4JQOA

Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with citrulline and inorganic phosphate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
338
structure length
338
Chain Sequence
QSNAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
rcsb
source organism Vibrio vulnificus cmcp6
molecule tags Transferase
molecule keywords Ornithine carbamoyltransferase
total genus 133
structure length 338
sequence length 338
chains with identical sequence B, C
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jqoA01
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jqoA02
3M5DA 2AT1A 4F2GA 1TTHA 3KZMA 4KH0A 3M4NA 3R7DA 4JQOA 1RAGA 4H31A 2BE9A 7AT1A 6AT1A 1R0BA 1RADA 2FG6C 3KZKA 8AT1A 4FYVA 2QG9A 4FYYA 9ATCA 4IV5A 1VLVA 1PVVA 2FZGA 1RAHA 4KWTA 1RAAA 2FZCA 3M4JA 3KZOA 3MPUA 4E2FA 1ZA2A 4KGVA 2FZKA 4OH7A 3UPDA 1FB5A 1FVOA 2HSEA 1EP9A 4WTOA 1PG5A 1RAIA 4ANFA 3E2PA 3LXMA 4AT1A 3AT1A 2RGWA 3R7LA 4FYWA 2A0FA 2OTCA 1ACMA 3NPMA 2BE7A 1DUVG 3L05A 1C9YA 4KGXA 4AMUA 3GD5A 3GRFA 1D09A 5ILQA 3L06A 3KZCA 4EP1A 4NF2A 1XJWA 4AM8A 4KH1A 4A8TA 1RAEA 1A1SA 1EKXA 4F04A 5G1NA 3KZNA 2AIRA 3R7FA 2P2GA 1SKUA 1RACA 2QGFA 3Q98A 2IPOA 2FG7C 4EKNB 2H3EA 3D6NB 1ML4A 5AT1A 2ATCA 3TXXA 1NBEA 2YFKA 1EZZA 3L02A 1DXHA 1ORTA 8ATCA 1AT1A 2G7MC 2I6UA 1R0CA 1I5OA 1RABA 1ZA1A 4BJHB 1Q95A 2W37A 1OTHA 4JFRA 5G1PA 1JS1X 4A8HA 1F1BA 3L04A 3CSUA 4FYXA 1AKMA 3M5CA 3D7SA 2EF0A 1RAFA 3SDSA 1TUGA 5G1OA 4KGZA 3TPFA 1TU0A 4A8PA 4JHXA
chains in the Genus database with same CATH superfamily
4Y8VA 3U6KA 1EX6A 4TKVA 2C4HA 1MDFA 3K9LA 2NPIA 3OQJA 3U3JA 1ZNZA 4O63O 3ZD9A 4R8LA 4FYKA 1JDVA 3T0GA 1CXZA 3GDFA 2PUWA 2XKAA 3ZE6A 3GBPA 2DQKA 3ZJ5A 1VG9B 2ECPA 4HXYA 3ZX4A 1Z3CA 2SECE 2WINI 2PUVA 3BL6A 4O2BF 4BFXA 5CR9A 4IJ6A 4BAUA 1Z4OA 3PE6A 1LCIA 3WHLA 1G5RA 1WW2A 4M99A 4X8LA 4Z0TA 5H4HA 3U4DA 1GZUA 1A9PA 3W2EA 3WGIA 1BH6A 3INRA 3Q5EA 4BNLA 1H3FA 3U13A 5F7ZA 4CYMA 3GFSA 1NNI1 2XWBF 2Z2ZA 3PDWA 1I1OA 2NV6A 4RYLA 4C0AC 4ARIA 5KWIA 2PX4A 3B12A 1GPH1 2L18A 2VT2A 3PEUA 4QT0A 4R1TA 2C9BA 2OXRA 3PUYA 2FR8C 2AN1A 4FTWA 2D74A 4ZRMA 3TN7A 3PD1A 4JI6B 3HHEA 2GRAA 5EIAA 2WAYA 4XDHA 3P9RA 1Y8AA 3L6DA 3Q72A 4LXIA 5DU2A 3K0FA 3SM9A 3WIUA 4CQMA 4CQMB 2E4ZA 2JGDA 1W46A 3H19A 2AQ8A 3QXGA 5FD8A 2JBAB 4CMHA 3SC3A 2FY8A 4BEWA 3RTDA 1WIWA 1QQ6A 4OYYA 5IKMA 1ZAKA 3T5CA 1I7NA 1WB5A 3VVBA 4CKXA 1T9GS 2CJFA 2XECA 4FFRA 4TXLA 4EARA 3ORQA 1C3VA 1YZUA 2GR9A 2ZBRA 1JAXA 3JYPA 4D9FA 1HSOA 3L05A 3EIHA 1G98A 1LPPA 1JG2A 2YDYA 1HNNA 2JFHA 5C8YB 2NZVG 5BW6B 4BL5A 2I4RA 1US8A 5IDVA 1AV6A 4AUNA 3TNJA 4KUEA 4AJ4A 5C5EA 1WD7A 1HLPA 3PXBA 4I4TB 1EGHA 4NH0A 3UOAB 5TIIA 2DB3A 2G40A 1DOAA 3U4AA 4IYJA 1V37A 1ONSA 4EG7A 3WKCA 5HFNA 1G8HA 1TO6A 5TMEA 2YJGA 4R5MA 1H6BA 1SU8A 4E3ZA 2HA5A 1X1SA 2WR8A 4BJ5A 2FH5B 1Y42X 5FRDA 1BC5A 4WEQA 1T0PA 1L4YA 4CV0A 3SVTA 4B7XA 2FPIB 3EGDB 4HB3A 1AQIA 4TL9A 5FH9A 3PFFA 4MWZA 4ZA2A 3LL7A 2VI5A 5JZ9A 1QGUA 3I0MA 3O2SB 1WP9A 4LAFA 1SUSA 1I2BA 3WWYA 1U28C 4R9UC 5E3HA 4DAOA 4AULA 1ZW1A 2BUAA 2YHUA 3V97A 3HLTA 4PZZA 2DH6A 4H7HA 1ABBA 1F7UA 1DKMA 1F0YA 5GY7A 3CW8X 3FDXA 3MJSA 4KL8S 4BX0A 5BORA 1X70A 4KCGA 5F9HA 1GTG1 1PUXA 2OV2A 4FDUA 4G0MA 1C4XA 3ZJTA 3I9KA 1EXWA 5DRTA 3S4YA 2H51A 4XWWA 4EG1A 1O87A 4WN9B 4AL4A 4CODB 2HK6A 3M5DA 5ICSA 5ALLA 4LGYA 4DA8A 4G4JA 4LC9A 2PUTA 4ZHQB 1DFHA 1G1AA 4KQXA 1Y9EA 3LE8A 3B3FA 3FRJA 3K0BA 1WV0A 4BZPA 1Z4PX 3FUXA 3RAEC 2A92A 8GPBA 5JC1A 1L6RA 2H1FA 2EW1A 4W99A 4DPMA 2D0PB 3LXUX 5LKRA 4K9PA 2FX2A 2AOWA 3FPFA 2MSWA 3KZKA 1AKTA 4LWQA 4NBWA 4IDCA 1M3SA 4QNNA 3VV3A 4IV5A 3DAHA 1Z2NX 4NCBA 1W1IA 4KR6A 4WKOA 1YQGA 4GYWA 1MORA 2J87A 10MHA 1N36B 4FFWA 3EHDA 4R9SA 2ATEA 5BURA 4KIGA 5H81A 5I9MA 1O5OA 2OXIA 3JYOA 3NRJA 2H1VA 5K8JB 4XQEA 2LNDA 1G7CA 3BSWA 2D2VA 2RH5A 3IE2A 5DX0A 3T95A 4AP9A 4CLOA 3S5JA 1A72A 3ZH2A 1Y1KE 3PQEA 3QLUA 1UH5A 3WJ1A 2PJRA 2QL5A 4YLEA 4TN5A 3B9PA 1IMJA 1W36B 5E4FA 2PH7A 2JJMA 2LV8A 4RK5A 4AG3A 1J2TA 3ND5A 4UZSA 5J1SB 4G0PA 2FPIA 3EGDA 4DQDA 5IAOA 5JY1A 3U7GA 1FTNA 2GF9A 4QTZA 4UHDA 1USWA 1FSSA 1V5EA 1TVCA 3NTUA 2HU8A 5G0SA 1XSEA 1V43A 3QVJA 4Q7EA 3U9SA 2ZGVA 1BD3A 2Z5GA 3H9UA 3MGKA 2YFHA 3CZMA 4LVCA 5DTEA 1Z34A 2A67A 2I1LA 2XUAA 1HFEL 4X94A 4DIFA 3QWBA 2CCJA 1FW6A 2A3RA 1DC5A 2HPZA 1XROA 3RVBA 2FPPA 4DGSA 3AL2A 3UYLA 3ZV6A 2F9FA 3SQWA 2YNMD 1VJRA 1JP7A 1UK9A 4Z53A 3BMCB 4N5NA 5M3BA 5GIPE 1MV5A 2X8AA 4Z3OA 4PINA 2Q4DA 1G5HA 1Y3BE 1B6RA 4HN9A 4LE0A 4NCJA 1TM5E 4CMAA 1DG9A 3W2IA 3GCWA 5AIBA 1IB0A 3P5SA 3EFBA 4EK9A 1BE0A 4IQ0A 4R68A 1K66A 3TIGA 3PENA 2NX2A 1G7SA 3B51X 5BMVB 2RKWA 1JLMA 4FU0A 4D5GA 4JU8A 3I9V1 3TRFA 1CQJB 2I3GA 4MLCA 5KSWB 2KSQA 2FP4B 1LZLA 1SCJA 5LLDA 3NHKA 3KXKA 3WMRA 2AD5A 4C0LA 1ZN7A 5ALUA 1T4GA 4WV3A 3D7LA 1V4NA 4LRYA 4GOLD 2VSQA 4O4LB 4X3OA 4ZEOA 4RJTA 2O20A 2OG2A 1EUZA 1ADGA 1NJ8A 4URFA 4H0CA 1KVRA 3EY4A 3FCYA 4XCXA 4EHDA 2D0OB 2GNAA 2V7WA 3I8OA 1D7OA 2C5EA 3PU6A 1I80A 4EO9A 2ZAGA 1O95A 4QUAA 3ONEA 4LQDA 2J5XA 2C5LA 1AN0A 2O2YA 3FTQA 4QQ8A 4RVDA 2XGOA 4MO9A 1PQ4A 1ONNA 1U3FA 3DVSX 3EWSA 5A3QA 2GAFA 3UJ3X 1NI4B 1PJQA 1W9MA 2BKEA 2WMDA 1NFQA 2FQ1A 1GFWA 1SOVA 3ODPA 4MAMA 3CNEA 3ND7A 3TBHA 4OAPA 4B82A 5GONF 2QMQA 2J3QA 2X0DA 4AZTA 4BWGA 5CB4B 1XNGA 4Z1MD 1IAVA 2DHEA 1EUCB 1A50B 2HRDA 2I2DA 1NQAO 2Q3CA 1IY1A 1P72A 3MC1A 1E7RA 5DIZA 3I5YA 1CUDA 2JIBA 2X0RA 2NYRA 2VJBA 3AI1A 4NYJQ 4M8LA 1GUYA 1S2MA 4CL0A 3IMGA 3MOGA 1JTVA 5EG5A 2JNWA 2ZSHA 4RM2A 1LS6A 2B8NA 4HWKA 4MVJG 4Z9AA 2V0CA 1BCRB 1TVEA 4DCMA 1B41A 5HP4A 3IP8A 4CCSA 5F2EA 1RZRD 4CQLA 3IOEA 3QPUA 3Q2IA 1RWVA 5T64A 3D1VA 2VTBB 1XPOA 2FWBA 2NXJA 4XWGA 1M1YB 4UQPA 5EIWA 5BQPA 5FR1A 1JSCA 3K6SB 4B3XA 4B2PA 2CXXA 1U90A 2B30A 3MN1A 4ZOLA 3EEBA 5FFNA 3DDSA 1P2TA 3CCCA 1G17A 1VJ5A 2OB2A 3GFBA 4LDZA 5EJ4A 1B8NA 1H23A 4Y2UA 2PGLA 5JMWA 5HYVA 5IRCD 1PDVA 2Q3DA 3O4HA 4DKXA 5LYJB 2AZXA 1R0WA 3EIXA 5G0TA 5JZOA 1I3LA 5KCZA 1CIPA 4FJ0A 2JGKA 3STHA 3FM9A 3DNMA 3STYA 4QKQA 5BN4A 3DNPA 1TU3A 1M5TA 1V9LA 3ED1A 3G2KA 4IHQA 4W5WA 3VH1A 4FR2A 5AVTA 1ECJA 2FZ5A 3F7MA 2YR0A 4JK3A 1YI1A 4DWWA 4NSNA 5KYGA 1AN9A 4EELA 1KSFX 4MS4A 1L3BA 1YUNA 4LKRA 4EVIA 5F7JA 2O1WA 1CUCA 1E2JA 1H3NA 4X41A 3H6KA 1SKBA 3QKSA 5FAKA 4NYIR 4O2RA 3UWSA 5JS8A 4LI3X 1UJ5A 3NPMA 3PUWA 3UFBA 1GZVA 4P5PA 3L9XA 5KTRA 2XCTB 1M0WA 4J76A 1A1VA 5DSTA 5J5CA 2BGKA 1MABB 4IXTA 1KXJA 3IPRA 1JIXA 4CEJB 4KODA 2BJWA 1I24A 3DWFA 4MUXA 1LTHR 1QHNA 4WUVA 4Q3AA 3VTFA 1INLA 2VNKA 3ZLJA 2VJQA 3BWDD 3FLBA 3PQ5A 4MK4A 4MMZB 1QOPB 3ZDCA 2W6QA 3NVMB 4LPSA 5G4LA 1U6KA 3HDHA 3ZVMA 5BQFA 3JQPA 2QUKA 4QVKA 4YMIA 1P73A 4DRZA 2R66A 1K6IA 3ZE8A 2TMGA 4QLOA 3L84A 3N2EA 1GSAA 1IVNA 1CQIB 2B0CA 2JH8A 1EA5A 1T36A 5FNVF 3EZXA 3UJ9A 1GLVA 2Q1UA 4UFNA 1DAGA 4PLHA 4ZZ0A 1N92A 2ZYWX 3I4CA 3ZK8A 4BFZA 4ZYVA 5I7UA 3FOZA 1M2KA 3DPUA 3L0OA 4FOTA 5FOSA 1YR8A 2CFIA 3P0RA 3OLCX 1X1DA 4FWIB 4HTFB 2A4KA 2B8JA 3BYZA 3PUVA 5ALQA 2X5XA 1Q22A 5EZYB 5ICEA 2FB9A 3CB4A 1V5FA 2AMJA 4IZOA 4X93A 4KP7A 1VI5A 3PHBE 3Q0EA 4X54A 4EGJA 1JQBA 4EI2A 4B3SB 1BEUB 2HU2A 3WAJA 1KPGA 5EZSA 3SWWA 4DVGA 5CFOA 4W5JA 2BFWA 1KO8A 1FRQA 3UV7A 2H9AA 3PT9A 4PTYA 1P5RA 2YWFA 1LK7A 1SUIA 1SA0B 1HQKA 3PNVA 4IJ5A 5A6SB 3AOGA 2HCBA 4Q12A 3C4QA 1RHQA 4YROA 3RFXA 4YCLA 3VOSA 1SQ6A 5DNYB 4BNDB 4D0NA 3A37A 4KE6A 4MW6A 2W5UA 1CRWG 1EK5A 1QOQB 5MF6A 4F96A 4DDTA 2JZCA 2OK7A 3W77A 1U31A 5KQPA 1VXRA 4P92A 1BU5A 1IEWA 1RPNA 1GEEA 2HBZA 1Q6YA 2QQ5A 4MXDA 4O1MA 1REQA 4D0LB 2OGSA 3NTOA 1SC9A 3QFRA 1WU8A 2NZXA 5AK5A 5JECA 1MB2A 4WUTA 1PF7E 2BTQA 4KMOA 5BVHB 2XBUA 4J0IA 2VPQA 2ZRGA 1QHIA 3T7CA 3WRXC 2WT9A 3SF0A 1E3SA 5CEFA 5JQGA 3H2KA 3O8OB 5LZ4A 2GARA 5CX1A 1R6UA 4UEWA 3ZJ4A 4JJFA 1Z5ZA 3GIDA 3K96A 1TQ2A 3CLKA 4I55A 1N6IA 2G08A 3GK3A 2GDZA 4YREA 5C1PA 3UQYS 1WVGA 4DMGA 2WIJA 4HQ0A 3ZBPA 3RLIA 2RK4A 4EUFA 2FDXA 4G0VA 2WU4A 4JVNA 3K9BA 4P32A 1L1FA 4RENA 4AJ9A 3QPBA 3ZIAA 2ENWA 1GZ5A 4ILKA 4TMYA 3RE1A 2DULA 3DBVO 3OZTA 1U4NA 3UYKA 5BN4B 4PPNA 3BIOA 3WA7A 3JQAB 1EVLA 3NH9A 4Y6PA 2H16A 2ZPUA 4OHWA 4G9BA 5BY2A 4E3WA 1UC4B 2EW2A 4MI3A 4AXXA 3H1PA 1VL5A 4JUBA 1OFUX 3WBKA 4L1KA 1CEXA 1AGYA 4C14A 1UFVA 3HBLA 3VSAA 1ZJZA 4MQEB 2PS1A 3O2JA 4B81A 1A2KC 1GRCA 5C80A 1CVRA 1XVIA 2FPUA 3PIRA 4G25A 2QR5A 2Z2IA 1YONA 5AH0A 3OHMA 2B37A 3UKOA 4E5UA 4YONB 1I9GA 1M76A 3ZY6A 4AW9A 4CM7A 1Y1QA 3LCUA 3TQSA 4JC8A 5AXDA 1ZGBA 4OGWA 4NZPA 5DM60 2PVPA 3NTVA 3ERCA 3ZBTA 4KBFA 3BBPA 3V6MA 3LFUA 3BK2A 2D4HA 4MUJA 2NTJA 2GN1A 4GPTA 4M1QA 3PC6A 1UP7A 2AEJA 3AONB 2UZ1A 3BSSA 3GQBB 2JHPA 3KQWA 3FMOB 3QU5A 5EXEA 3T54A 5LP6B 2V1UA 2G6BA 2Q1TA 3T61A 4RCYA 3OHPA 2AE2A 3LXXA 4HNAB 5EWJB 4NV0A 3LCCA 4B33A 1A69A 5DI3A 3RK4A 2Q2QA 4TUYA 3HYTA 2RBGA 2ZR9A 2O1XA 3HDYA 2GJSA 3GEPA 3G85A 4RWZA 1YDFA 2HPVA 2ZRKA 1YHZA 3I6IA 4UQOA 5K8UA 3CVUA 3A3OA 4DCVA 1UMBA 1H2EA 2PH5A 2ZT8A 4WJLA 4R98A 5J58A 2FSGA 1V9CA 3BFKA 3DE7X 4R83A 4TYPA 1EVJA 5FPHA 3RG2A 1XCMA 3KKMA 3PYMA 4UHCA 1VMDA 3RYFA 4DXDA 3VAAA 4BVEA 3GFVA 4CR7A 3UMYA 3HMKA 4WEOA 3B6JA 3QQPA 3COZA 1XMSA 2Z58A 4JNCA 3BKXA 4O4LA 5ALGA 3EIOA 4F12A 4C22A 4J6FA 1YZLA 3A6ZA 3DQQA 3FI9A 1JT2A 1M6VB 1C8BA 1RWKA 3BMNA 1VPEA 4CIBA 4MPTA 1L8AA 4ZO4A 3S27A 3U3MA 2VK4A 2PGOA 3LA8A 4KE7A 3BB4A 4N8DA 2WKQA 4EUNA 4QOGA 1IRIA 1JQJC 4RH0A 2H1HA 3V8VA 4Z4CA 5BSGA 4BV9A 3ZGZA 1G8GA 3EQ2A 2ANBA 1RTTA 3G5LA 2IELA 1OILA 2MSLA 4MUNA 3EPKA 1TNDA 4P0PB 2QM3A 4DMMA 4UVHA 3RTGA 4RL4A 4GE3A 2CSXA 2Q1XA 1RPTA 4JQOA 1RXCA 1SM4A 4QGAA 1QQ7A 1Z0AA 3G2HA 1W0CA 4OA8A 4ESVA 2XCRB 1OBVA 2F64A 2HV8A 2QE7A 2RC6A 1YA6A 2INGX 4HRYA 1KP3A 4ZHSA 1KMCA 4RKEA 1ZOOA 1G6OA 1C9MA 1MT0A 2EL9A 1QIGA 1VTKA 2GK3A 2IF0A 3JAWB 3MB8A 4YS6A 2G9VA 4BO8A 2I6GA 3L8FA 5J2TB 1U28A 1MNAA 4RKFA 3W5DA 3RAGA 2OSVA 5T41A 4CLHA 5HIAA 3M81A 2IK8A 3MT8A 4IXDA 4JXKA 1XTUA 5DGHA 3PEWA 3HZZA 3RASA 4I1PA 4LXUA 5FV7A 3V80A 4BQNA 1XTJA 4P31A 2JFGA 3R5TA 2C59A 4E2FA 1IATA 2IH5A 2EFGA 3RKSA 3WDSA 4EO4A 1P61B 1AH2A 2P67A 4FYPA 3DCJA 2QENA 2BMVA 4GYYA 2I7XA 4IH4A 1KJQA 2OAEA 4MV9A 3OJFA 3P2KA 3R3UA 1FNMA 2NO4A 5SYMA 1BVRA 2IUUA 5KUTA 5A3VA 1IRXA 1CQPA 1XEWY 1XWFA 2GZ1A 3D8RA 3VJMA 4JI2B 4GR5A 4S1TA 2AR7A 1NQXA 3RBVA 1WXIA 4O4JB 3KELA 5H80A 2BGTA 3UXHA 4PQEA 1O77A 1B74A 4N0DA 4Q1BA 4XCVA 2CL6X 5TPZA 1AS0A 2V7PA 3KVOA 3ZE2B 2HLHA 1L5SA 4CGYA 1ITZA 4YAKA 5LXTB 1TJ4A 2E2WA 3HRIA 5DNWA 4RSRA 1RWQA 4OPMA 3LOUA 3RBXA 3WK6A 4OI0A 2C2OA 4HAVA 4MVJP 3TK1A 4KH1A 3DVLA 5CFZA 3TJMA 2DWCA 2FK8A 3K1JA 3TLCA 1XC7A 3AVWA 1N5KA 1WM1A 2CFTA 1XRSB 5HZGA 5C4GB 5CB8A 1UM9B 1RQXA 2ZWOA 1FU4A 4N54A 5KQRA 5L7WA 4NZ9A 1JU3A 1NF9A 1G38A 3GLHE 3LYUA 3MT0A 2WJZB 4OYHA 1EP3B 5TPZD 1P74A 4IBOA 3J81k 4QE3A 4A8JA 1EX9A 1UFKA 4Y9DA 1L5FA 1HDOA 1NVGA 2R44A 3D4NA 4MKFA 5KNDH 3DXZA 1Z16A 4BNXA 1EZZA 1J21A 1HYHA 2F1IA 1JKMA 2BBTA 1KI9A 2Q6IA 5E4YA 3A1EA 3LVBA 5D7BA 1SUDA 3MLAA 4PG6A 4P83A 4D9BA 3AVPA 2BSQA 1XTKA 1UMCA 2MT9A 4EIWA 4BO2A 1GDTA 3LCJA 1EUQA 3T3EA 1URPA 2GTIA 4Z6KA 2I4MA 4JGBA 3BF8A 2QSZA 5AJTA 4IIBA 1YFKA 1EGVB 3AHHA 2FQYA 3PX2A 1DGQA 1OXKB 4N5LA 4KQHA 1KSGA 1TZJA 5K3FA 3DF9A 3OZRA 4PZ0A 1RPJA 2AOTB 3DUWA 3PQ3A 3K6SA 2NUAB 1Z2OX 5B64A 5ED4A 1IVSA 2QEQA 2VEDA 3KJZA 2ISQA 3GJTA 5CW1A 3A9SA 3ROFA 3UMGA 2ZRQA 4JJEA 4MKZA 4HH0A 2A35A 3TYXA 4A8JC 4EY6A 4IOJA 4GQIA 2CUZA 4BMSA 3A8TA 4PC7A 3NEYA 4X95A 1VLLA 1KVSA 1M1UA 2VHJA 3WWPA 3N6XA 1CW2B 5KTPA 2OCXA 4XWTA 3RRMA 4CV2A 5JADA 1KR5A 4I4CA 4R2IA 1YCHA 1C7RA 1MX1A 1L2TA 1A3CA 1DFGA 2Y6UA 3D0RA 1MCZA 4TVBA 4CMIA 4LBVA 6ABPA 3RYCB 1L7OA 4J1TA 2HWYA 2NO7A 5B3AA 3ZVNA 4MCAA 2QORA 2EC5A 4C4SA 2VYCA 4A2QA 4FUTA 4LF8B 4QTXA 5E9JA 2QRQA 2PWAA 2O2JA 4QAJA 1RRPA 2NO9A 3SLKA 5SZIA 1P1BA 4GBED 5EC8A 2F4NA 1XEXB 1FRNA 1JG6A 2V7XA 2EG5A 1M6WA 4H7PA 4N0QA 4WFKA 3M6AA 1GZ7A 2GCOB 2X23A 2OG1A 4BPBA 1DDOA 3AUJB 3TL6A 4BYMA 2AOUA 1Y5LA 3H65A 1M83A 2Q0SA 4B3TB 4I81A 3H7AA 4ENWA 1RNLA 4FKZA 3U56A 3LKZA 5HUJA 4I4IA 4CKWB 1PGOA 4J3NA 3KFLA 4F6CA 4TXJA 5EIOA 4P4GA 4QXRA 4IUCS 4FCVA 3B82A 4MA0A 4GGOA 4KBYA 5IJ9B 1KDOA 3KJIA 5GV8A 3HKCA 1J20A 3F3KA 2O6HA 4YR9A 3AKEA 3I9OA 3EEYA 4P4TA 3FNRA 5IUKC 3PT5A 3P2MA 1PK8A 4HDNB 4TRMA 3ZWNA 1LDGA 1G7RA 1WXEA 1IL0A 3FG9A 3LA6A 3OKCA 4TL7A 4UUBA 5HQJA 2XGMA 1RI5A 3U26A 2IP1A 4ID9A 4FJ1A 1XTRA 4DIMA 4NG5A 1XZNA 4HYTA 2C2GA 4YAEA 2AK2A 2XKBA 2ZTLA 2R86A 2VH1A 2QTTA 3PPYA 5AJHA 3WZMA 2AGVA 4HUQA 2ZS9A 2GI4A 5DLPA 4FYJA 4ZI3A 4ZZ1A 4S24A 3ASUA 2YJ4A 4DRXA 1TAQA 3G1TA 3L7YA 5HF9A 5HFAA 4U2FA 2ZUBA 1YK0A 2WUEA 5DM2A 3VZSA 5JFGA 2JI6A 3KKPA 3IR5A 4ZVMA 1NJ6A 3EZ9A 1IN6A 1QP0A 4ZQHA 5EWLB 3E5RA 2RBKA 1FQOA 4H7JA 1LPOA 2QYTA 4YRNA 3EYWA 2JD1A 4MQBA 2WICA 2NUPA 3A9CA 3EXHC 2PZAA 4JP8A 4BKRA 5EJFA 3VYSB 1TT7A 2JJ1A 4E6EA 4UD2A 3WGVA 2PO7A 3LLVA 1RLIA 2XUFA 4G2TA 1SG0A 2MOKA 5DLDA 1W8IA 1QK3A 2IKQA 5FIUA 4FZJA 2PFKA 3IV6A 4QYTA 1USUA 1V16A 1E79D 2ZVQX 3GAAA 4E32A 2B4RO 2XNJA 1DXYA 1IK4A 2QTGA 5KQMA 5B30A 4KKXB 3OUZA 3AYXB 4Q4CA 621PA 1RBYA 4P53A 1MB3A 1AU9A 3N2NA 1PN3A 4BNKA 1XZLA 2AW5A 4JOBA 3IEIA 2IZOA 4CG3A 4PC6A 5JD3A 2DBVO 5B7QA 5CLLA 3ZXYA 3OIUA 4O02B 1J9GA 3U9LA 1TEZA 1PR4A 3WV5A 5IZ4A 2FP4A 4XDYA 3TM4A 4B6JA 3A1FA 2Z1NA 4ALMA 2O2SA 3KAKA 5L3QA 1N33B 1AGPA 1NKVA 3RODA 4IIVA 2DLCX 1Q7GA 3FDJA 2CHEA 3LBNA 3EQ6A 2IXTA 1UDRA 2ODPA 1GZ6A 2Q3HA 1HDEA 3BIWA 4MTLA 3IBYA 4ND5A 3U49A 4H31A 1CUVA 1PRYA 2NZYA 2PV0A 3KM0A 2CXHA 3LC1O 4Q4AA 2ZUSA 3T3IA 3CKKA 2I6FA 2MJLA 2JI4A 1GAEO 1FPQA 3DG9A 3G13A 1SHLA 1P4RA 2D2XA 4Y98A 1VG0B 4QQNA 1FTSA 2BLNA 1HTWA 3G0OA 4C88A 3QFSA 3N6VA 1FUUA 4LQCA 4KYTA 1QG6A 4L0CA 1PJ4A 3HUTA 4PYLA 3SXJA 2YY5A 4RAOA 2DERA 4F9FA 3WYGA 1TEXA 1YQWA 4R2KA 4GUAA 5T4EA 1G19A 3DO8A 4EWLA 1KZ7B 1N0WA 1NBIA 2R48A 2AF4C 4DNOA 4RDHA 1AM4D 3ZDEA 4JFAA 1GAXA 3IHKA 3RJMA 2FPOA 1LSSA 5AUPB 5FYQA 5HIJA 1Q3TA 5GWXA 3SR3A 3KZXA 1NW5A 3GLQA 5EMHA 3LQFA 3GEGA 3LOQA 3NUQA 3QEBZ 4OCZA 2J9YB 1VE6A 2QVGA 1E6MA 1HI9A 3BH6A 1GCOA 1PNOA 3JASB 2OXCA 1NQOA 1L4BA 1IQRA 4B75A 2O54A 2JHGA 4GU5A 5T4BA 2HRZA 4D4HA 2C92A 3CLTD 4TL8A 3IA2A 1Z5UA 2YV2A 4DWVA 4KKVA 1GTRA 1P80A 1G55A 3NJRA 1U98A 2IVFA 3KR1A 1JR4A 1UM9A 1N9KA 1M34B 1NQVA 1OKKA 1VDZA 2KLBA 2XTAA 2ZJ0A 4JUCA 4XSGA 1WEHA 1ILWA 4E5NA 1JT9A 3X2EA 2V03A 3RIXA 4LDNA 3W1WA 4OMFG 3TE7A 1LBEA 5A9SB 2NQ8A 2OENG 3C45A 4KAAA 1W73A 3TVYA 1I7DA 3MJTA 4HLUC 2H11A 5CNMA 1E7SA 1E5XA 2IBSA 3WG9A 4PU0A 1SXPA 4I5FA 2BKVA 3R5JA 4M1OA 4NU0A 5HIKA 4PF1A 3G9TA 1MUUA 4WPGA 1P6UA 5BR4A 1FFBA 1MQ9A 3LL4A 4U7JA 1PBTA 1ZZEA 4CMEA 3OM8A 2D1SA 2QJTA 5E3JA 5JR3A 2R7LA 3ZTTA 1HE2A 1L7QA 3CHYA 2A5DA 3P45A 3U2QA 4D9NA 2IZ1A 7ADHA 4ND7A 4BVAA 2HHHB 2QMOA 4E31A 4RMGA 3HN7A 4DANA 1ZJ6A 3UK6A 4TV9F 4FUQA 2XB9A 4QYWA 5CLHA 4LJYA 3ZS8A 4HBGA 5EY5B 2BYTA 4F92B 2ZZKA 2EF0A 4LE2A 4RORA 1KQNA 1S96A 1Q0LA 4KGZA 2A88A 1T5BA 1TPYA 3RC7A 2EZUA 4A5SA 4K0KB 1EQUA 2BIFA 2PGDA 1UDBA 3DB1A 3DOJA 2EZ9A 3JD0A 3OC6A 3Q9UA 4IKPA 2DXIA 3KJNA 4TSKA 2QD1A 3WIBA 4UNPA 3AI7A 3QH4A 2CXQA 3CPJB 1GGVA 2G36A 3YASA 3VHLB 3D8TA 4B4DA 2A0XA 1HOXA 4HATA 4DRXB 1Y7HA 1C2TA 2BEKA 3K7EA 4JT4A 3TLAA 4N1AA 3ECCA 1VIAA 2Q3JA 1DC4A 1GT91 4GXQA 2WNHA 2P62A 2VTKA 1DIOB 2WHPA 3C70A 4TM8A 3IJ5A 3Q7RA 3IUPA 5D8DA 2BDEA 5E2IA 2WU3A 2B4KA 2VRNA 2VK2A 3V1NA 2PA0A 1HF3A 1X15A 1XU4A 1CTQA 2YRXA 4K87A 3PA6A 1H2YA 1Z0UA 4O33A 4C7XA 1O08A 1YAHA 2AL7A 3B1XA 1HEIA 4JLUA 5TPWA 3JV7A 3ZBUA 1EDDA 3WK7A 3ZW9A 2ZIXB 1Z22A 3E81A 1DWPA 2A78A 1NJGA 3PNYA 4DB4A 1VP3A 1SPBS 2N42A 2MSDB 3H1TA 3FSJX 3TDMA 1PE0A 4OYRA 3Q3HA 4LXTA 2HRBA 4LY3A 1JXQA 1UAGA 2X4GA 4JCCA 4DJDC 2B98A 3R74A 1GGFA 1NGSA 1E5LA 1I3CA 3TG8A 1EB8A 2IYNA 1V3TA 4C0WA 9GPBA 1Q83A 2NQ2C 4D9GA 1KF0A 3OCXA 2Z4TA 4BB6A 3GUUA 3M9WA 4B47A 4NKRA 4OKIA 1VE5A 2FWMX 5LN1A 1C7FA 5IU6A 1NYTA 3PXUA 1I01A 3W5SA 3ZDXB 1I6MA 4EO7A 1QIJA 3GEEA 1XP5A 1DLIA 2A1UB 2WMYA 2Z0MA 3UV6A 2ZRIA 2EFHB 3EB9A 1P91A 1CLEA 5FBZA 4A26A 3LPAA 4U0KA 1AMNA 2PUEA 2SICE 3QEMA 1NXPA 1CB0A 4MLPA 1E64A 5A4JA 1GYRA 4FQ8A 4RDCA 1M6EX 1FYFA 1ZK4A 2R5NA 3ACCA 5FL7A 2WQ7A 1XBTA 3KR0A 3OCZA 3L4JA 3EIUA 4P1ZA 5EZ5A 2HGZA 1PEDA 1QJCA 2JRCA 3CLTC 3WGMA 3UH1A 3F6SA 1IDOA 3HJNA 1L3CA 4WX2B 5DYTA 1Z73A 1NBMD 1PO7A 3GA7A 4B84A 5AK6A 2PXAA 4EZEA 4Q01A 3DV9A 4CF4A 3DOUA 4ZK6A 3M6MD 2RHJA 2EDCA 2QYHA 2B4YA 3QYAA 1RRCA 3GD7A 2WJ6A 2G4VA 3L02A 1F8FA 1U2DC 1SOWA 2CDAA 4ATNA 3O8NA 4XD7D 1YB2A 2YN2A 3BD8A 3KTOA 4RA9A 1QIEA 1T4CB 3R24A 5FPTA 1IY9A 3UMBA 1SIBE 2GNPA 3GLSA 4YA6A 3UB3A 4H1HA 1JR3D 1ACLA 4RA6B 2YIMA 3RIYA 5EP3A 4D43A 1IUNA 1EHCA 2GJ8A 2GM4A 5J9FA 3VPAA 1B73A 2YCLA 5B55A 2H0AA 3NDIA 1JA9A 2EJWA 5JSZA 3SZLA 3FFTA 2VLBA 1PDOA 1TZKA 2AV6A 3LH5A 2H4YA 4NDZA 4ETWA 4HNTA 4ZTZB 2HXYA 5D3QA 3ITNA 3OD5A 4GDMA 4H7FA 3FOAA 2F6RA 1C4KA 2J46A 1QDEA 2QN2A 1SXGA 3OT4A 1WXFA 2OXFA 3KEOA 4I55F 1QIFA 4QICA 1NNUA 4XD7A 5SY6A 1T5TA 3L6CA 3OFVA 1Z45A 5ENDA 5CU7A 3QX9A 4WQMA 1FTGA 3WMFA 3UUWA 5IHPA 1CY8A 2HRCA 3NLLA 5BQ5A 3RS4A 4YJ2A 4UC0A 2JHFA 3LQ2A 5IEBA 2YZMA 4IDFA 1H0KA 2BM8A 5DWVA 5U4QA 3OEHD 6YASA 3IQHX 3TW8B 4TRNA 3JWEA 3NNNA 4UPVA 2ZXEA 1XMOB 1NDUA 4IJUA 4ALLA 5FLKA 2PKXA 5C8YF 3W06A 3DHNA 4G1VA 2IF2A 4OQYA 2GLXA 4EECA 3ZLTA 1FNDA 5TS2A 1W5TA 4I50A 1BXRB 2IODA 4DJFC 3MELA 3WRVA 4F1JA 3A6LA 3ENVA 2G0AA 3IP6A 4BNDA 1FFSA 2RGNA 3FCXA 1MKYA 1KRWA 2QRPA 2VS1A 3QVKA 3ZWOA 4WJZA 3SFVA 4GMKA 3NV9A 1A2BA 1WMFA 3U6BA 4X1YB 5HEKA 3ZG6A 4DR3B 1PJ2A 3GLGE 1W0KD 1JHDA 2R47A 1W4BA 2V9CA 3C5VA 5DLQC 1I10A 1NYLA 1IWOA 2Q49A 2P5TB 5ALMA 3JW8A 2PQ6A 4F97A 4HDKA 2DBZA 3G2LA 4OQFA 1VE9A 2F00A 1PGQA 1P45A 4EY4A 1DARA 1VE3A 2F1KA 3CLSC 3HWSA 1BDBA 3KYCB 5FUBA 5HJEA 1Z63A 4FDLA 2BM9A 2HRRA 4WY5A 1FUIA 1RHRA 2A0FA 1GQYA 1KQGA 1X9GA 1X38A 4DMKA 2WVJA 1UL1X 5AJUA 3LLSA 2O7NA 4IDBA 3CISA 2GBIA 2Z5LA 2ZUVA 3OMXA 4WZBA 2O5RA 3AUSA 4JBNA 4XXHA 5FBWB 4ER0A 1ZUNB 1O6BA 3ZIUA 3MQ2A 2R2GA 3P4XA 4BFVA 1XPRA 4PQGA 3M3PA 3TRHA 1G21B 2PVSA 3VUEA 3LY5A 1A9SA 3S2YA 1U0RA 1NPYA 3O0DA 4JC4A 2AS0A 3JWIA 1XIVA 1SB9A 2BDUA 4JR2A 1FBNA 2VJYA 2WE8A 4KO2S 4GEKA 4RFSB 2O8FB 2RHCA 4GP7A 4UASA 4Q15A 3RRFA 1N6KA 4BGDA 1KA9H 1XLTA 1WQ1R 3ADKA 3F5QA 4M60A 4OGFA 4CEJA 2P6MA 1HURA 1OFTA 3OPXA 4UHEA 3JXEA 5BUZA 3AVXA 4WA7A 1XHLA 2C07A 3I6BA 3OJCA 1YK1A 5JI3E 1NBEA 1VHJA 3PD7A 2CZGA 1NMYA 2ZUEA 3A1NA 3NOXA 4EA6A 4M0UA 2PFGA 5EVJA 1EI9A 1AJEA 3M9LA 3E9ZA 1JG4A 3L41A 4RA6A 1BXGB 4WDQA 4KQJA 4Y6QA 1Z68A 3BZBA 4QRIA 5JCOC 4ON9A 3IPYA 5FADA 5IKOA 3QXCA 1BEZA 1EU1A 2P8SA 4X91A 1O4VA 5EKXA 3AEUB 3DL0A 1PNQA 5GP1A 3Q88A 1LF0A 2D13A 2C42A 5HOEA 2IDKA 4E1AA 5T6MA 4FFSA 1P2DA 3RC3A 4UTOA 4OOEA 1YJ5A 3LUHA 2NUTA 4ZT3A 5IBRA 2DF8A 2ZJZA 3DJYA 3ESYA 3AR6A 4G5RA 3HUUA 1U0JA 3KQYA 5G3ZA 3UMFA 4M6WB 2GN2A 3AGPA 3S1AA 2Y0BA 2X8BA 1DQNA 2CXRA 4MQLA 1QWSA 3EZ6A 2C9CA 1ZC3A 4FZ3A 2XV1A 3W2FA 4HYQA 3RYIA 4RPLA 3L2OB 1XTBA 2C82A 4LXYA 3CZAA 1IOLA 2QW0X 4OL0A 1GN8A 2FSPA 2HLPA 4NYIQ 3AV3A 1V4VA 1OAOC 2F9MA 2OZKA 4F2PA 3T7IA 1FTYA 1OLSB 1TDJA 4N0PA 1MW9X 5FNVB 1JEYB 1QQBA 2DWPA 3AXTA 5JPCA 3STWA 1A2QA 3L1KA 5CFQA 1Z26A 1Z5GA 5DNCA 2YWHA 3B89A 2C7OA 4URWR 3GRCA 3DE5X 4LJ7A 4Q66C 4FMDB 3ZS9A 4B3GA 2B4AA 2SKDA 2ZBDA 5HVNA 1QTIA 3BWBA 1R6TA 1GU7A 4FONA 1V6SA 3I01M 3TZEA 4AWXA 2XMZA 2I6QA 4YPOA 2GPNA 2GCEA 1CHNA 1QR2A 3C16C 4F8EA 3AYZB 3CTPA 1WR8A 5IJ0A 3G9UA 4ESHA 1H69A 1SD1A 1WXQA 4DCGA 2Q45A 3IMFA 2O3UA 2HCTA 4OMCA 2ZT5A 2WYUA 2NNLD 1KC1A 5E38A 2WKRA 3EXEA 2FVXA 2O50A 1Z29A 1KJZA 4L22A 1TLLA 2PEZA 5AKYA 5LZ5A 5REQB 3I1FA 4S12A 2DPXA 1C1XB 5A5DA 4B4WA 3WSWA 1FFXB 4U1RA 1P39A 1TI7A 3L6OO 4YJHB 5KWVA 1OLXA 3VH2A 2HEGA 2H07A 3SD7A 3MAAC 2BFAA 1MGOA 1NNEA 2REOA 3E8MA 3OT1B 4W82A 5GQSA 2F4VB 2Z1DA 2AFIE 3JRWA 5F9FA 2ZYSA 4I9UA 1XMIA 5WRFA 3AC0A 4D4IA 8OHMA 4CNQA 2A9VA 4R31A 1PGJA 4L6CA 2CN1A 3CLUC 4DYHA 2OKCA 4Q1AA 5C5CA 1NV8A 2BMEA 2A9QA 1YASA 1A1SA 1BE8A 2NU9A 2WMOB 4EVQA 5JOQA 3PITA 2B1JA 2R00A 2IOHA 2NADA 1FDTA 2C1EA 2K4MA 5TR9A 2XUJA 1J8DA 2B9VA 1JTEA 3F3SA 1TZMA 2YNMC 4BMCA 3Q6NA 4AWBA 5A4AA 4GI3A 5KSZA 1LQUA 1RI1A 4MIYA 4RCVA 4NU8X 2P2CA 2QF7A 3DAFA 5JCPA 5AT1A 4A4DA 2I78A 1XLVA 3IAS1 4O2AA 5IKPA 1ZL2A 2HYDA 2JJQA 3EF1A 4R2XA 2RARA 3BJMA 3CCBA 2ODEA 4UMVA 1ZM7A 1FYXA 1FFAA 3L0DA 3LMKA 2IYRA 1UBGA 1QHFA 1DZ3A 2I6TA 2VDWA 4DCUA 4OVKA 4NENB 3UANA 2ID4A 1JJAA 1QYXA 2AI2A 3B9RA 4FE7A 4G0XA 4CV3A 5ER9A 2AQKA 3HN2A 1E5VA 1LY1A 2IE0A 1HE5A 3ZY3A 3KLPX 1WUHS 3A14A 3LY7A 1RRKA 4A2PA 16PKA 4ITVA 2AJDA 2I9KA 2RAPA 2XE4A 3DDWA 1TAGA 3ONWA 1M2VA 3TKLA 6GPBA 3AW9A 3M5CA 4G1MB 4EBFA 4F2HA 2Y66A 5AI0A 3VR4A 1PT6A 2HBQA 3QJGA 5C5DA 4BS9A 2H1SA 4F91B 4MZDA 3LSYA 2CFCA 4DIEA 3CNQS 2ESRA 1N1DA 3HR4A 2GHQA 3CV3A 1MLDA 1VRVA 5FBRB 5MFZA 2XR1A 1OLOA 2QI9C 2EWVA 1YNOA 2EXXA 4Q9AA 3O9VA 1K27A 1ZCAA 1NVVR 3FSEA 2I0FA 4MICA 2I4NA 3TRIA 5KJFA 1W85B 5CTJA 5CG1A 2DX7A 2PTGA 3ZV4A 2GERA 4ER7A 2IHZA 1YO6A 2VKQA 2LW7A 2YHIB 3FETA 3FOCA 3MSCA 4PQRA 2JCSA 3I09A 1A9XA 3B8HA 4JT8A 2W7TA 1MN6A 3DL4A 5TS3A 4ENTA 5BVGA 3V2IA 2VFAA 3G0IA 4Q6WA 1QQ5A 1CETA 2XZOA 4RQTA 5FPYA 2QMUA 3BHJA 3QTTA 3U62A 2ZR7A 2WLTA 4N7MA 3VJKA 5FO1A 5I9SA 2X6TA 1GPAA 1J2YA 5JPDA 1SXIA 4OP3A 3IDQA 4JWTA 4OQQA 2VJAA 1G2OA 1A7KA 4CUZA 4QTTB 1CJCA 1GFZA 2WT4A 1O89A 3IBGA 2WB4A 4GF5A 2ZSUA 3QHQA 1I7LA 3Q8KA 3LBYA 4EM6A 1SIWA 4BLUA 5F77A 5HK9A 3QUTA 3RTEA 4C7VA 3BD7A 3DDNA 1YZ3A 1WUYA 4TVOA 4ANFA 6LDHA 3MWJA 1QQTA 3OETA 4RJIA 2GYWA 1LLFA 2HV9A 4L95C 3RSOA 1M0TA 1DE0A 4P7GA 2IUEA 3DC7A 1AHNA 3G0HA 2HMSA 4Q16A 2I4OA 1KOJA 4BB0A 3HFJA 2YVQA 3AG6A 4P3YA 4DJTA 3EA5A 3GJ3A 5IVIA 3BWMA 3W4JA 1GG2A 2GD1O 3ZDZB 3KJXA 3K92A 4BFTA 4BO3A 1QFMA 4HNRA 5IABA 1G20A 4EFDA 4F6RA 2CD9A 1LU9A 2MMCA 1WCV1 4LF6B 3A9UA 2JEOA 5TMBA 4F45A 4ZI7B 1TX4B 4R1SA 1GADO 1QH8A 2WAOA 1S5PA 2XJ9A 4Z2AA 2VXBA 4CHTA 4DIKA 2A9JA 1U94A 1EFKA 2HI0A 2IQ5A 2XE6A 2XMPA 1BX0A 1YR9A 1KAMA 2BEJA 1D1TA 1SU7A 2P2ZA 2P8JA 2XHZA 5KYVA 2EFEB 4IIUA 3TOZA 3TOVA 2V9PA 5SYNA 3VNAA 3U31A 1ZU5A 1VHTA 2VHWA 3VSEA 2QM0A 1G6HA 2Q5IA 5JSFA 5ADWA 1M2JA 3WZLA 5JROA 5JHHB 2VP2A 3F9RA 4QLBA 1I7QB 1ZYUA 4JX9A 1C8KA 3NBFA 3OEWA 4KO1S 1U5BB 4OD0A 2BY4A 4RMNA 3WNZA 2WP0A 1S9DA 3HCAA 5KOHB 5EIBC 1O94D 1QB8A 3GCDA 2LDXA 3WNCA 5B1EA 1XDWA 1Q1EA 1UFOA 2YC4C 2ZWPA 3FVRA 3D5QA 4XCQA 2VQDA 3QGMA 1VGVA 4N7RA 4DW8A 3FXAA 3NIFB 1EESA 2CE7A 5AXAA 4A16A 1BA2A 1LDEA 4PE5B 4XZ3A 2I34A 3IO5A 1X86B 4BBPA 1SRRA 4N49A 3T7TA 3GRUA 2PIAA 2REXB 2VDUE 4O4HB 2IZ7A 3H2GA 2W70A 4M89A 4PAOA 4WOJA 1KOGA 2ZSEA 2IHYA 4P3XA 4GRAA 2FEOA 1V8BA 3HDGA 4U63A 1TCVA 3HBNA 3R7NA 3SHTA 5CGQB 3SXUA 5CCEA 1E1NA 1EGAA 5I7RA 4TMZA 1E94E 1JEQA 4IKOA 3S44A 2WTUA 4GQBA 3OZGA 2V7UA 3ZNNA 4Q3LA 5LB4A 2P6UA 3ENZA 4IFEA 5KTTA 1MB9A 2X9GA 3KVNA 2X58A 3PNMA 4G0NA 1R2QA 4LJ8A 4ND8A 3T4PA 2OCAA 2OVFA 1RC0A 1YH3A 3AUTA 3H3JA 4M7WA 5JVDB 4CKEB 5MN6A 2VH2A 3L77A 4CZ2A 4F9TA 3ZXSA 2C3YA 5EPUA 3RAFC 1WZEA 2YJ3A 1C5KA 3Q7QA 3BN3A 2BGLA 5F52A 5BWBA 2NMVA 5JJIA 3WFJA 1UFRA 4X62B 4R1OA 3DEYX 1SBYA 5I3CA 4BNJA 3CZPA 1WMBA 1L3IA 2KHZA 4IDEA 1O0SA 3EWAA 3KOOA 1C7EA 1P2VA 3JARA 4MWOA 4X97A 4Y6RA 1GTMA 4B1FA 4BQRA 1Z82A 3AUUA 2P2DA 3IAS6 2XT0A 3HKCB 5JMTA 3B20A 4TKUB 2OLEA 3W7AA 1B8OA 2BJVA 3X43A 1BRTA 4FILA 4Z4IA 3WLIA 4KDCA 2LDBA 1VECA 4L4XA 2WTMA 3O4JA 2ZRFA 4DDUA 1NC1A 3SQMA 2BEUA 2VJMB 4RE6A 1VGRA 3OTIA 3AF3A 4KRXA 1WSWA 5IUJC 2HGSA 4CLOB 2AOUB 1XELA 1Z5VA 5JH7B 2VP4A 2V6GA 2Y27A 4FK8A 3TVTA 4D57A 4MP3A 3QXSA 1W96A 3R0JA 2YRWA 3GN1A 1U8EA 1HZZA 5DI3B 1UT8A 5DZSA 1SU4A 4RF5A 1YJCA 4GBGA 5HM6A 1VBNA 3ZWPA 3L4KA 4MSUA 1VJTA 1BDHA 1CY0A 2YXNA 1TA9A 4NCHA 5AW5A 4CF6A 3JVIA 4JBLA 4KG7A 1KVTA 4C1NA 1C4WA 1B2RA 4GOOD 4JXZA 1FX0A 1U4SA 4YH1A 1VPTA 2UYGA 2RHMA 3TZBA 2CMDA 1P2UA 4N3GA 4NPCA 1R8YA 2V6JA 4AJKA 4L2IB 3H1AA 4LC1A 1YF3A 4IIYA 1SVOA 1QANA 1EWTA 1RJFA 4J1QA 2AOTA 4RM3A 4E09A 2FFBA 5IJWA 2JS7A 3PQ4A 1MVOA 1NHGA 2GKGA 4GWKA 3FJOA 5JSKA 5E1BA 5A3SA 1KJYA 1ZESA 4GT1A 1SCBA 4EJSC 1V47A 1ZMXA 4UEKA 4WCFC 5F76A 2JRLA 4ZHQF 1RZ3A 5FI1B 1PNRA 1F4PA 4WE3A 3O75A 1D2AA 3UK1A 3ET4A 1LPSA 4BUZA 3UJBA 1E61A 1JS1X 4JLSA 1TZ2A 3K5IA 1SCUB 1O94C 1NZJA 2XYRA 4U39A 2NU7A 3AHCA 1N1MA 2X3YA 4ETMA 1QGUB 5BN3B 4MTCA 4X85A 3RR2A 3UN1A 2QL9A 4DUZB 3RANA 1XLWA 4IGFA 1FJGB 1ZN2A 1SBNE 4K1LA 1XTVA 2W2VA 4R54A 4BATA 3K8OE 5KOIA 5KJCA 4RYDA 2BHSA 3HADA 2GT1A 3UIEA 4A15A 1FJXA 2VAMA 4LMRA 1T3TA 1ID1A 2Q1WA 3AFHA 2YVAA 5CX1B 1X7YB 4RL6A 3PGMA 2E1PA 3MLBA 4H6PA 3RUHA 3SOZA 4BO6A 2IBMA 1Q7TA 4DXAA 2AR0A 1E1QD 2PRIA 3JQ8A 3T8YA 4LZLA 4LX0A 5LKAA 2C1XA 3H84A 4IIGA 4K6OA 4C03A 2X2EA 4DLTA 3IPCA 1NI5A 2X2FA 1PJ3A 2QYSA 3MMSA 1ZMBA 2DUUA 1R0BA 3FCSB 3JQ7B 4WKPA 4X6LA 2Z9DA 1FDSA 4M8NE 3T3DA 3V7UA 3RIMA 3S68A 5AVWA 1ZVVA 4E12A 4G4GA 4XJXA 1DCFA 1XAIA 3F9IA 1UK6A 3S5UA 5CTAA 1ZG3A 3TB6A 3B6EA 3B8EA 3K32A 3RJTA 3AFIA 4O4JA 1QP8A 4GIBA 4BBAA 1NLFA 5G4KB 3HKEA 2WV9A 3DFUA 3KQTA 4WZAE 1Z4IA 2IS6A 3VSCA 1EQAA 1C1XA 3GHHA 3LI2A 4OH7A 2WILA 2RGYA 4Y9UA 2H06A 4JKOA 3ZVRA 1DEAA 1KJJA 1ODTC 3AJRA 2HN9A 3R0XA 2KYRA 2ZK7A 3C6MA 3QX8A 4KWCA 4HY3A 4BTEA 1Y7TA 2JGDB 2COKA 5H3LA 3R7BA 3W90A 4FPXA 3OWXA 3T0FA 2BGUA 1ATZA 4GD3Q 4NENA 2ONZA 2JLXA 1JPUA 1Y7IA 4G0QA 5DXJA 2KB0A 3ROZA 3HP4A 4B3JA 4RZ3A 4BV8A 3U4MA 4IGIA 2Z9BA 3CE6A 3MUFA 1CUSA 2CJWB 1Q0UA 1NW3A 1GLNA 2R6R1 3HDVA 3F4KA 4GYKA 4DQXA 1Z37A 1OZFA 4KMMA 2Z43A 2ZQYA 3JAWA 4BNZA 4KN5A 3E53A 4S1PA 3SEZA 4C07A 1VL1A 2EDAA 3OM1A 4PYJA 2C96A 5ALPA 2NZ8A 1COWA 3HNRA 1OV6A 3HU5A 4JC5A 5K2MA 5K3CA 3RYIB 5CEEA 2IEZA 4BKPA 3JTMA 3PNQA 4Q05A 4DBZA 3LT4A 2QM8A 3LHIA 1DQPA 3CW9A 3IAAA 2GF0A 5IVKA 4V24A 3S1AB 1EX7A 1W88A 1OI2A 2BP7A 3B7WA 3ICOA 3ABSB 1F60A 4YCJA 3SJAA 1WCYA 1CULC 1NYQA 5KSPA 3C5HA 1QE5A 3OT1A 1T15A 2QAJA 3BMQB 3DT8A 5CITA 1UWKA 4JYZA 3Q1LA 5CLFA 5LDDC 3GT3A 2B5WA 2HXSA 1PP4A 4TYQA 1I2AA 2GAAA 3STUA 2WHEA 4PYRA 1THTA 3ASYA 1RHUA 4HBZA 3I2FA 5KINB 3LBIA 2H6EA 1IZ7A 4V0OA 1QLHA 1Q21A 5REQA 1BFDA 4DA4A 3RV4A 1PJTA 2AJBA 3UY4A 4B0OA 3D81A 5DM1A 1YVPA 4E5KA 1CF9A 2B99A 4U3JB 2VPZA 3PXDA 3KJHA 4V2UA 4KAJA 2O3SA 1UXGA 2W2KA 2G82A 1E7QA 1OXMA 2KLHA 2H00A 2Z4RA 2ATIA 4G67A 5KZMB 3H6HA 5JSUA 4Q1FA 5LQUA 4OJKA 1RYBA 2BR3A 2PIDA 4ZU6X 4YUAA 1HE3A 4RPJA 4J4HA 2C9OA 2VTBA 1IOVA 3JYNA 2V3VA 1ORRA 2IW3A 1AZSC 3G23A 3I9MA 4I5IA 3AR3A 3L79A 3QK7A 3A6JA 4C2AA 4PHTA 1CY7A 2Y1XA 5DCLA 4WBSA 4IGEA 2BHLA 4KH0A 1OB5A 4HB4A 3IUYA 3U7IA 1E62A 1Y6RA 2FYTA 5KPJA 1EXVA 3TUIC 4QOJA 5CB6A 1ZONA 2GKSA 1OC4A 2GK6A 2EL7A 1OX6A 3A6EA 3FSGD 4OH1A 4RTJA 1ISMA 3P94A 1UOPA 4Q93A 4E51A 4FEAA 3HA7A 5AYVA 4BB9A 1K2VN 3OHSX 4YQZA 4ODIA 3HYRA 4L4YA 2V7TA 4H6WA 4BNFA 1WVIA 4QDXA 2DPYA 1EAYA 1ZQ9A 1Q19A 1ZGGA 2GHTA 3KYDA 1NI4A 4RK7A 2RB5A 1JHQA 1BQ3A 2Q5FA 3MGCA 1OWMA 3UJ6A 3EGXA 3GQVA 5EE0A 1W4ZA 3OVMA 2ZVDA 3DKRA 1VKHA 3QTLA 3OCCA 1ZNYA 2OCYC 4J0FA 3WV4A 4FNAA 4BQIA 1Z17A 3JCZA 4C6TA 2I67A 1NXOA 5ALHA 5SICE 1P33A 5L7TA 2Y1LA 2QSJA 3DV0B 4HAZA 5K03A 1H9CA 4BMVA 4P38A 3N8IA 4YV2A 1KR2A 4TV9B 4W9NC 1AO3A 1E7WA 1W5EA 4NV1A 1V9SA 5ISMA 2DHQA 4MVJH 1HDIA 1P1IA 1TYCA 3WWOA 2B83A 1IWBB 1V95A 1NURA 2H5JA 2PYIA 3TUJC 1QH0A 1FFHA 4CE6A 5EJIA 1Y8RB 1IM8A 1ODFA 4QYMA 2IYZA 4E4YA 2E18A 5FOQA 1YB6A 3EPRA 4QUIA 1SELA 4JUIA 2JCYA 3LX5A 4JEIA 1XU9A 1K3FA 2HD4A 1LLUA 3A4MA 3DZKA 4M53A 4QODA 3WL6A 1QGAA 3K8QA 4EW3A 3PTAA 2DPLA 4HH4A 3V34A 4CDMA 2X3FA 4WK2B 3V6LA 2LIPA 1CFJA 5EP4A 5B3LA 2L82A 3GVCA 1J0EA 1XL0A 3PXXA 4PXAA 1AHIA 1ZEJA 1IJKA 1O8CA 1QG0A 4L8VA 3D8SA 3LUGA 3ND9A 4W5OA 3BCUA 4Y2YA 1WX1A 3RRYA 1EK2A 3NMUF 5DLYA 3B7PA 3CQ9A 5DM4A 4TS4A 3PB3A 1LW6E 5JZBA 2J07A 2XTMA 2HMWA 5CNIA 3LSTA 3IDOA 4PM4A 5D3MB 3T7JA 1W5AA 2XUDA 4KO8A 5LMNB 4GKJB 4NYMR 4RC9A 4B8WA 1HZJA 1KAHA 2DPMA 3AERB 3AP1A 1K9SA 2ID9A 1SUPA 3I32A 1KQPA 3ICPA 2ORIA 3MQFA 3B1JA 1CNEA 2R4TA 2XGSA 2A33A 4S04A 1R5NA 1B6TA 3FPAA 5CHEA 4GS5A 4ZANA 2XEDA 1I3KA 3ZCVA 1E3LA 1TC1A 4XVUA 4PO8A 4X1IA 3ZQ4A 1RJEA 4GPAA 3ESZA 1CP2A 5EVCA 3CG4A 1VHDA 1A88A 3BOSA 4D6PA 4RTQA 4W8HA 1ZI9A 1EJ2A 5AVQA 1E2EA 4HQOA 2JFVA 3DV0A 1AKVA 1YBAA 2WWXA 1TMGE 4M1ZA 4BGEA 3C3KA 4UM9B 2C7BA 2NO6A 4QBKA 3WDKA 4MYDA 4OHOA 2QE6A 4RVGA 3QX3A 3GZ4A 3HB4X 1NU6A 1HNWB 3ZXUB 1KDPA 2HH9A 4B9EA 1KFKB 1FW8A 4DM4A 1RAFA 1IZZA 5CT9A 1T36B 3TRJA 2AG8A 3BMXA 2O2IA 4QQRA 1Y4AE 2VNHA 3TPZA 2Z2JA 2D59A 3LIIA 3D5TA 3D54D 3MS2A 4NAVA 4EB0A 3S99A 4JUFA 3AY6A 5JYEA 4K7JA 1GPLA 1SVSA 3LHSA 3RTAA 5K4GA 2C0PA 4EMSA 4K9DA 3CVYA 4PGHA 3NHUA 2WIKA 3PE3A 1FRVA 3OU7A 4Q21A 4TZ6A 2I6SA 3PGVA 4YRAA 4RTKA 4WMLA 3L0BA 1PTJC 1YB7A 1B6SA 5AHOA 1P9OA 3TTXA 1K75A 1QGYA 3RF6A 2QA5A 5H02A 5JH7F 4HP8A 4D9MA 3GI1A 4J8PA 3WQBA 4ZYLA 5CA1A 1U6IA 3AU8A 4WZZA 4DA9A 5L6LB 4OLHA 3THWB 1RBQA 4YYZA 1Q57A 2JANA 3Q11A 3FOBA 5J2UA 2PH1A 3MPUA 1Z07A 4BWYA 3MZ0A 1YJXA 5DB4A 5EIEA 3VKGA 4TLDA 5BRJA 4F60A 2I4LA 5JSZB 1YRLA 3AEXA 5ALTA 2O0MA 1UBNA 3ZDQA 4UJ5A 3KQKA 2PKEA 4RE5A 4BQQA 1J56A 2I2BA 2HSEA 4OX9B 2PWBA 4R7TA 5CCDA 4PRYA 2PBFA 4GP6A 4AUEA 3RGGA 4RA9B 4DYVA 4ZK2A 3WGZA 3GB9A 4HR7A 2A5LA 5HSGA 3NJ4A 4PO9A 1CD5A 1G8SA 1VKJA 5TPWB 1A27A 3NIBA 3GLRA 1XP8A 3H3XA 1Z2DA 2TMYA 3PG5A 1BJTA 5IMBA 5TQ2A 5ILQA 4Z9XA 3GNLA 4KPGA 1HDYA 4IEIA 3PC8C 4EITA 2C95A 2P4HX 1QGZA 4RKRA 2C20A 5BR7A 1MFPA 1UINA 4D9KA 2Z6VA 3LY9A 3P9IA 3QE0A 4KFCA 3QWHA 4GZ3A 1NOKA 2CMFA 1N32B 3MMPA 1N7JA 2Q8QA 3M1YA 1EXNA 1DELA 1KYTA 1MENA 3I9V6 4LJ4A 1JHAA 3E3AA 3BJEA 4FZRA 3S0JA 2POQX 1Y1LA 4DN6A 1NSTA 2Y3IA 2PMDA 2YL2A 3OQHA 4C04A 1T3HA 2IOFK 1DMSA 4UU7A 5JT1A 4CN9A 1H94A 4XGKA 1HQCA 2HRQA 2WJGA 4NOLA 3W4IA 1NJFA 5EPEA 4U2EA 1MC4A 2BKXA 4FNOA 4U2CA 1VPWA 4F3KA 2IS2A 4EYSA 3G8BA 4BN5A 3OOWA 1NF2A 1IFXA 3RM3A 1P8AA 3SF8A 3VYVA 3OQOA 2D7JA 2V6IA 3ZHOA 1C4OA 1TMYA 1UC8A 1DTEA 3HU3A 3AKYA 3K6RA 2QJRA 3AWDA 3OP4A 3RREA 3U3OA 3FZNA 1N5MA 3WR5A 3R9WA 2DFLA 4Q3CA 4P3KA 1CJMA 5AP9A 5IFLA 3FNQA 2YXPX 4KIJA 4GC9A 4LOIA 2R2AA 4G97A 1P1KA 3UJAA 2G1UA 4F46A 5LD2C 1E1MA 3GEIA 4N01A 1EUDB 1JHRA 1YZTA 3EK2A 4I8DA 4X7MA 3ZUPA 1KFBB 3C8ZA 4KNWA 4JJGA 4HK4A 5JWOA 1OXSC 3B5EA 3F5MA 2BI4A 1USIA 4H27A 2QNIA 4PCLA 4TWAA 2CNDA 2YWCA 1XCBA 1Z0SA 3MJFA 3WLTA 2AX3A 1OD6A 3AB7A 4I1YA 5D1HA 3D59A 3KQNA 3WGTA 1FNBA 2F43B 3W6ZA 5CLIA 5T57A 3F6PA 1ICEA 4G0ZA 4I8IA 4CIWA 4YY3B 5B12A 1P8JA 3KLOA 2F59A 3L4SO 1EPUA 2YH2A 3W34A 4REQA 1L5LA 3FI0A 4D5EA 4TOIA 2NAPA 3KQOA 5BRAA 3RRBA 5IS2A 2ZE8A 3B48A 2RG1A 3GJXC 3R9KA 5LQKA 3UCFA 4DG5A 5JXGA 2R6GA 1YQTA 1R0YA 4AIRA 2O7QA 4W1SA 3RVJA 1PVOA 3WTCA 1ECGA 4DA0A 4RSHA 5E9AA 3WXMA 2AFHA 4RPKA 3WSTA 4GX0A 4CM4B 2FOXA 4M9QA 1LVHA 1GA6A 2AC2A 1XCLA 4RADA 5DCUA 5BSUA 3D6FA 3NU1A 4M0PA 1YBVA 2QRGA 4FEGA 1JDSA 2ECOA 1U0LA 3EXIA 5A71A 4MRSA 3DTNA 2YVKA 2JGEA 2BONA 3ZHSA 2VYNA 3FYHA 3NC4A 1KMHB 1Y5IA 1GNQA 4AZ3A 4LOLA 2EKZA 3WJAA 2NXWA 3B5IA 2GXUA 3NTXA 4S1VA 2WF9A 1JAHA 1IG0A 2C99A 2PVCA 1LBIA 2K7ZA 3QVOA 1GZHB 4D99A 3AEYA 3AUYA 3OPQA 1UJBA 4Y2RA 3D2BA 3UUFA 2J0QA 3KU1A 3AMVA 2J3JA 3FMPB 4IHAA 4V3CA 4B6RA 4CFSA 3U16A 2DFKB 1HKHA 2FRXA 4RW0A 2WC1A 3VDRA 2XE7A 4YJGA 4HFMA 2VPXA 5IDXA 2C2BA 4BQPA 4QDZA 1PG2A 3THXA 1DIAA 3KSMA 3H6GA 1OOEA 2GLUA 3UJDA 4H9GA 4MUMA 1A5TA 1WW3A 1PZEA 1YDEA 3DYBA 3ME5A 3AF2A 3ND8A 5BQOA 2X0FA 3RHTA 2HJ9A 1WBDA 4L5BA 3CR3C 3KU4A 3OCWA 4Y2PA 3A04A 4GBJA 2G09A 4HEA1 1T6BY 2V8BA 5U9CA 1IIBA 5KI6A 3D6TB 3IH5A 4L5AA 1R8XA 4LOAA 1KO4A 3NB0A 1WDMA 5F3RA 3TW8A 3WRWA 3HQ4O 1JX6A 3MK31 4WESA 1E2KA 3WGGA 3ZWYA 3H9CA 3ISJA 1E9FA 1EFUA 1TK2A 1K2WA 2ZSJA 3CYFA 2CLFB 3GGGA 4KQ6A 4BMNA 4MGZR 1PLJA 4RIIA 5I9IA 2HUNA 4D82A 3DAOA 1CJTC 1F0PA 2Q3BA 4HG2A 4EB3A 2Q6TA 4C0XA 2HNKA 3K2EA 4P4LA 4CLXA 1UDAA 2FEMA 5K9ZA 3VR6A 1JJBA 4IMPA 1GTSA 3CZ9A 2MYNA 3KR2A 4ITRC 2Q7XA 1MC8A 4NG4A 1C1DA 1RXSA 1VYTA 3EDYA 2IEIA 1W19A 1OWNA 3DF7A 1KI8A 1X80B 3VPBA 3IAFA 1NAHA 5EUBA 4EG0A 3IEMA 4DE5A 3O74A 4C20A 5JXIA 2QN1A 2J59A 2WJHA 4LI0A 1Z6PA 4Y2GA 4QSHA 1AY0A 1CZRA 1KMHA 4PSUA 5IT9A 5ALVA 4H3HB 2BH2A 1WA5A 3USZA 4IO1A 4RACA 3GDOA 1MT3A 3SK0A 5CT4A 3M4YA 4COKA 3ZDBA 4HWTA 1RS0A 4ZYYA 2LRHA 4K1XA 1Z7BA 3K31A 2KM1A 4O2AF 4UZEA 3TECE 1RRMA 4E46A 5AUQA 5CFLA 3G3EA 1Q92A 1TQDA 4H1TA 2QAGB 4IDOA 2OMKA 5EOVA 1ID8A 3EDQA 5EWMA 2FW6A 2XAAA 4JR1A 5JBNA 3KJQA 4HLCA 4IPTA 1UKCA 1O7JA 4LYYA 4ARUA 3PYLA 2GD0A 1NATA 4KE9A 1DCKA 1EH5A 1MDBA 1U3CA 2XOEA 1J09A 3LECA 1MTOA 2IYXA 3QENA 3IEXA 5FI0B 6AT1A 3CX3A 3IAXA 3DCIA 4IIDA 4NIMA 1EM8A 1H3EA 4II3A 5LQJA 3OLVA 1ZHFA 3AM4A 3EQ7A 1PX2A 4D3YA 5BSFA 3A1VA 3NYIA 2C7GA 2VRBA 3ANXA 1NONA 4P3OA 4YBRA 2RH4A 3A9RA 2UYYA 4NOJA 4OKNA 5B2EA 1RXIA 3LHKA 5DF1A 1MC1A 2JHAA 2XVAA 2O57A 5HZHA 1R8SA 2O1SA 2DY0A 4H18A 3FWZA 1E9CA 4B76A 2H57A 2QY6A 3C97A 3CZ4A 2R1TB 4XRGA 1IOWA 1QHHB 3JR7A 1FP7A 2H18A 4KLRA 4TV8F 3PXGA 3E4CA 1AS3A 5AW8A 2TMKA 1ZM2A 4MB2A 3DVQX 1CUWA 2WOJA 3PQDA 2RIPA 3DEZA 4AS3A 5BP7A 4CKWA 4FGKA 4TMXA 4D92A 1W2GA 3SIPA 1KI6B 4IWNA 4EMUA 3A6PC 4RSGA 3R3ZA 3SJZA 5LD2B 4GX1A 1YS4A 4F1WA 5C9ZA 4LF7B 1T29A 1CY2A 1WOYA 3CLRD 5JMPA 1LJUA 1WG8A 4DCSA 1ACMA 2FF5A 3FNHA 2X9NA 4OXKA 1BKYA 2YBEA 1G8FA 3DM5A 3NANA 4RVCA 3NGMA 4C0BA 3EEFA 4CTNA 3A3KA 1C50A 1XZDA 3W2TA 3X44A 4GVPA 5F7XA 3V2GA 3TMAA 2F62A 3GZNA 3H9JA 1GCIA 2I2XB 3HRHA 2ZE5A 1LLCA 1T5DX 5JBQA 2ZDGA 4NU6A 1B1AA 4PZDA 1ZK1A 2WHPB 3UEOA 3TEFA 1TM3E 2UZAA 2AUMA 2Q1SA 1CS4C 3A25A 3MWKA 1O54A 4AXBA 1JPJA 4RD6A 3GAFA 2E0IA 7REQB 1KETA 4CF3A 4FHGA 3RVDA 3NOVA 2EFCB 1U9CA 2C54A 4TM7A 3UMVA 1MOPA 1NNLA 3F6CA 3QOXA 5I7EA 3A2LA 3QJYA 3QHAA 2P9CA 1D04A 4U2GA 2P6OA 4Q37A 2F43A 1X1QA 2YWGA 3AUAA 2OQVA 1DRUA 4EKNB 5B6JA 2PZMA 3DEHA 1X7XB 5JS6A 5H5JA 4ZYXA 2XZLA 4URXR 4E07A 2FWIA 2QI9F 2WHRA 3QNUA 1FX1A 1BGXT 4Q4HB 1KKMA 5E8JA 2GN6A 3KL2A 1BMFA 2WJ3A 4EL5A 5CVTA 3GFQA 1V7PC 3NWJA 1R0CA 1XZCA 2AMVA 4LYEA 2IYUA 5DTJA 3P96A 1GD1O 3TNFA 1QH1B 2EFYA 4HAOA 5A3RA 3T5PA 3BXXA 4ZKDA 2E6UX 3RS0A 3AVOA 2Y67A 3C4VA 4RPIA 2W2XA 3I28A 4GM4A 9ABPA 1GTL1 2QLMA 3DPIA 2JLYA 1J2JA 4QBFA 1EFRA 3TZCA 3NT2A 4IVPA 4B32A 3A3PA 3RSHA 1RSZA 1K8XB 2OC9A 5ERGB 4B7ZA 1CC1S 1U5CA 3UK2A 4BXOA 2ZIUB 1A71A 2DT8A 2WIGA 1LRKA 1OBHA 3V42A 4XVCA 1MQAA 1N0IA 1T8YA 3DZ8A 3PNKA 4BLSA 1NM5A 1R88A 2YY6A 3CS3A 5AW0A 3WAGA 1JV2B 2PUCA 2VSXA 2VIIA 1OLSA 3DE0X 3EVEA 4W8OA 1JRLA 1KKLA 2B92A 4P5EA 5JJ5A 3OX4A 3W05A 4PONA 2ANCA 4PS0A 4ZOBA 2YZNA 2R6JA 4BU1A 3VTZA 4CMGA 4ZI7F 3UC5A 4D8XA 1BOOA 3M2TA 4FFVA 3SHFA 2CL5A 3OEED 3U17A 4A6EA 2DFTA 5H9WA 4TSRA 3OSUA 4B8YA 4DXHA 1XMJA 5I7OA 1GNVA 1FLDA 4XARA 5FNZA 3ICWA 1LH0A 1N3YA 3B2NA 3INNA 2YOGA 3ZZMA 5IPFA 2W42A 3I6ZA 5JAQA 1YD7A 2HQOA 5IDYA 4EGSA 2O5VA 3LPMA 1J2UA 1FYEA 4OHZA 4HLQB 2AN5A 4QUKA 4URUR 4ETIA 2ZTHA 4DMLA 2EG9A 4P22A 3RVPA 4GWGA 5IVDA 3PC2A 5B1IA 4PZUA 4QX6A 5JAIA 3E1SA 4KLNA 1HUQA 1U0BB 3KZOA 2VQ3A 4QGHA 2VUHB 4DBLC 4X1KA 4TWIA 1GSHA 1RWOA 2Y93A 2AQIA 2PR7A 3UOGA 3DZIA 4RIFA 2WW8A 1SKQA 4W1PA 5EFZA 1G2QA 3UK7A 2XF2A 1Y7PA 4FLMA 5FBQB 1P2SA 2ZCUA 2C94A 2PGIA 3OTHA 1Y5RA 4RKQA 1X8LA 4Y6GB 4D4JA 1E3EA 1C3LA 1P2GA 2AOVA 4FHZA 4JBIA 3FDIA 4EG3A 5C3MA 2WJ4A 4EB6A 1I7PA 1YXMA 2P90A 3Q0IA 4JSTA 1NMSA 4GHWA 1OVGA 3REFA 4AQDA 4EHBA 3DZHA 5LYJF 3O73A 3G5MA 4UULA 3ZD6A 3UTDA 4FB5A 2XYQA 4K9MA 4EW6A 1FQJA 3GCXA 1BS9A 1FP6A 1L5HB 1WKVA 1T9KA 2ACWA 2D4AA 3AKDA 3IUMA 1TCAA 3L40A 4W63A 4D8WA 4QREA 2JLVA 2JLQA 2TMDA 3EUEA 2YV4A 3UV3A 3HSSA 2IZ5A 2PV7A 1FRZA 3IVGA 1OF1A 5FX2A 2ZJ6A 2J0EA 3NBZC 4BVGA 2J6CA 3SNKA 4Q6BA 3J81A 1QRSA 2VZ0A 1F2UB 2AWNA 4UNIA 2BAGA 1HM5A 2FWRA 4M9CA 3ZZ0A 2F3RA 4QFDA 3GZJA 2IUFA 1N34B 2IUYA 4R1LA 3TSWA 4A0HA 5H9VA 4EGFA 1Z38A 1Z0FA 5M7EA 3BHNA 4MV6A 2HY7A 1B7GO 2HBRA 2KPOA 3FB4A 1YJAA 5HFJA 1NQUA 4PCUA 3W7VA 3UA4A 2G5CA 3INGA 4NZYA 3U4GA 5D6NA 1P1RA 4EY5A 5A3JA 1MTZA 2BBOA 5TF0A 4YJHA 5IXJA 1TKAA 4HDKB 1MHPA 3ZDDA 3D3EA 2YMLA 3F7OA 3O8BA 1MAAA 3KLMX 3A26A 4FIDA 5DPMA 4JELA 1PEKE 4TX1A 3KS9A 3QOWA 4R8VA 4JODA 3Q3IA 3GH1A 2VHZA 1GVNB 2EKPA 2GJ9A 5DYIA 5FHQA 5ILGA 5FWDA 4REOA 5J40A 3VRHA 1RHJA 2XADA 3AETA 3EG5A 1AGXA 5KAMA 3H11A 4CTMA 4MGYR 3RWBA 3E9RA 4GPD1 3TLZA 4BKOA 4CTJA 5JXJA 5DGCA 1ADFA 1CWUA 2G0NA 2R8OA 3T5GA 3FNEA 4J6EA 5K45A 2E6KA 4PG8A 1H2RS 2P41A 4IJKA 4B4VA 4UU1A 1TQ8A 4BTVA 2M6KA 2Q4EA 3ZK7A 3W6UA 3EZNA 3L8EA 4DSZA 2HSZA 4LNHA 3CE9A 5LP6A 1DKUA 3D0QA 1ZGCA 1IZYA 2ZIAA 3JQFA 4QU8A 4KFSA 2ZLBA 4L8LA 1HDRA 3RH0A 1RC1A 3R5XA 3FDFA 3FPCA 3NC0C 3OZAA 1OGYA 4IICA 4M83A 2XNKA 4PBSA 2X0NA 4QG7A 4BAGA 5KYTA 3B3JA 4AKGA 2XWSA 4H60A 4AJHA 1DT3A 1RWBA 1Z7WA 3PTLA 3EIEA 4N12A 5HJ2A 3UO8B 3ZCPA 1N9GB 1T0IA 3L8GA 4V1CI 2HIGA 4G07A 4Q48A 4P9NA 1CR1A 3HTXA 1Z36A 3OIGA 4PLCA 2W2PA 1IY8A 3RVOA 4N82A 3F90A 3CCFA 3VPGA 1UK7A 2F1HA 3HLKA 1NV9A 1ZD2P 3IIMA 5EHXA 1E3TA 2HCFA 4PIMA 1T9CA 3A1UA 2CY0A 1QAOA 2J6HA 4KGVA 1G3IA 1UJCA 1ORIA 4WACA 1ZH8A 4M22A 3AEUA 2PCJA 1JSZA 2H1CA 3JQ9A 2JH9A 1AG9A 3WKDA 1KO1A 1FMFA 2G06A 5GAJA 2JFWA 3QLEA 3KETA 1E6LA 2WJPA 2QX8A 4NE7A 5DBOA 4B44A 1A0OA 1JG1A 1RBMA 5GOTA 2OA0A 4D4GA 5ESWA 1TD9A 4B4KA 1QZXA 1WQ4A 3BMQA 5KTKA 1JZQA 4NBRA 2PSDA 1WUJS 3ZWKA 4QWMA 1U8TA 1VI2A 1HQYE 1L7VC 1XDGA 1QCZA 3S7TA 5CYFA 3ROXA 4KIUA 4GICA 4IDGA 1YFLA 2SCUA 2QDKA 4WW0A 3LF2A 4JX8A 1G42A 1W25A 4PR3A 4PV7A 5HS6A 3OOYA 3I3OA 1RAEA 3CKLA 4DNPA 5INTA 4FYMA 3EGWA 5CFRA 4C0HA 4RZ2A 4CL8A 2N0SA 1J4AA 4AY4A 3HBAA 1I4EB 1CR2A 2ZWMA 4YCDA 2D5IA 5K0LA 3QPDA 3V7WA 1MAHA 3IQEA 1VL0A 2HNBA 4IXNA 2GBFA 1VPLA 3HZOA 3RRZA 3W6OA 2X0EA 1OZGA 2C03A 1GR1A 1AUQA 2ZS7A 2XCOA 3MJHA 1OZ0A 3N2ZB 4M37A 2JIPA 4JJ6A 4NABA 1UFQA 2NO5A 4N6GA 3WS7A 2ZR8A 3PRJA 3COVA 1OXVA 4QU0A 3BQNB 4IIXA 5ESRA 1WV1A 2W11A 5B57C 1TUBA 1L9KA 2A30A 1ZUHA 3KB6A 3ER6A 1IN5A 3ET5A 5HR5A 4FCWA 1XDSA 1GGNA 4EAQA 1ZIOA 3THOA 1LSOA 3LWDA 4X7BA 3U19A 3HB0A 4IRUB 4DR1B 3CC8A 5DCYA 3NFRA 3RSQA 1B1CA 3MOIA 3ED5A 5CB4F 1MJGM 2WM3A 3HEAA 1GL6A 4EENA 2CK3A 1MXHA 2P6RA 3FPBA 4KVFA 3C3MA 2ZJ7A 3A10A 2OHFA 3VR4D 5T7BA 1A4UA 3DLCA 3CVOA 4X44A 5I7FA 1ZIYA 1N2SA 3RBAA 4LJLA 3TF5A 2DAPA 1QYWA 2R8YA 3CJQA 3FX2A 3H4TA 1RR6A 4RV9A 4W9NA 2H8GA 4CMCA 1W88B 3CUVA 1IHDA 4M1MA 4R8SA 2MYUA 2O8CB 2CDBA 2B3DA 1FQWA 5BN5A 4JVSB 3UGTA 1VE1A 5IAKA 3GJSA 3K1YA 3B1KA 4RMIA 2EX0A 5BYBA 4IJQA 1G8PA 1GLGA 2QD3A 1N3BA 3ELUA 1ZRHA 2CNOA 2JFBA 3VDQA 1JG7A 3EDCA 2ONKA 4TMKA 3UQZA 5A02A 1VPVA 1IC6A 1J33A 1PFWA 2XWPA 1GSOA 4JVLA 4L8YA 4NFSA 3VKUA 4AO6A 2YRFA 2IXBA 1RI3A 3IT3A 1V11A 4K6HA 5DT9A 1DG3A 1ZOLA 1ZITA 2LCQA 4B7AA 2LCIA 3W79A 1GPDG 3PFWO 4YXFA 2ID7A 2X86A 2R25B 2ZYIA 5KCMA 2B21A 1Q0TA 5U4XA 2JFNA 1P7YA 4GPIB 1PLKA 4KVGA 3RJ9A 3IC5A 4EB6B 2UYCA 1C3EA 4YEDA 2Q9UA 3UUGA 4BASA 1Z0JA 3R7WA 2G1PA 3JAKB 4TWZA 1LEHA 5L4NA 3DGEC 5LQMA 1YUBA 2O5EA 1KJNA 2XNHA 3PC7A 2XVZA 4P3PA 4WNIA 3D0KA 1RPZA 4XX1A 1UZAA 1X1BA 2CV2A 1W34A 3M5WA 1E9EA 1T4CA 2ZB8A 4YRTA 5FL7D 4MV3A 2Q6VA 2C97A 1WJGA 4IHKA 5ALFA 3U7JA 5IULC 4NATA 1KYVA 2YX1A 5B1YA 1W0JA 2WHXA 2XE8A 4AIIA 1B0AA 2VJPA 3O3OB 4LJ9A 1PV1A 3O84A 1UADA 4C87A 2LP4Y 3O4IA 4LOKA 2AA3A 3TQFA 1R5OA 2IT1A 3HKEB 3MJDA 5KAPA 4OJMX 3KQSA 4N3NA 4PFSA 3BJIC 3U7RA 1NVVQ 3G49A 3LBFA 1JPVA 2WWFA 2YHIA 5JCXA 1HOTA 5IARA 1KY4A 2DLDA 2VHTA 4GLJA 5D5PA 2C2WA 3GAZA 1I1HA 1EWQA 1QIHA 1SUAA 5HUQA 2DR2A 1JW9B 1GQQA 3USCS 3RW9A 2GZMA 2HIMA 1E1KA 1X1AA 4Y1FA 2XUOA 5EJ6A 3NBXX 1UCFA 3NHAA 3G9ZA 4IRXA 1LV8A 3IB3A 4HZUB 4RZUA 1TB4A 1TGVA 3CRW1 3MUEA 4ND3A 1O97D 1Y34E 3IQFA 3R6WA 2XUQA 5H83A 2W2TA 3FTFA 2HF8A 2FN4A 2VYVA 3K70C 4EGQA 3ON5A 4URVR 2FEPA 2X1HA 2XMSA 1YZKA 2XOKD 3JATA 4FFLA 4R2JA 2VAVA 3ZYCA 3M4XA 4Z49A 3IEVA 1C1YA 1Q7BA 2PSSA 4Q4LA 2OLKA 4XUEA 4GUDA 4P98A 3GCGA 2G1KA 2X6RA 3DBHB 3VKFA 1H2BA 1RYMA 2OYSA 4FGLA 4YRBA 1E8DA 3UUEA 2BEUB 3HYNA 1N2CE 3BMNB 3P0FA 5FQOA 4OI2A 1IM2A 5F51A 3SMQA 5K0EA 1UQRA 2JAWA 4QJ3A 1W76A 1VA5A 1DAIA 2ET6A 3LVFO 3VU8A 5AW1A 5GINE 1SZJG 3NYRA 2YHBA 1KJWA 4OXIA 4RJ2A 5HK8A 3MEQA 1WBBA 4ZWNA 5BPFA 2I4IA 4YHHB 4XE5A 1HY3A 3NNSA 4CCYA 3AEKA 5KNBH 2QZSA 1KZGB 4JVOA 3OG9A 2EKLA 1E2LA 3MCTA 2ORWA 3K0KA 2XOKA 4IOKA 1BDJA 4JI1B 3RNLA 4NWIA 2YWDA 5JG7A 4HPWA 1L8QA 3C1UA 1QE3A 4DNQA 4TZ0A 3CWCA 3K9QO 4LX8A 3ZHZA 2NTEA 1IHXA 2C84A 4P34A 5I47A 4I5DA 3IQGX 3KP1A 3QEKA 1GRRA 2YZ7A 3EZFA 5E7QA 3ZHUA 5JLJA 1DHTA 2JGAA 2XB2A 4ENQA 2ISSD 1O9BA 2Q27A 2JJYA 4YCBA 3KBOA 3B6KA 1SQSA 3EQ8A 2OK8A 1CJBA 1J8FA 2EWWA 4OTZA 5F1PA 4NVRA 3RHFA 1C29B 1I4WA 1XPJA 4F4HA 1OE0A 3EA0A 1R37A 2Y99A 4II7A 3E18A 4O2BB 4ZPJA 1T2EA 2EFDB 4J7CA 3UXMA 3LWZA 3MRXA 5FJIA 4UPDA 1VBKA 1DKPA 4FKMA 1LFDB 4IH1A 2PAFA 2V0GA 4UM8B 1PQWA 4ENUA 1HE4A 1M10A 3K5WA 3KSDO 5EJMA 4ZGBA 5C8DA 2FZCA 1A4IA 1OFIA 1YR1A 4DLPA 2VCEA 3JRXA 2K7FA 4ZJYA 3EH1A 1JFRA 2FSFA 1JDTA 4OI1A 4L5JA 4KXLA 4RY2A 3N8HA 2WUVA 4UATA 4DLWA 3LUAA 2J9FB 3QPAA 4OUKX 4YT8A 5EJ8A 4R0VA 4Y3UA 3D4BA 3PI7A 3QW4B 3AU9A 1N4AA 3WI7A 5ECWA 4JL6A 5IJ0B 5JNUA 4INAA 3GLHA 3AI2A 3K05A 1GUZA 3TTUA 5CXQA 1QVZA 4QA9A 5EZQA 3T7AA 4KPEC 4XVHA 3H18A 2EGUA 3TGPA 2W6ID 3OU6A 2OXEA 3GNSA 3CVJA 3JYHA 5IF9A 3GR6A 3TG2A 4AJIA 2NN3C 2ZE6A 3JARB 4OXYA 5AM5A 4KITB 1DUVG 1V7ZA 2B4TO 3Q3CA 3OF2A 2RH9B 4NEQA 4OBBA 5HGXA 1XR3A 3M83A 4ND1A 3ZN2A 1CB7A 4ARBA 1EQ2A 5A9SA 5AO9A 2I1WA 3P5BA 4HN4B 1UJNA 1E9VA 1NC3A 1OSNA 4BMZA 4AN4A 2J0SA 4NZNA 4EL0A 4O0MA 4RTSA 3FA2A 3F67A 3N86A 1ZD4A 4U00A 3NCTA 3REGA 4EQ6B 1HZZC 2AXNA 4MUEA 4BE9A 2IBTA 1R6DA 1PK7A 3BG5A 3NVAA 5A5VA 5KX5A 4XM2A 3BMCA 2V96A 5BUCA 1GNTA 5AVZA 2ZB7A 2FCRA