4JQDA

Crystal structure of the restriction-modification controller protein c.csp231i ol operator complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMANRLAKVLKIPVSYLYTPEDDLAQIILTWNELNEQERKRINFYIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of DNA binding by C.Csp231I, a member of a novel class of R-M controller proteins regulating gene expression.
pubmed doi rcsb
source organism Citrobacter sp. rfl231
molecule tags Transcription/dna
molecule keywords Csp231I C protein
total genus 31
structure length 94
sequence length 94
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12844 HTH_19 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4jqdA00
1NEQA 2KZ8A 2CSFA 3IVPA 4OB4A 4NDWA 3BDNA 2AXVA 1X2LA 2AWIA 2KEIA 2WUSR 2GZUA 3BD1A 1UTXA 1UXCA 2LYKA 3B7HA 2KPJA 2OFYA 3HZIB 2LYPA 1PRVA 3FYMA 3KXAA 1YSEA 3CLCA 2LYSA 4MCTA 1RZRA 1HF0A 1LMB3 3G7DA 2AXZA 3JXBC 2O4AA 3QF3A 4IA8A 3DNVB 4PU7A 2R63A 4YARA 2O38A 3QWGA 4PU4C 1E3OC 2OR1L 1JFSA 3GN5B 2IU7A 1WIZA 3OP9A 4X4IA 1ZUGA 4MCXA 4PU8A 1LLIA 1R69A 1UXDA 2KEJA 3JXCL 1S7EA 1QQBA 4I6UA 1PNRA 1ZAYA 3OQOA 2PUGA 1RZRD 3F52A 4JCYA 2LYJA 2BNOA 4FBIA 2KEKA 2PUDA 3SCGA 1JFTA 1ZZ8A 1ZZCA 4YBAA 4YG4A 1WH6A 2A6CA 4Z5HA 3RZZA 4Z5DA 3ZHIA 4J1XA 2LYQA 1PRAA 2L49A 4X4BA 4PU3C 1DWKA 2PE5A 3KZ3A 2PUCA 2EWTA 2R1JL 3FYAA 3LFPA 3SCHA 1WETA 1DW9A 2IUOA 1ZZ6A 2BNNA 2L8NA 2XCJA 4F8DA 2MQKA 3QYXA 1ZPQA 4X4EA 2IVQA 1RIOA 2PUEA 1ZZBA 3D1NI 2BNMA 2JVLA 3PXPA 2XSDC 3F51A 3R1FA 3UFDA 1ZS4A 2PUAA 1RPEL 1QQAA 4X4CA 1Y7YA 2AUWA 3LISA 1VPWA 2ICTA 1ZZ7A 1ZZ9A 4JQDA 2B5AA 2XIUA 1QP7A 2LCVA 1CJGA 3JXDL 2PUBA 1XWRA 3QQ6A 2CROA 1GT0C 3ZHMA 4I8TA 4YG7B 4X4HA 1EFAA 1RZSA 1X57A 1JWLA 3L1PA 1CQTA 2IVGA 2EBYA 4Z59A 5K98B 3U3WA 1OCTC 1QPZA 3VK0A 3SCFA 4J1WA 1OSLA 1LCCA 3OQMA 1IC8A 3GBFA 2PUFA 2HINA 2ICPA 2WIUB 4JCXA 4IWRA 1AU7A 3OQNA 1BDHA 1B0NA 5A7LA 4IVZA 4Z58A 3ZKCA 1WH8A 3MLFA 3F6WA 4I6TA 1BDIA 4YG1A 3TRBA 2AW6A 2LYRA 2MEZA 3GN5A 2GRMA 2LYLA 4GQMA 4X4GA 2AXUA 2FJRA 1PRUA 4X4DA 2BJCA 1QP0A 2HSGA 3OMTA 2IVBA 3CECA 3CROL 4GHJA 2H8RA 4FN3A 4X4FA 1LQCA 1POUA 2PIJA 1QP4A 3BS3A 4Y42A 2PPXA 3KJXA 3O9XA 1PERL 4I6RA 2XI8A 1L1MA 3G5GA 3S8QA 2EF8A 1ADRA 2D5VA 2IV1A 3H5TA 2O49A 2XJ3A 1LCDA 4O8BA 1SQ8A 3FMYA 1O4XA 1JH9A 1ZVVA 1NERA 2GRLA 4Z5CA 1R63A 3EUSA 2JCGA 1Y9QA
chains in the Genus database with same CATH superfamily
4HRAA 3IVPA 1X2LA 2AWIA 3HZIB 2LYPA 3FYMA 1RZRA 4MCTA 3QOXA 3G7DA 2O4AA 3DNVB 4YARA 4PU4C 1E3OC 4MCXA 1LLIA 2HFZA 2KEJA 5DRYA 5DT2A 4FBIA 3A9ZA 2KEKA 1HQ1A 1MFQC 1ZZCA 2A6CA 3ZHIA 3GUUA 4X4BA 5DRTA 3KZ3A 2EWTA 3FYAA 3A9YA 3GZDA 3QYXA 3D1NI 3UFDA 3R1FA 4X4CA 2XIUA 2PXFA 2LCVA 1XWRA 4I8TA 1EFAA 1JWLA 4ER0A 2FFHA 4OBMA 2EBYA 4Z59A 3U3WA 3VK0A 3SCFA 1QZXA 3VWSA 1BDHA 4IVZA 5A7LA 1BDIA 3TRBA 2AW6A 4X4DA 5DTQA 2V3CC 2BJCA 3A9XA 3NXHA 3CECA 3CROL 1LQCA 1QP4A 1PERL 2XXAA 2XI8A 1L1MA 3S8QA 2D5VA 1QB2A 4O8BA 3FMYA 1O4XA 1ZVVA 2PXVA 3NZLA 2HCSA 1NEQA 2XXPA 2KEIA 2WUSR 3OWQA 1UXCA 3B7HA 3KL4A 3CLCA 2LYSA 4DE9A 1HF0A 1LMB3 3QF3A 4IA8A 2R63A 1JFSA 1WIZA 4PU8A 1R69A 1S7EA 4I6UA 2PXEA 4Q2JA 4ER7A 2PUDA 4YBAA 4YG4A 1WH6A 2JQEA 2LYQA 4EQZA 2L49A 4EKIA 1DULA 5DTRA 1WETA 2IUOA 2MQKA 1ZPQA 1ZZBA 2PUAA 3QOWA 3PXPA 2XSDC 1RPEL 3ZPXA 2AUWA 2LLWA 1ZZ9A 4JQDA 2PUBA 2CROA 3SX0A 4X4HA 1RZSA 3L1PA 3G0TA 2IVGA 1OCTC 1QPZA 3NDBB 4J1WA 1OSLA 3OQMA 2HINA 2WIUB 2ODRD 3UWPA 2PXUA 5GAGi 1B0NA 3ZKCA 3MLFA 4I6TA 1U2ZA 4X4GA 2AXUA 2FJRA 5GAHi 1QP0A 1POUA 3MEJA 2XJ3A 1JH9A 4Z5CA 1R63A 2PXBA 3EUSA 1Y9QA 2CSFA 4NDWA 3NROA 3BDNA 2AXVA 3BD1A 1UTXA 2KPJA 4EZIA 2OFYA 3SR4A 3KXAA 1YSEA 3JXBC 3QFIA 3GN5B 1UXDA 1QQBA 1PNRA 2PUGA 3OQOA 2LYJA 2BNOA 2VEOA 1JFTA 1ZZ8A 3R09A 3RZZA 4J1XA 3LQXA 4PU3C 1DWKA 2HCNA 2PUCA 3LFPA 4ER3A 4F8DA 4DE8A 4X4EA 1RIOA 2PUEA 2JVLA 5DTMA 3F51A 4WVLA 1QQAA 1Y7YA 1ZZ7A 3GZDC 1QP7A 2MXDA 3JXDL 2LLVA 3QQ6A 4ER5A 1GT0C 3ZHMA 4YG7B 2PXKA 5K98B 2PXQA 2PUFA 4JCXA 1AU7A 3M9LA 4ER6A 4Z58A 1WH8A 3OKZA 4GQMA 1PRUA 2HSGA 3GZCA 4X4FA 2PIJA 3O9XA 4Y42A 4I6RA 3G5GA 2IV1A 2O49A 3DM5A 1LCDA 2J7UA 1NERA 2GRLA 2M4HA 2KZ8A 4OB4A 4EK9A 2PXTA 2GZUA 2LYKA 1PRVA 2AXZA 4PU7A 2O38A 3QWGA 2YBDA 2OR1L 2IU7A 3OP9A 4X4IA 1ZUGA 4EKGA 3JXCL 1ZAYA 1RZRD 3F52A 4JCYA 3TEPA 3SCGA 4Z5HA 4Z5DA 1PRAA 2PE5A 2R1JL 3SCHA 1DW9A 1ZZ6A 2BNNA 2L8NA 2XCJA 5DSXA 2IVQA 1ZS4A 2BNMA 2L1PA 3LISA 1VPWA 2PXDA 2ICTA 5JUWA 2B5AA 3ME5A 3PE5A 1CJGA 3TFLA 1X57A 1CQTA 1IC8A 3GBFA 2ICPA 4IWRA 3OQNA 3F6WA 2PXPA 4YG1A 2LYRA 2MEZA 3GN5A 2GRMA 2LYLA 2XXQA 2J7WA 3OMTA 2IVBA 4GHJA 2PXLA 2H8RA 4FN3A 1NW3A 3TELA 3BS3A 2PPXA 3KJXA 2EF8A 1ADRA 3H5TA 1SQ8A 2LNMA 1LCCA 2JCGA
chains in the Genus database with same CATH topology
1NEQA 2KZ8A 2CSFA 3IVPA 4OB4A 4NDWA 3BDNA 2AXVA 1X2LA 2AWIA 2KEIA 2WUSR 2GZUA 3BD1A 1UTXA 1UXCA 2LYKA 3B7HA 2KPJA 2OFYA 3HZIB 2LYPA 1PRVA 3FYMA 3KXAA 1YSEA 3CLCA 2LYSA 4MCTA 1RZRA 1HF0A 1LMB3 3G7DA 2AXZA 3JXBC 2O4AA 3QF3A 4IA8A 3DNVB 4PU7A 2R63A 4YARA 2O38A 3QWGA 4PU4C 1E3OC 2OR1L 1JFSA 3GN5B 2IU7A 1WIZA 3OP9A 4X4IA 1ZUGA 4MCXA 4PU8A 1LLIA 1R69A 1UXDA 2KEJA 3JXCL 1S7EA 1QQBA 4I6UA 1PNRA 1ZAYA 3OQOA 2PUGA 1RZRD 3F52A 4JCYA 2LYJA 2BNOA 4FBIA 2KEKA 2PUDA 3SCGA 1JFTA 1ZZ8A 1ZZCA 4YBAA 4YG4A 1WH6A 2A6CA 4Z5HA 3RZZA 4Z5DA 3ZHIA 4J1XA 2LYQA 1PRAA 2L49A 4X4BA 4PU3C 1DWKA 2PE5A 3KZ3A 2PUCA 2EWTA 2R1JL 3FYAA 3LFPA 3SCHA 1WETA 1DW9A 2IUOA 1ZZ6A 2BNNA 2L8NA 2XCJA 4F8DA 2MQKA 3QYXA 1ZPQA 4X4EA 2IVQA 1RIOA 2PUEA 1ZZBA 3D1NI 2BNMA 2JVLA 3PXPA 2XSDC 3F51A 3R1FA 3UFDA 1ZS4A 2PUAA 1RPEL 1QQAA 4X4CA 1Y7YA 2AUWA 3LISA 1VPWA 2ICTA 1ZZ7A 1ZZ9A 4JQDA 2B5AA 2XIUA 1QP7A 2LCVA 1CJGA 3JXDL 2PUBA 1XWRA 3QQ6A 2CROA 1GT0C 3ZHMA 4I8TA 4YG7B 4X4HA 1EFAA 1RZSA 1X57A 1JWLA 3L1PA 1CQTA 2IVGA 2EBYA 4Z59A 5K98B 3U3WA 1OCTC 1QPZA 3VK0A 3SCFA 4J1WA 1OSLA 1LCCA 3OQMA 1IC8A 3GBFA 2PUFA 2HINA 2ICPA 2WIUB 4JCXA 4IWRA 1AU7A 3OQNA 1BDHA 1B0NA 5A7LA 4IVZA 4Z58A 3ZKCA 1WH8A 3MLFA 3F6WA 4I6TA 1BDIA 4YG1A 3TRBA 2AW6A 2LYRA 2MEZA 3GN5A 2GRMA 2LYLA 4GQMA 4X4GA 2AXUA 2FJRA 1PRUA 4X4DA 2BJCA 1QP0A 2HSGA 3OMTA 2IVBA 3CECA 3CROL 4GHJA 2H8RA 4FN3A 4X4FA 1LQCA 1POUA 2PIJA 1QP4A 3BS3A 4Y42A 2PPXA 3KJXA 3O9XA 1PERL 4I6RA 2XI8A 1L1MA 3G5GA 3S8QA 2EF8A 1ADRA 2D5VA 2IV1A 3H5TA 2O49A 2XJ3A 1LCDA 4O8BA 1SQ8A 3FMYA 1O4XA 1JH9A 1ZVVA 1NERA 2GRLA 4Z5CA 1R63A 3EUSA 2JCGA 1Y9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEQ A;  2KZ8 A;  2CSF A;  3IVP A;  4OB4 A;  4NDW A;  3BDN A;  2AXV A;  1X2L A;  2AWI A;  2KEI A;  2WUS R;  2GZU A;  3BD1 A;  1UTX A;  1UXC A;  2LYK A;  3B7H A;  2KPJ A;  2OFY A;  3HZI B;  2LYP A;  1PRV A;  3FYM A;  3KXA A;  1YSE A;  3CLC A;  2LYS A;  4MCT A;  1RZR A;  1HF0 A;  1LMB 3;  3G7D A;  2AXZ A;  3JXB C;  2O4A A;  3QF3 A;  4IA8 A;  3DNV B;  4PU7 A;  2R63 A;  4YAR A;  2O38 A;  3QWG A;  4PU4 C;  1E3O C;  2OR1 L;  1JFS A;  3GN5 B;  2IU7 A;  1WIZ A;  3OP9 A;  4X4I A;  1ZUG A;  4MCX A;  4PU8 A;  1LLI A;  1R69 A;  1UXD A;  2KEJ A;  3JXC L;  1S7E A;  1QQB A;  4I6U A;  1PNR A;  1ZAY A;  3OQO A;  2PUG A;  1RZR D;  3F52 A;  4JCY A;  2LYJ A;  2BNO A;  4FBI A;  2KEK A;  2PUD A;  3SCG A;  1JFT A;  1ZZ8 A;  1ZZC A;  4YBA A;  4YG4 A;  1WH6 A;  2A6C A;  4Z5H A;  3RZZ A;  4Z5D A;  3ZHI A;  4J1X A;  2LYQ A;  1PRA A;  2L49 A;  4X4B A;  4PU3 C;  1DWK A;  2PE5 A;  3KZ3 A;  2PUC A;  2EWT A;  2R1J L;  3FYA A;  3LFP A;  3SCH A;  1WET A;  1DW9 A;  2IUO A;  1ZZ6 A;  2BNN A;  2L8N A;  2XCJ A;  4F8D A;  2MQK A;  3QYX A;  1ZPQ A;  4X4E A;  2IVQ A;  1RIO A;  2PUE A;  1ZZB A;  3D1N I;  2BNM A;  2JVL A;  3PXP A;  2XSD C;  3F51 A;  3R1F A;  3UFD A;  1ZS4 A;  2PUA A;  1RPE L;  1QQA A;  4X4C A;  1Y7Y A;  2AUW A;  3LIS A;  1VPW A;  2ICT A;  1ZZ7 A;  1ZZ9 A;  4JQD A;  2B5A A;  2XIU A;  1QP7 A;  2LCV A;  1CJG A;  3JXD L;  2PUB A;  1XWR A;  3QQ6 A;  2CRO A;  1GT0 C;  3ZHM A;  4I8T A;  4YG7 B;  4X4H A;  1EFA A;  1RZS A;  1X57 A;  1JWL A;  3L1P A;  1CQT A;  2IVG A;  2EBY A;  4Z59 A;  5K98 B;  3U3W A;  1OCT C;  1QPZ A;  3VK0 A;  3SCF A;  4J1W A;  1OSL A;  1LCC A;  3OQM A;  1IC8 A;  3GBF A;  2PUF A;  2HIN A;  2ICP A;  2WIU B;  4JCX A;  4IWR A;  1AU7 A;  3OQN A;  1BDH A;  1B0N A;  5A7L A;  4IVZ A;  4Z58 A;  3ZKC A;  1WH8 A;  3MLF A;  3F6W A;  4I6T A;  1BDI A;  4YG1 A;  3TRB A;  2AW6 A;  2LYR A;  2MEZ A;  3GN5 A;  2GRM A;  2LYL A;  4GQM A;  4X4G A;  2AXU A;  2FJR A;  1PRU A;  4X4D A;  2BJC A;  1QP0 A;  2HSG A;  3OMT A;  2IVB A;  3CEC A;  3CRO L;  4GHJ A;  2H8R A;  4FN3 A;  4X4F A;  1LQC A;  1POU A;  2PIJ A;  1QP4 A;  3BS3 A;  4Y42 A;  2PPX A;  3KJX A;  3O9X A;  1PER L;  4I6R A;  2XI8 A;  1L1M A;  3G5G A;  3S8Q A;  2EF8 A;  1ADR A;  2D5V A;  2IV1 A;  3H5T A;  2O49 A;  2XJ3 A;  1LCD A;  4O8B A;  1SQ8 A;  3FMY A;  1O4X A;  1JH9 A;  1ZVV A;  1NER A;  2GRL A;  4Z5C A;  1R63 A;  3EUS A;  2JCG A;  1Y9Q A; 
#chains in the Genus database with same CATH topology
 4HRA A;  3IVP A;  1X2L A;  2AWI A;  3HZI B;  2LYP A;  3FYM A;  1RZR A;  4MCT A;  3QOX A;  3G7D A;  2O4A A;  3DNV B;  4YAR A;  4PU4 C;  1E3O C;  4MCX A;  1LLI A;  2HFZ A;  2KEJ A;  5DRY A;  5DT2 A;  4FBI A;  3A9Z A;  2KEK A;  1HQ1 A;  1MFQ C;  1ZZC A;  2A6C A;  3ZHI A;  3GUU A;  4X4B A;  5DRT A;  3KZ3 A;  2EWT A;  3FYA A;  3A9Y A;  3GZD A;  3QYX A;  3D1N I;  3UFD A;  3R1F A;  4X4C A;  2XIU A;  2PXF A;  2LCV A;  1XWR A;  4I8T A;  1EFA A;  1JWL A;  4ER0 A;  2FFH A;  4OBM A;  2EBY A;  4Z59 A;  3U3W A;  3VK0 A;  3SCF A;  1QZX A;  3VWS A;  1BDH A;  4IVZ A;  5A7L A;  1BDI A;  3TRB A;  2AW6 A;  4X4D A;  5DTQ A;  2V3C C;  2BJC A;  3A9X A;  3NXH A;  3CEC A;  3CRO L;  1LQC A;  1QP4 A;  1PER L;  2XXA A;  2XI8 A;  1L1M A;  3S8Q A;  2D5V A;  1QB2 A;  4O8B A;  3FMY A;  1O4X A;  1ZVV A;  2PXV A;  3NZL A;  2HCS A;  1NEQ A;  2XXP A;  2KEI A;  2WUS R;  3OWQ A;  1UXC A;  3B7H A;  3KL4 A;  3CLC A;  2LYS A;  4DE9 A;  1HF0 A;  1LMB 3;  3QF3 A;  4IA8 A;  2R63 A;  1JFS A;  1WIZ A;  4PU8 A;  1R69 A;  1S7E A;  4I6U A;  2PXE A;  4Q2J A;  4ER7 A;  2PUD A;  4YBA A;  4YG4 A;  1WH6 A;  2JQE A;  2LYQ A;  4EQZ A;  2L49 A;  4EKI A;  1DUL A;  5DTR A;  1WET A;  2IUO A;  2MQK A;  1ZPQ A;  1ZZB A;  2PUA A;  3QOW A;  3PXP A;  2XSD C;  1RPE L;  3ZPX A;  2AUW A;  2LLW A;  1ZZ9 A;  4JQD A;  2PUB A;  2CRO A;  3SX0 A;  4X4H A;  1RZS A;  3L1P A;  3G0T A;  2IVG A;  1OCT C;  1QPZ A;  3NDB B;  4J1W A;  1OSL A;  3OQM A;  2HIN A;  2WIU B;  2ODR D;  3UWP A;  2PXU A;  5GAG i;  1B0N A;  3ZKC A;  3MLF A;  4I6T A;  1U2Z A;  4X4G A;  2AXU A;  2FJR A;  5GAH i;  1QP0 A;  1POU A;  3MEJ A;  2XJ3 A;  1JH9 A;  4Z5C A;  1R63 A;  2PXB A;  3EUS A;  1Y9Q A;  2CSF A;  4NDW A;  3NRO A;  3BDN A;  2AXV A;  3BD1 A;  1UTX A;  2KPJ A;  4EZI A;  2OFY A;  3SR4 A;  3KXA A;  1YSE A;  3JXB C;  3QFI A;  3GN5 B;  1UXD A;  1QQB A;  1PNR A;  2PUG A;  3OQO A;  2LYJ A;  2BNO A;  2VEO A;  1JFT A;  1ZZ8 A;  3R09 A;  3RZZ A;  4J1X A;  3LQX A;  4PU3 C;  1DWK A;  2HCN A;  2PUC A;  3LFP A;  4ER3 A;  4F8D A;  4DE8 A;  4X4E A;  1RIO A;  2PUE A;  2JVL A;  5DTM A;  3F51 A;  4WVL A;  1QQA A;  1Y7Y A;  1ZZ7 A;  3GZD C;  1QP7 A;  2MXD A;  3JXD L;  2LLV A;  3QQ6 A;  4ER5 A;  1GT0 C;  3ZHM A;  4YG7 B;  2PXK A;  5K98 B;  2PXQ A;  2PUF A;  4JCX A;  1AU7 A;  3M9L A;  4ER6 A;  4Z58 A;  1WH8 A;  3OKZ A;  4GQM A;  1PRU A;  2HSG A;  3GZC A;  4X4F A;  2PIJ A;  3O9X A;  4Y42 A;  4I6R A;  3G5G A;  2IV1 A;  2O49 A;  3DM5 A;  1LCD A;  2J7U A;  1NER A;  2GRL A;  2M4H A;  2KZ8 A;  4OB4 A;  4EK9 A;  2PXT A;  2GZU A;  2LYK A;  1PRV A;  2AXZ A;  4PU7 A;  2O38 A;  3QWG A;  2YBD A;  2OR1 L;  2IU7 A;  3OP9 A;  4X4I A;  1ZUG A;  4EKG A;  3JXC L;  1ZAY A;  1RZR D;  3F52 A;  4JCY A;  3TEP A;  3SCG A;  4Z5H A;  4Z5D A;  1PRA A;  2PE5 A;  2R1J L;  3SCH A;  1DW9 A;  1ZZ6 A;  2BNN A;  2L8N A;  2XCJ A;  5DSX A;  2IVQ A;  1ZS4 A;  2BNM A;  2L1P A;  3LIS A;  1VPW A;  2PXD A;  2ICT A;  5JUW A;  2B5A A;  3ME5 A;  3PE5 A;  1CJG A;  3TFL A;  1X57 A;  1CQT A;  1IC8 A;  3GBF A;  2ICP A;  4IWR A;  3OQN A;  3F6W A;  2PXP A;  4YG1 A;  2LYR A;  2MEZ A;  3GN5 A;  2GRM A;  2LYL A;  2XXQ A;  2J7W A;  3OMT A;  2IVB A;  4GHJ A;  2PXL A;  2H8R A;  4FN3 A;  1NW3 A;  3TEL A;  3BS3 A;  2PPX A;  3KJX A;  2EF8 A;  1ADR A;  3H5T A;  1SQ8 A;  2LNM A;  1LCC A;  2JCG A; 
#chains in the Genus database with same CATH homology
 1NEQ A;  2KZ8 A;  2CSF A;  3IVP A;  4OB4 A;  4NDW A;  3BDN A;  2AXV A;  1X2L A;  2AWI A;  2KEI A;  2WUS R;  2GZU A;  3BD1 A;  1UTX A;  1UXC A;  2LYK A;  3B7H A;  2KPJ A;  2OFY A;  3HZI B;  2LYP A;  1PRV A;  3FYM A;  3KXA A;  1YSE A;  3CLC A;  2LYS A;  4MCT A;  1RZR A;  1HF0 A;  1LMB 3;  3G7D A;  2AXZ A;  3JXB C;  2O4A A;  3QF3 A;  4IA8 A;  3DNV B;  4PU7 A;  2R63 A;  4YAR A;  2O38 A;  3QWG A;  4PU4 C;  1E3O C;  2OR1 L;  1JFS A;  3GN5 B;  2IU7 A;  1WIZ A;  3OP9 A;  4X4I A;  1ZUG A;  4MCX A;  4PU8 A;  1LLI A;  1R69 A;  1UXD A;  2KEJ A;  3JXC L;  1S7E A;  1QQB A;  4I6U A;  1PNR A;  1ZAY A;  3OQO A;  2PUG A;  1RZR D;  3F52 A;  4JCY A;  2LYJ A;  2BNO A;  4FBI A;  2KEK A;  2PUD A;  3SCG A;  1JFT A;  1ZZ8 A;  1ZZC A;  4YBA A;  4YG4 A;  1WH6 A;  2A6C A;  4Z5H A;  3RZZ A;  4Z5D A;  3ZHI A;  4J1X A;  2LYQ A;  1PRA A;  2L49 A;  4X4B A;  4PU3 C;  1DWK A;  2PE5 A;  3KZ3 A;  2PUC A;  2EWT A;  2R1J L;  3FYA A;  3LFP A;  3SCH A;  1WET A;  1DW9 A;  2IUO A;  1ZZ6 A;  2BNN A;  2L8N A;  2XCJ A;  4F8D A;  2MQK A;  3QYX A;  1ZPQ A;  4X4E A;  2IVQ A;  1RIO A;  2PUE A;  1ZZB A;  3D1N I;  2BNM A;  2JVL A;  3PXP A;  2XSD C;  3F51 A;  3R1F A;  3UFD A;  1ZS4 A;  2PUA A;  1RPE L;  1QQA A;  4X4C A;  1Y7Y A;  2AUW A;  3LIS A;  1VPW A;  2ICT A;  1ZZ7 A;  1ZZ9 A;  4JQD A;  2B5A A;  2XIU A;  1QP7 A;  2LCV A;  1CJG A;  3JXD L;  2PUB A;  1XWR A;  3QQ6 A;  2CRO A;  1GT0 C;  3ZHM A;  4I8T A;  4YG7 B;  4X4H A;  1EFA A;  1RZS A;  1X57 A;  1JWL A;  3L1P A;  1CQT A;  2IVG A;  2EBY A;  4Z59 A;  5K98 B;  3U3W A;  1OCT C;  1QPZ A;  3VK0 A;  3SCF A;  4J1W A;  1OSL A;  1LCC A;  3OQM A;  1IC8 A;  3GBF A;  2PUF A;  2HIN A;  2ICP A;  2WIU B;  4JCX A;  4IWR A;  1AU7 A;  3OQN A;  1BDH A;  1B0N A;  5A7L A;  4IVZ A;  4Z58 A;  3ZKC A;  1WH8 A;  3MLF A;  3F6W A;  4I6T A;  1BDI A;  4YG1 A;  3TRB A;  2AW6 A;  2LYR A;  2MEZ A;  3GN5 A;  2GRM A;  2LYL A;  4GQM A;  4X4G A;  2AXU A;  2FJR A;  1PRU A;  4X4D A;  2BJC A;  1QP0 A;  2HSG A;  3OMT A;  2IVB A;  3CEC A;  3CRO L;  4GHJ A;  2H8R A;  4FN3 A;  4X4F A;  1LQC A;  1POU A;  2PIJ A;  1QP4 A;  3BS3 A;  4Y42 A;  2PPX A;  3KJX A;  3O9X A;  1PER L;  4I6R A;  2XI8 A;  1L1M A;  3G5G A;  3S8Q A;  2EF8 A;  1ADR A;  2D5V A;  2IV1 A;  3H5T A;  2O49 A;  2XJ3 A;  1LCD A;  4O8B A;  1SQ8 A;  3FMY A;  1O4X A;  1JH9 A;  1ZVV A;  1NER A;  2GRL A;  4Z5C A;  1R63 A;  3EUS A;  2JCG A;  1Y9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...