4M81A 3GNRA 4BEUA 1EJSC 4LUIA 1JF5A 2Y7EA 2Z27A 1UP2A 1SFSA 2ZADA 5CC6A 3B0UX 3WY1A 3CV2A 1P0KA 4O1CA 2DGAA 4CCZA 3M64A 2KZHA 2P50A 1W9VA 3LPOA 4CN4A 3L4YA 2W6RA 4FALA 2QUMA 1Q5MA 1C93A 3URNA 2D2HA 3DUGA 4A3UA 4GD0A 5AZ0A 3EOUA 2C7FA 5TF0A 3N6HA 3AU2A 4DX3A 2PFHA 3T0DA 1W0MA 3PZVA 3DKLA 2OZ8A 1GOXA 3GKFA 3F7JA 3UPBA 1FQ0A 2REQA 1HL9A 2ZRWA 1XQLA 4HZ7A 2J24A 3MP3A 4F8XA 3OYXA 3TSDA 3TTSA 3DU0A 3FYPA 5T91A 4ZQMA 2HRWA 3DXIA 3GYEA 3W7GA 4XZWA 2HVMA 3TIMA 2FIQA 2R9RA 3HQ1A 2G3NA 2ZOXA 5DMNA 1CIUA 3N6JA 3WKZA 2OGJA 2J75A 2VUYA 2VC7A 3RN6A 1H0GA 1E72M 5MKGB 2IW0A 3GDKA 5LNUA 1VFFA 4AY7A 3M5YA 4PUDA 4RNJA 3ARXA 1UKQA 4DN1A 3WJZA 3DOPA 3QHMA 3NQDA 1VJIA 2NT1A 2P5NA 4N6EA 4KWVA 5E09A 3U57A 3B8VA 5DANA 2AGTA 3AZTA 5AC5A 3AWNA 3IACA 5HNNA 1NEYA 1W5OA 1U1UA 1DWAM 1DTNA 3A3WA 4H9VA 1XIFA 4ZGYA 3AXKA 3C0SA 3W23A 4GFIA 3P7YA 3TLQA 2FGZA 5TAOA 4W8LA 3BV7A 1W54A 2QULA 4B4FA 4O19A 3HF3A 3E38A 5G5IA 4IPJA 4LUYA 3RHGA 6TIMA 3IEBA 4QDPA 3EDJA 4K39A 3KL3A 1W5PA 5I07A 2E4TA 4PTVA 3USBA 1EIXA 1OB0A 3GC4A 3SRFA 3BLDA 3W28A 1VJZA 3WLIA 2VGGA 4ZE5A 1D7FA 4D6FA 2XIOA 4Q7NA 3LCWA 4KKXA 3MHGA 3URQA 1Q2RA 4W5ZA 4N9BA 3LB0A 3Q58A 3LM3A 3NL2A 4MKVA 1JPDX 2Y1HA 3BCFA 3EB2A 1KM3A 5LNVA 3TYUA 2UBPC 2WJFA 2WSPA 3H2CA 5DXXA 2VXNA 3WYZA 2YXGA 3NVTA 3V5OA 3NVDA 1M3UA 3QXBA 3O16A 4TO8A 1VBUA 4WJ8A 4G8TA 1C7SA 1GOQA 4E2BA 1EJRC 2GDUA 1Q66A 2Z4GA 3WLLA 1LT7A 3UCQA 1CDGA 4XTDA 3W72A 4WJXA 4GO9A 3RRXA 3IAPA 1PE1A 4DLMA 4MZYA 1E0VA 2F84A 5LIKX 3WQFA 1XGDA 4OV9A 1QNRA 3N9RA 1GVQA 4L4PA 2ESCA 5G2WA 4QQ3A 4LAMA 4R9XA 4QDWA 4PUNA 1OWQA 3SSJA 1O66A 4XK2A 2QUNA 1Q6FA 3BSGA 2WKGA 4HSHA 3II1A 4MY1A 4EVZA 3H7VA 5FIPA 2GVJA 2RKXA 4RPPA 3PTDA 2FPTA 3L65A 2PDPA 4ZSUA 4JCLA 1MSSA 2QKFA 3W1QA 1UCWA 2V2DA 3UPMA 1T6MA 4UNKA 1RJRA 3V5CA 4FNTA 1EXBA 5HULA 1ZFJA 1TJ1A 4DJDC 3BJFA 3L9CA 1V79A 1XDLA 1E6ZA 3AU6A 2X8RA 3UNDA 2Y24A 1TWIA 3EB4A 4JFVA 2G4FA 3AIQA 4EACA 5CSUA 5DRCA 3WLPA 2FLIA 1V6WA 5CZ0A 2VFFA 3GHSA 3CV1A 1MNSA 1UR2A 3TCEA 1JR1A 2R1LA 1T41A 3BUVA 1GW1A 2D73A 1VFLA 4JQ2A 3P8IA 1XD0A 4GYPC 1ISWA 5K7JA 2HROA 3WFZA 1NF7A 1H3GA 1G94A 3UY8A 1E5JA 1P0NA 4H9ZA 2JK2A 3EX1A 2G8ZA 1JCNA 3GNDA 4ORIA 4ZENA 3W4RA 4H7ZA 1FCBA 3VVGA 3DI0A 3AIRA 1X1OA 1U1HA 4K2SA 4I7VA 3PUGA 4MVAA 2PDUA 5J5RA 3CZEA 4NXKA 2VCAA 1TVNA 4U4MA 1XR2A 2CCRA 3ZT6A 4MY9A 3VKBA 2JIEA 4QDMA 2XDFA 2GJRA 3UYCA 4XZMX 4Q22A 4DYEA 1DWIM 1JFXA 3WSUA 3AWOA 2HE5A 4UOZA 5DX7A 4DJEA 2YPIA 3ZLFA 5FAJA 5I3IA 4FNSA 2Y7GA 2VFEA 3G8EA 2A7PA 5CPLA 4PB3A 4NAEA 2QDHA 1F8MA 3B9NA 1CXEA 1U5HA 4P7LA 3SCRA 2I9UA 5CC3A 4J35A 4UQBA 2Q02A 1GZ1A 1BYCA 2CBVA 2J8FA 1VBGA 5FJJA 2J7DA 5I02A 3E0LA 4LXFA 2OMAA 4ICCX 3WF3A 2PE4A 2Y8UA 4MHBA 3FOKA 5AHNA 5HDRA 2WNQA 1PDYA 3QM3A 4BQ4A 1XS2A 4DZIA 3TYCA 3I10A 1BVNP 2OB3A 1AZ2A 4AX6A 1ICPA 3MSGA 4LCSA 2IPFA 4P7OA 3D47A 3GSMA 2PDQA 4QE5A 2WBKA 3W73A 4ZBCA 1VS1A 3KHJA 1KGXA 4UTTA 4TVUA 3VABA 3MSDA 3UXAA 2BS9A 1JFHA 1GVFA 4DJFA 1R3RA 2WQPA 3KLLA 4GHRA 4FNPA 1GZGA 1FKWA 4LV9A 2Y89A 4RXFA 4J9JA 3VE7A 1JZ4A 4O52A 5A8OA 1BTCA 3H2NA 5I3DA 3V3WA 1W1IE 3CNYA 2WMFA 1T0OA 4AD3A 4A8NA 1KM2A 1Q8JA 5BWAA 3BL3A 4R7JA 4E0CA 3AMCA 2BVWA 3AHZA 2QCFA 1S5NA 3N2XA 1JCMP 1FXPA 4WJEA 2PBGA 2QJJA 5HR7A 3LZ5A 5DT5A 1JZ3A 2UWFA 2O9RA 4UC5A 3CQ0A 2TAAA 2HTMA 3W7HA 3AROA 4LYPA 1QNOA 2ZXDA 1B3YA 1TPB1 3K8LA 3ES8A 5E5CA 1AD4A 3S46A 4RL3A 1VHNA 1V03A 3DG3A 2GGHA 4ACYA 3O0KA 3LNPA 4JCMA 3TU9A 3HFYA 2GGJA 1UOKA 3QGKC 4GH1A 1XXXA 4ATDA 1FCQA 2VGBA 2QPSA 5EMUA 4CCEA 1K9FA 3V4BA 2VRJA 3S6OA 3S5ZA 4ZSTA 4P5UA 1VFSA 3UZWA 5D04C 3K8KA 3UZ5A 4IJCA 3NO5A 4QSFA 4C6OA 4DYKA 3EB3A 3PF3A 2GQ8A 3GAKA 4YVVA 1G7UA 4YTTA 4L5ZA 4NZCA 4W9TA 2WOQA 4P8VA 1TMLA 5F7UA 3KM8A 3CYVA 2G37A 1KBJA 2BASA 4JOMA 3EPOA 2J66A 3E9AA 3EZ4A 2PTZA 1DEDA 3JRKA 4GY1A 3M5ZA 3ARRA 3QN3A 3LPFA 5A6SA 1VBRA 3ARWA 5J04A 2ISVA 2BG5A 1TV4A 2VMFA 3WDHA 5DEZA 4LAOA 3K2GA 3GDLA 1MZRA 5FJOA 4NY2A 4E2OA 4PUJA 3UEQA 1Q7QA 1FWFC 5DRIA 4IIFA 3O05A 3K8MA 3BW3A 4KETA 2ZWYA 4JIRA 2BSLA 2QCLA 1V5XA 2WLZA 4HPXA 4QBXA 5AVNA 4US5A 5ECVA 4W86A 5DELA 4C1LA 2E6AA 2Y2WA 4ZR8A 3VM5A 2Q71A 1AJZA 2Z6IA 3KX6A 1DP0A 4LGXA 4ROQA 5HNTA 4JHOA 5FACA 3WUGA 2NQLA 3LSBA 5CKSA 3CBWA 1RJQA 1AODA 1SR0A 2NLYA 2QZRA 4O1EA 1IR2A 2YDQA 3ANVA 3C0JA 2W3ZA 1KGUA 4HNOA 3GNXA 2Z1VA 3K30A 3RJXA 3ZIZA 3LHZA 5B7YA 4QEEA 4DY1A 1IT0A 2HPMA 3SCOA 3A64A 1ZP4A 1TPUA 3OGRA 4JKMA 3QHOA 2BOEX 2YCLA 1E4MM 2Z1WA 2VTFA 3L68A 1EPXA 1F6YA 1CX9A 3W81A 4F0RA 3ZR4A 4DF2A 1TPDA 5DN1A 2D22A 2F6XA 1V0KA 2R1MA 1D3HA 5AOUA 2PCEA 4M19A 5C71A 3UVIA 1WKDA 1LBLA 3M0ZA 3MWCA 3FCPA 4WD0A 1LL7A 1POKA 3NZGA 1EP3A 4H8NA 3ZFHA 3GTIA 3LBOA 3NM1A 3VIGA 1GOKA 1XG3A 5GNZA 4S1FA 1PPIA 6PTDA 5KZ6A 5LXXA 1JZ2A 2PDNA 3EWZA 1XLAA 1TE6A 3HGRA 4HK7A 3FJLA 4F48A 2F7FA 4S3AA 4U28A 4B5UA 3POCA 2WSKA 5G4EA 3HQNA 2VCBA 4FAMA 3RJYA 5A94A 1PV8A 5EY5A 1BF2A 2POZA 3L66A 1TR9A 2DSZA 3A21A 1LQAA 4JD4A 1WZAA 1V51A 1BRLB 3V36A 3TX9A 5BYWA 1O68A 3GNPA 4J4KA 4JTEA 2PSNA 1RHCA 1V3JA 3THAA 3DBNA 5E1QA 4Q8QA 2NQJA 1S2WA 4LS0A 5CPMA 2O9TA 3JR2A 1OABA 4GJ1A 3W2NA 1AD1A 1FWGC 2HZGA 4AVOA 2VC6A 4R3UA 2VDHA 4JTJA 4RE2A 3TN6A 3TYBA 4A3YA 3VE9A 2HSAA 2R91A 3T42A 2HK0A 3TQ0A 3MY9A 3AMDA 4O8RA 4NF7A 4OBTA 3NQFA 3VZZA 3OA3A 1TPWA 5FEXA 3VIMA 3WJXA 2WHJA 3QPZA 2YOCA 3SY8A 3IK2A 3I4KA 3W24A 2PLJA 4Y2WA 1XUZA 3FHQA 3AXHA 1M65A 4Q4PA 4HMDA 1CGYA 2JKEA 4HA0A 1E6RA 1I0DA 8CGTA 2IS7A 3VIHA 2F6UA 4PMYA 2J8TA 4IGSA 4GCXA 1HGYA 3LRLA 2P3EA 2V5CA 2O92A 2Y70A 1XLHA 4WR3A 1IT8A 3IV8A 1F3WA 4UQAA 4W5UA 4M24A 1CBGA 2BOGX 2A4AA 3WH8A 1PCKA 2PGWA 1V4YA 4H7CA 3UXIA 4KIRA 3NM3A 5C9ZA 2WMIA 3O15A 1F76A 2PS2A 4XZLX 3GVQA 5BU6A 3PPCA 4XSMA 3O63A 1K8ZA 2E7FA 5C7HA 3FXYA 1QBBA 1Q85A 1XLEA 1IXOA 4UCFA 4JFTA 3RK8A 4ERIA 3PNZA 4IIGA 1NQ6A 3HGJA 2VD9A 5M1TA 2O0TA 2V82A 4AYGA 1U5JA 1X6LA 1DQXA 1OSEA 2DW6A 4OQVA 1EWEA 3LHYA 2NVCA 3P74A 2A3BA 4BWLC 4IJBA 2XIQA 4AVNA 2IKGA 4JN7A 3T05A 4Z2JA 2WJZA 1JF6A 3ABZA 3VGGA 3VNYA 1YPXA 4FSAA 1SFJA 2CETA 3OW1A 9CGTA 1TREA 3UG3A 5A8MA 4Z0SA 1PVNA 2Y8KA 2VVNA 4Q7BA 3RM4A 4H00A 3W7LA 4AZCA 5AHFA 1EFZA 2QR6A 1WUFA 2GVGA 3N29A 4AG0A 3LOTA 1I60A 3EBVA 2Y5SA 3UD6A 2PDJA 3CEPA 3H23A 3ZLGA 3GG0A 1XW8A 3HOJA 1OIMA 3EEGA 3WLTA 2XH0A 4HCLA 3WDJA 3GUGA 2EKCA 4Y9NA 3RRAA 3IVSA 1J0YA 1TTPA 1VJSA 2QVHA 3THDA 4M56A 3FYYA 1R7OA 2ZBTA 4F40A 4JEQA 5JUVA 5E6YA 2WNZA 4L6DA 4LRSA 4WCJA 1TJPA 2GGIA 1JAKA 4HK6A 1HJVA 1J0ZA 2A6NA 3B8TA 1HT6A 1A5SA 1CWYA 4PUUA 3OVGA 1YADA 3ZR6A 4H9YA 5L9FA 3FA5A 4WXZA 3NPXA 4JX6A 1EB3A 4DHGA 4O16A 4MKSA 4Z1AA 4ZOCA 3KL0A 4RJEA 4KCWA 4QIUA 2ALDA 2Y62A 1YNQA 2ZUWA 3HGOA 2JKAA 3E49A 3AAMA 3W25A 3WIJA 1ZAHA 4CUCA 3MANA 3FA4A 1A50A 5E9XA 3LTPA 3I6EA 3ITOA 4AEFA 3ITTA 1NWRA 4GQ0A 2C3ZA 2J79A 4HKPA 1E3ZA 4XUYA 3EPMA 2A79A 1R5YA 3KOFA 5FD0A 3W7PA 2GQ3A 1ISVA 4Y8FA 3I7SA 4M6VA 1RBOB 4EAMA 2AAAA 2XSAA 1M41A 2WMIB 1E43A 3VNZA 3FHAA 3VKCA 3H70A 2OLHA 2DIKA 4NILA 2DQWA 3NDYA 4RE4A 5HR6A 1V08A 3DGBA 5IFPA 2DZAA 1P43A 3PJTA 4HSOA 5MHBA 4G6CA 4OJYA 5LIYX 4UMBA 4OGZA 3OG3A 2C19A 2C1HA 2XTKA 1K7XA 1BLIA 4MTVA 1EQPA 4I3GA 3SB0A 4OECA 2OEJA 1OCNA 3EWCA 3LG3A 3UZXA 3VFLA 4DZAA 5FCZA 3CQHA 3NYDA 4L1XA 3V75A 4UFLA 4E6MA 4ZO9A 2ZZ3A 1C8VA 3UJSA 4H4IA 4IISA 3K1GA 2BXVA 2H90A 3T55A 4DB7A 3KXQA 4DPQA 1AJ2A 3NJ3A 3CUFA 7REQA 3OZYA 1MW1A 4ACZB 5IBXC 2B7OA 1YX1A 1ZPTA 4GK8A 2RDTA 2Y88A 4AZCB 1PEZA 3QHNA 1NWUA 3S9IA 4C6DA 1DKWA 2WK2A 3P82A 4K7VA 4L80A 1KQZA 4EAYA 3CT7A 4BJHA 2DSVA 3SFWA 1PYFA 4FR1A 5A2AA 1XX1A 3XIMA 4DPPA 4FX8A 4ASTA 3PZNA 3HIJA 2NSXA 4HT3A 4HCDA 2ZDRA 1FVPA 1JRCA 3S1VA 1YYAA 3BLEA 2ZQ0A 2R24A 2PD5A 4HN4A 1OX4A 2DY3A 2XU2A 1SZNA 3M6YA 3S3GA 4JL2A 1XC4A 1Y65A 3QC3A 2I5IA 1XLMA 2QDEA 5FA5A 2X16A 5M03A 2CHNA 2UY5A 5DBTA 3WEOA 4NAFB 5M2FX 4NXSA 2FDSA 3VNKA 3BJTA 4KWUA 3L5AA 4ZFCA 2NUWA 3GE7A 4YCOA 4GQRA 1EDGA 1V6TA 2V67A 5AYXA 4C7FA 1QVBA 2Z24A 3H55A 3CQIA 1IE7C 3IJDA 4XX6A 3DGRA 2IQDA 1DTUA 4CQAA 1S3TC 2D2JA 1KO0A 4MOZA 4U3AA 1JNEA 4URIA 1N7KA 4NKCA 1X7FA 1MMFA 2C13A 1CGWA 4LPCA 3CIWA 2XISA 1TCDA 4S2BA 4CQBA 1J11A 1LUCA 3HG5A 3L12A 3NQGA 1UR0A 3HURA 1KB3A 4GVHA 3WQ8A 4WSJA 1CXLA 1PB0A 2OYMA 4HJWA 3I65A 3B40A 4B5XA 3BZGA 3CV6A 1VPQA 2W27A 2OSXA 3E2SA 2WVVB 3L4XA 3OG2A 4JL1A 2GJXB 2QHAA 3RPDA 2FHBA 4CD7A 2R1PA 3GK0A 5DBUA 1XLBA 4D1IA 1EHAA 2QPUA 1BGGA 2FZDA 2X41A 1DJIA 1ZJBA 1EJUC 3EWBX 4TXEA 2PC8A 3GIYA 1UUMA 2PP1A 2SFPA 4FR6A 1HKJA 1SPQA 4JIPA 1XBYA 4PFHA 1Q6GA 1JYXA 4M80A 1J01A 3CK5A 3MVIA 7XIMA 3L2IA 1W8GA 3R12A 1Q6DA 2F38A 1FH9A 2Y63A 1VYPX 2PTDA 4Q4OA 1ODUA 1YLVA 2HQAA 1XLCA 3VC6A 4E2DA 5BXTA 2NQ9A 3URAA 5EMYA 1PHQA 1M68A 2OXNA 2W92A 2J6VA 4JNYA 1E1CA 3TR9A 4W8AA 3WK1A 3P0XA 3WJSA 1TV3A 4HZ8A 4WK9A 4C6JA 1G4PA 2QAPA 1GEQA 2G0WA 3SCPA 3UBPC 1J0HA 2XFYA 1F7BA 5CGMA 3POHA 1JUKA 3ABQA 4FI4A 1XCFA 1AQMA 2AKMA 3VNLA 4PSRA 1FBAA 1P0DA 3S5YA 3W7OA 3TN5A 3LCFA 3BURA 2C16A 1IXQA 3BQ6A 2CC0A 2PTWA 4NJKA 3RGTA 1Z44A 4QISA 1FTXA 3C2FA 1MXSA 3GG7A 1E15A 1UA7A 1WX0A 4O0ZA 3SCTA 3HQPA 4FIQA 5GJNA 1HP5A 1GK8A 2V81A 1TX0A 3OVPA 1AJ0A 3EOEA 2PDWA 3RLUA 1RCXB 3GS6A 3TQKA 4AD0A 1KXHA 3ZSSA 3W75A 4DYJA 5K2ZA 3LCXA 5D9NA 3QGVA 1W6TA 3TA6A 5A1AA 4YL2A 1J2BA 2V8ZA 3DHDA 1JD9A 3IWPA 1M01A 1V77A 3RXZA 2WVSA 1Q7MA 4PH6A 4IXXA 3R8HA 2Q3RA 1XBZA 4KRUA 4H8UA 2J8GA 2O7QA 3T0CA 5AHIA 3C86A 3G1AA 3BJSA 4O4VA 4UTHA 2C6QA 1I0BA 3O0FA 1CGUA 3PNUA 2P0OA 3EDEA 1RH9A 2JF6A 5EMLA 1QPOA 3KBSA 2ZUSA 4QAWA 2BLEA 4DUVA 4E4PA 3WBXA 1Z3NA 4LQ1A 2WM0A 4GYJA 2Z0IA 4AQLA 3WMLA 2CLFA 1R87A 4JFWA 3KP1A 1W1VA 4JYFA 1VBHA 2FB2A 3R11A 5DMMA 2TMDA 2HNHA 1KLZA 1WBJA 4QG6A 3UA3A 1UR4A 1XYLA 1J6PA 3LGGA 1FKXA 3NGFA 4UMCA 4TVCA 3LSCA 1R0MA 3QY6A 4DF0A 3GHRA 3GHTA 4QQUA 3M0VA 1KNWA 4D6CA 4RDZA 4QITA 1B4EA 5FJIA 4F2BA 3KLKA 1I9CB 3L0GA 3UCDA 2YA0A 4MAVA 4NL1A 2BNJA 4MDOA 4LYKA 1W3KA 2IKHA 1TRDA 1W31A 4E4UA 4AEEA 1X6NA 4AZ5A 2ZRYA 7CGTA 5DMYA 2GSHA 3NG3A 4WSHA 4QFUA 3A23A 3GQYA 2I16A 3V5FA 1WAWA 3S42A 3W1MA 3RX4A 3FEQA 1ZY9A 3B8IA 1WCGA 2FTYA 5EGRA 1FWEC 3GU2A 3ES7A 2YZRA 1ITXA 2VDGA 4MPKA 5I23A 3U9IA 3I7QA 1DJXA 1XKYA 4HNCA 3ECQA 2J47A 1EYWA 4FX6M 1OJXA 3UZZA 1N8IA 3CYJA 2TPSA 4AWUA 1GYMA 3NDZA 4DNHA 4HNUA 2YA1A 3P8JA 1WXZA 1LF1A 3I4EA 2DT0A 3N18A 2OEKA 4PCTA 1XLIA 3P60A 1DBTA 1PL9A 1E5NA 4LC6A 4HHLA 3SEPA 1UW9A 3DEQA 1K6WA 1P0EA 3F2BA 4LTSA 1XM3A 3W02A 2Z29A 3H6OA 2A21A 6XIMA 3EA3A 3IJ6A 3CXOA 3TYEA 2DZWA 1LOQA 3FDKA 4A2RA 1A5LC 3CL7A 4CU8A 2PZ0A 2E9LA 3SZ8A 4XAFA 3NQCA 3GDMA 1NTHA 1DYSA 3W74A 3M7SA 2VWSA 3E1F1 3TOYA 4XKYB 5I7GA 4I8YA 4BY3A 3MSRA 1L6SA 4E3VA 3CPUA 3SCUA 1DXEA 3LCLA 2XFWA 5HQMA 1VPXA 3WG6A 1XRFA 2VZOA 4M5PA 3QLDA 3WNNA 3GB6A 3SUVA 2H9AB 1O5XA 1TR1A 1B3XA 4NZJA 1LL4A 3IJQA 1TA3A 2J7EA 4JTKA 4FZIA 1KXTA 5BU9A 1HKMA 1NJJA 1O12A 5LIUX 2QV4A 2EGZA 5D2VA 1HL2A 4PCNA 3XINA 4ZB2A 2QPXA 3PK7A 2HXUA 4PUKA 4L9ZA 2ZCGA 3U2OA 4DWSA 3H4GA 3R8GA 1UKOA 7TIMA 2X1UA 2BGQA 3PZGA 5F2GA 2CZVA 3KVMA 1BAGA 1LQ2A 1QFEA 2Z7KA 3MHUA 1TJ0A 4YMZA 2VI0A 2ICSA 3NA8A 1TTIA 4WKAA 3LBMA 3KRUA 1QHOA 2O56A 4PMOA 5AN7A 4Y9OA 4H9UA 2PP3A 4HTBA 3GTHA 2RDUA 5FJTA 2A85A 4L4OA 1R86A 2W63A 4MWAB 2CBJA 2ISFA 1NDZA 4WUIA 4UB9A 1C3FA 5ABFB 2Z7GA 1HX0A 1NAL1 3M9YA 1G7VA 3DN5A 4A3RA 2XFFA 3ZVIA 4UOJA 4Q4MA 4CVUA 3W7NA 3U5UA 4M51A 5C2CA 4PBEA 2C8NA 3ARPA 2WB5A 1S1RA 1UWSA 3CAWA 1PIIA 4GQGA 1GKPA 1TSIA 2B7PA 3SCSA 3TQPA 4L65A 4EOUA 1V6XA 3NFUA 3WH7A 4ZFMA 3EOLA 1OC7A 4TV5A 2IXVA 1V6UA 4I6VA 4HU3A 5LNRA 3GX9A 4WDTA 4GYFA 2WHMA 3RILA 5LIWX 2FZBA 2WSQA 3STPA 5G4WA 3REQA 2OYKA 2OX4A 4LV4A 4LFYA 3WH9A 3MUAA 2YR1A 3VDGA 3I3DA 4R53A 1HIZA 4TV6A 4X0VA 3JUGA 4BFAA 5I3HA 4IMCA 4H6KA 4P2VA 4YPJA 1SJBA 1GVOA 3E5PA 2EAWA 4JTIA 3BSHA 1X97A 4R88A 4LF1A 3W7MA 2F61A 3WJWA 2V38A 5EBUA 2X1IA 1WDWA 3DG6A 3GG8A 2YW4A 3V1PA 1TCMA 3STGA 2V0TA 1VYRA 3QSTA 4RLIA 2RGMA 2Y5JA 1VC4A 2VENA 1DJZA 1YPFA 1SW0A 5H6HA 1UPMB 3DFYA 4QJ4B 3H2AA 2C91A 3MMUA 3EA1A 2OX1A 1J5TA 5KZDA 2J77A 2AQOA 3L21A 2YL9A 2FJKA 3AUJA 4HTYA 5U7SA 3UPWA 1B90A 7ODCA 1XPYA 4FF7A 5D30A 2ACSA 2ZX8A 1XD1A 4I9AA 3VMNA 1QW9A 2P3ZA 4N02A 1B2YA 4Z2GA 3VIFA 4KS0A 4PTMA 5F1VA 5HK4A 5DF0A 1O5KA 4AEOA 3G0XA 3H24A 3W83A 4CD4A 3OLDA 4MJMA 1PTDA 1RY0A 1W56A 2P8CA 5E70A 1KCKA 1E9YB 1F07A 3LV5A 2WNNA 1P6BA 3GNOA 2FDMA 4YN5A 1V02A 3BH4A 1H1NA 2IPJA 1JGMA 3TA9A 3GAYA 2YW3A 1EQCA 4MG4A 2DU2A 1R3VA 1NWSA 3TDFA 4JIIX 3BLIA 3VK5A 2PLCA 4EX4A 2PWVA 3S8HA 4Q6JA 3WLNA 4B3KA 5A2CA 3HO8A 4DQWA 4DJED 3R58A 1LWIA 4JS3A 4EPDC 3MKVA 1RCQA 1V3IA 1RBLA 4A35A 4BF5A 2DT2A 5CJNA 1YTEA 4DO6A 3GXNA 4AZIA 3BMWA 3V0TA 2FPVA 4E8CA 2H6RA 3MQTA 1G69A 1QBAA 5FEPA 1ZAIA 4YTQA 3I3EA 3RG6A 1SJAA 5C9WA 3CHVA 1XI3A 4S3JA 1B4KA 4O15A 4DBEA 3O3RA 1Z69A 1TQJA 4C1NB 3L4UA 1H5VA 1ONWA 1KKRA 4PUEA 2OQYA 2WHLA 3UWQA 1FWSA 3DECA 3N14A 4MADA 3TV8A 2VYOA 1R47A 2J7FA 1ONXA 1A0CA 4GOAA 2E6DA 1O6IA 3MO4A 4KPLA 1NFGA 1EJTC 3PPHA 5AC6A 1ECEA 4BHYA 3SCVA 2DFAA 4E2VA 4PUWA 2WZEA 1J4EA 4DJFD 1K70A 1CXFA 3QYQA 4UZUA 2YCEA 4UTWA 2VRKA 5HMFA 1BPLB 5DLCA 3FK4A 4AZGA 3MUCA 3T2OA 4X2RA 3GUWA 2XGZA 3LPGA 5A6JA 4MLRA 2PTXA 4PA8A 4F0HA 3AIWA 4DM1A 3N25A 2A7RA 4QLJA 3PP7A 3H4XA 4QX4A 4IPLA 2X1SA 3W1XA 2GDQA 3WFAA 3W7IA 3CUGA 3DFOA 3MT1A 2A3CA 3LBCA 2XSBA 3H2EA 3OGVA 1J9YA 4B9ZA 3SM0A 1FCUA 3VI2A 5JH2A 3WQ4A 5G1YA 3C52A 1WKYA 1BG9A 1GPWA 3O6AA 2X05A 2XYLA 4NT0A 2E5BA 1E6SM 5HWJA 8TIMA 1O1ZA 2PDLA 2VM8A 4Z2KA 3L5LA 5J5DA 3ANUA 2BY3A 3WLKX 2ABBA 3K5XA 3NO1A 1CTNA 3S2CA 2Z1SA 2J27A 3TAKA 4LC8A 4O10A 5A6LA 1JDFA 1RXOB 2NQHA 3CJPA 4GVFA 5CPOA 5EFFA 3G3MA 3UGVA 3N1AA 4W7UA 3NL5A 2GFTA 2X42A 3M7WA 4MNJA 1QASA 1OFPA 3P93A 5HXMA 4L4MA 3EXRA 1XIDA 9XIMA 3DFHA 4AD5A 3IJIA 3TJ4A 3LXBA 1FHLA 3HM7A 3A9BA 1MZHA 4O57A 4DIAA 4ZO8A 4GX8A 4CD6A 2YBTA 1VEMA 2ZC1A 1NOUA 1QNVA 1GQKA 2ZZ5A 3G77A 4F9JA 4PCFA 4W93A 3DCPA 3WD2A 2PDHA 1R30A 4PFMA 3B04A 1PJ9A 1FXQA 3W37A 5IOBA 4REQB 3C0LA 2FVKA 3OBAA 5FKYA 3TSMA 1U1JA 4CNUA 1YXDA 3EOSA 3E5BA 3C6CA 4IP4A 4JIEA 5BROA 4I9TA 5REQB 1L6WA 3W6YA 3FEMA 2E68A 1A0EA 2VFGA 2VVSA 1ZBWA 1BFNA 3E0VA 4L64A 3BAJA 2DZSA 1DXFA 1LM1A 3WK3A 3RCMA 3CUIA 3UETA 3F4NA 3RITA 3H2FA 3VO0A 4AMCA 1EPVA 3RLHA 2MNRA 4HVXA 4US5D 5CSRA 2GSEA 3T40A 3B0PA 3HG4A 4PTNA 1D7KA 3P80A 3UJEA 2OPJA 3SUTA 3BK0A 3OIHA 1K02A 3WELA 2V3DA 3FS2A 2D3NA 1BD0A 3TW7A 1ZSXA 2ISWA 3LTSA 1OC5A 1JL8A 2YSWA 5JIPA 1RA5A 4WZHA 2HBVA 1XIGA 3KVKA 1OFOA 1VEOA 1P6WA 5CBJA 4ALDA