4JQOA

Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with citrulline and inorganic phosphate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
338
structure length
338
Chain Sequence
QSNAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
rcsb
molecule keywords Ornithine carbamoyltransferase
source organism Vibrio vulnificus cmcp6
molecule tags Transferase
total genus 133
structure length 338
sequence length 338
chains with identical sequence B, C
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jqoA01
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jqoA02
1D09A 1RAIA 7AT1A 4F2GA 4FYXA 4AMUA 4JFRA 3M4JA 6AT1A 1TTHA 3GRFA 2YFKA 3M5CA 1I5OA 1TU0A 1RAFA 8AT1A 3NPMA 1VLVA 3L04A 1R0CA 2FZGA 1XJWA 3R7FA 1FVOA 3E2PA 2AT1A 1RAAA 4KH1A 3CSUA 4EP1A 1FB5A 3UPDA 1EKXA 4WTOA 3AT1A 5G1OA 3D7SA 3TXXA 4E2FA 5G1NA 4JQOA 1SKUA 5AT1A 4FYYA 3R7DA 3KZOA 1RADA 2OTCA 1ZA1A 3KZMA 4F04A 4A8PA 3D6NB 4AT1A 4JHXA 4BJHB 1OTHA 1A1SA 2BE9A 1DXHA 2BE7A 2EF0A 8ATCA 2QG9A 3MPUA 1PG5A 4KWTA 4AM8A 1RAHA 4KGVA 2H3EA 1JS1X 1RAEA 4H31A 5ILQA 3TPFA 2FG6C 3Q98A 4KGZA 4ANFA 3KZNA 1NBEA 2HSEA 3KZKA 2G7MC 1PVVA 2FG7C 1ML4A 2W37A 4A8TA 2RGWA 4FYVA 4FYWA 2QGFA 1AKMA 1C9YA 3M5DA 4IV5A 2P2GA 1R0BA 4A8HA 3R7LA 5G1PA 3GD5A 3KZCA 1ZA2A 1ACMA 2I6UA 1EP9A 3SDSA 1RABA 1DUVG 4KH0A 9ATCA 1RAGA 2AIRA 4NF2A 1AT1A 3M4NA 1TUGA 2FZCA 3L06A 2IPOA 1Q95A 4EKNB 2ATCA 1ORTA 2FZKA 3L02A 4KGXA 1F1BA 2A0FA 4OH7A 1RACA 1EZZA 3L05A 3LXMA
chains in the Genus database with same CATH superfamily
1XKQA 4C4ZA 2K2WA 1K9VF 1QP8A 1ZGZA 2ATVA 2BJWA 2H6EA 2J9XB 2XCIA 4MJ3A 4PLTA 4WK0B 1WSWA 3A1CA 2ZUVA 3IRVA 4RL6A 3L6CA 2QZ9A 2YVKA 3V6LA 3TOCA 1E0AA 3KKNA 1OTYA 3TI7A 3N3BC 1CUZA 1T26A 3I4FA 1L5SA 3PHCA 2ETVA 2R4QA 1QNFA 3SS8A 3IPRA 4KEAA 1SULA 2X1MA 2IX3A 1PFKA 3FSJX 1PDVA 3KLOA 4DCGA 1YL7A 2UYGA 3MS7A 1RBQA 5C34B 4YACA 4DJFC 4GDMA 4AY2A 1W6RA 2VYVA 5KB3A 3PEUA 4RZIA 3S0JA 2NIPA 3FYCA 4FFBB 1J99A 3NNNA 1XA0A 1O1YA 3U3XA 4N1AA 1A9TA 1KJ9A 4NG4A 1JPNA 2BT4A 3PNYA 3D6FA 4RK0A 3ACCA 5CTAA 3JPYA 2Y68A 1HOTA 1P60A 2Q0SA 4MWOA 4WCDA 3OQMA 1AKUA 2P0YA 1Q44A 2PTHA 5AT1A 3NIDB 1J2TA 2J5QA 4GD3Q 3IOYA 4LYYA 4UBJA 3JYQA 1AN0A 1B26A 3AHDA 5FTKA 2C98A 4ESOA 2D0IA 3H1PA 1T0IA 2ZCJA 2BZGA 4NOMA 5JS8A 1I7NA 3KZVA 1KDTA 1SK9A 1VSBA 3TRHA 4ZDIA 1XNHA 3HGQA 2DHRA 1HEIA 3PHJA 3O94A 5FOXA 4C5AA 5IJXA 1ZM3A 4LBYA 5IDWA 5TX7A 2C99A 3GI1A 1NVEA 4B3TB 1UBRS 4BQQA 1YKGA 4RM3A 1A9PA 3B85A 4KUHA 1EUDB 3T7RA 3ELYA 1SCUA 5K20A 3OEED 4K6FA 1NUAA 1VFPA 4BAGA 5ECWA 4I8XA 3U13A 1AA6A 3AF2A 1ULUA 2Z3ZA 4I0WB 1RWBA 1F0KA 3QENA 4M0DA 1ETHA 1CHDA 4QLBA 4E3WA 1QG0A 1A5ZA 1J00A 1PJRA 3QE9Y 3AEXA 2IJGX 3IDZA 3TM5A 2ZJYA 4JBNA 1MAVA 5EYPA 1ZJ4A 5KVAA 2QN3A 1WXGA 1OH8A 2A9VA 4YV1A 3T34A 3WL7A 5LKRA 4M0KA 1D8TA 4DA6A 5JD5A 1MO6A 3AEZA 4OHYA 1DTSA 3KR1A 3TBFA 2GB4A 3RHZA 5EWLB 1KARA 3PI6A 4KREA 3UBMA 2E4WA 1GFWA 1VI6A 1E9RA 3AUJB 4F2HA 3W5SA 5EJFA 4CEIB 1TM4E 2PGNA 3IR5A 1RJEA 3L4BA 3OEEA 4G1FA 3IP9A 3E3LA 4NV3A 4W63A 2H0RA 4ZV4A 1JDPA 1YJBA 4K03A 4PNPA 4YAUA 1KZGB 4HQ6A 5JMPA 1NN0A 3GLHB 3HDQA 3DKKA 4XR9A 5EE9A 3SYTA 1HKHA 2Z98A 4MQLA 4HOYA 4CL8A 2IXAA 1YTUA 4LDQA 4CKBA 5LN1A 3GMTA 3HZZA 5A6VA 3SDSA 4NU5A 4BBPA 1SEPA 2Y0EA 1S4MA 4YP7A 3WLPA 4PX3A 4RJJA 4AURA 1P5RA 1PUIA 2AIRA 3C48A 4KUEA 1Q1NA 2EGHA 1JHPA 3QIAA 4PIPA 1T9GR 2GVNA 5BVGA 1DUIA 5A9SA 2ZR8A 1JEYA 4EY4A 3VAZA 1SBCA 4M9ZA 1P91A 3FLBA 1FPQA 4C3VA 5KSOA 1OFUA 3QZUA 4PU0A 2IHYA 4C43A 1UDAA 1GCAA 1KU0A 1JB9A 1ZUNA 4OHVA 4JB3A 4CR6A 4F3KA 5CPFA 5AIBA 3FOEC 1M5TA 4TLMB 1SNYA 2FDXA 4I4IA 3SZMA 4GKVA 3Q8LA 3P2JA 1GXSB 4M9XA 1XCBA 3DG9A 2GM5A 2NVUB 4UUNA 2X7JA 2GNOA 3AKYA 4ETIA 2R2AA 2IOFA 2FW1A 4A0RA 5IWCA 1FA9A 4YAFA 1AF7A 5FKJA 2HY7A 4A0SA 2JHCA 1X1EA 4UFNA 4ZU1X 3S29A 2VUSA 3FSGD 1EA7A 1D4OA 1FSGA 1QX4A 2HK7A 3N6RA 3CE6A 5TR9A 5BMVF 4NWIA 4FI3F 4BIMA 1QRDA 2JHPA 3E22B 2H17A 4JSYA 4UD6A 5DNWA 3CW8X 5CBPA 1M8PA 2CDRA 4OSPA 3RYFA 3SOZA 4CLOA 4XWTA 4BGIA 3CQ9A 4HVTA 5KYWA 1CTQA 2AMLA 3KB8A 1WIWA 3BDIA 3M34A 3SXUA 2A0WA 2FWAA 1D2RA 2PL9A 2Q1XA 5T57A 4DPKA 4E5UA 2BEVA 3AR6A 4DJDC 1Y4AE 5JMOA 1FFBA 2RGAA 3M2PA 4F92B 2REQB 3FNIA 4M54A 4PZDA 5DF1A 2ZR7A 2QB5A 2XUJA 3FSGA 3GNQA 3CXUA 1YUNA 2W98A 3GRZA 4AJ2A 5J2TA 1KO8A 2Q1TA 4L5JA 1HQCA 3TN7A 1TGYA 1RP7A 1BX0A 2G72A 2SICE 3EA0A 2F90A 3I9V6 3OZ7A 4FR2A 4XH9B 1BDBA 2JGNA 3E53A 1Q19A 1K0FA 4RVSA 4J9UE 3VVBA 2JL1A 2VUHB 3RRNA 5EC8A 1I9GA 3R0XA 3QPWA 2PGLA 2QG9A 4DREA 4JI4B 5GM2A 4FGJA 3IQGX 4CJXA 4OK5A 4PC3A 2Q6OA 2HPHA 3V1UA 5LQNA 3VO1A 3LFUA 1SURA 4DV3B 4LZAA 1E9EA 1M34B 2ZT6A 4K05A 4E4TA 5C7IO 5CA1A 3TG8A 3U7FB 1GZUA 3RRFA 1XQVA 1EXMA 2EP8A 3TPFA 4Q3NA 5G41A 2CHUA 2ZJOA 1BS1A 1U3FA 3TRIA 3V42A 2CV0A 5EY5B 1ZH6A 1B8UA 4TYYA 1C0LA 5BSRA 1U0EA 3UM9A 4Z7OB 1P5JA 1FYFA 3ND8A 6REQA 2NZYA 3HV0A 2OFPA 3AI1A 3DUFB 2FEAA 4H1VA 1ZR4A 3D64A 3ZWKA 5JZ9A 2OT3B 3LKZA 5L7TA 4IDHA 3QPCA 1X1QA 2V3CC 1V6AA 3HB9A 2R6FA 4G0NA 2J8ZA 1IM8A 1KC3A 3BXFA 1AC5A 1NE2A 3OJWA 4RHCA 4CMGA 4D92A 2WAYA 4M8IA 4PYNA 3IUYA 1JBKA 5IJZA 2O0LA 5SYNA 2HPZA 4X20A 1GEGA 4IEIA 2OSBA 4R9SA 4C9BA 3BMNB 3TD6A 1EK2A 2QN6A 5FCDA 1ZL0A 2AN9A 3PUIA 3OOEA 4OD0A 4DHWA 2BFAA 3UATA 2Q5IA 1BXGB 2I8LA 3CU5A 3EXEA 1WZNA 2PLFA 3DKRA 3JZAA 3KB2A 3MYRA 2C5BA 2EARA 1R9JA 4TMWA 3UB2A 2FY8A 3AZPA 1IFXA 3DKPA 3OIUA 2QV0A 3DAGA 3MWYW 4OHFA 1L5FA 4X1KB 3G2QA 3ZJ4A 4HYYA 2JJ8A 5CB4B 2ANBA 2PMWB 4CTKA 2ATCA 4HRYA 3WLLA 4ENQA 1LLDA 4ZCMA 3SYKA 1T4BA 4HH1A 2PIDA 1VSVA 2UXBB 4ZC1A 2YHBA 3WLRA 4O2BF 3OH8A 4K9MA 1QQ5A 4O8CA 4CR8A 1ZJ5A 4NEGA 2GQ0A 5FD8A 3D31A 3Q5DA 2E4UA 2P3SA 4J4BA 5FTLA 3OLXA 3TZHA 2X0JA 5HZHA 2ABWA 1PJCA 1QZZA 1YXMA 4M83A 3U56A 1RZVA 3ICOA 2C57A 4JEHA 4IICA 2W43A 2NQ2C 3PD1A 4LXTA 3TOZA 4QKQA 5K6AC 4DMUB 2VQFB 4RZ2A 3A3PA 1E6KA 3L04A 3TQSA 1V9LA 1NBIA 2DFNA 2FWMX 2XAAA 1LJUA 2NNWB 1ZZGA 4HAXA 4DLYA 5CEEA 3GVXA 4V0QA 3COPA 3F2VA 4CCAA 1J4AA 4G0VA 5IM5A 4IQ4A 1EVZA 2XE4A 3RVKA 4FTWA 1AA9A 3VO2A 4L8VA 2G70A 3IIEA 1CNMA 2HR1A 4F72A 1ZMXA 2ISCA 2GM9A 4RV5A 3ASYA 4Z9BA 4U7FA 3FIUA 4EO9A 2OTCA 5FFNA 2HL6A 4ETMA 1WW2A 1OZHA 3DC7A 4IHJF 3T7JA 3QLUA 1FUKA 1XOIA 5B7PA 3IEVA 1B16A 1TJPB 2H5IA 3CSDA 4U7HA 3QVKA 3SEAA 4TXNA 3FOZA 4IJMA 3CVWA 1N75A 2H1HA 2J3DA 1WQ1R 3A4LA 5DBEX 2GAAA 4DLBA 1MENA 2ORYA 1JTVA 3D6AA 5AJYA 1Y42X 3DV2A 1X13A 3VNVA 3DDZX 3ND5A 3EOZA 1U8EA 2YDXA 4I9GA 4Z8YA 2E82A 3STTA 5C52B 3RJMA 1MPTA 2IXEA 5JEDA 1XB2A 5FNZA 4CKZA 4DR1B 1H4VB 2QN1A 4Q4CA 1Y1LA 1QK4A 1L5KA 3FMVA 2F1KA 4E07A 2BFFA 4OFZA 3CPHA 2EU8A 2QIOA 2YWJA 5L3RA 2NSYA 5BXYA 3VOAA 3NAMA 2E6KA 4KWEA 1S4QA 2DMRA 4TTTS 3OQHA 3ELUA 2M6RA 1CUIA 1GTL1 5C1BA 2HSEA 4FW8A 5AVKA 2I78A 2W6ID 2PFGA 3I83A 4JXXA 4XIJA 4BUJA 1S5PA 5IAGA 4R5HA 1L7XA 3WQQA 2FG7C 1CRPA 2D62A 2PWBA 3W05A 2IT1A 4QDOA 4URHA 2JIDA 2P1ZA 4BCBA 1QGZA 2ZIZA 1U1FA 3WLIA 3HKDB 3FWHA 1ULSA 3C45A 3SIRA 3BGWA 2H4XA 2VBCA 3L07A 4I55F 2QXUA 5FBHA 1E3TA 2WIDA 1Q84A 1HSOA 5H4HA 1SY7A 2P6PA 2EJUA 1BYIA 3PITA 5KMGB 1LI4A 2XMZA 4HWOA 1XPRA 5EZSA 3TTWA 4OKNA 1R5JA 3E9CA 3H2BA 2HK6A 4XLLA 3UKJA 4BFVA 1C3LA 4BWGA 3DZHA 1Q11A 3W2GA 5EKTA 2W6IA 5IYZF 3HN6A 4H7PA 3C0KA 3EWIA 3TDMA 1SVSA 2G8LA 2H4YA 3ENQA 3REQB 1XMJA 4BPBA 1SC3A 1Y1QA 3BN3A 2FJUA 4F6LA 4ZVMA 1CIVA 1JU3A 4X95A 5ALDA 1C9NA 2P9CA 3MXOA 1XTVA 2K87A 1TM1E 1N8TA 2I1WA 1E1MA 1KVTA 1ZOSA 1ZRNA 3IIJA 5NULA 1A8IA 1DC6A 1RQNA 2D2EA 2GDZA 4D56A 5K2OA 3OPXA 4P5EA 5G0WA 1M6VA 4ZGWA 2IPXA 1TYAE 4RTJA 1NDHA 2WNHA 3PF9A 1NFFA 2AB0A 3CJQA 4GZ3A 5CJ2A 2DQSA 2JJ1A 3IQHX 1K1EA 3R09A 1FSSA 3UJ3X 1WOYA 1YDHA 5K8UA 1VPTA 1P0CA 4FDAA 4U7JA 4F7DA 2ISQA 5JASA 3Q0TA 2C82A 4S2UA 5C8YB 4FBMA 4RLFA 5AW7A 1Z7GA 2P68A 4X66B 4HNAA 2ZP1A 5CT8A 4C01A 3I8OA 5K3EA 3RABA 3T1NA 1LW6E 5GADl 2B1GA 2GZDA 4PZZA 4AF7A 3IURA 3P26A 1U2PA 3M8KA 2Q5CA 3EDOA 1LSUA 2PRIA 5JT1A 2OO5A 3K2IA 4BO7A 3WGMA 4NU6A 4YPFA 4J03A 3FCEA 5BSEA 4UTZA 4IF6A 3TSYA 4MV4A 1P2DA 2CFCA 2WVHA 1LY1A 1G8PA 1GYRA 1XRNA 3ITEA 5G1OA 3TBKA 3D7SA 2G5PA 4PCAA 1UXKA 3MRXA 3WDKA 2E4AA 1RXUA 5EERA 3RV4A 5BRNA 4CBVA 4NYMR 3C4QA 1U3WA 2CHVA 4MX8A 3DZJA 2OBMA 4Q4JB 1E3WB 4RVDA 5T8KC 1REQA 3IKLA 4EY5A 1DAGA 5C8VA 3MBKA 3MCAA 4LJAA 2HDWA 1QUFA 1NYRA 2M6SA 4BDSA 3QVLA 4WLVA 2QTTA 5KNDD 4F56A 2O2DA 1XZKA 4QM7A 4IGEA 1U2QA 1YIAA 1N5IA 1T2DA 3TSAA 1PZHA 3EHDA 4GYYA 1XD8A 3PEYA 2WFLB 2O5RA 3EG9A 4MV3A 3F47A 4OJKA 3N2KB 3OMXA 3P2YA 4G5RA 4JUBA 4D6XA 3PWZA 4QXRA 5I4IA 2RONA 5KIAA 1XDBA 3TNFA 2OCAA 4KQHA 4S3MA 4DQLA 3LG2A 2J59A 3U60B 4EB6B 3I1FA 1G18A 3PXBA 1X7GA 1UT5A 4E12A 4AX4A 4B6OA 2B4AA 1GYPA 5H3HA 4ZCRA 2X8AA 1PFQA 1ADJA 4Q3EA 4KZPA 1Y3AA 2ZUEA 1DCKA 3PD7A 2ZCVA 4E51A 5JZBA 3PK0A 4X3CA 1OWPA 2X2EA 3G0GA 4E5PA 5LB4A 4D1YA 5JALA 3QU2A 4IILA 1Z37A 3D81A 5E1MA 4JA0A 4MQFA 2XTJA 4GOKA 2OAGA 4CM4A 2XQVA 2YQ5A 3ZJYA 5IZCC 4A15A 2N1BA 1PLLA 2J0EA 2PPVA 2VHUA 3F8SA 2R8EA 3QP9A 4TMZA 3GT7A 1E2HA 1MG0A 2QVCA 5JTTA 5KPDA 3BF8A 1KMQA 3QKSB 1V45E 4FZRA 4UHJA 2AJBA 4XFKA 2FSFA 2PS9A 5DGHA 4RVUA 1O4VA 3GZNB 4DR4B 2ERCA 4TMXA 2AX4A 1T9HA 2IHNA 2QD5A 4RJ2A 3ZZ1A 1NAIA 1N2OA 3FPCA 3ZLTA 1C0PA 2UYCA 3L06A 2DF8A 5HJ2A 5K8JB 1QKKA 3QU4A 3UH1A 4C7OA 3DW1X 5GJVC 3LNTA 3NVKI 2GA8A 3RF6A 4IDEA 2YKGA 3JQAB 4KTVE 3R7BA 4R0MA 4N65A 2FEXA 2VAWA 1Y7IA 1R12A 3CZ9A 5GONB 2RMKA 4LQCA 1N7JA 4ERXA 3HJNA 5DYTA 3IUBA 3I4LA 1WMFA 4BP8A 1CFZA 1A5BB 3DBLB 3DKIA 3GLQA 4G0PA 5GJCA 2W70A 1N2ZA 1ZVVA 1E2BA 2JFHA 3HLTA 4L4RA 5CH8A 5TJHA 3EEYA 2HF8A 3LUHA 3L5OA 4F60A 2Q0XA 3AW8A 1PQWA 2FKAA 3CRW1 4FSHA 2I87A 3VKFA 4D7AA 2OHOA 1MABB 2PBRA 4KO3S 4MVJF 4RPJA 5IN5A 2HA0A 2HJWA 4EA9A 4MMXB 5ALJA 5I5GA 4G9BA 4HTFB 2PWZA 2IEGA 3NH6A 3RTGA 2PXCA 3THRA 4EEZA 3HSYA 1LNSA 4OFBA 1OYVA 1V3TA 1OXBB 3LC7O 1N0HA 3WA7A 1VP9A 1Z2OX 4HK4A 4AG5A 2C7PA 4DZZA 3EXG2 4QELA 2ZAOA 5BWOA 1G3UA 2BIFA 3GCWA 4TLDA 2QX4A 3GUHA 1EDEA 1EDZA 3PNKA 3PQ4A 5L3ZA 4KLZA 5FIUA 4Z54A 1DFHA 1RI1A 2NG1A 2XV1A 1JA0A 1E64A 2OM6A 2Z1NA 1JR4A 1SZDA 3MEQA 4LISA 3SSNA 1A1SA 3MYYA 1UK6A 4H9GA 2C20A 1OWMA 2DULA 3IMCA 1L4LA 4CODB 1WB4A 5A4AA 1OA0A 3VTZA 3Q3GE 4OY3A 1EDDA 3CBQA 1HORA 1T2EA 1XCPA 4XQ9A 4C20A 1WXHA 4XUGB 1A5SB 1S0UA 3PWTA 4U4AA 1ZI9A 4KV9A 3I62A 5A5FA 4CU2A 4EKIA 4ZCIA 5EOVA 3D4NA 3EMDA 3SPXA 3V6MA 4LF4B 3ZE7A 4FMCB 1RXCA 3RS8A 3PJGA 3DTTA 1K4KA 4LF7B 1ZJZA 1RPTA 1W75A 4H7DA 4RV4A 3T0IA 3WRWA 4P08A 4BIIA 1PQUA 3QLUC 2Q0HA 4WQMA 4Q3LA 4WBNB 3O8OB 5DZSA 1Z29A 3AEUB 5HW0A 4UE2A 3KG2A 3THYB 3WRYA 1DB3A 3MWLA 3UK1A 3WMRA 3EEBA 5J2UB 2RHGB 4LDJA 2B0CA 2Y67A 5LLSA 2NXWA 4Y1GA 4OIFA 3EX7C 1B1CA 1E79D 1YI1A 1A9XB 1X8LA 4LK2A 1PJQA 1Z47A 1YKFA 2XHEA 2I2CA 3A1WA 3D7NA 4M37A 4FONA 4TXJA 3V7WA 3ZGOA 4A5SA 1FQWA 3QU5A 3HKEA 5M04A 1EIZA 4JWTA 1GZ5A 1E94E 3BKXA 2J3HA 4D9NA 5BQFA 4DDUA 5KNDH 3W5JA 2BFNA 3O74A 3P2KA 1C3XA 1OAAA 2ZYGA 3EGCA 2VTBB 3DMYA 4L5AA 4PZ0A 2MSNA 3HXKA 2GSWA 3GFVA 1KBOA 3RNLA 4U7TB 4DXHA 1I8TA 4H0CA 1WDKA 3GLFB 2R25B 1W85B 1HDGO 4X1YA 1E79A 1JU9A 2LTAA 4M36A 4DSAA 3H05A 1T2NA 1TUGA 2GBLA 4HQOA 2P8SA 2YV4A 3D8SA 4EL0A 5BR8B 2P2YA 4R81A 1HX7A 3UFBA 4ZDJA 2PZLA 3TLCA 3UOGA 1SWWA 3TUZC 3E7DA 1EZ4A 1Q7TA 4NICA 3AV3A 2FMHA 3PT5A 4HDSA 1Y8AA 1TA0A 2PL3A 3O0DA 4UBOA 2VZ8A 3GEPA 5IK2D 4C7VA 3ZPXA 4LJRA 4A1FA 3HYCA 5TMEA 3T7EA 3LT4A 4BX3A 4JL8A 3UG6A 2WSLA 1BXRB 2PZGA 4N5HX 3NDBB 1IY8A 1DIBA 2GF9A 3LBIA 3AUAA 3ZHOA 3RVOA 5HRCA 4NRDA 4UOZA 1TK2A 5JEEA 2QX8A 4JT4A 1FP4A 4HWGA 4CU5A 4LE1A 1FVFA 3UUWA 4AO6A 2CDNA 2DWCA 3PVCA 5IARA 3QOYA 2NO4A 4H3SA 4UUOA 4XB6B 4CKCA 4XSVA 4DDTA 3OZAA 5IK2A 2O2ZA 4L4ZA 5E38A 2QE6A 2ZSFA 2NYVA 4TRNA 5F23A 5IAOA 1VRCA 2OV4A 1Q14A 3EG5A 4K81B 3UB3A 3W8DA 3QEAZ 4G81A 4S1NA 3UT0A 1ULHA 3DTVA 3DV9A 4LF6B 3B1VA 3COSA 2Y76A 2H8KA 2VF4X 1CBUA 3GAMA 1CS0B 1M8GA 4LGMA 1DG1G 3KKOA 4ZVLA 3VYWA 3ZN2A 1OWLA 3EIEA 2BW0A 2HO5A 4YBRA 4BTVA 4R6WA 3A9UA 1Y1RA 1RHJA 2OO5C 2VLIA 3HA5A 4KW7A 4XVHA 3G5AA 1L4UA 4RY9A 3AETA 3IKJA 4OPMA 4QC2A 4ZZ3A 1NN1A 3GCXA 3HFJA 4H3HB 2QRLA 4KXUA 1ELOA 4KCGA 1NI5A 2X5NA 3D5TA 1C30B 2VDWB 1XEWX 2XNHA 3IESA 5DBHX 5F2EA 4PC2A 4ZEOA 1ULTA 3RUEA 2R6ZA 3QW4B 4OHCA 2GAIA 1KYQA 3HFRA 4Q9LA 1O8CA 4OX9Y 5HTKA 2DH5A 1G4AE 4ZV7A 5AKYA 1S9DA 2XTAA 3D2AA 3KKZA 4G5HA 1GM5A 5J3JA 4GS5A 1PNOA 3U9TA 4D43A 1CEEA 1IBMB 1E2EA 4HNRA 2PT5A 5EMHA 4WZBB 5EJAA 2XRZA 3HFGA 3RJTA 3MWDA 4UVEA 4BVBA 5JD4A 3OIVA 2H31A 3AP2A 4YDRA 3AR7A 4QQFA 1U2EA 5ADUS 2R7LA 2OBYA 4R7GA 1W47A 3TUJC 1GL6A 3GFQA 4Y9RA 3AVTA 2Q3MA 2QUJA 2XQKA 2F1JA 1W6UA 1J8DA 4BTEA 1BCSA 1KKUA 1EI9A 1LLUA 3T15A 2YMPA 3VZQA 4U9HS 2WWHA 3EPHA 5KDLA 2AG1A 1JWAB 2OHGA 1AIPA 3AQ4A 1W5TA 1M0SA 4W1QA 1NTOA 4IJ6A 1HDRA 3K9NA 1SOMA 4R9NA 3EW7A 1RPNA 5BR7A 3RCBA 4B6SA 4F4DA 4Z2AA 2ORED 2HHJA 1Z26A 2B99A 3BIFA 3ZQKA 2PWAA 3TI9A 1SUCA 4QXOA 3A9RA 5FI3A 1SBNE 5DLDA 4FJ2A 1E1QD 1KZ4A 5DKFA 1MV5A 2IYXA 2XDWA 3D54D 3UHPA 4CM5A 2P2NA 3HBLA 2IX9A 2JS7A 4E5VA 2GLXA 3BXPA 1JQBA 1Z5OA 3ABOB 4MS4A 1YO6A 1W0JD 2GK6A 2Z5VA 4IINA 1JL3A 1VPVA 4L2IA 1BGXT 4MVJE 3SEQA 3SKXA 5LNK1 3AVYA 4DLWA 5KWSA 1HTTA 5F9HA 2ZQYA 5E6UA 3ZHRA 2N3ZA 3PSHA 2F3TA 2GZHA 2R7NA 2QUBA 4L7QA 1E1QA 4HV4A 3NTXA 3AVQA 1ATZA 1X1DA 4MH0R 3WL4A 3FA2A 4CM8A 4MIOA 1JLRA 3PUXA 2BGLA 5JVDF 1M54A 2ZXEA 2L82A 4I6JA 1G2OA 5HM8A 1C29B 3HFSA 3JYLA 3K9LA 3QSGA 5IVIA 3R0IA 3FOAA 3RHSA 5LP1A 2C5FA 2X8JA 3ZY5A 1F2TB 1W0JA 2PG3A 3OZXA 5DO9A 5I8WA 2ZUFA 5BV1A 1F4LA 3K6SA 5BQPA 1K8RA 2NTEA 3B82A 3DL7A 1W76A 4FFMA 4IEEA 1RNLA 2YW9A 1M2JA 2OILA 3F1KA 3V4OA 5CAEA 1N5DA 4GOJA 2HHHB 2FTKE 1AUPA 3UJ6A 3AP3A 3U5TA 1GKLA 3HYRA 2QL5A 2ZR9A 4FOPA 4O2AA 1IOWA 2UVQA 2ZE7A 1WP9A 3QQPA 5GY7A 1RWMA 1SCDA 1KVUA 3KOZA 3P9QA 1XT6A 4DIDA 5E6SA 4DR5B 4PTZA 5JS1A 4XW2A 721PA 3VU9A 4EDFA 4DSTA 4KOEC 3MWEA 4K5QA 5DM2A 3VPXA 1JXAA 4QYSA 3VDXA 3HEAA 4BV3A 1WW8A 2NVWA 3TW8A 3KSZO 2DP4E 1CUXA 3W4JA 1KMNA 3I45A 4HH4A 4JJKA 3SR3A 3KLPX 4QYWA 5ILQA 3AIKA 4IP0A 3FZGA 5AKGA 5LA6F 1NQWA 1IYZA 4TKUB 1PJSA 3FJYA 1YR6A 1NW9B 3DBHA 5BT9A 4BRZA 3KUXA 1DO8A 3C3KA 1NWCA 1E3EA 1TXGA 5CCDA 3T3HA 1C4OA 4J0CA 4OBBA 4LQLA 4CG3A 1DEOA 5EP4A 2HADA 3GLTA 1B6SA 2TYSB 3ONVA 5KJ6A 4YAWA 2JA2A 3F8TA 3N59A 1K27A 1S2GA 3D1JA 4NFYA 4DIEA 2W90A 3NC1C 3HZHA 4IBOA 1L3BA 4M98A 1WJGA 2PKCA 1GADO 1SG0A 3W6PA 2MINB 1PU2A 3A7EA 3K0AA 1TJYA 2B8WA 2W2XA 3G8YA 1EINA 1Z56C 2IH4A 1Q0TA 1QORA 2GVZC 5E4YA 1VKHA 2D1SA 2GPYA 3E6AA 2O8DA 3MELA 4LWQA 1O96B 1XL0A 5DLQC 5KSZA 1DHRA 2G40A 4LC9A 4QVGA 1DPGA 2Q8PA 3EBLA 2PKXA 3FVRA 4JK3A 3T12A 3BMQA 3WRYC 1IQUA 4B74A 1E7YA 4K9QA 1XQXA 4IDOA 5DBIA 3T9BA 2YJ3A 2ZRAA 3M4NA 5DJ5A 1MZVA 2DR2A 1E2PA 5I7WA 2YYSA 1QRRA 3IEPA 3QPUA 4IIHA 4KXQA 1B6TA 4H7KA 5CTJA 4H1WA 3SXPA 2I65A 3EF3A 2X76A 5K5EA 1KZ6A 3GJ5A 1NZDA 4HDKA 5CX4A 1ISJA 2VAVA 3PA8A 3RU2A 5DYNA 5AVQA 3ZX4A 1Z3CA 3HEBA 3JALB 1OYWA 3DL4A 1MHPA 1K6JA 4CIAA 3NCTA 3ZU3A 2PQMA 1JAIA 4HRVA 5L4LA 4RTOA 3RKSA 4PS0A 3F67A 1LXCA 1W93A 1Z28A 3FNHA 1QH9A 4PPQA 3MTDA 1A7JA 4U5QA 5THKA 4DOMA 5JJLA 1EXNA 2Y0CA 4PG4A 2QY9A 2VQ6A 1U3TA 2X5OA 4S1OA 4JYMA 4MUXA 4X61A 1RQ7A 2WUGA 4I4TB 1P5FA 3JQ9A 2YV2A 1K08A 3DE1X 3WWPA 1EIWA 4PO3X 3CKMA 1GDDA 3HVUA 3O75A 4UJ5A 2VS1A 2DVMA 5JNVA 1JHUA 1FFSA 1FVOA 3GG2A 2VWQA 5FUYA 1FDOA 4ACBA 2VJLA 4CEJA 2CXUA 3ZV3A 4EG8A 3E8XA 1M0EA 5DULA 1GGJA 4QEDA 1CUEA 1PIWA 2EW1A 1T0JB 2QRJA 2GYYA 4JNKA 4GO1A 2QS9A 1NF8A 4MQUA 4MSUA 4N6GA 4AMZA 4BKUA 2IEYA 3KDPA 3MJDA 4FVTA 3G82C 1DWPA 2ZT8A 3FPJA 3IS3A 3M6VA 4TZTA 3T3MB 4CQNA 4F04A 4US0R 4NE9A 4AFNA 5JSZA 2CXRA 1FU4A 5AICA 4HBGA 3LUKA 1J8YF 1JAXA 2G06A 2ZVDA 4S35A 3R7SA 5FEUA 4QJ5A 2JGMA 1F14A 3HU1A 3RROA 3O31A 4U7DA 4CIVA 1C41A 4IS3A 4ND7A 4O4LA 4Y0AA 2O2JA 4DDVA 2PGDA 1Q74A 3A6GA 2JG3A 4ZO9A 2VZ9A 1EFKA 1MKYA 1TF7A 2IXDA 3BPSA 3O1LA 3ZHYA 2OCXA 2VT7A 3ETNA 3FGOA 2EYUA 2O8BA 1H2HA 4ER6A 3MPUA 1KVSA 3C14C 2FUG6 2A0KA 1N4AA 3KPUA 4JI1B 2H3EA 2IIQA 3RJZA 4QATA 2EATA 2PS3A 1GY8A 2J5XA 1VQ1A 2P9FA 3B1WA 3N7UA 3PNVA 5SY9A 3UJ7A 3WBKA 3WWYA 5EKUA 1UBFA 1KI2A 2VJOA 3ZYZA 5A71A 2VRBA 2FFJA 3JVVA 3DTNA 4AROA 3AJRA 2X6TA 3F7NA 1JLHA 1NLZA 3BTUA 2X8LA 3EISA 2XYVA 5JRZA 2OY0A 4KR3A 4GOOD 3VKVA 4B35A 4FZJA 3BGVA 2LPMA 1PBNA 2XRMA 5CR9A 2DGDA 1KQNA 2QN7A 1QVRA 3TRFA 5JPCA 1DTEA 1JE0A 1THMA 1QCDA 1XALA 2HUNA 2I55A 4H6VA 1XVTA 4JR1A 4OL9A 3ZV5A 4A9AA 4A2QA 3IBCA 5HTOA 1HE8B 2BFDA 2YC4C 3H2IA 3IE2A 4BJ3A 1O0CA 3L0IB 4DA7A 2C8VA 2PUTA 1I3NA 4KL8S 1TYDE 5B4UA 5JJCA 3R24A 2Q1YA 1JXOA 2ZCUA 4OI4A 1DOZA 5A2QA 1BWQA 1K7XB 2D5BA 2N1MA 1ZONA 3CZ5A 2W5UA 3M3PA 3FVVA 4JBHA 4U2KA 1WB6A 2QDXA 4EG4A 3HXTA 1L8QA 4H1TA 4O2BB 4KIUA 1XZQA 4G37A 1BD4A 2B0JA 1E20A 3L4JA 1HA3A 5JWOA 3KEFA 4L4UA 5IKMA 2PMKA 3Q8XB 3EE6A 5G4LA 2DR0A 4G3XA 4MUFA 4EGQA 3EAFA 3KHSA 5A1TA 2GARA 4RPLA 3P2IA 3PYMA 4ZOLB 2QI9C 3JAWB 4UMVA 1BHQ1 1NJ2A 2NUTB 2ORIA 4FFSA 4R84A 4EHBA 4AJJA 1DAMA 1RT9A 1V7ZA 1WXFA 3KQUA 3N2ZB 3IDAA 2IDZA 3EZ2A 3KXIA 1K0UA 3OZWA 4BS9A 5CDUA 3G0HA 5LLDA 3NV7A 2PE5A 2ODNA 5L3VA 4DSZA 5I47A 5HE8A 5JCJD 1L7EA 5G0VA 2M9MA 4LW8A 3TTSA 2M98A 3AU9A 1K66A 2DJIA 3A27A 4GZ6A 5FPSA 4RA9B 4O08A 3RFVA 5KX5F 1G55A 5H68A 2WF6A 3MCTA 4E03A 1CD5A 3A1EA 3ID6C 3MHTA 1SGWA 1DWUA 3TDNA 3G6WA 1WDWB 1Q1EA 1J1UA 1FB5A 4YAEA 5BV7A 5DK4A 3RLIA 3KAPA 2ZUDA 1Z07A 1G3IA 1NW4A 1BRTA 2IU3A 2O1EA 2Z2IA 1YZNA 2V6GA 4LZJA 2NPFA 4IYJA 1MNAA 3H7IA 2WUWE 4ND8A 3ZQ6A 3ITNA 3PNQA 5ABPA 5JCJA 1KI6B 5FQNA 2HQRA 3K1AA 3PBKA 3UQZA 4NFHA 4X6XA 2FQ1A 5T67A 1LQ2A 2GZRA 2VK1A 1KERA 1AQNA 4B7AA 1N2CA 4XDGA 5AKIA 3RJ5A 3NBXX 2JH9A 2C31A 3OT1A 5B1DA 5BW4A 3UH0A 3RC8A 3B6EA 3MJSA 1G19A 1SVOA 3EAQA 1G1AA 1ICEA 1P29A 2IYAA 3KL4A 3K9HA 3TYXA 3RYCA 5DV9A 2FSIA 6ABPA 4BQEA 3GARA 3NEPX 5JIBA 1YR2A 1Y33E 2VO1A 3G89A 1G7SA 2IU6A 1T2FA 3TLZA 1KJNA 4TL9A 4PSVA 2E18A 1QX3A 6YASA 4LYDA 1CVIA 5TGZA 3R8CA 1XJQA 3TKAA 1TLTA 3MWFA 1CUGA 4I55B 2JGDB 3EQ9A 3HR7A 1EP3B 3MQFA 2ZJ8A 5THXA 1KR5A 4Q21A 4OK6A 5E9JA 3ZW7A 4A36A 4O4JA 2JCXA 1ML4A 2W37A 3CUWA 4L8YA 3TAUA 1GTSA 2XUPA 3LPMA 3WI7A 3A8TA 4INAA 4A8JB 1JNYA 4AJKA 4LOAA 1AO0A 4JGIA 5AXCA 1D6MA 3LT0A 1E2GA 1E0SA 4A16A 1NYLA 3OHMA 5IYZB 1ZD9A 2HU2A 2ZTLA 3EY4A 5A03A 3HXMA 2QM7A 3CB4A 4CTNA 3EGEA 4FLMA 2B5WA 2E87A 4PAWA 4OXRA 5G1PA 1Y9JA 3HWRA 3KZCA 4R8RA 3M4YA 1OX4A 3ZGYA 1J8FA 3TFOA 1DS6A 2BFBA 1OU4A 1OVMA 2PJUA 4CL0A 5IFLA 1DJOA 2FXIA 2B61A 1JALA 4OXXA 4PN3A 3LC0A 4DJEC 3UMSA 1BJKA 3F9RA 5BVHA 3HY4A 3DE3X 5KCZA 3DOHA 4HC4A 5LQSA 3DWGA 5HUQA 5LD2C 4LC1A 2WHQA 3BZWA 2UXDB 2AWNA 2G5TA 1UIRA 4C6SA 1E6LA 1BCRB 1Q0HA 4WY5A 2HFJA 4MUNA 4QG3A 1UFRA 2F3QA 3EARA 1M2GA 1JG4A 4GU5A 4DLRA 1Z13A 1XLWA 3C7TA 3HYTA 3T38A 4DGSA 2BOVA 5B2EA 4FC7A 2W2PA 1YIDA 3HQ4O 3H9UA 4WJKB 4X84A 1HF3A 4FWTA 2YJ5A 3CEJA 4PPGA 5EKXA 4EPWA 1PT7A 5B3LA 3VU8A 1RFGE 1W9MA 3A4IA 1YAHA 2PK3A 4P34A 4EX6A 4EG1A 1P1HA 3L2OB 3PFFA 1UEXC 1ZX1A 2H2FA 3I01M 2CMKA 3F5DA 3QF4B 3R3JA 3VKHA 4PM4A 3MJEA 3N5CA 4NMWA 3VKGA 4J0HA 2CZCA 3SC4A 3NV9A 5IAEA 3WV5A 5K3FB 2HO4A 2FPIA 4KNWA 3NG1A 3TJZA 2FZWA 3OX3A 5AVTA 2J0QA 3GLIA 1LDNA 2FSSA 3A1FA 3KPJA 4RK6A 4ZHSA 4ZVTA 4EHIA 5IC4A 1USVA 1Z83A 2QYOA 4OFXA 1FLAA 5BPHA 4FT2A 5AVSA 4K28A 1AN9A 1YZHA 3FPHA 3RVNA 1VE7A 1KP3A 1IK6A 3W6ZA 4RMIA 1DIAA 3GRKA 3QX8A 2NU8A 2JFNA 1QIDA 5DYIA 4GX2A 5KVVA 4FDUA 3MAGA 3WMWA 2JIOA 1E1CA 1NLUA 1E9BA 1OT5A 4ZAGA 3RM3A 4K6OA 1SVLA 1K2WA 2C7QA 4D8WA 1IK4A 1GAXA 5EEGA 4ZI7F 3JQ7A 3G17A 1JIXA 1JHZA 1MTZA 3N8KA 4JBGA 2BI8A 1I6KA 1MC5A 1Q77A 1TAHA 1Y8QB 5E9WA 5JSYA 5KVCA 2H8GA 4AN4A 3WA6A 4I9FA 4BNDA 5ALKA 1I2ZA 3KAQA 2PIAA 4ND3A 5F7OA 2IHJA 4KQGA 1MB2A 1YCDA 3B1YA 3H2SA 4U0KA 2FMUA 1JH9A 2I34A 1DJNA 2PZAA 4LRWA 2AUTA 4PLGA 3ZWBA 2P1RA 4MUMA 1ESNA 3O9MA 1CX9B 4D97A 1E7QA 1BAPA 3FYUC 4Q39A 1ABFA 5KHAA 1J49A 2OVBA 1KEEA 1I94B 2DECA 3UA4A 1A4UA 3NATA 5CDSA 5EJ6A 3U6BA 1XWIA 2NO7A 4JQZA 3W5UA 1KEKA 1JJAA 4NS1A 1AXEA 3KVOA 5CGZA 3ZGZA 5A5VA 1V8FA 4PO8A 4HAZA 4HPWA 4BU1A 1ZW1A 4MDYA 1H5NA 3ZHBA 3CNHA 5K8VA 3FMIA 4JWKA 4UC0A 3SX4A 2WJVA 3AR2A 3EJWA 3KOWA 3N7TA 4KOAA 4IJQA 1THZA 4LHWA 2XYPA 4Z3DA 3K70B 3FPEA 1F7UA 3K32A 5CNMA 2WINI 2UVPB 4F0JA 1D8AA 2DPYA 3DEAA 3OU7A 3TZBA 2O1WA 3LZCA 3VUFA 4ZK6A 4G5YA 2R97A 4KMRA 1TU3A 1ZL2A 5AK0A 1A2BA 3PFCA 4G5QA 5K6TA 2AG0A 3HKBB 2PEZA 2XQJA 3MF4A 2NXEA 3B78A 3GJ7A 3FVQA 1V7PC 621PA 2FN8A 4QRHA 3SYMA 1TIPA 4BE9A 1IDOA 1D1TA 2VPTA 4C0JA 4XM0A 4B8ZA 4MITA 2FQWA 1D6JA 1YDEA 4HZIA 1EK5A 1OLSA 1PN3A 3D3EA 4D9IA 3WP0A 1HT0A 4DLNA 4LV6A 3NBAA 3BQMB 5KYGA 2I33A 3V80A 4HH3C 4QXMA 3U80A 2F8SA 1OFGA 1JECA 1TF2A 3N2GA 4L95C 4XRRA 3NDRA 2QEQA 2DCMA 2JIQA 2O2XA 2ZIUB 2JLBA 3G2OA 2H1OA 2Y1KA 3ZCRA 5SYMA 1GZDA 4GECA 4FE7A 4HQFA 4R31A 1KQOA 3SQNA 3W4KA 4DADA 4FBGA 4OHZA 1I2CA 1AUVA 1YACA 3T4PA 3DR5A 5BNFA 1PWYE 2OFFA 2G1PA 3WGUA 2W0SA 5D3MA 1Y63A 1G6Q1 1Z6XA 4W99A 4Q4HB 4MINA 3T1VA 1GFIA 3C8UA 4K9NA 3OLZA 2SNIE 3B1JA 3GXBA 2GFIA 4WRRA 4DWOA 3GMDA 4TMFA 4MUKA 3TIGA 1XHFA 4P33A 2ZPUA 2GILA 4EVSA 1SKYE 3A31A 2YRXA 3EA4A 1T0BA 5FTMA 3NDJA 3KXKA 1L8OA 1Q15A 3PDUA 4OQDA 3CUVA 4XWAA 1ZIOA 5A4FS 3I6BA 5B57C 2WICA 4ON9A 3FHTA 1FDWA 1V7QA 2QN2A 2XODA 2QTAA 4PVCA 1CYEA 1TLLA 3REGA 3GFRA 1WS6A 2GCGA 1QF7A 1MQSA 2VA9A 2XUZA 4QM6A 2CL7X 2QV7A 3OOWA 3RR2A 3DULA 3ELDA 4HLCA 5DISB 1QH8B 4R9UC 5CLJA 1LPSA 3U19A 4DCUA 1X7YB 2C97A 2JEZA 4OXKA 2Z1MA 3DCNA 3NWOA 3L8YA 3OIWA 4DTIA 4UAGA 2YVLA 2GXUA 1R2QA 3ZDCA 4HQKA 3SE7A 2XSZA 5K3AA 3L77A 2LKDA 3B1KA 3KV1A 3RBXA 4EHNA 3N6VA 1ZU5A 3WJ2A 3JWGA 1NBMA 1H9CA 4ZGGA 5LMZA 4EKGA 2CLDX 2H52A 1AV6A 3QWAA 4UASA 3CX6A 3H5VA 5TQ0A 4ZO4A 4PFJA 3PDIB 5REQA 5TPWB 4RFVA 4AAYA 3DXXA 1B2LA 2XUKA 5CDGA 1PL0A 4CGYA 4OLAA 1XDWA 2IYQA 2N46A 5D1NA 1COWD 1SHTX 1R4MB 2EW2A 2WWXA 3CISA 3DVQX 3JQ6A 1YJCA 4JCOA 3RYIB 2FH5B 4RD3A 3GOHA 4XR4A 5EMLA 3HYNA 5JAIA 3GRUA 1ILEA 3KAKA 1ZM9A 1RJ9B 4L3VA 1TGVA 4V03A 3FCCA 1L5GB 1A96A 4PFKA 1KO5A 1XZAA 4MQEA 3CEPB 1Z34A 2MYTA 3UUFA 1AQ6A 2CYAA 4LOHA 2ZS9A 3GEHA 1CW2B 4BLRA 3AH8A 3ZE8A 5H4GA 2X4GA 1BC5A 2A4KA 2RCYA 3KYCB 3MJVA 1MEOA 1XMSA 3BRWD 4TZ0A 2H11A 4YV0A 5FOSA 2IDMA 3MB5A 1COWA 3GFSA 4MO2A 3IDQA 5F77A 1NUTA 1KI4A 2JA1A 4EJ6A 3F6BX 3MS2A 5G4KB 1FTSA 1OTXA 1R10A 4NZZA 4QECA 5JY1A 4NU0A 5M5BA 4BNIA 1U90A 4Z5XA 1U5CA 3E9MA 4P2GA 3A4TA 4AD8A 1RACA 1EWRA 4FEAA 3BA1A 3JWPA 3ZTTA 1NNUA 1PYOA 1QHYA 1AV7A 2QX6A 3CNQS 4PHGA 5EIOA 2Y1DA 3E3MA 1IHUA 1P2UA 16PKA 4F2GA 5KYXA 3LP6A 4KXWA 3VISA 2XYGA 3DXZA 4Z0PA 3EASA 3KDAA 4IXMA 1E2IA 4MKGA 1EYZA 3BRWA 4LZNA 2ZANA 3RS4A 1LX6A 2XRFA 3T4XA 4B6EA 3K94A 2GPTA 1XDZA 2HMSA 1AHHA 4RHTA 2OLJA 3LHDA 4P5DA 3WRVA 3ZLJA 5M34A 2HQBA 3ICEA 4ER0A 1RRVA 2W6CX 5BWBA 3ZWPA 5GOZA 4Y6GB 1PFYA 3K8ZA 1GQ2A 1Y5MA 3N28A 2CW5A 2BELA 2R96A 3H7AA 4I3GA 5IT5A 1BVYF 5IC5A 1PFVA 1Y1SA 3G8CA 6GPBA 5IUKC 1MG5A 3RSGA 1CERA 4OHWA 3QE3A 4GWLA 5IJ0B 2Q50A 3KPVA 2NU6A 2WY2D 4RMGA 3P9XA 3Q8WA 3ETLA 3V4LA 5LIPA 5AP9A 2WNIA 2AFIA 2VWPA 2WTEA 3O83A 4MS3A 4BXOA 2R8XA 1ENZA 2M2IA 5CK5A 1KYIA 4LDAA 3QA9A 2R00A 2FZ5A 2AFHA 3Q3IA 4NABA 1SK8A 4D4HA 3PJEA 1AM4D 1D2NA 2YINC 4GQIA 2VF5X 4IFBA 4WFJA 1X7XB 4UATA 1P0PA 1YULA 1CZOA 3B20A 3ODPA 3R5FA 4FK8A 4HFMA 4HN4B 4J1SA 2VAXA 3OD5A 4KQFA 2J85A 2ZIGA 4GPTA 1G38A 5KOJB 4X8MA 3ZWCA 1B23P 3INYA 1P31A 3ICWA 1JLLB 1OUMA 1R8SA 3TRKA 1YQTA 2ZWPA 4ZJYA 1OKKD 5FI1B 4DUGD 5LDHA 2RK4A 5DGIA 4JT8A 4IGIA 4WUVA 1ORIA 1EX9A 4MUYA 4Q47A 4DT1B 4RKFA 1A7UA 1NBAA 2QL6A 3KBBA 3KJIA 4EY7A 1WF3A 2G9ZA 1YRWA 2XRYA 3H2HA 2RSLA 3JD3A 3OWOA 3FG9A 4B09A 1G7CA 5J63A 2QUZA 4YMUA 3RSLA 1C3JA 1CRZA 2B35A 2OWEA 3U39A 3VR3D 1M6EX 1NRWA 4IDNA 5JO0A 3OETA 3PFIA 1Q1BA 1XJ5A 4FEEA 3C8HA 1C0IA 3C97A 4OV6B 2GZ3A 4CQLB 1VLQA 1PVVA 2PZEA 1VCMA 2O50A 3D8HA 2QQEA 1QE0A 2HCFA 1HG0A 2H59A 2G9VA 2NYRA 4X90A 4E1AA 3TKLA 3JQRA 4RHEA 3FX2A 4HN9A 4Y2PA 4OB7A 3WXBA 2C2HA 5IC6A 3SHWA 2QGFA 3WK8A 4LGYA 4MWDA 4CQMB 5H8WA 2WM2A 1LWOA 3BHMA 4ES6A 2PKEA 2D5IA 5TVKA 3NAZA 1YA4A 1RYDA 1VKNA 3OZDA 1IY0A 1YQUA 4YWJA 2A7QA 5HMLA 4CV2A 3PHLA 3AY3A 2ZSBA 4MV1A 1HE1C 4RIHA 3VQTA 2C2OA 3NOXA 4H4DA 3VR3A 6Q21A 1DX6A 3W2EA 3STVA 2HOQA 3G7UA 1LI7A 1G5FA 9ATCA 3MQ4A 4L57A 1ZGAA 4B73A 2UUAB 5K4AA 3AUUA 1D9XA 4EFLA 2X14A 3AXTA 2R3SA 3T9CA 2UU9B 2J67A 2ESRA 3TQFA 4BQPA 1R0RE 4MB2A 3X44A 5J9FA 3ESBA 3GDHA 5GAJA 3EIOA 5DN6D 5GZ1A 3L02A 3U4QA 2HMUA 1GO2A 4M1EA 3NETA 1TC2A 2ECOA 3DVRX 4DQKA 2RGBA 4R1OA 2J30A 4MUHA 4RWEA 5KNBA 1G9XA 3IQFA 4O4HF 3K71B 3T5PA 2CZGA 1HE4A 2FFAA 1YR1A 2C4HA 1UKVY 4KE6A 4LZOA 2OXTA 4L07A 5KTTA 1LEHA 3UCFA 4G0WA 4CFZA 2JBAB 4R2KA 3L1JA 5BMOA 2EJCA 4HLNA 2A9FA 1TRHA 1WKCA 2P2SA 3RARA 5A4IS 1WXQA 1JFFB 1FVXA 4WNCA 3E7WA 2IGBA 1LPMA 1UODA 1II9A 1PNTA 1DT5A 1G8JA 3I04A 2HC9A 4IH1A 1GGFA 4YFVA 4BCCA 4D5EA 1WZUA 2MSWA 2WWGA 5G0TA 4WK6A 3TRDA 1SKMA 4MWTA 3VR6D 4XOUA 3D2LA 3VHRA 3RT9A 2Y1FA 1RKBA 1TM2A 4JP8A 4EJSA 3DO8A 3D6JA 1MAWA 3E7XA 4FYYA 4U02A 4URVR 3GPBA 4JI7B 1XNQB 4NFLA 3M9XA 5HCUA 2HCBA 1ETUA 3FMFA 2P6OA 4UFOA 3ZX5A 3VR5D 4IZ6A 1YZQA 2IZ5A 5K03A 1TUEA 4OQEA 1DG3A 5TJ9A 3L01A 3B6MA 3DT8A 2C4TA 2BE9A 4DV2B 1BMTA 5HDBB 4ER5A 5JCOC 2RHDA 5AUQA 3WMGA 3BD6A 4PW0A 3VR6A 4DN6A 1XVIA 2ECPA 2ZSDA 2W2TA 3CEHA 2PCJA 4G5GA 3R5TA 5K3CA 3SNHA 1PEDA 3GELA 3H5IA 3K8YA 4IJKA 3IMEA 2AW5A 3PYXA 3QV2A 4M1ZA 3SZRA 2P9EA 4Y7DA 4AICA 1VJ0A 3V1KA 2VKQA 4DMCA 3U7HB 2VXOA 5DGDA 2ZU6A 3JZIA 4GPZA 1MOQA 2PSEA 4TMKA 3PGXA 1EE2A 1N1MA 3RWOA 2Z6UA 2FK7A 3M6LA 2DE0X 3IR7A 1E7MA 3PQFA 4OA5A 5D7BA 2EFYA 1IN7A 5L7WA 3VSCA 5JMWA 2QI9F 1A8HA 2RI6A 2Y05A 1QH1A 2XR1A 3THXB 1QRTA 4DPMA 4C89A 3F5SA 3SHVA 4FLFA 2QVGA 1QJCA 5DXJA 3LQKA 1M66A 1WHSA 4C3ZA 4YAGA 2FUEA 4NJMB 3B3AA 3NT4A 4KAFA 3HNPA 3KT3A 3CONA 1TK9A 5B37A 1DRUA 4HKTA 4I46A 1Y7HA 2AFVA 1AB6A 2O06A 4U2BA 4ZREA 3AHIA 2UUOA 3ESDA 1X6VA 4HL6A 4X7RA 1QHIA 3CKLA 2OCLA 3NRCA 4UEOA 4Y2QA 2VJDA 3NUQA 3RFFA 4AI6A 2WP8J 4IJUA 3NGXA 4MI1A 5B1SA 1CZLA 1XROA 4M1KA 4OU5A 4D6YA 5DMHA 3TLYA 1JSCA 3UMCA 1GTRA 2FK8A 1EK0A 2ZRLA 2JCSA 4O63O 5E7IA 4B48A 5CVDA 2OMKA 5M7EA 4DMRA 1PR1A 1KDZA 1RRKA 4NBLA 5AKXA 1ESDA 3ODGA 3ZVRA 1EQAA 1KORA 4CKYA 3IVXA 3NZEA 5H5JA 2FF7A 2SHKA 3C8ZA 4NQRA 1I36A 3FWPA 4I8IA 5DK6A 1BDJA 2D1TA 2RHWA 3SZLA 5HZKA 3QBTA 1EFVA 1VDZA 4LI3X 1NG1A 1GFZA 1D7OA 1SD2A 1YZLA 2P4UA 3K0BA 3QNWA 4DUYB 3LUJA 1MEEA 4RJLA 2WUDA 2ODWA 3DE7X 2ERXA 2KW5A 1JSZA 4W5TA 3WJ7A 4UREA 4X91A 2CJYA 13PKA 4K88A 1E3QA 5SZHB 3W06A 5HYVA 4M9UA 3UPTA 2PVCA 4Q03A 3UA3A 4LRXA 5LP6F 3Q7TA 4UNQA 2I54A 5LZ4A 3WL5A 2L17A 3CF4A 2PMEA 3UWSA 5EXEA 1L7DA 1U99A 2J48A 4NBTA 4CCWA 4CDGA 1TM5E 3KSAC 3AR4A 4IIDA 1ID8A 2X22A 4C04A 1JEQA 3TMYA 3E2PA 1YCHA 3ND6A 2D00A 3FKSD 1BDIA 3VR2D 1TYEB 4UUAA 4YUYA 4RDCA 4YUAA 3SM3A 1ZHOA 1J1IA 2O8EA 1U0OC 4NYIR 4H15A 4XDYA 1WWKA 5G53C 2W11A 1N5JA 4MLZA 1EP1B 1NNLA 5L3QA 3LW7A 2RHHA 4ZCLA 5ESRA 4IOKA 4RVCA 1MJ5A 2FVXA 3NM6B 3TIXB 1IONA 5BQ3A 4Z3KA 4OHKA 3B6ZA 2QAGA 3A9SA 4R83A 2O8CA 1GGHA 3MCZA 1E7WA 1XXHB 4C4OA 4EYSA 5FA6A 5BV0A 2MT9A 2OPHA 2AI2A 1TVKA 3DZIA 3FKSA 4P3KA 1IL0A 1W30A 4LN1A 3LVRE 3GLGE 1MH1A 1ZUWA 3JYHA 2P91A 2AVDA 4JU8A 4F9GA 2GJSA 1A9OA 2E2WA 4PHCA 4B6FA 1L7OA 3ABZA 2HIAA 1FS6A 2Q41A 2QM3A 4ZQFA 1WR8A 2V4ZA 1GNVA 4WNYA 1GNSA 3VR6H 1FS5A 2W8ZA 4QUKA 3UOAB 3LWNA 2B83A 2J3EA 4P54A 4CETA 3PHHA 4IJVA 1Z82A 4H7IA 1TK3A 4JJ6A 4AP6A 1JHMA 1YRYE 1V1RB 4WINA 2R00C 1G2PA 1G4UR 1I2DA 3PQ5A 3DS8A 1ZN2A 4ABTA 2HQOA 3JW8A 4P36A 5EIBD 2NSHA 3EGVA 5EXPA 3QJ5A 4JT2A 1NJ6A 1E1NA 2OE2A 1OPRA 4JN6B 3LSYA 4GR5A 2ODQA 4YJFA 5FBRB 3VR5H 1TD9A 4GM1A 4ARUA 4CHTA 3OQ6A 3VVLA 2GESA 1UMCB 3HJFA 1LA2A 3IT0A 2A8YA 5LOVF 1X7HA 1XL1A 1E5DA 3E70C 5MFZA 3QH4A 3BGOS 3EDMA 3AVPA 5J4LA 4A8HA 4PRYA 1HO3A 2H2IA 2A5LA 3UJ9A 1YJ5A 3CJRA 4L6AA 4BTLA 2OORC 1H4QA 2JLWA 3UIEA 2I3AA 1BS9A 2DHQA 4LZLA 4CCYA 1ONSA 1Z2PX 2ZSUA 3ZKWB 4BNUA 4UTPA 1NXTA 1C7FA 2XZDA 1YR8A 1C7IA 2JLCA 2VJQA 4BRSA 3WGVA 1EHCA 4UNIA 5DTIA 3IULA 1DKQA 3LCJA 3B12A 5SZKB 4RTNA 2CJFA 3PQDA 4EHAA 4YP5A 3E8SA 2FJPA 3ZZNA 3G02A 1EVIA 1Y3CE 3PXXA 4J3JA 2NP7A 2WJWA 2HYIC 1DNPA 5TSDA 1KRXA 4RKWA 2VKTA 4F96A 3LW8A 2P9GA 2QDKA 1VGQA 1RHMA 4G8BA 4KVAA 1RHUA 2ZUUA 3K05A 1CUDA 3HHPA 3CF2A 3QPVA 5KX5B 2BGWA 3GGJA 1NRJB 4H7JA 3C6MA 2VC2B 2P11A 3TLJA 2BEVB 3H16A 4QNNA 5EIAA 3SBXA 1NWHA 2ZBVA 4BAZA 5IKPA 2R65A 4RELA 3U4GA 4HJXA 4K3UA 3N8GA 3ZCQA 4FFBA 3AM3A 1S02A 2D8MA 3LT2A 2PGAA 4C4RA 2ZYIA 1U4NA 4BWFB 4DLZA 2LWIA 1IJKA 3L7MA 4M46A 2WTAA 4GC5A 1JILA 4JITA 4UHKA 1XI2A 3EC1A 5KZMB 2NV2B 1KDRA 1DIGA 2V74B 5BQXA 3FH0A 4Z49A 2P65A 4AQYB 5HKKA 1ISPA 1ZBDA 2XJ4A 4R8KA 1KJJA 1R18A 1RYHA 4XQEA 1I4DD 3STYA 3U7EB 5A62A 2QROA 2XMDA 3CTPA 2PGIA 3IOMA 3W2FA 4RSMA 4ATNA 1IJBA 3J81k 5LYJB 1BE0A 4Q1DA 2R1VB 2DH6A 1RC1A 3CKYA 4EAQA 1R88A 4OOFA 4MRPA 1QYVA 1OBHA 1PL7A 4HAUA 3FGPA 4IKOA 3U31A 4BNKA 3DJYA 1K63A 1V26A 4OMUA 4NOJA 4WE3A 2KS6A 3VKUA 2A30A 5KJCA 1EUDA 3H65A 2AG8A 3C7AA 1R7RA 3HXPA 1XZGA 1VBMA 1P74A 3LCUA 4XGIA 1BE6A 5JLJA 1INLA 1PGOA 1D6NA 2AG6A 3ETDA 1RFLA 1EVJA 2JANA 2Q1UA 4KUGA 4NOKA 4PPNA 3L8GA 4WERA 1P8JA 1IC6A 2CXNA 4XCQA 3WBBA 4ARBA 4EJSC 6PFKA 1HE5A 4B8YA 4CQJA 5JNUA 3JQPA 5CYPA 4YMLA 1NUPA 1TZKA 5DI9A 5KSYA 2LGJA 2WE8A 1BMFD 4OBWA 3UWOA 1ORHA 5DI3B 5KU7A 1NKVA 2R6AA 4K1XA 2HJ9A 2YN4A 3OZFA 1DEHA 1LGYA 4H17A 1ISMA 3RFXA 1JI3A 3N9IA 3EXEB 4XRGA 4RKYA 2IW1A 1AU9A 1NW5A 3FDJA 4UVDA 4WN3A 3TZ6A 1EFRA 4XFJA 2I7CA 1O77A 4HEA1 4I9NA 4MKZA 4CEIA 4EHDA 1MO4A 2ZRCA 2EX0A 2YWGA 3GLKA 3HJAA 1EJBA 1PW7A 3BSYA 1K8QA 2IHZA 2PGOA 3QWBA 4HQLA 4XWGA 2Y1GA 5JYCA 5AUNB 7YASA 4YCJA 3AJ8A 1WMAA 5DNCA 4RYLA 2Y0BA 3FZQA 1B42A 4J0DA 4Q02A 3MT7A 2EKBA 4CHGA 3SXJA 1BMFA 3TL3A 4TYNA 5BUCA 5KOIA 1WB9A 5ISMA 4AUKA 1P1FA 2WILA 5SZIA 5F2KA 3TSZA 5L40A 3M3DA 3EDCA 4ERNA 2G1JA 1YFJA 2WMOB 5BWMA 1VHTA 7ADHA 5DCWA 3RAGA 1SXGA 4BVKA 5BW5A 1RM3A 2B92A 1KTIA 1U11A 1UZLA 3L0ZA 2HMVA 4DBLC 1NV9A 1NKSA 2QRVB 4JLBA 3G2LA 1RYZA 4RK1A 4YQYA 2HBRA 5AJHA 4D80A 1VG8A 2NVUA 1BSVA 1QDUA 3KS9A 3OPYB 3WTCA 1E66A 3CRZA 4HFRA 4KACA 4MHOA 4QWWA 2DWQA 1FPMA 1T6YA 2JBWA 2O05A 2XBUA 3IVGA 4JS0A 4X7PA 4D44A 5EVCA 1ZRMA 3RV3A 4CF6A 2Q46A 2G9QA 1RZUA 4Y6OA 4YROA 3U3OA 1BKDR 4JIMA 1RS0A 5J5VA 4ZKDA 4YJ3F 3CLSD 5LIRA 1V8OA 2FR8C 2I1QA 4ZQGA 1A9SA 3E22A 3RO7A 4C1NA 3UTDA 5DHTA 2I6QA 4R41A 4FMPA 5FUQA 1RQGA 2ODTX 1AHNA 1BO6A 1IZZA 1CZRA 1E4VA 1Q3HA 2RJ3A 3GK3A 3H18A 4IR7A 4Y2RA 1B1AA 1VE3A 3FKJA 1HRKA 3H6KA 3HWWA 3VVCA 4J94A 4PO9A 4R8MA 4HR7A 3T99A 2P2LA 2AKEA 5DCUA 1WO8A 2ECQA 3CUUA 3IVMA 4I99A 5AKHA 4YREA 4DYDA 2WSBA 4L08A 5DHFA 4F46A 4G1CA 1XAIA 1RYNA 1RXYA 2IZ6A 2WTUA 1GITA 2REQA 4L4YA 2P3LA 4FIDA 5G1NA 3BJZA 4C05A 1N3YA 3EMBA 1XD9A 2RH8A 4Y1RA 4LJSA 2BFFB 1BD3A 1CY8A 3SK0A 1AF4A 1RHQA 3JVIA 3GN1A 3LS2A 1OE0A 4LF8B 1J25A 1GZ4A 4LJ7A 3VYTB 4A0QA 4B3BA 2PZMA 2CSUA 4XFDA 3FNQA 3KR0A 4XUDA 3TW6A 3KQSA 5DM70 3CH4B 3LHSA 4GX5A 2LRHA 4I08A 3UMBA 1XMXA 2BONA 3SLGA 4EITA 1X38A 2BUCA 3A58B 1M34A 2ZUCA 4AZ0B 1EHIA 2EIHA 2V0NA 5JZMA 3EWAA 1PG5A 4X00A 1JEDA 1Y7TA 2Y1CA 3QVMA 4FGSA 4MKIA 4N5LA 2FPLA 1XCGB 3WKEA 2CVOA 1L4GA 5HSGA 2DUNA 3HXOA 2SECE 1BFDA 3DUFA 3CVYA 3JYPA 4BVEA 2QLNA 4G09A 4BMNA 3C3PA 2QAGC 3IUMA 1NBEA 4FWIB 3EBPA 2VK8A 3MQ2A 1P7CA 2AVNA 2IYSA 2EIXA 4UBNA 1V4BA 1XD2B 2PUJA 5K8TA 1ZISA 5JZVA 1N9GB 2LVBA 4XGKA 3L7AA 1A7KA 1ZICA 3PCXA 4G5XA 4YX9A 2QD3A 1RRGA 5C2JB 3QUBA 1PNVA 4XJVA 3BMNA 3PP8A 4DR6B 1FDRA 1M72A 4AY3A 4UHHA 2P2GA 1X94A 1DAPA 2EFGA 1XN1A 4DV5B 2NSDA 4C21A 3EVFA 1W4LA 1BXGA 3D59A 1Z4PX 3DR3A 3AF6A 5DMXA 3FCYA 4D9FA 2H5JA 2WSYB 1QO7A 1TAUA 1P7YA 1VECA 1WSBA 2HLPA 5AOBA 2FSHA 5DU2A 1PWHA 5JXIA 3H2KA 3VYRB 3HRHA 5CB4A 1O97D 4JLDA 1R8YA 2CMDA 4JJ4A 2X9LA 1EBFA 1SZCA 2PUEA 3LJKA 1F8XA 3DMDA 1JLMA 1IU9A 3BRSA 4HNAB 1NFQA 2WDZA 4LQ4A 2ZRPA 3HVHA 3K9QO 3OFND 3FRJA 4TOIA 5IDVA 1H2AS 4KO8A 3UV7A 1CS4C 1TEVA 3RT7A 1KPIA 3TPCA 1HDEA 2RGNC 3AMVA 2R60A 4FE3A 4ZD6A 3H5RA 3AIOA 3BE5A 2CWWA 3QMMA 3AY6A 1YFKA 3LUAA 4ZAZA 1YOBA 1T6ZA 4OU4A 5JQGF 2X2PA 3ONWA 4M7PA 2B5OA 1B41A 1AKVA 1WUTA 2FWIA 3B7GA 4L1KA 4OYYA 1W0KD 5LU9A 1E9FA 3PVZA 2ZULA 5EIBC 5I01A 4ALIA 3TQCA 4DA8A 4NS4A 3CNEA 2POCA 4YDQA 3G85A 4C7JA 1J20A 5ADVA 3T5GA 1REQB 4EOGA 2WU0A 1J0BA 4LV8B 4JIGA 3VRHA 3NHLA 1JTFA 1DIHA 1AGPA 1PK8A 2DOKA 4W1SA 1GU7A 3OSZA 3PGLA 4L15A 3MAAC 1JQEA 1E5LA 2PWPA 1ZH4A 1R6BX 3ETGA 4IWYA 4BLVA 3ZGVA 4XVRA 2Q5LA 1W0KA 1YB2A 3EG9B 3F7TA 2QD4A 4F97A 5C1IA 3SJ7A 1KJYA 1PR9A 2GHIA 1LSOA 3BA6A 2IIVA 3E9EA 3GMIA 3GF4A 3NWJA 1IZYA 4GZMA 4LA4A 4HSGA 4KK3A 5HMMA 2G8NA 1HYBA 3ZD9A 4ZWNA 4DANA 2EKZA 1Z4KA 3A1TA 5ALIA 2AZDA 2XVMA 2OP0A 3D9QX 4O02B 2LW7A 1X9HA 3V4PB 2Z4SA 1OXUA 1IXKA 1ND5A 3VPFA 4UEKA 4C2AA 1OZGA 1WCWA 2AOTB 3L49A 4WZ6A 2IXGA 4MQMA 3L0SA 3PFGA 2YMLA 2WD8A 3CB2A 5DHQA 2R7KA 2GRJA 2DPHA 4XOIA 3OFJA 4HGZA 5F3DA 2CY0A 3T3GA 2X13A 3S44A 3E5MA 5FULA 1QO0D 4URXR 3OO0A 3UGKA 1CUBA 4CM4B 2I2WA 1FLDA 2QLMA 3COZA 1H65A 2RJNA 3GJ4A 3OFVA 2YBDA 4NL4H 1KZHA 2P40A 2CV2A 3G6KA 3IALA 4X8HA 3U4CA 4IKPA 1Z7YA 2B98A 2IHBA 5C8XA 4G8CA 3DMTA 1Z4MA 3HKDA 3H2JA 3X0DA 4PZUA 3HP1A 4G01B 2OGTA 3VAYA 5KTRA 1OFUX 2YWDA 3E9ZA 1GDTA 3BB1A 3HCNA 4O0MA 1U0JA 1CDZA 1JPVA 4WLNA 1V1JA 4OQZA 3V8EA 1KRWA 3W78A 1EFCA 4UM7A 4HGQA 1W5FA 5DGXA 1NSTA 3C2QA 3VC1A 4D9EA 3I61A 1E3JA 1QO0A 2QJWA 1AKEA 2VJMA 4MRMB 2AHRA 5EMKA 3DCJA 3ZD6A 3GCDA 1BVUA 4D4KA 4B3CA 4YR9A 2H2GA 2P9YA 3I3OA 1A9YA 3JPWA 4O6VA 2QRHA 4RK7A 3I4CA 1MW9X 4RS3A 3RSCA 5F7XA 5IXYA 1ZSVA 1P81A 2Q2OA 3FHJA 4C0KA 4M9QA 3FTEA 2AEMA 3U4MA 1WAMA 3PXEA 2AKYA 3E5RA 3PUWA 3PUHA 3QV1A 2YW2A 3ZZ0A 3GDWA 4GVLA 5EUBA 1M67A 4KPGA 1DTWB 2QTWB 4B34A 2NT4A 1FZQA 1E62A 2FPPB 5ALMA 2Q5JA 1UDXA 4PLYA 2GBIA 2PH7A 1OGIA 2YZMA 1POXA 1EXVA 3WLJA 5CXQA 3S5UA 3R9IA 3F8WA 4H35A 3L4SO 1VKRA 4HAVA 5GQSA 1UFQA 4G0UA 4QGFA 3C7CB 4FU0A 4GL2A 1EFDN 3OM8A 4JLJA 4JELA 5CNKA 5C8YA 4CL2A 1I2MA 3OZGA 3P4XA 2WQ7A 2XB2A 2C9ZA 3AHGA 3ZDYB 2DY1A 6ADHA 1PWXA 4RXMA 4QTXA 4DMLA 2O0KA 4X6YA 2AV6A 3GFGA 1PT9A 1B3RA 1GQRA 2ZI7A 2FWBA 3MLAA 3WIBA 4YV7A 4KKXB 1GRRA 1VRWA 4B3FX 4R1QA 4KXVA 3W8EA 3P9IA 1O6CA 5FBLB 3K15A 4ZAXA 3OJ0A 1KQGA 3AUSA 2CUTA 2EL9A 2V7VA 3VHXA 1XRMA 4QXQA 2YFYA 4H6PA 3ZDDA 1LBQA 3RFTA 4UE3S 2P30A 2DBQA 1OMOA 1P2BA 4MB0A 1IBKB 3BXXA 4QXAA 4EY8A 3EUFA 4AZVA 1YMVA 4GSYA 4HB4A 1E1RD 1L7VC 3AWIA 3DZDA 1XO1A 3A6FA 4MW4A 4Q4JA 5HP4A 1NMEA 1ODKA 3P8ZA 3P5SA 2A9KA 3WO1A 4GT1A 1DBIA 1XEXA 2P6MA 4BNMA 4M0LA 1ZXLA 2R6HA 4K2AA 5CLIA 3IIKA 4ZAWA 4ZT3A 4BN5A 1UM8A 1RI5A 1WD5A 4K9OA 2YTZA 2A35A 1T4CA 3QFHA 5EIXA 3I5UA 2H2AA 1E1LA 3V8QA 3DZKA 2EZ4A 2Q3CA 2ZWVA 4N0QA 3K72B 2WFLA 3C5EA 1Q3TA 1UBMS 1FIUA 2ZI9A 3JQEA 3R44A 2YXLA 2P3QA 3N2KA 1ZFNA 1QVVA 3PFWO 2PSJA 1Y82A 3UK0A 2BR4A 3HKEB 3LPLA 4ZT5A 4Y9SA 4ZJPA 3NMUF 2YOFA 2FVYA 2QU8A 4FFOA 4EB6A 1I51A 5KHLB 4EY6A 1FCJA 2GNAA 2GJ4A 1ZM4A 3PHBE 3C7KA 4HXYA 2TMGA 4OYLA 2IS4A 1A9RA 4AIIA 3A2KA 3KVNA 1BIFA 1MIHA 5B6PA 3QXJA 3QQ5A 1W49A 4HNSA 2EZ8A 5C7LO 5JARA 3PR3A 4OI2A 4AMYA 2HDHA 3U1BA 5ER6A 4HTAA 4RF4A 3LQYA 3JQAD 3OCVA 1SOWA 1YQXA 1LDMA 3PXUA 3TL6A 5THQA 2JI8A 2A94A 2BMVA 1VHLA 3SQOA 1AZTA 3PV0A 4B0OA 1L7QA 4J49A 3ZW8A 1RPAA 3BWYA 2CXOA 4BLPA 5EWMA 2GYWA 3QKSA 2C2KA 2NAPA 1XE3A 2GEBA 1ZNQO 1VI5A 4EUKA 4AS3A 1S2DA 2I4NA 3WLAA 2FPMA 5TT1A 3V8PA 5C9ZA 3PYLA 1RABA 1CF2O 2V8BA 2XB9A 1ISHA 4BPRA 4QQNA 1B4DA 4O4HB 1DAHA 4YMTA 1YVPA 3OAAD 1KEZA 1ZINA 5DW3A 4TKVB 3JQAA 2IPOA 4BNGA 5FLKA 5JAPA 4EKNB 1HTBA 2A5YB 2WUVA 4DCSA 2AN1A 4QUIA 4H08A 4W5QA 2GAOA 5AI0A 3B7WA 2I4MA 5EHXA 2VDMB 5EHIA 4CE6A 3KUCA 1P9OA 1E4EB 3IC5A 3DOJA 4XVCA 1KSFX 5CHYA 2PO7A 3C7DB 3HY3A 5EMJA 2BGUA 1O9GA 1OLOA 3D8TA 1II8A 2FOIA 3EUEA 4WD3A 5AR1A 2LCQA 2VDQB 4GGOA 4ZHQF 1TPYA 1M0TA 2JLQA 3PIDA 2IZ1A 2XVYA 3C6ZA 3GPDG 4P7GA 4RAOA 5JDCA 1RWXA 4MZDA 1P2TA 2K6GA 3UJHA 4E21A 5A02A 3RAFC 3OAAA 3I9OA 5H7XA 1U8CB 4HTFA 3OT5A 1HNXB 1Q91A 1Y37A 3OCJA 2E9SA 4I50A 3OEYA 2ACVA 2E48A 4G9EA 3ZW9A 2IOFK 1FUUA 3RIYA 3A6PC 2G4VA 2Q07A 2FPWA 2ID8A 1KAQA 3Q9UA 2A1UB 2AUNA 3VPDA 5K0TA 2EZTA 3VNRA 3SS9X 3C5VA 4MXDA 1D2GA 1ID1A 3B89A 1QTQA 2HNKA 2EG9A 2PJRA 2C8JA 3A04A 3EUAA 2RDMA 1AGYA 1BN6A 1DKMA 3IBTA 1FYDA 3IAM6 4B6JA 4KR7A 2E5FA 2GAJA 3PA6A 1XZPA 2CDAA 3IUJA 5FPHA 3FW1A 1NX9A 1CQWA 3EMVA 3WGIA 5TEWA 3TZLA 2J0UB 4RLQA 1NYTA 5DH9A 2QD1A 5F4ZA 3N0TA 3PWKA 2OV1A 2JGLA 2PZJA 3FTCA 4M1OA 1KYYA 5TNXA 1WD7A 3CRNA 4B82A 2DPMA 2WKSA 3VV3A 5MF6A 3QMPA 1IPEA 4NKRA 4EG7A 4JYZA 4LDRA 3TVYA 5CFRA 2PD4A 2ZRJA 1L1FA 5KTNA 1T8SA 3FBGA 5SV2A 1NM5A 4IPTA 4DCNA 4Z1MD 4EFKA 3SQLA 1CZUA 2WHEA 4RVGA 5PGMA 5TMBA 4WBNA 3GC6A 2HT6A 3O8OA 2PUGA 1NQ5A 3AEUA 3WNVA 3C5CA 4FJ0A 4OHOA 4B4OA 3AUYA 2CBGA 4UKDA 5I7VA 3JQBC 1YK0A 3TQIA 2OXIA 4UEWA 1T6XA 3I30X 3S2ZA 1A9XA 1KYZA 2PUDA 1PZXA 3QKRB 4F3TA 4MR7A 4BEVA 4UHBA 2YS6A 3I5MA 1HDOA 4JJAA 4TSKA 3V8RA 3CLRD 1L7NA 1UBKS 2QXYA 1K4YA 2PMBA 3FRIA 5FPPA 1N6HA 1DGQA 2V7PA 2J9YB 2WMYA 4BYGA 1D5CA 2GN9A 4ZYTA 3JU3A 3RLFA 3E7PA 1TOAA 3PPVA 2MMCA 4NLLA 4NV1A 3GRAA 4Z1MA 2VTBA 2PJZA 1K3TA 3H17A 2Y3IA 1D2EA 2FLVA 4KQXA 5IVPA 4MI6A 4IM7A 1SMKA 4R7ZA 4UHFA 4MS4B 3RBAA 2WJ4A 1CQIA 1FMJA 3R2JA 1C8KA 2W4IA 4KSBA 1OZ0A 2P0AA 5DHAA 1RQ2A 1XTUA 2JD1A 3GLFA 2YHIB 2IHKA 1IHYA 5AM4A 1KKMA 3OA2A 5E6UB 4P80A 5I7OA 2FW6A 5ALYA 3DMTC 4F2DA 4CGZA 4RTMA 4C3OB 4J3FA 3TVDA 3NHUA 3WDSA 3N2LA 2W0MA 4HT3B 4LYGA 2O2EA 3BB4A 3EZYA 4NE2A 3TMAA 4CM8B 1W35A 3FUVA 5AXDA 3Q40A 3K4HA 4J7UA 4L9RA 1SPBS 3UICA 3QVUA 3BWBA 1KMCA 3VX4A 1T29A 5DWQA 4CFYA 4GRIA 5JSUA 4JBXA 4IOMA 1I30A 1MIOB 4BZWA 4PY2A 3C1AA 1QRSA 1C7JA 1J22A 3O8LA 1D2HA 4MVYA 2CCKA 5BSVA 3I2IA 4MGHA 1PO7A 2P90A 2RKWA 2PKRA 1XRJA 2CXPA 1BXRA 2CYCA 3GRRA 2FE4A 2V98A 2ZQZA 3L84A 4KDFA 4GI7A 4NIMA 3RK0A 5AVRA 5JECA 1M73E 1C81A 3X3HA 1HI9A 2OBNA 1VMDA 4UDYX 3O8RA 4IUCS 4AF6A 1N0UA 5L7YA 3K96A 3O2QB 4KB5A 4U2FA 2VPXA 1EVYA 1X70A 5D5PA 2Y1LA 4TWJA 5IXJA 3H99A 4HB3A 1QZ3A 1VL2A 3FVWA 3RGGA 5ED0A 1HMYA 3MLEA 5AOCA 1AKTA 2AQ8A 2VTKA 3UB4A 1JR3E 5CDTA 1E9AA 4YAOA 5DSZA 4P4TA 4YRQA 1Q0SA 2JZCA 1UZAA 2EF1A 2G1AA 1EKXA 5IJ0A 2NO0A 4AZWA 5FDFA 1TZCA 1OIVA 5I7EA 2NYUA 1HYQA 5CA0F 4BEWA 3LE8A 4FOOA 5C35A 3U6KA 4GWKA 2X77A 2HF9A 5ALUA 4AKTA 4AS1A 3A7DA 1IEWA 2RJOA 3CLTD 5A3QA 3W1WA 3ZTWA 3DDHA 4R6XA 1PFUA 3VNBA 3DBHB 2A58A 4R0NA 4U2CA 2QW0X 3FUWA 1H6BA 1T3GA 3IAHA 2YL2A 1S9HA 3A1NA 3NGMA 5CG2A 4MRSA 2BE7A 5LD2B 3KSBC 4WH0A 4LCBA 1C30A 2VDWA 1Z45A 1SXJE 3BSSA 5TQJA 3WWCA 4YGYA 2Y0DA 2CCJA 3AINA 5AM3A 3LDUA 4NEHB 2QYTA 3OPMA 5EUCA 10MHA 3ZCPA 5ENZA 4FYJA 1VG1A 4Q93A 5DBFA 4J16A 3K0AB 2XQIA 1BJRE 4EG3A 1T4MA 4GOXA 2C77A 3BGDA 4LFAB 3QTTA 1H94A 4BMSA 3E27A 3E9RA 3HYLA 1KK1A 4KWIA 4D82A 4Y2YA 4UNRA 5KTMA 5LOVB 1I4TD 5F1KA 4CFSA 3L3BA 1CR1A 1VC2A 2GO7A 2G7MC 4R68A 4OYRA 1P1JA 3G8DA 1Z8NA 2AOUB 4N03A 4C0WA 3BMQB 5K8CA 2X5KO 2DAPA 4K26A 5C3UA 4BNWA 5LZ5A 1XCMA 1CY4A 1JDTA 2ZVJA 3CZQA 4DWJA 4DC9A 3MTQA 4IW3B 1P5ZB 1Z6QA 3RPEA 5TDHA 1VBFA 1JYFA 4JUFA 4HNTA 1PJ4A 3BDAA 1GPYA 5ENVA 4IQ0A 5IZ4A 2XE6A 4ND2A 1FK8A 1KDOA 3KQMA 5JXHA 2W93A 2H06A 1O2DA 4HS4A 3VH2A 1D07A 2QK4A 3ORFA 4HQ0A 4EGAA 1T8WA 3FNEA 4LNAA 4E5KA 1VM6A 4KN8A 5HIMA 3RSFA 2CXQA 3EHEA 3JTEA 4OUDB 4ID3A 2FFQA 2OVFA 2ZWIA 2XKBA 3D2BA 3OE7A 2JJ2D 3FZEA 3OTWA 4K6GA 5UKDA 3SSMA 2PUFA 3NT2A 2ONKA 1PHRA 4KQKA 3V00A 1IEXA 4D0GA 4AJ9A 1PR4A 1EB9A 1F38A 2QSUA 1RLIA 3AEKB 3DLTA 1F4VA 4RDXA 4EEKA 1CXZA 1T2AA 3VVMA 3E15A 1J9ZA 1H3FA 3F2IA 2WTXA 1UP6A 4HWKA 1FJXA 4MKHA 2OAQ1 5DTEA 4ML3A 4X7MA 2WW8A 4QTUB 2B8TA 2H85A 3C3YA 2XMBA 4D99A 4NH4A 2BKXA 2BVNA 2PH1A 2QVBA 3M33A 3OJOA 2AUMA 2VH5R 6AT1A 2CMFA 2JJ2A 3W04A 2VDUE 5A7GA 3HXLA 2DX7A 3D2CA 5JSZB 5C18A 1AVTA 2PCLA 3ZDQA 4OXYA 3P9CA 3K0EA 3GR6A 1CY2A 3FYUB 3M49A 3LL4A 4N7MA 1PWEA 4DJAA 1Q2XA 2VUUA 4Y2HA 1AUQA 2A67A 3DVLA 3OCZA 1RAAA 1FNSA 3P2MA 4O4LB 3NOQA 4DNOA 4WPGA 3CV3A 4LS3A 3QVWA 2REOA 3CEAA 3ZIAD 4JCCA 1V4VA 3JYOA 5M2QA 4XCVA 4BGVA 1UWKA 3N2YA 4ZEMA 2J4DA 3KR9A 4NFSA 4ECEA 4POAA 4DKXA 5L51A 4J6EA 2OHJA 3U7RA 3NORA 1LVGA 1R3DA 1OASA 4TZ6A 4B33A 1MLDA 1VYVA 3T7AA 4JVMA 2A4MA 2V3VA 1SUEA 4AT1A 5FPKA 1P7PA 2C5EA 1LDYA 2GJAA 2W2VA 2XE8A 3GFPA 2FN7A 3NDIA 4MGKR 1EP2B 3ZE1B 1VSTA 1Y6ZA 4ARSA 2VBIA 3H83A 3QX7A 3V1MA 4KN6A 3OJCA 3ADDA 2VAPA 1NVKA 4R2HA 4BX9A 2WIJA 4TV8F 2JGAA 2JH8A 1JX6A 1YQWA 2O7QA 4GKKB 2RBKA 4F71A 2PV0A 5IHXA 4IMRA 1DZ3A 5EQDA 1QZUA 4ZXPA 3RRXA 2OCGA 4DMHA 1HH4A 3QEMA 5KQLA 2FI1A 2XGOA 3EA5A 3H9QA 4QHYA 4K0KB 5I9IA 4TKUA 2FX3A 1UDWA 2IYPA 2Z9BA 4KXNA 1KYVA 1RQPA 1TMKA 5ILOA 3VC7A 1VJRA 5ANRB 1DVRA 5L6LB 2OCYC 4F21A 3FYDA 2M1XA 3ACBA 4KE7A 3NGLA 3S2UA 1JDNA 5C53B 4G0XA 1O7JA 5I7AA 2IZZA 3D3KA 1S8NA 1PK9A 3G88A 3KC2A 1OBCA 2VHWA 2IE0A 1QFMA 2MINA 2QZZA 3HADA 3HLYA 3I2JA 4I4CA 5HE9A 1IEVA 5A06A 5KWEA 2F4NA 3C6KA 3O3NB 3OTQA 4G89A 1H1LB 1Q0RA 1Y1PA 1VB3A 3GZJA 5JI2E 5KVSA 4EF5A 3MB8A 3EVNA 1QKIA 1W52X 2BCJQ 1NC1A 1O96A 2DUMA 3BAFA 2PLAA 2YCBA 3TIVA 1MC4A 1N57A 3EZLA 3PKJA 4KYUA 1V95A 4ZOBA 1UBGA 3EFOB 1YZVA 4I6EA 1RDFA 3OZBA 5BSWA 4ZK2A 3DD1A 2IV3A 4TT8A 3K9GA 1CK4A 1L5YA 4PYOA 4QTTB 3IPLA 2PDAA 5HBRA 5K2MA 1Y4DE 3D5QA 1LPNA 4Q3CA 1NULA 4U7PB 1K89A 1K6XA 2JCGA 2HMTA 2L42A 3D1VA 5EIFA 1KAOA 3BSFA 2BKLA 2Z3WA 1ONPA 4KGDA 5ICCA 5BMVA 3OY7A 1VA5A 3HA3A 4YDHB 2V58A 4YJ3B 3SJZA 3DHVA 2DHCA 7AT1A 1XMPA 2ZGVA 3T3IA 1E2FA 1I4WA 1L7AA