4JQ4A

Akr1c2 complex with indomethacin
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
316
structure length
316
Chain Sequence
b'KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 112
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq4A00
1C9WA 4RPQA 4YU1A 1Z89A 1RY8A 1RY0A 4R9OA 1HW6A 4JIRA 1PYFA 2NVDA 5HNTA 2FZBA 1LQAA 1XJBA 5DANA 2HE5A 1S2AA 5HA7A 1T41A 4ASTA 1ZSXA 4XVDA 4XK2A 4ICCX 2ACSA 2C91A 3H4GA 2BGSA 3RX4A 1S1PA 2P5NA 4JQ3A 3R8GA 1LWIA 3LEPA 4EXAA 1S1RA 4L1WA 3GHRA 1JEZA 1Z9AA 2HE8A 4YS1A 3Q65A 2BGQA 4GABA 3UZZA 2PEVA 4GACA 1M9HA 5LIYX 2ACUA 2PDPA 2DUZA 4XZHA 3V0TA 3LQLA 3UZYA 3CASA 4IGSA 4WEVX 4JTAA 5AZ1A 3RX3A 3LQGA 4JTCA 4H7CA 1SM9A 4JQ2A 3M64A 2IKHA 4JTQA 3EAUA 5C7HA 2PZNA 4PR4A 3GHSA 2PDBA 2PDWA 4YVVA 3UFYA 2ISFA 4NKCA 1AZ2A 1ZQ5A 4HMNA 2ACQA 1IEIA 4FA3A 3UP8A 2HVOA 3O0KA 2IKGA 4WDXA 4QBXA 3R94A 4PRTA 5M2FX 3LZ3A 2ACRA 3BCJA 3CV7A 3ONBA 2QXWA 3CMFA 1A80A 1FRBA 1AH3A 3P2VA 3N6QA 2PD9A 5JH2A 4QXIA 4LBRA 4G5DA 1VBJA 2F38A 1ZUAX 5HNUA 3ONCA 3G1RA 4H8NA 4LB4A 1Q5MA 1VP5A 1UR3M 4YVPA 2PDUA 2PDJA 2VDGA 3WBXA 2ALRA 3D3FA 3R6IA 2PDGA 3CV6A 3T42A 4GIEA 3V35A 2WZMA 4QR6A 4GA8A 2HVNA 3BUVA 2IQDA 1EL3A 3LENA 2PDNA 2FGBA 2FVLA 4EXBA 1MRQA 3RX2A 3H7UA 4GQ0A 3GHUA 1EXBA 3GHTA 4Q3MA 1AZ1A 3B3DA 2FZ9A 4WDWA 3C3UA 4LB3A 3WBYA 1RALA 4XO7A 2WZTA 1GVEA 4L1XA 5JH1A 2I17A 2PDKA 2PD5A 2IKJA 3MB9A 1YE6A 2J8TA 3DOPA 3V36A 3V0UA 1PWLA 3LNMA 3EB4A 3UYIA 1AFSA 2INEA 3O3RA 4FALA 4XZIA 3MC5A 3LZ5A 3UG8A 3R58A 1MZRA 3UWEA 3CAQA 4DBSA 2HDJA 1R38A 4ZFCA 4PUWA 3BV7A 4LAUA 4XO6A 4FAMA 4OTKA 1YNQA 3G5EA 2AGTA 3Q67A 1AH4A 2IPGA 3EB3A 3LN3A 1X98A 3R7MA 2IPFA 3V0SA 2DUXA 4LAZA 2CLPA 3UZXA 3WCZA 3M0IA 1Q13A 3COTA 3S3GA 3LBOA 4MHBA 3DN5A 1AH0A 1HQTA 4IJRA 4AUBA 1X97A 5AZ0A 2PDFA 3UZWA 5LIXX 2IPJA 2PDMA 4XZMX 2NVCA 5LIKX 4WDUA 3BURA 4Q7BA 1XF0A 2R24A 4PUUA 4LBSA 4IJCA 4JIHA 4PMJA 4PRRA 4JQ4A 2PDYA 3FJNA 4XZLX 1K8CA 3R8HA 3FX4A 4XZNX 1EKOA 1PZ1A 3N2TA 3M4HA 2F2KA 3LUTA 3LD5A 4XAPA 2IS7A 3QKZA 4JTRA 4QX4A 1X96A 2PDCA 2PDQA 4GQGA 3H7RA 4JTDA 5LIUX 1ADSA 2HV5A 1Z3NA 4JIIX 1OG6A 4WGHA 5KETA 1XGDA 3U2CA 4GCAA 5LIWX 4WDTA 2IPWA 2R9RA 3VXGA 1US0A 3R43A 4DBUA 3KRBA 2PF8A 3GUGA 1IHIA 4I5XA 4DBWA 1YNPA 3WBWA 2PDXA 3F7JA 3ERPA 1J96A 3NTYA 2PDLA 2IKIA 2PDHA 1PWMA 1ZGDA 1PZ0A 2FZ8A 4HBKA 4FZIA 4F40A 4WRHA 2FZDA 2DV0A 4DZ5A 1T40A 2HEJA 2A79A 1YE4A 4JQAA 1QRQA 4YVXA 2IQ0A 2INZA 3CAVA 3WG6A 1EF3A 1Z8AA 1QWKA 4XVEA 2BP1A 3UGRA 1MI3A 1S2CA 4JQ1A 2I16A 2PFHA 2PDIA
chains in the Genus database with same CATH superfamily
1SVDA 2YPIA 4ZGYA 1TO3A 1V7AA 3NXLA 2VUYA 1SFLA 2B7QA 1XYFA 4O1AA 4WKAA 3IACA 4KT2A 1M41A 3WK0A 3KCJA 1DWHM 3SN0A 1EA9C 1FBAA 3WJSA 4UTJA 1M65A 4JKLA 5HA7A 3W2LA 3IUHA 4CQDA 1HKMA 2V5KA 1W17A 4F2TA 2BODX 5T9CE 2OQLA 4G7EB 1EIBA 4CLMA 4K8HA 3TEVA 1VCFA 3C8NA 3N9KA 2GQ8A 2O4MA 3QPYA 5M17A 5BWFA 4XD6A 2PWGA 3HG3A 6XIAA 1J79A 5A2BA 3AHTA 5HWJA 1P1MA 5DX7A 1UZHA 2JALA 1PKNA 4FLQA 4RE2A 1CGTA 4PTVA 1RPKA 4B4FA 1K9EA 1HKWA 1DXEA 3UR2A 1Z32X 5HK4A 1PE1A 2HPIA 3MUIA 3EMCA 5G1TA 1TX2A 4KWVA 1BF6A 4CD6A 3VGHA 3HF3A 5EU9A 5HMFA 1RLDA 1LL7A 3DFTA 3O6DA 4KGLA 4MADA 3W3OA 1T8XA 1QCWA 4ZQNA 4YCOA 1F74A 1NEYA 3WMBA 1P7TB 3SZ8A 3M64A 1E4MM 3EAUA 4RKAA 1J2BA 1OC6A 4L56A 3C8FA 4HMCA 3NPVA 3UFYA 1NQ6A 3I7RA 4DO7A 4WXZA 1CIUA 3P8IA 1A5AA 1XS2A 1HL8A 1XGZA 4MLJA 3ZWTA 1POJA 2FHBA 3W23A 2OTDA 2H3DA 4M56A 1P6BA 3SRKA 4DAFA 1GOQA 4UTHA 3W85A 2B31A 4UTTC 1Q6OA 2FLIA 1A49A 3TJXA 3I3EA 4U33A 4BFAA 3G1SA 3H6OA 2PC4A 3BCJA 2Q8LA 1C92A 1TX0A 1UJPA 2B4GA 4C7FA 3W7CA 3L66A 3EOSA 4PB4A 5TQLA 3MSDA 2FVMA 1P43A 2J7FA 3CZKA 3ZLGA 4W89A 1T7LA 1CLXA 1ELSA 3W1XA 4I9AA 5BOEA 2XDFA 1NIUA 2FB3A 4OOZA 4LB4A 3KOYA 1KNWA 1VGAA 1UROA 3IUDA 3OPSA 1C8VA 4RW5A 2VX7A 4ES4A 5AVHA 2HROA 4QEEA 2VELA 2G3IA 1WDSA 1NELA 1AA1B 3T42A 1KCXA 2V5DA 3G6LA 4GIEA 1NWRA 3MS8A 3IGSA 4JTIA 3G1VA 1JUKA 1SZGA 6REQA 2V2HA 1R9XA 2RJGA 3L0NA 3KP0A 2XFRA 3H7UA 3GU9A 1N2VA 2A3CA 5CPSA 2A0NA 4XSMA 1AZ1A 3C61A 1W3HA 5D8WA 3W1UA 1MZHA 3C3UA 2TPSA 2G3FA 3LX9A 4CQ9A 3AXXA 5LZLA 3E9AA 1MQRA 5FEZA 4JGDA 4TVCA 2X40A 3PFMA 3V36A 1OY0A 1EX5A 1K7XA 4MB3A 2YLLA 3IIOA 5I09A 1B1YA 2UY3A 4PBEA 5A6BA 2DZBA 2ANUA 1W1VA 3C0QA 3CAQA 2HPMA 1VAHA 1OGBA 1ZS2A 4NJIA 5CGTA 3VA8A 5GNXA 1UPMB 3P74A 5IRPA 3U7BA 4LRTA 3PJXA 2AAMA 5LNRA 4ZQPA 2QJJA 4GRSA 5I7GA 3V7PA 3MV01 4YJ5A 1YADA 1IR2A 3EWWA 1LZOA 4GIAA 1ITQA 1Q7ZA 1GOIA 1VEPA 2Y70A 1LL4A 4H2CA 4DXXA 1PIGA 3FNDA 4O4WA 2C3ZA 3BXWA 3FXGA 4LUSA 1HQTA 1V0KA 4HGXA 3QEZA 1F8MA 3VILA 5A95A 3T8LA 2PDMA 2E77A 5A8OA 1UCWA 4GYKA 4CEXC 5EKYA 3TOYA 2H9AA 1MW3A 2G3JA 2WM1A 3NPUA 3WDHA 3QHMA 3Q94A 2DSZA 3TN5A 5CPLA 3EOEA 1O5KA 4DZIA 6ENLA 2AL2A 4R7OA 5CPTA 1R8LA 1QHPA 3QGKC 1VEOA 2Z1WA 3CUFA 5GJPA 1K70A 2YZ5A 1ADOA 1K8YA 3VGGA 1UA7A 4JTDA 2BASA 1E4IA 1XYCA 1W9DM 2WYSA 2YIHA 1IXPA 3T1GA 2WVVA 1OG6A 2V30A 4WGHA 2I9UA 1IYXA 1XGDA 4KWWA 3GU2A 4O16A 3OVRA 1QNOA 1GOWA 2QJMA 2R9RA 1IEXA 3MHUA 3DC8A 3NOEA 4LOCA 1DOSA 2IQTA 4WK9A 3S1UA 2NX3A 2AL1A 3LHVA 4ICNA 3L67A 2BNJA 3O2LA 1BG9A 1YNPA 3YPIA 4ERAA 1ONXA 2PDXA 2V67A 1Q63A 5KMYA 4E2VA 2NQ9A 3P5YA 2R94A 3GKAA 3S6DA 1PWMA 1ZGDA 2UBPC 3EWZA 1W3TA 5JIWA 3A4AA 4AFYA 4K6AA 4PUEA 3T9PA 3LPGA 2HEJA 3OP2A 4K36A 1E6SM 2OQHA 1S5MA 4OUEA 3L4XA 4R33A 3PZVA 1MI3A 5KITA 3GNDA 3C2EA 3BTNA 4O0KA 3M0HA 1H3GA 4JKKA 2PTZA 2XVNA 4D71A 5J5DA 3TMLA 1R46A 1XYBA 4IT1A 1EGZA 2VENA 3MWAA 4PCFA 4DO5A 1DQUA 3UERA 2XGZA 4I90A 1JYXA 3AMDA 1SGJA 3OBKA 1I2NA 4RZBA 5KINA 2WNQA 2X1IA 3H4GA 1QAPA 3LCXA 2CETA 2XVGA 3EYPA 4GXMA 2WNWA 1UC5A 5BMWA 3GDKA 3B0PA 1R9YA 3E2VA 4DUOA 6A3HA 1G4PA 3TVAA 3GC4A 4H9MA 4X3ZA 5A1AA 1E72M 3IJIA 1LLOA 3AIUA 3S2CA 5DLCA 4MB4A 1UKQA 2P3ZA 4YS1A 4YTQA 1M3UA 1ZCOA 4D1JA 3S9ZA 3UPWA 3THDA 2QUTA 3E0VA 3MP3A 4ORIA 4N9DA 2YCJA 4UIOA 1OZMA 2QZRA 4QNWA 3UU0A 3LB0A 3EDKA 1W56A 3QY6A 3CLWA 1WDWA 3TA9A 2ZCGA 1US2A 3RX3A 3P3BA 1FUYA 3MI6A 2OSWA 3QQ1A 3OO2A 3T8QA 3QGVA 4GNVA 1LT7A 3APGA 3KOFA 2EJ1A 4EK7A 5LGZA 2ZX8A 2QYGA 5DQPA 3POCA 3EWUA 1WXJA 2IKHA 5EMLA 2BB0A 3QZEA 2ABAA 3I68A 4O1BA 3WDRA 4IIEA 4NKCA 4O15A 1LLWA 4S3GA 5A2CA 1KWGA 2ZRWA 2QVHA 2CU0A 3BAYA 1ODZA 1LUCA 1JCYA 4M51A 3GVGA 1KFBA 1XQLA 1Z48A 3L21A 4C65A 4AWSA 4IFRA 3C0JA 4C6KA 1EJ7L 4LAKA 2D2OA 5M2FX 2VFFA 1JCTA 3DECA 2ADAA 3B8DA 1Q4NX 3EEZA 3SCWA 1OHLA 4JTSA 1GOKA 2GLKA 4QROA 5E09A 2X1SA 2XGIA 4A29A 3N12A 5I23A 1O94A 3UCCA 5BCAA 1UZ1A 4E4FA 2GPTA 2HXTA 1EB3A 3HFYA 4K37A 1ZUAX 2OXNA 3USBA 3OQ8A 1XLFA 4QCFA 1P0EA 3IEBA 4H8NA 3ZJ7A 1SO6A 4H8UA 3SUVA 3P0XA 3MSYA 3RLGA 3THAA 3VKKA 2PZ0A 2TODA 1E70M 2J24A 1HJQA 3QJAA 2HNEA 5CBBA 1VFUA 4RNJA 4OBRA 1FWNA 3QYSA 3WL1A 1ICPA 1AD4A 1A0CA 1LDCA 3FHQA 4M81A 5DT5A 1PKMA 2BWGA 1B4KA 3CZGA 1SSGA 2V3GA 3GHTA 1B4EA 5A6LA 2FZ9A 4WDWA 3RK8A 4KFNA 4GJ1A 1XL9A 2O0TA 1DV7A 1GVEA 2I17A 1JAKA 1YTKA 1UWSA 3RUBL 1IEQA 4AH7A 1IEWA 4GG9A 2YFOA 3ZT6A 3LNMA 1IZKA 5FSDC 1TPB1 1KRCC 1NAL1 1X8CA 2W4XA 5LA1A 4O11A 3B9EA 4LVBA 3W72A 1R38A 3R79A 1NJJA 5D05A 1CEOA 2Z2UA 4GE8A 1PBGA 2E6DA 1SO3A 3VGFA 4M6PA 2VGFA 3BOFA 3R0KA 4PCPA 1X98A 3JW7A 3MMUA 4CD7A 3AOFA 4REQA 3CPRA 4F3HA 3TE9A 2A4AA 2DPEA 3CL8A 1W9BM 2C0AA 1ZALA 3FOKA 3WFZA 1RBOB 2DU2A 3KL3A 3DN5A 2W79A 4MWAA 4PTNA 5H2ZA 4RZ6A 3WH5A 1G4EA 3CHCA 4IPPA 2VP8A 3U2OA 2AQWA 1MEHA 1J01A 4FLOA 2NX1A 4H8VA 2ZZ7A 1P6WA 1J0HA 3OA5A 3WLKX 5BRBA 3NOYA 5GNYA 1CX9A 3E1F1 3IJ7A 3P80A 4JHOA 2E68A 2WW5A 4M6QA 3CV1A 3SCNA 4F9DA 3WLLA 4G7FA 2CLMA 3FIGA 1B3OA 4JIPA 4FOKA 3LUTA 3CIWA 4UFHA 1H41A 4UQBA 2C1HA 5D03A 3S46A 2PDCA 1UD3A 2FHFA 3B9AA 3G0XA 5LIUX 1ADSA 5D30A 1X1NA 2WVVB 2VRQA 4FNRA 5F2LA 4LQ1A 4GXPA 5KETA 3KLLA 1TSIA 2X8RA 2BY1A 3L5MA 4DM2A 1UWUA 1IXNA 1KFJA 4AVNA 1KR1A 3WQCA 1NWTA 3LDVA 4PRWA 3G1YA 5M03A 1Q7QA 1CGYA 1PCWA 3UBPC 3GXMA 1Z41A 3QMSA 3W76A 4C6EA 1FCBA 2PCEA 4EWJA 2QS8A 4HZ8A 3HGRA 2OJPA 3PPGA 3GFYA 5JMUA 3WY1A 4F40A 1UPPA 3IJLA 1GOOA 3B0VC 3UJFA 3LHWA 1TUFA 3DYMA 4C60A 1UH3A 3P60A 4CNUA 8XIMA 3AYTA 2PWFA 3HQ1A 2GSHA 4UTWC 4DBDA 3SECA 3N34A 3QGAC 3BCDA 3E49A 2GL5A 4W9TA 3WH9A 3NO3A 1L6FA 1UIOA 2R1NA 4KGJA 3EB2A 4H9XA 1E6XM 3H12A 3KOZA 3AQUA 4WCJA 2ZZ6A 4J4KA 4NNAA 4XVDA 3W7NA 4FLRA 2ACSA 2INFA 1VFSA 1PS9A 4XTIA 3IPWA 2XINA 1E0VA 5JIPA 3LLXA 2C1IA 3R8GA 2YKKA 3HJEA 1UP0A 1B0IA 2RUSA 3CC1A 1DHKA 3ZXWA 3W28A 2FH6A 1BSIA 4LYQA 3WQPA 1Q2SA 4PMDA 3GHRA 1BVNP 3EX1A 1LLZA 4QG6A 3H26A 3WK2A 1U5VA 4IFOA 3GY1A 3AI0A 2A21A 2VKZG 3A21A 4CN1A 1L6WA 1EJSC 1QNRA 3GFZA 5DMNA 1CXIA 3TFCA 5HUOA 3V4BA 3VIMA 3FSTA 3S5SA 3TSMA 2C7FA 4JN7A 2WSQA 1WKYA 1T8QA 1E1CB 1VD6A 3A3XA 4JTCA 4PUMA 3RO6A 3RPTA 3VOCA 2QCHA 2VMFA 6CGTA 4XZBA 1Z7AA 3GDRA 3EXRA 3QMTA 3G22A 1TE6A 2XYLA 4CCZA 3LGDA 4UTKA 2ISFA 3I4KA 2V8ZA 2J74A 3PWIA 4GD0A 2CFFA 2JIWA 3LSCA 1TV8A 2Z4GA 3LV6A 3UP8A 1HNYA 4MIMA 4MKSA 5F4XA 3I65A 1KV8A 4JTEA 3QH2A 3K4WA 2ZUTA 1LOQA 3SUUA 1HTIA 3QKEA 3R94A 4PRTA 3BG5A 2EG6A 4O53A 4FNSA 3P2VA 2GK1A 1RD5A 1Y5XA 1RK5A 2XIOA 3W9ZA 1UC4A 4NAEB 5JH2A 1H62A 5HNRA 4LBRA 1E3XA 1PB0A 1W1B1 3LCWA 5I00A 6XIMA 2PDUA 4IOTA 1GQIA 4LNYA 3KOWA 3WBXA 3NM3A 1UQYA 3SIMA 1G1YA 1ISXA 1GKRA 4S3KA 3G0UA 4LEFA 4DJDC 5D4YA 2FVLA 3BLDA 3GYCA 3MI3A 3RX2A 1SR9A 3W84A 3FJ4A 3NDOA 3M5YA 4O52A 4C6CA 1UKOA 1A4MA 2GJLA 2B81A 5AC5A 3ABXA 4QRNA 1FWEC 2ZX5A 3PHAA 5AHMA 3VZZA 3L4ZA 1YE6A 3DOPA 3W02A 2PGFA 4HA0A 4IGHA 3BLPX 5FF3A 1GPWA 4LNCA 4NU7A 4HCDA 4Z2KA 1LCOA 3BJFA 4MZYA 4IQJA 1AD1A 5BXSA 4R7JA 2DY3A 4XAGA 5LXEA 4BQ3A 3SUWA 1JG9A 3ZJ8A 2Y61A 1H7PA 4GQBA 5DT7A 4QLKA 5EPDA 3DFOA 5E9XA 4FF7A 4B9ZA 1CBGA 2VD8A 3G5EA 4J3VA 4S1FA 3O9NA 3M7SA 4UR8A 1J0YA 1OC7A 1QVBA 2CEQA 1V79A 2VHLA 5K9CA 1SZNA 2PBGA 2ICSA 1TV3A 3BSMA 3MKCA 1SW3A 4AZBA 4MDOA 4IFKA 1RA5A 2ZZ1A 1RBLA 3BLFA 2ZX7A 2BOEX 1TJ2A 4UBPC 1K4GA 2X0HA 4NJKA 2XIIA 1D8CA 3TYBA 4DEFA 4XZMX 4AHPA 1TA3B 2BV9A 2XFYA 4TR9A 1HP5A 1HUVA 4WY0B 4PUUA 2XN0A 4M1BA 4QJ4B 1B3WA 1C3FA 3EPOA 2VZUA 3UWYA 3UD6A 3GB6A 4L5ZA 1CI1A 4DO6A 3M6DA 3DG7A 1DTUA 3IJ8A 3PZGA 3GG1A 2FZNA 1PCKA 2AOSA 4FIQA 1PKYA 5EBAA 4I5UA 1OIMA 4AZ5A 2ZRZA 3O06A 1DIKA 3JVAA 4ZBCA 2DZVA 2BOGX 2ZZ2A 1E0TA 1WAUA 1GJWA 1OD0A 1TRIA 3V18A 4GCAA 1JZ5A 4ZTXA 2WVSA 2V5JA 4FOUA 4J3XA 1PL9A 5EY5A 3NL6A 1EJWC 2GDQA 5CBIA 2YDRA 1JDCA 3IANA 5B7ZA 1D7FA 2EBNA 1SJAA 4XD3A 1W8SA 1GVFA 2AAAA 3HOJA 1TV5A 1XIFA 3PZ9A 1F3WA 2Z1VA 4A22A 4BQ2A 4NI8A 2PDHA 4PODA 1JZ2A 2L5HA 1I0BA 1M53A 3OIHA 4F4RA 2V69A 3PZUA 3B40A 4A4AA 1UH4A 4GJIA 1YE4A 3L65A 2Y5EA 4NNBA 4ZFMA 3SBFA 1G67A 1Z8AA 4XVEA 2YDQA 3T81A 3AIQA 3LHZA 1KCLA 2ZVIA 3GTHA 3UETA 3GFXA 4G1KA 1FQ0A 3MBFA 3K30A 3TTOA 3B8VA 4CQ8A 1PYFA 2BSLA 3LCFA 4NI3A 4IX0A 2XH7A 3GDBA 3G1DA 5I2UA 4DF0A 5HUPA 1JGIA 1F6KA 1QNSA 1EOKA 4P5UA 3RYSA 4HNLA 4MAVA 2BMBA 1A4LA 4HA4A 4DF1A 4QSHA 1B90A 2G3MA 2NV1A 4D8ZA 4MJZA 1RQBA 1GEQA 1ITXA 1S2TA 1EZWA 1O1ZA 2OVLA 4I3GA 4YTUA 2WNZA 3E5PA 4B3KA 3KBVA 5IBXA 3NYZA 5CZ0A 3RM4A 1K4HA 3QFEA 4AD0A 4XBJA 1CCWB 3W71A 2QAPA 1X39A 3CGTA 2G37A 5LHFA 4E2DA 2BGQA 2E67A 3CEPA 4ZTYA 2ZC8A 5K7JA 3AJ7A 3N25A 2ACUA 1A5BA 2A6NA 1LT8A 4HNOA 1H1NA 3GK0A 4Z1BA 5GPRA 2V5CA 1XRTA 4JL1A 1E1FA 1KRMA 1TUXA 4TX9A 3GIQA 2QCLA 3IV3A 1RV8A 4DELA 2P88A 4DZAA 1Z6KA 2DJXA 5K9XA 4US6A 3TCSA 1H49A 1QXLA 4JTQA 1OFPA 5C2XA 1B9ZA 2JQXA 1KFEA 3G1XA 3EMZA 1CT5A 2WMKA 2E5DA 2QW5A 5HMDA 5CLWA 1B3VA 1DJHA 1FDYA 2G41A 2R6OA 3M43A 1Q6QA 3GG7A 4WX2A 1ME8A 2G8ZA 4KWUA 4Q8PA 3QSRA 1U1JA 4AZIA 2GUUA 3FA5A 4WSKA 1BRLB 1IE7C 1CECA 1M7PA 1TV7A 4Y2WA 4DWSD 3W37A 3VM7A 3GIPA 4D6EA 4HZMA 4OGZA 3OZOA 4NJHA 3SUTA 3T0BA 1Q65A 4PMRA 4XIAA 1MSSA 5IFPA 3AIVA 1JQVA 3K8LA 1M7JA 4NILA 3W1AA 2F38A 4O0ZA 2DZAA 9XIAA 4IJBA 1RXOB 4IIDA 1A5OC 5B80A 2EG8A 3RCMA 2YXOA 1UR3M 1D3HA 1F07A 4NYYA 4X2PA 2ZXDA 3W7QA 2A5HA 1W54A 2UWFA 3E02A 3NSXA 3FAWA 1HL2A 1KFCA 2VWTA 3RILA 2A7NA 2CCRA 5DBTA 3SCTA 5ABTA 4C90A 3NQMA 4RDWA 4S3EA 1XSKA 1ODUA 4TXEA 4M7TA 4ZQMA 3WQFA 4EAMA 3PB0A 3LYEA 4M24A 1R2RA 4EVZA 1QI2A 4KS0A 5I02A 3RCNA 4ZA0A 4AY1A 2D0HA 1CYGA 1HO1A 1WX0A 2WQPA 6PTDA 1A3XA 4XO7A 5D9PA 2NQ5A 2GVGA 2WOQA 1YTEA 4NNCA 3AAMA 4MJMA 1TB3A 4WJEA 1XH1A 2C0HA 5AYZA 1XDMA 4GI6A 2GUYA 3REQA 2DZXA 3KTSA 3L9CA 3VIOA 1H50A 5CQ1A 2PMQA 1OZQA 1V3IA 5T8GA 1L8PA 5AHFA 3UXIA 1BXCA 2R1KA 1Q85A 6TAAA 1NFBA 1W5NA 1IWBA 2X2GA 2NX9A 3OG2A 3VGBA 3VOFA 1Q6FA 2VGIA 4GBDA 3VNZA 1V6XA 1AH4A 3N17A 2ZVRA 3DI1A 4W88A 3ABQA 4RDVA 1XCXA 1F76A 1K03A 4F9JA 2DVXA 2VC5A 4YPJA 2QNEA 1RR2A 1L6YA 2V82A 2OODA 3BGGA 1V7YA 3CYJA 4DVOA 1W1A1 4GUJA 1YNYA 1G7UA 4PZVA 2VOMA 3BAJA 3M5ZA 3VNLA 4XBKA 1CB2A 3QW3A 2X1RA 5AYYA 1KBJA 6TIMA 3NL5A 3C2YA 2YGYA 1HXJA 3GTIA 3EEGA 4AZ7A 5CXPA 4ZR8A 4X9YA 9RUBA 1UP2A 1GYNA 3W4RA 3MPGA 5D02A 5CJNA 2R24A 1SMAA 3O16A 4CN6A 1WZAA 4HOWA 5I06A 5CZJA 2DT3A 2F6UA 3IS4A 3VC5A 2CZDA 2DZWA 3LTSA 4MYXA 3U0HA 2OLAA 1GVRA 4I8DA 5EFFA 1JRBA 4AMAA 3M4HA 2HQAA 2OEMA 1W3IA 3CNYA 2Y8VA 4JKMA 4W7VA 1YKWA 4QS5A 3TMQA 5IXEA 1WBJA 3SIZA 3S1VA 4UZUA 1KV5A 1WP6A 1GGOA 3C2RA 4D8AA 2VVSA 1BSLA 1XPGA 3LM3A 4WZHA 1XSJA 5DELA 3PBWA 2F7FA 1QASA 1H2JA 4XKYB 2W6RA 1QW8A 1I0DA 1DWFM 2BDQA 3F03K 4MUZA 1V03A 1TPDA 4BI5A 3E0WA 3R43A 3CPGA 4UQAA 1GZ1A 3QOMA 1NTHA 5MF5A 1S5WA 4H83A 2XWEA 1IF2A 5EFDA 1M04A 2BTMA 3D0CA 3S1WA 2DP3A 3F7JA 4Q8WA 1WUFA 2XM1A 3TR9A 3HGJA 4CNNA 3NTYA 5EA9A 1WKDA 1XD1A 4D8LA 3OU8A 5A6SA 1H5VA 4J2PA 4ACZB 5EMYA 3M47A 4GVIA 2F9RA 2ZA1A 1ZU8A 3W29A 3QM3A 4C6NA 4DZ5A 3CTTA 3F1QA 4MPQA 4O8RA 2KAUC 4M6UA 4CEUC 1BYAA 3QPEA 1MQPA 1W3LA 1J11A 2RJHA 3UGRA 2XIMA 3NO1A 3SQMA 4DB7A 3A4XA 2DSVA 2RHGA 1V0MA 5E0CA 2HS6A 1RY8A 1RSCA 3VNMA 1GK8A 4R9OA 1MXGA 4AC7C 4LUTA 4DYEA 2GGIA 3OOQA 4Q32A 3UJRA 3KX6A 1G7VA 2V81A 4EPEC 4GVHA 4AHQA 2PA6A 4ICCX 4OBSA 1BGGA 4AZGA 1KWKA 5A6TC 5JBEA 4JAWA 2P5NA 3DFYA 3R1ZA 4IP4A 3VIIA 1F9CA 4O12A 4DXKA 3W27A 3WX7A 5E6ZA 1Q8AA 4O0QA 1VJZA 3A9IA 1JF5A 4AXNA 4YMZA 3PTMA 3UXLA 5D09A 7XIMA 3NPWA 4NZCA 1YDVA 4UQ9A 4QJ5B 3GTFA 2PEVA 2FJUB 2ZZ5A 4KEZA 1EUAA 4KEVA 3K8MA 5G4HC 4HNNA 4NF7A 3QYQA 1TPC1 4Z1CA 4Q8QA 3AROA 1GQJA 2ZXAA 4ZE4A 3V5FA 1O5RA 2ZUNA 1H1ZA 1EC7A 2DSWA 1CENA 3U48A 3TAKA 2J62A 3OVGA 3B9DA 1YPXA 2BXVA 4JQ2A 4HMDA 2P3EA 5IBXC 4UB9A 2FDMA 2QPUA 3BMVA 1AMYA 5ABGA 2FPTA 3QY7A 1SJDA 1EEXA 3QFWA 1IEIA 4LW7A 5D2WA 5AC8A 3PM6A 4NZFA 3EWCA 2E1DA 3E12A 3ARPA 4X22A 1F73A 1MUWA 1H7RA 1WZLA 3GXFA 1PEZA 4RZ5A 1UR1A 4GX8A 3KUMA 3G3MA 5I5RA 4BR1A 3SCRA 5IDZA 3WDPP 4ICMA 4XUYA 4H41A 3L2LA 3UXDA 1OADA 1L6GA 1BGAA 5GVJA 3S2NA 2DIEA 5I3IA 2CPUA 4CQAA 3ONCA 5A6JA 4GFSA 4HA3A 1SO4A 1I6NA 4IZGA 3CBWA 2ZZ4A 3VIJA 1VP5A 1TWWA 5CPNA 1A0DA 4XAYA 1QATA 1GJUA 4FX8A 4ILSA 3RU6A 1JVNA 4Q8TA 2NLYA 1OFBA 2OX4A 2WZMA 4OOUA 4WUIA 5FF2A 4U4MA 1K8XA 4CU7A 1XM3A 1KGUA 2PDNA 3ES8A 3D3AA 2PWUA 3LRKA 1H5YA 4PMYA 1UR4A 1EXBA 3LCGA 4JOMA 4WHBA 3W1MA 3SJNA 4W87A 3QLLA 1ICQA 4UXDA 3NQCA 1WBHA 3WBYA 1RALA 3ITGA 5JH1A 3PUEA 3NVDA 4ZE5A 5CAKA 3UY8A 3FCPA 2IKJA 4B3LA 5I3JA 4GWEA 3UG4A 1W1PA 3V0UA 5IHRA 2J7CA 2XVPA 4V1YA 5GJNA 5AY7A 1W2VA 2F84A 4H7VA 1NF0A 2PTYA 4GYPC 2NZLA 1GTEA 2X1UA 2AMGA 2JEQA 3QV6A 4AZCB 4W93A 4LWWA 1B3XA 3Q37A 4ZO6A 4O19A 5ABFA 1OJXA 3B04A 4MG4A 2B0MA 2VUNA 3PNZA 2QCNA 4I7VA 3G8EA 1N7KA 2QUUA 3BL3A 1TG7A 4QSFA 5FEXA 4FXRA 3BQ5A 2E4TA 5FEWA 3TIMA 5M5DA 1ENUA 4PMUA 3NAVA 2QV5A 4IH3A 5IDIA 3TNOA 4PEEA 3T40A 2WVUA 3H53A 3NL3A 5F7UA 1NWSA 3SSJA 3QV9A 1J0ZA 1OWQA 3BPWA 2NVCA 4FP1A 4KCVA 1YRRA 3CYVA 1F4AA 4AHOA 5I77A 4JIQA 3N15A 4PB3A 2YL6A 1J9YA 1TTPA 1H60A 1DJNA 3MA8A 3GNRA 1GW1A 1I60A 1PTDA 4RW3A 5CEWA 2YL8A 3DKJA 4UFLA 1GW9A 1MRAA 3ZWSA 3RAOA 2FFCA 2YB1A 3TNBA 1FXQA 1OSEA 2A3EA 4XAPA 4ENLA 4A05A 3AXIA 3KE0A 4HNCA 1GQNA 2X0YA 3C2VA 1K3UA 4L7ZA 3HPZA 3I6TA 2GOUA 4PSPA 2J9YA 1FWTA 2IPWA 4XV0A 2Z1KA 1OF8A 3S2LA 5KZMA 4PCSA 3P14A 3B8UA 3BAKA 5FJUA 1XIBA 3U7VA 1VYPX 4A21A 2WPGA 5CGQA 4A8RA 1NP0A 1IXQA 3LK6A 4X61A 3NVTA 3AS3A 4ERGA 2AKZA 2BXYA 1JL8A 4JBRA 1O4UA 3WEOA 3H2FA 3AIRA 2XPKA 3W2NA 5D2YA 2OPJA 5A6AA 4B91A 5DRIA 2ZOXA 4LYRA 2FZ8A 1TVNA 1PTGA 2W61A 2FZDA 2WCAA 3BE7A 3CHDA 4JL2A 1A5MC 1VFHA 3S2MA 2V3EA 1EDQA 1DE6A 3U8GA 1ONEA 3S5YA 3W24A 1HVQA 3KBJA 5LA0A 1FH9A 4DN1A 3AC0A 4CCDA 3WH6A 4CVUA 2VNCA 1JZ7A 4JX5A 1TJ0A 2CWXA 4QDMA 1E5NA 4TMBA 4HJFA 4E6MA 3OVQA 1CXLA 3L4VA 5T91A 4A3RA 1TR1A 1U33A 5DANA 1W32A 3N2CA 1VIWA 4F79A 2JGQA 4JEJA 1Q4WA 4M3PA 3RLHA 1SFJA 2VDHA 4NASA 3ABOA 1VIZA 2CHOA 1CGUA 1N82A 3QQ0A 3RMJA 3XIMA 1XWYA 1TIWA 5ABHA 4GC4A 4JEQA 1YXYA 4DRSA 4QE4A 5CSRA 1BXBA 4NZ5A 4QDPA 4Y9OA 3SY5A 2XISA 1RQHA 1MWOA 5EMKA 1ECEA 1Y0EA 4GABA 3MP4A 3P84A 3W7RA 2X09A 3SRFA 2E28A 3HG2A 4TUFA 4GJJA 1W9XA 3EDDA 3ARWA 8RUCA 2VTFA 4MYAA 2YR1A 4IGSA 2YYUA 4AIEA 3GAYA 2GJXA 4C1LA 1U1UA 3MUAA 4F48A 2XN1A 1I45A 2O7SA 2OEKA 3KVLA 3WJYA 1UOKA 1ZCCA 4EE9A 4AQLA 3B9NA 2YCLA 4TQTA 3KLKA 4NT0A 5FI8A 4G6CA 1DKWA 1QI5A 2WJFA 3EWXA 1SQ7A 1A3WA 3ITOA 5I3KA 3B4UA 1XH0A 2PGWA 4PR4A 3E96A 3MDUA 3VD5A 1A5UA 1PDZA 3GLCA 1UWQA 2G4JA 1RLCL 4V1XA 2PWVA 7TIMA 5AYIA 4ZOAA 2EG7A 3LY0A 1LJYA 1Z42A 1EPVA 3MTWA 3UF9A 1VPXA 2ISVA 4QAWA 3RU8X 4RJEA 4Q22A 3VAVA 1RH9A 3CV7A 1I8JA 1M7OA 4F0KA 3SQSA 4H6EA 4FHAA 1A80A 2HMCA 3WJXA 4Q7IA 3AMCA 4C1NA 5BNKA 2XFFA 1WZMA 7CGTA 3ZM8A 1WCGA 1DJZA 1R87A 4QIUA 3ARTA 3K1GA 3ITTA 1KTBA 1B3YA 4LY4A 1DJWA 3PVFA 4ATLA 1XGEA 1UD8A 1OX4A 2VDGA 4LCRA 3R89A 4YNGA 2QVNA 2YBTA 4U2ZA 3V35A 3INPA 3NYDA 1E0XA 4QITA 4KFOA 3MMWA 1VFLA 3P67A 5AYXA 1H4PA 2JIEA 3MSGA 3UG3A 3U9IA 1EHNA 2GGHA 4I7WA 4QJ1A 2WSYA 1ZNNA 3PAOA 2TAAA 4J1OA 1RPXA 2E7FA 1VCGA 2BS9A 3BK0A 3I3BA 1DL3A 4HK6A 4NP7A 1ITCA 1KGXA 2CITA 3CPUA 1QBAA 2CLLA 4N4QA 2IW0A 5ECUA 1J0IA 2WCSA 4ZL1A 4UR7A 1UMYA 2BBFA 3EB4A 3UYIA 4U5IA 3QC3A 3PULA 3STEA 4DWSA 4FALA 5K4ZA 4DI9A 1JCJA 2ZZ3A 3R10A 4JY9A 3VFCA 1SYTA 3BCFA 1MNZA 2Y7DA 1NOWA 3ANYA 3CQKA 4WF7A 3WQ6A 4BEQA 3MV11 1W91A 3ZVHB 3BV7A 4LAUA 5BW6A 3SEPA 3V5CA 4NXKA 1MXDA 1YEYA 4KH2A 3MI2A 4YCPA 1JPIA 1TREA 4LUJA 3MJYA 1TQJA 4MGGA 3AMGA 4CQCA 4AZHA 4GCXA 3CWNA 3LXBA 2ZUMA 3GVQA 3MCMA 3R7MA 1KRBC 2MNRA 4ML4A 2JKAA 1XXXA 1SU5A 2ONEA 1MW0A 5AB3A 1P48A 1XDLA 3B97A 3PFRA 3GC2A 3UZWA 1B30A 3FKKA 4Q4PA 5AECA 1KM1A 2CLIA 2CXGA 2J25A 1KTCA 3IIXA 2WO5A 3JRKA 1KR0A 3GO2A 4CCCA 3ZZ1A 1XC6A 5IOBA 1QK0A 2AQVA 4JIHA 2DIKA 4ZQCA 1J0JA 1K02A 4M0XA 2WC3A 4GNJA 3WQOA 1NWUA 4G7EA 3POHA 4KESA 3GRIA 4ZO9A 3H22A 3AHXA 2HNHA 3BLOA 3C3NA 3KS5A 4OBTA 4GBUA 1UUQA 3VMPA 3QKZA 2I14A 2PDQA 4U3AA 2EPLX 2A3HA 3LXCA 1JR1A 1UKSA 4LY8A 4P7RA 2HV5A 4CN4A 4BI7A 4WKFA 3TSDA 2VEKA 2TMDA 4DJFD 4O10A 1KM3A 3FW6A 2XN2A 2MANA 4HYVA 2Z00A 2DZSA 3G1HA 4E2BA 2J27A 3RNDA 4MZ1A 1EWEA 3TOPA 1O60A 1FKXA 4JTKA 5BYWA 1YBQB 4HOXA 4LXFA 1P7TA 4NZ1A 1UIPA 4KEUA 2F61A 3DXIA 3RITA 3U4AA 2O92A 1U22A 4JX6A 2ZUWA 3U6WA 3LCLA 3HV9A 1W9PA 2DV0A 2HJPA 4FO4A 3TJ4A 3T05A 3U5YA 4GIRA 2G97A 3WFLA 3WQVA 1XX1A 4IL0A 3IVTA 3WH8A 2PU1A 4QFUA 4I9JA 1C9WA 4RPQA 3WNOA 3OZPA 4FI4A 3UEQA 1EC8A 2NUYA 2ODOA 5FJTA 1VLIA 1J12A 4ADUA 1K7EA 1W1ZA 2Q3OA 4WJXA 3O05A 3I6EA 3TWBA 2OQYA 3ARYA 2HE5A 4AB4A 5G4EA 1XSIA 3UVIA 1UW9A 1THFD 1UB3A 2CZVA 2REQB 1UH2A 1HGWA 2PURA 3BLEA 4S3JA 5G5IA 1S1RA 4AEOA 1BYBA 4M29A 3VKDA 3DCPA 4RPPA 1IV8A 4YXGA 2DUAA 3O07A 3CHEA 4AVFA 2EPMX 5FF7A 3B0XA 1D8WA 5DCEA 4JTTA 3IK2A 4YWIA 4FIRA 3U4FA 1LQ0A 1ADDA 1GNXA 4KRUA 3QXBA 2Q02A 1TMQA 1XLLA 1L2QA 4LS1A 5H8MA 1VFTA 2PWEA 2QCDB 2YBUA 2GUBA 3LXAA 3UJSA 3WNLA 2FIQA 4KKXA 3FV9A 3TUUA 1W3KA 3G24A 3GUWA 1GT8A 1OYBA 2WHJA 3MKKA 4S3DA 3E74A 3RLVA 1I2RA 4G56A 4OIFA 4WQ6A 2OZTA 3TTEA 1AW1A 4N9CA 3KL0A 2XVKA 4A3UA 2QGHA 3BG3A 1KBBA 2CKRA 3UPMA 2G5WA 1LRQA 4UZSA 4GKLA 1FWAC 2YDSA 3GHSA 1O12A 2PDWA 3EKGA 1JXKA 1GHSA 3BGAA 4L6OA 1AZ2A 5I3FA 1S38A 1ZQ5A 3UWZA 4TVDA 3HV8A 1VLWA 1XYAA 3EDFA 5GNZA 4Z1AA 3WD4A 2GQAA 3NO5A 3FDGA 1WXZA 5FA5A 3NR0A 4WDXA 2I7GA 4B5UA 4XAFA 1KD0A 3FFSA 4AWTA 4NZ4A 4NJJA 3MUCA 2G96A 4CD8A 1WE5A 5KZ6A 1B5TA 5H6HA 1VS1A 1UD4A 4MMWA 3FJ6A 2DVTA 3LMZA 3SURA 3W25A 1X1OA 1I1WA 2C1GA 1MQQA 1LORA 2X41A 1V8EA 4W7WA 4N9EA 1X6UA 2O4QA 3EDJA 4XSLA 4RLIA 1XLCA 3ARQA 3N1AA 4MZ8A 4HU0A 1XBZA 2B7OA 4L6DA 2ZX6A 2CZEA 4F0LA 3QOKA 1VQTA 3KTCA 4JIEA 3TDFA 4HPJA 1ZFJA 2FTPA 3SCVA 1XW8A 2OMAA 2FGBA 3VD3A 2WJDA 3WUBA 3ECQA 4GQ0A 2WKJA 3VO0A 1F3EA 1IZCA 4A3YA 3MUZ1 3DFSA 4IM4A 4IIFA 2E09A 1FWDC 5DFAA 2RGMA 2YBVA 1TV2A 3HG5A 4O17A 2R8WA 4ZO8A 1OT1A 1YPFA 2VCAA 2F6XA 5EL1A 3M0ZA 1HN1A 2NQJA 1T5AA 1VPYA 5E0KA 5A8NA 1V3KA 1TJ1A 1ISZA 4XD5A 4QQUA 5HANA 5BU6A 3GH7A 4B3ZA 2JEPA 5C8BB 1PX3A 2UY5A 4JYEA 1V08A 5HQMA 2WB5A 1MMFA 4C5YA 1TYGA 2EAWA 2OR2A 2ZE3A 3BAIA 1K9DA 3RG6A 4C6PA 1ZENA 3LU2A 3Q4DA 4F0HA 1Y5WA 1XFBA 1F7BA 4DM1A 1LRNA 2ZADA 3BW4A 3V0SA 4DWSC 3NZ1A 4I6VA 3UZXA 3G0SA 3M0IA 1IGSA 1RZMA 2CWNA 4ZOCA 1Q13A 4PA8A 1UUMA 4J3UA 4RE4A 4D1IA 5A6MA 2PP0A 4RNIA 3WH7A 1O1HA 4XD4A 3W1QA 1XLMA 4BQ4A 1RUSA 5U7SA 3UXKA 2FMOA 3WUGA 2D24A 2YL9A 1QPNA 2D0FA 4E3TA 2CLOA 1TMHA 2E5BA 3WF2A 3MCOA 1OABA 4DUWA 4IJCA 3HB9A 3IUIA 1W1YA 4IIBA 1AJ0A 1BFNA 4R34A 2PDYA 3SCOA 3FJNA 4XZLX 4V33A 3I7QA 3VABA 1KXTA 3FX4A 2QJNA 3VPLA 4NRSA 2Q8ZA 3PC0A 1QPQA 4P8UA 1JUEA 4S3FA 1E56A 3QV7A 4WVXA 4RE3A 3VNJA 4EXQA 4GZ7A 3MDWA 4H9TA 1LBFA 3E2SA 5LIWX 3N2OA 3AFBA 3VUPA 1JJKA 4XUGA 3WN6A 4BJHA 2OWCA 3ARSA 3RR1A 1RVGA 3OYZA 2KX9A 3PTDA 4IGNA 5HJYA 4HU4A 4DBUA 2IUZA 2G50A 2PF8A 3ZJ6A 3B9OA 1HO4A 1EFZA 1BHGA 2VZOA 3O6CA 2DJLA 5H8UA 2DSUA 2ZDRA 1Q6LA 3WLHA 4DBEA 3MBDA 5LXXA 1M5WA 1H09A 3DERA 4K2SA 4UCFA 2DW7A 3VIPA 1M7XA 2EPHA 1AUSL 2J9XA 3WSUA 1RCQA 4B5VA 2Q09A 2VX5A 3KBWA 3FVDA 1EBGA 3KVMA 3RPDA 3CAVA 4UFKA 1DYSA 2ATSA 1CGWA 1QWKA 2OZ8A 1LL6A 4HSOA 4RE0A 5A8MA 2Y7EA 1MDLA 2I16A 4EP8C 5M3WA 4DY1A 2XH2A 4IPIA 1KM6A 1QU4A 3FAXA 3IIPA 4I7UA 1RY0A 1SZRA 4JIRA 5LNVA 3ABRA 3T2PA 1XCFA 4JTLA 5I3GA 1R30A 4F2BA 1EA0A 3EWYA 4R88A 1OFOA 1T41A 1TVPA 5G1MA 1NH6A 1POKA 2Q01A 3GC5A 4JS3A 5DF0A 4WGXA 3UCQA 2VD9A 1EJXC 1IR1A 3M0JA 4Z0JA 3QHNA 4EXAA 1P0DA 1FTXA 4N0RA 2Z24A 1FDZA 2GYIA 3QSTA 4U3CA 2XGBA 4J40A 2PRHA 1HG3A 1F4HA 1JEZA 5FKYA 4N42A 3SFKA 1BTMA 3FA3A 4MNKA 9XIMA 1SSDA 4AY8A 1WZKA 2PDPA 4IIGA 2P1FA 3EOLA 1VR6A 1RD6A 3K4AA 1W5OA 4J3TA 2I1OA 3A3WA 2OT0A 3UXAA 5DBUA 4U10A 2DVUA 4UUIA 1G9HA 4BZYA 3C0SA 3W7OA 3II1A 1KQZA 4MUPA 2WV8A 1V5XA 1UMLA 2WMIB 4KIRA 4PL2A 3PZOA 1PDYA 2FZMA 1GUVA 1ISWA 1T96A 3KVJA 4NHVA 5HJLA 3EX6A 3N04A 1MUMA 4L4OA 4YVVA 5FJPA 3W70A 1J6OA 3QR3A 2CBJA 4GO8A 4MAZA 1XC4A 1W8GA 4R9XA 4PFHA 5DRCA 6ALDA 1G4TA 1U5HA 1J6PA 3ZYZA 1TTJA 2JGYA 3AS0A 3CZEA 3M5XA 1XFCA 3DFPA 1BVZA 5G1YA 4E8CA 4ONVA 4C6LA 4K1GA 3H4WA 3PBYA 1EZ2A 3TYAA 1OFAA 3DDMA 4CNOA 2Y0FA 1H11A 1QW7A 3UR8A 2POZA 4MM1A 1NY1A 2ZWZA 1CZ1A 4FEZA 4K38A 2O9PA 2Z2BA 2CLFA 3R0UA 2YFNA 5ECVA 4HD5A 4L6HA 3AWOA 4H4IA 3S6TA 3ARRA 1DTNA 3C6CA 3GXPA 3RGTA 3AIBA 2ZRXA 8CGTA 3U2EA 4DUVA 2GGGA 4PN2A 3CV6A 2PCQA 1Q6RA 4MB1A 3L12A 2DDXA 1IEVA 1CTNA 3SY8A 3TCEA 5D8ZA 2OOGA 3P5ZA 4YLWA 2FPYA 4BS0A 3JUGA 5HXMA 1KLZA 2P10A 3H23A 3C2FA 4H01A 1XG4A 1R3RA 4BWLC 1TZZA 4LB3A 2VZSA 2JKEA 1WOAA 3GSMA 5F2GA 4EAYA 3ENLA 3QC0A 1GYLA 3EX2A 4ZXLA 2VFHA 4L64A 4GVGA 2GWGA 1RA0A 2NT1A 2Z25A 5A3HA 1JYVA 3J7HA 3VKAA 1JIBA 4R3UA 2ZQ0A 4AC1X 3QMRA 2EPOA 4O1FA 3SGZA 3AMLA 2FPVA 2W92A 3FYPA 2NQLA 4DIAA 4BF7A 4FNTA 3CB3A 1EP3A 2AGTA 1Q7MA 2E6AA 1X38A 4H19A 3K2GA 1UR2A 1PZ3A 4P8VA 3BSGA 3VKCA 3LN3A 5CSUA 4DX3A 1V4YA 3OLDA 3LI0A 4QDWA 3GIYA 4MNLA 4MNJA 2HCVA 3EA3A 2Q6ZA 1EGMA 2BHYA 5EMJA 2KZHA 3S3GA 4HVXA 3THCA 4MHBA 3T6CA 3OZYA 4RL3A 3SSZA 3TYZA 2GOKA 3H70A 2NV9A 3OBEA 3BC9A 5HQEA 1QPOA 4KFPA 4JFTA 4DLFA 3W7HA 2WVTA 4GI4A 3EMQA 1T99A 3G3DA 3O8AA 1SJCA 3NQBA 1KKRA 4PRRA 2VEGA 3NJ3A 4RCXA 5LNWA 1EXPA 4DPQA 4MKVA 3AHVA 1VF8A 1YIXA 1KXHA 1XQKA 3TA6A 4XZWA 3OBAA 3PZQA 3VGDA 4RXGA 3OW1A 3GW3A 4QX4A 1DQXA 1SPQA 4GQGA 3H7RA 3GTNA 5CBJA 2WWDA 1BYDA 5CC5A 1ICSA 3VUSA 4YL2A 1XLIA 5HULA 2WMFA 3OQEA 1PX4A 3KRZA 5C5YA 4AIUA 2ZX9A 3CZ8A 2DT2A 3SCPA 2VGGA 1OF6A 1XG3A 1DWGM 4GFIA 2R82A 3VXGA 3NGJA 3KTXA 4U28A 1DHPA 3F2CA 1V6WA 1I1XA 4I5XA 2XJ7A 4WXYA 1AQHA 1E1CA 4OV9A 4E3VA 3WMLA 1V51A 2PGRA 3KHDA 2CZ5A 4X0VA 2BY3A 1H0IA 1HKVA 2C71A 1CDGA 2FDSA 4M82A 1K6AA 4HTBA 3PUDA 2GVLA 4HHLA 4HJWA 1LTDA 1W1TA 3EOUA 4JQAA 2IQ0A 3W07A 3CIXA 4TTUA 1PSCA 1QUMA 4JFVA 3WLIA 1ZBWA 1NDWA 2C18A 2HBVA 4JQ1A 3TYCA 5G2WA 5I03A 3WF0A 4KIEA 4BF9A 4ZO7A 2XIQA 4YU1A 1IT0A 4O50A 4Z2GA 3LCHA 1DORA 4RXFA 4AISA 3B8TA 5HNTA 3CQ0A 2E9BA 4EKJA 1M01A 3M44A 1V6TA 4C1KA 2J66A 2C6QA 2C8NA 3FVMA 4D6JA 3W7KA 1EP1A 4MB5A 4DJFA 1ZSXA 5TD4A 1MEWA 4NAEA 1X6NA 4IMGA 1JUBA 2R1LA 5FCZA 1JNEA 2C13A 3B8WA 3SN1A 2R1PA 4US5D 5CC7A 1LROA 1H1YA 5CSSA 4GINA 1XINA 4PSRA 2BHUA 1LWIA 2QDDA 3M0YA 2W3ZA 2G4FA 4CUCA 2C15A 1FWHC 3VNIA 4GI8A 2UZ9A 2OLHA 4WY0F 1J2WA 5HR7A 1EPXA 3GXTA 1RVKA 1NQKA 3CUGA 2PI6A 3WDJA 3GTXA 5DY3A 1GG0A 2ZTJA 2OFJA 3E2RA 5E70A 1WO2A 4WSJA 3SUSA 2ZA3A 4HZ7A 2O56A 2X7WA 4NUWA 1M03A 3LBMA 2NXIA 5CJ5A 4HN4A 5LNUA 3CASA 5HAOA 3E38A 2NW0A 1AG1O 4Y7EA 2Q3RA 3SCSA 4BF5A 3L0GA 5CSYA 3KZPA 2BX7A 4AYSA 3SQLA 3W1RA 1EJVC 3W2JA 1IGWA 4UWMA 3U3HA 1KBIA 2PC8A 3P82A 1F8IA 4J5NA 1ZAJA 3SGGA 1OX5A 3I3DA 4B2DD 4E5TA 2Z0IA 5D32A 3BV4A 1FCVA 3L4WA 3OYXA 1E40A 4F8XA 3V1HA 5BOFA 3VIFA 4GNKB 3PBUA 1KXQA 1JNDA 3N2BA 4S3BA 4H3DA 3B8IA 4ADTA 3IJ6A 4B5TA 1XP3A 4K68A 4BHYA 3M0VA 2PF0A 4PMXA 5CZSA 1WKEA 3OODA 2E1WA 3W81A 1QHZA 1WYIA 4W84A 2VOTA 4DQWA 4QLLA 3GX9A 2C19A 1OYCA 1XIMA 3EWDA 3KDNA 2YW4A 3NUKA 4W8AA 3E0IA 3S9IA 3W01A 2FJKA 1VBJA 4QE1A 1LBLA 3AIWA 4EACA 3G1RA 3KP1A 1TA3A 4N6FA 2VRJA 5KEZA 2OLSA 3HPAA 4FXFA 5CG7A 4WY0A 4AG0A 2GDVA 1HP4A 2HBXA 2ALRA 1OCNA 3IK4A 2VC9A 3BDKA 3HO8A 5E0FA 2VM8A 2W27A 2MUCA 3LGGA 2HVNA 3GAKA 3WKZA 4OKDA 4LX4A 4CKQA 3MSRA 1KM2A 4DJDD 4EXBA 2QMJA 3DAQA 2V9DA 3V75A 1X1ZA 1QOPA 2VR4A 3PWAA 2XZ7A 3MMDA 3RRXA 1JGMA 3SR7A 3TFXA 3KDOA 4PTMA 2ISDA 1DWJM 4UFIA 2WZTA 2WKLA 2V6AA 2ZYFA 3HQNA 1X7FA 4EPKA 2IMRA 2P76A 4UTTA 3BANA 1YXDA 4JDYA 3BJTA 5FJIA 4LC8A 5CG0A 1TZ7A 4NAFB 1R2TA 4QQ3A 3B06A 2D23A 3W6LA 1SZEA 4HHMA 1YNQA 3RM8A 4M19A 1YDNA 5GJMA 2HVMA 4C6BA 3PZNA 3LMYA 4BK9A 3QPZA 3LPFA 5LA2A 4ZSTA 1NP2A 2ZUVA 1C90A 5AN7A 2IPFA 1LYXA 1GVIA 5DN1A 4YIWA 2VZTA 4WKHA 3ZSTA 4O18A 4UFMA 4C6MA 1SUXA 4NL1A 4RDZA 3AS1A 1CWYA 2Y4SA 3TYDA 2IPJA 1XCWA 2VEIA 2DT1A 1A53A 1PO9A 3BURA 5C70A 4CCEA 2GGJA 4QS6A 1PUDA 3FY1A 4RV3A 3UR7A 2CESA 5U4NA 1TPWA 3CM4A 1DXFA 2CNCA 1ZBVA 1MNSA 4KEMA 3VOHA 2CBVA 4ZZ9A 3KZSA 1TJPA 1SFSA 3WD2A 3KS6A 2TYSA 4FMVA 4HA1A 1R3SA 5DO8A 5TIMA 2ZIDA 1FH7A 5JBDA 2AQOA 3QHOA 2DZPA 1G69A 1KQYA 4CNSA 4IHCA 1IT7A 1VHNA 3MZ2A 2EQDA 1XYZA 5EGRA 4IPNB 3RR4A 1B57A 2ATMA 4KCUA 1JPDX 2FB2A 5HPCA 2QPXA 1JULA 3ERPA 1LG1A 3PB2A 3VNYA 4TVUA 4NX5A 1T0OA 1REQB 2OYKA 4HBKA 3FJLA 3N4EA 1VJIA 4LCSA 4Z1DA 5CAHA 3QY8A 2JK2A 4Y9NA 3LBCA 3AYRA 1UG6A 4IMFA 4GLEA 2WBGA 3NZPA 2WSKA 2NSOA 1EO5A 5D04C 3WG6A 1RP9A 1EF3A 2WLZA 4Q4KA 4FX7A 4DXVA 5MHBA 3LSBA 1R3QA 4ROPA 5DXXA 3FXYA 4O28A 1UBPC 3VX1A 1F61A 1YYAA 3AWNA 3MVTA 3AXKA 3WD0A 4ATDA 2J7GA 2YW3A 1BRLA 1O5QA 4FNUA 1GQKA 3L5LA 5C2CA 4JN6A 4PFMA 3GXIA 2GVEA 4J35A 4ECLA 3M0MA 5BRPA 3H2NA 3W7IA 2F8QA 2PWDA 4YTRA 4XB3A 2C91A 3V16A 2BGSA 4M6VA 3CO4A 1AVAA 3UZ5A 3MW7A 1Q8JA 2GJPA 3W2UA 5D9NA 2YA2A 1I2PA 3OTRA 4GZJA 4E4PA 2F2HA 5C9RA 4C91A 5XIMA 3WNKA 4O1EA 3VTRA 3F4NA 1W2PA 1E9LA 3DYPA 1PIIA 5K4XA 1UHVA 3JU2A 2QV4A 3W7EA 3VE9A 1JPHA 3EPNA 4DJFC 4RNFA 2W91A 3PBGA 2A3LA 4EOUA 5LIYX 3MVIA 1R86A 2VVNA 2Z7KA 4XZHA 5H8PA 2OWWA 3KCLA 3VVGA 3RRAA 3MHFA 2OZ0A 5CZKA 2X42A 3GG8A 3GVRA 3T55A 1OFDA 4DYKA 1E9ZB 2QJGA 4H6RA 3AALA 4GZEA 3F4WA 4AYGA 3CHVA 3KBMA 4OT7A 4HHHA 1Y7VA 4Q4OA 2FYMA 3P93A 3T7VA 1GVYA 3LI1A 3DHFA 1EX1A 5BZAA 4V27A 5TF0A 1QW9A 4IISA 3GG0A 3GYEA 3L4UA 3C4UA 4LUIA 2ACQA 2Y62A 1VENA 4GUHA 2J7EA 1XLJA 3ANVA 3K4DA 4TU1A 3O63A 1M6JA 3IRDA 1BTCA 2P8CA 4D6GA 1K6WA 2E9LA 2V0TA 1J5TA 1C8XA 3T44A 4ZB5A 3CMFA 1UWAA 1E3ZA 1WOBA 1JPMA 1K8ZA 1AH3A 1B9BA 4LBUA 4BY3A 2QIIA 1E4NA 4ZB2A 3CQHA 4PH6A 3T0TA 1P0NA 2PLMA 2R14A 1UA3A 3A5FA 4Z2LA 1WDDA 1FOBA 4Y9MA 3DYOA 3ITVA 1JYNA 3B0YA 2Z6JA 4MF4A 3OIXA 3R8RA 3MUY1 2DZTA 3H21A 1TWSA 3VIGA 4PUKA 2WM0A 4X9SA 1DJQA 1KKOA 4NRRA 3SW6A 1OCQA 4HP5A 2J8GA 3T0DA 4UTLA 4PTDA 2WHLA 2FKPA 2OB3A 4Z08A 1EL3A 3DBPA 2WZEA 1FVPA 3NZRA 4MWAC 1DIOA 2WBKA 3F5JA 1EHAA 3ID7A 3BQ6A 3SN4A 3NQ7A 3S6OA 3GHUA 3XINA 2WHMA 3OG3A 2QJIA 3WDQA 1FHDA 1AQMA 2QIWA 3BZGA 4TX6A 1BKHA 5G4WA 4FNQA 3G1FA 4GIYA 5XIAA 1C93A 4XKYA 3VM5A 4Y8FA 5E5CA 3WEMA 1AFSA 1I2OA 5KTLA 3V5OA 3STPA 3QVQA 3R4IA 4PMZA 1OD8A 1WPCA 4DBSA 5SWUA 3FEMA 1W31A 3S5ZA 1XRFA 3OLGA 1A5CA 3F5KA 3TW6A 5CCZA 1FCQA 3KRSA 3WJWA 2E8ZA 3ZOAA 5HWNA 4ACZA 1OC5A 2CBUA 3BWWA 5D9MA 4Y9PA 3G77A 3EA2A 4D6IA 2NT0A 3W26A 5I0DA 2FH8A 1U83A 4M8UA 3SGUA 1H51A 5MKGB 1QT1A 1WDPA 1VEMA 3F2BA 3Q45A 4JCLA 3ZLHA 5CGMA 4PEKA 1UWIA 3FSUA 2VQUA 1AH0A 1S46A 4O8AA 4N6EA 2V3DA 4AUBA 3APTA 3H7VA 1WNOA 2PWHA 2TRSA 4AWUA 3CO8A 1JQXA 3TC7A 1Q3NA 4YWSA 1LP6A 1UD6A 1K9TA 3KAOA 1XDJA 3NZQA 3PBMA 1BYCA 2V68A 4ZSUA 5C9XA 3LPOA 3MJMA 3AHYA 4S2BA 1HIZA 1G0CA 2E0PA 2Y8KA 3AJXA 4KMQA 1S39A 2B7NA 4GUIA 3N2TA 5G2HA 4DI8A 2DIJA 2OGYA 3LD5A 5J8LA 1HJUA 4PB5A 3Q58A 4JTRA 2W5FA 3H54A 2WXDM 1DEDA 1QJWA 3A4WA 1G4SA 7REQB 2Y5JA 2QCMA 4IICA 5J5RA 2YOCA 3U2CA 5F4WA 3S8HA 4Q4SA 2NWRA 3TLQA 3TQPA 2JFEX 2J8FA 4MSSA 2NWSA 4LC6A 3GUGA 2YSWA 3FA4A 3N4AA 1VJSA 4KBXA 3TLLA 4R85A 3M0KA 3WNPA 1I4NA 1UP3A 4S38A 2OU4A 4QE5A 3PN8A 2GVJA 3TV8A 3O6YX 1DE5A 1VZWA 3UNDA 4HB7A 2X16A 1GG1A 2ZWYA 2CHRA 1KCZA 1ZBCA 4B5NA 4EPBC 3FYYA 3GKFA 4J27A 1KC7A 2YB4A 4DJED 3QZ6A 4PMNA 3E6EA 3N9RA 3W0KA 3NDZA 1FWCC 4K1WA 5BU9A 3W38A 4MTVA 3F2DA 3DHPA 3SCQA 2OELA 3HA1A 1HW6A 3CUIA 2QKFA 2D0GA 3NM1A 1FWWA 1MVYA 4LAMA 1VCVA 4DO4A 3GD6A 1DVJA 3UA3A 4P8XA 1S5TA 1VHCA 3PTQA 3W88A 3LLFA 5AC7A 1YXCA 3URQA 3WQGA 1EJRC 1S1PA 3W7MA 3KL5A 2WPBA 5IHSA 1FHLA 1RK6A 2V5LA 4LYKA 3QBUA 4L1WA 3NPXA 4JD4A 1E43A 5HOSA 4FK9A 4LRSA 3FGCB 3LRMA 5AHEA 5LKYA 2OGJA 2HE8A 3SM0A 3IGHX 4RNHA 4KQNA 3PG9A 3NQDA 3CWHA 3KWSA 4W5ZA 3UJEA 1EGVA 3WMSA 1IXOA 1NDZA 1KM4A 5FOOA 3A3HA 2XUCA 4R27A 3RPMA 4KF1A 2PRMA 4MJ2A 4UTWA 3HG4A 5I6SA 4D6CA 3TXZA 4HPXA 4Q8UA 1G01A 3UG5A 2ZTKA 1R47A 4JN8A 4UTUA 2PZNA 2CW6A 4GY0A 5CPMA 3VZYA 4AZCA 2QT3A 2QR6A 1JZ8A 3BVJA 3L2IA 4XG1A 1EP2A 3W1NA 2A1YA 3ZR6A 1ZPTA 2JBMA 4US5A 2GWNA 4H04A 1B3ZA 4IMEA 2CC0A 4FA3A 4PUJA 1ME7A 4Q7NA 3O0KA 3WF1A 1LF1A 3Q2DA 3LLDA 2YLAA 3GBEA 2A7PA 4UFJA 4NG3A 3E0FA 3ONBA 2VZVA 2QXWA 2QDGA 1GOXA 2R1MA 1SMDA 1OCJA 3VIKA 1C9DA 3BMWA 4HSHA 4JTUA 3BICA 1H7XA 3GVVA 1AJ2A 3S5OA 1KGWA 3CV2A 2WJEA 1IIGA 5KSWA 2HK1A 4Q6JA 4A6GA 1L2UA 2VCCA 2E3ZA 1XR2A 3WLPA 4UQDA 4ZEPA 1HVXA 3UWWA 5FESA 1ISVA 3U5UA 2Y89A 5JBFA 3APYA 3C86A 4HU3A 1GHRA 2E25A 1OT2A 3LRLA 3AU2A 4GA8A 4B2DA 1RBAA 4QJ3B 1BF2A 4FR6A 4CGTA 4H2HA 2J13A 3BLLA 1R5YA 1HT6A 3DGRA 4QNEA 5DY2A 3A9BA 2CLHA 2FHCA 1QWGA 3VDGA 2Y1HA 5CPOA 3UESA 1GPFA 3B3DA 3DC0A 1UYQA 3DFNA 4KWSA 5T26A 4Q8VA 5B7YA 3ARZA 3N9SA 1KFLA 5FJRA 1ZZMA 1YW1A 4ATWA 3WQWA 1A5NC 2XSXA 3MB9A 1XUZA 1TCDA 4B92A 4H00A 1GZJA 1TELA 2GJNA 4XZIA 4AX6A 1M68A 3RJYA 3D6NA 3R58A 1MZRA 3WD3A 3UWEA 4GH1A 1EO7A 3W2KA 1A3HA 1JDFA 3N2MA 5D2VA 4Q8MA 1E9YB 4YHGA 1DJGA 3S42A 1OEPA 1G5AA 5CZTA 3ZT7A 4ZB0A 1XKYA 4AVOA 2VR5A 5FL1A 1KM5A 2J79A 3H2OA 4EF8A 3N6HA 1CPUA 3W7PA 1O7AA 5D37A 2ZDSA 3WMCA 4A35A 3NQ2A 1GVQA 1QNVA 2PLJA 3ATZA 1XLGA 3GH5A 1OYAA 1HL9A 4AF0A 1ML1A 2BOFX 2Z29A 3BW3A 5DCBA 4MFEA 4K7YA 4GX9A 4HTYA 2RH9A 1C29A 2V3FA 1MDRA 2VRKA 5T9BG 3WLSA 4DJDA 3AHZA 3UWVA 1X8FA 5LIXX 3QRHA 3K8KA 2JE8A 5JQ9A 2ZUUA 2ZRYA 1X7IA 4YHEA 1GWJA 3RHGA 2VFEA 2V2DA 4JTJA 3LA4A 3SFWA 3TX9A 3UGVA 6REQB 3FDKA 3R8HA 1V0LA 4J7RA 1AJZA 4UCGA 1PZ1A 1TVLA 3WDIA 4QISA 2A6LA 3OLIA 1C91A 3AMKA 1JXJA 2JKPA 3E0LA 4DZHA 1EEPA 3ZSSA 3VD7A 1R7OA 4JNZA 4CVWA 1A5KC 1JI1A 4FS9A 1OG0A 1Y65A 1KA9F 1O5XA 2ZKMX 2D22A 5KZEA 1QI3A 3SB0A 1GVSA 2CBIA 1FP9A 1VRDA 3VYLA 4D6FA 3KFTA 2HZGA 2XHYA 3WZ0E 1QK2A 4M1RA 5AVNA 4LVFA 2QJHA 2E8YA 1H7OA 1OB0A 1ZP4A 3CU2A 3QZAA 3WLRA 1J96A 4GVFA 4YN5A 3VZXA 5CKSA 1XBYA 2J47A 3VDAA 2I5QA 2D2JA 5AYBA 1U2YA 2OYLA 1E6QM 1B54A 4NZJA 2Y8UA 1FWGC 5M1TA 3MHGA 3T07A 3VI2A 4L9ZA 1T40A 4JHMA 2EXOA 2PTWA 1NFGA 3C56A 4LTSA 3VINA 4IMDA 3DGBA 3KXQA 4QLJA 2DH2A 2W67A 3CT2A 1R3WA 1HGYA 4LUSB 3GDLA 4LALA 4GQRA 2PFHA 3W6YA 2VL4A 5A94A 3LTYA 4A8LA 7ENLA 3SDOA 2BVWA 1EF2A 2XZ9A 4ZOBA 1L9WA 4RDYA 2O9OA 3EOOA 4TO8A 3GW0A 4KRTA 2Y7GA 1FA2A 3HU7A 3MY9A 2H9AB 1CNVA 5DMYA 3SAZA 1H63A 1HZYA 3GU1A 3SRDA 5BOOA 4I9TA 1YPIA 3QV8A 1E0WA 3R25A 3RJXA 2CERA 2AL2B 1BWKA 1TPUA 1TE1A 4FOJA 2D20A 2EF9A 1C8YA 1K1DA 3PZTA 4FNPA 4G9PA 1Q6GA 3TU9A 2VEMA 3IJ9A 3EKZA 3BARA 1FH8A 5E1QA 2OWXA 1WDQA 4GY1A 5HNNA 5F2MA 5FSEC 4LUYA 1DWAM 1P0BA 3T4CA 4JTFA 3LQLA 1WXYA 4E38A 1V93A 4IGMA 3T2OA 2VFIA 1CXKA 3BW2A 3CL7A 1V02A 4JNMA 2B7PA 3PAJA 1Q6EA 1S2UA 1PZ2A 1Q6CA 4NVTA 3H55A 4S3AA 3W73A 2X30A 4IMAA 4HNTA 2GSEA 4DPPA 3CZJA 1AQFA 3PZIA 2D1ZA 3BGJA 1ZHAA 1E55A 1E6NA 4MJ4A 1W5QA 3HTWA 4A8IA 3TZNA 2OZ3A 4ZVJA 3UR5A 3ZVHA 5BXPA 1VC4A 3C2OA 4S23A 4XWUA 3GH4A 1GEHA 4G1NA 5ABEA 4C6QA 1J0KA 4HN8A 3B0UX 3SRHA 3DG3A 1VKFA 2YDAA 4ZCWA 1XKJA 4HIBA 5HR6A 1SFTA 3RMEA 4POCA 4JYDA 3MANA 3CHFA 3TQVA 4HHPA 3LZ3A 4YYCA 5TBOA 1DXIA 2P0OA 3D46A 4D6DA 1UZ4A 1SZFA 2DH3A 2W66A 1YQ2A 2OO6A 2PTXA 2ISWA 3JR2A 3BH4A 5A8PA 2VX4A 1BWVA 3CH9A 4IG2A 1F5ZA 2TSYA 4OWGA 4AZ6A 4XAZA 4LVAA 4AMCA 4YTTA 5EBUA 4JXCA 1IT8A 4Y8EA 1FWBC 2BY0A 5I79A 3H2AA 4YVPA 1BQCA 2VURA 1KW1A 4E2OA 3CUZA 1EIXA 3DBNA 3NQEA 2BZNA 3RIKA 4A2SA 1FKWA 3NXFA 4JDBA 4NZ3A 1OGGA 3OGVA 4ZMGA 3R13A 1K7FA 4MWAE 1XBVA 1YLVA 2GFTA 2Z2AA 3OHMB 4MLRA 2VQTA 2IQDA 2VC6A 4ZENA 4DWDA 4HK5A 3MYOA 5EYWA 1PKLA 4BI6A 3ATYA 2QLYA 3EX4A 3LNPA 3IAQA 3CIVA 1XH2A 2OCZA 2ASHA 1ZJIA 1R3VA 4LYPA 1JZ4A 3HZ3A 4TV6A 4XISA 1JD7A 1K77A 1OK4A 1D7KA 1M1BA 5C2GA 1F6PA 4Q8OA 1ITUA 1PPIA 2QQ6A 4P7NA 1SR0A 4J3SA 1OK6A 3LZ5A 4ZQOA 4Z2IA 2CHNA 2Q71A 1FY6A 2ZRUA 5FF4A 4LVGA 5ENLA 1YBQA 4XO6A 3USZA 2VX6A 1AW2A 1LUCB 4OTKA 2V38A 3HPXA 3I6RA 3TZFA 5K3VA 2D3NA 2QDHA 4L4PA 4HCHA 2IPGA 1PJ9A 4OQVA 1EH9A 2CIPA 3EB3A 2XIJA 1W9UA 3E5BA 4JR5A 3WBAA 4TIMA 1EDTA 3P0WA 4AF0B 4HOZA 3N73A 1S5NA 5C0QA 1LOLA 3EBVA 3QQWA 5F2IA 1C8QA 3D5HA 3W75A 1X97A 1ZB5A 1EYWA 2J6XA 3MYPA 5AZ0A 3TN3A 1QFEA 1W5PA 3ZLFA 3F4CA 4AAJA 4KWOA 2VGBA 2VEPA 1CB7B 3UQNA 4IWWA 3LTPA 3EGJA 2WMGA 2WANA 2ZUSA 4PMJA 2QUMA 1F6YA 2P53A 1QPRA 4IX2A 5I07A 2REQA 1JYWA 4UTIA 2CLKA 5BWAA 3H2MA 4IF2A 3PF3A 4H1ZA 4K8GA 2ZBTA 2A7RA 4V28A 3W1PA 4XX6A 3O7UA 1J4EA 3W86A 1VBRA 2J9ZA 2OYMA 2A2IA 3CLMA 3RDKA 1Z69A 4LH8A 1XI3A 4IQLA 1HKIA 4WDTA 3THUA 2NUWA 1BXNA 2X2YA 2EO7A 1KXVA 1HX0A 4GY7A 2QCDA 2VCBA 4C7DA 7PTDA 3STFA 8A3HA 1ZY9A 2JF7A 3HJZA 1NARA 1R3TA 4DBWA 4HK7A 1FWJC 5AHNA 2HWGA 1MW1A 1V0NA 1FWFC 1TR9A 3TJLA 1OCBA 1UD5A 4OE7A 1TCMA 3W7LA 1L8NA 5JU6A 5A8GA 3N18A 2RFGA 3VKBA 2FQIA 3UPBA 3I7SA 1P1XA 4D9PA 3PP7A 1V3LA 4MOZA 4REQB 3RLUA 2QMKA 4MKNA 1MYRA 4RR4A 4XKMA 3SI9A 4TMCA 4A2RA 3MO7A 2DQWA 3B05A 4MWAB 1XLHA 4WOQA 1HJSA 1W9VA 2CYGA 1N8WA 1HJVA 1NSJA 4LU0A 5D38A 2Z7GA 1XLDA 2J4GA 2QF8A 5DMLA 3NA8A 3CQIA 4LAOA 3DFHA 5F1UA 2YA1A 3OHIA 3WUFA 2FZBA 2WK2A 1EJTC 1IWAA 4UOZA 1XICA 4JICA 4LVDA 2RKXA 1V6UA 3VIHA 3VCRA 3DHUA 3UWQA 3WNMA 3ABSA 4UR9A 5EMUA 7ODCA 1CLKA 3ARXA 5FAGA 1S5VA 4E8GA 3NEVA 4AIOA 1BD0A 4JPGA 2VO5A 3ITYA 3S2JA 4PL1A 1OQFA 1V3JA 4HPHA 2GGEA 3PUGA 4UOQA 4CD5A 4S3CA 3UZZA 3TJIA 3CEUA 2EEXA 1UD2A 3ITLA 4X2RA 3QLDA 4INFA 3W22A 3DI0A 1JCLA 4DJEA 5I78A 3IWPA 4JFSA 4IXXA 4JTAA 5AZ1A 1VPQA 4AD1A 2RDWA 3VDCA 3GXNA 4HQVA 1TPH1 2Z1SA 1R9ZA 1WQ5A 1CXEA 3DG6A 1FCUA 5BROA 3LCIA 3NGFA 2V2CA 4K39A 4HSNA 2BLEA 3IVSA 2ZXBA 5HMEA 2WJZA 1N8IA 1SW0A 3TC3A 1YDYA 3AS2A 4D2JA 3NQ6A 4PC8A 3W87A 1JDDA 1Y5VA 2POTA 3NQ8A 3FN9A 4C6DA 1QDSA 2G0WA 2PBOA 2J7BA 2VYOA 2HVOA 2A3BA 4YYFA 1AMKA 3AU6A 3TP4A 2OSXA 4AY7A 1PHWA 1WDRA 1EUNA 1V3HA 2EHHA 2ACRA 4AXKA 3VK5A 3BO9A 3E3HA 3EXTA 4OV4A 1KLYA 5C9UA 1EJUC 4MNMA 4MFDA 3W82A 1FRBA 1Q66A 1RCXB 2X05A 1GJPA 4IG2B 1E51A 1TFVA 1ZAIA 2XH0A 4OVXA 4RUBA 3TW9A 4H9VA 4XBSA 3DUGA 4GO9A 4TX8A 1RHCA 5L9FA 1OGSA 2BG5A 4CNTA 3WEZA 2XSAA 3HN3A 4EX4A 1S2WA 2XTKA 1SW7A 5TAOA 3UCDA 3IRSA 2Y5SA 3LERA 2OSYA 1SO5A 1UQZA 5RUBA 1ZJAA 1JPKA 3KM8A 3D3FA 4U5KA 3MP5A 4TV5A 3UYCA 2XSBA 3P6LA 3PSVA 1GOMA 3W1LA 5FAJA 3BUVA 2OKOA 5AHLA 1PX8A 1OIFA 3WQDA 3AZSA 3GNPA 4PMQA 3SY1A 1UR8A 4NQ1A 2ZRVA 4I9MA 3TROA 3WQEA 1MEIA 2PLKA 4HMEA 3R12A 1JCNA 3TK7A 3V3WA 1NFPA 2Y24A 3RM9A 5J04A 4L1XA 2FVKA 4MY1A 2PD5A 1J10A 2H8XA 4B9YA 1HJXA 5HATA 3KBNA 3GM8A 4PE8A 1DJYA 2DEPA 4M80A 3IIZA 4GI9A 2BHZA 3IAPA 3MU7A 1GONA 3TH6A 4UOJA 3FKRA 4IUOA 3NURA 3VOJA 1V3MA 4FAMA 4G8TA 2PODA 3P61A 2J88A 1XYMA 1GKPA 1FX6A 3CJPA 5FD0A 4N9BA 4HT3A 2QCCA 1JCXA 1MO0A 2ZE0A 1GQLA 4ZXOA 2XH4A 4MY9A 3R5EA 2C79A 1G94A 1S3TC 3OLEA 3PUOA 2YXXA 2GK1B 3DFQA 2QPSA 1OBAA 2OKTA 4E0CA 3ALGA 4IJRA 4GISA 4W8LA 2NQZA 4GC3A 2ON3A 3RF9A 1A5SA 3IGXA 3NCOA 1OX6A 1JAEA 1ECQA 4GOAA 3MKVA 4O14A 4Q7BA 5C6MA 1XF0A 2HSAA 4C6FA 5HQLA 1BEUA 4N7QA 1U30A 4LBSA 3CTLA 3W00A 5HMSA 3WYZA 3KHJA 5E9AA 1OFQA 2FGZA 1RAKA 1AW5A 3FHAA 3RFAA 4PUDA 4LT9A 1UWTA 4GYPA 3HPSA 1JCMP 1PHQA 1F3XA 1R0MA 2F2KA 1ZL1A 3T2QA 2GQ3A 1X96A 3ZR5A 4IXHA 4AD3A 3AISA 1IQ8A 2WZIA 3VNDA 1WA3A 4GPNA 2R91A 3A64A 2D2GA 4J28A 1LWHA 2XG9A 1Z44A 1A50A 2BFGA 3DEQA 2DORA 3EWBX 1UASA 1DJXA 4LS0A 3STCA 3CXOA 3KRBA 3WO8A 2OT1A 2PS2A 3SCUA 4Z17A 3JS3A 3KOXA 1UKTA 5AHIA 3VD9A 3UY7A 3WL0A 1P4CA 2PDLA 2WMIA 2Y88A 4Q8NA 1VYSX 4GGBA 3UNTA 2YXGA 3N3MA 3PJWA 4GGHA 1EWDA 2ZA2A 3PPHA 3NQAA 2OG9A 4WRHA 3EX3A 3O0FA 5CH9A 4F0SA 1C7SA 3B8SA 2A3AA 1VBHA 4IFKB 1KFKA 4FX6M 3PNUA 2E6YA 2D73A 4JYFA 3CL6A 1KM0A 1NOUA 4P61A 2PDIA 1X6LA 1XIDA 3WJZA 1TJRA 4ML9A 2NV2A 3AO0A 4UNKA 3GVWA 1FFRA 1KBLA 2V63A 4AD2A 3BAXA 1GZGA 5REQA 2QAFA 3NWRA 4TOQA 1FDJA 3L4YA 2D3LA 1LBMA 4XK2A 2F6KA 4KCWA 4D72A 5HINA 8XIAA 1HKJA 3T78A 3CK5A 4PCTA 4NX0A 4QP0A 3M16A 1RQEA 4C5ZA 5HWMA 3LEPA 4PMOA 1TQXA 3WLOA 4J3WA 3H8AA 5LHEA 3VDBA 3ZO9A 3LV5A 2PU0A 4OFCA 3M6YA 1QI4A 3BLKA 3NFUA 4H9UA 5FJOA 1HJWA 2Y6ZA 4ERIA 3HIJA 5EMMA 1E6PA 4AWEA 4DNMA 1LWJA 3SADA 4J9JA 4KPLA 2PTDA 2WC4A 2WSPA 2DUZA 1R6WA 3WK1A 1H7NA 3V0TA 3URAA 1PVNA 4ROQA 4WEVX 3TTQA 1RJQA 2PP1A 3AUOA 2OO0A 4L4MA 1J93A 2XFWA 4WJ8A 3QR0A 4H7CA 4Q33A 4OECA 1P6CA 3G18A 3VDHA 5G2IA 1S3HA 3WENA 4U2YA 4N2YA 3VD4A 4GQQA 1PV8A 2CKSA 3MUXA 5C7HA 4B5WA 3ES7A 1EQCA 2AKMA 4Z42C 1ZJHA 3C0LA 3IJDA 3PBVA 3A5VA 4OZOA 3DENA 2HISA 4DJEC 2DSKA 2AMXA 4P2VA 4G2DA 2NSXA 1VRXA 1LM1A 4M7SA 4GUFA 3WLTA 4XQ6A 2WMHA 1KRAC 1TKKA 3WF4A 4L61A 1H0GA 5AFDA 3A13A 5D33A 5A5WA 2DGAA 3GR7A 2QULA 2XM2A 1XV8A 3O15A 4CNPA 1QOQA 2O7QA 1O68A 5HJXA 2E5CA 2GVYA 2RGLA 5A8QA 4L9YA 4QXIA 3A22A 3VOGA 3STGA 3TN6A 1SJBA 1I2QA 3C52A 3OGSA 4HZ6A 5HNUA 3IV8A 3T09A 2YA0A 2DW6A 2J7DA 4ALDA 2J77A 4AEEA 1OFEA 2V5BA 1XUUA 2PLCA 1ZRQA 3NZGA 3QN3A 2Z28A 5I3HA 1KCKA 4HYWA 1V6VA 3H2CA 3NEHA 2UY4A 3M0XA 4Z2JA 4C6IA 3LHYA 3NQVA 1XIJA 3DU0A 4EF9A 2H8ZA 2J78A 3GNNA 3KRUA 3BLIA 4EPDC 4FF5A 4AU0A 1HKKA 4Q3MA 2VC7A 3RO8A 4UMCA 4DAIA 3GXDA 5K9DA 4JZ5A 4X0NA 4EIVA 5AC4A 4HNVA 3A4JA 5FEPA 5PTDA 3I10A 2YCIX 1KO0A 1DBTA 3LOTA 3UWUA 2RAGA 1YTDA 2FTYA 3MC5A 2Z26A 3TWAA 4L65A 4IPJA 3BAWA 1QOXA 3ALFA 3ARVA 4F0RA 3VGEA 3TR2A 2RDXA 2WLYA 1ONRA 4ZFCA 3NQFA 3M46A 2WWCA 3PZMA 1H61A 1VFFA 1OFRA 2UY2A 1MFUA 3NL2A 1KFWA 3URNA 2FTWA 4JFWA 4BQ5A 1DWIM 3ME3A 4L9XA 2PP3A 1F3TA 4WSHA 3A6OA 4PBGA 4IIHA 1Q6DA 4MY8A 3FEQA 3OGRA 3COTA 4XTDA 2EPNA 3LBOA 3KBSA 3E2QA 1EDGA 1XYLA 2I5IA 3PK7A 4J2MA 4YTSA 4UMBA 2ALDA 1F05A 1TPVA 3EDEA 3WQ8A 3L7RA 3URBA 3VCNA 4KRZA 1FHUA 3TKFA 3HMJG 3VCCA 4H6KA 3A24A 2ZXQA 1VH7A 3CUJA 1AQ0A 1XHGA 2X1TA 4AD4A 1UKPA 4FSAA 4O13A 4RX0A 4KW2A 2QEZA 3CAKA 2XWDA 3WNNA 4JQ4A 4I5RA 4QEHA 3PS7A 1K8CA 1CGVA 4NY2A 2J6VA 1GTHA 1EKOA 3AYVA 5AKQA 1ZAHA 2FMNA 3WLMA 4EWND 3N13A 3NSMA 4LSBA 3WD1A 2BY2A 1O6IA 3TTSA 2FFIA 1PTAA 4H7ZA 5L6UA 1B31A 1J5SA 4HU8A 1G6CA 4Y9AA 3N3TA 2QUVA 7A3HA 3OB8A 3PANA 1QR7A 3RCYA 1OM0A 4HKPA 3WBEA 3WFAA 2W62A 4PTWA 3F5LA 3VKJA 3H24A 2LLEA 1N55A 4J3ZA 2GDUA 1GCYA 2WMJA 4UMAA 3REQB 3TAOA 2NXHA 2EJAA 1O95A 2QCFA 3VU2A 2FGLA 1ZTVA 4GXWA 2QF7A 3PSWA 1QNQA 1D3GA 3AYSA 3BMXA 5K2ZA 3ZIZA 2ZFAA 4AD5A 2IKIA 2I5GA 2Y63A 2QCGA 1XBXA 5D9OA 1XLBA 4B16A 3LHUA 1EYEA 3CMJA 3HM7A 1Y8BA 4IQDA 4UQEA 3MQTA 2OEJA 1NOFA 2VEFA 1VB9A 1XISA 2WC7A 5C71A 3HQPA 1V6YA 1UWRA 1W5MA 1A47A 4A3QA 3MO4A 5BXTA 1NDVA 1S2CA 4H8HA 3H2EA 1B2YA 3P81A 2QHAA 5CJMA 1DIEA 2WAGA 4OUIA 1Z89A 3M7WA 3OA3A 1W3NA 5D2TA 2YCKX 5EB8A 1V77A 1BWLA 5REQB 1QTWA 2Z1XA 1XJBA 3ELFA 3B4YA 5H91A 4ASTA 4R5EA 5CPQA 3A23A 2YCEA 1EC9A 2SFPA 2QDEA 3ZVIA 2DQXA 4HCLA 3LGEA 1E0UA 3RX4A 3GDMA 1XLEA 3N4FA 1YMYA 4RZ4A 3CUXA 4F0MA 1XIHA 2BVTA 3G2GA 1VBUA 2NXGA 1QBBA 1EBHA 3KVKA 1D3CA 1W6TA 1FWIC 4GKTA 4LPCA 1TWDA 1HF6A 4UTMA