4JQIL

Structure of active beta-arrestin1 bound to a g protein-coupled receptor phosphopeptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
190
structure length
185
Chain Sequence
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-arrestin-1
publication title Structure of active beta-arrestin-1 bound to a G-protein-coupled receptor phosphopeptide.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 36
structure length 185
sequence length 190
ec nomenclature
pdb deposition date 2013-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jqiL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jqiL02
4LRIC 1MJJA 4RBPK 2LV4A 4NKDA 3KNBB 5FOJA 2JJSC 1LHZA 2X4TB 2UV3A 4JFDD 3V6ZB 3QA3A 5I30H 4ENED 3BH8A 1PKOA 2N7AA 4U1IB 1S7QA 4MS8C 4WEBH 3FZUC 5J1AA 4V1DB 1I9RH 2HFFA 1JYWA 3TN0D 1Z9MA 5HI4D 3OAUL 3QWRD 4OCYH 1HXMA 2L7JA 1ETZB 4M9PA 2QADD 1M7IB 3RJQB 4FNLL 2AJSL 5D1XA 1MUJA 4TSAL 2J8HA 3O6LH 5KTEL 4XVSH 1KN2H 4ZUUB 2R0WH 3PQYD 5T3XD 3QDJB 5DURD 1AFVH 2CJUL 1UWGH 3RU8H 4WFGD 1I1YA 3DXAE 1NMBL 3HMXA 1YEIL 2WWMC 3U9PH 1QSFD 1YNTB 4PJHE 1TVDA 4N0FB 3ISWA 1F6LL 3CPLA 4P4RA 5JDSB 3ZDZF 1B4JH 3NFNB 5HYIA 3TV3H 1W0WB 3BP4B 4APQB 1Q0XL 3HLAA 3IB4A 2GQHA 1ZMYA 5GJSH 3HHRB 3G5XB 1ADQA 4FFYL 3ARUA 3QH3B 5D2LA 3QUXA 3VCLB 1L0QA 4KVNL 4OF3A 1FG2A 1U3HC 4YIQA 4Y5YC 1G7HA 3MFFA 4Q7DA 4YHMH 3DHJA 3K1DA 5EZJA 2IAND 5L6YL 3K46A 1JGUL 1HWHB 1BBDL 4R97C 1Z9OA 1UCBH 4YFLF 4J3VA 1Z5LB 2XI9A 5E6ID 4NRXB 4K23H 3UTQA 4CJ1A 1SYSA 1UH4A 1G7PB 4OD2A 2YD7A 3ARDC 3H9SA 3ROOA 2ERJC 1G6RB 3IFLL 1SEBB 1U8QB 4UMGA 3WL9B 2YHGA 1E6OL 3WUWB 3I6KA 4JRWA 3U83A 4HIJA 4RISL 4WFFD 3SDYH 4KTDL 1CLYL 3O2VL 2FBJH 1PY4A 3RHWF 2NY5H 4HIIA 5GSVB 5EOTB 5C8JB 3RNKA 3BDXA 1EK3A 5BS0A 1JNNL 1P1ZB 2YA0A 5GS0C 2X5PA 3DUUA 1IQWL 1S7RA 1A6PA 2UWEF 2IH1B 4M1DH 4DGIL 1PX4A 2CK0H 2X4RA 4CL7A 4Z7WA 2AEWA 4WHYG 1XR9A 3JTSA 4WJ5B 3LKSA 3L5XH 5F7HA 4PR5B 4D0BB 4HH9A 5EUOB 1NDMB 4LSDA 1RURL 3GI9H 1MJ8H 5T3ZE 4G6JH 3OR7B 1ZLVK 1PEWA 3WFHA 5CSBA 4TVPH 3UDWC 1BLNA 3HUJB 4KKCC 3FQWA 3C09B 3UYOD 3OKOB 4NQUA 1V8HA 2VQTA 3WIHA 1JE6A 2OI9C 1VFUA 1TJHH 3QEUA 2DTMH 3JV6B 5A2IH 4H8WL 5BCAA 4XBPB 2OK0H 4WFEE 1FYHB 4ZFZB 1J1XH 4ONFL 5DJ0B 2IMNA 4NQDA 1BOYA 4XMLL 2D0HA 1KF9B 5CBAA 1MVUB 2R0LL 3PNWB 1MCPL 3E8UL 3C60D 2OYPA 3GBMH 2J8OA 4FFZL 1A9BB 1TZIA 4PJ7A 4KVCH 3TVMC 2R9HC 2HJKB 3HNVH 2P48B 2XYCA 4XRCB 1V7MH 2EDTA 1BVLA 1SJHA 5I1GL 4XX1G 1KELH 1E0OB 4M61B 4JFEE 3QSKB 3NCFB 3RDTB 3EYVB 3TWCH 5C2UB 5BRZE 3BPOC 1F4HA 1F45A 3ULUH 3T4YA 4XBEL 3DIFA 5DQDH 3LQAL 4NO2A 4KROC 3PHQA 4AEHL 2FR4A 1F6AB 3TT3L 2HVKB 4E41E 4NC0B 4XNZB 3VXME 1OGAA 4ORGA 4FXKB 4G43B 1I4FB 3WNOA 2X7LA 1T0NA 1CD1B 5JORA 3G5YA 3ALPA 3HR5B 3MRLB 3BRDA 2Y7QA 4FXGB 3ARWA 2C1PA 4PB0H 1J8HE 4PJGA 3UTPE 1SMAA 3K80A 2ZKHL 1D6VL 2KQNA 3QDMD 1CL7I 5SWSD 1V7NH 2BXYA 3C8KA 3BPCA 2WP3T 5ADOL 5GIRA 4P59H 5DO2C 1ZKAA 4RGMC 5E2UL 2O5ZL 3MRMA 4JANA 4L4VA 1MAJA 1XF5B 4ODHL 5DJYB 4KRMB 4EDWL 1CYGA 1KCLA 1S8DA 3S35X 3LKPA 3RVWC 4KRNA 1GC1H 1QEWA 1R0AH 2ZG2A 1U0QA 4MD4B 2WANA 1RZ7L 5GGVY 5EO9A 4QTHB 3REWA 5IMLA 1DE4A 5HHOE 1KOAA 3VRJA 3VGGA 4I8DA 5LXGL 4NZDA 5FA3A 4P5KA 3AB0B 3WNPA 4NZJA 4OCWL 4C4KT 3VFOB 3IFPB 1LMKA 1QR1A 3L5WB 2YWYA 4MX7B 2DM2A 5C0NC 1L7TH 3FAWA 5ACMA 2VXVL 3G5VB 5F3BA 3ZDXF 1CDCA 5D2LF 2NZIA 5CKAA 4PJFB 5DHVH 1UZ8B 5GISH 3RNQA 2ICWA 3VXRE 1T0MA 2ARJA 1YQVL 5F9JA 3U82B 4X4XA 5DJ8A 5FGBA 2UVFA 4GW4A 4HHAB 1UWEL 5F7EL 4YDJA 5KVEH 2HLFD 1CGUA 2JKXA 3N1QC 3GSQB 4P4KD 4E5XB 1HEZB 4XCFL 3TN0A 5I8CA 2F5AL 4P49A 4POUB 4CNIB 2PTVA 2R29L 3OMZA 1UM6H 1YEJH 1DBMH 1ZWIA 3DVIA 4MNQE 1X5LA 3R0MA 4QCIB 2FEEL 3LN4A 3KLHD 3PQYA 4FP8H 5EZIL 3IJSA 5DK2B 1UYWH 4EKXA 3SE9H 2P7TA 2RJMA 4LSUL 3TA3C 5MERB 3SGEH 1LK3L 2X4QA 3CCHB 1QSFA 1ZANH 4ZMAT 1DTUA 4F7MA 3G08A 1MCFA 1TPXC 4Z7WF 1DVFD 3HA0A 4L4TD 2G5BA 2R69L 4PJDE 5DQ9B 2PYED 2VDRH 3W0WD 2JCCA 2ORBH 1MLCA 1LO0H 4S2SB 4P5TD 3BD3A 3FQTB 4TVPE 5HDBF 1HOCB 3QDGE 2OXGA 5GGVL 2R4RH 1Y0LA 5IIEB 3KXFE 3O2DA 5HD8D 3RKDC 5E6ZA 2IANA 1CE6A 1K3IA 1AXTH 5IESL 4PJIA 4ZS7L 1I1AC 2MHAB 4I5BB 2EDFA 2XZAL 3KJ4C 4AENA 5BO1L 4OLYL 5E6IA 1AC0A 4WO4B 5F88B 1XGTB 1KPVA 5IB2B 4DTGL 2W9EH 4XP4L 1KT2A 5JPMA 4LSRL 3RWCB 1BF8A 3T0AA 5D1ZA 2YSSB 4JO3H 4PGCB 2ZZUT 5K9KB 1D5BA 2AXFB 4RZCB 4MD0B 2F8VA 3QIUB 2ZNWA 4GKNA 1IAIL 4NCC2 4F57H 2O5XL 3LKQA 3MPCA 3GMMB 4GKZB 4PJ7F 2JJTC 2EDYA 4JM2D 4LVHB 5KW9L 1C08A 2OZ4H 2I07A 3CFJB 1T20A 2F9BT 1A3LL 3IJYB 5DUBA 4UI2A 1VENA 1C5DA 2HT3D 2J8UE 4HUWA 1EEYA 3ULUE 3JWOH 2XT1B 2MQ0A 1DQQB 1P53A 5EUKB 4ODTL 4LASH 4ERSL 2QQLL 3BH9B 5GS3A 3HC4L 1PD6A 1BM3L 5IFHL 4OZIE 4L8CA 5D7IF 5GS1C 2BSSB 2R23A 3RVXD 4P9HL 4EI5C 5FO8A 3PG2A 3CVIH 4U1HB 1HH9A 2WBJD 5KN5B 1G84A 3DO3A 3E2HB 3PP3H 3H0TB 2VL5B 3TBYB 3ARED 1U3YA 1ZSDB 5LBSL 1CXIA 2NY0C 1G7JB 3PABB 1VGKB 2X4NA 5AUMA 4UT6L 2IQ9L 1F02I 2ZUWA 4FTVE 2A0LD 4OIAA 3WDHA 4PJGF 5L2JA 3BI9X 4UT7L 2Z91A 2EE9A 1UT9A 4G9FE 5IVNA 4RSVA 3U9UA 2AXGB 1MCNA 5HYEA 1S7SA 3BKYL 3B83A 1J0HA 3UXFA 5EG6C 1MFCL 4IOIA 4V2CB 4X4ZA 3L3OB 3QEQD 3O4OC 2V9RA 4CRPA 3C60A 3BUYA 1CVSC 2AJYL 5IBUB 2IG2L 4TQEH 1FNGA 1BEYL 4PRAA 2EH7H 4KKNA 1S7WA 2VERN 1BD2D 5D8JH 1JYXA 3FZUD 2I60H 2XKNA 1OLLA 4GXVH 1JHTB 3UEZA 1VEMA 1ZLUH 3F7YA 4BZ1H 4ODVL 4ETQA 1BZ9A 5FYKL 1JHLH 1U6AH 3GIZH 5D70H 4ZO6A 5I76B 2DWDA 1Q9LA 4PFEA 4K8RD 1UM4H 1F8TL 4UV4L 2XTJC 4NNPL 3DVGB 1QHOA 1I1CA 4ZFOA 3CVHH 2WWMD 3HZVA 4XC3H 4Z7OF 1LE5A 3QI9B 2K7QA 1OD9A 4ODSH 5D2NB 3QDMA 5FIEA 5SWSA 4PBXA 3HE7B 4WW1B 4MA7L 3T1FA 1T7XA 1CE1L 3IXTB 1FVEA 1B0RA 3ECBA 3GK8H 4J8RA 5C09E 4CVXB 1QFWL 1NH6A 4R4FH 4X9FA 4LMQI 1U3HD 4TUOB 1BHGA 1TJIL 2CRMA 5MENE 1OW0A 1NBQA 1ITBB 3NCYP 2QHRL 2XWJB 3O6FB 3GNMH 3VGEA 3LQZA 4D0DA 4MMZC 1A6AB 5HHVL 5KVFL 3BT2H 1DBBH 1KIRA 2HRLA 4PJ9C 5E5UB 2YD5A 4LSTH 5IBUG 4Z7QF 2ITCB 3MA7B 3L3HA 5BOPA 1X4YA 3ZZ1A 4IDJL 1G7IA 1WBXB 4UT9L 5MP6L 4KPHL 3STBA 1YEHH 4TN9A 4NWUL 2JCCF 4J12A 2GK0B 1A7QH 1GHFH 3O8XC 4EXPX 4WIQA 3MLWL 5JA9A 3W9EA 2VXQL 4NPYA 3WMSA 2DWEB 5EU4B 4YQXL 4LLYB 5HYSB 3ZHDA 3MSPA 3SHSA 1RAMA 2VOTA 4K94L 4NDMB 2E9JA 1VHPA 4PJIF 1S5HB 2UZYB 4JN2B 3WN5C 3KYKH 4U1SA 1NANH 1NCUA 3VXUD 3MNVA 5DJZB 4P4KA 5KS9E 2DLEA 2KKQA 3D25B 5HHMB 1MHHB 5TGBA 1XAUA 5C0GA 2XRAL 4GQ9L 1U2CA 4N1EA 2QL1A 5C0IB 5IJVA 3X3GH 2CDFA 4XCEA 1CFSB 4N90E 4KKCD 4LAQH 1WGOA 1NAMA 3K4AA 4POZC 1QQDB 4GLRI 1NCNA 3CSPA 1KPUA 3FL7A 3P73A 4PGDA 2NNAA 3FJTA 5I1CH 3V0VA 5SWZD 3SGJC 1WFUA 3AMLA 4Q6YA 4IHOB 4YGAB 1R5VB 3DX8B 4U6VL 4RQQB 3VI3F 4OKVA 4B50A 1VPOL 3EDEA 1IC7L 2R1YB 1DVFA 2BSED 2VDQL 3TO4B 4OF7A 4NUJB 4PGEB 1T6WA 3QIBB 4M43H 5D93B 2X1OA 4NHCL 2PYEA 3H6JA 2IBZX 3IDNB 3L3JB 1CD8A 3W0WA 2ATPA 1EHLH 4AG4H 1YPZB 3LMJH 2D7PA 3BD5A 3RWJA 4BSWB 3STLB 4M6MH 4W4NA 1NCAL 2R9HD 1J05B 3ZKXC 5F7UA 5CHNA 4UAOC 1NKRA 3IKKA 3K2UL 3Q2CA 2ZOLB 1S9WB 5FKAA 1ACYL 3SJVB 1JNHB 4Z0BH 1JNLL 4M6NL 1C16A 1NBVH 2M26A 3ARGC 1KXQE 2XV6B 3HMXH 4YZFE 2FYYA 2FATL 4NQCD 4PB9L 4J4PD 1U58B 4KROD 4HK3J 5T5FL 1QBMH 1Y6NR 3R1GH 4K7PY 4MWFA 1TTGA 1U8OA 4TTDD 4X7TB 3SCMB 3QWQB 4OB5L 3ARPA 1LP9E 3BN9C 2HJFB 4QRPD 4F80A 4BKLA 2GHWB 5HYFA 1MWAB 5HVHC 3KDMB 2CPCA 2B0SL 3BDYH 5GJTH 5DFTA 2AK1L 1BX2B 4X7SL 1R3HB 4KGJA 4KWUA 5DYOA 1E4XI 1M1SA 4I9WD 3RWIB 3QXAB 3CU7A 2NYYC 3V6BR 3N1PC 1N2RB 4JZJA 1G7QA 1OTTC 4YO0A 5CS7A 5TE4L 3IVKA 4BZ2H 4QRUA 4QYOB 3QXUA 3BZFB 5IHZA 3PGCB 3WCYA 3B5HA 2ADIA 3MUGB 4QXUH 3QQ9C 4QKXB 2D7TH 1G9ML 5CP7A 2BHUA 3F62A 3TBSB 4EI6A 2ZUVA 2YD1A 1JPTL 2X05A 2WBJA 1URLA 2LAGB 4PJCA 1K85A 4LPYA 1JRHH 5BXFA 1DQDH 3VD4A 1K4DB 4I4WA 4GBXB 3RRQA 3AREA 2BVOB 3QULB 1WT5A 4KTEL 4L3EB 3L95B 4U1NB 4XAKE 1VKXB 1OAZL 1FL6B 2YUXA 1ZA6A 2CKBB 4S1RH 1IGFL 3GRWL 4DAGL 1N5AA 4G8GB 1A7NL 2YD4A 4FQPA 2UWEE 3ZTJG 2VLJB 5C0ND 1IEBB 4EDXA 4LRIA 3SO3B 5ISZE 4ZQKB 3QEQA 3AXLA 1FZOB 1KTDB 4L8SC 2JJSA 3RTQC 1B2WL 5E8DL 3W5NA 3Q1SH 4IRSC 4M7ZB 1XZ0A 2IBBA 4Y2DD 4O4YL 1BD2A 5D7SH 1Z0NA 5K9OB 1A3RL 5FUCC 2AW2A 3KPRE 4X8JB 2VSDA 3TT1H 4WWKC 3Q6GL 1DBKL 4OQTA 2A9NH 3OR6A 5DD6A 4DKDC 1RU9L 2KL6A 4EN3D 3SDXA 4OTXH 5DD1H 1KLGA 2VAAA 1I7UA 1YN6A 3I2CH 4HMDA 2HN7A 1WJ3A 1T4KA 4ZUVB 1LEIB 4L8BB 1RFDH 4ODUA 1M7DB 3U0TB 1AC6A 3O2WL 3UJJL 2V7HA 4RMRA 3A6BL 4DCQB 4PD4J 4R7NB 1T5WB 4HXAH 4XWOC 3UO1H 3TA3D 3SOBL 2P44B 5MI0C 1YYMH 2AJXH 4WUKL 5FUZL 4GMTL 4AM0A 3MNWA 3NABH 2B5IC 4PJ5B 5IK3B 2YD2A 3O4LE 1KJMA 1X4ZA 5AD0B 3DUSA 1H8SA 1I3GH 4OD1L 5F6HJ 3RL2A 4JPKL 5H37G 3NPSC 4QLRA 3SGKA 5JQ6H 3IXAA 3CDFA 4D9LH 2ESVB 1U8MA 4WU7A 3GSUB 4GAYA 3NGBC 3V5KB 4P48A 4J7RA 3AUVA 5J11C 1YC7A 1MLBA 4UILL 4LIQL 1U41A 2W0LA 3ULVH 1D5ZB 1U3HA 4Y5YA 1HN1A 3K8LA 1IGMH 1U8HA 3RKDD 4H88L 3DUHA 1I1AD 3F7PC 3L5HA 1EVTC 4YHPB 5E9DD 2Q87A 4HUVB 3L5JA 1JZ7A 1RHFA 2VISB 5I8OH 3TH4T 5BVJB 4DQOL 2P5WD 1A4JB 1P4LA 1JGDA 3MRPA 3EJZD 4J3OC 4NJAL 5ETUB 1KN4H 2HG5B 4LCCC 3AVEA 3ARDA 3WS6C 4XPAH 3EOAA 4JDTH 1A14L 2ADFH 2Y4SA 4FMFA 3GMPB 2VJXA 2X4OB 3MACL 4JG0H 1INEH 2AQ1A 3MA9L 2R2HB 2J12B 1KB9K 4W68A 3SDCB 3KPRB 4UOW1 3WFDL 1VFOA 5EU3B 5CD3A 3HI1B 1Q0YL 3LQAC 4DGVH 3UJTH 3IDJB 1T21A 3FCTA 4JFYB 4WHTB 3MYJA 6CGTA 2BFVL 4KH2A 4UIKL 3QJHA 4R7DA 4KMTL 2NW3A 5J7CC 5CJXC 3MO1A 4JFPA 1NC4A 2HKHL 1GGTA 3VXUA 3WNMA 2G60L 5C9KA 2WUCH 3TJEH 1N0LA 3EFDL 1NBYB 1AP2B 3MLSH 5IOPB 1PJ9A 2NXZC 4H1LH 3HI5L 3GI8L 5T1MA 43C9B 3MR9B 4NSKA 3QYCA 3UDWA 5DRZA 3DROB 3O11B 2A6JA 2C4FT 2H1PL 1QFOA 5KZCB 2NY0D 4U6YB 2MPAL 3ZDXE 2I5YL 5A2JH 4QXTA 4OI9A 5D2LE 4OZFB 4NJ9L 1AGEB 2E7HA 4KJWD 2X9YA 4HWBA 5SWZA 2H2PC 4ZXBC 3GGWA 2F54D 2NY1C 1G6VK 4G6FD 1U8PB 4U3XA 4G5ZH 4O58L 1TQBB 1RVFH 1AE6H 4OBRA 4F7TB 4XVJH 2YUZA 1MJJB 3WKNA 5A3IC 1MHCA 3VDCA 3QIWC 1GCFA 2PETA 5D7JB 4JHAH 1S9VB 3QP3A 3H9SE 5D1QB 5B8CA 4K7FB 4KHTH 4PJCF 3CX5K 1LO3H 3ETBF 4DKFL 4TTGA 4FZ8H 4YC2C 2P49B 2Q7YA 4LRNL 4NQCA 4J4PA 2V2TB 2XQYK 3L7FB 3EO1A 1SY6A 3MJ9L 4G8FA 4JZOB 2P5EB 5I8KL 3NCEB 4QRPA 1KFAL 3ARBB 1B4RA 3GSVB 1C12A 2FSEA 5HPOA 2PW2B 3VE0A 4UQ2B 3CFDA 3PJSB 4HBQA 2IQAA 3IYLW 2XA3A 3OAUH 4Q9BA 1UJ3A 4XPGH 3QUKB 1R3JA 2AJSH 3L1OH 4GXUM 4OZFG 4TSAH 5KTEH 5J57B 5F93C 4WEMB 1HWGB 1EEQA 3KPMB 4U6XA 3SDXF 3RQ3A 2EYRA 2CJUH 4TNVK 5TDNB 3TZVC 3SGDI 5JTWA 5FM5O 1YEFL 2X1XR 1YEIH 1UXSA 4XXCC 4QRQA 4AJ0A 4NQDE 1R3IH 5KAQF 4J2XA 1IMHC 2XWTA 4UV7L 4WTZA 2V5SA 4PV9A 3QPQC 4PRNB 3MV01 1PKQA 1KIUA 2E3VA 3H3PL 3RWDA 1EERB 4PJ7E 3G5ZA 5CEZL 3U4AA 1X4XA 5EU6B 1Q0XH 4OFYD 3UTQB 5E70A 4OCLC 1F6FB 5EOCJ 4FFYH 3ROOB 4QT5A 5DS8A 1UC6A 5CZKA 4WTXA 4F2MB 5E8OB 4GW1B 4MJIA 3O8XD 3FOLA 1KCVL 2I9LA 3BZEA 3TCXA 1HYRC 1U3ZA 2DKSA 1I9JL 4U6HB 5CMAA 4K9EL 5L6YH 1RQ5A 2VNCA 5BOZG 1P84K 5BS0B 1RPQA 1RV6X 1OGAE 1QD0A 3DI3B 1EEUA 1JZ8A 5IQ7H 2ZSVA 3PGDB 4Y2DA 1BQLL 2QSCL 1S7RB 3HNSL 1B6DA 4I77L 5FYJD 3KPSA 3O3DA 4Z7WB 3C6SA 4PJBA 1XR9B 1RIHL 4X7DC 1ZHKA 3QWOA 4PJGE 1MY5A 3I3EA 3L7EB 3MOQA 4KTDH 1CLYH 3O2VH 3MLRL 3RP1A 4YDIH 1OHQA 3S36L 1KACB 2JB6B 1T1ZA 5L8JB 4O2FA 1IQDB 4POZD 2NY7L 3HZMB 4ESKA 3IDGA 1BLNB 3FQWB 4L4VE 5CZVL 7CGTA 1IQWH 1ED3A 1KCRH 2MCG1 3TA3A 2EC8A 1AI1H 1IGJA 3D18A 4AIOA 3NCJL 2VDPH 3AAZA 3LY6A 5BJTA 4NN7B 4D0CB 4P9HC 4HKZA 1LDPL 5IMOB 5DC9B 2YPLB 3NTCL 2RGSA 3MRHB 4NHUA 1ZV5A 4N1HB 3QCTL 4Y4FC 2MCPL 2BVPA 1MCKA 1RJLB 5C07D 4MZ3A 3UBXA 2HMIC 5T33H 3F6IA 1U92A 2FEDC 2FX8H 3CFKA 1BWMA 5DEGA 3I3DA 4QOKD 3ZYOA 1AO7D 2OTWB 3V7MA 1OF2A 4GRLB 4OCSL 1JP5A 35C8H 1GJIA 1Y18A 1DEDA 4H8WH 2DQFB 5I6XB 2EC9T 3DYOA 1I1AA 3O3UN 5E9DA 1V3MA 4OM0L 1MCQA 4U31A 5GRUL 4LF3B 4Z95L 4GKOA 4F37K 2P5WA 4XMLH 1YUHA 1TDQA 3TBTB 4JFDE 2G2RA 4Z7OE 3DIFB 4NO2B 4HWUA 1HZHL 3V2AR 2C4FU 1MCPH 3E8UH 5D7IB 3GKWL 4J3SA 5SWQA 3D6GA 4FFZH 2ENSA 4YH6A 5DJCB 4KGLA 4ORGB 4U2YA 4BFIA 2CXKA 3MLVH 3HNTL 5I1GH 1MCWW 4PRBA 3MODL 3BD4A 2C1PB 3GHBH 3MRFA 3QFDA 4YK4B 4ZDHA 3C5ZB 3SY0A 3QO0B 5ESVB 3S37X 3PQYE 4XBEH 5T3XE 5EZOH 1J10A 1AHWC 4JM4L 5H94B 4ISVB 4WFGE 3BPCB 1Z6JT 2CR6A 4JN1L 4ZUWB 3TT3H 1JN6A 2GT9A 5GIRB 2E27L 4OZHA 5JW5B 1QSFE 4JANB 3SDDC 3JTTB 1I85C 2X1PA 4OZGB 2AJUL 3U0WL 5GS1A 1YEDB 2YC1B 1S8DB 1M7XA 3LKPB 4XTRC 5E7FA 3VGBA 5FUOL 1J1PH 3VGFA 3BX7C 4WU5B 4MQSB 1D6VH 5EO9B 2JCCE 3MLYL 1NGWA 3OKNA 1GOHA 4KRPD 4P3CL 4BK5A 5IW6B 3VRJB 4Q2ZA 2HFGL 1FRGL 1OM3L 5ADOH 2FECI 3TC9A 2GSIB 5FKPA 2LVEA 2PW1B 2RAMA 3HE6D 1RK1A 2DLFL 2F54A 1OD7A 5E2UH 2O5ZH 1TZHB 2VQUA 4HGWA 3VXQB 1QG3A 3PDOA 5HGBA 4ODHH 3ZKQD 5FM5M 1ZLVH 2IANE 4PJIE 4EDWH 4NO3B 2IADA 3RIFF 3EYQC 1DBAH 4G42A 4U49A 3A0OA 4YXKL 5F3BB 3DYPA 5JR1H 5CD5C 2XZZA 5HGHA 3AU1B 4N0UB 4KJYA 3DMMB 3QNXB 5DFVC 3BIKA 1CZ8L 1D5XB 5LXGH 5J0BA 2JJVA 4TOYH 3VRIB 3OJMB 1HIML 4EUPG 2BRQA 4X4XB 4CN4A 1J11A 4Z76A 4WFFE 4YDJB 4OCWH 3BIAX 4WWKD 1NAMH 5DEFA 4NQXB 4GMSH 2BRRL 3RA7L 5I1AB 2I25N 5EIVA 3IETA 3TBWA 2VXVH 4X5WA 4PY8I 2B39A 1ZWIB 3VJ6A 1I7TB 4XVUC 5JIIA 3WFZA 1DQLL 1WAAE 4NKOA 1CVRA 3TEUA 5GRJH 3KPTA 1FNFA 3IJSB 4XWOD 5E2JA 2BSRA 2IGFL 5F7EH 1YMMB 3MUY1 5GRYA 1I8IB 3L3KB 5IF0A 2FX9L 1T03L 2VMFA 3BWAA 5E00B 3D3VD 2GUOA 1PVHA 4HKJA 4XAWH 4XCFH 1ULVA 2F5AH 1XT5A 1UXWA 3CDCA 5HGGS 1YDPA 2R29H 5C6PB 3G08B 4TSCH 3PWNB 2X9WA 4PJBF 4L9LB 1CFQA 4MB3A 5ILTL 4NKIL 4KMQA 1T89A 4JO4L 1UB5B 3D0LA 5E2TH 5ESQB 1M6OA 3RVTC 4YHOL 3MZTA 5DTFA 2AJ3A 1MLCB 4CW1A 4QNPF 1BJMA 2UYLA 1CT8B 1NCTA 4BJLA 3D69A 2DQGL 1U8LA 4TUJB 4NO0D 4R26H 4LLVB 1X6NA 4OJFL 3QO1B 3MCKA 2YRPA 1J1OL 4KY1H 2WINA 4PJ9A 1RZIA 4NWTL 5I74B 1T66D 2R69H 3HCVA 5IKCA 4PJAB 2KH2B 1CF8L 1I1RA 4NCC1 1XGPA 1MCEA 4UNVA 1Q9OB 4OFYA 2OXHA 1KPVB 3HB3C 5JHDB 4S1SL 4M1GH 1KT2B 4FG6C 4ELMB 4LOUD 4JZNA 5M94B 3S3PA 5C71A 2F19L 4HC1L 4PRPB 1E6JL 3RY4A 5D1ZB 5GGVH 5C0FA 9CGTA 3MRJB 1D5BB 5FM4A 5D7LD 4JEGB 3O6KL 3O8XA 5E8NB 1CICC 1YEGH 5ITFB 3RVVC 5IESH 3D48R 4ZS7H 1R5WA 2P42B 3ZLQC 1GH7A 5DD5L 3MV8B 1KJ2L 2FL5A 1Z2KA 1C08B 4I0KA 1T20B 5BO1H 4OLYH 3NBNA 1QO3B 1EHXA 3OJ2C 5F1IA 4QHKI 1ZLSH 5DUBB 2PO6C 3WN5A 4DTGH 4XP4H 5IR1B 3W39A 2H41A 1AXIB 3G6JB 4PJXA 2A2QT 3TNMB 2E6PA 4MAYC 1UADC 1U91B 2XY1A 3NA4A 1AKJA 3QDME 1KEML 5SWSE 3QEGL 2I9TA 1IAIH 4I2XE 2O5XH 1HH9B 1UKSA 3N9GL 3WHXB 5KW9H 4OGYH 4Z9KB 3TNNA 3QXVA 2UZIL 1CDHA 4P57B 4RDQG 1HSBA 1R3LA 3QUMB 4RFOL 4JFHD 4M93C 5AUMB 2H2PD 3P4OB 1T22B 4XGZB 4ZXBD 3SGJA 5E99L 5L2JB 2I24N 3VXSB 3MV7D 1G9MC 3WSQL 1JF1A 4OKDA 1D6EB 1NEZB 3ES6A 1CCZA 2CMRL 2QQLH 2Z4QA 4AYFA 4ERSH 4OIIL 2F8OA 3U9UB 2OL3A 2VDOL 1S7SB 4Y5VB 5IFHH 4KDTC 1T83C 4RGNC 4OZHF 1CDIA 1FE8L 4RGOH 4IOIB 5A3ID 1CXLA 1OAUL 1V3KA 3QIWD 1CG9A 1I8MB 2A6KA 3UTZA 4F7EB 4OQTH 5LBSH 4QOKA 1AO7A 1CLOH 1L7IH 3U6RA 4UT6H 2H32A 1WLHA 4GRWH 1JI2A 1F4WL 2NY2B 3VFMA 4K8RH 2CQVA 2MMXA 5E4EC 3BKYH 4ETQB 3MREA 5TPWL 2YBRB 3ARGA 3KHQA 4IJ3C 3D87B 5FF6A 4AMKL 1SJEA 2DWDB 4ETYA 3C5SA 4A2MA 3MXVL 4L8DB 3UCRA 5HYJD 4MXVF 1SVZA 2AJYH 2IG2H 2I27N 4MCZA 1JPSH 4S1DD 4M7JL 1P7KB 3H9HB 1D7FA 3L3DA 3I75A 4LVNC 4ZFOB 1FN4A 4R2GB 5FYKH 3HPLB 3OKDA 1A6UL 5DMJB 3MLXL 1IEAA 5LG1A 2G75A 4OM1H 3BGAA 3QR2A 3ZKMC 2EYSA 1L0XA 1WK0A 1AD9B 1KENL 2CO6B 4JGMA 5ICZA 4UDUA 1RJZA 1RZJH 4HX1A 1F8TH 1B0RB 4UV4H 1UM5L 3TZVD 5JO5B 4NNPH 3NIGF 5SV3A 3G04B 2VRAA 4LVHC 1ZGLM 2RIKA 4L4TE 3R8BB 2D3VA 3GMLA 5TQ0L 4DVBA 2PYEE 3LQZB 3RI5F 1SBBA 2ICWJ 3KJ6L 1KIRB 1IAOB 5FOBA 2APVA 5EBWA 1B0GB 1RD6A 3HE6A 3L3HB 4P2OD 5GXBB 1JWMB 5EPMA 1AR1C 1QFWH 2X42A 4Z7UE 2XY2A 2ED7A 1QLRB 1TJIH 3V6OC 2IFFH 4WDIA 2OR7A 2OR9L 4NN5C 2C3VB 2O26U 2QHRH 3OKEA 3VI4F 5JHLH 1OGTB 3GMNA 1X3DA 2F53D 1JPFA 4NPYB 5HHVH 3HR6A 3MBEC 4G6KH 4IRSA 1X9QA 2DIJA 4DVRL 1QRND 1GSMA 1UVQB 3GJFK 3T77B 4IDJH 3T0EB 1L9MA 4DJMA 4UT9H 2GK2A 2UY7A 5MP6H 5TQ2L 4QHNA 1P2CA 4KPHH 4WWKA 3MNVB 5H35A 3PHOA 4U3CA 1JTPA 5F89B 3T8XA 4NWUH 3OKLA 1FYTB 2E7BA 5TGBB 1JPST 4Y4HB 5CAYB 2HRPL 4LLDA 4Q0XL 2B1AL 2CDFB 4E42A 1KNOB 4YQXH 2AJVL 1JFQH 4V1DD 3FB6B 3U48A 4K94H 1MCWM 4KKLC 4YEEA 5F9WC 1KIPA 2QJDA 3V0VB 3D3VA 4GW5B 2P8MA 2BK8A 3FRPG 4JREC 5I1EH 1A7PL 2ADGA 3UTSA 4J1UA 1K6QL 2CLRA 3DO7B 3QDJD 4YHIA 4PJXF 2AEIT 1EAPB 4S1QH 4AQOA 2HMID 2FEDD 3P4MA 3W0WB 1JK8B 3F7VA 2ATPB 5FXCH 2OCFD 3SDAC 4K3GA 5ERWA 4JQVC 4LHUB 5DVNA 3RWJB 1CDJA 5I1DB 5J13B 5FV1L 3HRZA 4NO0A 3QRGL 4WNQA 3S35L 5CHNB 4U6VH 3QEQE 1VPOH 3VFTA 4APQD 2V5YA 4G6AC 4QHKJ 1NFKA 1QNZL 3QXDA 2VDQH 3UAJD 5MEPB 3THML 1KBGL 1DL7L 2B2XL 4PLJC 5D71H 1TETL 2FYYB 4LCCA 1PW3A 1FGNH 4N8CL 2LABA 5DD3L 1KIQA 1BD2E 4YX2H 4CBPA 2LAAA 5EU7C 3S5LA 1NCAH 3I6GA 4BKLB 1LO5A 5D7LA 4WVRA 1Z3GL 3SDXE 3K2UH 4KZDL 1DLFL 1FFOA 5HDOA 4IMKC 1ACYH 5DGQA 3BZ4B 2EXWD 2AJZA 1JNLH 1NUDA 3FHQA 1VFMA 4TSBL 1AQDA 2WBKA 2FATH 4PB9H 4ZOEA 3X11A 4O2EA 4C56B 1PFCA 4DN4L 4JZJB 1G7QB 5JIHA 3E3QC 4QO1A 5AAMA 2YUWA 4KTYA 4OB5H 1IE5A 1QVOA 4OI7A 1NFDB 3FN9A 3KYOA 2B0SH 3F5WA 5DJAA 2AK1H 4X7SH 3T2NL 4X99B 5HVWA 4EI6B 1F3DH 2EH8H 4JKWA 4PJCB 1BZQK 4LLAA 5D5ME 5DT1L 1NBZB 5BXFB 3BYTA 2AV1A 5FYKE 1MPAL 2ZCKH 4G7YL 1IKNA 4I3SH 4R0LB 3OX8A 2AK4D 3IDMA 4ZXBA 3V52L 4GOSA 4OSUL 4OFKA 1U2HA 3C9NA 2OTUA 4Z5RB 2D4DA 1X5AA 3CX2A 1JWSA 3FTGA 3MFGB 1JPTH 2Y6SC 5CD5D 5BZDA 2DLIA 3QIWA 4WWID 3AXLB 4ZOBA 1MCOL 3V4UL 4JVWA 4DN3L 5DFVD 5FO7B 3UTOA 5ADPL 4YJZL 4HXBL 5B38G 1JPGA 1FHGA 4XWGH 3VWJC 3D0VA 3O3EB 4CN1A 1HI6A 3ZHKA 1IGFH 3GRWH 4DAGH 5ICXA 5D93C 3QIBC 1A7NH 3B43A 5BVPL 4NZTL 5E5RB 3OKKB 2D31A 3NN8A 3V0WL 2GJ6D 1NGPL 1R6VA 4JR9L 5TDPA 5M95B 3U46B 3K2MC 2ZG1A 5HYJA 1B2WH 4ODUB 5E8DH 4K3HA 1AGBA 2KDGA 5CBEA 3VXUE 4OGAC 5IMKB 4O4YH 5FDYA 3SGEI 1A3RH 4MMXC 2IPUG 3VMOA 2EIEA 3EYSL 3FQUA 4XNYH 3Q3GA 1DBKH 2VC2H 1A6ZB 1RU9H 5MEQA 1MAML 4W6YB 8FABB 1FC1A 2ZPKL 3SCMC 3RWGA 4P9ML 2GTWA 3S4SG 1RUQL 3ARXA 1YQ2A 4NKQB 3UJJH 3IXAB 1WEJL 3O2WH 3RVTD 1JZ2A 1U8MB 1LQSR 3A6BH 3PIQA 1FNEA 4WU7B 1P4BH 5GZOC 3CUPA 1TTUA 3IGAA 5EO1A 3TZVA 4CU7A 1MFDL 3SOBH 1EFQA 3HAEH 3LKOB 1U3HB 3C5JA 5TF0A 3B2VH 5FUZH 1U8HB 2FO4B 1CXFA 2R8SL 2HJLA 2NX5B 4OD1H 5EBLA 3EYUL 4HZLA 5JZ7D 2YD6A 1N64H 4JPKH 3PWUA 4R97B 3DURB 3X12A 3CZFB 3MOBL 2DF3A 4KJPD 5IV2A 1JGDB 3MRPB 4PREB 4P2OA 5FYKU 5DLML 3T0BA 3HB3D 1H5BA 2BZDA 1LVEA 3ARDB 3EOAB 4FG6D 3X13A 2ERJB 1GZPA 4UILH 3D39A 3SPVA 4J6RL 4W4OC 2VIRA 1LD9B 3DV6B 1OT1A 1MAKA 3GSNA 4GBXC 1WF5A 2ATKB 3X14A 4BQ9A 1KTKE 1P69B 1YMHB 4H88H 3RVVD 4NQCE 2VABA 1PAMA 1HH6A 2F53A 3AS1A 2GYSA 1KG0B 1T21B 3VH8G 4NJAH 1FH5L 1I9RL 2BJML 2H9GA 4QRPE 1HYSD 1QRNA 4D9RD 3QJHB 3V4VL 2HT4C 4QHLA 1A14H 3EKCA 3MO1B 4KJQC 4OCYL 1NC4B 2FGWH 1BIIB 4I9WE 3BISA 5EOQL 4HG4J 3KNBA 3SE3C 5C0CA 1FGVH 1BF2A 2X4TA 2R0WL 1WWBX 3V6ZA 5CSGA 2X40A 1FNSL 3WFDH 4U1IA 1Q0YH 4XI5D 3GJEA 5HHXH 2H2SD 3RU8L 4CJ0A 1ZGLP 4V1DA 1E27B 5L0QC 4WUUB 2BFVH 2A6JB 4MXWL 4UIKH 2FZ3B 3I6LD 5FV2A 4KMTH 3U9PL 1JI1A 2OI9B 5EORL 3QJFB 3BO8B 1ETZA 2HKHH 5SWZB 4GKSB 1M7IA 4YDKL 5AZEL 3GGWB 3EFDH 2VLRB 5JW4Q 5C6TL 3B6SB 5SV4A 3HI5H 3TV3L 3B9AA 4ZUUA 3QDJA 1IAMA 1PKQE 4WFHD 5LWYH 5GJSL 5CLTA 2GIYA 2H1PH 1NCDL 3V6FA 3OPZH 1YNTA 2I5YH 2BVQA 4QXWA 1QLEH 4N0FA 3TVMB 1NLBL 1T5XA 1DEEA 2IBZY 3B9KC 3WLWC 3NFNA 3VWKC 3BP4A 4MNGB 4APQA 3VGHA 1UCBL 4O58H 5DC0A 2IALB 2YS4A 3BPOB 4K23L 1F13A 2VDMH 2Q7YB 1I3UA 3TM6A 4G6MH 4DGYL 2EDKA 5JNYB 4KKAD 4YAQB 2AEQL 3EO1B 3SDYL 4EOWL 2ZOKB 4M5YH 2FBJL 2FSEB 3U0PA 2UVEA 3VE0B 5DD0H 4PGBB 1Z5LA 5ANMB 3BOVA 4NRXA 4WO4D 4DOHB 1G7PA 1G6RA 1AHWA 1U8QA 3MJ7B 3ZKMD 3NFPA 2NZ9C 1YJDC 1QSED 2EDXA 4ODXB 4CU8A 3QIUD 5I8KH 4U6XB 3VU2A 1KFAH 3GI9L 1I85A 2EYRB 4G6JL 3PV7A 5F96L 2ZUYA 2QQNL 3KPQB 5GSVA 3K4ZA 5EOTA 5FCUL 5C8JA 5F9AC 4TVPL 5HPMB 1P1ZA 3MRNB 3PWPB 1FLRL 2VLLB 1OWWA 2PUQT 2IH1A 2IPUK 4LFHD 5J89A 1VFBB 1EGJA 1RULL 2VH5L 2P45B 5MHSD 4PR5A 2AK4A 3I9GH 4D0BA 5EUOA 1J1XL 4IIQC 3G5ZB 1PZ5B 3MCG1 1AR1D 3B2UD 4MYWB 5E9DE 1K4CA 1YEFH 5DS8B 3HUJA 2LU3A 4H5SA 3UMTA 3OG6B 2EYTA 1F3JB 3OKOA 4BFEA 2EEDA 2P5WE 5FYJH 3GKZA 2HLAB 1T7VA 4MJIB 3H9ZA 3FAXA 2I9LB 4UV7H 4RIRB 4KVCL 3JV6A 1FO0B 3Q5OA 3X3FL 2C3HA 3H3PH 4M7LT 3VXOB 1VEOA 3TWCL 5DJ0A 5DJDB 2ZSVB 1A5FL 1NANI 3KPSB 5F3HB 3WFBH 4JRYB 4PJBB 1MVUA 2GJ6A 3PNWA 3ABZA 3LRGA 2R15A 4P3DB 5D7JC 4TPRL 5D1QC 1AGDB 4K9EH 2HJKA 4XRCA 4CMMB 5HVFB 1T1ZB 5E24E 4G3YL 2OL3H 4OZHE 2J4WL 3EYVA 4FQIL 4CADB 5F44A 4F58L 1FFNA 1BQLH 4MQXC 5CILL 4PUBL 5HY9B 1IGJB 1S7TB 3AAZB 3EDKA 1RIHH 1V7NL 1U93B 5L88L 5BJTB 3QNYB 4NQEB 1F6AA 2HVKA 1Q9KB 1LILA 3MLRH 4FXKA 1I4FA 1FV1B 5TE6L 5GGQL 2DIAA 1CD1A 1QP1A 4YBLC 2F54E 3UBXB 3HR5A 3MRLA 2LU4A 4FXGA 4M8VA 1MFEH 4MQ7B 5GRZA 4JFFB 5IBTH 1BJ1H 3H7BA 1TCMA 1XH3B 3HE7D 1I1AB 4G6AD 1LDPH 4MJ5B 4BA8A 3KJ4B 2CUIA 4K71B 5JDJA 3QCTH 2MCPH 4PLJD 1XF5A 2CDGB 2ID5A 4X5XA 2G2RB 5DJYA 3FB8A 5C0AD 5CGYC 1NC2A 4HW6A 1L7TL 3SQBA 4Q97A 4GS7C 3PGFL 4OCSH 3NIFF 3KYMA 3O6FD 4BFIB 4IOFD 1CICA 4N8PA 3NIGE 4ZFGH 4Z95H 3U1SL 1ITCA 3VFOA 3IFPA 4G9DB 5I17A 3L5WA 4MX7A 3G6AB 1JYNA 1HZHH 3G5VA 3R0NA 1YEJL 5HI5C 4PLKC 4Z7VE 4C59B 4PJFA 5DZOA 2R1XB 2XACC 2B4CH 1FL5A 4EI5B 3FO0L 3MODH 3S97C 4HHAA 1JRHI 1N8ZA 3WIFB 2HA1A 3PP3K 3SE9L 4LCIL 3WJJC 3U2SB 2NY0B 2FJGB 1NGWB 4JM4H 3GSQA 3K74B 4XP6L 1HEZA 3VI4E 4E5XA 3S88L 4JN1H 4Q2ZB 5B21A 4GRMA 2E27H 3FN0L 5JW4N 4MA1C 2VR5A 1OB1B 2NLJA 2BOCB 2Y5TB 4HGWB 5E94B 3LV3A 4IRJC 1YZZA 3PV6A 4KDTA 1MHPL 1T83A 3B5GA 3U0WH 2VDRL 2NY3C 5FUOH 1LO0L 4KAQH 5DA0B 5DK2A 4G42B 5IHUL 4QWWC 3O4OB 1I75A 5MERA 1S3KH 3JWNC 2R4RL 3MLYH 3CCHA 2HFGH 1FRGH 4Y7MA 1OM3H 5ACZB 1ORQB 1AXTL 4R96A 4X0KB 2Y9RT 5DMGC 3TO4D 4Z76B 3QIBD 4KUZL 4XVTH 1TJGL 1ZLUK 3ZKND 1HE7A 1QOKA 3V79C 4LCWA 5EUOF 2RCSH 2VWEE 4S2SA 3QB7C 2W9EL 5F7FA 3FQTA 3IETB 4YXKH 4ZSOB 1HOCA 3LEVL 4U1GB 4JO3L 4GRLC 3VJ6B 5IIEA 2Y06L 3HUJF 5FYJE 4PPTA 1CZ8H 2VR9A 3B3IA 1XFPA 3FKUS 4NKOB 4OGAD 1MELA 4PJXE 1HIMH 5GRVK 1T1XB 4NFBA 2XTJB 3SJVD 2NR6C 4K7PX 2DN7A 5D7KD 5IF0B 3BP7A 1PZUB 3IFNL 4WO4A 1XGTA 1ZT7B 2BRRH 1IGCH 1HHKB 5IB2A 4UB0H 3W2DL 5FA4B 1JZ4A 3RHWK 4CKVX 4Y5XC 3RWCA 3SCMD 2PN5A 2YSSA 4PGCA 1LGVA 5IBLD 3GB7B 4LASL 2AXFA 1QSEA 4MD0A 4HWEL 4RZCA 1DQLH 4XXDA 4NRYA 3QIUA 5GZOD 3S3JA 5DTFB 2CKBL 3GMMA 4LPCA 4RMVA 2IGFH 4CW1B 2EO9A 5ECJE 4YK4C 5JQHC 5JLZB 3CFJA 2FX9H 1T03H 1HHJB 4MSWB 3IJYA 5I1IL 2MSPA 5IB4B 5C07E 1OAXL 1DQQA 4G80B 5EUKA 2WINB 4PJ9B 4QOKE 5L2KB 1AO7E 5ILTH 3BH9A 3FN3A 4LNRA 1PDKA 4E0RB 1Q72L 4JO4H 1XGPB 4R4BB 1G7MB 4TULH 4YHOH 3NA9L 2BSSA 4RWYL 2VO5A 4DUWA 4CUCA 5KN5A 4U0QB 3BEVB 2DQGH 3H0TA 3V6OA 5CJOH 4GBXD 5EOCL 3TBYA 2V5MA 3WYRA 1ZSDA 1CFTB 1GPOL 3OHXB 4L3ED 4OJFH 1VGKA 5F70A 5T1LB 1Y6KR 1ND0B 3O81A 3S96B 1R5WB 3MBEA 4NWTH 2CIIA 4YE4L 2I60L 2AXGA 1NMCC 4G8GD 3DHMA 5E8PB 5T1KA 4BZ1L 2VLJD 3WN5B 3GIZL 5D70L 4S1SH 4KJQD 4H1LB 5I0DA 2V2WB 2F19H 1OAKL 4HC1H 1NCCL 4HMCA 1M71B 1II4E 2X2YA 3DMMC 1AKJB 3NMEA 1FAKT 4JGJA 5JPNB 2XIDA 5GRVL 1BBJB 2BX5A 1T6VN 5DD5H 4CVZB 1JHTA 3CVHL 4LP4A 3N06B 4XC3L 5FYJU 1HSBB 1R3LB 3NCYS 4U1JB 3O9WC 1KCSH 2BOBB 3BP5A 5BV7L 5I76A 2WM0A 3JUZA 2YEZB 2E9IA 1KJ3H 3TH2T 1HKFA 4HUKB 1ZHBA 3M1BB 4JKPL 3QEGH 4M4PA 1KB5A 3KPLB 3CFBB 4X6FB 2DI7A 3NFSH 3B5TA 4R4FL 5GS2D 3DVGA 2DTSA 5J6HB 1X7QB 1QSVA 1CIUA 4FN0A 4PJFF 3SDAA 2UZIH 1CG9B 4JQVA 4L9DA 5DJXB 3UTZB 5F7MC 3BESR 4PJ5D 4YPJA 2JJUA 1AO7B 4KQ3L 4RFOH 3ZKXB 3GNML 2H32B 4HJ0C 1QBAA 3CSYA 1BPVA 4UAOB 3RKPA 3WLWD 4EQ3A 3HPJB 3BT2L 4OIIH 4LSTL 2VDOH 2ESVD 1TZGL 3BMVA 1EHAA 1JF6A 1P9MC 3OAYH 2OBGA 3ARGB 4YFDB 1FE8H 3BVNB 1GRWA 5C0AA 1Q94B 3BFOA 4TUOA 1YEHL 5DQJB 5FGCB 4H1LG 2WWKT 1Q38A 5HVHB 2XWJA 3F12A 4HKBA 4WRLA 1RHHB 3FMGL 1A6AA 4MCZB 4KDWA 3JV4B 4JQXC 5I74C 4IMKA 4WEUD 4EBQL 3OKDB 5TPWH 1J18A 3W9DB 1WBXA 2Q8BL 1WZLA 2G75B 3OKYA 3QFJD 5ESAB 2X1QA 4PJEB 5D96C 4AMKH 4AZ8A 4O5LL 4K3JL 1KGCD 3TCLB 4WY7H 3GM0A 4GH7B 3MXVH 5DUMH 5ICZB 4UDUB 1WFTA 4F33B 1RJZB 2BNRA 2GK0A 3D3VE 3SDCD 4HX1B 5C0BA 3WE6A 3X3GL 3O41B 4M7JH 2DWEA 2YR3A 1L6XA 4LAQL 3BEWB 3QNZB 1JYVA 2CDEB 4NDMA 1A6UH 1S5HA 3EDFA 3EZJB 4JN2A 3MLXH 1MF2H 1U3JA 5HHNB 4DVBB 1KXTB 3OB0H 5DJZA 3PWVB 5FDWA 3D25A 1KENH 1MHHA 3MLZL 5FOBB 3NCCB 3DJ9A 1R24A 3MRBB 2XXMB 5IB3B 5C0IA 3IKCB 1CFSA 3CDGB 1IZJA 3N0PB 2R1WA 1HKLH 1VACB 3ESUF 1F97A 4LEOB 2OSLB 1QQDA 1EHLL 3C2SA 3LMJL 4WDIB 1FFPA 1X5ZA 5BW7C 2OTPA 2PTUA 5TQ0H 3MLUH 4L8SB 3TO2B 3RTQB 3MLPA 4IHOA 3KJ6H 3DX8A 3VFUA 4RQQA 1NSNH 4IRSB 3VWJA 1P7QB 2R1YA 4N9OB 4I0PB 3P4NA 4M3JA 4Z77B 3TO4A 4NUJA 4PGEA 1MCLA 3QIBA 5IJKC 5DHXB 2A77L 3HMXL 3L3JA 4WWKB 3O3AA 1YPZA 5D7JD 4BSWA 2OR9H 5TH2B 5D1QD 1RZGA 3T2QA 1J05A 3MC0A 3LH2H 2V17L 5DRXA 1FC2D 4JRXB 2NQCA 2NY2C 2ZOLA 1S9WA 4DVRH 4U1KB 3SJVA 1JNHA 1OP5K 4MQXD 3OWEA 4OF0A 5MI0B 1ADQL 5TQ2H 1KIPB 2B5IB 4PBVC 3DGGB 3CFIC 1UB6A 4YXHL 4X7TA 5HTSA 3SCMA 5FK9A 2QEJA 1IVLA 1DJSA 1NUGA 2P5ED 3UTSB 1YEKH 3NPSB 2CLRB 2HJFA 5HDQH 3S37L 3ARBD 1MWAA 4Q0XH 5IVOA 2KPNA 4JFHE 4QXUL 4JKMA 2C4XA 2VTFA 4OLXL 4BUGA 3DGCR 2D7TL 2AJVH 1R3HA 3MV7E 2V5RA 5J11B 3F7VB 4HZAA 1PQZB 3IDUA 2KUTA 3RWIA 5ERWB 5A40E 3QXAA 4KK5C 3UPCA 5JOFA 4M1CD 3RUGA 1DQDL 4PBWD 1N2RA 4KXZH 4LLUA 4GG6A 1H0DA 4WENB 4QYOA 1KYOK 1K8DB 1S78D 4LPXA 3HFML 4S1RL 4Z7NE 3MUGA 2DAVA 3ILQC 3TBSA 2HTLC 3MRQB 4UBDC 1VSCA 5EA0L 1B90A 4RMSA 4W4OA 3MV9E 1G6RH 5IM7B 1K4DA 5FB8B 4GBXA 4KDVA 2BVOA 3QRGH 4X6EB 5D7LB 3S35H 4L3EA 3L95A 4U1NA 1B0WA 4WV1C 1FL6A 4LNVA 3U7WH 1G0XA 3Q1SL 4NP4L 2DIBA 5EU6D 5A43C 1QNZH 3OTTA 2EDHA 2FH6A 5HYJE 2Q6WA 1KBGH 2B2XH 5DI8A 1AQDB 3X11B 4O2EB 3RWHB 2P43B 2VLJA 3S3SA 3TT1L 1IEBA 5DD3H 2EDEA 3AS2A 4ZQKA 3WIHL 1N6QL 1EGJH 2NY5C 4U7SA 5HI5D 4RMQA 4X9GA 1KTDA 2NXZB 3I2CL 3SE3A 1ONQA 3KYOB 2EKSA 1RFDL 5CP3A 2DD8H 1RZFH 5B39B 1DLFH 4KZDH 5ENWA 3OKMB 4LDEB 4FQQB 3VFNA 3DI2B 5E5MB 3UO1L 5K9OA 3TYGL 1LNUB 1YYML 4HWNA 4X8JA 3I50H 3NABL 3K81A 4G8IB 2P8LB 4RAHA 5J6GB 2FDBP 2NY1B 4Q9CA 1QBLL 1RZKL 4ZUVA 4Z8FH 5JQ6L 3U0TA 1M7DA 4D9LL 2C3XA 4DCQA 1CR9L 1YN7A 3QIWB 1EPFA 5I73C 1LK2B 4HK0B 1MPAH 4PJ5A 4LLQB 1HDMB 1J86A 5AD0A 1CD9B 4JFZL 5DR5L 4JFQB 4MDJB 4HK3N 2R2EB 2IAMC 4NBXB 2YPLD 3AY4C 4N5ED 3KS0J 3U7AA 1CDYA 2Y36H 4FA8A 3K3QA 2ESVA 3ARFC 5GGRB 3GSUA 3V5KA 1JZ5A 3HMWL 4P2QB 2D31B 5D4QA 1GVIA 1IAIM 2D9QB 5DSCA 4GRLD 4QRRB 1QRNE 1D5ZA 2J88H 1MCOH 2EO1A 4DN3H 5J13C 1G7LA 4HXBH 2YUVA 1AGBB 5CBEB 4HUVA 1H8OA 3ULUC 2CD0A 1A7BA 2VISA 4DGVL 4HLZH 5BVJA 1A4JA 5I18L 2PXYC 5BVPH 4NZTH 2HG5A 3M8OH 4KKBC 3QFJA 1NGPH 5EIQA 4JR9H 4V1DE 2JIXD 3GMPA 3BP6A 2X4OA 3MLSL 4DZBA 2FEEI 3EFFA 5T1DL 2R2HA 4U1LA 4TRPL 1YPZF 3SDCA 3EDDA 3SEPA 3IGAB 3HI1A 5EO1B 1EX0A 4HBCL 3IDJA 3C5ZD 5EU5A 1NFIB 1C5CL 3QDJE 3BYYA 1R5IA 3S7GA 3NIFE 5F1KC 2HJLB 4Q6IC 1BQSA 4HKXB 3UYRL 3LVEA 1NBYA 1RUQH 3UJIL 5IOPA 3TESA 1NAKL 1G0DA 5IV2B 1REIA 1WQVT 4G5ZL 4XMPH 2AXHA 5JIKA 1GC1C 4P46C 3ZMRA 43C9A 1RY7B 3MR9A 3BQUC 2WSKA 1EH9A 1U8KA 2MKLC 4XVJL 1JV5B 3DROA 3D39B 5GZNC 1D9KC 3O11A 4DZ8B 4YGVB 4U6YA 2Z8WC 1UZ6F 5F8RC 2R8SH 4OZFA 4R0LC 3EYUH 4KHTL 3VXTA 1HH6B 2F53B 3RUGF 2ICES 3BW9B 3J8F7 3MOBH 4JHWL 1F58L 4GG6F 4X9BA 3IAPA 5T3XL 4TNVF 1A4KB 1CLCA 4F7TA 1AQKH 3DXAD 3O0RL 2C9AA 4J6RH 1MEXL 4F3FB 3DMMD 1J0JA 1NGXB 3FB7A 5D7JA 5C0CB 1S9VA 1IAII 3PE9A 5D1QA 1OY3B 4K7FA 4NOFA 1HQ4B 1ZHNB 3GJEB 1WVZA 2A73B 1HHHB 2ZCLL 3WEXB 1FH5H 2BJMH 2AI0H 3MRIA 3V4VH 2WAHA 1PLGL 2J1KA 4UNTA 5JXED 3W11C 1QFWM 2V2TA 3DRTB 3RWFB 5EOQH 4B7IA 4XPGL 3L7FA 3O2DL 3L3GB 1G9NL 3EOTL 3L1OL 1KC5L 3VXPB 2FD6L 4JZOA 2P5EA 4AH2A 5JW4R 3ARBA 1FNSH 4Y4FB 3GSVA 2ILLA 2XZCL 1YMMD 2PW2A 5EUOE 2BY2A 3ROLB 1SJVA 1W72A 3BE1L 2V7NB 4HS3B 4MXWH 3PJSA 4UQ2A 3V6FB 2DQEH 4GRWB 1R3IL 2CR3A 2BVQB 2H6PB 3BAEL 3EJJX 4TNWK 5J4MA 5KSAC 1S7VB 5EORH 1OTSD 1QYGL 3HUJE 1FSKC 4UTBL 2OQJB 4YDKH 5AZEH 5I2IB 1T5XB 1DEEB 1WTLA 3QUKA 5C6TH 3KPOB 4NO5A 1MQ8A 3KPMA 5JIPA 3G6DL 3QUZC 4UDTB 3H3KA 5TDNA 4YXLL 1EO7A 1U8IA 2VL4A 4E9LA 1NCDH 3OAZH 1YY9C 2PR4L 3O3BA 1F3RB 3IF1B 4MXQC 3O45B 5CJ8A 4X7FC 1NLBH 2XN9B 1GGUA 4OFVA 4PRNA 3U0PB 3ZL4L 1IZKA 1WIPA 1Q1JH 5EU6A 5IQ7L 1X6LA 4IEFB 2YD3A 2WW8A 5JHDD 1QZ1A 3S34H 5CINL 4DK6A 1AHWB 4PRPD 3GMQB 3NFPB 4DGYH 5D1ZD 2JELL 4NGHL 2AEQH 4F2MA 5E8OA 4BH8B 4GW1A 4M9OA 1E4KC 4EOWH 1MI5B 3SDDB 4U6HA 1OAQL 1LEKA 4YDIL 3K8MA 3AC0A 3MV8D 3OQ3B 4U33A 5HHPA 4WFED 3JWOC 4NQVA 2O93L 3PGDA 4F37F 2QQKH 5EWIH 1KCRL 2CGRL 2G9HB 1AI1L 1CFVH 2VDPL 3EO0B 2AK4B 4YBQC 5A2KH 1F90L 3L7EA 2NXYC 3N1GC 1QFWI 5F8QC 5F96H 1KSRA 4DUXA 4KK9C 2EKJA 2JB6A 2QQNH 5FCUH 1IQDA 1K4CB 3HZMA 4PG9A 4MD5B 1RMFH 5T33L 4H5SB 4RAUB 2FX8L 3ARRA 2EYTB 1FLRH 3IRZA 4LQ1A 3QXTA 2XXCB 2BCKB 1DN0A 1RULH 35C8L 5DK3A 4UOW0 2VH5H 3VXSD 3D9AH 4KK6D 4LSPL 1NMAL 2HYMA 3BIBX 1SQ2N 4D0CA 3RZWA 5IMOA 2YPLA 3MRHA 1YECL 1QHPA 2JK5A 2XFXB 3TBVA 1RJLA 1W0VB 4ZFOL 1EV2E 3VRLF 2CIKB 2GJ6B 4P5MB 5D6CB 2EZ0C 1F5WA 2OTWA 4PYGA 4GRLA 1A02N 4F8TA 5DVKA 4D9RE 2VQ1B 5IW1A 2DBJA 4HG4K 3X3FH 2DQFA 2NY2D 3MLVL 4ZUSB 1EAJA 3UP1A 5IMMB 5JA8B 1FFNB 2BMKB 3GHBL 2V9QA 4HT1L 1ZA3B 1A5FH 4LF3A 4PJFE 5BQ7A 3TYFB 4KV5F 3TBTA 1E4WH 3SE8L 2K9UA 5EZOL 5CWSA 2QHLA 2GI7A 1JUFB 2JIXA 5D7IA 5DJCA 4TPRH 3VA6A 3I6LE 2WIIB 4G3YH 2J4WH 3NH7H 4FQIH 4KK5D 4MAUH 4F58H 4R2GD 1J1PL 3IAQA 3C5ZA 4ZAKB 5CILH 3QO0A 2VE6B 5ESVA 4PUBH 1CK0L 3PL6C 2DKUA 3H7BB 2R56H 5L88H 5H94A 4ISVA 4ZUWA 3WLBB 2ZG3A 3LRHA 5JW5A 5FGRA 3QHTC 4FQLH 2AXJA 3JTTA 5TE6H 4OZGA 4X5XB 5GGQH 5C0DA 3FB8B 2HTLD 1YEDA 2YC1A 1BVZA 4QXGL 3FO2B 1NC2B 5D72L 4UBDD 2ADJB 2GAZA 2OP4H 1DBAL 4WU5A 4JDVA 3MJ8B 5JR1L 3M07A 3KYMB 1C5BL 5IW6A 1FPTL 1CICB 4DK3A 1QACA 4TOYL 3LEYL 2GSIA 5I71C 2PW1A 4HCRA 3MNZA 5KOMC 1TZHA 1TCRA 5AG8A 3VXQA 4A6YA 5FGSA 4JO2L 4JY5H 5I17B 5JOPD 2PO6B 1NAML 1GGIH 2HH0L 3QEHA 4GMSL 4NO3A 5E4IA 5CEXB 3JWDL 1C1EH 1MIEL 2D2OA 3ZE2E 3DARA 3GSXB 2DB8A 3DXAA 3PGFH 3AU1A 4MAYB 4N0UA 5FHBH 3VDBA 3DMMA 1S5IH 2AS5M 3QNXA 5DRWB 3S8WA 2NY4C 3A6CL 1D5XA 3VRIA 1HHGB 1FL5B 2Q8AL 5GRJL 3T0ED 2DQUL 1FVCB 1N8ZB 3U1SH 5IEKB 4NQXA 2EDRA 4XAWL 4M93B 1TQCC 4XPBH 3Q5TA 5I1AA 3QISA 1FYTD 4Y4HD 2Z31B 4GRMB 5JXEA 5IWLA 4TSCL 3P9MB 4M5ZL 1I7TA 1WSST 2NLJB 3BGFC 3STZA 3LV3B 1HILB 3PV6B 4RGNB 5E2TL 3NIDF 1AD0A 5MHSE 3FO0H 4RMUA 1R3KA 1YMMA 4K3EL 5IVXB 1I8IA 2W60B 4XNUH 3L3KA 4LCIH 3QQ4B 2DKMA 4Y19B 5E00A 3R8QA 3LRSB 4HIHB 5DMKA 4R26L 3JV0A 4XP6H 3S88H 1WUNT 2XG4A 3FN0H 3V6OE 2IAMD 4KY1L 4R96B 2EXYC 3PWNA 4L9LA 5E4EB 4ZO8A 1MHPH 4LPTA 2WBWB 1P9MA 1UB5A 2D03H 1X5HA 5ESQA 2VN4A 4LCWB 3ZE1F 4IJ3B 1CGYA 1EUTA 1V5JA 4LHUD 4M1GL 5IHUH 2FHCA 1CT8A 5D1XC 2XPGB 4TUJA 3HTLX 2RFXA 4LLVA 5J1SC 3QO1A 3B3IB 4X6DB 1S7UB 1KLFA 4ZYKA 1YEGL 3IRPX 4MA3B 4X80L 1OQXA 1MWAH 1NUFA 4JQXA 1SMOA 4LVNB 4KUZH 4K71C 1TJGH 5F9DC 4PJAA 1NLDL 4NM8H 2A6DB 4RNRA 3BP7B 5C7XH 5TDOA 1Q9OA 3HC0B 1ZLSL 2BC4B 4KKBD 1U9KA 2Z8RA 1DLHB 4NYLA 1SEQL 5J06A 3KYNB 5JHDA 4ZPVA 4ELMA 4OLEA 4PRPA 3LEVH 3MRJA 2XNAB 2Y06H 1M05B 3R06B 3MRDB 1QSEB 4HF5H 4XXDB 4NRYB 5E8NA 5ITFA 1K9TA 3HAEB 1RJYB 1ZT4A 3DETC 3QUXC 2A74B 1T1WA 2ARJQ 3MV8A 5I1LA 3AM8C 4OGYL 3VFPB 5ALCH 1MCRA 1QO3A 3IFNH 4C56D 3UTTB 4KC3B 2DQJL 4UU9B 4NBYB 4NQSB 3W2DH 5IR1A 3DX7B 2K3TA 3G6JA 3T1WA 3TNMA 4NIKB 2VITA 3UZVB 1A6TA 1U91A 4HWEH 2AERT 4LNRB 3E0GA 5D2NE 4P46D 5AZ2H 3H8NA 3BQUD 2RHEA 2CKBH 1MHEB 1H3PL 4RGOL 1JWUB 3WHXA 5GSRB 1D9KD 2FRGP 4P57A 1KLUB 4UIMA 4OQTL 3QUMA 4NN5B 4OI8A 2YWZA 5I1IH 1CLOL 1L7IL 3IDYB 1X5IA 3P4OA 1T22A 4XGZA 1OAXH 4ZS6C 4GUPA 3T04D 3VXSA 3MBEB 5K9QI 1MH5A 5GHWL 1D6EA 1NEZA 2CIIB 43CAB 4K8RL 5I15L 1Q72H 3B8SA 4Y5VA 4E41A 5T1KB 3NA9H 4RWYH 2VAJA 3VXMA 1UA6L 4B53A 4NZUL 4WCYL 1ZTXL 1SM3H 5E1AB 4OZGF 2X09A 3A6OA 5EOCH 1I8MA 4F7EA 1GPOH 4MS8D 1K2DA 1CI5A 1JPSL 1A9EA 1P6AB 4QF1B 4YE4H 2H3NB 5E7BA 2WK2A 4XBGA 4M4RA 3HAEG 5I8EB 3RX7A 3FO9A 2YBRA 5F9WB 3BP5B 1DBJH 1MCIA 4OM1L 1OAKH 1NCCH 5IHLB 4U1GC 4JREB 5HGDB 4L8DA 1BQHB 5B4MC 1ZHBB 5EBMB 3GSRA 1IAKB 1KB5B 1RZJL 2VDNH 5ALBL 4XH2A 1QSZA 5HHME 1P7KA 3H9HA 2EIDA 3N50A 5FYLD 1MRFH 3SDAB 1EXUB 3HPLA 4WI9A 4O51B 2YK1H 5BV7H 4M62L 3PWLB 4UUJB 3CSYB 1F4XL 1AD9A 2BNQB 5K9QG 4IS6A 1NUNB 3W81A 1S7XB 4JKPH 3H3BC 3QUZD 3ULVC 5JO5A 2VLMD 3G04A 2CRYA 5C0AB 1DQJA 1K5NB 1NPUA 4Z78B 4MXQD 5LGJA 2IFFL 1NCBL 1WFNA 4KQ3H 3FRPA 5DK0B 3BWUC 3I85A 2NX5D 5JHLL 1LO4H 3F12B 4HKBB 2Z8SA 1XR8B 4LGSB 1YPZE 4X7EC 1IAOA 3RIFK 1B0GA 4G6KL 4OCXH 1PG7L 1TZGH 4HPYL 2UY6A 1A1NB 3ARDD 1JWMA 4U2ZA 3SJVE 2E6JA 1KULA 1T2QL 2YPKB 3D2UB 1QLRA 2DM7A 3DTXA 4HAFA 1DUYA 3L5IA 5D7KE 2C3VA 4RDQF 3QZWB 4HWBL 2BNRB 2H8PA 1OGTA 3O6MH 3R4DA 5C0BB 3FMGH 3WE6B 1LEGB 1T04A 1BQHG 3PXJA 1Z9SA 3K0WA 3RZCC 5DXWA 1JFQL 4EBQH 1JMXA 3CXHK 5GS0D 2GTZB 1UVQA 3T77A 3UZQA 3DX6B 3T0EA 4JB9L 5F6IB 1EIBA 2Q8BH 4JFOA 4PJDA 1TFHA 4PYHA 1NC4D 1FFRA 1UZ6E 4O5LH 2AKRB 4K3JH 4PJAF 4TYUA 3ALXA 1MOEA 5F89A 4YBQD 5FDWB 4JHZA 4Y1AB 1FYTA 5F7NC 5I1EL 4Y4HA 1R24B 3T08A 3MGAA 3GBNL 5FEBA 4ELMF 5C0JA 3DYMA 1ZOXA 5I1JH 1KNOA 2R1WB 4S1QL 2QSQA 4GO6B 2A83A 3FB6A 4D9QE 2HVJB 4WUUD 2CO7B 3OJDB 1FFPB 2WIMA 3WDJA 4XB7A 1I9EA 4PLNC 2YXMA 4GW5A 2VLRD 3RL1A 1SY6L 3MLZH 3VFUB 1YYLH 3VWJB 1TIUA 3IFOB 5FGBC 2IAMA 3RPIB 3H7LA 5K9JH 3N85L 3DO7A 3P4NB 1MFAH 5I66B 4L3EE 3G6JF 2QV2A 1EAPA 3ARFA 5ID1A 4PRIB 3TN0C 1FBIH 2BVYA 5D71L 5HI4C 1JK8A 1FGNL 3O3AB 4IOSD 2QADC 2QKIA 4LHUA 4YX2L 2V6HA 1ZGLA 3QCVL 4G8GE 1RZGB 3TVMD 5I1DA 2VLJE 4X4MA 3WNKA 5DRXB 4ZD3L 4X8XA 4NC2B 5C70A 8CGTA 2DL9A 3QZWG 2VXUL 2YA2A 4DEPC 4N0CC 5MEPA 5E2VL 2PXYA 2A77H 1FZJB 5LJYH 4JPWL 3MXWL 1BMGA 5KSBB 4OZIA 4NFCA 3I02B 1UB6B 3NZ8A 3ZDZE 5FK9B 4LEXL 5DEZA 2V17H 4MA8L 3FFDB 4C83B 3NZHL 2PYFB 4MZ2A 3SKJH 4GAFB 5DF0A 2AV7B 3SGDH 1MCJA 1NCWL 2DQDH 2EH8L 3BZ4A 4PRHB 2CSPA 5JOFB 4G9FA 1ADQH 3RUGB 4C56A 5ABDE 4R4NC 2A9ML 2EDNA 4LLUB 4GG6B 3CGTA 2ZCKL 1H0DB 4LSVH 4M02A 4I3SL 3UPAA 1KTLB 3GDBA 4YXHH 4NOBA 5DO2D 3IS1X 3S37H 4PJ5E 1NFDA 5E6IC 4OLXH 2HFEB 1PSKH 2Z9TA 2BP3A 4P46A 4X99A 3RVWD 3BQUA 4PLOB 4U0RC 3L9RA 3PWPD 1D9KA 2ESVE 1NBZA 3WKML 1BREA 3BZDA 4POYA 3S4SA 4R0LA 4GJTB 1FFQA 1ZLWH 1CQKA 4XWGL 3HFMH 5HI3C 4KK8C 4U6TA 1BFSA 1HINL 4UZGA 2Q6WB 5DI8B 4Z5RA 1I8KB 4AY0A 4NKMB 4MQTB 4OBSA 5EA0H 5GGUB 2XQYG 3LKRA 4F7PB 4MJID 5FO7A 2NY4D 1CXHA 1ONQB 2W0FA 2YZ8A 4F15C 2EKSB 2BY1A 3IJHB 4NP4H 1H3TA 1KGCE 3O3EA 5ENWB 2ZUSA 4I0PC 4LQFL 3VFNB 5L0QB 4Y0GA 3KPSD 4M6OL 5EO0B 3OBAA 4JRYD 4OCRH 4J3XA 3OKKA 3H42L 4XNYL 2VC2L 4NC1C 4K7PL 5C09A 2ZUQC 3WIHH 1N6QH 4LBEA 3U46A 3U7YL 1N3NA 3GMOB 2O61B 5EULV 3F7RA 1BGXH 1UEYA 1P4BL 1P4IH 1L9NA 2DQCL 4PTTB 5IMKA 3ARYA 2X6MA 2M1KA 2EDJA 1OP5H 1YN7B 1EZVX 3TYGH 1IM3A 4JY4B 4HGKC 3C60C 3B2VL 4I1NB 4LCUA 4XP1H 5DJ2B 3CFCL 5KSAA 1A6ZA 4NQED 4JAMB 5JMRA 3V8OA 1SJXA 8FABA 3BPNC 3B9KB 4PJDF 1N64L 1QBLH 1RZKH 3VWKB 4YNYA 3QPXH 25C8L 1ZS8A 1T2JA 3QUZA 1INQA 1CR9H 4KV5E 3S36X 1JGVL 4ZFFA 4H8WC 3MGOB 4JFFD 3RX8A 5DSCB 3LKOA 2FO4A 1G7LB 2NX5A 3LHPL 4JFZH 32C2A 5DR5H 3EO9L 3WDIA 3MV11 2OJEB 4CDHA 1UQSB 3DURA 4WI8A 3LPWA 5F21B 3CZFA 3T3MF 4PREA 4RFNC 5DMIH 3VA2C 1T3FB 3HMWH 1RIUL 3QFJB 2CLZA 3ORJA 2FGWL 1MCSA 1QLFB 3BP6B 4I3RL 1LD9A 3DV6A 4PS4L 4DZBB 2ATKA 3EFFB 4U1LB 1YMHA 1FGVL 2R2BB 1E4KA 2VLKB 3PDGA 2FLBT 1NGZB 2OZ4A 4HH8A 5HHXL 1A2YA 1KG0A 5EU5B 4RAVB 5I18H 2EEAA 2P5EE 1OW0C 2GSGA 3SBWC 3ULUF 1IL1B 1R5IB 1ACZA 5KSUB 3BRFA 4UQ3B 2Z35B 2R4SL 1XGUB 1K3ZA 1BIIA 1AGCB 2AVGA 3KPNA 4EVNA 5T1DH 4OUOA 4OZIF 4IIQB 4TRPH 1MRDL 4EEEA 2X41A 5GRWA 5DRNB 3V5DA 4EI5D 4N8VG 5JW4M 5LWYL 1U8KB 4HBCH 3CC5A 2XG5A 1E27A 3CSGA 3EYFB 3HN3A 4W6WB 4WUUA 1C5CH 4HS6B 2FZ3A 3CX5J 3OPZL 5TJWK 4JCLA 5K93A 1QLEL 2IJ0C 4ZS6D 3QJFA 3BO8A 1S9XB 4GKSA 4JDZA 4YHLH 3UYRH 3VXTB 2VLRA 3E6HA 1OP3K 3UJIH 3B6SA 1NAKH 2D0GA 2Q20A 4H0GA 5F7LB 4X7CC 1LP9A 2XICA 2HLFC 4M7LL 2VDML 2EIZB 4P4KC 5IB5B 1NFDF 4G6ML 2P47B 5EU6E 1CLZH 2ARWA 1DN2A 1YNKL 4HJGA 2L4OA 3FB7B 5H2BB 4K2UH 4YR6A 5LCVH 1XF3B 1KJ2B 3TVMA 4JY6B 4H25B 4ACPA 4HEPG 1DP0A 4M5YL 3MUHL 3KLHC 5KSVA 4OLUL 2GFBB 4JHWH 1F58H 4MNGA 5DD0L 5T3XH 2IALA 2BXZA 1WWAX 3MRIB 1YNLH 1INDH 2LU7A 3FOMA 4NUGL 4WI3A 3S5LG 1XF2B 5BS0E 1F4YL 4HS8L 3O0RH 5IQ9B 1MEXH 3WFEH 1VFAB 4R6UA 5JNYA 4YAQA 5B4MD 4FFWC 1WBZA 1DVFC 4YDVB 4Z7WE 3MLTB 4AH2B 3BJLA 4JFXB 1T80A 1BFOB 4LK4A 2ZOKA 4QTIH 2XTJD 4DKEH 2IWGA 1D3CA 1TNNA 2VXSH 4YBLB 3ZE1E 2ZCLH 2C1OB 4P5TC 2GW5A 4PGBA 5E2WH 2BVUA 1W72B 2WQRA 4F7CA 5ANMA 1YY8B 5HDBE 3PL6A 4R3SA 1PLGH 5T5NG 3MJ7A 2BDNH 3O2DH 1G9NH 3EOTH 3I9GL 3EJYC 1KC5H 2DQIH 4Z6AT 2GITB 2FD6H 4NO5B 4FQXB 4ODXA 3ULVD 1WC7B 1XCTB 5A16B 5C08B 3KPQA 2XZCH 1U8IB 3WV0A 2YPLE 3FT4B 3BE1H 4LARH 4QGYA 5HPMA 3MRNA 4GS7B 3PWPA 3O3BB 1EVUA 2VLLA 5FYJL 3BAEH 1P84J 1WWCA 4Y8AA 3HS0A 1VFBA 1QYGH 3LEXA 1ZT1A 4UTBH 3WXVL 3TPKA 4ZPTA 4PJ9D 3FFCB 5L2KD 3ET9F 1I9IL 4JM2C 1U95A 2K7PA 2V5TA 3G6DH 3AROA 1PZ5A 3SE4C 4P2RB 3D1MC 1JTTA 5GPRA 4YXLH 1QUNA 2HT3C 3WFBL 1GZQB 1A7RH 4XNMB 3OGCA 2PR4H 2W0PA 3V5HB 1F3JA 1UEMA 4LLMA 2HLAA 5T1LD 5GGSB 1S9YB 5C1MB 4RIRA 2VUOA 1VCAA 3SKOB 1LEKB 3F58H 1FO0A 5FHAL 5D7IE 3O4LA 3VXOA 2OL3L 3RVXC 3ZL4H 1SVCP 5HHPB 4XNQB 2CUHA 3HC3H 1ES0A 2WBJC 3ZSSA 1MCDA 2C5DC 4NQVB 5DJDA 1J0YA 2W1NA 1T7YA 3CH1B 5CINH 5F3HA 3F65A 2O5YH 4JRYA 4X6CB 4X9HA 2A0LC 2JELH 4NGHH 3GMRB 2DRUA 1JZ6A 2KZWA 4P3DA 5IFJB 1EFXA 1AKJD 4MA1B 2D4FA 5E03A 1AGDA 1OAQH 4IRJB 4CMMA 5DMYA 4JKLA 2NY3B 4PG9B 2NPLX 4CADA 3OXRA 1MFEL 4OZGE 2CGRH 5HY9A 5IBTL 1DN0B 1S7TA 2APWA 1CGWA 1CGXA 15C8L 1I8LC 1U93A 3K4DA 5KVGH 3QNYA 4NQEA 2VKXA 1F90H 4NM4L 5TFSH 1Q9KA 3FT3A 1W8NA 2W0KA 5C6WH 1FV1A 2JK5B 5CSZB 3TIDA 1B6UA 3TBVB 4ALAL 2DJ4A 4LGRB 2YRLA 5EN2B 2MKWA 1AY1L 4MQ7A 4JFFA 1NEUA 4K8RC 4J3TA 1EDQA 5IW1B 4YHKL 3BKCH 4LSPH 1A6VL 1NMAH 1XH3A 4G8EB 4WI2A 2N1KA 5CIPB 3T3PF 4MJ5A 3P11L 4N0CD 4N0UE 1I1FB 4ZFGL 1T1YB 5BQ7B 2WZPD 1YECH 4HIXH 3ARGD 4YZFF 3CNKA 5E8EB 2CDGA 5D6DC 2PTTA 3OV6A 4BUHA 5I9QC 5CWSB 2Q7NA 4Y5XB 2F74A 1LP9F 1CBVH 2GY5A 2JIXB 2APBA 2NY6B 3BN9D 3SQOH 2W92A 3C2AH 4WW2C 3SGKC 4EUPB 2J6EA 2CLVA 3IT8D 1Q9WB 2ITDA 4YPGB 2B4CL 2F8XC 4BH7B 2JJTA 1I3RA 4HT1H 2J7LA 3LZFL 3AM8A 2YXFA 2NYYD 2PKDA 2SEBA 4O02L 4KXZI 3SE8H 4G9DA 3HG1B 4R4ND 4YHNB 1IGTB 4OV5B 1OTTD 5DGRA 1J12A 3G6AA 4AEEA 1YMME 1RZJC 3T65B 1WBYB 4Q74A 4P23B 5IP4A 2YOCA 4D8PB 4Z7QE 3QQ9D 5C0DB 2R1XA 3OL2A 1GYAA 4EI5A 3LN5B 4KAQL 3WBDA 2GAZB 3WIFA 4JDVB 4PRDB 2EDQA 3RIAF 1CK0H 1S3KL 3U2SA 2FJGA 4M8QA 1L0YA 5LAXB 3GHEH 4O2CB 4WGWB 5M7QA 5HI3D 2FO1A 4KK8D 1U36A 3MNZB 1D5MA 1OB1A 5BZWA 1TCRB 2BOCA 1NMCB 1VERA 2Y5TA 5E94A 4XVTL 4A6YB 5F9OL 3CLFH 4QXGH 2UUDH 3QEHB 1SBSH 5D72H 2RCSL 1WCBB 3LB6C 1GGBL 5GRXG 4PJAE 2WP3O 3DXAB 1C5BH 4WI4A 3RTQD 5JHDE 3ELAT 2JF1A 3GJFB 5IHBA 1FPTH 4ELME 4HFUL 5ACZA 4PJHB 1ORQA 4IRSD 3LEYH 1IC4H 4PRPE 1P7QD 4I0PD 4X0KA 4ZTOL 1FIEA 1QR4A 4CDGC 2Z92B 4JO2H 3UPRB 2HH0H 4RRPG 3S6CA 3O9WB 3JWDH 1IGCL 4LGPB 3MRKB 3MV8E 1MIEH 4UB0L 4OGXH 5ID0A 4ZSOA 4XCYB 3U36B 2X9XA 3VI3E 1VB9A 3QAZB 4K94C 3STZB 1JTOA 3A6CH 4JRXD 4R8WL 3G6JE 4GG8B 4C4KO 4QHMB 1AD0B 1T1XA 2Q8AH 2P24B 4JVPA 1R3KB 2DQUH 4HFWB 3SKMB 5GGRY 5TE7H 1VADA 5B8CC 4MVBC 3WUWG 5DMKB 1ZT7A 3QRFM 1HHKA 5I75C 5FA4A 1YA5A 3PDDA 1EEZB 4KHXH 3IU3B 3UTSD 4M5ZH 3GB7A 4X4YB 4H26B 3LS5H 3BSZL 3OAYK 3D85B 3VXSE 3BN3B 1DANT 4TULL 4J4PC 4A2LA 3BPLC 4K3EH 5JLZA 4ZAKC 1HHJA 4L3CB 4TTDC 5CJOL 5LQBH 1IGIL 1KUMA 2FGZA 4MSWA 5J12B 2RFXB 3REVB 5IB4A 4ZYKB 2ZUTA 4G80A 4MJ6A 1X5GA 1IGYB 4EIGB 4OLWL 5L2KA 4RNRB 4E0RA 4U7KA 2MNUA 5J3HC 4R4BA 1G7MA 5TDOB 1OOAA 7FABH 4Q9QH 2VYRE 1CIDA 4NYLB 4ZPVB 5D96B 1UJ3C 1JGEB 3BEVA 2WV3A 2DQHH 4W81A 1UJTA 3LSOB 4L1DA 1CFTA 3OHXA 3C08L 1YEEL 5T1LA 1WISA 4M7KL 1CTOA 1ND0A 4X80H 3S96A 1ZT4B 1T1WB 3KHOA 3RZCA 3GFUA 5I1LB 1NLDH 3L3IB 5E8PA 2WMPA 3BGMA 1H15B 5LVEA 1SEQH 1OWRM 4H1LA 1KCSL 2V2WA 5GGTA 3OB0K 2X4UB 1M71A 2NXZD 3P77B 4KQ4H 1KJ3L 2VITB 1AGFA 1A6TB 2X4SB 5JPNA 2EC9U 1X5YA 5DHYA 1BBJA 3VFSB 3NFSL 4CVZA 1OARH 1T7WA 4NNXB 4JFEB 2DQJH 4UIMB 4U1JA 2Q86A 4XZUB 5BRZB 2BOBA 2ED8A 3FQXB 4JFDA 2Z31C 4GUPB 4LSSH 2YEZA 3BHBB 2NY1D 1PYWA 1MH5B 3WXWL 2E9WA 4HLZG 3ZT5A 1FCCA 1FIGL 1XF4B 4Y2DC 5L7XH 1JF5A 4CU6A 3M1BA 4E41B 2CRIA 4YFEA 3KPLA 3DV4B 4N0RA 3VXMB 1H3PH 3CFBA 4X6FA 1G9EA 1WCQA 3MRGA 5J6HA 1X7QA 3QWRA 3HI6L 4EN3C 3RGHA 3T2PA 5DJXA 4JJ5B 4XB8A 1BJ8A 4PTUB 2HKFH 3RAJL 1J8HB 4C55A 5JOPE 1K2DB 5F7WC 3KVQA 4X6BB 5GHWH 3HPJA 1A9EB 5I15H 4XBGB 3EOBB 3Q6FB 3FO9B 3WIIL 4P2QD 1UA6H 3BVNA 4NZUH 4WCYH 1ZTXH 5FYLH 4N9GB 4OAWB 1DUZB 3LS4L 1Q94A 4OQ1A 4QRRD 4IBLT 4WY7L 1LO2L 2GJZB 3T0EE 4FFWD 5DUML 5DQJA 5JOEA 1HQRB 2Q3AA 4QRTB 1B9ZA 2RBLA 3GSRB 4XH2B 1RHHA 1SYVA 1FYTE 1UENA 3JV4A 5HHOB 1BZ7A 5F7KC 4OIBA 4BQ6A 1H8NA 3W9DA 1MF2L 5ESAA 2YD8A 4L3AA 4Z0XA 4PJEA 2ED9A 4HIEB 3TCLA 3GSNL 5LKNA 3EJYD 2Y1VA 4IS6B 2IF7A 1MFBL 4F33A 5ALBH 3EJZC 4X98B 2XWBA 3T3ME 4CAGA 3B9EA 3O41A 1MNUL 1HKLL 3WO4C 3BEWA 1DQJB 3QNZA 2CDEA 6FABH 4LKXB 3VXRB 5IROC 5LGJB 4PJ8C 1MVFA 5HHNA 3MLUL 4M62H 4HD9A 3OSKA 3W0WE 3QPQD 4X9IA 1F4XH 3PWVA 4WV1B 4XPTH 1NSNL 2JB5H 2V2XA 3MRBA 5IB3A 1FVDA 4RCAA 4X4ME 1V05A 3IKCA 1I7ZB 5DZNA 3CDGA 1GOFA 4MNQB 4I48B 1OPGH 1EHNA 1VACA 1Y6MR 5GS0H 3D39D 1OTUC 1WAAA 2OSLA 4LEOA 4PY8J 3DTXB 1DUYB 1NCBH 2OM5A 3ULVF 1QKZL 3VD7A 3TIEA 2MQ3A 3IDYC 4L8SA 1ZVSB 2H8PB 3TO2A 3RTQA 3NACL 3LH2L 3PHSA 1T04B 5I19L 1P7QA 1PG7H 4I0PA 2HFTA 1CFNB 4HPYH 4Z77A 1DANU 5DVMA 3LKNB 4JFOB 4PJDB 5HDLA 2RQ8A 1T2QH 4KJWC 3OZ9H 4OD3H 3LD8C 5ITBH 1NJ9B 5HGAA 4NCDA 4WI7A 5C0CD 5L8KB 3AS0A 5TH2A 3BJ91 4HWBH 1YEKL 4C56E 5HDQL 3QDGB 5C0JB 3FQNA 2WNGA 1HHIB 4JRXA 2YD9A 3KXFB 3F6LA 2A83B 3VFWB 1DDHA 5L8LB 4U1KA 5CEYB 5IB1B 1NFDE 4JB9H 2PCPA 2W9DH 4FQ2H 1A1OB 5I73B 1A21A 2OJZL 1IT9H 2C3GA 1KJVA 5E95B 5DUPL