4JQGA

Crystal structure of an inactive mutant of mmp-9 catalytic domain in complex with a fluorogenic synthetic peptidic substrate with a fluorine atom.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
GFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHAFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Halogen Bonding Controls Selectivity of FRET Substrate Probes for MMP-9.
pubmed doi rcsb
molecule keywords fluorogenic peptidic substrate (8MC)PLG(PFF)(DNW)AR(NH2)
molecule tags Hydrolase/substrate
source organism Homo sapiens
total genus 46
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4jqgA00
1J7NA 3O64A 3HB2P 2WOAA 1R54A 2JT5A 1JAPA 3V96B 3LJTA 2DW2A 3TSKA 1GKDA 3RTSA 1QIBA 1QJJA 3G42A 3LUMA 1MMBA 5B5PA 4L6TA 1FLSA 4I03A 3P1VA 4A3WA 4CTHA 3EHYA 5CXAA 1UMTA 3L0VA 4JA1A 3Q2HA 966CA 4H82A 1QICA 4J4MA 2W14A 1JIWP 1G05A 3KEJA 1MNCA 3KRYA 3L0TA 4ILWD 4IUWA 1A85A 3ZVSA 5BOTA 4PKWA 2Y6DA 1XFVA 1R1HA 3EHXA 1R1JA 1AKLA 1BSWA 2OW9A 1Z3JA 3LIKA 1UTZA 2X3BA 2K2GA 1GO8P 2DW0A 3DPFA 2X7MA 2MZEA 4AUOA 2K9CA 1BUVM 3TT4A 2OW1A 4XM6A 3DPEA 4PKRA 2X3CA 3LQBA 2OXUA 3O2XA 5LABA 3F18A 1YCMA 4G9LA 2I47A 4H1QA 1A86A 1ZS0A 2D1NA 3DNGA 3EDGA 3F1AA 1OS9A 1HY7A 1SMPA 1CK7A 1CAQA 2DDFA 1CGFA 2HU6A 3LK8A 4H84A 1QUAA 1UEAA 1H71P 5I4OA 4FXYP 1I73A 1IAAA 1DTHA 5CZMA 2OW0A 4ZR5A 3RTTA 3P24A 3LILA 3TVCA 1HFSA 1MMRA 2ERQA 2W12A 3B92A 3DSLA 4I35A 1XFUA 3KMEA 1JANA 1ZXVA 1CQRA 3HY9A 4WK7A 3LJGA 4HX3A 1BZSA 1CIZA 4GR3A 5D2BA 1GXDA 2N8RA 2WO9A 5D3CA 2D1OA 3WV2A 4JIJA 1ZTQA 1O0QA 1C7KA 1ASTA 4R3VA 3F15A 2XS4A 3EDIA 2E2DA 4PKVA 1IAGA 1QIAA 1K7GA 1DMTA 3BA0A 1BQOA 1JJ9A 1OS2A 1JAOA 1BQQM 1KUFA 1RMZA 1GO7P 1CXVA 3TS4A 1GE5A 3ZXHA 1XUCA 5CUHA 1USNA 2W15A 2RJQA 3HDBA 4JPAA 4ON1A 5L7FA 1BUDA 1G49A 4JQGA 4DD8A 4XM7A 2JIHA 3E8RA 1ATLA 1OO9A 4GF1A 3LJZA 4AYKA 1XURA 3GBOA 1D8FA 1PWVA 1ZP5A 2W13A 2MLRA 4GR0A 2J0TA 2JNPA 1IAEA 4GQLA 5JMYA 1BKCE 4WKIA 3AYUA 3N2UA 3B2ZA 5H8XA 1B8YA 2MZHA 5D7WA 3VTGA 2JSDA 3N2VA 4GWMA 3OHLA 1PWPA 1R1IA 1IADA 2OXZA 3SHIA 1XFZA 4H3XA 4H49A 3MA2A 3LGPA 1OM6A 456CA 3WV1A 2EROA 1JAQA 1SU3A 2WO8A 2W0DA 1R55A 4GUYA 4WF6A 1JIZA 2E3XA 1Y93A 5I3MA 3DL1A 1HOVA 1K7QA 2O36A 2O3EA 1K7IA 3LEAA 4IN9A 4DF9A 3I7IA 1C3IA 2JT6A 1YOUA 4WKEA 2XS3A 4PKUA 1KBCA 1G12A 2TCLA 3F16A 3ELMA 1XUDA 5BPAA 1OM8A 1BM6A 2FV5A 4EFSA 3EWJA 3HBUP 5D1UA 2DDYA 4IJOA 2AIGP 5L79A 1CGLA 3LIRA 1D5JA 1KUIA 1PWQA 1KAPP 4PKQA 1GE6A 1JH1A 3HDAP 2V4BA 1SLMA 1CGEA 2FV9A 1BKCA 1HFCA 1Y8JA 3I7GA 1JKYA 2PJTA 3HY7A 4WZVA 1I1IP 4H30A 1BIWA 1ZXCA 1FM1A 4PKTA 1Q3AA 1KUKA 3K7LA 3VI1A 2Z2DA 3WV3A 1L6JA 3LQ0A 1O0TA 4FVLA 2DW1A 1S4BP 1IABA 2J83A 3LMCA 1ROSA 5BOYA 830CA 3EDZA 4L63A 3KHIA 3KECA 1SATA 3U1RA 2YIGA 2RJPA 1JK3A 4DV8A 1Y0VA 1GE7A 4H76A 1MMPA 3G5CA 3B8ZA 1XFXA 2QPJA 3UVCA 1FBLA 1KUHA 2KRJA 5I43A 2OY4A 1RM8A 3HYGA 3KMCA 2OZRA 2CKIA 4L19A 2ERPA 1GKCA 2X3AA 4H2EA 1C8TA 1BKCI 3AYKA 1HTDA 3F17A 1UTTA 1G4KA 2OVXA 4DPEA 4GWNA 1YQYA 1WNIA 3LUNA 3K7NA 4Q1LA 2OW2A 5B5OA 1SRPA 2OXWA 4A7BA 1OM7A 1EB6A 1B3DA 5I2ZA 3CKIA 2YB9A 3DWBA 1D8MA 1KUGA 1ND1A 3OHOA 1I76A 4G0DA 1MMQA 1XFYA 2CLTA 1ZVXA 3NX7A 1EAKA 4GR8A 2OVZA 2A8HA 4XBHA 3KEKA 1EUBA 1PWUA 5D1SA 1IACA 1AF0A 4JP4A 3F19A 4XM8A 1AYKA 5I12A 1UMSA 2MZIA 1SLNA 1YP1A 1G9KA 2POJA 1PWWA 3Q2GA 4PKSA 1OMJA 2AYKA 3USNA 4AIGA 3EDHA 3KWVC 4QKZA 4HMAA 5I0LA 3HBVP 3ZUKA 2Y6CA 2USNA 2L0RA 2OY2A 4XCTA 1HV5A 4AXQA 1XFWA 3LE9A 3LKAA 2SRTA 5D1TA 4FU4A 4FXQA 3AIGA 2OI0A 1D7XA 2MLSA 1QJIA
chains in the Genus database with same CATH superfamily
1J7NA 3DTKA 3O64A 3HB2P 2WOAA 1R54A 2JT5A 1JAPA 3V96B 3LJTA 2DW2A 3TSKA 1GKDA 3RTSA 1TVIA 1QIBA 1QJJA 3G42A 3LUMA 1MMBA 5B5PA 4L6TA 1FLSA 4I03A 3P1VA 4A3WA 4CTHA 3EHYA 5CXAA 1UMTA 3L0VA 4JA1A 3Q2HA 966CA 4H82A 1QICA 4J4MA 2W14A 1JIWP 1G05A 3KEJA 1MNCA 3KRYA 3L0TA 4ILWD 4IUWA 1A85A 3ZVSA 5BOTA 4PKWA 2Y6DA 1XFVA 1R1HA 3DTEA 3EHXA 1R1JA 1AKLA 1BSWA 2OW9A 1Z3JA 3LIKA 1UTZA 2X3BA 2K2GA 1GO8P 2DW0A 3DPFA 2X7MA 2MZEA 4AUOA 2K9CA 1BUVM 3TT4A 2OW1A 4XM6A 3DPEA 4PKRA 2X3CA 3LQBA 2OXUA 3O2XA 5LABA 3F18A 1YCMA 4G9LA 2I47A 4H1QA 1A86A 1ZS0A 2D1NA 3DNGA 3EDGA 3F1AA 1OS9A 1HY7A 1SMPA 1CK7A 1CAQA 2DDFA 1CGFA 2HU6A 3LK8A 4H84A 1QUAA 1OZ9A 1UEAA 1H71P 5I4OA 4FXYP 1I73A 1IAAA 1DTHA 5CZMA 2OW0A 4ZR5A 3RTTA 3P24A 3LILA 3TVCA 1HFSA 1MMRA 2ERQA 2W12A 3B92A 3DSLA 4I35A 1XFUA 3KMEA 1JANA 1ZXVA 1CQRA 3HY9A 4WK7A 3LJGA 4HX3A 1BZSA 1CIZA 4GR3A 5D2BA 1GXDA 2N8RA 2WO9A 5D3CA 2D1OA 3WV2A 4JIJA 1ZTQA 1O0QA 1C7KA 1ASTA 4R3VA 3F15A 2XS4A 3EDIA 2E2DA 4PKVA 1IAGA 1QIAA 1K7GA 1DMTA 3BA0A 1BQOA 1JJ9A 1OS2A 1JAOA 1BQQM 1KUFA 1RMZA 1GO7P 1CXVA 3TS4A 1GE5A 3ZXHA 1XUCA 5CUHA 1USNA 2W15A 2RJQA 3HDBA 4JPAA 4ON1A 5L7FA 1BUDA 1G49A 4JQGA 4DD8A 4XM7A 2JIHA 3E8RA 1ATLA 1OO9A 4GF1A 3LJZA 4AYKA 1XURA 3GBOA 1D8FA 1PWVA 1ZP5A 2W13A 2MLRA 4GR0A 2J0TA 2JNPA 1IAEA 4GQLA 5JMYA 1BKCE 4WKIA 3AYUA 3N2UA 3B2ZA 5H8XA 1B8YA 2MZHA 5D7WA 3VTGA 2JSDA 1XAXA 3N2VA 4GWMA 3OHLA 1PWPA 1R1IA 1IADA 2OXZA 3SHIA 1XFZA 4H3XA 4H49A 3MA2A 3LGPA 1OM6A 456CA 3WV1A 1XM5A 2EROA 1JAQA 1SU3A 2WO8A 2W0DA 1R55A 4GUYA 4WF6A 1JIZA 2E3XA 1Y93A 5I3MA 3DL1A 1HOVA 1K7QA 2O36A 2O3EA 1K7IA 3LEAA 4IN9A 4DF9A 3I7IA 1C3IA 2JT6A 1YOUA 4WKEA 2XS3A 4PKUA 1KBCA 1G12A 2TCLA 3F16A 3ELMA 1XUDA 5BPAA 1OM8A 1BM6A 2FV5A 4EFSA 3EWJA 3HBUP 5D1UA 2DDYA 4IJOA 2AIGP 5L79A 1CGLA 3LIRA 1D5JA 1KUIA 1PWQA 1KAPP 4PKQA 1GE6A 1JH1A 3HDAP 2V4BA 1SLMA 1CGEA 2FV9A 1BKCA 1HFCA 1Y8JA 3I7GA 1JKYA 2PJTA 3HY7A 4WZVA 1I1IP 4H30A 1BIWA 1ZXCA 1FM1A 4PKTA 1Q3AA 1KUKA 3K7LA 3VI1A 2Z2DA 3WV3A 1L6JA 3LQ0A 1O0TA 4FVLA 2DW1A 1S4BP 1IABA 2J83A 3LMCA 1ROSA 5BOYA 830CA 3EDZA 4L63A 3KHIA 3KECA 1SATA 3DTIA 3U1RA 2YIGA 2RJPA 1JK3A 4DV8A 1Y0VA 1GE7A 4H76A 1MMPA 3G5CA 3B8ZA 1XFXA 2QPJA 3UVCA 1FBLA 1KUHA 2KRJA 5I43A 2OY4A 1RM8A 3HYGA 3KMCA 2OZRA 2CKIA 4L19A 2ERPA 1GKCA 2X3AA 4H2EA 1C8TA 1BKCI 3AYKA 1HTDA 3F17A 1UTTA 1G4KA 2OVXA 4DPEA 4GWNA 1YQYA 1WNIA 3LUNA 3K7NA 4Q1LA 2OW2A 5B5OA 1SRPA 2OXWA 4A7BA 1OM7A 1EB6A 1B3DA 5I2ZA 3CKIA 2YB9A 3DWBA 1D8MA 1KUGA 1ND1A 3OHOA 1I76A 4G0DA 1MMQA 1XFYA 2CLTA 1ZVXA 3NX7A 1EAKA 4GR8A 2OVZA 2A8HA 4XBHA 3KEKA 1EUBA 1PWUA 5D1SA 1IACA 4L7AA 1AF0A 4JP4A 3F19A 4XM8A 1AYKA 5I12A 1UMSA 2MZIA 1SLNA 1YP1A 1G9KA 2POJA 1PWWA 3Q2GA 4PKSA 1OMJA 2AYKA 3USNA 4AIGA 3EDHA 3KWVC 4QKZA 4HMAA 5I0LA 3HBVP 3ZUKA 2Y6CA 2USNA 2L0RA 2OY2A 4XCTA 1HV5A 4AXQA 1XFWA 3LE9A 3LKAA 2SRTA 5D1TA 4FU4A 4FXQA 2YUFA 3AIGA 2OI0A 1D7XA 2MLSA 1QJIA
chains in the Genus database with same CATH topology
1J7NA 3DTKA 3O64A 3HB2P 2WOAA 1R54A 2JT5A 1JAPA 3V96B 3LJTA 2DW2A 3TSKA 1GKDA 3RTSA 1QIBA 1QJJA 3G42A 3LUMA 1MMBA 5B5PA 4L6TA 1FLSA 4I03A 3P1VA 4A3WA 4CTHA 3EHYA 5CXAA 1UMTA 3L0VA 4JA1A 3Q2HA 966CA 4H82A 1QICA 4J4MA 2W14A 1JIWP 1G05A 3KEJA 1MNCA 3KRYA 3L0TA 4ILWD 4IUWA 1A85A 3ZVSA 5BOTA 4PKWA 2Y6DA 1XFVA 1R1HA 3DTEA 3EHXA 1R1JA 1AKLA 1BSWA 2OW9A 1Z3JA 3LIKA 1UTZA 2X3BA 2K2GA 1GO8P 2DW0A 3DPFA 2X7MA 2MZEA 4AUOA 2K9CA 1BUVM 3TT4A 2OW1A 4XM6A 3DPEA 4PKRA 2X3CA 3LQBA 2OXUA 3O2XA 5LABA 3F18A 1YCMA 4G9LA 2I47A 4H1QA 1A86A 1ZS0A 2D1NA 3DNGA 3EDGA 3F1AA 1OS9A 1HY7A 1SMPA 1CK7A 1CAQA 2DDFA 1CGFA 2HU6A 3LK8A 4H84A 1QUAA 1UEAA 1H71P 5I4OA 4FXYP 1I73A 1IAAA 1DTHA 5CZMA 2OW0A 4ZR5A 3RTTA 3P24A 3LILA 3TVCA 1HFSA 1MMRA 2ERQA 2W12A 3B92A 3DSLA 4I35A 1XFUA 3KMEA 1JANA 1ZXVA 1CQRA 3HY9A 4WK7A 3LJGA 4HX3A 1BZSA 1CIZA 4GR3A 5D2BA 1GXDA 2N8RA 2WO9A 5D3CA 2D1OA 3WV2A 4JIJA 1ZTQA 1O0QA 1C7KA 1ASTA 4R3VA 3F15A 2XS4A 3EDIA 2E2DA 4PKVA 1IAGA 1QIAA 1K7GA 1DMTA 3BA0A 1BQOA 1JJ9A 1OS2A 1JAOA 1BQQM 1KUFA 1RMZA 1GO7P 1CXVA 3TS4A 1GE5A 3ZXHA 1XUCA 5CUHA 1USNA 2W15A 2RJQA 3HDBA 4JPAA 4ON1A 5L7FA 1BUDA 1G49A 4JQGA 4DD8A 4XM7A 2JIHA 3E8RA 1ATLA 1OO9A 4GF1A 3LJZA 4AYKA 1XURA 3GBOA 1D8FA 1PWVA 1ZP5A 2W13A 2MLRA 4GR0A 2J0TA 2JNPA 1IAEA 4GQLA 5JMYA 1BKCE 4WKIA 3AYUA 3N2UA 3B2ZA 5H8XA 1B8YA 2MZHA 5D7WA 3VTGA 2JSDA 3N2VA 4GWMA 3OHLA 1PWPA 1R1IA 1IADA 2OXZA 3SHIA 1XFZA 4H3XA 4H49A 3MA2A 3LGPA 1OM6A 456CA 3WV1A 2EROA 1JAQA 1SU3A 2WO8A 2W0DA 1R55A 4GUYA 4WF6A 1JIZA 2E3XA 1Y93A 5I3MA 3DL1A 1HOVA 1K7QA 2O36A 2O3EA 1K7IA 3LEAA 4IN9A 4DF9A 3I7IA 1C3IA 2JT6A 1YOUA 4WKEA 2XS3A 4PKUA 1KBCA 1G12A 2TCLA 3F16A 3ELMA 1XUDA 5BPAA 1OM8A 1BM6A 2FV5A 4EFSA 3EWJA 3HBUP 5D1UA 2DDYA 4IJOA 2AIGP 5L79A 1CGLA 3LIRA 1D5JA 1KUIA 1PWQA 1KAPP 4PKQA 1GE6A 1JH1A 3HDAP 2V4BA 1SLMA 1CGEA 2FV9A 1BKCA 1HFCA 1Y8JA 3I7GA 1JKYA 2PJTA 3HY7A 4WZVA 1I1IP 4H30A 1BIWA 1ZXCA 1FM1A 4PKTA 1Q3AA 1KUKA 3K7LA 3VI1A 2Z2DA 3WV3A 1L6JA 3LQ0A 1O0TA 4FVLA 2DW1A 1S4BP 1IABA 2J83A 3LMCA 1ROSA 5BOYA 830CA 3EDZA 4L63A 3KHIA 3KECA 1SATA 3DTIA 3U1RA 2YIGA 2RJPA 1JK3A 4DV8A 1Y0VA 1GE7A 4H76A 1MMPA 3G5CA 3B8ZA 1XFXA 2QPJA 3UVCA 1FBLA 1KUHA 2KRJA 5I43A 2OY4A 1RM8A 3HYGA 3KMCA 2OZRA 2CKIA 4L19A 2ERPA 1GKCA 2X3AA 4H2EA 1C8TA 1BKCI 3AYKA 1HTDA 3F17A 1UTTA 1G4KA 2OVXA 4DPEA 4GWNA 1YQYA 1WNIA 3LUNA 3K7NA 4Q1LA 2OW2A 5B5OA 1SRPA 2OXWA 4A7BA 1OM7A 1EB6A 1B3DA 5I2ZA 3CKIA 2YB9A 3DWBA 1D8MA 1KUGA 1ND1A 3OHOA 1I76A 4G0DA 1MMQA 1XFYA 2CLTA 1ZVXA 3NX7A 1EAKA 4GR8A 2OVZA 2A8HA 4XBHA 3KEKA 1EUBA 1PWUA 5D1SA 1IACA 4L7AA 1AF0A 4JP4A 3F19A 4XM8A 1AYKA 5I12A 1UMSA 2MZIA 1SLNA 1YP1A 1G9KA 2POJA 1PWWA 3Q2GA 4PKSA 1OMJA 2AYKA 3USNA 4AIGA 3EDHA 3KWVC 4QKZA 4HMAA 5I0LA 3HBVP 3ZUKA 2Y6CA 2USNA 2L0RA 2OY2A 4XCTA 1HV5A 4AXQA 1XFWA 3LE9A 3LKAA 2SRTA 5D1TA 4FU4A 4FXQA 2YUFA 3AIGA 2OI0A 1D7XA 2MLSA 1QJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7N A;  3O64 A;  3HB2 P;  2WOA A;  1R54 A;  2JT5 A;  1JAP A;  3V96 B;  3LJT A;  2DW2 A;  3TSK A;  1GKD A;  3RTS A;  1QIB A;  1QJJ A;  3G42 A;  3LUM A;  1MMB A;  5B5P A;  4L6T A;  1FLS A;  4I03 A;  3P1V A;  4A3W A;  4CTH A;  3EHY A;  5CXA A;  1UMT A;  3L0V A;  4JA1 A;  3Q2H A;  966C A;  4H82 A;  1QIC A;  4J4M A;  2W14 A;  1JIW P;  1G05 A;  3KEJ A;  1MNC A;  3KRY A;  3L0T A;  4ILW D;  4IUW A;  1A85 A;  3ZVS A;  5BOT A;  4PKW A;  2Y6D A;  1XFV A;  1R1H A;  3EHX A;  1R1J A;  1AKL A;  1BSW A;  2OW9 A;  1Z3J A;  3LIK A;  1UTZ A;  2X3B A;  2K2G A;  1GO8 P;  2DW0 A;  3DPF A;  2X7M A;  2MZE A;  4AUO A;  2K9C A;  1BUV M;  3TT4 A;  2OW1 A;  4XM6 A;  3DPE A;  4PKR A;  2X3C A;  3LQB A;  2OXU A;  3O2X A;  5LAB A;  3F18 A;  1YCM A;  4G9L A;  2I47 A;  4H1Q A;  1A86 A;  1ZS0 A;  2D1N A;  3DNG A;  3EDG A;  3F1A A;  1OS9 A;  1HY7 A;  1SMP A;  1CK7 A;  1CAQ A;  2DDF A;  1CGF A;  2HU6 A;  3LK8 A;  4H84 A;  1QUA A;  1UEA A;  1H71 P;  5I4O A;  4FXY P;  1I73 A;  1IAA A;  1DTH A;  5CZM A;  2OW0 A;  4ZR5 A;  3RTT A;  3P24 A;  3LIL A;  3TVC A;  1HFS A;  1MMR A;  2ERQ A;  2W12 A;  3B92 A;  3DSL A;  4I35 A;  1XFU A;  3KME A;  1JAN A;  1ZXV A;  1CQR A;  3HY9 A;  4WK7 A;  3LJG A;  4HX3 A;  1BZS A;  1CIZ A;  4GR3 A;  5D2B A;  1GXD A;  2N8R A;  2WO9 A;  5D3C A;  2D1O A;  3WV2 A;  4JIJ A;  1ZTQ A;  1O0Q A;  1C7K A;  1AST A;  4R3V A;  3F15 A;  2XS4 A;  3EDI A;  2E2D A;  4PKV A;  1IAG A;  1QIA A;  1K7G A;  1DMT A;  3BA0 A;  1BQO A;  1JJ9 A;  1OS2 A;  1JAO A;  1BQQ M;  1KUF A;  1RMZ A;  1GO7 P;  1CXV A;  3TS4 A;  1GE5 A;  3ZXH A;  1XUC A;  5CUH A;  1USN A;  2W15 A;  2RJQ A;  3HDB A;  4JPA A;  4ON1 A;  5L7F A;  1BUD A;  1G49 A;  4JQG A;  4DD8 A;  4XM7 A;  2JIH A;  3E8R A;  1ATL A;  1OO9 A;  4GF1 A;  3LJZ A;  4AYK A;  1XUR A;  3GBO A;  1D8F A;  1PWV A;  1ZP5 A;  2W13 A;  2MLR A;  4GR0 A;  2J0T A;  2JNP A;  1IAE A;  4GQL A;  5JMY A;  1BKC E;  4WKI A;  3AYU A;  3N2U A;  3B2Z A;  5H8X A;  1B8Y A;  2MZH A;  5D7W A;  3VTG A;  2JSD A;  3N2V A;  4GWM A;  3OHL A;  1PWP A;  1R1I A;  1IAD A;  2OXZ A;  3SHI A;  1XFZ A;  4H3X A;  4H49 A;  3MA2 A;  3LGP A;  1OM6 A;  456C A;  3WV1 A;  2ERO A;  1JAQ A;  1SU3 A;  2WO8 A;  2W0D A;  1R55 A;  4GUY A;  4WF6 A;  1JIZ A;  2E3X A;  1Y93 A;  5I3M A;  3DL1 A;  1HOV A;  1K7Q A;  2O36 A;  2O3E A;  1K7I A;  3LEA A;  4IN9 A;  4DF9 A;  3I7I A;  1C3I A;  2JT6 A;  1YOU A;  4WKE A;  2XS3 A;  4PKU A;  1KBC A;  1G12 A;  2TCL A;  3F16 A;  3ELM A;  1XUD A;  5BPA A;  1OM8 A;  1BM6 A;  2FV5 A;  4EFS A;  3EWJ A;  3HBU P;  5D1U A;  2DDY A;  4IJO A;  2AIG P;  5L79 A;  1CGL A;  3LIR A;  1D5J A;  1KUI A;  1PWQ A;  1KAP P;  4PKQ A;  1GE6 A;  1JH1 A;  3HDA P;  2V4B A;  1SLM A;  1CGE A;  2FV9 A;  1BKC A;  1HFC A;  1Y8J A;  3I7G A;  1JKY A;  2PJT A;  3HY7 A;  4WZV A;  1I1I P;  4H30 A;  1BIW A;  1ZXC A;  1FM1 A;  4PKT A;  1Q3A A;  1KUK A;  3K7L A;  3VI1 A;  2Z2D A;  3WV3 A;  1L6J A;  3LQ0 A;  1O0T A;  4FVL A;  2DW1 A;  1S4B P;  1IAB A;  2J83 A;  3LMC A;  1ROS A;  5BOY A;  830C A;  3EDZ A;  4L63 A;  3KHI A;  3KEC A;  1SAT A;  3U1R A;  2YIG A;  2RJP A;  1JK3 A;  4DV8 A;  1Y0V A;  1GE7 A;  4H76 A;  1MMP A;  3G5C A;  3B8Z A;  1XFX A;  2QPJ A;  3UVC A;  1FBL A;  1KUH A;  2KRJ A;  5I43 A;  2OY4 A;  1RM8 A;  3HYG A;  3KMC A;  2OZR A;  2CKI A;  4L19 A;  2ERP A;  1GKC A;  2X3A A;  4H2E A;  1C8T A;  1BKC I;  3AYK A;  1HTD A;  3F17 A;  1UTT A;  1G4K A;  2OVX A;  4DPE A;  4GWN A;  1YQY A;  1WNI A;  3LUN A;  3K7N A;  4Q1L A;  2OW2 A;  5B5O A;  1SRP A;  2OXW A;  4A7B A;  1OM7 A;  1EB6 A;  1B3D A;  5I2Z A;  3CKI A;  2YB9 A;  3DWB A;  1D8M A;  1KUG A;  1ND1 A;  3OHO A;  1I76 A;  4G0D A;  1MMQ A;  1XFY A;  2CLT A;  1ZVX A;  3NX7 A;  1EAK A;  4GR8 A;  2OVZ A;  2A8H A;  4XBH A;  3KEK A;  1EUB A;  1PWU A;  5D1S A;  1IAC A;  1AF0 A;  4JP4 A;  3F19 A;  4XM8 A;  1AYK A;  5I12 A;  1UMS A;  2MZI A;  1SLN A;  1YP1 A;  1G9K A;  2POJ A;  1PWW A;  3Q2G A;  4PKS A;  1OMJ A;  2AYK A;  3USN A;  4AIG A;  3EDH A;  3KWV C;  4QKZ A;  4HMA A;  5I0L A;  3HBV P;  3ZUK A;  2Y6C A;  2USN A;  2L0R A;  2OY2 A;  4XCT A;  1HV5 A;  4AXQ A;  1XFW A;  3LE9 A;  3LKA A;  2SRT A;  5D1T A;  4FU4 A;  4FXQ A;  3AIG A;  2OI0 A;  1D7X A;  2MLS A;  1QJI A; 
#chains in the Genus database with same CATH topology
 1J7N A;  3DTK A;  3O64 A;  3HB2 P;  2WOA A;  1R54 A;  2JT5 A;  1JAP A;  3V96 B;  3LJT A;  2DW2 A;  3TSK A;  1GKD A;  3RTS A;  1TVI A;  1QIB A;  1QJJ A;  3G42 A;  3LUM A;  1MMB A;  5B5P A;  4L6T A;  1FLS A;  4I03 A;  3P1V A;  4A3W A;  4CTH A;  3EHY A;  5CXA A;  1UMT A;  3L0V A;  4JA1 A;  3Q2H A;  966C A;  4H82 A;  1QIC A;  4J4M A;  2W14 A;  1JIW P;  1G05 A;  3KEJ A;  1MNC A;  3KRY A;  3L0T A;  4ILW D;  4IUW A;  1A85 A;  3ZVS A;  5BOT A;  4PKW A;  2Y6D A;  1XFV A;  1R1H A;  3DTE A;  3EHX A;  1R1J A;  1AKL A;  1BSW A;  2OW9 A;  1Z3J A;  3LIK A;  1UTZ A;  2X3B A;  2K2G A;  1GO8 P;  2DW0 A;  3DPF A;  2X7M A;  2MZE A;  4AUO A;  2K9C A;  1BUV M;  3TT4 A;  2OW1 A;  4XM6 A;  3DPE A;  4PKR A;  2X3C A;  3LQB A;  2OXU A;  3O2X A;  5LAB A;  3F18 A;  1YCM A;  4G9L A;  2I47 A;  4H1Q A;  1A86 A;  1ZS0 A;  2D1N A;  3DNG A;  3EDG A;  3F1A A;  1OS9 A;  1HY7 A;  1SMP A;  1CK7 A;  1CAQ A;  2DDF A;  1CGF A;  2HU6 A;  3LK8 A;  4H84 A;  1QUA A;  1OZ9 A;  1UEA A;  1H71 P;  5I4O A;  4FXY P;  1I73 A;  1IAA A;  1DTH A;  5CZM A;  2OW0 A;  4ZR5 A;  3RTT A;  3P24 A;  3LIL A;  3TVC A;  1HFS A;  1MMR A;  2ERQ A;  2W12 A;  3B92 A;  3DSL A;  4I35 A;  1XFU A;  3KME A;  1JAN A;  1ZXV A;  1CQR A;  3HY9 A;  4WK7 A;  3LJG A;  4HX3 A;  1BZS A;  1CIZ A;  4GR3 A;  5D2B A;  1GXD A;  2N8R A;  2WO9 A;  5D3C A;  2D1O A;  3WV2 A;  4JIJ A;  1ZTQ A;  1O0Q A;  1C7K A;  1AST A;  4R3V A;  3F15 A;  2XS4 A;  3EDI A;  2E2D A;  4PKV A;  1IAG A;  1QIA A;  1K7G A;  1DMT A;  3BA0 A;  1BQO A;  1JJ9 A;  1OS2 A;  1JAO A;  1BQQ M;  1KUF A;  1RMZ A;  1GO7 P;  1CXV A;  3TS4 A;  1GE5 A;  3ZXH A;  1XUC A;  5CUH A;  1USN A;  2W15 A;  2RJQ A;  3HDB A;  4JPA A;  4ON1 A;  5L7F A;  1BUD A;  1G49 A;  4JQG A;  4DD8 A;  4XM7 A;  2JIH A;  3E8R A;  1ATL A;  1OO9 A;  4GF1 A;  3LJZ A;  4AYK A;  1XUR A;  3GBO A;  1D8F A;  1PWV A;  1ZP5 A;  2W13 A;  2MLR A;  4GR0 A;  2J0T A;  2JNP A;  1IAE A;  4GQL A;  5JMY A;  1BKC E;  4WKI A;  3AYU A;  3N2U A;  3B2Z A;  5H8X A;  1B8Y A;  2MZH A;  5D7W A;  3VTG A;  2JSD A;  1XAX A;  3N2V A;  4GWM A;  3OHL A;  1PWP A;  1R1I A;  1IAD A;  2OXZ A;  3SHI A;  1XFZ A;  4H3X A;  4H49 A;  3MA2 A;  3LGP A;  1OM6 A;  456C A;  3WV1 A;  1XM5 A;  2ERO A;  1JAQ A;  1SU3 A;  2WO8 A;  2W0D A;  1R55 A;  4GUY A;  4WF6 A;  1JIZ A;  2E3X A;  1Y93 A;  5I3M A;  3DL1 A;  1HOV A;  1K7Q A;  2O36 A;  2O3E A;  1K7I A;  3LEA A;  4IN9 A;  4DF9 A;  3I7I A;  1C3I A;  2JT6 A;  1YOU A;  4WKE A;  2XS3 A;  4PKU A;  1KBC A;  1G12 A;  2TCL A;  3F16 A;  3ELM A;  1XUD A;  5BPA A;  1OM8 A;  1BM6 A;  2FV5 A;  4EFS A;  3EWJ A;  3HBU P;  5D1U A;  2DDY A;  4IJO A;  2AIG P;  5L79 A;  1CGL A;  3LIR A;  1D5J A;  1KUI A;  1PWQ A;  1KAP P;  4PKQ A;  1GE6 A;  1JH1 A;  3HDA P;  2V4B A;  1SLM A;  1CGE A;  2FV9 A;  1BKC A;  1HFC A;  1Y8J A;  3I7G A;  1JKY A;  2PJT A;  3HY7 A;  4WZV A;  1I1I P;  4H30 A;  1BIW A;  1ZXC A;  1FM1 A;  4PKT A;  1Q3A A;  1KUK A;  3K7L A;  3VI1 A;  2Z2D A;  3WV3 A;  1L6J A;  3LQ0 A;  1O0T A;  4FVL A;  2DW1 A;  1S4B P;  1IAB A;  2J83 A;  3LMC A;  1ROS A;  5BOY A;  830C A;  3EDZ A;  4L63 A;  3KHI A;  3KEC A;  1SAT A;  3DTI A;  3U1R A;  2YIG A;  2RJP A;  1JK3 A;  4DV8 A;  1Y0V A;  1GE7 A;  4H76 A;  1MMP A;  3G5C A;  3B8Z A;  1XFX A;  2QPJ A;  3UVC A;  1FBL A;  1KUH A;  2KRJ A;  5I43 A;  2OY4 A;  1RM8 A;  3HYG A;  3KMC A;  2OZR A;  2CKI A;  4L19 A;  2ERP A;  1GKC A;  2X3A A;  4H2E A;  1C8T A;  1BKC I;  3AYK A;  1HTD A;  3F17 A;  1UTT A;  1G4K A;  2OVX A;  4DPE A;  4GWN A;  1YQY A;  1WNI A;  3LUN A;  3K7N A;  4Q1L A;  2OW2 A;  5B5O A;  1SRP A;  2OXW A;  4A7B A;  1OM7 A;  1EB6 A;  1B3D A;  5I2Z A;  3CKI A;  2YB9 A;  3DWB A;  1D8M A;  1KUG A;  1ND1 A;  3OHO A;  1I76 A;  4G0D A;  1MMQ A;  1XFY A;  2CLT A;  1ZVX A;  3NX7 A;  1EAK A;  4GR8 A;  2OVZ A;  2A8H A;  4XBH A;  3KEK A;  1EUB A;  1PWU A;  5D1S A;  1IAC A;  4L7A A;  1AF0 A;  4JP4 A;  3F19 A;  4XM8 A;  1AYK A;  5I12 A;  1UMS A;  2MZI A;  1SLN A;  1YP1 A;  1G9K A;  2POJ A;  1PWW A;  3Q2G A;  4PKS A;  1OMJ A;  2AYK A;  3USN A;  4AIG A;  3EDH A;  3KWV C;  4QKZ A;  4HMA A;  5I0L A;  3HBV P;  3ZUK A;  2Y6C A;  2USN A;  2L0R A;  2OY2 A;  4XCT A;  1HV5 A;  4AXQ A;  1XFW A;  3LE9 A;  3LKA A;  2SRT A;  5D1T A;  4FU4 A;  4FXQ A;  2YUF A;  3AIG A;  2OI0 A;  1D7X A;  2MLS A;  1QJI A; 
#chains in the Genus database with same CATH homology
 1J7N A;  3DTK A;  3O64 A;  3HB2 P;  2WOA A;  1R54 A;  2JT5 A;  1JAP A;  3V96 B;  3LJT A;  2DW2 A;  3TSK A;  1GKD A;  3RTS A;  1QIB A;  1QJJ A;  3G42 A;  3LUM A;  1MMB A;  5B5P A;  4L6T A;  1FLS A;  4I03 A;  3P1V A;  4A3W A;  4CTH A;  3EHY A;  5CXA A;  1UMT A;  3L0V A;  4JA1 A;  3Q2H A;  966C A;  4H82 A;  1QIC A;  4J4M A;  2W14 A;  1JIW P;  1G05 A;  3KEJ A;  1MNC A;  3KRY A;  3L0T A;  4ILW D;  4IUW A;  1A85 A;  3ZVS A;  5BOT A;  4PKW A;  2Y6D A;  1XFV A;  1R1H A;  3DTE A;  3EHX A;  1R1J A;  1AKL A;  1BSW A;  2OW9 A;  1Z3J A;  3LIK A;  1UTZ A;  2X3B A;  2K2G A;  1GO8 P;  2DW0 A;  3DPF A;  2X7M A;  2MZE A;  4AUO A;  2K9C A;  1BUV M;  3TT4 A;  2OW1 A;  4XM6 A;  3DPE A;  4PKR A;  2X3C A;  3LQB A;  2OXU A;  3O2X A;  5LAB A;  3F18 A;  1YCM A;  4G9L A;  2I47 A;  4H1Q A;  1A86 A;  1ZS0 A;  2D1N A;  3DNG A;  3EDG A;  3F1A A;  1OS9 A;  1HY7 A;  1SMP A;  1CK7 A;  1CAQ A;  2DDF A;  1CGF A;  2HU6 A;  3LK8 A;  4H84 A;  1QUA A;  1UEA A;  1H71 P;  5I4O A;  4FXY P;  1I73 A;  1IAA A;  1DTH A;  5CZM A;  2OW0 A;  4ZR5 A;  3RTT A;  3P24 A;  3LIL A;  3TVC A;  1HFS A;  1MMR A;  2ERQ A;  2W12 A;  3B92 A;  3DSL A;  4I35 A;  1XFU A;  3KME A;  1JAN A;  1ZXV A;  1CQR A;  3HY9 A;  4WK7 A;  3LJG A;  4HX3 A;  1BZS A;  1CIZ A;  4GR3 A;  5D2B A;  1GXD A;  2N8R A;  2WO9 A;  5D3C A;  2D1O A;  3WV2 A;  4JIJ A;  1ZTQ A;  1O0Q A;  1C7K A;  1AST A;  4R3V A;  3F15 A;  2XS4 A;  3EDI A;  2E2D A;  4PKV A;  1IAG A;  1QIA A;  1K7G A;  1DMT A;  3BA0 A;  1BQO A;  1JJ9 A;  1OS2 A;  1JAO A;  1BQQ M;  1KUF A;  1RMZ A;  1GO7 P;  1CXV A;  3TS4 A;  1GE5 A;  3ZXH A;  1XUC A;  5CUH A;  1USN A;  2W15 A;  2RJQ A;  3HDB A;  4JPA A;  4ON1 A;  5L7F A;  1BUD A;  1G49 A;  4JQG A;  4DD8 A;  4XM7 A;  2JIH A;  3E8R A;  1ATL A;  1OO9 A;  4GF1 A;  3LJZ A;  4AYK A;  1XUR A;  3GBO A;  1D8F A;  1PWV A;  1ZP5 A;  2W13 A;  2MLR A;  4GR0 A;  2J0T A;  2JNP A;  1IAE A;  4GQL A;  5JMY A;  1BKC E;  4WKI A;  3AYU A;  3N2U A;  3B2Z A;  5H8X A;  1B8Y A;  2MZH A;  5D7W A;  3VTG A;  2JSD A;  3N2V A;  4GWM A;  3OHL A;  1PWP A;  1R1I A;  1IAD A;  2OXZ A;  3SHI A;  1XFZ A;  4H3X A;  4H49 A;  3MA2 A;  3LGP A;  1OM6 A;  456C A;  3WV1 A;  2ERO A;  1JAQ A;  1SU3 A;  2WO8 A;  2W0D A;  1R55 A;  4GUY A;  4WF6 A;  1JIZ A;  2E3X A;  1Y93 A;  5I3M A;  3DL1 A;  1HOV A;  1K7Q A;  2O36 A;  2O3E A;  1K7I A;  3LEA A;  4IN9 A;  4DF9 A;  3I7I A;  1C3I A;  2JT6 A;  1YOU A;  4WKE A;  2XS3 A;  4PKU A;  1KBC A;  1G12 A;  2TCL A;  3F16 A;  3ELM A;  1XUD A;  5BPA A;  1OM8 A;  1BM6 A;  2FV5 A;  4EFS A;  3EWJ A;  3HBU P;  5D1U A;  2DDY A;  4IJO A;  2AIG P;  5L79 A;  1CGL A;  3LIR A;  1D5J A;  1KUI A;  1PWQ A;  1KAP P;  4PKQ A;  1GE6 A;  1JH1 A;  3HDA P;  2V4B A;  1SLM A;  1CGE A;  2FV9 A;  1BKC A;  1HFC A;  1Y8J A;  3I7G A;  1JKY A;  2PJT A;  3HY7 A;  4WZV A;  1I1I P;  4H30 A;  1BIW A;  1ZXC A;  1FM1 A;  4PKT A;  1Q3A A;  1KUK A;  3K7L A;  3VI1 A;  2Z2D A;  3WV3 A;  1L6J A;  3LQ0 A;  1O0T A;  4FVL A;  2DW1 A;  1S4B P;  1IAB A;  2J83 A;  3LMC A;  1ROS A;  5BOY A;  830C A;  3EDZ A;  4L63 A;  3KHI A;  3KEC A;  1SAT A;  3DTI A;  3U1R A;  2YIG A;  2RJP A;  1JK3 A;  4DV8 A;  1Y0V A;  1GE7 A;  4H76 A;  1MMP A;  3G5C A;  3B8Z A;  1XFX A;  2QPJ A;  3UVC A;  1FBL A;  1KUH A;  2KRJ A;  5I43 A;  2OY4 A;  1RM8 A;  3HYG A;  3KMC A;  2OZR A;  2CKI A;  4L19 A;  2ERP A;  1GKC A;  2X3A A;  4H2E A;  1C8T A;  1BKC I;  3AYK A;  1HTD A;  3F17 A;  1UTT A;  1G4K A;  2OVX A;  4DPE A;  4GWN A;  1YQY A;  1WNI A;  3LUN A;  3K7N A;  4Q1L A;  2OW2 A;  5B5O A;  1SRP A;  2OXW A;  4A7B A;  1OM7 A;  1EB6 A;  1B3D A;  5I2Z A;  3CKI A;  2YB9 A;  3DWB A;  1D8M A;  1KUG A;  1ND1 A;  3OHO A;  1I76 A;  4G0D A;  1MMQ A;  1XFY A;  2CLT A;  1ZVX A;  3NX7 A;  1EAK A;  4GR8 A;  2OVZ A;  2A8H A;  4XBH A;  3KEK A;  1EUB A;  1PWU A;  5D1S A;  1IAC A;  4L7A A;  1AF0 A;  4JP4 A;  3F19 A;  4XM8 A;  1AYK A;  5I12 A;  1UMS A;  2MZI A;  1SLN A;  1YP1 A;  1G9K A;  2POJ A;  1PWW A;  3Q2G A;  4PKS A;  1OMJ A;  2AYK A;  3USN A;  4AIG A;  3EDH A;  3KWV C;  4QKZ A;  4HMA A;  5I0L A;  3HBV P;  3ZUK A;  2Y6C A;  2USN A;  2L0R A;  2OY2 A;  4XCT A;  1HV5 A;  4AXQ A;  1XFW A;  3LE9 A;  3LKA A;  2SRT A;  5D1T A;  4FU4 A;  4FXQ A;  2YUF A;  3AIG A;  2OI0 A;  1D7X A;  2MLS A;  1QJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...