4JQAA

Akr1c2 complex with mefenamic acid
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C2
total genus 117
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jqaA00
5LIUX 2PZNA 1Z3NA 4XK2A 4ZFCA 2PDCA 3UG8A 3ONBA 1GVEA 1Z89A 4FALA 3FX4A 4WDUA 4WDWA 1ZSXA 5HNTA 5HA7A 2IPGA 4LBSA 3UZXA 3UZWA 1M9HA 3R7MA 2J8TA 3H7RA 3MC5A 3RX3A 2WZMA 4IJCA 2FZ9A 3LQGA 5AZ0A 2IPFA 3EAUA 3U2CA 3UP8A 3QKZA 2PDXA 3UZZA 1R38A 1ZUAX 1VBJA 4DZ5A 2IPWA 1JEZA 3UWEA 4GABA 3BCJA 1S1PA 1IEIA 4LAUA 4JTQA 3LZ5A 4YS1A 3V0UA 2VDGA 3CASA 3N2TA 3R43A 4MHBA 4YVPA 5JH1A 1T41A 3O3RA 1RY0A 1US0A 4HMNA 2IKHA 3LUTA 1MZRA 3CAQA 2P5NA 4JQ3A 4XAPA 2NVDA 1AH3A 3WCZA 5LIYX 5HNUA 1S1RA 2I16A 1UR3M 4I5XA 2ACUA 1PWMA 1XF0A 4H8NA 3LBOA 4GQGA 3P2VA 1PYFA 2NVCA 2PDLA 4H7CA 4AUBA 2FZDA 3GHSA 1HW6A 2PDKA 3B3DA 3MB9A 2WZTA 3RX4A 4DBUA 1ZQ5A 1T40A 1IHIA 4FZIA 3R6IA 3R8HA 3F7JA 4JTCA 1Q5MA 4PRTA 3LN3A 3LZ3A 4WDTA 2PDYA 3LQLA 3D3FA 2DUZA 2R9RA 4WEVX 2ISFA 1AZ1A 3COTA 1QWKA 1J96A 3M64A 2BP1A 2ACSA 2PDWA 2ACQA 4HBKA 3G5EA 4NKCA 2PDUA 4FAMA 4XZNX 2HV5A 1RALA 3R8GA 1C9WA 4F40A 2ACRA 2IPJA 2PEVA 4XZIA 1YNQA 3DOPA 3ONCA 1AZ2A 2IQDA 4OTKA 2ALRA 2HEJA 2PDBA 5LIKX 3ERPA 1X98A 1YE6A 4Q3MA 1XJBA 4ICCX 4L1WA 3N6QA 4PR4A 2PD9A 4JIIX 4GIEA 1PZ1A 3WG6A 4ASTA 1AH4A 3WBWA 1FRBA 1A80A 4QBXA 1YNPA 3EB3A 3EB4A 3CV6A 1Q13A 1XGDA 3LD5A 2PDFA 5JH2A 2BGQA 2DUXA 2F38A 1VP5A 3VXGA 4GACA 2PDIA 4JIHA 3R58A 2IQ0A 3V35A 2AGTA 1X96A 1ADSA 4GA8A 4JTDA 4EXAA 2A79A 3M4HA 4QX4A 5KETA 4LAZA 2PDHA 3GUGA 3UYIA 3V0SA 1EL3A 2IKIA 3RX2A 1SM9A 4IGSA 3GHUA 4LB3A 3V36A 2PDMA 3CAVA 1ZGDA 4LBRA 3G1RA 2FZBA 3T42A 2PD5A 4GQ0A 2FVLA 4XZHA 3LENA 1QRQA 2DV0A 4PUWA 3V0TA 4WRHA 1RY8A 2INZA 2PFHA 2C91A 1LWIA 4GCAA 5LIXX 2PF8A 2R24A 3UFYA 3UGRA 4JQ1A 2HE5A 3C3UA 2PDJA 4PRRA 1AFSA 3LEPA 3Q67A 5M2FX 4Q7BA 3DN5A 4JTRA 1X97A 4G5DA 1EXBA 4JQAA 3O0KA 2CLPA 2HDJA 2IKGA 1S2AA 4XVDA 4JQ2A 4LB4A 1OG6A 4JQ4A 1Z9AA 3BUVA 1AH0A 2INEA 4XO6A 5DANA 5LIWX 2IS7A 4PUUA 4IJRA 3CMFA 5AZ1A 2F2KA 3R94A 4R9OA 3UZYA 1LQAA 4WDXA 4JTAA 1YE4A 3WBXA 3GHRA 4L1XA 1PZ0A 4DBSA 3H7UA 3Q65A 4QR6A 2HVOA 2PDGA 3BURA 1K8CA 3BV7A 4EXBA 4QXIA 3NTYA 4YU1A 4RPQA 4XZMX 2HVNA 1Z8AA 2PDNA 1EF3A 2IKJA 2I17A 3M0IA 4XVEA 3H4GA 4YVXA 2PDPA 4XO7A 1HQTA 3CV7A 4PMJA 4YVVA 1EKOA 3GHTA 3S3GA 4FA3A 2FZ8A 5C7HA 4JIRA 4WGHA 3KRBA 1MI3A 2PDQA 3WBYA 3FJNA 3LNMA 4DBWA 4XZLX 2QXWA 2HE8A 1PWLA 2BGSA 1S2CA 1MRQA 2FGBA
chains in the Genus database with same CATH superfamily
1W6TA 4M81A 1PHWA 2A7NA 4FS9A 2QPXA 1TZ9A 4PTNA 3GVRA 2O56A 1JPIA 3R89A 2RDWA 3LY0A 4P7RA 3GNDA 2ZZ7A 1FWIC 1MXGA 4NZFA 1RK5A 5HA7A 3LS9A 3P6LA 4LAOA 1KFKA 1YDOA 4GY1A 2HSAA 4ALDA 2WM1A 2HISA 3OHMB 3OODA 3F1QA 2I5IA 3AIVA 4BWLA 3KAOA 2FMNA 2IPFA 3GW0A 4NT0A 2REQA 1F6KA 1JCMP 4M5PA 3SAZA 2E6AA 5BOOA 1YDVA 4BI6A 2EG8A 4LYKA 3UWEA 2ZVIA 2EKGA 3HBLA 2QJJA 3PF3A 4IP5A 3BAKA 1DJWA 4GK8A 4FX6M 1EPXA 4Y9AA 1ZJIA 1QT1A 2CETA 4YVPA 2MNRA 2CITA 5JH1A 4LUTA 3SFKA 1M6JA 4JAWA 2PU0A 4IH3A 2YZRA 3FHQA 1BRLB 3ZSTA 4FNRA 5DT7A 2QULA 1KBBA 2VO5A 4ATLA 3NPXA 4MAZA 4TOQA 5DY2A 4GZEA 1B57A 4M56A 4Q4KA 4F2TA 2QDDA 4KPLA 5CAKA 3CV2A 1H7XA 2BHUA 1H5YA 1TQJA 3BO9A 3IARA 2ACUA 1XIBA 1EJWC 1H3GA 4EPDC 3IUIA 4GVHA 4MZ1A 1LRTA 4L4MA 4NYUA 2B7OA 3MDUA 1LLWA 1B3VA 3VGEA 1HKMA 2E6FA 3L9CA 3G24A 3CK5A 3IK2A 3MKVA 1BF2A 4DYJA 3RX4A 4E8GA 3MMWA 1UZDA 3ABOA 4FIRA 1EUAA 4ZFMA 4HD5A 4EKJA 4CNTA 3NQMA 4L4OA 3SJ3A 1Q5MA 4XZWA 5B7YA 1QHPA 1RHCA 4QDPA 3TXVA 1DHKA 3BSGA 1VEOA 1OBAA 2AMXA 1E1CB 4MWAE 1CCWB 1UP2A 3M5YA 3WQ6A 2YZ5A 3WDJA 2ZTKA 3ISIX 4G1NA 2NUYA 3TAKA 4FXSA 2JIWA 4HBKA 4WQ6A 5I00A 2I7GA 3NZRA 3KUMA 3EWZA 4N9DA 4QEEA 3UJEA 1M03A 4F40A 2BASA 4B15A 2ACRA 3HQNA 4S3FA 4DJDD 3W7IA 4LH8A 3EOUA 1XLDA 3LLXA 3DOPA 1CT5A 2PWVA 3CIXA 1W3LA 3TDFA 3RK8A 3WK1A 4ICCX 3TK7A 3BMXA 3H7VA 2FHCA 1DWJM 1EWDA 3H12A 1SZEA 2WAGA 1TSIA 2WVVA 3U4FA 1JJKA 2WPGA 1V79A 1H51A 3NQAA 1A5SA 4LGXA 3W00A 3LRMA 1UKPA 2ZRXA 4DX3A 4K8EA 4QBXA 3BL3A 3MO4A 1JDFA 4Z1BA 3VKDA 2NV1A 4JFVA 4GUIA 3KOYA 3G0UA 2EPHA 4B3LA 3GSMA 3DBNA 4GYKA 4Q8TA 1K3UA 2F38A 1YTKA 1XPGA 3REQB 3RO8A 1TWWA 1TG7A 3VAVA 5BU9A 3GXDA 1O12A 2PDIA 4P7LA 5IFTA 3EB2A 3UR2A 1UROA 2PPGA 4PBGA 3BQ5A 2QCMA 2GUUA 1BYCA 1FP8A 3UXLA 4GI8A 4QQ3A 2UBPC 4E4PA 5HMEA 5BWFA 1RLCL 3VNLA 1Q4WA 4WJEA 4M3PA 3S5OA 4I5UA 3GDRA 3L67A 3NL5A 2QGYA 3GDTA 3VOGA 4I5RA 4EVZA 3BAWA 4D6CA 5HPOA 3C0JA 2DJXA 2VD8A 4UQEA 3L2MA 1TCDA 3T0BA 3GG7A 3C0QA 2QV4A 3L4YA 3MU7A 1CGXA 1LWIA 2ZICA 4FEZA 2R24A 3M9YA 1KFBA 4CD7A 1XYBA 2FFCA 2A2IA 3DCPA 1XX1A 3VNDA 5DCBA 3V1PA 1E0UA 4JICA 3ARPA 4IGNA 3W1PA 3TNBA 4PRRA 1EBGA 3NR0A 2OSXA 1ODUA 3Q67A 2H6RA 4GWEA 4LS0A 1OY0A 4LYRA 2BY1A 2NQHA 2ANUA 4JFSA 3LM7A 2EO7A 3DDMA 5AFDA 2E8YA 4XVDA 1E6SM 1JDDA 3VCNA 3ITXA 2QUTA 3R94A 3S1VA 3B05A 1TPH1 2XVKA 3K4WA 3VOIA 3DU0A 2BY3A 8TIMA 5LKYA 1XYZA 1QBBA 1XICA 4G6CA 3W7NA 5D37A 4DBSA 4BF7A 4GKLA 4AZBA 4J3SA 4DIAA 1P0BA 1Q6EA 1E9YB 2QJMA 2F2HA 3BURA 3NDOA 4DBDA 3QHOA 2HVNA 3CB3A 4MDPA 2VDIA 2VGFA 3GG8A 3H4GA 1QBAA 2BBFA 3C52A 3N2CA 2CEQA 1YRRA 1R87A 3PBVA 1TYGA 2ZRWA 1CGTA 3KS6A 5CPQA 1XBYA 1E15A 2R91A 2Q8LA 1NTHA 3G1AA 3VIGA 2NT1A 3L5AA 4C6MA 4ZTXA 1BGAA 1VHCA 2C3ZA 4MWAB 3BW2A 4S2BA 5BMWA 4IMCA 4KEZA 2Z0IA 1KCXA 1UMLA 3G1XA 4XK2A 3SB0A 2PMQA 4C7FA 1V3HA 3WEZA 3BG3A 1S39A 4ZEPA 4FNUA 3F03K 1MW1A 3CH0A 5DMYA 2FHBA 2VRQA 5HNTA 4AIEA 4IMFA 3A13A 4C6CA 2ZKMX 2EEXA 2FH6A 1QR7A 4HHHA 3GNPA 3MZNA 2WMJA 3LGDA 4M1RA 1VLIA 2JK2A 5C55A 2QJIA 4AXKA 1B4KA 4BCEA 1V0KA 4R34A 1GHRA 1XC4A 1MEHA 1F73A 1NOWA 5I6SA 1GQKA 3CL6A 2AL1A 1XXXA 1UKOA 3ITGA 2HBVA 1JEZA 2NV9A 4OHQA 3TKFA 1BD0A 3KDNA 4RW5A 4QG9A 4ZQNA 3HV9A 1V6WA 3EPOA 3PPCA 5BRPA 1JRCA 1TX0A 4IISA 2WQPA 2E28A 3A24A 4KRTA 2YCLA 3R43A 3PBWA 3WK2A 4MHBA 4DZAA 4U2YA 1GOWA 2V0TA 2J6XA 3E0WA 1H41A 4N02A 1KKRA 2ZTJA 4UB9A 1JDEA 2BY0A 3W2NA 4MFDA 3WNLA 1V02A 2QDHA 1IXQA 3FEMA 1US0A 2F9RA 1DJHA 2OX4A 3A3HA 4J40A 4K1WA 2Z29A 4CQ9A 1R46A 2GUYA 1JUKA 4IFRA 1NF7A 1GTHA 1GQLA 2A5HA 2PCEA 2OB3A 1UJPA 3B06A 4JTKA 3ZJ7A 3NAVA 3NQ7A 3LBOA 2DW6A 4O19A 4EPBC 4LQ1A 5IRPA 5DXXA 2ZZ1A 3RCNA 4GH3A 1UWQA 2R1NA 3W7HA 2Z25A 3VE7A 2VEIA 3CZKA 3AYSA 2FZDA 4UTTC 3PPFA 1DWHM 1ZJHA 2CC0A 1GVYA 3GU2A 1JG9A 4LCSA 2ABBA 3B3DA 3SCVA 3QBUA 3MB9A 3VK5A 1K7EA 2PGWA 3TVAA 3E2RA 4MAVA 3TFCA 4JTCA 2Z1WA 4MZYA 2Y70A 4LT9A 4O1BA 3UA4A 1OFDA 1ZP4A 3ORWA 5BNKA 3LZ3A 4JX6A 1J0ZA 3SZ8A 2HVMA 3CQIA 3QR3A 4GE8A 3WQFA 3OZPA 1FWDC 1F76A 1TV3A 4V1YA 2R9RA 2WZHA 5JUVA 3ZWTA 3DC8A 1TPB1 3N2BA 3EMQA 2P1FA 1P4CA 4INFA 3VD7A 1L6YA 2VWSA 4FAMA 3WD3A 1ZALA 4QLKA 2BS9A 2CPUA 3M6YA 1I0DA 1LG1A 3CMJA 5J5DA 5CEWA 2ZZ6A 3B8UA 1P48A 2IQDA 2ALRA 2PDBA 1ISYA 1I2PA 1XLAA 2PAJA 1K9FA 3TQ0A 2I9UA 4CKQA 4QLJA 5H2ZA 2QUMA 4AW7A 4HK6A 4L56A 3H2OA 2PP0A 4PL1A 3ME3A 4NJGA 3Q4DA 3AMKA 4CNOA 1XHGA 1UD8A 3EB3A 2UY2A 3EWYA 1TIWA 3RN6A 3E0VA 2BWGA 2CBUA 3MMDA 4DWDA 2R6OA 4KCUA 3OW1A 1QW7A 1W5QA 3G3MA 3M0MA 4FNTA 1QI4A 5FI8A 2D3LA 3KCLA 4PUMA 2GWGA 4TXEA 2G41A 3QXBA 3B4YA 4V28A 5LA2A 4FIQA 1X96A 4JTDA 5FEWA 1JQVA 3NGFA 3NO1A 1YPXA 1UA3A 4GY0A 4DJFA 5A6AA 1XLGA 1WDWA 3KLKA 2J7EA 4N9BA 3GAKA 1KM4A 2QCCA 2XGZA 1WNOA 5DBUA 3RFAA 4LUJA 2D69A 4AEEA 1OZMA 1J6PA 3CAVA 4A2SA 3O16A 1C3FA 3H55A 3AHZA 4XAGA 4D72A 4U33A 3PZTA 2HXTA 4XZHA 1DTUA 3QPZA 2OO0A 1XIGA 1F07A 3P5YA 1RP9A 2CZVA 3DG3A 5DRCA 2FB2A 1HL9A 4OVXA 2WWDA 3CQJA 3SO7A 4NAEA 3SUVA 5BXPA 8XIMA 4HU3A 4ACZA 4D8AA 4IX0A 2HQAA 5FF3A 1GWJA 5A6JA 2V38A 3AMLA 1JAEA 3Q37A 3CUZA 1OF8A 4DXXA 3PUEA 4TR9A 3D46A 1GQIA 3TYAA 3GO2A 1OADA 3P7YA 1VYPX 3ITTA 3W1LA 5I3HA 1XLLA 3W1RA 1TZ7A 1GKQA 2CFFA 1PZ2A 2GL5A 3N17A 1V6XA 2EPKX 1EA0A 3ABSA 3WLRA 1UKQA 2FTPA 3L5LA 3H4WA 1H60A 4P8UA 5D03A 1BQGA 1ADOA 1TVLA 2YA1A 3WH9A 4F0HA 1W5PA 4EOUA 3AISA 1OB0A 5A6MA 3PUOA 4QCFA 1KBJA 1ZZMA 4QXIA 3LCXA 4UTKA 1XR2A 1ONRA 3WQ8A 3G22A 7ENLA 4X22A 3W7PA 5HPCA 1NWUA 3BJTA 4Z08A 4BZYA 1QJWA 1NEYA 3OPSA 4HNVA 1G4PA 1Q6QA 3SURA 4HSNA 1MI3A 1H5VA 1U33A 4IM4A 4YTSA 1DWFM 1LCOA 3EX2A 2HNEA 2Y7EA 4Y96A 1I45A 2FGBA 3VNYA 3PJWA 3O8AA 4KIRA 3W2MA 4RXFA 3SJNA 3P8JA 3EDJA 2GGGA 5A8MA 2XH2A 1W3NA 3EX6A 3L68A 3U5UA 4JCMA 4CGTA 2VC6A 1ZY9A 3VA8A 4V27A 1ZSXA 3W7QA 2NUWA 1A5UA 1ZAJA 1XYLA 4WUIA 2Y7DA 5F1UA 2BHZA 4KEUA 4AC7C 5CKSA 2WMKA 2D2JA 5HANA 1VRDA 4FLOA 3RX3A 1XUZA 4EX4A 3LM3A 3EAUA 5AZ0A 1VIZA 3MI3A 2GZXA 4OWGA 1WE5A 1JULA 3OHIA 1Y5XA 4ECLA 2FZNA 1WQ5A 1C29A 1UOKA 4LEFA 4J3TA 5EPDA 3WLPA 1R7OA 1VIWA 3QC0A 1WKDA 3JS3A 4KWWA 4GVGA 2RDXA 3N1AA 4AQLA 5U7SA 2H9AA 2VDGA 1NY1A 3VMNA 5BRBA 2NUXA 1MQPA 3FYOA 3GDMA 4IPLA 1KBKA 2I5GA 4DF2A 2VP8A 3STGA 3BAXA 1Q7QA 3BLDA 3HO8A 1N55A 2PSNA 2J66A 2C18A 2VEKA 2QHAA 4EAYA 3T4CA 4IPNB 5A6SA 3PAJA 2FPTA 3UA3A 1OYAA 4NZ5A 5HNUA 4ES4A 1UC4A 1E1CA 2Q6ZA 3HURA 1JF6A 4H9UA 3M0JA 1HJUA 2VQUA 3NQBA 3PS7A 5CG7A 1X6LA 1XFBA 3W2JA 3BICA 3N2MA 3P93A 4YPJA 3C2EA 2A21A 4FLQA 3QR0A 4LY8A 2A7PA 4JD4A 4KKXA 3CB8A 3MKCA 2PDLA 4LW7A 3THAA 3K2GA 1GORA 4PODA 1ICSA 1ZENA 1LP6A 4KWOA 5CGTA 4OBSA 2Y63A 4M6QA 3GNRA 4E8DA 3PR2A 1JCYA 1YBQA 2A7RA 1IHIA 2HXUA 3IEBA 1EQPA 3W85A 3UY8A 2DGAA 2QNEA 3MVIA 1EJVC 2W91A 1HNYA 2Z4GA 4L1GA 1UD4A 2PDYA 3QZAA 2QCGA 1M5WA 3KBSA 4M51A 4UTHA 5M5DA 4M80A 1GJUA 2ACSA 2VNCA 3K30A 1NDZA 3NGJA 3G5EA 1LUCB 3TQVA 1K6WA 3CHVA 1EUNA 4CU6A 4HHMA 1E0WA 2A3AA 2IPJA 3RPTA 3N4FA 4F48A 5ECVA 2D2OA 4BQ4A 4XZIA 2VEFA 4BEQA 4GINA 3PJUA 1A0DA 8RUCA 3VKBA 1O66A 3PBGA 1TTIA 1I2QA 1CXKA 4XAFA 5E9XA 1AH4A 1O5QA 4TV5A 3AU2A 1YXDA 3NNTA 2F8QA 5CSUA 3KL5A 4MLJA 2E1WA 1PVNA 3GYEA 3URNA 3RJXA 3KVLA 1TPDA 1LRQA 3JRKA 2VUYA 3AS0A 3TSMA 3K8LA 3BAJA 3P67A 3U0HA 3G18A 4YTUA 4GUGA 1IEQA 2YCIX 3M0XA 1R3WA 4AMAA 4IMEA 4XZBA 1XGZA 3HG3A 3PNUA 4LAZA 3WJZA 4HYWA 2CWXA 2NXGA 3KCJA 3RX2A 4OT7A 3HPXA 2CBIA 4GI4A 1W5OA 2VZUA 4XD6A 1VCFA 5CPLA 3T0AA 3E74A 3W24A 1SFLA 4TX9A 5D8WA 1EGVA 1C90A 3LENA 3N3TA 3LGEA 3DFYA 1V0NA 4IPJA 1PKMA 2DV0A 3W1AA 2Y8UA 2YBUA 1JCXA 4DWSC 2GJPA 4BF9A 1M7XA 4UNLA 1V3IA 1V08A 3EKZA 7CGTA 1D3CA 4LS1A 5A6TC 4PULA 3GVGA 4LWWA 4C6EA 1B3OA 2I9EA 1AL7A 3CWNA 5K7JA 2QUNA 5D32A 3R8RA 3O2LA 1D8CA 4QROA 4Q7IA 5FSEC 3T05A 3O0KA 2C79A 4YLWA 2JIEA 1PX3A 1P0KA 4QISA 4GJJA 5CPTA 1XIMA 2NWRA 4N6EA 2VWTA 4XAYA 2PP1A 1D8WA 2ALDA 3LPPA 2ISDA 3CPRA 1TPEA 3UCCA 4FHAA 4GXMA 5AHEA 3F4NA 1GK8A 2WYSA 4F2BA 4LX4A 3TONA 5LGXA 1E4IA 2AL2A 3UZYA 4MYAA 4P2VA 2WVTA 3QSTA 1XCXA 1KRAC 4H6QA 4D6IA 5JIPA 4XWUA 1UKSA 3Q2DA 1R3SA 3LXAA 4LUSB 3SQLA 3VKJA 4DUXA 3UXDA 2GJRA 1F5ZA 1H7PA 1EFZA 2C1HA 1I0BA 1E4NA 4RPQA 2JF7A 4H3DA 1Q6CA 3QEZA 1XFCA 4WOZA 3DFSA 3LLFA 4MB4A 4XO7A 3PZNA 4HJFA 5C5YA 4DUWA 1UH4A 3AJ7A 3FVMA 3WLHA 4MY1A 2BVYA 2GSEA 1TUFA 1XBZA 2BOEX 3W27A 3GNNA 3ICJA 3WBYA 4DWSA 2OX1A 3NWRA 4RR4A 1Q6GA 3UXKA 2B81A 4MMWA 1QCWA 1SVDA 4GVIA 4YJ5A 1A49A 4IPIA 3W01A 3TFXA 1VPXA 4HA0A 5I79A 1XCFA 2XIMA 1FBAA 5FF0A 2OFJA 4DJDC 1LL4A 3TQKA 7XIMA 1Z89A 1XW8A 1OG0A 1QAPA 1IZJA 3JZEA 4IMDA 3L0KA 3W7LA 4PCTA 1F2JA 3WH8A 1JPHA 1P7TB 4O1EA 3TN6A 3U9IA 1AJZA 3UZXA 1EA9C 1GONA 1PCWA 4JEQA 2PI6A 1JCNA 1MXSA 5EU9A 2CCRA 5K9CA 2QIWA 5LYRA 3C0LA 5CSYA 4L6OA 4CEXC 5KMYA 4ZZ9A 1SMDA 4LANA 2WBGA 1XRSA 3N29A 1MYRA 1K02A 4V15A 1ZBVA 5FJPA 4GY7A 4W4QA 1N8FA 4UC5A 4LBUA 1E6NA 3KOZA 1ITUA 3IJ6A 4Z2JA 5A3HA 3AAMA 2HMCA 4NXKA 3DX5A 1O95A 3E49A 3R13A 2X0HA 1MNSA 2QCFA 1DBTA 2Z7GA 1DIOA 4JQ3A 3GC5A 5LHEA 1UPMB 1ZCCA 3DG7A 4S39A 4PUJA 4K3ZA 3NPWA 3DC0A 3MUXA 5EL1A 4PMVA 3VGBA 5IXEA 2DFAA 1US2A 4S3KA 4WJXA 2ZZ5A 4Z42C 3OEXA 4JNZA 1ZNNA 3MSDA 5I3IA 3HN3A 1CDGA 3ELFA 1ZBCA 1SSDA 5BCAA 3I6EA 5H8UA 2EKCA 2ZQ0A 4H04A 1C8QA 2PBGA 5LNWA 4H7CA 3GXNA 4GYFA 5EKYA 1MUWA 1B31A 1W1PA 3M16A 3LHTA 3GG0A 1WKEA 1R3VA 4J2PA 1IEXA 1SPQA 4UQDA 1HX0A 1ZBWA 3WLTA 4JN6A 4RZ4A 4L5ZA 4ORIA 2VR4A 3R6IA 1SJDA 1I1XA 4ZE4A 1CI1A 4E4UA 5A2BA 2ZXBA 3BK0A 1LBFA 1B4EA 4W8AA 3VM7A 5ABTA 2DUZA 4IFOA 2JKEA 1W0MA 4XX6A 3COTA 1QWKA 1TV2A 1H50A 1O94A 1HVQA 5EY5A 2PDUA 2CU0A 2E5CA 2O9PA 4UTFA 1TX2A 3QGVA 5HUPA 4I9TA 2NX9A 4MLRA 1W91A 1TMHA 3LXBA 1BHGA 1OINA 4O53A 4F0KA 5ENLA 1F3EA 2ZE3A 3AMGA 3LOTA 4Q4RA 4W89A 2TYSA 2OGJA 3ERPA 3NL3A 2Q3OA 1CPUA 4R7OA 4ZGYA 3W6YA 3ZVHA 1Y8BA 4IUOA 2CW6A 4GCXA 1JD9A 1SJAA 2WPBA 3SRDA 1VBHA 1SQ7A 4O18A 4NRRA 3E38A 5F2IA 3UJRA 2DT2A 1FCVA 1PTGA 4GYJA 3QMRA 1OFAA 3B9DA 1R3TA 3PFMA 1Q13A 1XGDA 1O7AA 3LD5A 1JDAA 4CNNA 1FKXA 4KEMA 4GGHA 4WKHA 3GVVA 1OX4B 1TTJA 2NVAA 1WXYA 1W3TA 1P6BA 2DIEA 3WK0A 4CUCA 1SR0A 1ADSA 1IYXA 4HHLA 3BGAA 2B7QA 3MWAA 1I8JA 4RZBA 1OABA 3BWWA 2A3LA 3XISA 3WFZA 1E0TA 2CKRA 3TR2A 1AW2A 1AUSL 3LV6A 1YKWA 1D9EA 1FFRA 2X1IA 2UV8G 1AJ2A 3B4UA 4AU0A 3P74A 4AH7A 3RR1A 3AHYA 1LQ2A 1V0MA 1EX5A 2OLSA 1FDJA 3VMOA 3H23A 4MY8A 1MZHA 3C5QA 3MCMA 1GTEA 5I3KA 5I02A 3O6AA 2VFHA 3PJXA 2PF8A 3BGGA 5I06A 4S3GA 3G6MA 2Q02A 3NXFA 8A3HA 2J6VA 1S38A 3C8FA 3LHYA 2JALA 5CC6A 5CZ0A 4JNMA 2DT3A 3KEHA 3VGFA 3HGSA 4LU0A 4PMDA 1JD7A 4B5VA 3OGVA 3F4DA 1L6FA 4L6DA 3WNNA 4CD8A 5B7ZA 3FJ4A 2VX6A 4W93A 1POKA 3HGRA 2ZUUA 3WY1A 4LB4A 4PB3A 3W7DA 2INEA 3IVTA 4CN6A 5LIWX 1W1YA 3AALA 2XIBA 4R9OA 1NOUA 4ZO9A 3RCMA 4DZIA 4LUYA 1EJUC 3QW4B 1G7UA 3GHRA 4JTSA 2E5BA 3LG3A 4HTYA 3DFNA 3H7UA 1HJWA 2ABAA 3Q65A 3IJDA 4LUTB 3CHFA 1K8YA 1QWGA 3RLVA 1UR2A 1GYMA 2XFWA 1JGIA 1FVPA 3MY9A 3QFWA 1W1VA 2D1ZA 4NNCA 2RAGA 1UBSA 2V81A 4IX2A 1EF3A 2IKJA 1JNEA 5K9DA 1N7KA 3AFBA 1KRMA 4UR9A 5AYYA 5BXSA 3CLMA 4AHOA 4YVVA 2YDSA 4OU1A 2G50A 1H7NA 2P50A 1VZWA 2ZRZA 3BJFA 3LHWA 1KFEA 1L9WA 2GDQA 3WD0A 1FH8A 3R0KA 3TSBA 3S8HA 5FIPA 2WBKA 3VMPA 1CBGA 1DP0A 1I2OA 4RDVA 1H7OA 1MRQA 4G9PA 5LIUX 1VS1A 2DH3A 1OEPA 2OWXA 3SY1A 1IE7C 4UIOA 4GNVA 1N82A 2INFA 1G67A 3NQDA 3FSUA 3ABZA 3PK7A 5IDIA 2X41A 1EYEA 4R7WA 3P60A 2OQHA 4UZSA 3QC3A 1UWRA 3A23A 1UQZA 1OD0A 4UMCA 2BHYA 1NFBA 4TU1A 2PODA 1X38A 2A3HA 5LA0A 2W66A 2V2DA 3A22A 2DDXA 2PDXA 1XYAA 2V5DA 3T9PA 4GO8A 3S42A 1UUQA 5C71A 3V3WA 2R8WA 1U1UA 1TWIA 3MP4A 1W8GA 4JKMA 1OT2A 2B7NA 2ON3A 1IEIA 3ZJKA 3LZ5A 3LYEA 1EO5A 3H54A 3GXMA 4TUFA 2VEMA 1H1YA 1XRVA 3V75A 3W26A 3P3BA 1XL9A 3GB6A 4CQ8A 1C7SA 1U1HA 2EBNA 4B92A 3IJ9A 2ZUWA 3QOKA 1AQHA 4LVFA 4O1FA 4HCLA 2IKHA 3VO0A 1E40A 4XKMA 4GBDA 4R5EA 1OSEA 3UNTA 5BXTA 1EB3A 2RGMA 3VGDA 1HKWA 1TJRA 3CUHA 2H3BA 3VD5A 4ZXOA 3RYSA 5C9UA 4GNKB 3W1NA 5BZAA 1F3TA 3W29A 3N19B 3RMEA 5HNNA 4CVWA 5F4WA 1W9VA 3TTSA 4B4FA 2E0PA 4HHPA 4EF9A 3N34A 4WY0F 3SCWA 2NVCA 2Y85A 4J28A 4O0KA 3APTA 3TP4A 3UYCA 3B9EA 4AUBA 4F0SA 2F6XA 1HW6A 3KX6A 3MZ2A 3W74A 3W86A 1KRCC 1TPFA 2W5FA 1GOKA 3MYOA 2QEZA 1R6WA 2D2GA 3N73A 2GOKA 3MSRA 1UB3A 5RUBA 3O1NA 4UFKA 2ZDRA 1E9IA 1AJ0A 1PIIA 5G4HC 1KCZA 3F7JA 3ARWA 4O10A 1S46A 4GUHA 4Q4PA 5CSSA 2CBJA 3LCLA 3VD4A 1H2JA 1VLWA 3RPMA 4PUNA 1JFXA 2G4JA 3VE9A 5A6BD 2DZBA 2A6NA 3GIYA 1VFFA 3M64A 2ACQA 4PZVA 3B8WA 1LT7A 4NU7A 2B0MA 4PTDA 1Q65A 1V0LA 2XG9A 3MYPA 1IF2A 4B5XA 2HV5A 7REQB 5AVHA 3W3OA 3EWDA 2BDQA 3GDBA 5M17A 4K7YA 4ICMA 3NQFA 4U4MA 1SZGA 4LVBA 2PUZA 2YA0A 1AZ2A 1J12A 2HEJA 3EX3A 1BKSA 1PTDA 3PPGA 5GVJA 1KGWA 2QF8A 1P5BA 3R0UA 1WZAA 3UJ2A 1YDYA 3L0NA 4OZOA 1F6YA 4DBEA 2GQAA 3VZZA 5TD4A 1U22A 8CGTA 3WBAA 1LORA 4XD4A 1EC8A 1VFSA 4XQ6A 1KB3A 3YPIA 3MUY1 3RUBL 3VXGA 3NURA 2CBVA 3JZUA 4CD4A 1TIMA 3BW4A 4B5UA 3KWSA 2IQ0A 4MM1A 1RK6A 4J4KA 3IIOA 1IIHA 4XTIA 2PWUA 3GY1A 3EA1A 5KSWA 3QYSA 3UWWA 1G5AA 3T0DA 2PDHA 4K1GA 2X0YA 3GR8A 1PKYA 3T55A 1B3YA 2RFGA 1JAKA 1HO4A 1P0EA 2YYTA 1MFVA 4ORMA 3RM4A 1KGUA 4LNCA 4LBRA 5D33A 4XBKA 4E4FA 3C8NA 2VL4A 4E2BA 4J3VA 2WCGA 4KQNA 1KBIA 1VEPA 3N9SA 5KZDA 2PWGA 3LU2A 3N6JA 4IL0A 3TXZA 2XZ9A 3RIKA 4NJKA 4KW2A 4MWAA 1VFLA 4NZCA 3I6TA 3BAIA 1QPOA 5EA9A 3IJ8A 4QG6A 1EP3A 4TX6A 5C9WA 3TMQA 4RE0A 4NVTA 2GSJA 3UVAA 2G3FA 3KBVA 1TA3B 3VI2A 1SU5A 4IL2A 2OPJA 2FMOA 3NL6A 4PC8A 4L9ZA 3GE7A 5U4NA 1FCQA 1P0DA 3F5JA 1O1HA 3H2FA 3W75A 1ISXA 3POHA 1XCWA 3N11A 3MMUA 3VILA 1AW5A 2OCZA 3GXIA 3CTLA 3SQMA 1AH0A 4XO6A 1FOBA 4YXGA 3B03A 3OG3A 5MF5A 1H7RA 2HK1A 2NZLA 3CYVA 3GR7A 4H9VA 5LNRA 3WL0A 4JTAA 4PCPA 3RAOA 2TSYA 4NAFA 1T8QA 2VZVA 2I14A 2BLEA 4ACZB 3B0XA 5GQBA 1EPVA 1QNQA 5EGRA 4QDMA 2W3ZA 1FHUA 1Z42A 3G8RA 3NTYA 5T26A 1U5JA 1TJ1A 4HZ7A 2AKZA 1VF8A 1DPMA 5JBDA 2HS6A 1HQTA 3LSBA 4AYGA 4HNOA 3SR7A 3O06A 3RDKA 1EH9A 1TWSA 3TC7A 4JKKA 4B3KA 5HJYA 4BWLC 2CLMA 3H24A 1C8YA 3CWOX 2C19A 3CGTA 1HKKA 2R1PA 2WLZA 3LPOA 5DMLA 1TO3A 4FR6A 4GXWA 3RITA 4R7JA 3ZR6A 1SO3A 2OO6A 1W17A 1J79A 4CQCA 3HG4A 2I1OA 3BARA 2YXOA 1E3ZA 1SGJA 4GYPA 3KTSA 4A21A 3S9ZA 1SW3A 1CB7B 4DJDA 5G2WA 1C8VA 4S1FA 3B40A 4AD4A 3R7MA 2GUBA 5DN1A 4AEOA 1SFJA 4J5NA 4JDBA 3M43A 1TB3A 3K4AA 4XV0A 1GQJA 1Q6DA 2GVEA 4CU8A 3MDWA 4TO8A 1MW3A 3ZMRA 3W1UA 3GS6A 1H63A 5FF4A 4BI5A 3OYXA 2ZOXA 3MW7A 4HNCA 4PFMA 3VIFA 5C9RA 1Q2SA 3N2OA 2OVLA 3AIWA 3IIZA 3S2JA 4LAUA 3EKGA 5C70A 4QAIA 1UR0A 3HJZA 4G2DA 1MUMA 3EPMA 2BB0A 3PC0A 1ELSA 2J62A 2DEPA 2WK2A 1PIFA 1KW1A 4EF8A 4IP4A 4UTLA 3C56A 4E3TA 4C7GA 4K36A 1PV8A 2EJAA 1GGOA 3KDOA 4CVUA 3M5VA 5LNSA 3CAQA 5EB8A 1IQ8A 3TCSA 3KBMA 1R9XA 2NW0A 1BSLA 3QPYA 2D20A 1TUXA 3LX9A 3CAKA 1W3KA 2WVSA 2ZADA 3C2RA 2E9BA 1AK5A 2DUAA 1KXVA 2GVJA 1BVZA 5T9BG 4MF4A 2OSYA 3QVQA 5FJJA 2CKSA 2UZ9A 1PBGA 4EACA 1HJSA 4JL1A 1XIDA 3LTSA 4FI4A 3MBDA 3F5KA 4IQDA 2WNQA 3UR8A 2VKZG 1RPKA 2A3EA 3EXSA 4N2YA 1FWJC 1L8NA 1XRTA 2VJXA 2WMIA 4PMUA 3KZSA 1ZQ5A 2YR1A 2VGIA 3ZLGA 6ALDA 2DSVA 2OWWA 3XINA 1TMLA 4HA1A 4RPPA 4WKFA 3WJXA 1FHDA 4P8XA 1V02E 2V3GA 1MO0A 1RBOB 1PL9A 4HMDA 4RZ5A 2XH4A 1TV8A 3HQOA 4W9TA 1DQUA 1KNWA 3FAWA 3B0YA 2AQVA 2BP1A 2ZX6A 1UP3A 3GBEA 4Q8OA 3C2VA 1OIFA 4EE9A 3IGHX 4LVDA 1QMLA 3HM7A 4ILSA 2XVLA 2G97A 1TPUA 3EA2A 3MI2A 2DZTA 3W23A 2PLJA 3PB2A 1TTPA 1RJRA 1A47A 1OCJA 1XGEA 4H01A 2HPMA 3OJGA 4ONVA 4A35A 2Y8VA 4X63A 2XFYA 2C16A 3TW6A 3M5XA 3BGJA 1K9DA 4S3JA 3NFUA 4KFNA 2PTZA 5MHBA 3BJSA 5AKQA 5CLWA 4QAWA 1VC4A 1UD5A 3DYMA 3LHVA 4LCQA 2W67A 1XLFA 4KRZA 4IQLA 5E09A 1VBGA 1RBAA 1PAMA 1UCWA 4MIMA 4HOWA 1IR1A 1NU5A 2J7GA 5KETA 2VELA 1XLBA 4AX7A 1X8CA 3J7HA 1JZ3A 4W88A 4UCGA 1AQFA 3SFWA 5I3JA 3R4IA 2XSXA 4BR1A 5FAJA 4UOZA 1E6PA 4PCSA 1OC6A 3NO3A 1GVIA 2CXGA 4JX5A 3CPGA 1I1WA 1US3A 1BG4A 1NFPA 3LXCA 1QPNA 4AD2A 3CAWA 3H53A 1QHZA 3NYZA 4XB3A 2VR5A 5H6HA 5CZTA 5CAHA 3DAQA 3V7PA 4Q4QA 4IMAA 2A85A 1JNDA 3OGRA 5E0CA 3UGRA 3C4UA 4PTMA 1W1B1 4KMQA 3KBJA 3FHAA 4J35A 3I10A 4A8LA 5M2FX 2XVNA 4BF5A 4RW3A 4CCZA 1HFBA 1EZ2A 3T8LA 4KCVA 4OV9A 2PE4A 1EDTA 1QNOA 4FNSA 3WQEA 1BXBA 3IVUA 4Q8PA 1HG3A 1A5CA 4I7WA 3U4AA 4GFIA 4Z0SA 2YGYA 5AZ1A 3IRDA 3FFSA 3SCSA 1XLJA 3CL7A 4RE2A 3R79A 4RL3A 3WBXA 1ZRQA 1CGWA 2QCDA 4IGHA 3AWOA 1UWAA 4C6NA 1NOFA 1CLVA 9RUBA 1J0HA 1LZOA 5D30A 1ENUA 1DVJA 4M24A 4UFLA 3BOFA 4M1BA 2JGYA 3LPGA 1KXTA 3TYDA 3BV7A 4PSPA 1JYXA 2NQJA 1UMYA 2KZHA 3KTCA 1OK4A 1DIKA 1IXOA 3M0IA 2H8XA 3UPWA 2X42A 1JFHA 3MS8A 3VUSA 3WQ5A 2QAFA 3SCRA 2FTYA 3ANUA 3N14A 1EKOA 2PTWA 3PTQA 3TYEA 2FB3A 1KWGA 2CNCA 3W6MA 2QVHA 3IWPA 4HCDA 4GBUA 3SCQA 2GPTA 4NZ1A 3SUUA 1MDLA 2BXVA 3B8TA 2BODX 4PGLA 2HE8A 5D02A 5JQ9A 1G4SA 1K7FA 3LRKA 4NP7A 4UQAA 5D2VA 1FXPA 1V3JA 3PZMA 1MW0A 2Y4SA 2YOCA 3E2SA 3ONBA 2J9YA 4LUSA 1UOZA 1UR8A 3VX1A 3EOLA 4D6FA 4JN7A 4DJEC 3T0TA 2UWFA 2G8ZA 2P8BA 3PVFA 4NJJA 3RM9A 3F4CA 3B0VC 1D7KA 1FWHC 2PWFA 3T2QA 2ZWYA 1UC5A 2Z6IA 3UXIA 5HBFA 4GQBA 3CL8A 3OZMA 4W7VA 5FJOA 2E9LA 4L7ZA 4CCDA 4LALA 1Q7ZA 4NX0A 3UP8A 1MW2A 1Z44A 3AXHA 3W76A 1UD2A 3T7VA 3I3DA 2GOUA 3QTGA 1UP0A 1T6MA 4MADA 2WHKA 1UIOA 2O9TA 3WQVA 2NT0A 4ZTYA 3S1UA 1XI3A 4HZ8A 1J11A 1UZ4A 4B4HA 4LRTA 1WOBA 4I6VA 4MB3A 4O4WA 5CC3A 4ZSUA 1YXYA 5CCZA 1VD6A 4RV8A 2FTWA 3NXLA 4H1ZA 2J47A 3IIPA 3WQGA 2Y89A 4JDYA 5JIWA 3OGSA 3R25A 4MZ8A 2NQZA 4LTSA 4RNIA 1X6UA 4GISA 1DE6A 5HWNA 2QMJA 4TMCA 1OFRA 4CNPA 2H90A 2NVDA 4FOKA 1OFBA 1LQ0A 4Y7EA 1I2RA 4AYSA 3IV3A 3RM8A 3CZEA 3M0KA 3WD1A 4MWAD 5FAGA 2OWCA 1CNVA 3QSRA 1CENA 2GJXB 3KBNA 4HPJA 7REQA 2X7VA 2VXNA 1GZ1A 2OEJA 4FNPA 1D7FA 3PBMA 1X7IA 2ZXQA 3NOEA 5MKGA 5G4WA 3DZ1A 5DY3A 3M6DA 1V7AA 4O11A 3FNDA 2EPMX 3L12A 4BQ3A 1WZMA 3LCFA 2VOMA 1RUSA 3ARZA 4OE7A 2D3NA 2P76A 4FZIA 3R8HA 1DV7A 4PRWA 1HKIA 4CU7A 3UCQA 3DHDA 3CLWA 3CPUA 1JCJA 3FV9A 2XZ7A 1E43A 1FWWA 4DPPA 4C1NA 4JTFA 1RSCA 4XIMA 5T8GA 2ZZ4A 5FEPA 2DQXA 1ISZA 2QDEA 1KKOA 2BVWA 3W7MA 5HJLA 4GH1A 1E6XM 3BSHA 4O17A 2JKAA 2PEVA 4O12A 2PB1A 3NZGA 2CHNA 1J0KA 4ZA0A 4FO4A 2PRLA 3HIJA 1XUUA 1ICQA 1LDCA 5AC7A 1W8SA 3FYYA 1EGZA 4Q3MA 1OK6A 4R9XA 1DKWA 2P0IA 2ZWZA 4WY0B 2DIKA 4HSHA 4GIEA 3PANA 4WR3A 1W5NA 4WD0A 2Y7FA 3BPWA 3EX1A 1DXFA 2NX1A 1E6QM 3L66A 1YNPA 1JR1A 1OC7A 1W9XA 5DMMA 1GOOA 3FJ6A 2D73A 4UMBA 2PDFA 1QW8A 2BGQA 2VZOA 5GNYA 3CXOA 3WF1A 1UWIA 4IICA 3QW3A 1EIBA 2NX3A 4QX4A 4Q7NA 4KEVA 2RUSA 3JU2A 1EL3A 1A0EA 2G3NA 1DJYA 1SM9A 1KO0A 2WMHA 3EMCA 1EYWA 3D5HA 3HGJA 2ICSA 1ZP3A 4W8LA 5F2MA 1R0MA 3WMLA 4UTIA 1DJIA 1YBQB 1E1FA 4WK9A 4Z2LA 4GQ0A 3TJIA 4B5TA 4AZCB 5TAOA 1OQFA 1S2WA 4WRHA 3SIMA 1Q6LA 4I7VA 1RY8A 2INZA 1XSKA 3C6CA 4N0RA 4GCAA 4DM2A 2P10A 2Z1XA 4IZGA 3RG6A 5KZEA 2A6LA 4X2RA 2WV8A 3GW3A 3WN6A 1GOIA 4R33A 3NL2A 2VI0A 1OX4A 3L4TA 4ML9A 2VC5A 3NO5A 1FWFC 2NXIA 2HS8A 2WSKA 4S3AA 1Q6RA 3R2GA 1QK2A 5E0FA 1QPQA 3W37A 3WQOA 4HNTA 3ARVA 1WDQA 3QZ6A 1IWPA 2HTMA 3S9YA 1TZZA 1KCKA 3AZRA 1GUVA 4BK9A 3FCPA 4PFHA 3ZS4A 4RLIA 3BUVA 2VURA 3GZAA 2Y61A 2VCBA 5FEXA 4UQ9A 3UF9A 2IS7A 1E9LA 2R1MA 2FPVA 1NDVA 2VRKA 1SYTA 4NUWA 3LV5A 1AMKA 3KRSA 3NEVA 4RDWA 3HGOA 2YBVA 1KD0A 3VOJA 3HQPA 4US5A 1G6CA 3E0IA 2BVTA 2VTFA 4HK7A 3IS4A 4FB7A 1ONXA 4HPXA 5AHIA 3GYCA 5M03A 1RQHA 3SCOA 2OSWA 3CHCA 3AIUA 5G1YA 3N6HA 5L9FA 4HPGA 4JIQA 4QNEA 1YMYA 2VVSA 4QJ5B 3SSZA 2Y88A 4RNFA 4PN2A 3WF0A 1QFEA 3FKRA 3W1TA 1UH3A 3S3GA 3WELA 2HJPA 1F3WA 3GIPA 4EXQA 3C61A 4QE1A 4QQUA 3Q58A 2W79A 3W28A 3GWQA 5CPNA 4XZLX 1SFTA 2QXWA 4ZB5A 1RV8A 3POCA 3VIKA 1Z3NA 3W22A 3H2AA 3ID7A 4JCLA 5C2CA 1GVEA 3GFXA 1IEWA 2CESA 5HMSA 3MSYA 4HN4A 2TMDA 4POCA 1EZWA 2Z24A 1X39A 1PKLA 3K8KA 2IPGA 4G8TA 4PMZA 4P7QA 1LRNA 4O0QA 4F9DA 3LGGA 2QLYA 3GC4A 1RPXA 4UNIA 1GVSA 4H9TA 3UJFA 4PBFA 1DE5A 1TV5A 4C1NB 4RNHA 3WLNA 3HV8A 2FJUB 1KRBC 3ZT6A 1EHNA 1UZHA 4F4RA 3TMLA 1F05A 2J7DA 1XISA 2ZBTA 4GX9A 5I03A 4DYKA 2QCEA 4ATWA 3WJWA 1FDYA 2ADAA 4PMQA 4C7DA 3RGTA 3P8IA 3DERA 1FFQA 5KZ6A 4DN1A 4GQRA 5E6ZA 1XP3A 1GW1A 1Z41A 1Q6OA 2KAUC 3KVJA 2J74A 1HTIA 1OVDA 5CLTA 1V8EA 4YS1A 3C3NA 4NQ1A 3PZQA 2E09A 1SW7A 2PA6A 3GR4A 3ARSA 2DVUA 1T8XA 3KBWA 3HU7A 4UFJA 4ZQRA 3M47A 5F2LA 1FWNA 3U7VA 3QYQA 2QAPA 3ALFA 3STFA 4YNGA 3SEPA 4H19A 3WF2A 1W1ZA 3MT1A 3SCPA 4Z2KA 3EMZA 3CV1A 1JXJA 2I16A 1E0VA 4H8UA 1EF2A 3WJSA 1JPDX 2CWNA 4FXRA 1KFWA 1SO4A 4YHEA 1OYCA 4IQEA 3UWQA 1RZMA 3PPHA 3RCYA 4Y6GA 1CXLA 3GBDA 1Y5VA 2GGJA 2EPLX 4HZMA 1QTWA 3QLDA 3TJ4A 3W7JA 5FESA 2RH9A 2X0SA 3HJEA 1IV8A 1VPYA 3CWHA 2J8FA 3NM3A 1CB2A 4KT2A 1Q85A 3S2CA 3WLMA 2XTKA 2J7BA 3EOOA 5FF7A 1B1YA 2UY5A 4GGBA 4DHGA 2ZX8A 2NV2A 3IPWA 3EDFA 2WSRA 4UTTA 3VIMA 4F0RA 3SSJA 1TJ2A 1MWOA 2XGBA 3LN3A 4U2ZA 4A8RA 2OQYA 1MUCA 1AQMA 4K68A 5J5RA 1L0PA 1K70A 3VIJA 4M29A 2REQB 2ISFA 4Q8WA 3RMJA 5AC6A 4U3CA 1W1IE 4A8NA 4MFEA 2EF9A 3BCDA 3ATZA 3FDGA 1UWUA 4ZQCA 1WCGA 1EJ7L 1XRFA 5DO8A 3WDPP 1NSJA 4S38A 4O52A 3H2NA 1YIXA 3SECA 2VUNA 1BEUA 1Z6KA 4TTUA 1P1XA 1KXHA 4YTTA 1YE6A 4MNLA 3W25A 4L4PA 2JGQA 3TA6A 3NEHA 3BCFA 2XSAA 3TOPA 1W2VA 2C1IA 2QF7A 2J79A 4ZO6A 1X1ZA 4RDYA 5TQLA 4Q8VA 3O05A 1OWQA 3WSUA 4Z17A 1XIHA 5FEZA 1PS9A 2CLHA 4UXDA 3W02A 1T96A 2OT0A 3HPSA 5EMUA 3OOQA 1L6SA 2RDTA 5A8PA 3W73A 2QV5A 1ECQA 3PG9A 4YCOA 4O28A 4AWEA 1H09A 4ROQA 2YL8A 2Y0FA 1M7OA 1XQLA 1XC6A 3VD3A 2AKMA 5BRQA 2YDRA 3A9IA 3OA3A 1MDRA 2NSOA 3B0UX 1FX6A 1ZL1A 4DEFA 2VFIA 3G1RA 3DBPA 2FZBA 5D9OA 1JZ2A 3W87A 1OFPA 3QJAA 1BLIA 1XLIA 4FP1A 4Z2IA 5DX7A 1PTAA 1TPVA 4WSKA 2WHJA 4IXXA 1BYDA 1OF6A 1OIMA 3IJ7A 4AZ5A 3FY1A 1IGWA 5FL1A 4CNUA 4QE5A 3N04A 4DY1A 4PTXA 4RE4A 1L8PA 1F8MA 4JQ1A 4V1XA 3LB0A 2FPYA 4W84A 3TLQA 1JCTA 4QRNA 5M1TA 2W61A 1LOSA 4AZIA 1T5AA 3K46A 3AROA 4WX2A 4WOQA 5IHSA 4RUBA 3UW6A 2XN1A 4NZJA 1FWSA 2DT0A 3O6DA 2X1UA 4WZHA 1L2QA 3VX0A 2GVLA 1QOXA 2CLPA 3H70A 4JX4A 4JY9A 3WZ0E 3BXWA 2OYKA 3ITVA 3G1YA 4JQ4A 1Z9AA 3OVRA 3DYOA 1SO6A 2WVVB 2ZUTA 4E2VA 5DANA 4S3CA 3THUA 3TCEA 4IJRA 3VKKA 5IBXA 2OGYA 1SZRA 4LS2A 5H1WA 1NAL1 1TKKA 4MNKA 2JEPA 1PSCA 2IXVA 4BFAA 3MUAA 1TV7A 4AVOA 4ADUA 3DFTA 1LWJA 4R88A 4MKVA 3EGJA 1TA3A 2VMFA 4QR6A 4Z1CA 1S5MA 1I60A 3VFLA 1WXJA 2ZXAA 1JGMA 5BXRA 3TTEA 3OIHA 2PDNA 1EDGA 3VKAA 2DZAA 3MQTA 3UR5A 3VOFA 1RVKA 4TV6A 4YTQA 1PUDA 2QUUA 1RD5A 2R82A 2V2CA 2C0HA 2GK1A 4YCPA 2ZA1A 3W9ZA 1KLYA 2VR2A 1BYAA 4MYXA 5I2UA 2V67A 4LY4A 5AC4A 3ENLA 4ZQOA 1GZJA 4NILA 2FDSA 1LBLA 2QIIA 2O7QA 4Z2GA 3KL3A 1V3MA 3EEGA 5CJNA 2PDCA 4D6EA 2P53A 3B97A 7PTDA 2GJLA 4D6GA 3ITYA 4HVXA 4IXHA 3OLIA 3DUGA 1G7VA 2GVGA 4DF0A 4UCFA 3IIXA 4ZE5A 3VGHA 3RPDA 2DJLA 1XDLA 4LBSA 4FOUA 4G1KA 1M9HA 4ZQPA 1RVGA 3CIWA 1WKYA 3S6TA 1TR1A 1KFJA 1VAHA 2YB4A 4Z0JA 4ZMGA 3S6OA 2W6RA 3DKJA 3FOKA 3BLKA 2Q8XA 3S83A 4L80A 4JTTA 1WDSA 2WC7A 4GABA 1KM3A 4GFSA 4GOAA 1TMQA 2XWEA 4C6KA 1DWAM 3CU2A 1RLDA 2OU4A 2FJKA 3DFQA 1R7AA 5FCZA 4Q4SA 3A47A 3ECQA 3WQCA 5AYIA 2V30A 4XUYA 3NJ3A 1QI2A 2DY3A 3MV01 4JNYA 3NG3A 5CJ5A 5JU6A 1KXQA 1I6NA 3QV9A 1R8LA 4NX5A 4E5TA 2AQOA 4Q33A 4GQQA 1NFGA 2Z00A 3BTNA 2WOQA 1VFUA 1MZRA 1S3HA 4GRSA 1W37A 1P0NA 3AOFA 1GZGA 4G7EB 3VYLA 2BXYA 1RH9A 1R2TA 4FXFA 2VD9A 1KM5A 1L6WA 1M01A 2BSLA 2D23A 4L65A 2P0OA 3W84A 4DJEA 2XSBA 1FH7A 3WX7A 5T9CE 3C0SA 5B80A 1XF0A 2JBMA 2RJGA 4B91A 3L4ZA 5DMNA 3WDRA 1JXKA 3T78A 2GGIA 3LERA 3PFRA 4AX6A 3LA4A 3BMWA 2OKTA 3IGSA 4PEEA 3NQ8A 3W7GA 2C6QA 3GH5A 1JCLA 4H7ZA 2VGBA 5DT5A 1M65A 4LCRA 4CN4A 1BPLB 2A4AA 2CZEA 3K13A 1J8VA 3PULA 1YQ2A 1WZLA 4KGLA 3SRHA 2PGFA 4LC8A 4QFUA 5EMMA 2J7CA 3MVTA 2J25A 2VFDA 4I8DA 2F61A 7TAAA 3UZ5A 1MRAA 3OQEA 1DJGA 3P0WA 3W1QA 2XM1A 5E70A 4OUIA 3WMCA 4AF0A 1VFOA 3L4VA 3WUFA 2ZA2A 3CBWA 2PDWA 3LI0A 4D6JA 5KTLA 3GVQA 3WH6A 3IJLA 3APGA 1ITCA 4YHGA 1NJJA 4WJ8A 5F4XA 1C9WA 2BXZA 5A2CA 5LHFA 4UZUA 3NIYA 2JQXA 3TYZA 1PDYA 2YCLB 1YW1A 2CHOA 3SCTA 1S5TA 1WYIA 2OTDA 3STPA 1XIIA 3O9NA 4DJFC 2X1TA 2J7HA 3UG4A 2P88A 3QPEA 1FRBA 1OGSA 3TOYA 1JZ7A 4P7OA 3NQ6A 3L21A 4IP7A 3EB4A 1A5NC 5IOBA 1A3WA 1NP0A 4AHQA 2GDUA 4LVAA 2ATMA 1PHQA 5CQ1A 6XIAA 4X60A 2H8ZA 1Q63A 3OVQA 4C6FA 4DQWA 5D4YA 1EJSC 3T0CA 1RP8A 4MUPA 1FWRA 4IIGA 3TTOA 2AGTA 3B8SA 2WVUA 3NM1A 1RBLA 5I24A 5EMLA 3V0SA 3E0LA 3B0PA 4PA8A 5AN7A 2PS2A 3JW7A 3OLDA 4J7RA 3WDIA 1BG9A 1ZGDA 4QHRA 4XISA 3DESA 3T42A 2OZ8A 1AQ0A 2DSWA 4OJYA 5LGZA 2WKGA 2WSYA 2HK0A 2J9XA 1ECEA 1G4EA 5H8PA 4ZOAA 4O15A 4P7NA 5LIXX 2O4QA 1LG2A 5D2YA 1ONEA 4M19A 1V93A 2ZUVA 4NI8A 1ICPA 3B8VA 5EYWA 3PTMA 3FEQA 2E77A 3RILA 2QPSA 1YHTA 4QS6A 1W1A1 1EC9A 3WBEA 2X1SA 3GNOA 3SGUA 4EPKA 1CECA 1S2AA 3VDCA 4J3ZA 3EWUA 2YL9A 4IIFA 1HKVA 3M7WA 3OBEA 4IQJA 1C7TA 3O0FA 1W1TA 4OV4A 5C9ZA 1U2YA 5I3DA 3VD9A 4LV9A 1XLEA 5HR7A 3VNJA 2DZXA 1H1ZA 2YYUA 3UZJA 4AHPA 2PDGA 4GIYA 4WGXA 5H8MA 3U8GA 2PF0A 2PZ0A 4QLLA 4LRSA 4PMOA 1J5SA 3AS2A 1Z8AA 4KETA 3PZVA 1O5KA 4JTEA 4XVEA 2PLCA 2DU2A 4US6A 4ZSTA 3CV7A 3ES7A 1JIBA 1N8WA 1VYRA 4AWSA 4H8HA 3VKCA 4F8XA 5AVNA 1BWVA 2DH2A 1J6OA 3RXZA 3O07A 1B30A 3VIIA 4CLMA 3ZQ9A 1JF5A 1SR9A 2DSKA 2ZUSA 4NL1A 2GSHA 1UR4A 3LNMA 3RJYA 4DBWA 1GQNA 3FK4A 1X1OA 2RDUA 2J7FA 3EX4A 5A8GA 4NXSA 1KTCA 2ESCA 3R5EA 3PBYA 1GW9A 5EMKA 2X40A 2R94A 3FA5A 4XBSA 2J88A 4JPGA 9XIMA 4WVXA 2WMIB 2EAWA 1U5VA 2WCSA 1AG1O 3LCGA 3I4EA 3MP3A 2WSQA 3IK4A 2QYGA 2X30A 3OU8A 3GFZA 1G1YA 2E68A 5IHRA 3M0YA 3WMBA 4IIEA 3LQGA 1B90A 1Q4NX 4ADSA 3BW3A 5ABFA 1A50A 2POTA 3K5XA 5FD0A 3ITLA 3ZLFA 1UPPA 3GTFA 3PZGA 2NLIA 2CHRA 2C7FA 2FGLA 1O5XA 3ZJ8A 4K7VA 3QY8A 3MWCA 5G4EA 4LF2A 1S1PA 3K8MA 2PBOA 2QCNA 4NJHA 3T1GA 1E0XA 4HP5A 3VZYA 1BAGA 3DKLA 4UWMA 1B0IA 3BLEA 4PH6A 1XSIA 1DJQA 2WZEA 4QSHA 2XISA 2QJNA 1W5MA 1XLCA 1KR1A 5A8OA 1B3XA 3LUTA 4ZOCA 1WPCA 3EOEA 3WH5A 2NQ9A 4JIPA 3IAPA 1FHVA 3PSWA 1KQYA 2VYOA 3G1FA 1ZBKA 4Q4OA 3UY7A 1HZYA 4FLRA 3BSMA 1U5HA 3PTKA 3ZZ1A 4BKNA 1P1MA 2AGKA 2BTMA 1B3WA 1Q7MA 1GOXA 1REQA 3C2YA 1PWMA 4ZODA 5BYWA 1SW0A 1TR9A 3H26A 4ZB2A 3HA1A 1KC7A 4C6QA 1FKWA 3PWAA 1RJPA 4GXPA 3FIGA 4O1AA 5I7GA 3LI1A 1F61A 3A4WA 3TN3A 4GLEA 4NZ3A 2AOSA 1K9TA 3NVTA 1H4PA 3TR9A 4B9YA 3U2OA 5A6KA 2LLEA 1XWYA 3ARUA 4NASA 4EP8C 4KWUA 3ZR4A 4C6OA 1T40A 4Z1DA 4ZXLA 2PWHA 1WA3A 4U3AA 1RAKA 3QQ0A 2WHLA 4OGZA 4X9YA 4WF7A 1PIGA 4C6LA 1QOPA 3SCNA 3VINA 3WF3A 3I3EA 5CC7A 1AZ1A 4MSSA 2WHMA 3N18A 3T2PA 3URBA 1N8IA 1XIEA 2BV9A 3VNZA 1RA5A 4J3XA 3C2OA 3DG6A 5C54A 3NDZA 2QCHA 1RALA 1WX0A 3H22A 3OYZA 7TIMA 3L4UA 3IGXA 5EBUA 1PZ3A 5G1TA 4E8CA 3AXIA 3P14A 3NSNA 3UWYA 2QQ6A 2Q8ZA 1ZAHA 2YPIA 2WM0A 4Q8QA 4AMCA 2ZC1A 3LRLA 2ASHA 2PD9A 3TLLA 1GVQA 1QO5A 3S47A 3UU0A 3FA3A 3NQVA 4A6GA 1WKFA 1G94A 3W7KA 1ZJAA 1U30A 3VNKA 3CUJA 3E5BA 3INPA 3FYPA 5HDRA 3UVIA 4UMAA 5HOSA 5F2GA 4PB4A 3E1F1 1E1EA 5DQPA 1BYBA 1DYSA 2NLYA 3A64A 2YX0A 1JL8A 2JF6A 4GA8A 2XVGA 1R85A 2WMFA 4PUDA 3RO6A 4HNUA 5LNVA 1BTMA 3UCDA 3NPUA 3NCOA 3KWXA 1K9EA 2XYLA 3VNMA 3BV4A 5HAOA 3V36A 4AVFA 3BLLA 3GH7A 4LYQA 7A3HA 2FH8A 3E5PA 4HU0A 1Q3NA 2Q3RA 4AAJA 2Z6JA 1KFLA 1R30A 3FXYA 2WB5A 4UOQA 1T99A 2EPOA 3AC0A 4ERAA 4ENLA 4GJIA 2PLKA 1CGUA 1KM2A 4BEUA 4NAFB 2WNZA 2YB1A 4WCJA 3PG8A 1XH0A 1UZ1A 5E5CA 4CNSA 1PB0A 1JVNA 3S1XA 1QDSA 4F0LA 2JKPA 1EDQA 2A0NA 3GKFA 1J0JA 1VJSA 4Y9MA 2C71A 3DN5A 2WJEA 2I56A 3KOXA 3IUHA 1GEHA 2VT0A 3AXKA 1EXBA 3GRIA 4R27A 3ZT7A 2E6DA 4BQ2A 3CQKA 2IKGA 1KM0A 4I9MA 2ZFAA 1ME7A 2C0AA 4NG3A 4ZL1A 3VDHA 4LUIA 2E8ZA 1R3RA 1Y5WA 6ENLA 1LROA 1ZAIA 4B5NA 1GJWA 1F4AA 2D2HA 3CJPA 2PC8A 2F2KA 4OOUA 1WDDA 1WAUA 4PMRA 3TN5A 1W9BM 4DJFD 2XJ7A 4LPCA 2OMAA 4AD0A 3MHFA 3AU6A 1DEDA 2YBTA 3CT2A 4B90A 4X0VA 4DJED 4QJ3B 3T08A 3W2LA 2WLYA 5LZLA 3PZUA 3ZFHA 3PZ9A 4KRUA 4GMEA 3S5YA 1LOLA 4R3UA 3DGRA 1O6IA 3E6EA 2XDFA 2CXEA 3G0SA 3QOMA 3GD6A 1Q45A 1QUMA 2G3IA 3T44A 1E70M 4E2DA 4FA3A 3K1GA 2Z1BA 4B2DD 1WAWA 4MJ2A 1VH7A 1A5KC 5CJMA 1TV4A 5CZKA 3V5FA 1E71M 2ZVRA 4MNJA 2YKKA 4JYFA 1DQWA 1YLVA 4H9YA 3PN8A 3N25A 3BOLA 1QI5A 2BGNE 3VC5A 3KVMA 1C9DA 4DO6A 1JPKA 4X0NA 1MVYA 2DZSA 2E5DA 2CERA 5HMDA 1KLZA 2V5LA 3QFEA 3PP7A 1B9BA 3T4WA 1K4GA 3GH4A 2OXNA 2VCAA 5IFPA 3CZLA 3EKLA 1WZKA 3EWBX 4JIEA 4W7UA 5G5IA 1WOAA 4O8AA 2W27A 3A5FA 1BF6A 4YYFA 3K1DA 1JZ8A 1K77A 5CC5A 2NQLA 3GM8A 3QKZA 4RXGA 5A1AA 4F0MA 3IIVA 3UZZA 4FK9A 4UTUA 1O60A 2QZRA 1ODZA 1FWTA 2Y5JA 3BCJA 2GGEA 2AL2B 1X8FA 3EZ4A 3U57A 2QCDB 3WL1A 3CNYA 3VVGA 3V0UA 3CASA 2WNWA 3KOWA 4JTGA 2ISVA 1FCUA 3HFYA 4AG0A 2FDMA 4WY0A 1KQZA 1JZ6A 4DUVA 1Q8JA 1K1DA 4AFYA 1GJPA 2PTXA 5E9AA 2AMGA 4P8VA 3WDQA 2X09A 4F3HA 1XKYA 3BZJA 2DIJA 4DO5A 4C6JA 3CC1A 3WCZA 5FL0A 4CQDA 5LA1A 5I78A 2P8CA 3W70A 5CGMA 1VB9A 1DL3A 3L7RA 2XIJA 3GFYA 4ICNA 1HF6A 3CEPA 1FWCC 3QQWA 2DSZA 4AIUA 4TVDA 4I90A 4Y90A 1BXNA 4HSOA 2GQ8A 4M6VA 4DI8A 3ZT5A 4OKDA 1POJA 3L4XA 4PBEA 2PCQA 4UNKA 3PWIA 2JFEX 4JS3A 1DJZA 3VOHA 3U6WA 1H11A 4Q8MA 3JR2A 5G1MA 1TWDA 4HOZA 3ZLHA 5BOFA 5DLCA 3W81A 4E0CA 1BXCA 1I4NA 4O4VA 3T09A 1S3TC 1UIPA 3AZTA 3R11A 4C90A 4AB4A 6XIMA 2ZX7A 4KBXA 1TFVA 3P62A 3AIQA 2XH0A 3NPVA 2ZA3A 2QMKA 4PRTA 4AY1A 3WNMA 2J4GA 3WLLA 3N4AA 1UR1A 3W7RA 1AD4A 1H0IA 3TWAA 4YN5A 4DNMA 3TTQA 1EJTC 3L65A 1YPFA 3VU2A 4XZNX 1GYLA 4CCCA 3VIOA 3WUBA 4OECA 4DZHA 3DHFA 4LNYA 3B04A 5EFFA 3BMVA 4JXCA 1ZJBA 2XHYA 3NUKA 2XUCA 1XBXA 4UR8A 3UJSA 4O50A 2G5WA 3KP0A 3GTXA 1GVRA 5HK4A 3ARXA 4JIIX 5D04C 4AZGA 2ZUNA 4K6AA 3SBFA 3MTWA 1E4LA 1IWAA 1YEYA 1CGVA 3ABQA 3RU6A 2OOGA 4JYDA 1B2YA 3GNXA 3VDBA 3AO0A 3UNDA 2WXDM 3KHDA 1WUEA 4ZR8A 1GT8A 1F6PA 1YYAA 4E2OA 3PUDA 3THQA 4QSFA 5JH2A 2ZIDA 4GZ7A 2YFNA 3HG5A 4NJIA 4HMEA 3WIJA 2FQIA 3AQUA 1B54A 4FPSA 4QEHA 1PJ9A 1CTNA 4PYSA 1G69A 4GKTA 3QMSA 3TE9A 5MKGB 2IKIA 5HUOA 4Q4MA 2QPUA 3ZO9A 1CYGA 3V4BA 4RZ6A 4XTDA 4H41A 2B7PA 5G2HA 3M0LA 4S23A 1ML1A 4KCWA 4TIMA 2PD5A 4O1CA 2X2GA 1S5NA 1J2BA 3LHUA 3LHZA 2GQ9A 1W2PA 3KZPA 3GUWA 4JTUA 2WQDA 4RX0A 1X7FA 5A94A 2CZFA 4GO9A 1SMAA 2GLKA 4YTRA 1KM1A 3UBPC 1V6TA 4NNBA 2EG6A 4TMBA 3ABXA 5DF0A 3MCNA 3HG2A 1B5TA 5CZJA 4HOXA 1UHVA 1HKJA 3C3UA 2PDJA 4MG4A 1AFSA 3QR1A 3CZ8A 3N9KA 3WO8A 3KCOA 2HCVA 4DWSD 4LJ3A 5A95A 4EWND 5CSRA 1X97A 1R3QA 3FDKA 4G5DA 1LL6A 4IUGA 3MV11 3M0ZA 2VENA 3GG1A 1S2UA 1XH1A 5D05A 5D2TA 5ABEA 4Y8EA 1S2TA 1F8IA 3P0XA 1IT0A 1EWEA 2PWDA 4H4IA 1BKHA 4F79A 2ZZ3A 4DF1A 5K4ZA 3ZSSA 2Q71A 1XINA 4UUIA 4PTVA 2OQLA 1E5JA 4WDXA 4DUOA 1LLZA 4MKNA 2FIQA 2OJPA 4L1XA 3IAQA 4A3UA 5I3FA 3ITOA 1R2SA 4JHMA 2R1KA 3A4JA 1J0IA 1G4TA 1UG6A 3BC9A 3E3HA 1K8CA 5XINA 1QVBA 4KGJA 2E4TA 1EEPA 1A4MA 2VDHA 1ZB5A 5C8BB 4PUEA 4ZENA 4PMJA 1DWGM 3THDA 1V6UA 2FZ8A 4JTIA 3CHEA 4JY8A 1NIUA 3E0FA 5JBEA 3O6YX 1A4LA 5D2XA 2GGHA 4AD5A 4KF1A 3PTDA 3ABRA 2VEGA 4DO4A 3TSDA 3ZWSA 1PWLA 3GC2A 1CW2A 1QATA 4BJHA 3TROA 4ZFCA 2FVKA 4Z1AA 1CXIA 5FSDC 3EDEA 1RCQA 1A3XA 1TVNA 1WV2A 4IG2B 2ZUMA 4AISA 4JTJA 1XV8A 3HQ1A 3NQ2A 1TTQA 3TWBA 3IUDA 4TX8A 3STCA 1QNRA 3SY8A 5KEZA 2ZRUA 2X05A 3B9AA 3PB0A 3KRUA 5T91A 3H7RA 4YWSA 4IJCA 2GK1B 1NVMA 3TEVA 2YSWA 1UJQA 4HA3A 4X61A 2BG5A 1RXOB 4QJ4B 4WSJA 4P61A 1K03A 2G95A 5TIMA 3TNOA 4PMYA 4O54A 1I2NA 3BVJA 3WDHA 1DXIA 3QTPA 4TTGA 3I65A 1PX4A 4C60A 4EK7A 1WUFA 2EGZA 3BE7A 3AWNA 4PL2A 1OCNA 4D71A 3STEA 3G77A 4I3GA 1JYNA 4C6PA 2BMBA 2J78A 3WQPA 4OQVA 1R86A 4HMNA 3EXTA 2C15A 1ADDA 3QV6A 3AXMA 3ZR5A 3QGKC 2BVDA 2CLKA 1XKJA 1EOMA 5D38A 2OYMA 1PDZA 4RJEA 4C6IA 4LAKA 3L2LA 2O9RA 1QK0A 4AZ6A 1GKPA 2HPIA 1MXDA 2X8RA 1IGSA 4L9XA 1LYXA 5D8ZA 1FDZA 4HGXA 4MY9A 3FKKA 1GG0A 1BWKA 5GJNA 1U83A 4EANA 1W3HA 4WXYA 1XYMA 2Z26A 1WB0A 4HYVA 1L6GA 1RD6A 3GQYA 1R5YA 1QO2A 3AICA 1OM0A 3R10A 1F9CA 4MTVA 4Q32A 3ZIZA 1DORA 5IM51 1BVWA 2FKPA 3HF3A 1RJQA 5BW6A 1V6VA 4GUJA 2OG9A 4F2UA 2X1RA 3FW6A 3AXXA 2Y2WA 4AWUA 4JFTA 1O5RA 1TE1A 1XQKA 3HZ3A 1CLXA 5HWMA 1ZHAA 5DCEA 5BOEA 3OA5A 3CEUA 4I6KA 3GK0A 4H83A 2E3ZA 1HGYA 3QGAC 1EP1A 5IBXC 2YCJA 2O7SA 2UY4A 1VFTA 5BROA 1SJBA 3LPFA 2AQWA 3I68A 4IF2A 4WHBA 5BMXA 4AC1X 2WKJA 5AC8A 3USZA 1GOQA 1HJVA 3R0DA 5REQA 1VBUA 3UXAA 3BOXA 2O55A 4PR4A 1VFHA 2VGGA 4YYCA 3M07A 4ASTA 3PBUA 5A5WA 3DIPA 3TC3A 4NNAA 1UWTA 1CX9A 5AHLA 1OHLA 4ZQMA 4HIBA 1OFOA 1EGMA 3IJIA 3AIRA 4PUKA 4YIWA 2EXOA 1ZPTA 5E93A 3EDDA 1E72M 1XM3A 2TAAA 4W86A 4GACA 5XIAA 2YLLA 4NY2A 2FLIA 4IFKB 1QHOA 4H00A 1XDJA 4MPQA 3F4VA 4CQBA 4MB5A 4HK5A 2ZYFA 1J5TA 1V7YA 1EIXA 4O57A 4LSBA 5LXXA 1E4MM 2QVNA 4ADTA 2QS8A 4LB3A 2V3EA 4FLSA 4GNJA 3MJYA 1CXFA 4DXVA 3T8QA 4X2PA 3FXGA 2HZGA 4UTWC 4XKYA 4PUWA 1ISVA 4A05A 1RA0A 3ZJ6A 3AS3A 4CD6A 3ARTA 1E56A 3MHGA 1JYWA 2OODA 2B4GA 3AJXA 2I57A 3SQSA 2PU1A 5GNXA 2HE5A 4K39A 1T0OA 1FWAC 4XBJA 4DI9A 2V82A 1O1ZA 1JQXA 3G1VA 3MP5A 4JBRA 1Z32X 3BLOA 1FUYA 5HMFA 4AD1A 4C1KA 3KTXA 1HIZA 3A3XA 1OD8A 1MQRA 4H8VA 3E96A 1TCMA 4PMXA 4K38A 3NA8A 2FVMA 3V5OA 1NQ6A 4QCEA 2SFPA 7ODCA 1NF0A 2VCCA 1JUBA 4JQ2A 3LK6A 2HWGA 3WLKX 1W9DM 5TNVA 4DVOA 1IT7A 2P3EA 2PC4A 3QY6A 1KM6A 4H2CA 2EG7A 4HA4A 4KH2A 1YE4A 4ZCWA 1Y0EA 1FH9A 3RRXA 1CWYA 3AUJA 4HU8A 4AWTA 1D2KA 3W6LA 5AYXA 5ABGA 3UERA 3AHXA 2HVOA 4I9AA 1KTBA 4S3EA 2XU2A 4NHVA 4Z1YA 2FYMA 1LL7A 2A3BA 4ZO7A 1YX1A 4EXBA 4YWIA 2ZDSA 4YU1A 3VIHA 3EXRA 4MVAA 2KX9A 3S2NA 1JI2A 2I17A 2ZZ2A 1A3HA 2WO5A 3DECA 4K2SA 6PTDA 2VZSA 1S5VA 1MFUA 3ZVIA 1EO7A 1OFEA 1ITXA 1QASA 3W71A 3KRBA 3SW6A 2PDQA 4ROPA 4ZOEA 3KRZA 3S4TA 4XIAA 3FJNA 1VEMA 2ZCGA 1XBVA 1AD1A 1QNPA 1VFMA 3KFTA 1TJ0A 3LDVA 4W8BA 4NZ4A 4H7VA 3QHMA 3VDAA 4PMNA 1OT1A 1HL8A 1ZTVA 1XG3A 3QH2A 3I6RA 2W92A 3W53A 4FALA 3P82A 3UWUA 1VQTA 3S46A 4WDUA 4PCFA 1DWIM 2D22A 3UGVA 2ZRVA 4MOZA 4QNWA 1V4YA 3FJLA 4U5IA 4A3RA 2DZVA 1GVOA 2ODOA 3UZWA 4BHYA 2J8TA 4C5YA 4PEKA 1GKRA 1UYQA 4US5D 1ITQA 1JYVA 4C6BA 2VM8A 1VJIA 2GQ3A 3U2CA 4CQAA 4AF0B 5DRIA 3BG9A 4QDWA 4D6DA 2XIOA 3ARYA 4U5KA 4FXJA 2AAAA 1Q2RA 4O0ZA 3CO8A 3NQGA 3EWCA 5G2IA 3M46A 3TH6A 3IV8A 3CHDA 4ZVJA 4AD3A 3NYDA 2V63A 2XIQA 1QI0A 3A3WA 4FMVA 3VABA 3WD2A 4UR7A 3MUCA 5AECA 2J8GA 2X16A 5HXMA 5LSMA 5AHFA 1NARA 2F7FA 3A21A 1UR9A 1RY0A 2VFEA 3H6OA 4C91A 5D9NA 2G37A 4MWAC 3LTYA 1FHLA 3RHGA 4XAPA 3SUTA 4J3UA 1DTNA 1G9HA 1GOMA 1UR3M 3N15A 3WQWA 3OBAA 5ABHA 5C2XA 4U10A 2G96A 4GQGA 3KE0A 4IIDA 3ARRA 2V5CA 2VHLA 1NWTA 3VC6A 1AA1B 3V18A 3EOSA 4C5ZA 5HNRA 5SWUA 5I77A 4OIFA 4XAZA 3G1HA 3W0KA 3GU9A 4MJMA 3U2EA 4J9JA 3C86A 4JR5A 3EDKA 4QM1A 2PURA 4REQA 3MPGA 2IMRA 3UWVA 2XN2A 3UQNA 1J10A 2WZTA 2Y1HA 4DBUA 4IT1A 3MANA 2W0UA 4ATDA 1YXCA 1V5XA 2CLOA 5I3GA 2OZ3A 3UG3A 3OQ8A 3T07A 5XIMA 1W32A 1TPC1 5E6YA 3OB8A 3D3FA 5FA5A 3FSTA 3DGBA 1NDYA 1REQB 5H91A 2V3DA 3MBFA 3TIMA 3FA4A 5JBFA 4IOTA 3QQ1A 5TBOA 2DZPA 3CUIA 3L23A 1ZFJA 5DCDA 4Q8NA 1WBJA 4WLCA 4UQBA 1EBHA 2F6UA 1ALDA 5DBTA 3WKZA 3G3DA 1AW1A 3CQHA 4UQCA 3IANA 4O8RA 5HQLA 4OTKA 4DPQA 5E0KA 5LIKX 2E1DA 1MNZA 1T7LA 1X98A 3H2CA 3II1A 4D2JA 3N6QA 4N4PA 1TJPA 5D2WA 1E6RA 4EWJA 3A12A 2G0WA 1PCKA 4AZHA 4OFCA 3N2XA 4H9XA 3D47A 2ATSA 1A80A 4G7EA 2WC3A 4Q6JA 3CV6A 1GHSA 1XLMA 3N4EA 3W7CA 6REQA 3LCIA 1VP5A 4HCHA 1FQ0A 1H62A 3ZYZA 1QU4A 3PAOA 2Z2BA 3WENA 3VPLA 4A8IA 1XDMA 4DRSA 3A4XA 3R58A 3QN3A 5CBJA 1H1NA 2A79A 4M8UA 2YCEA 3V1HA 4ZO8A 3BG5A 2VX7A 1UH2A 2ZRYA 4KIEA 4S3DA 3NQEA 1BFNA 3DI1A 6CGTA 4AZ7A 4JN8A 1FWBC 3AYVA 3I4KA 1TQXA 2EQDA 4JFWA 1JRBA 2VZTA 3SUSA 2XIIA 3MUIA 4MDOA 3KLLA 2BZNA 1TE6A 3CS2A 3HOJA 3DEQA 4N9EA 4DM1A 1QI3A 1KFCA 2D0FA 3BQ6A 5FJTA 3G8EA 4EAMA 4KWVA 5AC5A 1C8XA 2C91A 3SRKA 2UY3A 1VJZA 1V3KA 4GZJA 5F1VA 4QGCA 3CUFA 4D8ZA 5LNUA 2CZ5A 3UFYA 1SO5A 4NI3A 4UFMA 1CIUA 4GIAA 2RKXA 4B5SA 1LLOA 3BH4A 1VPQA 2YFOA 2DW7A 1TPWA 2GJNA 3AYRA 1NDWA 1W3IA 5AHNA 4R85A 5A8QA 3S2LA 4A2RA 2IXUA 3D0CA 2PTYA 2Y24A 2OELA 2PWEA 1A53A 3THCA 4NSBA 4A4AA 1P6WA 3WD4A 4I8YA 3LCHA 3HMCA 1D3HA 3AIEA 3BLPX 3WEMA 3WYZA 4AZCA 1J0YA 1VHNA 4DWSB 5KITA 4JYEA 3CMFA 5TF0A 1OJXA 4NYYA 4ZOBA 1DJNA 3TUUA 4AIBA 1TWZA 3SN1A 2DVTA 5I07A 2F84A 3VIPA 3KXQA 1L2UA 3RF9A 2J75A 3REQA 4KERA 4UBPC 5IDZA 4O1DA 3AIBA 4LYPA 2J27A 2VRJA 3MI6A 2V8ZA 1BQCA 4J27A 3I7SA 3H21A 3RLHA 2GWNA 1CEOA 1RCXB 2ZXDA 4YVXA 3W1XA 1LT8A 3H4XA 3PNZA 3DFHA 1X6NA 3VUPA 4AXNA 3MO7A 3U3HA 4TVCA 3MHUA 4D6HA 4PTWA 3QV7A 5HINA 1HJXA 1J9YA 1NM9A 5HULA 3TJLA 1V03A 5A6LA 3TYBA 4DLMA 1LOQA 3GU1A 2PGEA 1F4HA 3R1ZA 1LBMA 4A3QA 4JEJA 3S6DA 3WLSA 3GDLA 1P43A 2V6AA 2E7FA 3TYUA 5AB3A 4ACYA 3FX4A 1XD0A 3TZFA 5AYBA 5I23A 4IPPA 4CEUC 2YJQA 1OCBA 3B8IA 4L4LA 3S9IA 2RGLA 1GEQA 3N9RA 4GX8A 2YLAA 1GYNA 5DFAA 1H7WA 2FZ9A 3L4WA 1NELA 3E12A 5A8NA 3IJQA 5FOOA 1Y7VA 2D0GA 3R12A 3S1WA 1PPIA 1RQBA 4MNMA 4OUEA 2IPWA 2H3DA 3SGGA 3G6LA 4HZ6A 1WO2A 5HWJA 3W4RA 2GFTA 5CH9A 1SZNA 4JTQA 4FSAA 3WEOA 3PZIA 2EPNA 3NVDA 1IZCA 3KS5A 2NWSA 5E1QA 5GJPA 1IXNA 1J2WA 1XPYA 3IVSA 1KA9F 1A5AA 4MJZA 1Z7AA 1RR2A 1J93A 3VTRA 1HO1A 1S2VA 1WBHA 1JI1A 1MEIA 1HL2A 2RHGA 3URQA 2GDVA 5LIYX 4AY7A 1Q8AA 1S1RA 1HXJA 4M7SA 1W9PA 3VCRA 4XSLA 2J77A 4FNQA 3WFAA 4AY8A 2F6KA 3G0XA 3TA9A 3EA3A 3P61A 1UUMA 4LAMA 3KM8A 1H0GA 3M5ZA 2H9AB 3RLUA 4RNJA 1PKNA 4XUGA 1PEZA 3F2DA 2XFFA 3OG2A 3DHUA 5REQB 2QJGA 2OLAA 1DIEA 4H6RA 3QV8A 3WNKA 3BANA 2XINA 3GTNA 3NSXA 4N4QA 1VBRA 1KBLA 3OO2A 2DORA 2G4FA 5F7UA 3OVPA 3E2QA 3E2VA 1MEWA 2HBXA 1W56A 3NQCA 1SFSA 1UW9A 3OP2A 1Z48A 4RV3A 4HNLA 3UPMA 4X9SA 1EHAA 3OTRA 4D8LA 1W9UA 3WNOA 1HVXA 3ARQA 2BNJA 3ES8A 4HN8A 4LOCA 3AHTA 3R8GA 4CD5A 2YW4A 4LV4A 4BA0A 3AS1A 1C91A 2DQWA 4A3HA 2YW3A 3B9OA 1R2RA 4QE4A 3A4AA 1DXEA 4L1WA 4HPHA 4JKLA 4MUZA 4W5UA 2XM2A 1UWSA 3I3BA 4X3ZA 5F4SA 4H6KA 3AMCA 2G3JA 4DB7A 4W85A 2CLFA 1K8XA 3ZOAA 1PX8A 3LLDA 4MKSA 5C0QA 3N3MA 5C7VA 1NP2A 4I7UA 3WUEA 3W82A 1CZ1A 2G3MA 4HKPA 3AMDA 2ONEA 3ANYA 3K4DA 4HYRA 5L6UA 5BWAA 5C2GA 3ITCA 4JZ5A 2CYGA 3W72A 1VR6A 5I5RA 1LUCA 4DNHA 3P5ZA 4J1OA 3KOFA 1F3XA 3O7UA 1VCVA 4JIHA 4M6UA 3DYPA 2GJXA 2V5BA 4EXAA 2C14A 4B16A 1QNSA 3DENA 5I09A 5ECUA 1VRXA 1FWGC 3UYIA 4GYPC 2C13A 3TV8A 2Z2UA 1MQQA 3FS2A 3GHUA 3AZSA 5CPSA 4KESA 3LBMA 2QCLA 3V16A 3KW3A 3SGZA 1FWEC 3VFCA 4KWSA 5KZMA 2W62A 3UD6A 4QITA 4H9MA 3EWWA 1XIFA 2BX7A 4IMGA 1DHPA 3O63A 2BOFX 3CUGA 4J2MA 2TPSA 4PSRA 1Q66A 2FHFA 1ISWA 4UFHA 1O4UA 3LEPA 3TU9A 4Q7BA 2Y8KA 3CH9A 4GIRA 3LSCA 4JTRA 1ZS2A 3VNIA 4JQAA 1C92A 3TYCA 2HDJA 4BQ5A 3L2IA 4C6DA 1CLKA 1FXQA 1K6AA 1NWRA 3NOYA 2TRSA 4JGDA 1G01A 3RNDA 4QTGA 4Y2WA 3T2OA 1OGBA 1EQCA 3AHVA 5I0DA 3PM6A 4PUUA 4JHOA 2DZUA 3GXFA 4EPEC 1LQAA 3GLCA 4DLFA 4O14A 1CGYA 5CBIA 4F66A 5CG0A 3AYTA 2YL5A 4LC6A 3FGCB 2X7WA 4E3VA 1DIDA 2OOFA 1UA7A 5C9XA 1DOSA 3TTYA 4QS5A 1QNVA 1TREA 3VDGA 3G2GA 2L5HA 3MCOA 5FJRA 1ZU8A 3H2MA 4XZMX 4AIOA 3T6CA 3WH7A 2IQTA 3L5MA 3EYPA 4HT3A 3WLJA 2EHHA 1EXPA 5AHMA 2A3CA 3OLGA 2PP3A 2PDPA 3N12A 1JPMA 3BLIA 3S0CA 4WIWA 3BAYA 5ABFB 2Z1KA 5KINA 1Q6FA 4UTWA 3NZ1A 4V33A 4V2XA 3VCCA 1OC5A 3U48A 4KFOA 4N9CA 4O16A 2XVPA 2QUVA 3BDKA 5JMUA 1S2CA 2ISSA