4JQGA

Crystal structure of an inactive mutant of mmp-9 catalytic domain in complex with a fluorogenic synthetic peptidic substrate with a fluorine atom.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
GFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHAFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fluorogenic peptidic substrate (8MC)PLG(PFF)(DNW)AR(NH2)
publication title Halogen Bonding Controls Selectivity of FRET Substrate Probes for MMP-9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/substrate
total genus 46
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4jqgA00
2X7MA 3LKAA 3EDZA 3HBVP 1O0QA 2JIHA 3LIRA 1ZTQA 1JIWP 3SHIA 1HFSA 2YB9A 1PWPA 3N2UA 2I47A 3GBOA 1KUFA 2A8HA 1CK7A 1Y0VA 3KWVC 3B2ZA 4Q1LA 3CKIA 3LJGA 4GF1A 1IADA 1IACA 1Q3AA 4EFSA 1B8YA 2OXUA 1ZS0A 3KHIA 1IAAA 2CKIA 2DDFA 2Z2DA 1FM1A 4A7BA 1EUBA 2POJA 1PWUA 2TCLA 1I1IP 3KMEA 3DWBA 1OM7A 2OW9A 3LUNA 4XM6A 4WZVA 4PKUA 5B5OA 1G9KA 1G05A 2Y6DA 4H82A 1HY7A 2OW0A 1O0TA 1SMPA 2X3AA 2OY2A 3HDBA 1CGEA 2MZHA 3K7LA 2WO8A 4PKVA 1MMQA 2PJTA 1G49A 4CTHA 1XFVA 2MZIA 3OHLA 1K7IA 1BUDA 1I73A 2J83A 4ILWD 3V96B 830CA 3DSLA 3WV2A 3OHOA 2DW1A 4GR3A 3G5CA 1BKCI 2O3EA 1HTDA 3UVCA 1HFCA 3KECA 3L0TA 1IAEA 5D1UA 2XS3A 1K7GA 1D8FA 1JKYA 1BUVM 1GKDA 1Z3JA 1XFWA 4L6TA 1CXVA 3NX7A 3LQBA 4DV8A 5L7FA 1JAOA 2KRJA 1XFUA 1I76A 1UEAA 1PWQA 4H49A 1GE6A 5D1SA 1CGLA 4IUWA 4WKEA 2E3XA 4H2EA 1JJ9A 5LABA 2Y6CA 1QIBA 1PWVA 2OVXA 2MZEA 5I0LA 4XCTA 3F18A 4GR8A 1KAPP 2FV5A 2SRTA 3B92A 3ZUKA 3RTTA 2JT6A 2YIGA 3AYKA 3Q2HA 2JSDA 1BQOA 1MMBA 5BOTA 2W15A 1GO8P 4DF9A 1USNA 4H1QA 1XFZA 1PWWA 2ERQA 1HV5A 1IAGA 1QUAA 1R54A 1RMZA 1OM6A 966CA 2OVZA 3F19A 1AF0A 1FLSA 2WO9A 1G4KA 4PKQA 1BQQM 3VI1A 2AYKA 3Q2GA 4WKIA 3EDHA 2AIGP 3DNGA 1D5JA 4GR0A 2CLTA 4R3VA 1Y8JA 3I7GA 4FXQA 1OM8A 3TVCA 2EROA 4FXYP 3WV3A 4AUOA 3F16A 1ZXVA 2OY4A 1UTZA 1R1JA 1BSWA 1R1HA 1SLNA 1QICA 3KMCA 1ASTA 1WNIA 4FVLA 3EDGA 3P1VA 2JNPA 3ZVSA 1AYKA 3HYGA 1MMPA 1OS2A 3O2XA 3B8ZA 2K9CA 3KEKA 3HB2P 3EHXA 3VTGA 2K2GA 1YOUA 1CIZA 1BKCE 1JANA 3AIGA 5I12A 2DW0A 1BKCA 1OO9A 4JIJA 1KUHA 3F1AA 2E2DA 2OXZA 1JK3A 2XS4A 2RJQA 3LE9A 1C3IA 1GE7A 1YP1A 2DDYA 4PKRA 4QKZA 4FU4A 5CZMA 1XUDA 1ROSA 3RTSA 1JH1A 3MA2A 5D7WA 5D1TA 1QJJA 4H3XA 5I43A 4XM7A 3KEJA 2JT5A 4G0DA 4I35A 3LQ0A 2WOAA 2OI0A 2X3CA 3U1RA 5L79A 3BA0A 2OW2A 5BPAA 1XURA 1D7XA 1A85A 1ND1A 3K7NA 4XM8A 1K7QA 1AKLA 5JMYA 1ZXCA 4WK7A 2J0TA 4JQGA 1FBLA 2V4BA 4GUYA 4AIGA 1JIZA 1QJIA 2W14A 2N8RA 2OXWA 1SLMA 5CUHA 1KBCA 3N2VA 3KRYA 4DPEA 5I3MA 4I03A 4J4MA 4HMAA 3TS4A 1RM8A 4HX3A 2RJPA 4JP4A 4DD8A 4JPAA 3AYUA 5BOYA 1KUKA 1YQYA 3LMCA 2W13A 4ON1A 1A86A 1J7NA 2QPJA 4AYKA 1G12A 3F15A 1QIAA 1C7KA 3EDIA 4GQLA 3HBUP 2O36A 2ERPA 3HDAP 3I7IA 4PKSA 1SRPA 3F17A 4WF6A 3ZXHA 1UTTA 3HY9A 5D2BA 4PKTA 1GXDA 1ZVXA 4H30A 3EWJA 1DTHA 5D3CA 3LJZA 456CA 1JAQA 3P24A 4L19A 1JAPA 1L6JA 3G42A 1MMRA 2OW1A 1S4BP 1H71P 1KUGA 2X3BA 1XUCA 2OZRA 3ELMA 4XBHA 1GE5A 2USNA 3DL1A 1R1IA 2W12A 4H84A 1UMTA 5I2ZA 2HU6A 3LGPA 2D1NA 4ZR5A 2L0RA 4PKWA 1BM6A 1BZSA 1GKCA 4H76A 1EB6A 3LEAA 4JA1A 1BIWA 3LUMA 1IABA 3LJTA 3O64A 4A3WA 1B3DA 4L63A 3DPEA 1YCMA 1CAQA 2D1OA 2MLSA 2W0DA 4AXQA 4IN9A 1HOVA 3TSKA 3LIKA 1XFYA 1KUIA 1DMTA 4G9LA 1OS9A 3LK8A 3WV1A 1GO7P 5CXAA 5I4OA 1EAKA 3LILA 3USNA 1UMSA 1OMJA 1XFXA 1Y93A 5H8XA 1R55A 3DPFA 1MNCA 1ATLA 1CGFA 2DW2A 3HY7A 4GWMA 1ZP5A 2MLRA 5B5PA 4GWNA 1SU3A 3L0VA 3TT4A 3E8RA 4IJOA 1SATA 3EHYA 1CQRA 1D8MA 2FV9A 1C8TA
chains in the Genus database with same CATH superfamily
2X7MA 3LKAA 3EDZA 3HBVP 1O0QA 2JIHA 3LIRA 1ZTQA 1JIWP 3SHIA 1HFSA 2YB9A 1PWPA 3N2UA 2I47A 3GBOA 1KUFA 2A8HA 1CK7A 1Y0VA 3KWVC 3B2ZA 4Q1LA 3CKIA 3LJGA 4L7AA 4GF1A 1IADA 1IACA 1Q3AA 4EFSA 1B8YA 2OXUA 1ZS0A 3KHIA 1IAAA 2CKIA 2DDFA 2Z2DA 1FM1A 4A7BA 2YUFA 1EUBA 2POJA 1PWUA 2TCLA 1I1IP 3KMEA 3DWBA 1OM7A 2OW9A 3LUNA 4XM6A 4WZVA 4PKUA 5B5OA 1G9KA 1G05A 2Y6DA 4H82A 1HY7A 1OZ9A 2OW0A 1O0TA 1SMPA 2X3AA 2OY2A 3HDBA 1CGEA 2MZHA 3K7LA 2WO8A 4PKVA 1MMQA 2PJTA 1G49A 4CTHA 1XFVA 2MZIA 3OHLA 1K7IA 1BUDA 1I73A 2J83A 4ILWD 3V96B 830CA 3DSLA 3WV2A 3OHOA 2DW1A 4GR3A 3G5CA 1BKCI 2O3EA 1HTDA 3UVCA 1HFCA 3KECA 3L0TA 1TVIA 1IAEA 5D1UA 2XS3A 1K7GA 1D8FA 1JKYA 1BUVM 1GKDA 1Z3JA 1XFWA 4L6TA 1CXVA 3NX7A 3LQBA 4DV8A 5L7FA 1JAOA 2KRJA 1XFUA 1I76A 1UEAA 1PWQA 4H49A 1GE6A 5D1SA 1CGLA 4IUWA 4WKEA 2E3XA 4H2EA 1JJ9A 5LABA 2Y6CA 1QIBA 1PWVA 2OVXA 2MZEA 5I0LA 4XCTA 3F18A 4GR8A 1KAPP 2FV5A 2SRTA 3B92A 3ZUKA 3RTTA 2JT6A 2YIGA 3AYKA 3Q2HA 2JSDA 1BQOA 1MMBA 5BOTA 2W15A 1GO8P 4DF9A 1USNA 4H1QA 1XFZA 1PWWA 2ERQA 1HV5A 1IAGA 1QUAA 1R54A 1RMZA 1OM6A 966CA 2OVZA 3F19A 1AF0A 1FLSA 2WO9A 1G4KA 4PKQA 3DTIA 1BQQM 3VI1A 2AYKA 3Q2GA 4WKIA 3EDHA 2AIGP 3DNGA 1D5JA 4GR0A 2CLTA 4R3VA 1Y8JA 3I7GA 4FXQA 1OM8A 3TVCA 2EROA 4FXYP 3WV3A 4AUOA 3F16A 1ZXVA 2OY4A 1UTZA 1R1JA 1BSWA 1R1HA 1SLNA 1QICA 3KMCA 1ASTA 1WNIA 1XAXA 4FVLA 3EDGA 3P1VA 2JNPA 3ZVSA 1AYKA 3HYGA 1MMPA 1OS2A 3O2XA 3B8ZA 2K9CA 3KEKA 3HB2P 3EHXA 3VTGA 2K2GA 1YOUA 1CIZA 1BKCE 1JANA 3AIGA 5I12A 2DW0A 1BKCA 1OO9A 4JIJA 1KUHA 3F1AA 2E2DA 2OXZA 1JK3A 2XS4A 2RJQA 3LE9A 1C3IA 1GE7A 1YP1A 2DDYA 4PKRA 4QKZA 4FU4A 5CZMA 1XUDA 1ROSA 3RTSA 1JH1A 3MA2A 5D7WA 5D1TA 1QJJA 4H3XA 5I43A 4XM7A 3KEJA 2JT5A 4G0DA 4I35A 3LQ0A 2WOAA 2OI0A 2X3CA 3U1RA 5L79A 3BA0A 2OW2A 5BPAA 1XURA 1D7XA 1A85A 1ND1A 3K7NA 4XM8A 1K7QA 1AKLA 5JMYA 1ZXCA 4WK7A 2J0TA 4JQGA 1FBLA 2V4BA 4GUYA 4AIGA 1JIZA 1QJIA 2W14A 2N8RA 2OXWA 1SLMA 5CUHA 1KBCA 3N2VA 3KRYA 4DPEA 5I3MA 4I03A 4J4MA 4HMAA 3TS4A 1RM8A 4HX3A 2RJPA 4JP4A 4DD8A 4JPAA 3AYUA 5BOYA 1KUKA 1YQYA 3LMCA 2W13A 4ON1A 1A86A 1J7NA 2QPJA 4AYKA 1G12A 3F15A 1QIAA 1C7KA 3EDIA 4GQLA 3HBUP 2O36A 2ERPA 3HDAP 3I7IA 4PKSA 1SRPA 3F17A 4WF6A 3ZXHA 1UTTA 3HY9A 5D2BA 4PKTA 1GXDA 1ZVXA 4H30A 3EWJA 1DTHA 5D3CA 3LJZA 456CA 1JAQA 3P24A 4L19A 1JAPA 1L6JA 3G42A 1MMRA 1XM5A 2OW1A 1S4BP 1H71P 1KUGA 2X3BA 1XUCA 2OZRA 3ELMA 4XBHA 1GE5A 2USNA 3DL1A 1R1IA 2W12A 4H84A 1UMTA 5I2ZA 2HU6A 3LGPA 2D1NA 4ZR5A 2L0RA 4PKWA 1BM6A 1BZSA 1GKCA 4H76A 1EB6A 3LEAA 4JA1A 1BIWA 3LUMA 1IABA 3LJTA 3O64A 3DTKA 4A3WA 1B3DA 4L63A 3DPEA 1YCMA 1CAQA 2D1OA 2MLSA 2W0DA 4AXQA 4IN9A 1HOVA 3TSKA 3LIKA 1XFYA 1KUIA 1DMTA 4G9LA 1OS9A 3LK8A 3WV1A 1GO7P 5CXAA 5I4OA 1EAKA 3LILA 3USNA 1UMSA 1OMJA 1XFXA 1Y93A 5H8XA 1R55A 3DPFA 1MNCA 1ATLA 1CGFA 2DW2A 3HY7A 4GWMA 3DTEA 1ZP5A 2MLRA 5B5PA 4GWNA 1SU3A 3L0VA 3TT4A 3E8RA 4IJOA 1SATA 3EHYA 1CQRA 1D8MA 2FV9A 1C8TA
chains in the Genus database with same CATH topology
2X7MA 3LKAA 3EDZA 3HBVP 1O0QA 2JIHA 3LIRA 1ZTQA 1JIWP 3SHIA 1HFSA 2YB9A 1PWPA 3N2UA 2I47A 3GBOA 1KUFA 2A8HA 1CK7A 1Y0VA 3KWVC 3B2ZA 4Q1LA 3CKIA 3LJGA 4L7AA 4GF1A 1IADA 1IACA 1Q3AA 4EFSA 1B8YA 2OXUA 1ZS0A 3KHIA 1IAAA 2CKIA 2DDFA 2Z2DA 1FM1A 4A7BA 2YUFA 1EUBA 2POJA 1PWUA 2TCLA 1I1IP 3KMEA 3DWBA 1OM7A 2OW9A 3LUNA 4XM6A 4WZVA 4PKUA 5B5OA 1G9KA 1G05A 2Y6DA 4H82A 1HY7A 2OW0A 1O0TA 1SMPA 2X3AA 2OY2A 3HDBA 1CGEA 2MZHA 3K7LA 2WO8A 4PKVA 1MMQA 2PJTA 1G49A 4CTHA 1XFVA 2MZIA 3OHLA 1K7IA 1BUDA 1I73A 2J83A 4ILWD 3V96B 830CA 3DSLA 3WV2A 3OHOA 2DW1A 4GR3A 3G5CA 1BKCI 2O3EA 1HTDA 3UVCA 1HFCA 3KECA 3L0TA 1IAEA 5D1UA 2XS3A 1K7GA 1D8FA 1JKYA 1BUVM 1GKDA 1Z3JA 1XFWA 4L6TA 1CXVA 3NX7A 3LQBA 4DV8A 5L7FA 1JAOA 2KRJA 1XFUA 1I76A 1UEAA 1PWQA 4H49A 1GE6A 5D1SA 1CGLA 4IUWA 4WKEA 2E3XA 4H2EA 1JJ9A 5LABA 2Y6CA 1QIBA 1PWVA 2OVXA 2MZEA 5I0LA 4XCTA 3F18A 4GR8A 1KAPP 2FV5A 2SRTA 3B92A 3ZUKA 3RTTA 2JT6A 2YIGA 3AYKA 3Q2HA 2JSDA 1BQOA 1MMBA 5BOTA 2W15A 1GO8P 4DF9A 1USNA 4H1QA 1XFZA 1PWWA 2ERQA 1HV5A 1IAGA 1QUAA 1R54A 1RMZA 1OM6A 966CA 2OVZA 3F19A 1AF0A 1FLSA 2WO9A 1G4KA 4PKQA 3DTIA 1BQQM 3VI1A 2AYKA 3Q2GA 4WKIA 3EDHA 2AIGP 3DNGA 1D5JA 4GR0A 2CLTA 4R3VA 1Y8JA 3I7GA 4FXQA 1OM8A 3TVCA 2EROA 4FXYP 3WV3A 4AUOA 3F16A 1ZXVA 2OY4A 1UTZA 1R1JA 1BSWA 1R1HA 1SLNA 1QICA 3KMCA 1ASTA 1WNIA 4FVLA 3EDGA 3P1VA 2JNPA 3ZVSA 1AYKA 3HYGA 1MMPA 1OS2A 3O2XA 3B8ZA 2K9CA 3KEKA 3HB2P 3EHXA 3VTGA 2K2GA 1YOUA 1CIZA 1BKCE 1JANA 3AIGA 5I12A 2DW0A 1BKCA 1OO9A 4JIJA 1KUHA 3F1AA 2E2DA 2OXZA 1JK3A 2XS4A 2RJQA 3LE9A 1C3IA 1GE7A 1YP1A 2DDYA 4PKRA 4QKZA 4FU4A 5CZMA 1XUDA 1ROSA 3RTSA 1JH1A 3MA2A 5D7WA 5D1TA 1QJJA 4H3XA 5I43A 4XM7A 3KEJA 2JT5A 4G0DA 4I35A 3LQ0A 2WOAA 2OI0A 2X3CA 3U1RA 5L79A 3BA0A 2OW2A 5BPAA 1XURA 1D7XA 1A85A 1ND1A 3K7NA 4XM8A 1K7QA 1AKLA 5JMYA 1ZXCA 4WK7A 2J0TA 4JQGA 1FBLA 2V4BA 4GUYA 4AIGA 1JIZA 1QJIA 2W14A 2N8RA 2OXWA 1SLMA 5CUHA 1KBCA 3N2VA 3KRYA 4DPEA 5I3MA 4I03A 4J4MA 4HMAA 3TS4A 1RM8A 4HX3A 2RJPA 4JP4A 4DD8A 4JPAA 3AYUA 5BOYA 1KUKA 1YQYA 3LMCA 2W13A 4ON1A 1A86A 1J7NA 2QPJA 4AYKA 1G12A 3F15A 1QIAA 1C7KA 3EDIA 4GQLA 3HBUP 2O36A 2ERPA 3HDAP 3I7IA 4PKSA 1SRPA 3F17A 4WF6A 3ZXHA 1UTTA 3HY9A 5D2BA 4PKTA 1GXDA 1ZVXA 4H30A 3EWJA 1DTHA 5D3CA 3LJZA 456CA 1JAQA 3P24A 4L19A 1JAPA 1L6JA 3G42A 1MMRA 2OW1A 1S4BP 1H71P 1KUGA 2X3BA 1XUCA 2OZRA 3ELMA 4XBHA 1GE5A 2USNA 3DL1A 1R1IA 2W12A 4H84A 1UMTA 5I2ZA 2HU6A 3LGPA 2D1NA 4ZR5A 2L0RA 4PKWA 1BM6A 1BZSA 1GKCA 4H76A 1EB6A 3LEAA 4JA1A 1BIWA 3LUMA 1IABA 3LJTA 3O64A 3DTKA 4A3WA 1B3DA 4L63A 3DPEA 1YCMA 1CAQA 2D1OA 2MLSA 2W0DA 4AXQA 4IN9A 1HOVA 3TSKA 3LIKA 1XFYA 1KUIA 1DMTA 4G9LA 1OS9A 3LK8A 3WV1A 1GO7P 5CXAA 5I4OA 1EAKA 3LILA 3USNA 1UMSA 1OMJA 1XFXA 1Y93A 5H8XA 1R55A 3DPFA 1MNCA 1ATLA 1CGFA 2DW2A 3HY7A 4GWMA 3DTEA 1ZP5A 2MLRA 5B5PA 4GWNA 1SU3A 3L0VA 3TT4A 3E8RA 4IJOA 1SATA 3EHYA 1CQRA 1D8MA 2FV9A 1C8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7M A;  3LKA A;  3EDZ A;  3HBV P;  1O0Q A;  2JIH A;  3LIR A;  1ZTQ A;  1JIW P;  3SHI A;  1HFS A;  2YB9 A;  1PWP A;  3N2U A;  2I47 A;  3GBO A;  1KUF A;  2A8H A;  1CK7 A;  1Y0V A;  3KWV C;  3B2Z A;  4Q1L A;  3CKI A;  3LJG A;  4GF1 A;  1IAD A;  1IAC A;  1Q3A A;  4EFS A;  1B8Y A;  2OXU A;  1ZS0 A;  3KHI A;  1IAA A;  2CKI A;  2DDF A;  2Z2D A;  1FM1 A;  4A7B A;  1EUB A;  2POJ A;  1PWU A;  2TCL A;  1I1I P;  3KME A;  3DWB A;  1OM7 A;  2OW9 A;  3LUN A;  4XM6 A;  4WZV A;  4PKU A;  5B5O A;  1G9K A;  1G05 A;  2Y6D A;  4H82 A;  1HY7 A;  2OW0 A;  1O0T A;  1SMP A;  2X3A A;  2OY2 A;  3HDB A;  1CGE A;  2MZH A;  3K7L A;  2WO8 A;  4PKV A;  1MMQ A;  2PJT A;  1G49 A;  4CTH A;  1XFV A;  2MZI A;  3OHL A;  1K7I A;  1BUD A;  1I73 A;  2J83 A;  4ILW D;  3V96 B;  830C A;  3DSL A;  3WV2 A;  3OHO A;  2DW1 A;  4GR3 A;  3G5C A;  1BKC I;  2O3E A;  1HTD A;  3UVC A;  1HFC A;  3KEC A;  3L0T A;  1IAE A;  5D1U A;  2XS3 A;  1K7G A;  1D8F A;  1JKY A;  1BUV M;  1GKD A;  1Z3J A;  1XFW A;  4L6T A;  1CXV A;  3NX7 A;  3LQB A;  4DV8 A;  5L7F A;  1JAO A;  2KRJ A;  1XFU A;  1I76 A;  1UEA A;  1PWQ A;  4H49 A;  1GE6 A;  5D1S A;  1CGL A;  4IUW A;  4WKE A;  2E3X A;  4H2E A;  1JJ9 A;  5LAB A;  2Y6C A;  1QIB A;  1PWV A;  2OVX A;  2MZE A;  5I0L A;  4XCT A;  3F18 A;  4GR8 A;  1KAP P;  2FV5 A;  2SRT A;  3B92 A;  3ZUK A;  3RTT A;  2JT6 A;  2YIG A;  3AYK A;  3Q2H A;  2JSD A;  1BQO A;  1MMB A;  5BOT A;  2W15 A;  1GO8 P;  4DF9 A;  1USN A;  4H1Q A;  1XFZ A;  1PWW A;  2ERQ A;  1HV5 A;  1IAG A;  1QUA A;  1R54 A;  1RMZ A;  1OM6 A;  966C A;  2OVZ A;  3F19 A;  1AF0 A;  1FLS A;  2WO9 A;  1G4K A;  4PKQ A;  1BQQ M;  3VI1 A;  2AYK A;  3Q2G A;  4WKI A;  3EDH A;  2AIG P;  3DNG A;  1D5J A;  4GR0 A;  2CLT A;  4R3V A;  1Y8J A;  3I7G A;  4FXQ A;  1OM8 A;  3TVC A;  2ERO A;  4FXY P;  3WV3 A;  4AUO A;  3F16 A;  1ZXV A;  2OY4 A;  1UTZ A;  1R1J A;  1BSW A;  1R1H A;  1SLN A;  1QIC A;  3KMC A;  1AST A;  1WNI A;  4FVL A;  3EDG A;  3P1V A;  2JNP A;  3ZVS A;  1AYK A;  3HYG A;  1MMP A;  1OS2 A;  3O2X A;  3B8Z A;  2K9C A;  3KEK A;  3HB2 P;  3EHX A;  3VTG A;  2K2G A;  1YOU A;  1CIZ A;  1BKC E;  1JAN A;  3AIG A;  5I12 A;  2DW0 A;  1BKC A;  1OO9 A;  4JIJ A;  1KUH A;  3F1A A;  2E2D A;  2OXZ A;  1JK3 A;  2XS4 A;  2RJQ A;  3LE9 A;  1C3I A;  1GE7 A;  1YP1 A;  2DDY A;  4PKR A;  4QKZ A;  4FU4 A;  5CZM A;  1XUD A;  1ROS A;  3RTS A;  1JH1 A;  3MA2 A;  5D7W A;  5D1T A;  1QJJ A;  4H3X A;  5I43 A;  4XM7 A;  3KEJ A;  2JT5 A;  4G0D A;  4I35 A;  3LQ0 A;  2WOA A;  2OI0 A;  2X3C A;  3U1R A;  5L79 A;  3BA0 A;  2OW2 A;  5BPA A;  1XUR A;  1D7X A;  1A85 A;  1ND1 A;  3K7N A;  4XM8 A;  1K7Q A;  1AKL A;  5JMY A;  1ZXC A;  4WK7 A;  2J0T A;  4JQG A;  1FBL A;  2V4B A;  4GUY A;  4AIG A;  1JIZ A;  1QJI A;  2W14 A;  2N8R A;  2OXW A;  1SLM A;  5CUH A;  1KBC A;  3N2V A;  3KRY A;  4DPE A;  5I3M A;  4I03 A;  4J4M A;  4HMA A;  3TS4 A;  1RM8 A;  4HX3 A;  2RJP A;  4JP4 A;  4DD8 A;  4JPA A;  3AYU A;  5BOY A;  1KUK A;  1YQY A;  3LMC A;  2W13 A;  4ON1 A;  1A86 A;  1J7N A;  2QPJ A;  4AYK A;  1G12 A;  3F15 A;  1QIA A;  1C7K A;  3EDI A;  4GQL A;  3HBU P;  2O36 A;  2ERP A;  3HDA P;  3I7I A;  4PKS A;  1SRP A;  3F17 A;  4WF6 A;  3ZXH A;  1UTT A;  3HY9 A;  5D2B A;  4PKT A;  1GXD A;  1ZVX A;  4H30 A;  3EWJ A;  1DTH A;  5D3C A;  3LJZ A;  456C A;  1JAQ A;  3P24 A;  4L19 A;  1JAP A;  1L6J A;  3G42 A;  1MMR A;  2OW1 A;  1S4B P;  1H71 P;  1KUG A;  2X3B A;  1XUC A;  2OZR A;  3ELM A;  4XBH A;  1GE5 A;  2USN A;  3DL1 A;  1R1I A;  2W12 A;  4H84 A;  1UMT A;  5I2Z A;  2HU6 A;  3LGP A;  2D1N A;  4ZR5 A;  2L0R A;  4PKW A;  1BM6 A;  1BZS A;  1GKC A;  4H76 A;  1EB6 A;  3LEA A;  4JA1 A;  1BIW A;  3LUM A;  1IAB A;  3LJT A;  3O64 A;  4A3W A;  1B3D A;  4L63 A;  3DPE A;  1YCM A;  1CAQ A;  2D1O A;  2MLS A;  2W0D A;  4AXQ A;  4IN9 A;  1HOV A;  3TSK A;  3LIK A;  1XFY A;  1KUI A;  1DMT A;  4G9L A;  1OS9 A;  3LK8 A;  3WV1 A;  1GO7 P;  5CXA A;  5I4O A;  1EAK A;  3LIL A;  3USN A;  1UMS A;  1OMJ A;  1XFX A;  1Y93 A;  5H8X A;  1R55 A;  3DPF A;  1MNC A;  1ATL A;  1CGF A;  2DW2 A;  3HY7 A;  4GWM A;  1ZP5 A;  2MLR A;  5B5P A;  4GWN A;  1SU3 A;  3L0V A;  3TT4 A;  3E8R A;  4IJO A;  1SAT A;  3EHY A;  1CQR A;  1D8M A;  2FV9 A;  1C8T A; 
#chains in the Genus database with same CATH topology
 2X7M A;  3LKA A;  3EDZ A;  3HBV P;  1O0Q A;  2JIH A;  3LIR A;  1ZTQ A;  1JIW P;  3SHI A;  1HFS A;  2YB9 A;  1PWP A;  3N2U A;  2I47 A;  3GBO A;  1KUF A;  2A8H A;  1CK7 A;  1Y0V A;  3KWV C;  3B2Z A;  4Q1L A;  3CKI A;  3LJG A;  4L7A A;  4GF1 A;  1IAD A;  1IAC A;  1Q3A A;  4EFS A;  1B8Y A;  2OXU A;  1ZS0 A;  3KHI A;  1IAA A;  2CKI A;  2DDF A;  2Z2D A;  1FM1 A;  4A7B A;  2YUF A;  1EUB A;  2POJ A;  1PWU A;  2TCL A;  1I1I P;  3KME A;  3DWB A;  1OM7 A;  2OW9 A;  3LUN A;  4XM6 A;  4WZV A;  4PKU A;  5B5O A;  1G9K A;  1G05 A;  2Y6D A;  4H82 A;  1HY7 A;  1OZ9 A;  2OW0 A;  1O0T A;  1SMP A;  2X3A A;  2OY2 A;  3HDB A;  1CGE A;  2MZH A;  3K7L A;  2WO8 A;  4PKV A;  1MMQ A;  2PJT A;  1G49 A;  4CTH A;  1XFV A;  2MZI A;  3OHL A;  1K7I A;  1BUD A;  1I73 A;  2J83 A;  4ILW D;  3V96 B;  830C A;  3DSL A;  3WV2 A;  3OHO A;  2DW1 A;  4GR3 A;  3G5C A;  1BKC I;  2O3E A;  1HTD A;  3UVC A;  1HFC A;  3KEC A;  3L0T A;  1TVI A;  1IAE A;  5D1U A;  2XS3 A;  1K7G A;  1D8F A;  1JKY A;  1BUV M;  1GKD A;  1Z3J A;  1XFW A;  4L6T A;  1CXV A;  3NX7 A;  3LQB A;  4DV8 A;  5L7F A;  1JAO A;  2KRJ A;  1XFU A;  1I76 A;  1UEA A;  1PWQ A;  4H49 A;  1GE6 A;  5D1S A;  1CGL A;  4IUW A;  4WKE A;  2E3X A;  4H2E A;  1JJ9 A;  5LAB A;  2Y6C A;  1QIB A;  1PWV A;  2OVX A;  2MZE A;  5I0L A;  4XCT A;  3F18 A;  4GR8 A;  1KAP P;  2FV5 A;  2SRT A;  3B92 A;  3ZUK A;  3RTT A;  2JT6 A;  2YIG A;  3AYK A;  3Q2H A;  2JSD A;  1BQO A;  1MMB A;  5BOT A;  2W15 A;  1GO8 P;  4DF9 A;  1USN A;  4H1Q A;  1XFZ A;  1PWW A;  2ERQ A;  1HV5 A;  1IAG A;  1QUA A;  1R54 A;  1RMZ A;  1OM6 A;  966C A;  2OVZ A;  3F19 A;  1AF0 A;  1FLS A;  2WO9 A;  1G4K A;  4PKQ A;  3DTI A;  1BQQ M;  3VI1 A;  2AYK A;  3Q2G A;  4WKI A;  3EDH A;  2AIG P;  3DNG A;  1D5J A;  4GR0 A;  2CLT A;  4R3V A;  1Y8J A;  3I7G A;  4FXQ A;  1OM8 A;  3TVC A;  2ERO A;  4FXY P;  3WV3 A;  4AUO A;  3F16 A;  1ZXV A;  2OY4 A;  1UTZ A;  1R1J A;  1BSW A;  1R1H A;  1SLN A;  1QIC A;  3KMC A;  1AST A;  1WNI A;  1XAX A;  4FVL A;  3EDG A;  3P1V A;  2JNP A;  3ZVS A;  1AYK A;  3HYG A;  1MMP A;  1OS2 A;  3O2X A;  3B8Z A;  2K9C A;  3KEK A;  3HB2 P;  3EHX A;  3VTG A;  2K2G A;  1YOU A;  1CIZ A;  1BKC E;  1JAN A;  3AIG A;  5I12 A;  2DW0 A;  1BKC A;  1OO9 A;  4JIJ A;  1KUH A;  3F1A A;  2E2D A;  2OXZ A;  1JK3 A;  2XS4 A;  2RJQ A;  3LE9 A;  1C3I A;  1GE7 A;  1YP1 A;  2DDY A;  4PKR A;  4QKZ A;  4FU4 A;  5CZM A;  1XUD A;  1ROS A;  3RTS A;  1JH1 A;  3MA2 A;  5D7W A;  5D1T A;  1QJJ A;  4H3X A;  5I43 A;  4XM7 A;  3KEJ A;  2JT5 A;  4G0D A;  4I35 A;  3LQ0 A;  2WOA A;  2OI0 A;  2X3C A;  3U1R A;  5L79 A;  3BA0 A;  2OW2 A;  5BPA A;  1XUR A;  1D7X A;  1A85 A;  1ND1 A;  3K7N A;  4XM8 A;  1K7Q A;  1AKL A;  5JMY A;  1ZXC A;  4WK7 A;  2J0T A;  4JQG A;  1FBL A;  2V4B A;  4GUY A;  4AIG A;  1JIZ A;  1QJI A;  2W14 A;  2N8R A;  2OXW A;  1SLM A;  5CUH A;  1KBC A;  3N2V A;  3KRY A;  4DPE A;  5I3M A;  4I03 A;  4J4M A;  4HMA A;  3TS4 A;  1RM8 A;  4HX3 A;  2RJP A;  4JP4 A;  4DD8 A;  4JPA A;  3AYU A;  5BOY A;  1KUK A;  1YQY A;  3LMC A;  2W13 A;  4ON1 A;  1A86 A;  1J7N A;  2QPJ A;  4AYK A;  1G12 A;  3F15 A;  1QIA A;  1C7K A;  3EDI A;  4GQL A;  3HBU P;  2O36 A;  2ERP A;  3HDA P;  3I7I A;  4PKS A;  1SRP A;  3F17 A;  4WF6 A;  3ZXH A;  1UTT A;  3HY9 A;  5D2B A;  4PKT A;  1GXD A;  1ZVX A;  4H30 A;  3EWJ A;  1DTH A;  5D3C A;  3LJZ A;  456C A;  1JAQ A;  3P24 A;  4L19 A;  1JAP A;  1L6J A;  3G42 A;  1MMR A;  1XM5 A;  2OW1 A;  1S4B P;  1H71 P;  1KUG A;  2X3B A;  1XUC A;  2OZR A;  3ELM A;  4XBH A;  1GE5 A;  2USN A;  3DL1 A;  1R1I A;  2W12 A;  4H84 A;  1UMT A;  5I2Z A;  2HU6 A;  3LGP A;  2D1N A;  4ZR5 A;  2L0R A;  4PKW A;  1BM6 A;  1BZS A;  1GKC A;  4H76 A;  1EB6 A;  3LEA A;  4JA1 A;  1BIW A;  3LUM A;  1IAB A;  3LJT A;  3O64 A;  3DTK A;  4A3W A;  1B3D A;  4L63 A;  3DPE A;  1YCM A;  1CAQ A;  2D1O A;  2MLS A;  2W0D A;  4AXQ A;  4IN9 A;  1HOV A;  3TSK A;  3LIK A;  1XFY A;  1KUI A;  1DMT A;  4G9L A;  1OS9 A;  3LK8 A;  3WV1 A;  1GO7 P;  5CXA A;  5I4O A;  1EAK A;  3LIL A;  3USN A;  1UMS A;  1OMJ A;  1XFX A;  1Y93 A;  5H8X A;  1R55 A;  3DPF A;  1MNC A;  1ATL A;  1CGF A;  2DW2 A;  3HY7 A;  4GWM A;  3DTE A;  1ZP5 A;  2MLR A;  5B5P A;  4GWN A;  1SU3 A;  3L0V A;  3TT4 A;  3E8R A;  4IJO A;  1SAT A;  3EHY A;  1CQR A;  1D8M A;  2FV9 A;  1C8T A; 
#chains in the Genus database with same CATH homology
 2X7M A;  3LKA A;  3EDZ A;  3HBV P;  1O0Q A;  2JIH A;  3LIR A;  1ZTQ A;  1JIW P;  3SHI A;  1HFS A;  2YB9 A;  1PWP A;  3N2U A;  2I47 A;  3GBO A;  1KUF A;  2A8H A;  1CK7 A;  1Y0V A;  3KWV C;  3B2Z A;  4Q1L A;  3CKI A;  3LJG A;  4L7A A;  4GF1 A;  1IAD A;  1IAC A;  1Q3A A;  4EFS A;  1B8Y A;  2OXU A;  1ZS0 A;  3KHI A;  1IAA A;  2CKI A;  2DDF A;  2Z2D A;  1FM1 A;  4A7B A;  2YUF A;  1EUB A;  2POJ A;  1PWU A;  2TCL A;  1I1I P;  3KME A;  3DWB A;  1OM7 A;  2OW9 A;  3LUN A;  4XM6 A;  4WZV A;  4PKU A;  5B5O A;  1G9K A;  1G05 A;  2Y6D A;  4H82 A;  1HY7 A;  2OW0 A;  1O0T A;  1SMP A;  2X3A A;  2OY2 A;  3HDB A;  1CGE A;  2MZH A;  3K7L A;  2WO8 A;  4PKV A;  1MMQ A;  2PJT A;  1G49 A;  4CTH A;  1XFV A;  2MZI A;  3OHL A;  1K7I A;  1BUD A;  1I73 A;  2J83 A;  4ILW D;  3V96 B;  830C A;  3DSL A;  3WV2 A;  3OHO A;  2DW1 A;  4GR3 A;  3G5C A;  1BKC I;  2O3E A;  1HTD A;  3UVC A;  1HFC A;  3KEC A;  3L0T A;  1IAE A;  5D1U A;  2XS3 A;  1K7G A;  1D8F A;  1JKY A;  1BUV M;  1GKD A;  1Z3J A;  1XFW A;  4L6T A;  1CXV A;  3NX7 A;  3LQB A;  4DV8 A;  5L7F A;  1JAO A;  2KRJ A;  1XFU A;  1I76 A;  1UEA A;  1PWQ A;  4H49 A;  1GE6 A;  5D1S A;  1CGL A;  4IUW A;  4WKE A;  2E3X A;  4H2E A;  1JJ9 A;  5LAB A;  2Y6C A;  1QIB A;  1PWV A;  2OVX A;  2MZE A;  5I0L A;  4XCT A;  3F18 A;  4GR8 A;  1KAP P;  2FV5 A;  2SRT A;  3B92 A;  3ZUK A;  3RTT A;  2JT6 A;  2YIG A;  3AYK A;  3Q2H A;  2JSD A;  1BQO A;  1MMB A;  5BOT A;  2W15 A;  1GO8 P;  4DF9 A;  1USN A;  4H1Q A;  1XFZ A;  1PWW A;  2ERQ A;  1HV5 A;  1IAG A;  1QUA A;  1R54 A;  1RMZ A;  1OM6 A;  966C A;  2OVZ A;  3F19 A;  1AF0 A;  1FLS A;  2WO9 A;  1G4K A;  4PKQ A;  3DTI A;  1BQQ M;  3VI1 A;  2AYK A;  3Q2G A;  4WKI A;  3EDH A;  2AIG P;  3DNG A;  1D5J A;  4GR0 A;  2CLT A;  4R3V A;  1Y8J A;  3I7G A;  4FXQ A;  1OM8 A;  3TVC A;  2ERO A;  4FXY P;  3WV3 A;  4AUO A;  3F16 A;  1ZXV A;  2OY4 A;  1UTZ A;  1R1J A;  1BSW A;  1R1H A;  1SLN A;  1QIC A;  3KMC A;  1AST A;  1WNI A;  4FVL A;  3EDG A;  3P1V A;  2JNP A;  3ZVS A;  1AYK A;  3HYG A;  1MMP A;  1OS2 A;  3O2X A;  3B8Z A;  2K9C A;  3KEK A;  3HB2 P;  3EHX A;  3VTG A;  2K2G A;  1YOU A;  1CIZ A;  1BKC E;  1JAN A;  3AIG A;  5I12 A;  2DW0 A;  1BKC A;  1OO9 A;  4JIJ A;  1KUH A;  3F1A A;  2E2D A;  2OXZ A;  1JK3 A;  2XS4 A;  2RJQ A;  3LE9 A;  1C3I A;  1GE7 A;  1YP1 A;  2DDY A;  4PKR A;  4QKZ A;  4FU4 A;  5CZM A;  1XUD A;  1ROS A;  3RTS A;  1JH1 A;  3MA2 A;  5D7W A;  5D1T A;  1QJJ A;  4H3X A;  5I43 A;  4XM7 A;  3KEJ A;  2JT5 A;  4G0D A;  4I35 A;  3LQ0 A;  2WOA A;  2OI0 A;  2X3C A;  3U1R A;  5L79 A;  3BA0 A;  2OW2 A;  5BPA A;  1XUR A;  1D7X A;  1A85 A;  1ND1 A;  3K7N A;  4XM8 A;  1K7Q A;  1AKL A;  5JMY A;  1ZXC A;  4WK7 A;  2J0T A;  4JQG A;  1FBL A;  2V4B A;  4GUY A;  4AIG A;  1JIZ A;  1QJI A;  2W14 A;  2N8R A;  2OXW A;  1SLM A;  5CUH A;  1KBC A;  3N2V A;  3KRY A;  4DPE A;  5I3M A;  4I03 A;  4J4M A;  4HMA A;  3TS4 A;  1RM8 A;  4HX3 A;  2RJP A;  4JP4 A;  4DD8 A;  4JPA A;  3AYU A;  5BOY A;  1KUK A;  1YQY A;  3LMC A;  2W13 A;  4ON1 A;  1A86 A;  1J7N A;  2QPJ A;  4AYK A;  1G12 A;  3F15 A;  1QIA A;  1C7K A;  3EDI A;  4GQL A;  3HBU P;  2O36 A;  2ERP A;  3HDA P;  3I7I A;  4PKS A;  1SRP A;  3F17 A;  4WF6 A;  3ZXH A;  1UTT A;  3HY9 A;  5D2B A;  4PKT A;  1GXD A;  1ZVX A;  4H30 A;  3EWJ A;  1DTH A;  5D3C A;  3LJZ A;  456C A;  1JAQ A;  3P24 A;  4L19 A;  1JAP A;  1L6J A;  3G42 A;  1MMR A;  2OW1 A;  1S4B P;  1H71 P;  1KUG A;  2X3B A;  1XUC A;  2OZR A;  3ELM A;  4XBH A;  1GE5 A;  2USN A;  3DL1 A;  1R1I A;  2W12 A;  4H84 A;  1UMT A;  5I2Z A;  2HU6 A;  3LGP A;  2D1N A;  4ZR5 A;  2L0R A;  4PKW A;  1BM6 A;  1BZS A;  1GKC A;  4H76 A;  1EB6 A;  3LEA A;  4JA1 A;  1BIW A;  3LUM A;  1IAB A;  3LJT A;  3O64 A;  3DTK A;  4A3W A;  1B3D A;  4L63 A;  3DPE A;  1YCM A;  1CAQ A;  2D1O A;  2MLS A;  2W0D A;  4AXQ A;  4IN9 A;  1HOV A;  3TSK A;  3LIK A;  1XFY A;  1KUI A;  1DMT A;  4G9L A;  1OS9 A;  3LK8 A;  3WV1 A;  1GO7 P;  5CXA A;  5I4O A;  1EAK A;  3LIL A;  3USN A;  1UMS A;  1OMJ A;  1XFX A;  1Y93 A;  5H8X A;  1R55 A;  3DPF A;  1MNC A;  1ATL A;  1CGF A;  2DW2 A;  3HY7 A;  4GWM A;  3DTE A;  1ZP5 A;  2MLR A;  5B5P A;  4GWN A;  1SU3 A;  3L0V A;  3TT4 A;  3E8R A;  4IJO A;  1SAT A;  3EHY A;  1CQR A;  1D8M A;  2FV9 A;  1C8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...