4JQGA

Crystal structure of an inactive mutant of mmp-9 catalytic domain in complex with a fluorogenic synthetic peptidic substrate with a fluorine atom.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
b'GFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHAFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fluorogenic peptidic substrate (8MC)PLG(PFF)(DNW)AR(NH2)
publication title Halogen Bonding Controls Selectivity of FRET Substrate Probes for MMP-9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/substrate
total genus 46
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4jqgA00
1XFVA 2L0RA 1QJJA 1QIAA 1PWUA 1BUDA 3KHIA 1GXDA 2D1NA 1MMQA 3HYGA 2I47A 1ZS0A 1D8MA 1USNA 3LUMA 2O3EA 1G12A 4H3XA 3HY7A 1RM8A 3LQ0A 1JAQA 4XM6A 2N8RA 2O36A 4FXYP 2W0DA 2W13A 5D1SA 5L7FA 2ERPA 5D1UA 5H8XA 4PKVA 2DDFA 2K2GA 2WO8A 5I12A 3EDHA 2CLTA 4DF9A 2TCLA 1XFYA 2OVZA 1JH1A 4A3WA 3KRYA 1EB6A 1G05A 2OW2A 2JIHA 1BKCE 1CK7A 5D3CA 4G9LA 1I1IP 4JPAA 2J83A 3LILA 3B2ZA 1XFXA 1C3IA 2POJA 3EHYA 4H2EA 4H82A 1K7GA 3LQBA 3VI1A 3AYUA 1BQQM 3WV1A 1C8TA 1OMJA 2MZIA 1IAEA 1GE6A 3WV2A 2FV5A 1SLNA 2XS3A 1XFZA 4XCTA 4AIGA 1XFUA 2JT6A 2OW1A 2SRTA 2OZRA 5BPAA 4L19A 1GO7P 1DTHA 2E3XA 3F15A 5LABA 5D2BA 3G42A 4A7BA 1SATA 2HU6A 1BSWA 3LGPA 3HDBA 3V96B 3RTTA 1IADA 1UEAA 1JJ9A 3F1AA 2XS4A 4GR8A 1BUVM 3LKAA 2CKIA 3OHLA 3LJZA 2YIGA 2X7MA 2K9CA 3Q2HA 1C7KA 3HDAP 1AYKA 3KMCA 1R1JA 3TT4A 4JIJA 1IACA 1KBCA 2Y6DA 1Q3AA 2MLRA 2AYKA 3HBUP 4PKSA 3HBVP 4JQGA 3Q2GA 3DSLA 4PKUA 4L6TA 2AIGP 3VTGA 1YCMA 4WK7A 1Y93A 2WOAA 1L6JA 1D7XA 4WKEA 5I4OA 1JIWP 1IABA 3F19A 2X3BA 1BZSA 1R1IA 1ZP5A 3I7IA 1UMSA 3LEAA 4GR3A 1S4BP 3DL1A 3ZUKA 4HX3A 4AUOA 4AXQA 1BM6A 1CIZA 1GO8P 1SU3A 4ILWD 1QIBA 1YQYA 3K7NA 3G5CA 1O0QA 4QKZA 1AF0A 2Z2DA 2MZEA 1YP1A 5JMYA 1BQOA 4FXQA 1UTZA 1ASTA 1ATLA 1I76A 5B5OA 4PKTA 2USNA 1JAOA 1OM7A 1HV5A 1CQRA 1OS9A 5CUHA 2JSDA 1SMPA 2OY2A 4XM8A 3KWVC 3EDGA 3B8ZA 2E2DA 1KUGA 1Z3JA 3CKIA 3HY9A 1A86A 3DWBA 4J4MA 2DW1A 1HOVA 1SLMA 2OXUA 2KRJA 4GQLA 1WNIA 4WZVA 3L0VA 2Y6CA 1BIWA 1XUDA 2RJQA 1R1HA 2DW0A 2OI0A 3K7LA 2JT5A 4Q1LA 3ZXHA 4GUYA 1PWVA 4I35A 3AYKA 4EFSA 1PWWA 4L63A 3HB2P 1GE7A 456CA 1XFWA 1Y8JA 3F16A 2J0TA 5BOTA 1KUFA 4DV8A 3DNGA 3KECA 4IUWA 4HMAA 3ELMA 1HY7A 1SRPA 1QJIA 4H76A 4I03A 1FM1A 1XUCA 4CTHA 1IAAA 3N2VA 3NX7A 1B8YA 3OHOA 1G4KA 1I73A 1KUHA 3EDZA 4WKIA 1ROSA 1JKYA 1CAQA 3TSKA 3O64A 1JANA 1MNCA 1HFSA 3GBOA 1R54A 3UVCA 1OM6A 1PWQA 2OY4A 3LJTA 3KMEA 1GE5A 5I2ZA 2FV9A 2OW0A 2W12A 2MZHA 3E8RA 4ZR5A 3EDIA 1RMZA 5BOYA 1G9KA 4GR0A 1HTDA 4H30A 4FVLA 4H84A 2RJPA 1GKCA 2PJTA 1JIZA 1B3DA 3LE9A 3TS4A 3USNA 1CGEA 2JNPA 1HFCA 1Y0VA 1JK3A 1FBLA 3KEKA 1DMTA 1QUAA 2DW2A 3LIKA 3O2XA 1MMPA 1ZXCA 2V4BA 2WO9A 1CGFA 3SHIA 3ZVSA 4R3VA 1G49A 4XM7A 3N2UA 1CXVA 5D7WA 3LIRA 830CA 2OXWA 4H1QA 966CA 1AKLA 4FU4A 1ZVXA 2DDYA 3LMCA 3L0TA 1EUBA 1OO9A 3MA2A 1QICA 3B92A 2D1OA 1GKDA 5I3MA 1ND1A 1BKCI 3F18A 1UTTA 3AIGA 1PWPA 4PKRA 3P1VA 1IAGA 1MMBA 2W15A 3DPFA 4IJOA 1KAPP 1K7IA 1ZTQA 2X3CA 3LJGA 1O0TA 4IN9A 2X3AA 3EWJA 1OS2A 1CGLA 2OW9A 5I43A 1KUKA 4ON1A 1H71P 1OM8A 2A8HA 1R55A 2MLSA 3F17A 3LK8A 1EAKA 5L79A 4GWMA 2W14A 3RTSA 1J7NA 4AYKA 2OXZA 5CZMA 2QPJA 4XBHA 1BKCA 1XURA 2YB9A 5I0LA 4DD8A 5D1TA 1K7QA 1KUIA 4JA1A 4H49A 4WF6A 1D8FA 1JAPA 3LUNA 4JP4A 2ERQA 4G0DA 3I7GA 1FLSA 4GWNA 3WV3A 3U1RA 1UMTA 5CXAA 4PKWA 3P24A 1A85A 3BA0A 1MMRA 1YOUA 3TVCA 3DPEA 4GF1A 4PKQA 3EHXA 3KEJA 1D5JA 2EROA 4DPEA 1ZXVA 2OVXA 5B5PA
chains in the Genus database with same CATH superfamily
1XFVA 2L0RA 1QJJA 1QIAA 1PWUA 1BUDA 3KHIA 1GXDA 2D1NA 1MMQA 3HYGA 2I47A 1ZS0A 1D8MA 1USNA 3LUMA 2O3EA 1G12A 4H3XA 3HY7A 1RM8A 3LQ0A 1JAQA 4XM6A 2N8RA 2O36A 4FXYP 2W0DA 2W13A 5D1SA 1OZ9A 1TVIA 5L7FA 2ERPA 5D1UA 5H8XA 4PKVA 2DDFA 2K2GA 2WO8A 5I12A 3EDHA 2CLTA 4DF9A 2TCLA 1XFYA 2OVZA 1JH1A 4A3WA 3KRYA 1EB6A 1G05A 2OW2A 2JIHA 1BKCE 1CK7A 5D3CA 4G9LA 1I1IP 4JPAA 2J83A 3LILA 3B2ZA 1XFXA 1C3IA 2POJA 3EHYA 1XAXA 4H2EA 4H82A 1K7GA 3LQBA 3VI1A 3AYUA 1BQQM 3WV1A 1C8TA 1OMJA 2MZIA 1IAEA 1GE6A 3WV2A 2FV5A 1SLNA 2XS3A 1XFZA 4XCTA 4AIGA 1XFUA 2JT6A 2OW1A 2SRTA 2OZRA 5BPAA 4L19A 1GO7P 1DTHA 2E3XA 3F15A 5LABA 5D2BA 3G42A 4A7BA 1SATA 2HU6A 1BSWA 3LGPA 3HDBA 3V96B 3RTTA 1IADA 1UEAA 1JJ9A 3F1AA 2XS4A 4GR8A 1BUVM 3LKAA 2CKIA 3OHLA 3LJZA 2YIGA 2X7MA 2K9CA 3Q2HA 1C7KA 2YUFA 3HDAP 1AYKA 3KMCA 1R1JA 3TT4A 4JIJA 1IACA 1KBCA 2Y6DA 1Q3AA 2MLRA 2AYKA 3HBUP 4PKSA 3HBVP 4JQGA 3Q2GA 3DSLA 4PKUA 4L6TA 2AIGP 3VTGA 1YCMA 4WK7A 1Y93A 2WOAA 1L6JA 1D7XA 4WKEA 5I4OA 1JIWP 1IABA 3F19A 2X3BA 1BZSA 1R1IA 1ZP5A 3I7IA 1UMSA 3DTKA 3LEAA 4GR3A 1S4BP 3DL1A 3ZUKA 4HX3A 4AUOA 4AXQA 1BM6A 1CIZA 1GO8P 1SU3A 4ILWD 1QIBA 1YQYA 3K7NA 3G5CA 1O0QA 4QKZA 1AF0A 2Z2DA 2MZEA 1YP1A 5JMYA 1BQOA 4FXQA 1UTZA 1ASTA 1ATLA 1I76A 5B5OA 4PKTA 2USNA 1JAOA 1OM7A 1HV5A 1CQRA 1OS9A 5CUHA 2JSDA 1SMPA 2OY2A 4XM8A 3KWVC 3EDGA 3B8ZA 2E2DA 1KUGA 1Z3JA 3CKIA 3HY9A 1A86A 3DWBA 4J4MA 2DW1A 1HOVA 1SLMA 2OXUA 2KRJA 4GQLA 1WNIA 4WZVA 3L0VA 2Y6CA 1BIWA 1XUDA 2RJQA 1R1HA 2DW0A 2OI0A 3K7LA 2JT5A 4Q1LA 3ZXHA 4GUYA 1PWVA 4I35A 3AYKA 4EFSA 1PWWA 4L63A 3HB2P 1GE7A 456CA 1XFWA 3DTIA 1Y8JA 3F16A 2J0TA 5BOTA 1KUFA 4DV8A 3DNGA 3KECA 4IUWA 4HMAA 3ELMA 1HY7A 1SRPA 1QJIA 4H76A 4I03A 1FM1A 1XUCA 4CTHA 1IAAA 3N2VA 3NX7A 1B8YA 3OHOA 1G4KA 1I73A 1KUHA 3EDZA 4WKIA 1ROSA 1JKYA 1CAQA 3TSKA 3O64A 1JANA 1MNCA 1HFSA 3GBOA 1R54A 3UVCA 1OM6A 1PWQA 2OY4A 3LJTA 3KMEA 1GE5A 1XM5A 5I2ZA 2FV9A 2OW0A 2W12A 2MZHA 3E8RA 4ZR5A 3EDIA 1RMZA 5BOYA 1G9KA 4GR0A 1HTDA 4H30A 4FVLA 4H84A 2RJPA 1GKCA 2PJTA 1JIZA 1B3DA 3LE9A 3TS4A 3USNA 1CGEA 2JNPA 1HFCA 1Y0VA 1JK3A 1FBLA 3KEKA 1DMTA 1QUAA 2DW2A 3LIKA 3O2XA 1MMPA 1ZXCA 2V4BA 2WO9A 1CGFA 3SHIA 3ZVSA 4R3VA 1G49A 4XM7A 3N2UA 1CXVA 5D7WA 3LIRA 830CA 2OXWA 4H1QA 966CA 1AKLA 4FU4A 1ZVXA 2DDYA 3LMCA 3L0TA 1EUBA 1OO9A 3MA2A 1QICA 3B92A 2D1OA 1GKDA 5I3MA 1ND1A 1BKCI 3F18A 1UTTA 3AIGA 1PWPA 4PKRA 3P1VA 3DTEA 1IAGA 1MMBA 2W15A 3DPFA 4IJOA 1KAPP 1K7IA 1ZTQA 2X3CA 3LJGA 1O0TA 4IN9A 2X3AA 3EWJA 1OS2A 1CGLA 2OW9A 5I43A 1KUKA 4ON1A 1H71P 1OM8A 2A8HA 1R55A 2MLSA 3F17A 3LK8A 1EAKA 5L79A 4GWMA 2W14A 3RTSA 1J7NA 4AYKA 2OXZA 5CZMA 2QPJA 4L7AA 4XBHA 1BKCA 1XURA 2YB9A 5I0LA 4DD8A 5D1TA 1K7QA 1KUIA 4JA1A 4H49A 4WF6A 1D8FA 1JAPA 3LUNA 4JP4A 2ERQA 4G0DA 3I7GA 1FLSA 4GWNA 3WV3A 3U1RA 1UMTA 5CXAA 4PKWA 3P24A 1A85A 3BA0A 1MMRA 1YOUA 3TVCA 3DPEA 4GF1A 4PKQA 3EHXA 3KEJA 1D5JA 2EROA 4DPEA 1ZXVA 2OVXA 5B5PA
chains in the Genus database with same CATH topology
1XFVA 2L0RA 1QJJA 1QIAA 1PWUA 1BUDA 3KHIA 1GXDA 2D1NA 1MMQA 3HYGA 2I47A 1ZS0A 1D8MA 1USNA 3LUMA 2O3EA 1G12A 4H3XA 3HY7A 1RM8A 3LQ0A 1JAQA 4XM6A 2N8RA 2O36A 4FXYP 2W0DA 2W13A 5D1SA 5L7FA 2ERPA 5D1UA 5H8XA 4PKVA 2DDFA 2K2GA 2WO8A 5I12A 3EDHA 2CLTA 4DF9A 2TCLA 1XFYA 2OVZA 1JH1A 4A3WA 3KRYA 1EB6A 1G05A 2OW2A 2JIHA 1BKCE 1CK7A 5D3CA 4G9LA 1I1IP 4JPAA 2J83A 3LILA 3B2ZA 1XFXA 1C3IA 2POJA 3EHYA 4H2EA 4H82A 1K7GA 3LQBA 3VI1A 3AYUA 1BQQM 3WV1A 1C8TA 1OMJA 2MZIA 1IAEA 1GE6A 3WV2A 2FV5A 1SLNA 2XS3A 1XFZA 4XCTA 4AIGA 1XFUA 2JT6A 2OW1A 2SRTA 2OZRA 5BPAA 4L19A 1GO7P 1DTHA 2E3XA 3F15A 5LABA 5D2BA 3G42A 4A7BA 1SATA 2HU6A 1BSWA 3LGPA 3HDBA 3V96B 3RTTA 1IADA 1UEAA 1JJ9A 3F1AA 2XS4A 4GR8A 1BUVM 3LKAA 2CKIA 3OHLA 3LJZA 2YIGA 2X7MA 2K9CA 3Q2HA 1C7KA 2YUFA 3HDAP 1AYKA 3KMCA 1R1JA 3TT4A 4JIJA 1IACA 1KBCA 2Y6DA 1Q3AA 2MLRA 2AYKA 3HBUP 4PKSA 3HBVP 4JQGA 3Q2GA 3DSLA 4PKUA 4L6TA 2AIGP 3VTGA 1YCMA 4WK7A 1Y93A 2WOAA 1L6JA 1D7XA 4WKEA 5I4OA 1JIWP 1IABA 3F19A 2X3BA 1BZSA 1R1IA 1ZP5A 3I7IA 1UMSA 3DTKA 3LEAA 4GR3A 1S4BP 3DL1A 3ZUKA 4HX3A 4AUOA 4AXQA 1BM6A 1CIZA 1GO8P 1SU3A 4ILWD 1QIBA 1YQYA 3K7NA 3G5CA 1O0QA 4QKZA 1AF0A 2Z2DA 2MZEA 1YP1A 5JMYA 1BQOA 4FXQA 1UTZA 1ASTA 1ATLA 1I76A 5B5OA 4PKTA 2USNA 1JAOA 1OM7A 1HV5A 1CQRA 1OS9A 5CUHA 2JSDA 1SMPA 2OY2A 4XM8A 3KWVC 3EDGA 3B8ZA 2E2DA 1KUGA 1Z3JA 3CKIA 3HY9A 1A86A 3DWBA 4J4MA 2DW1A 1HOVA 1SLMA 2OXUA 2KRJA 4GQLA 1WNIA 4WZVA 3L0VA 2Y6CA 1BIWA 1XUDA 2RJQA 1R1HA 2DW0A 2OI0A 3K7LA 2JT5A 4Q1LA 3ZXHA 4GUYA 1PWVA 4I35A 3AYKA 4EFSA 1PWWA 4L63A 3HB2P 1GE7A 456CA 1XFWA 3DTIA 1Y8JA 3F16A 2J0TA 5BOTA 1KUFA 4DV8A 3DNGA 3KECA 4IUWA 4HMAA 3ELMA 1HY7A 1SRPA 1QJIA 4H76A 4I03A 1FM1A 1XUCA 4CTHA 1IAAA 3N2VA 3NX7A 1B8YA 3OHOA 1G4KA 1I73A 1KUHA 3EDZA 4WKIA 1ROSA 1JKYA 1CAQA 3TSKA 3O64A 1JANA 1MNCA 1HFSA 3GBOA 1R54A 3UVCA 1OM6A 1PWQA 2OY4A 3LJTA 3KMEA 1GE5A 5I2ZA 2FV9A 2OW0A 2W12A 2MZHA 3E8RA 4ZR5A 3EDIA 1RMZA 5BOYA 1G9KA 4GR0A 1HTDA 4H30A 4FVLA 4H84A 2RJPA 1GKCA 2PJTA 1JIZA 1B3DA 3LE9A 3TS4A 3USNA 1CGEA 2JNPA 1HFCA 1Y0VA 1JK3A 1FBLA 3KEKA 1DMTA 1QUAA 2DW2A 3LIKA 3O2XA 1MMPA 1ZXCA 2V4BA 2WO9A 1CGFA 3SHIA 3ZVSA 4R3VA 1G49A 4XM7A 3N2UA 1CXVA 5D7WA 3LIRA 830CA 2OXWA 4H1QA 966CA 1AKLA 4FU4A 1ZVXA 2DDYA 3LMCA 3L0TA 1EUBA 1OO9A 3MA2A 1QICA 3B92A 2D1OA 1GKDA 5I3MA 1ND1A 1BKCI 3F18A 1UTTA 3AIGA 1PWPA 4PKRA 3P1VA 3DTEA 1IAGA 1MMBA 2W15A 3DPFA 4IJOA 1KAPP 1K7IA 1ZTQA 2X3CA 3LJGA 1O0TA 4IN9A 2X3AA 3EWJA 1OS2A 1CGLA 2OW9A 5I43A 1KUKA 4ON1A 1H71P 1OM8A 2A8HA 1R55A 2MLSA 3F17A 3LK8A 1EAKA 5L79A 4GWMA 2W14A 3RTSA 1J7NA 4AYKA 2OXZA 5CZMA 2QPJA 4L7AA 4XBHA 1BKCA 1XURA 2YB9A 5I0LA 4DD8A 5D1TA 1K7QA 1KUIA 4JA1A 4H49A 4WF6A 1D8FA 1JAPA 3LUNA 4JP4A 2ERQA 4G0DA 3I7GA 1FLSA 4GWNA 3WV3A 3U1RA 1UMTA 5CXAA 4PKWA 3P24A 1A85A 3BA0A 1MMRA 1YOUA 3TVCA 3DPEA 4GF1A 4PKQA 3EHXA 3KEJA 1D5JA 2EROA 4DPEA 1ZXVA 2OVXA 5B5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFV A;  2L0R A;  1QJJ A;  1QIA A;  1PWU A;  1BUD A;  3KHI A;  1GXD A;  2D1N A;  1MMQ A;  3HYG A;  2I47 A;  1ZS0 A;  1D8M A;  1USN A;  3LUM A;  2O3E A;  1G12 A;  4H3X A;  3HY7 A;  1RM8 A;  3LQ0 A;  1JAQ A;  4XM6 A;  2N8R A;  2O36 A;  4FXY P;  2W0D A;  2W13 A;  5D1S A;  5L7F A;  2ERP A;  5D1U A;  5H8X A;  4PKV A;  2DDF A;  2K2G A;  2WO8 A;  5I12 A;  3EDH A;  2CLT A;  4DF9 A;  2TCL A;  1XFY A;  2OVZ A;  1JH1 A;  4A3W A;  3KRY A;  1EB6 A;  1G05 A;  2OW2 A;  2JIH A;  1BKC E;  1CK7 A;  5D3C A;  4G9L A;  1I1I P;  4JPA A;  2J83 A;  3LIL A;  3B2Z A;  1XFX A;  1C3I A;  2POJ A;  3EHY A;  4H2E A;  4H82 A;  1K7G A;  3LQB A;  3VI1 A;  3AYU A;  1BQQ M;  3WV1 A;  1C8T A;  1OMJ A;  2MZI A;  1IAE A;  1GE6 A;  3WV2 A;  2FV5 A;  1SLN A;  2XS3 A;  1XFZ A;  4XCT A;  4AIG A;  1XFU A;  2JT6 A;  2OW1 A;  2SRT A;  2OZR A;  5BPA A;  4L19 A;  1GO7 P;  1DTH A;  2E3X A;  3F15 A;  5LAB A;  5D2B A;  3G42 A;  4A7B A;  1SAT A;  2HU6 A;  1BSW A;  3LGP A;  3HDB A;  3V96 B;  3RTT A;  1IAD A;  1UEA A;  1JJ9 A;  3F1A A;  2XS4 A;  4GR8 A;  1BUV M;  3LKA A;  2CKI A;  3OHL A;  3LJZ A;  2YIG A;  2X7M A;  2K9C A;  3Q2H A;  1C7K A;  3HDA P;  1AYK A;  3KMC A;  1R1J A;  3TT4 A;  4JIJ A;  1IAC A;  1KBC A;  2Y6D A;  1Q3A A;  2MLR A;  2AYK A;  3HBU P;  4PKS A;  3HBV P;  4JQG A;  3Q2G A;  3DSL A;  4PKU A;  4L6T A;  2AIG P;  3VTG A;  1YCM A;  4WK7 A;  1Y93 A;  2WOA A;  1L6J A;  1D7X A;  4WKE A;  5I4O A;  1JIW P;  1IAB A;  3F19 A;  2X3B A;  1BZS A;  1R1I A;  1ZP5 A;  3I7I A;  1UMS A;  3LEA A;  4GR3 A;  1S4B P;  3DL1 A;  3ZUK A;  4HX3 A;  4AUO A;  4AXQ A;  1BM6 A;  1CIZ A;  1GO8 P;  1SU3 A;  4ILW D;  1QIB A;  1YQY A;  3K7N A;  3G5C A;  1O0Q A;  4QKZ A;  1AF0 A;  2Z2D A;  2MZE A;  1YP1 A;  5JMY A;  1BQO A;  4FXQ A;  1UTZ A;  1AST A;  1ATL A;  1I76 A;  5B5O A;  4PKT A;  2USN A;  1JAO A;  1OM7 A;  1HV5 A;  1CQR A;  1OS9 A;  5CUH A;  2JSD A;  1SMP A;  2OY2 A;  4XM8 A;  3KWV C;  3EDG A;  3B8Z A;  2E2D A;  1KUG A;  1Z3J A;  3CKI A;  3HY9 A;  1A86 A;  3DWB A;  4J4M A;  2DW1 A;  1HOV A;  1SLM A;  2OXU A;  2KRJ A;  4GQL A;  1WNI A;  4WZV A;  3L0V A;  2Y6C A;  1BIW A;  1XUD A;  2RJQ A;  1R1H A;  2DW0 A;  2OI0 A;  3K7L A;  2JT5 A;  4Q1L A;  3ZXH A;  4GUY A;  1PWV A;  4I35 A;  3AYK A;  4EFS A;  1PWW A;  4L63 A;  3HB2 P;  1GE7 A;  456C A;  1XFW A;  1Y8J A;  3F16 A;  2J0T A;  5BOT A;  1KUF A;  4DV8 A;  3DNG A;  3KEC A;  4IUW A;  4HMA A;  3ELM A;  1HY7 A;  1SRP A;  1QJI A;  4H76 A;  4I03 A;  1FM1 A;  1XUC A;  4CTH A;  1IAA A;  3N2V A;  3NX7 A;  1B8Y A;  3OHO A;  1G4K A;  1I73 A;  1KUH A;  3EDZ A;  4WKI A;  1ROS A;  1JKY A;  1CAQ A;  3TSK A;  3O64 A;  1JAN A;  1MNC A;  1HFS A;  3GBO A;  1R54 A;  3UVC A;  1OM6 A;  1PWQ A;  2OY4 A;  3LJT A;  3KME A;  1GE5 A;  5I2Z A;  2FV9 A;  2OW0 A;  2W12 A;  2MZH A;  3E8R A;  4ZR5 A;  3EDI A;  1RMZ A;  5BOY A;  1G9K A;  4GR0 A;  1HTD A;  4H30 A;  4FVL A;  4H84 A;  2RJP A;  1GKC A;  2PJT A;  1JIZ A;  1B3D A;  3LE9 A;  3TS4 A;  3USN A;  1CGE A;  2JNP A;  1HFC A;  1Y0V A;  1JK3 A;  1FBL A;  3KEK A;  1DMT A;  1QUA A;  2DW2 A;  3LIK A;  3O2X A;  1MMP A;  1ZXC A;  2V4B A;  2WO9 A;  1CGF A;  3SHI A;  3ZVS A;  4R3V A;  1G49 A;  4XM7 A;  3N2U A;  1CXV A;  5D7W A;  3LIR A;  830C A;  2OXW A;  4H1Q A;  966C A;  1AKL A;  4FU4 A;  1ZVX A;  2DDY A;  3LMC A;  3L0T A;  1EUB A;  1OO9 A;  3MA2 A;  1QIC A;  3B92 A;  2D1O A;  1GKD A;  5I3M A;  1ND1 A;  1BKC I;  3F18 A;  1UTT A;  3AIG A;  1PWP A;  4PKR A;  3P1V A;  1IAG A;  1MMB A;  2W15 A;  3DPF A;  4IJO A;  1KAP P;  1K7I A;  1ZTQ A;  2X3C A;  3LJG A;  1O0T A;  4IN9 A;  2X3A A;  3EWJ A;  1OS2 A;  1CGL A;  2OW9 A;  5I43 A;  1KUK A;  4ON1 A;  1H71 P;  1OM8 A;  2A8H A;  1R55 A;  2MLS A;  3F17 A;  3LK8 A;  1EAK A;  5L79 A;  4GWM A;  2W14 A;  3RTS A;  1J7N A;  4AYK A;  2OXZ A;  5CZM A;  2QPJ A;  4XBH A;  1BKC A;  1XUR A;  2YB9 A;  5I0L A;  4DD8 A;  5D1T A;  1K7Q A;  1KUI A;  4JA1 A;  4H49 A;  4WF6 A;  1D8F A;  1JAP A;  3LUN A;  4JP4 A;  2ERQ A;  4G0D A;  3I7G A;  1FLS A;  4GWN A;  3WV3 A;  3U1R A;  1UMT A;  5CXA A;  4PKW A;  3P24 A;  1A85 A;  3BA0 A;  1MMR A;  1YOU A;  3TVC A;  3DPE A;  4GF1 A;  4PKQ A;  3EHX A;  3KEJ A;  1D5J A;  2ERO A;  4DPE A;  1ZXV A;  2OVX A;  5B5P A; 
#chains in the Genus database with same CATH topology
 1XFV A;  2L0R A;  1QJJ A;  1QIA A;  1PWU A;  1BUD A;  3KHI A;  1GXD A;  2D1N A;  1MMQ A;  3HYG A;  2I47 A;  1ZS0 A;  1D8M A;  1USN A;  3LUM A;  2O3E A;  1G12 A;  4H3X A;  3HY7 A;  1RM8 A;  3LQ0 A;  1JAQ A;  4XM6 A;  2N8R A;  2O36 A;  4FXY P;  2W0D A;  2W13 A;  5D1S A;  1OZ9 A;  1TVI A;  5L7F A;  2ERP A;  5D1U A;  5H8X A;  4PKV A;  2DDF A;  2K2G A;  2WO8 A;  5I12 A;  3EDH A;  2CLT A;  4DF9 A;  2TCL A;  1XFY A;  2OVZ A;  1JH1 A;  4A3W A;  3KRY A;  1EB6 A;  1G05 A;  2OW2 A;  2JIH A;  1BKC E;  1CK7 A;  5D3C A;  4G9L A;  1I1I P;  4JPA A;  2J83 A;  3LIL A;  3B2Z A;  1XFX A;  1C3I A;  2POJ A;  3EHY A;  1XAX A;  4H2E A;  4H82 A;  1K7G A;  3LQB A;  3VI1 A;  3AYU A;  1BQQ M;  3WV1 A;  1C8T A;  1OMJ A;  2MZI A;  1IAE A;  1GE6 A;  3WV2 A;  2FV5 A;  1SLN A;  2XS3 A;  1XFZ A;  4XCT A;  4AIG A;  1XFU A;  2JT6 A;  2OW1 A;  2SRT A;  2OZR A;  5BPA A;  4L19 A;  1GO7 P;  1DTH A;  2E3X A;  3F15 A;  5LAB A;  5D2B A;  3G42 A;  4A7B A;  1SAT A;  2HU6 A;  1BSW A;  3LGP A;  3HDB A;  3V96 B;  3RTT A;  1IAD A;  1UEA A;  1JJ9 A;  3F1A A;  2XS4 A;  4GR8 A;  1BUV M;  3LKA A;  2CKI A;  3OHL A;  3LJZ A;  2YIG A;  2X7M A;  2K9C A;  3Q2H A;  1C7K A;  2YUF A;  3HDA P;  1AYK A;  3KMC A;  1R1J A;  3TT4 A;  4JIJ A;  1IAC A;  1KBC A;  2Y6D A;  1Q3A A;  2MLR A;  2AYK A;  3HBU P;  4PKS A;  3HBV P;  4JQG A;  3Q2G A;  3DSL A;  4PKU A;  4L6T A;  2AIG P;  3VTG A;  1YCM A;  4WK7 A;  1Y93 A;  2WOA A;  1L6J A;  1D7X A;  4WKE A;  5I4O A;  1JIW P;  1IAB A;  3F19 A;  2X3B A;  1BZS A;  1R1I A;  1ZP5 A;  3I7I A;  1UMS A;  3DTK A;  3LEA A;  4GR3 A;  1S4B P;  3DL1 A;  3ZUK A;  4HX3 A;  4AUO A;  4AXQ A;  1BM6 A;  1CIZ A;  1GO8 P;  1SU3 A;  4ILW D;  1QIB A;  1YQY A;  3K7N A;  3G5C A;  1O0Q A;  4QKZ A;  1AF0 A;  2Z2D A;  2MZE A;  1YP1 A;  5JMY A;  1BQO A;  4FXQ A;  1UTZ A;  1AST A;  1ATL A;  1I76 A;  5B5O A;  4PKT A;  2USN A;  1JAO A;  1OM7 A;  1HV5 A;  1CQR A;  1OS9 A;  5CUH A;  2JSD A;  1SMP A;  2OY2 A;  4XM8 A;  3KWV C;  3EDG A;  3B8Z A;  2E2D A;  1KUG A;  1Z3J A;  3CKI A;  3HY9 A;  1A86 A;  3DWB A;  4J4M A;  2DW1 A;  1HOV A;  1SLM A;  2OXU A;  2KRJ A;  4GQL A;  1WNI A;  4WZV A;  3L0V A;  2Y6C A;  1BIW A;  1XUD A;  2RJQ A;  1R1H A;  2DW0 A;  2OI0 A;  3K7L A;  2JT5 A;  4Q1L A;  3ZXH A;  4GUY A;  1PWV A;  4I35 A;  3AYK A;  4EFS A;  1PWW A;  4L63 A;  3HB2 P;  1GE7 A;  456C A;  1XFW A;  3DTI A;  1Y8J A;  3F16 A;  2J0T A;  5BOT A;  1KUF A;  4DV8 A;  3DNG A;  3KEC A;  4IUW A;  4HMA A;  3ELM A;  1HY7 A;  1SRP A;  1QJI A;  4H76 A;  4I03 A;  1FM1 A;  1XUC A;  4CTH A;  1IAA A;  3N2V A;  3NX7 A;  1B8Y A;  3OHO A;  1G4K A;  1I73 A;  1KUH A;  3EDZ A;  4WKI A;  1ROS A;  1JKY A;  1CAQ A;  3TSK A;  3O64 A;  1JAN A;  1MNC A;  1HFS A;  3GBO A;  1R54 A;  3UVC A;  1OM6 A;  1PWQ A;  2OY4 A;  3LJT A;  3KME A;  1GE5 A;  1XM5 A;  5I2Z A;  2FV9 A;  2OW0 A;  2W12 A;  2MZH A;  3E8R A;  4ZR5 A;  3EDI A;  1RMZ A;  5BOY A;  1G9K A;  4GR0 A;  1HTD A;  4H30 A;  4FVL A;  4H84 A;  2RJP A;  1GKC A;  2PJT A;  1JIZ A;  1B3D A;  3LE9 A;  3TS4 A;  3USN A;  1CGE A;  2JNP A;  1HFC A;  1Y0V A;  1JK3 A;  1FBL A;  3KEK A;  1DMT A;  1QUA A;  2DW2 A;  3LIK A;  3O2X A;  1MMP A;  1ZXC A;  2V4B A;  2WO9 A;  1CGF A;  3SHI A;  3ZVS A;  4R3V A;  1G49 A;  4XM7 A;  3N2U A;  1CXV A;  5D7W A;  3LIR A;  830C A;  2OXW A;  4H1Q A;  966C A;  1AKL A;  4FU4 A;  1ZVX A;  2DDY A;  3LMC A;  3L0T A;  1EUB A;  1OO9 A;  3MA2 A;  1QIC A;  3B92 A;  2D1O A;  1GKD A;  5I3M A;  1ND1 A;  1BKC I;  3F18 A;  1UTT A;  3AIG A;  1PWP A;  4PKR A;  3P1V A;  3DTE A;  1IAG A;  1MMB A;  2W15 A;  3DPF A;  4IJO A;  1KAP P;  1K7I A;  1ZTQ A;  2X3C A;  3LJG A;  1O0T A;  4IN9 A;  2X3A A;  3EWJ A;  1OS2 A;  1CGL A;  2OW9 A;  5I43 A;  1KUK A;  4ON1 A;  1H71 P;  1OM8 A;  2A8H A;  1R55 A;  2MLS A;  3F17 A;  3LK8 A;  1EAK A;  5L79 A;  4GWM A;  2W14 A;  3RTS A;  1J7N A;  4AYK A;  2OXZ A;  5CZM A;  2QPJ A;  4L7A A;  4XBH A;  1BKC A;  1XUR A;  2YB9 A;  5I0L A;  4DD8 A;  5D1T A;  1K7Q A;  1KUI A;  4JA1 A;  4H49 A;  4WF6 A;  1D8F A;  1JAP A;  3LUN A;  4JP4 A;  2ERQ A;  4G0D A;  3I7G A;  1FLS A;  4GWN A;  3WV3 A;  3U1R A;  1UMT A;  5CXA A;  4PKW A;  3P24 A;  1A85 A;  3BA0 A;  1MMR A;  1YOU A;  3TVC A;  3DPE A;  4GF1 A;  4PKQ A;  3EHX A;  3KEJ A;  1D5J A;  2ERO A;  4DPE A;  1ZXV A;  2OVX A;  5B5P A; 
#chains in the Genus database with same CATH homology
 1XFV A;  2L0R A;  1QJJ A;  1QIA A;  1PWU A;  1BUD A;  3KHI A;  1GXD A;  2D1N A;  1MMQ A;  3HYG A;  2I47 A;  1ZS0 A;  1D8M A;  1USN A;  3LUM A;  2O3E A;  1G12 A;  4H3X A;  3HY7 A;  1RM8 A;  3LQ0 A;  1JAQ A;  4XM6 A;  2N8R A;  2O36 A;  4FXY P;  2W0D A;  2W13 A;  5D1S A;  5L7F A;  2ERP A;  5D1U A;  5H8X A;  4PKV A;  2DDF A;  2K2G A;  2WO8 A;  5I12 A;  3EDH A;  2CLT A;  4DF9 A;  2TCL A;  1XFY A;  2OVZ A;  1JH1 A;  4A3W A;  3KRY A;  1EB6 A;  1G05 A;  2OW2 A;  2JIH A;  1BKC E;  1CK7 A;  5D3C A;  4G9L A;  1I1I P;  4JPA A;  2J83 A;  3LIL A;  3B2Z A;  1XFX A;  1C3I A;  2POJ A;  3EHY A;  4H2E A;  4H82 A;  1K7G A;  3LQB A;  3VI1 A;  3AYU A;  1BQQ M;  3WV1 A;  1C8T A;  1OMJ A;  2MZI A;  1IAE A;  1GE6 A;  3WV2 A;  2FV5 A;  1SLN A;  2XS3 A;  1XFZ A;  4XCT A;  4AIG A;  1XFU A;  2JT6 A;  2OW1 A;  2SRT A;  2OZR A;  5BPA A;  4L19 A;  1GO7 P;  1DTH A;  2E3X A;  3F15 A;  5LAB A;  5D2B A;  3G42 A;  4A7B A;  1SAT A;  2HU6 A;  1BSW A;  3LGP A;  3HDB A;  3V96 B;  3RTT A;  1IAD A;  1UEA A;  1JJ9 A;  3F1A A;  2XS4 A;  4GR8 A;  1BUV M;  3LKA A;  2CKI A;  3OHL A;  3LJZ A;  2YIG A;  2X7M A;  2K9C A;  3Q2H A;  1C7K A;  2YUF A;  3HDA P;  1AYK A;  3KMC A;  1R1J A;  3TT4 A;  4JIJ A;  1IAC A;  1KBC A;  2Y6D A;  1Q3A A;  2MLR A;  2AYK A;  3HBU P;  4PKS A;  3HBV P;  4JQG A;  3Q2G A;  3DSL A;  4PKU A;  4L6T A;  2AIG P;  3VTG A;  1YCM A;  4WK7 A;  1Y93 A;  2WOA A;  1L6J A;  1D7X A;  4WKE A;  5I4O A;  1JIW P;  1IAB A;  3F19 A;  2X3B A;  1BZS A;  1R1I A;  1ZP5 A;  3I7I A;  1UMS A;  3DTK A;  3LEA A;  4GR3 A;  1S4B P;  3DL1 A;  3ZUK A;  4HX3 A;  4AUO A;  4AXQ A;  1BM6 A;  1CIZ A;  1GO8 P;  1SU3 A;  4ILW D;  1QIB A;  1YQY A;  3K7N A;  3G5C A;  1O0Q A;  4QKZ A;  1AF0 A;  2Z2D A;  2MZE A;  1YP1 A;  5JMY A;  1BQO A;  4FXQ A;  1UTZ A;  1AST A;  1ATL A;  1I76 A;  5B5O A;  4PKT A;  2USN A;  1JAO A;  1OM7 A;  1HV5 A;  1CQR A;  1OS9 A;  5CUH A;  2JSD A;  1SMP A;  2OY2 A;  4XM8 A;  3KWV C;  3EDG A;  3B8Z A;  2E2D A;  1KUG A;  1Z3J A;  3CKI A;  3HY9 A;  1A86 A;  3DWB A;  4J4M A;  2DW1 A;  1HOV A;  1SLM A;  2OXU A;  2KRJ A;  4GQL A;  1WNI A;  4WZV A;  3L0V A;  2Y6C A;  1BIW A;  1XUD A;  2RJQ A;  1R1H A;  2DW0 A;  2OI0 A;  3K7L A;  2JT5 A;  4Q1L A;  3ZXH A;  4GUY A;  1PWV A;  4I35 A;  3AYK A;  4EFS A;  1PWW A;  4L63 A;  3HB2 P;  1GE7 A;  456C A;  1XFW A;  3DTI A;  1Y8J A;  3F16 A;  2J0T A;  5BOT A;  1KUF A;  4DV8 A;  3DNG A;  3KEC A;  4IUW A;  4HMA A;  3ELM A;  1HY7 A;  1SRP A;  1QJI A;  4H76 A;  4I03 A;  1FM1 A;  1XUC A;  4CTH A;  1IAA A;  3N2V A;  3NX7 A;  1B8Y A;  3OHO A;  1G4K A;  1I73 A;  1KUH A;  3EDZ A;  4WKI A;  1ROS A;  1JKY A;  1CAQ A;  3TSK A;  3O64 A;  1JAN A;  1MNC A;  1HFS A;  3GBO A;  1R54 A;  3UVC A;  1OM6 A;  1PWQ A;  2OY4 A;  3LJT A;  3KME A;  1GE5 A;  5I2Z A;  2FV9 A;  2OW0 A;  2W12 A;  2MZH A;  3E8R A;  4ZR5 A;  3EDI A;  1RMZ A;  5BOY A;  1G9K A;  4GR0 A;  1HTD A;  4H30 A;  4FVL A;  4H84 A;  2RJP A;  1GKC A;  2PJT A;  1JIZ A;  1B3D A;  3LE9 A;  3TS4 A;  3USN A;  1CGE A;  2JNP A;  1HFC A;  1Y0V A;  1JK3 A;  1FBL A;  3KEK A;  1DMT A;  1QUA A;  2DW2 A;  3LIK A;  3O2X A;  1MMP A;  1ZXC A;  2V4B A;  2WO9 A;  1CGF A;  3SHI A;  3ZVS A;  4R3V A;  1G49 A;  4XM7 A;  3N2U A;  1CXV A;  5D7W A;  3LIR A;  830C A;  2OXW A;  4H1Q A;  966C A;  1AKL A;  4FU4 A;  1ZVX A;  2DDY A;  3LMC A;  3L0T A;  1EUB A;  1OO9 A;  3MA2 A;  1QIC A;  3B92 A;  2D1O A;  1GKD A;  5I3M A;  1ND1 A;  1BKC I;  3F18 A;  1UTT A;  3AIG A;  1PWP A;  4PKR A;  3P1V A;  3DTE A;  1IAG A;  1MMB A;  2W15 A;  3DPF A;  4IJO A;  1KAP P;  1K7I A;  1ZTQ A;  2X3C A;  3LJG A;  1O0T A;  4IN9 A;  2X3A A;  3EWJ A;  1OS2 A;  1CGL A;  2OW9 A;  5I43 A;  1KUK A;  4ON1 A;  1H71 P;  1OM8 A;  2A8H A;  1R55 A;  2MLS A;  3F17 A;  3LK8 A;  1EAK A;  5L79 A;  4GWM A;  2W14 A;  3RTS A;  1J7N A;  4AYK A;  2OXZ A;  5CZM A;  2QPJ A;  4L7A A;  4XBH A;  1BKC A;  1XUR A;  2YB9 A;  5I0L A;  4DD8 A;  5D1T A;  1K7Q A;  1KUI A;  4JA1 A;  4H49 A;  4WF6 A;  1D8F A;  1JAP A;  3LUN A;  4JP4 A;  2ERQ A;  4G0D A;  3I7G A;  1FLS A;  4GWN A;  3WV3 A;  3U1R A;  1UMT A;  5CXA A;  4PKW A;  3P24 A;  1A85 A;  3BA0 A;  1MMR A;  1YOU A;  3TVC A;  3DPE A;  4GF1 A;  4PKQ A;  3EHX A;  3KEJ A;  1D5J A;  2ERO A;  4DPE A;  1ZXV A;  2OVX A;  5B5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...