4JQOA

Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with citrulline and inorganic phosphate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
338
structure length
338
Chain Sequence
b'QSNAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine carbamoyltransferase
publication title Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
rcsb
source organism Vibrio vulnificus cmcp6
molecule tags Transferase
total genus 133
structure length 338
sequence length 338
chains with identical sequence B, C
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jqoA01
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jqoA02
1A1SA 1ZA1A 3KZNA 1AT1A 1F1BA 8AT1A 3Q98A 4WTOA 5AT1A 2QGFA 4A8PA 1ACMA 4F2GA 1EKXA 4EP1A 1FVOA 1DUVG 4KGVA 3M5CA 1RABA 3KZKA 3L06A 1RAHA 4IV5A 1C9YA 1R0BA 3D6NB 1ORTA 3L04A 1PVVA 2EF0A 4JQOA 2G7MC 3GRFA 3CSUA 2FZCA 1TU0A 4KWTA 1RADA 2H3EA 4AMUA 4A8HA 2FZGA 3L05A 4FYXA 4KH1A 1RAEA 4JFRA 1TUGA 3R7DA 2I6UA 2FG7C 2A0FA 5G1OA 4BJHB 4FYWA 3TXXA 1DXHA 4NF2A 1EP9A 1RAIA 1XJWA 1OTHA 1D09A 2QG9A 3KZOA 2W37A 4F04A 1SKUA 3E2PA 2AT1A 2ATCA 4E2FA 4KGXA 3R7FA 4A8TA 3KZCA 3D7SA 2RGWA 1PG5A 1FB5A 4KGZA 1RACA 4H31A 3MPUA 8ATCA 2BE7A 4EKNB 1TTHA 5ILQA 4AM8A 7AT1A 4OH7A 1NBEA 1JS1X 3NPMA 2FZKA 1RAAA 1R0CA 1RAGA 1ML4A 3KZMA 1RAFA 4JHXA 3R7LA 3UPDA 1I5OA 2BE9A 3SDSA 5G1NA 3M4JA 2YFKA 3M5DA 2OTCA 1ZA2A 3LXMA 2HSEA 3AT1A 4FYVA 6AT1A 3TPFA 4AT1A 2AIRA 3L02A 2IPOA 5G1PA 2FG6C 1AKMA 4KH0A 1EZZA 1Q95A 1VLVA 3M4NA 2P2GA 4ANFA 4FYYA 9ATCA 3GD5A
chains in the Genus database with same CATH superfamily
3FWPA 3DLAA 3K5IA 4M86A 3X44A 4TYQA 3ZZUA 4AZSA 1Z5VA 1W36D 4NBSA 2PL3A 2IIQA 4MXDA 2BFFB 1G8YA 2IRWA 4BKUA 4RMJA 1YOVA 4GKAA 1ULSA 1XTVA 1WBDA 1GQRA 3PPYA 4LOAA 1ENZA 2YHUA 3RUHA 3UW3A 4YMHA 1EJ2A 3OOSA 4O08A 1BE1A 2R8XA 1WQ4A 2E3JA 4NOKA 3EAFA 3UMFA 4BL5A 5HZGA 3DZHA 2PUHA 2P2SA 3QA9A 2JAXA 3RNOA 3V3KA 3FETA 5TX7A 3SEAA 3ULKA 1ZMXA 2UVPB 3K1YA 2CXUA 4TKMA 5EUMA 1XXHA 2HDOA 3FB1A 2XUAA 4LE1A 4D8UA 5K0GA 3UHAA 1JAIA 1GCOA 5FLEX 1ZM3A 5DKFA 1SMKA 2VR1A 3M4ZA 2P1DA 1XO1A 2V7WA 5KNLA 2PIDA 5M2QA 1Q21A 3I2YX 3QWFA 1P9NA 3PXGA 1RI2A 2JFGA 1TKCA 1ZPDA 4WLNA 5ITZB 2H00A 1O96A 5CLHA 3GAFA 4Q7KA 3SZUA 5JSZB 2I71A 1TYEB 5K0JA 5IVHA 4LF4B 4R8SA 3A3YA 4BVAA 2PUCA 2GA8A 1PSDA 1SVOA 2H06A 4XVUA 3EIXA 1JKXA 4M98A 5H81A 4FYWA 1GLVA 3WIBA 1NUQA 5D3MB 2QN3A 1E4EA 2VHQA 2PLNA 1GL7A 1Q0RA 2QLMA 1C0EA 1UMDB 2L17A 1KDTA 1TIBA 1WUTA 2Q8PA 2Y67A 2ZBVA 3HL4A 3JQRA 4FS3A 1XMSA 4G07A 1OQAA 4HTAA 4M55A 4M8NE 1TM2A 5TE9A 1KDZA 4XDZA 5B6JA 3KT3A 1FUIA 2D0PB 3FHTA 4FDTA 2Y9MB 2AHRA 3CINA 3C4QA 3HXKA 3B5EA 1CZOA 1MVLA 3L40A 3TR0A 1XZEA 4I2VA 2DH6A 1JQAA 3TPCA 3VO8A 3DE5X 4FKBA 2IY7A 3LCMA 4BP3A 5A1TA 4EO4A 4H6XA 1YTUA 1C81A 1JR4A 2XVMA 2ZTLA 3KEFA 4A2QA 3W78A 3PGA1 1RYHA 1W35A 1NRXA 1X7HA 1AS3A 2WNHA 4XA8A 5CT8A 5HF9A 5D00A 3UK2A 3X1WA 3I9KA 2O23A 4LRUA 4CT5A 2ADOA 1UUFA 1Z4JA 1E62A 3CCBA 4X6UA 5DHFA 1C30B 3IKMB 2Q8QA 3CSSA 2BZGA 1H2AS 1T3HA 1QFSA 2LW7A 1TZMA 4UHBA 3DEHA 2Y1CA 4D9IA 2J3HA 1VQ1A 3UWMA 3O2QB 5DBOA 2F9LA 3AB3A 1VJ1A 3DDZX 3GV0A 4BLOA 4G5XA 4EENA 1LPAB 5IUNC 3SF8B 2I9PA 3FZYA 4M0PA 1ISJA 1UC9A 3C3MA 4B46A 4DSTA 2C95A 2PMCA 1E1RD 2G82A 3OE7A 3JSAA 1Y5RA 1DBRA 4MQFA 1JHDA 2QRPA 5JYCA 3PRHA 1DQSA 2D74A 3GQBA 3V8EA 3D2CA 2ZBFA 3Q9NA 5KTTA 4TTJA 4WK4B 4RF3A 5EGSA 1Z4QA 3H84A 4IKEA 4DIKA 4JT8A 4FJ2A 3WQSB 1Q77A 1ZN7A 3ROPA 4E2XA 1SOWA 2AGVA 3EEIA 4OXNA 3ZQKA 1LLCA 9ATCA 2ZRPA 5KDDA 1PAUA 4EG0A 1GTJ1 4K9QA 4MVJE 4P4SA 1NUUA 4L0MA 3VNVA 4NNJA 5CK4A 1XWFA 2HLPA 1BD3A 1Q0LA 2QRGA 1WM1A 3HJHA 3C6QA 4BJ3A 4I1OA 4M2LA 5I8WA 3CX7A 4BGIA 1ZLXA 1SCAA 2Q2VA 2WK1A 4F5ZA 1XNRB 1XDDA 1RQRA 2I76A 4QU8A 4QYXA 1KO4A 1PR6A 1SBTA 1Q1QA 4IPTA 3I12A 5F7ZA 4CKCA 1GTMA 2UUBB 4C22A 1N6HA 3AHJA 4FLEA 1N5KA 1E99A 2QTRA 1KH1A 2WAAA 4P86A 2F64A 3ONDA 4NFLA 4AQYB 2FSHA 4MVJP 2EQBA 3O4GA 3HCAA 2Q2WA 4IDEA 4LTNA 4XAQA 3T52A 5BV2P 1YKGA 3AXTA 2XWPA 2YJ4A 1MC1A 1YI1A 2GI4A 1HORA 1ZONA 4EJ0A 5KJ6A 1HNZB 3L05A 1S3SA 3MRTA 1GCAA 4HADA 5FCDA 3V2IA 3S1AA 1NMEA 5H70A 4MB2A 4NU8X 1EI9A 4OLBA 2H7YA 2ZVQX 1FX0B 4CEHB 4NZZA 2P4UA 2BAGA 4KO8A 4B9AA 1Z07A 1CRQA 1E9BA 2VQ3A 2PFKA 2ZDQA 2V4MA 3IODA 3KUCA 4KX3A 3T7KA 4EHBA 4P0QB 5TMDA 1RXYA 3THYA 4M1WA 2D1QA 5SICE 3NVKI 4KGDA 3DW1X 4JVLA 1IXKA 4B84A 4FEEA 1T5TA 4AP5A 1UAGA 3OI7A 4OHRA 1YI8A 4DHWA 2I66A 3PEFA 5CEEA 1L5ZA 1U2GC 1RQXA 2AT1A 5GV7A 3RS0A 3LUFA 3AEUA 3NIFB 3ONEA 2COEA 2I80A 4KL8S 2C1EA 1K7XB 1JNXX 3REQA 1Z4IA 1KKLA 2EZUA 3TGWA 3MK31 1NXXA 4KHZA 4PU0A 5CX1B 4QE3A 1X7ZB 3DCNA 4D9NA 3LRPA 3W77A 4OM8A 3RC8A 3IB6A 3L1JA 3P9YA 2GD0A 3RIEA 2HU7A 3SOPA 1JLRA 3USCS 5JFGA 2YFYA 1NYRA 2J08A 5EWJB 2FHSA 2PQMA 4OGKA 5HHTA 2BE7A 1O4VA 3D7KA 3B6EA 2IIBA 1ZGHA 1MZVA 2N3ZA 5J2TB 3ROEA 1VPWA 2QJTA 2WIAA 4L16A 4ZQGA 3CVOA 5FR1A 1BVRA 4G5QA 1SCKA 1Z0UA 8ABPA 1P60A 1F3OA 3F7TA 5BT8A 5K8TA 4BMXA 3RVPA 3NWJA 3P20A 4E2ZA 1ZCJA 3H2JA 2OM2A 4ALJA 1JLSA 4E12A 1ZOOA 2YBDA 4IGEA 4L8YA 4UAGA 3T0GA 4KR6A 1CZHA 3ZHCA 4YWJA 3W4KA 1G4UR 5IBRA 3ZKWA 2XNDA 4IWYA 2RGNA 2ODNA 1G3UA 4AIIA 1RS0A 2ZRCA 4YCBA 3ISJA 1A7JA 3PF9A 2FW0A 3BPSA 2VZEA 4CQMA 1BS9A 3UK7A 1GZ4A 4IOJA 4KR3A 3P96A 2ZB8A 4H6PA 2PMBA 4WAUA 3VOBA 4PAOA 1HDIA 2HFJA 4QHYA 3CW8X 3PE4A 1R4MA 4ND3A 3CPEA 1D4FA 1HQKA 1Y8QB 3K6SA 3I5AA 1UC8A 1L7XA 2DPMA 4WKPA 3LY5A 4JR1A 3WNQA 5FWYA 5ICCA 3L4JA 1FRVA 1O97D 4NVRA 3WOVA 2QT0A 2J6IA 4RPGA 3UMBA 3MM4A 1XKLA 3FA2A 4FOPA 2VK8A 4HWRA 3ESYA 1VMEA 3AR4A 3TZEA 3VJKA 4CM7A 3LUGA 5LP6B 4I8DA 4FP9A 4PTYA 2UXBB 1MIHA 3GAMA 1FPQA 2P78A 3C5HA 3CZCA 3OTWA 5HGJA 3W8RA 3ZQ4A 3ZIUA 3ZWVA 2WSBA 3QFFA 5E8RA 2DQYA 4YR7A 1L4NA 3KWFA 1SB8A 2EF0A 2P40A 1FU7A 2P68A 3AI7A 1QHHA 3GGOA 3LXXA 3RIGA 4B3FX 4E70A 3D8RA 2JDIA 3R24A 2AUTA 1TEZA 5EJFA 1X7XB 1ZMBA 4JA2A 2SECE 2EOAA 1C29B 1YGPA 5I45A 5DXFA 4JJGA 4PFSA 1JDUA 4UTOA 2ZWMA 2BGKA 3FH0A 1P1RA 5C8YF 4YI5A 2HUPA 2OZPA 4KRGA 5KNBD 3FUTA 5FX2A 4XTRA 1AHNA 4UHKA 3KU1A 4IWNA 1T36A 3A2LA 3F96A 3Q10A 1JB1A 3JALB 1U11A 4YCNA 1FRFS 1T0BA 3QPCA 4JC5A 2DFDA 3LDFA 3SS9X 1E3TA 1OGYA 5I5EA 2GJ9A 5ADWA 3UJNA 2FZ5A 2IXAA 4XWOA 1CIJA 3F9CA 3QNUA 3ETHA 4WCFC 1PFUA 7MDHA 3I9V1 1QVVA 3BD9A 1R0XA 3UCFA 1SG0A 2D54A 1G18A 2Q4TA 4RA9B 4DSUA 4ZVOA 1Z63A 4BEBA 4ZK2A 3RK4A 2OBXA 2V1UA 3QF7A 2JLXA 2Z2IA 5J4KA 1TD1A 3NG1A 2JC3A 3I61A 4A8TA 4PYNA 1LDMA 4IIFA 3SSOA 1BE8A 2BSXA 3ZD6A 5DRTA 2O3TA 3ZIAA 2FJUA 2JAOA 1V5IA 1GPKA 1RT9A 3JZMA 4EK9A 1WKVA 3BGDA 5ALGA 4WA7A 4L27A 2V1XA 2EIXA 5A0TA 3C3CA 3ZXSA 1GHTA 1XA4A 2RAVA 3QZUA 4P5DA 1VMKA 4KU4A 4U2BA 3AWDA 3P9XA 3BIXA 4CQLB 1U2DA 3PXDA 3JQ9A 2O5CA 2LV8A 2Z5VA 3ZYZA 3QFCA 4QM6A 3T06B 3AHCA 5BOVA 5BUZA 5B6IA 2A1TR 2DLDA 3GUVA 1ENPA 1TYCA 3UM9A 3RS9A 2QU8A 3DHYA 4NNPA 2OYCA 2IHKA 1E8MA 2H6EA 4Z1MA 1KGSA 4D74A 4E3WA 3IPXA 3LUCA 3OWOA 2WPNA 5TF0A 4NBKA 3CLSC 4Q4AA 3RADC 1SKQA 1SIWA 3OX3A 1G21A 4PSUA 5HIMA 2ZANA 4IJKA 4FFMA 1XVTA 4A0FA 4UNNA 2GSWA 1IM8A 1OLSB 3AF6A 1UBSB 3IUJA 3LHKA 1B8UA 2HTFA 2GWRA 3O38A 4YAUA 3LBFA 4B47A 4QFDA 3K53A 2YV1A 3T41A 2BLLA 1A04A 1EJ6A 4DGSA 1AGPA 4DLYA 4DA8A 4R9NA 2N46A 4UTNA 4HH3C 1AT1A 4R1TA 4C0JA 1J00A 4Y1EA 5CVJA 4FWTA 5SY9A 3ZDFA 2HLNA 4Q02A 4ZV7A 2QENA 3ZCSA 3HRKA 4G0OA 4LI0A 1Y5MA 1E2MA 1T5BA 2GZ3A 2YIVX 3R6TA 5K5EA 1V39A 1TFUA 4KQEA 3K9WA 3CH4B 2MT9A 1AMUA 1I0ZA 4QKQA 1DAOA 1ZK0A 1NAIA 2B4TO 3R5JA 4ZU1X 5H3CA 4D9MA 3K5HA 3PD0A 4X1KA 4HDSA 1TT5A 1TF2A 2JGRA 1IE3A 3L6DA 3I2IA 2DRIA 3NUZA 4Q7MB 1M1XB 1XLVA 2Q7XA 2YQ5A 2ARKA 3GX1A 1WUYA 4FINA 1DCKA 4BRSA 2RJNA 5HOQA 2AJ8A 3ZW8A 1FTWA 1RJGA 2J30A 4TQGA 4NYJQ 2FWBA 2W2LA 3KKLA 1DWQA 1P7CA 3HJFA 1TA4A 5AOCA 2OZVA 4XPIA 1T4GA 3CLVA 4YI3A 3PNMA 2VBCA 2ZB4A 5LXTF 2OILA 3HA3A 5TMBA 5C1DA 4XX0A 1BVHA 4UREA 3JQEA 5DX1A 3T4UA 1I94B 1L9XA 1PJAA 1DUSA 4FEYA 2O2YA 1GSAA 3WJ1A 3QU7A 4B5LA 5FL7D 4ER6A 1O94A 4B2IA 1J5EB 1IYZA 3LLMA 4JLWA 3GD7A 3OTHA 5EHNA 2B1IA 2WE8A 1NLZA 1PV1A 2FJPA 1XN1A 1AK9A 2ORED 4UUAA 1NVXQ 3RFUA 4W5HA 4CGYA 2BFBB 4NJMB 1T5LA 3CSDA 3WWOA 2GS9A 5I7EA 1HYBA 1QS0A 1W4RA 1L5YA 3BM5A 5JAHA 4RMGA 2ZSJA 4R7ZA 5JFTA 3DVQX 1N0UA 2BM1A 2NZUG 2R2GA 3N7TA 5HFAA 3ZGNA 5KNBH 5BVGB 3WNCA 3PC4A 4Y7CA 4NMMA 2FPPA 5F4ZA 1AE1A 4S2UA 1QH9A 3UG7A 1N6NA 4F4JA 2YRFA 1QGED 2HBQA 3SD7A 1CRPA 2EXXA 1Y33E 3O95A 2YV4A 1XTRA 4YBZA 2XITA 3T5MA 4BO7A 4QATA 1TPYA 4URFA 5IF3A 2GD6A 2O2GA 4FQ7A 1NLUA 4LYAA 4BX0A 4S12A 4UU1A 3VNUA 1YK1A 4OHYA 2VWPA 1Q84A 3NBYC 3W79A 4A2WA 3WRYA 4DA9A 2WIGA 1LPSA 1L4YA 4OP3A 4TL7A 2FFQA 4P53A 4J16A 1KK1A 5ICGA 1JBKA 5A3RA 1C3JA 3IA2A 2C4MA 3TQQA 4DMFA 2LCFA 3BREA 3MQFA 1E89A 2ZTMA 4R9RA 4XDGA 3DV9A 1GPJA 2B1JA 1O6CA 2DJ5A 2C92A 3EF1A 1A8IA 5LOVB 1IN5A 1L8AA 2CJXA 3TD6A 5IULC 4U0JA 1EXNA 1RYBA 2Q07A 4NI5A 3P97A 4XD7A 4IZ6A 3GNSA 5D1NA 3D4OA 2NSJA 1RXEA 3NLLA 4KXFB 1D6JA 1Q1GA 3DL0A 4XLLA 4L15A 5CA0B 5CCDA 3TUZC 2GDZA 4YECA 5DWVA 2CMDA 3A26A 4R2XA 4QL3A 5IBPA 3MJ4A 3WGMA 2BFEB 1L7VC 4Q7LA 3VH1A 4XUEA 4BZPA 2GBCA 3KKKA 3L93A 4EMUA 3WLEA 2OO5C 4L9AA 5K0ZA 4R51A 4WOPA 1WTAA 5ESXA 4GGOA 4R01A 1A1SA 2HMSA 1ZA1A 4B7XA 3AILA 3RARA 2XXAB 1RDFA 5KVSA 3ND7A 2W2KA 2PS3A 1PL8A 5DYNA 3GFBA 4YYZA 1N32B 5AUQA 4D3ZA 1Y9ZA 2Z9DA 3OP4A 4LUCA 3SF0A 5JZSA 3ZV3A 4G0NA 3AUYA 3SAJA 2UXDB 1BC5A 3CLKA 4MI6A 4RKRA 5CVCA 3FWYA 5KX5F 2Z6AA 4A7PA 4CLHA 4EYQA 4YMIA 3RIYA 5JJKA 4FNAA 4BNDA 1EXWA 4B3GA 2PM8A 3G2QA 3GPLA 4W8OA 2W0MA 5LQAA 1JH8A 2B37A 2YV5A 1PGPA 4C20A 3QKUA 1ECFA 4AJHA 3BE5A 2DFVA 4BYGA 1W1WA 1SQGA 1MQ9A 2AFVA 2GZ1A 3U7QA 2VPXA 3EZGA 2K6GA 2GXAA 5K4HA 1FMFA 4TM8A 1NUSA 3I4CA 3D0QA 3GMTA 3L8MA 1IMOA 2ZYVX 1OH6A 2EKBA 4ZICA 5KYUB 1YIOA 2OHIA 3DLHA 5DM60 4FN5A 1R12A 2IBSA 4XSVA 3FUVA 4XRGA 1DC7A 2WDPA 3HN2A 1MU0A 1Y4DE 4IHJB 1DZ3A 3L07A 3DTNA 4L4SA 1Z6QA 3OIDA 4X84A 1FLAA 5AM0A 2GASA 4AAYA 3UA4A 5JNVA 5L4LA 2ISSD 1K6EA 4P3PA 4UFOA 1TCAA 2NV6A 5EXXA 4K05A 5IC6A 1WDLA 1Y8CA 3AJEA 3RSQA 1HYHA 3GGPA 3VDRA 5KSZA 1N9GB 3RAJA 3O3OB 2PTGA 5TSDA 1EX1A 3IR5A 4HDRB 4HVLA 2QIPA 3GC6A 1P9OA 3CXUA 2WR8A 4K40A 4O3MA 1T3TA 1ZEMA 2QN9A 1QORA 1S1MA 2P62A 2LXNA 1YQUA 1QG0A 4GPZA 4LHWA 2NZ8A 2BFFA 4S35A 4RLHA 4GRIA 4CNQA 4OLHA 1IRXA 1EGQA 1OFTA 1PT5A 1Q2UA 1QIJA 2P9HA 3BERA 3BGVA 3LOQA 4LXTA 2ZRGA 2EP7A 4QLOA 1O0BA 3NHRA 2ORVA 1HY3A 2ENWA 3ST7A 4ENPA 1SVWA 1CE8B 1SNYA 3H8WA 1Y8ZA 1G5RA 2FDXA 2I4MA 3E5RA 4HH4A 1F48A 2P69A 4NZPA 3OO1A 2JCSA 2UVPA 4P5PA 1QP0A 3EG9B 3N6VA 3SCZA 3IBFA 2JLCA 2Y4NA 2WFMA 4JH0A 1Q91A 3NHKA 4NG5A 3F7NA 1SPBS 3OFNA 2P6MA 3GZ4A 3H4IA 5F73A 5B6PA 1GGEA 3B9RA 2QD3A 1PFVA 3FNGA 4BFVA 3RROA 3SVLA 4R2KA 1W5TA 5H3HA 5AVZA 4GYWA 3IHWA 3BXXA 1KZ6A 2X0KA 2YFQA 1ID1A 1XZ8A 2GZSA 3KHSA 1J8DA 1GZHB 4V02A 3G6KA 4OU4A 5ITZA 4A15A 5JSZA 1ZCAA 2PRZA 5JLAA 5AJYA 4ALIA 1QP8A 2R8PA 3BGWA 3EXHC 3V1MA 5ADVA 1OT3A 3PHIA 3NDJA 1KI8A 2O6LA 2POCA 1B0PA 3GDGA 4NFYA 4X1OA 1XMJA 1PL6A 1QYXA 3L8DA 4LSMA 5D3MA 1ZGGA 1S8AA 2WILA 3WAKA 3ZHOA 5A9RA 1N2SA 3M7IA 5IT4A 1YBVA 3EZXA 1UMDA 4WZBA 3MEQA 1J2JA 1R0ZA 1XZAA 1BXRB 4X6XA 4TXNA 4QLAA 3DR3A 1D04A 2CEAA 3OZTA 4KFSA 1DXQA 4M8IA 4BBAA 4PSKA 3ZU5A 4DWVA 3ZE1B 2PRSA 4E94A 4A5SA 1X9HA 1UBLS 3DT6A 3U9SA 1VGQA 2BHLA 1KGDA 2FGKA 4QJ3A 2RK4A 3A3OA 3ORSA 4NJEB 4RHUA 4WW0A 3VDNB 4RS3A 4K81B 4ZVVA 3CZPA 3DXYA 1ZN2A 3SJAA 3IV6A 4U9HS 1DU4A 3G9TA 3NJ8A 2KX7A 4NBLA 1ST2A 3O1HB 4DA0A 3G85A 3QFHA 1KH2A 2R6DA 2FQ1A 1Z75A 1TC2A 1XPJA 4MUHA 2QUJA 1KU6A 3LV8A 1U98A 5F3RA 5F78A 5KYVA 2PKYX 3WZ2A 1AA6A 1C30A 4EM6A 2V7QA 1QH8B 4BYMA 2IV7A 2QAGB 3KXIA 2O8DB 5IFKA 2O4CA 3CRNA 5H16A 3VHRA 2XDWA 1CTQA 2WVHA 5HKAA 3TDMA 3V46A 1E2JA 4RVGA 3SF8A 3FAZA 2YS6A 2RB5A 4BNNA 3EXEB 1E7SA 3PUXA 5C18A 4NYMQ 4R71A 3PA6A 3TF5A 2X5NA 3E3AA 3BFXA 3WO0A 3AUXA 4D99A 1HZZA 1PW5A 2C4TA 4YASA 4PCVA 1MD9A 2QJOA 4GWKA 1QF7A 3HWSA 1ZMOA 1SK8A 4J9UE 3FVWA 1QE3A 1XFDA 4KQGA 4F3KA 7ADHA 3ZPXA 1OB2A 4S0ZA 3PJEA 4HG2A 1RHMA 2VF2A 2X3YA 4GZ5A 4HATA 3TOSA 1EBFA 1XEAA 2XUDA 1SCQA 3LDHA 2FP4B 1DFHA 3MINB 3ZV4A 4A8JB 1V9SA 3HVKA 3MUOA 2LZ0A 3F6EX 4TS1A 1UMCB 1IJEA 1P5JA 3C3EA 3NC1C 1E1MA 3HP7A 1CZKA 1Q50A 2OXIA 5CA1B 2BLNA 4F84A 1W5SA 3IAM6 1U1DA 1MTZA 3UAGA 3COPA 2IPXA 2MHCA 4EYEA 5JMWA 1UBEA 1T9DA 3E3NA 1N25A 4OK5A 4QOJA 5E7MA 3DA8A 3W9SA 4U2EA 3UJ3X 1EFDN 1YTLA 2RMKA 3MS4A 2Q3DA 3PK0A 1YR9A 4FMDB 3NGLA 5FO0A 5KQMA 1T3SA 1KBZA 2DLCX 3V5NA 1XRPA 1IK4A 2V74B 4M8SA 5B7NA 4ZZIA 3LLSA 4BB0A 2ZIZA 1Q0QA 3AUKA 3MT0A 4Z9XA 5GJWC 1JJFA 5FQOA 2VI5A 1U8ZA 3GPDG 3T8YA 5AVVA 1IBKB 2BKXA 2XV1A 2HZBA 2VP3A 4GEGA 3RSOA 3REOA 2IEZA 3OE4A 3WIDA 3D0OA 1DG3A 4RENA 3UGKA 3U3XA 4OJNA 1FX0A 1MJGM 2B35A 2QGZA 4CEHA 3DLIA 5BSMA 2CNKA 5KOHB 2KW5A 4IHKA 3R7SA 3RKSA 1S02A 4JI8B 3ACBA 2YICA 4MUAA 2OYRA 3CXRA 4QARA 4MDFA 1WMEA 1FCJA 4GW3A 4MLPA 2QQGA 1H8ED 2WD9A 2IPOA 3GAZA 3H0CA 3N5KA 3SFTA 1XZKA 1IAQA 4GPD1 1I4WA 4OY3A 4B4WA 5L4NA 4AS1A 2R6FA 4ERXA 3X1KA 1X7DA 3L7NA 5COBA 4ZT2A 1ZFNA 1JFSA 1GL9B 1M2GA 2FP3A 2IXGA 5HIJA 1PJCA 1ZWLA 2R7NA 4XEUA 1F2TB 1U1GA 2UUCB 1I10A 3K6JA 5CX1A 3V3TA 1X1TA 1X7ZA 4HX9A 3BWXA 5ETJA 3PWZA 3WLKX 4GE3A 3NT5A 1GTL1 3H19A 3U49A 4IVNA 4AKTA 4GZMA 4EY3A 2NO6A 4H17A 1RWXA 5EWJA 4ZZ2A 1YRBA 2RHDA 5I9NA 1A71A 4KN8A 1EM6A 3MW8A 4RZ2A 3KZKA 3U81A 4PBTA 4PFQA 3W6NA 4YMSA 2G1PA 1WE2A 4QQFA 3JSXA 1PZEA 1ZH4A 2EYQA 2WTNA 3HBNA 2ZAOA 3QPAA 1KBQA 4XQ0A 5FTKA 3TJMA 3WJAA 3OMXA 2BKVA 5A2QA 1J1ZA 2NO4A 2NT4A 3T3GA 1YRWA 2FSPA 2JBHA 4DJJA 3L0BA 1E9AA 3SHFA 3R3XA 3PGKA 4RTPA 3KHUA 4EITA 3LO5A 3P9CA 1JA1A 3NNDA 4HEJA 4UM9D 3IXMA 2SKCA 3ABQB 3LI2A 3PRJA 4PONA 3TOXA 1RBYA 3UPTA 2ZYTX 3C7DB 5C8XA 4Q9KA 3WIVA 3N07A 4DY6A 1TMGE 3FW1A 2ODEA 4LDZA 3IT1A 1R0WA 2O52A 1XB2A 4NBWA 4QD3A 8GPBA 4DIEA 3PFNA 1EE2A 1KI9A 2YDYA 1BG6A 1TZKA 3LT0A 4BV2A 2GEKA 2P8SA 2RCYA 3O9VA 3EGIA 2R6R1 5C7YA 4QDOA 1T8TA 3W3AA 4I2NA 3NC4A 1M6YA 1N5DA 1YUNA 4OL9A 4RVDA 2ZSAA 3RYIB 2GPYA 4PBRA 3RC1A 3NBKA 1WHTB 3FYHA 4M37A 1DRKA 1Y8QA 4IX1A 3U0BA 5CFLA 1ZC3A 2IX3A 1KE1A 1D03A 3U4CA 4DG9A 4OXKA 1JB9A 3HS3A 4BNXA 1CYDA 4ETIA 3NYRA 4OL0A 1H0SA 3GCDA 1LNZA 4P3NA 2DHRA 5BUSA 2NP6A 5LMZA 1LUAA 1XRRA 1SZCA 5BNZA 3LX6A 1Q15A 3ET5A 4PS0A 5FTWA 3O8NA 1FTYA 2IYFA 2WP0A 5LP6A 4UD6A 1JAZA 4DQDA 2R3SA 5JTTA 4JJ7A 3S8MA 2CV2A 2R6JA 1RQNA 3FUWA 3HYTA 3KV1A 4X45A 2Y0PA 5DNVA 5BNWA 1MGPA 4KE8A 1PQ4A 5FBWB 1ISFA 2WWWA 1XMXA 1ZR2A 3QMMA 5GGYA 1TK3A 4TRMA 2CCJA 1YQ9A 1X7XA 4L8GA 1VSVA 2DVMA 1GA1A 2GQ0A 2C4KA 1R66A 1HSZA 2XCUA 4JEIA 3ZU2A 3SQWA 1YR3A 1NRWA 4WASA 3L8ZA 4I1YA 4EJMA 4CEIB 3HB9A 3L6CA 1VPTA 2VQEB 4GFDA 4QXOA 1BX3A 1PNQA 1RCUA 1E3IA 2F1OA 3EZFA 1NUAA 5CH5A 3S2GA 3UB3A 4D1YA 1EX9A 3REFA 1E6LA 3CJQA 3KV3O 1PZXA 1PUXA 1EQAA 4PVCA 4RX1A 4WXEA 3JALA 4B87A 5AVXA 1C9MA 3ORHA 4MHSA 4BO3A 1HEIA 2A4MA 3GUUA 1RYDA 2C82A 4BQOA 3C3XA 3TNDA 2H3HA 4RCVA 3T9CA 2X5OA 3CNEA 3KM0A 5F2OA 2XE8A 3DHEA 2QIOA 1IMJA 4AUEA 1NU8A 2AJDA 2QPOA 3D6VA 1P0CA 3ANMA 3HBAA 4J76A 4LY0A 3UHPA 2GK7A 1MV5A 1G7CA 2N42A 2B2NA 3DOFA 4G4SO 4MIEA 5ECYA 4EJSB 4ZV4A 4RA9A 4DLRA 1B2RA 1DKOA 3B8HA 3I76A 3T0IA 4D97A 2VQFB 5ALOA 4AK9A 4QFMA 5A06A 4G0XA 2QRHA 2PUVA 5TRTA 3AGPA 2FN4A 3G0HA 1EBBA 1UMKA 5CNJA 3WMWA 1DEKA 3AM3A 4F2DA 2PBLA 5CNKA 4HUQB 5D3QA 2Q1UA 2AN1A 1M0WA 4YRKA 1YDHA 3TN7A 3DNPA 2IHZA 1VXRA 3JWJA 1D2EA 3LG2A 4JNKA 1Z5ZA 4D96A 3JU3A 1W29A 1HDRA 4IS2A 2ZLBA 4P3KA 3J7TA 1A9YA 4YFYA 4ZEXA 3WTCA 3ZHSA 1CQWA 2QNRA 4OMDA 3A1WA 2B0CA 3UF0A 5J63A 3SYKA 2R79A 4CGZA 5ABPA 4NCAA 1DO0A 1MJNA 1FFXB 3L01A 4IRMA 1BMDA 4O2AB 2X1HA 4FD3A 1QVRA 1KFJB 4L8WB 4M9XA 4CQLA 1YVUA 1C3LA 5K0BA 1NPYA 1YCDA 1Q2XA 3DNMA 1W44A 4GAEA 2ZYAA 4KUHA 2NPOA 1L7RA 4QNRA 1FNNA 2QSUA 3LUDA 3GGSA 4BB6A 4EVRA 2I2DA 3TZBA 2DWCA 5DBFA 3ZHQA 2ZS7A 2BUBA 1LQTA 3QVJA 5IYZA 4M87A 4PLVA 4V0MA 1P6QA 5PNTA 2FUNB 3FF1A 1Q19A 3IB3A 1IBLB 2Y4OA 1ZMRA 2UAGA 3EODA 1I4OA 4B2LA 5IU6A 2WJYA 3N3BC 1OLSA 1NOIA 4ZU6X 5YASA 3DMFA 3ZU6A 2DP4E 2AL7A 3FOAA 2XIQA 2A94A 3K1TA 4MCAA 2VOJA 3QKTA 5IYZF 4YRBA 4NDNE 4PO9A 5HILA 1JSCA 2GJ8A 1QV9A 2QG9A 3U5TA 1EXVA 1KMQA 2HAEA 2HNBA 1KVTA 1NF3A 2D0IA 2J6BA 2XUKA 3CTMA 3RFFA 3JQ8B 2W6NA 4R9UC 1KAGA 1Y8RB 4BZXA 3LC0A 3HXQA 4WRRA 1LDYA 2PQ6A 2FR1A 1UFKA 5FFMA 4B79A 4BXOB 4RDXA 1SFRA 1FMLA 3BGIA 3L0YA 2C29D 2ZRBA 4PHGA 2ZYUX 3AZPA 4A1OA 4N0EA 4RTKA 1MRNA 4KSBA 1O6BA 5LQDA 1TKBA 3ENQA 4X1IB 1LLUA 1ZCFA 3NBUA 3L0SA 1ZL2A 2ZYHA 3PXUA 4K9RA 4V0KA 3VVLA 1TEHA 2A3NA 2BR4A 2IP1A 3UAVA 2IYUA 4D0RA 4CTJA 1NVWQ 1U0BB 4N9WA 4YCDA 2MTBA 1KEWA 2OOKA 4IMIB 2B4KA 4Y7DA 2H8KA 3NHLA 4E2WA 3IHTA 1E69A 3N0TA 4G56A 3I8SA 2CLEB 1H42A 1J2EA 1RAGA 2ECFA 4NBRA 2RHTA 5HUHA 4U02A 2IY9A 1C0KA 3INRA 2EX0A 3ZHUA 1IQPA 3PHJA 1W581 4B6FA 1WSWA 2QY6A 1JSXA 2ZETA 1Z5NA 3OEEA 4Q9LA 2PUFA 1VKRA 5MGBA 1JYEA 1E7WA 4JP3A 1YH3A 3TPZA 4KWEA 4B4UA 3HRHA 3JAWB 1CD5A 2JCXA 1IDOA 2FEOA 1PWHA 3SE0A 1LPNA 2M6RA 5KU1A 2O0MA 3T94A 5IJ0B 2DKOA 5J4VA 3PLRA 1GZDA 2FAXA 3PNPA 4YP9A 3ZCQA 5B7QA 1W7AA 1NLMA 3AHGA 4O4HB 1NXSA 2BFBA 4NJMA 4GKVA 2EP8A 4B1FA 3R8FA 4JLSA 3W2GA 1QHFA 2EZ8A 5I8ZA 4BFXA 2G71A 1KVUA 2PSJA 1ORDA 3GEHA 1YZTA 1E79D 1TM3E 3GGGA 1CG6A 4W1QA 5BVGA 3I52A 1WQ1R 2DHDA 4II2A 6CHYA 1JDPA 5KC9A 3V2GA 1KEPA 3P45A 1PQUA 1I2MA 2BTQB 4OYHA 5JZOA 1GG5A 2Q3BA 4WE3A 3BQMB 1G98A 5K51A 3P2JA 1SBCA 2ERYA 4KZPA 5E6SB 1GRCA 1ZBQA 1Z4NA 2W4IA 1MEEA 4ZD6A 1QLJA 1I01A 1TCVA 4LA4A 5CYGA 1NDUA 1HT0A 3FPAA 4M1TA 4UHEA 1ZN8A 2Y8EA 1J0AA 2XNCA 3B3GA 1ZRMA 3OJ0A 1P9RA 1C8BA 4G1EB 4EATA 2R6CA 4C4PA 4YHHB 3HWWA 1Y7LA 1HE4A 1G4AE 4NESA 3WZLA 3C45A 5ALNA 4ZVNA 4B45A 3ILXA 5AFSA 5EVCA 4N3BA 3I5MA 1RKVA 4IDBA 4UHFA 3V4RA 5AYVA 1V71A 4RNDB 3BK7A 5HJ7A 1NE7A 5L95A 5LOVA 1RYNA 1JR3D 2RGAA 3CKKA 4NYJR 3KL4A 3KQVA 4RLSA 5AJUA 1EWRA 3LQ1A 1XOIA 5CA0A 1MVOA 3MGGA 1XTSA 4JXXA 1U0RA 3NIBA 3SE7A 3GCGA 4DIMA 4JL5A 1T6BY 2BFEA 3NZEA 1MXFA 3GT3A 5JH7B 1AV6A 4GU5A 2YVQA 4AC9A 1JJBA 1XI2A 4J1NA 2HMTA 4OBEA 5IK2D 4ARZB 2OE2A 2EARA 3CZQA 1BFKA 4PM4A 3ELUA 2ABWA 3OA2A 2XXAA 1EBUA 4HBGA 1RIIA 4M9RA 1Q14A 5J58A 3IE2A 2PIAA 1E2LA 3GDWA 4OJTA 1WIWA 4D41A 1Z4LA 2Y6VA 3FTDA 1B76A 4OQYA 3WTBA 4JBIA 3Q8XB 3CA8A 4KBFA 2EFDB 5FQNA 4DWOA 5CD1A 2V7BA 1QXSA 2JJMA 4K2AA 1CFJA 1MO4A 2X8WA 4MP3A 1WULS 3LUPA 1Q7EA 1AUVA 5DSXA 2ZGVA 3TDNA 4CIAA 3ENWA 5FULA 1EJ0A 3V8VA 1EX7A 3H6KA 3EZ2A 1QNLA 5CLFA 4XFKA 1E5XA 3LY7A 3RSCA 2DTDA 4JWTA 1XCLA 1ECCA 1JIIA 2JJ8A 3H8SA 4JBHA 4AO8A 2GNOA 4CMIB 2QXYA 3RKUA 5BYKA 1Z5UA 3DZJA 3I72A 4BNIA 3TG2A 3CUVA 1ZN9A 5G0WA 2EX1A 4YRGA 3SJCA 3BAZA 4OGGA 2VO1A 5FPTA 1KI1A 4B6SA 2CY0A 1KI4A 4Q7JB 4IHJA 4XM0A 3ZBTA 3KQMA 2FB9A 1OH8A 2R8OA 2RAPA 3I1YA 1U0HC 4MK4A 4XLTA 1HSOA 4MP6A 4V0RA 4D8TA 4XWTA 3CTPA 1Y3IA 5DHUA 3Q6NA 1K7SN 5CFQA 1N9GA 1Z4MA 3DMDA 2X2FA 1F17A 1AG9A 1YVRA 4OEHA 4B3JA 3VAZA 1TADA 4HDRA 3A4NA 4PX2A 4B4DA 4D9FA 4RJJA 5HRUA 2G1AA 2RH5A 2QV7A 1G8AA 4X0EA 4RJTA 1UPTA 4V0SA 1Z0JA 3EJWA 1QIMA 4ON9A 1U5CA 1AKEA 4RADA 3HDYA 1NGSA 4QHTA 5K99A 2EFGA 1WWKA 4HAVA 5EPOA 2PZGA 1VI2A 3EH1A 3QK7A 4ZT7A 1L1EA 1JEEA 4D8VA 1ITZA 5KCZA 3WADA 1PRYA 2DKNA 4J0CA 2FLKA 3WAJA 1HG0A 4HDCA 3WLRA 2GN0A 1CE8A 2G6BA 5DF1A 2VFAA 3R9IA 1CY7A 1EZ1A 2GEFA 2ZR8A 5THQA 1HTTA 2GT1A 4R5MA 3HDQA 4Z51A 3FBTA 3EG9A 2ZRFA 2OCAA 5DMHA 3AL2A 3JZAA 3G2JA 3MSCA 4RTMA 2AD1A 4CKYA 2PZEA 4GPBA 3OURA 4HNHA 4QGFA 1EFAA 4JC4A 2DTEA 2BMVA 2A1UB 2GM9A 2ZIWB 3HFSA 2YWCA 4R84A 1V43A 4RPLA 1PYDA 4WBXC 1U6KA 3NU1A 2GCPA 3PHBE 3LGXA 3TTWA 4D25A 2G1UA 3GRFA 4MMYB 1P0QA 5LKAA 4HEA6 2G9RA 3WG9A 4COKA 3E9NA 1CRZA 5BR4A 3DKPA 4J3JA 5DOZA 4LBVA 3OZSA 4LZZA 5LB4A 1IWPB 5IS2A 1TTPB 2PEYA 4P82A 4RO0A 3JQAB 4JVNA 2WWYA 4CIBA 3FWNA 1T5HX 4EFMA 4KK4A 4N41A 4XGIA 1HFEL 1AF7A 1J2YA 2JFQA 1A1VA 4CDRA 2NSLA 4JJZA 5ECDA 1PJSA 4RJLA 3V8MA 2BGTA 2G8NA 1PNTA 2CYBA 4O4JB 1CR1A 3SICE 1V95A 4Y2HA 1KI2A 4JB8A 1BXRA 2QLLA 3DLBA 1UBRS 3MLEA 2OGWA 1PD0A 3BKXA 2JLZA 3H5TA 2WTMA 2H0AA 1YBAA 4YT2A 5F3DA 3L4KA 3PNQA 2GFIA 2HC9A 5B1EA 1K4KA 1Z73A 2WJWA 3IDFA 3OCWA 4LDPA 1QU3A 4LF8B 2GXQA 1NW7A 4NJEA 4GMHA 4TMFA 4I50F 5ANRB 3BEOA 4Z7OB 4IFEA 4ZT3A 1LV8A 3HU2A 2Q5IA 2BOVA 3A4YA 3HZRA 5DDIP 4MV7A 5JLJA 4H0NA 3IELA 3FHJA 1PYOA 3AC0A 1UKZA 2V7EA 3DBHB 4PAQA 2HCBA 4A6DA 4AJ4A 4NX2A 2XDYA 3BB1A 2F3PA 4QM7A 1FTQA 2QVBA 1JQ5A 3FY4A 3Q3EA 4RETA 5AVKA 3DFIA 1QH8A 3I92A 2LVBA 4C6HA 3MWFA 2BI7A 2QAGA 3L3BA 2OCIA 1SM4A 2O8DA 4MWTA 4A0QA 3I8XA 2FZKA 5KKAA 3WL7A 4YRAA 3H9BA 5ARDA 3S44A 1FYVA 1TEVA 2BCJQ 3F1LA 4FD2A 4W5TA 1CUJA 2VYVD 2VPIA 3P9ZA 4HQOA 3KSDO 4IIYA 4U2DA 2E55A 3E1KA 3EXEA 4H59A 4LX8A 5MN6A 1BS2A 1C7EA 1GPWB 4MUKA 2OVBA 4FN4A 3RAFC 4YQFA 4Q3AA 4YMGA 1NFRA 3NP7A 4D82A 4DF3A 5C8DA 3H6GA 4UNSA 5D6NA 2QRNA 3R44A 2FPLA 3DKIA 2XA2A 1PK7A 1J5PA 4L3WA 4JL8A 1E0SA 1PW7A 2QVZX 3HRIA 3RRJA 3BD8A 4AZTA 3NOQA 4FEAA 1TQ8A 4B35A 4DXDA 4JR0A 3V2HA 3PWKA 3RT9A 3SC4A 2HU2A 2CMHA 4OHCA 3MINA 1J56A 3NO4A 4CNBA 3L6OO 3ZX4A 1QFJA 3R3VA 4A8JA 1QPGA 2RGXA 5DHQA 5BOSB 1J1UA 2W8ZA 4JBGA 4H6VA 3P0FA 1UMCA 4OGWA 4OOFA 1ACJA 1P2BA 2X77A 1T24A 1TU3A 3OFVA 4GICA 1LLDA 1UBTS 5BR8B 3I01A 3E27A 1J9EA 5CA1A 3E84A 2ORIA 5I9TA 4AX8A 4DVJA 3O4HA 5KYKA 2WV7A 4KDEA 1P8JA 4NK5A 4R1OA 1B3BA 1CUAA 5FOSA 2FQYA 5FTMA 3TSWA 1LI7A 3GW8A 5LJLA 1P1JA 2OXFA 4AWXA 1LJ8A 5F5NA 1P1HA 3C6ZA 3CX3A 5IXJA 2LRHA 4BFYA 1E3EA 3WP0A 1DAPA 1VBFA 2EJCA 2V55B 2V6BA 4GUDA 4V39A 2ZBUA 2BEVB 5F2KA 1BKYA 3WS7A 1HDYA 4WKCA 1O0CA 1CLUA 3FPJA 1LK0A 4TMYA 5D3ZA 3RVLA 3AYXB 4WMLA 1PT7A 2EV9A 3DT8A 2CFSA 2H3EA 5LBUA 2B20A 1DX4A 1I0LA 5TPWB 4CU5A 2UYGA 2R8RA 3WNVA 4C2BA 2F3QA 3IPYA 1NNLA 4M53A 2A9RA 3OQOA 1UC4B 2GETA 4LJKA 4HWPA 3ZZ1A 2R6GA 3TXYA 1W8IA 4RD3A 2GTIA 3DCYA 1UC5B 4FXOA 3VHQA 2YN2A 3N7AA 1CR6A 3P52A 3R2JA 1NHGA 3ASYA 4N65A 5B7GA 5KOHA 1C4WA 1YZHA 1V0JA 5LA6B 1H69A 3PPXA 2WPDA 5GZ3A 1XROA 4UD2A 1KJJA 3JAMA 2EVWX 5DLEA 1QGDA 3NP9A 4OSEA 4NYMR 2IV3A 1IQ0A 4ZWNA 2JLRA 4ENSA 1ENYA 4DLWA 3OO0A 3Q7PA 6ADHA 1HOTA 2BHTA 2O0LA 2ODAA 2WJ4A 4KXNA 2ZTHA 2QD2A 1UZLA 3GEPA 4Q21A 2H5LA 2ZRIA 2SICE 2RHWA 5JPCA 1DWPA 4WXPA 4G8BA 5I47A 3DVRX 1D5WA 1FL9A 2WEKA 1P4GA 1F2TA 4LZPA 3U1TA 4C5CA 3O47A 2QI9F 1A4UA 2FWRA 2ACVA 3GNTA 4HMOA 4U5QA 4D80A 1YB4A 9MHTA 4G89A 2VPZA 1SBYA 1FB5A 4MQ6A 2XYRA 3T5CA 1ELOA 3MCWA 4D0LB 1RHJA 3ZDBA 3OX2A 1RM4A 1Y5NA 2ZI5A 3SIPA 5FWXB 3ZNNA 5G2OA 3FPLA 2H9IA 2CFOA 3HWX1 1A3CA 2AFHB 4H3VA 5TVGA 2CXTA 1B1CA 2P0AA 2PQ2A 3BF7A 3H4MA 5K3AA 2JLUA 1KMIY 1IHXA 2DWOA 2V6GA 2FR8A 5AVOA 4TTQA 2G07A 1F0PA 2IZ6A 1CDDA 3M89A 4KAJA 1BDJA 3COZA 3O26A 1I9CA 2P4SA 2GD1O 2FMXA 3OOEA 4G5OA 4PHCA 3F74A 4QTTB 3S2UA 3TLKA 1H85A 4L50A 4DCVA 1U0JA 2PGDA 4HVTA 4LSGA 5JASA 1GPYA 4GM1A 4QEDA 3EYAA 2P5UA 4G4JA 5DTIA 1Q22A 3CRRA 3ZDAA 1NX9A 1GAQA 1QG6A 5ALIA 1ZIYA 3G1UA 3DF7A 5EGNA 1O5OA 4WESB 3FUXA 4IIGA 1W5AA 3JQDA 3AR8A 5COAA 3USES 3TVDA 1M72A 3WBJA 5E3HA 5GPBA 2VAWA 2C2YA 3RYIA 2GVDC 4DQVA 2JFUA 4EW3A 2PCLA 3GLFE 1WHTA 4ZT6A 6Q21A 1DIGA 1PO7A 2DPHA 4GXTA 1EFTA 1GRNA 3TO5A 4DDVA 3D8NA 3MILA 1PS8A 3ASUA 3HB7A 3LRXA 4IDQA 4J1TC 3D3EA 3NHWA 4LNUB 5HJ2A 3WKBA 1SUIA 2VEOA 1J8YF 2ZBRA 4QXAA 1XLWA 3WO1A 4CR8A 2ZT6A 1WDTA 4M8KA 3WWEA 4LF9B 4ITUA 1A8PA 2CVZA 2PRKA 5DTEA 2J3EA 1EMDA 3U3MA 1DS6A 4I55B 5L7YA 1QP7A 4LISA 2Y05A 3B7PA 2ZIXB 1TL7C 3D2LA 3HN6A 4NTZA 1S2NA 4AY6A 2C00A 2VDJA 5IAKA 2A7QA 3UB4A 3IRVA 2DR2A 4D3YA 2JHPA 1XK7A 3ZWCA 1GKUB 3ONWA 4H9GA 3CUUA 1CY1A 2WSMA 2EF1A 6NULA 3S8YA 1QB7A 4AWAA 1CF2O 3QE4A 5FWNA 5ALXA 3R1IA 5A9TA 3H1FA 4CJXA 1OA0A 4PLCA 4I5IA 4CEIA 2VA8A 1BJRE 2JATA 2Y1LA 4TXMA 1UOOA 3N8GA 1SUDA 4XR4A 5DHSA 3EXHB 1RFGE 4RHCA 3VHLB 5BWLA 2BFDB 2NN3C 2FFAA 1D3AA 4Z8YA 1YZ3A 3ZVKA 1NMYA 2OP1A 4TLMB 5LZ8A 2JIZA 4B76A 4EELA 5CVEA 4ZOCA 3GJ0A 5EERA 2I6TA 2QQEA 4IGIA 4N40A 1R00A 1NAHA 2QUAA 1Y98A 4AYXA 4F85A 4ZCTA 2I2BA 4MICA 2FPKA 3KPUA 4BTVA 1EGHA 3FN4A 4V0NA 2HK9A 3L9WA 1G9TA 1NQUA 1H1TA 4R1NA 1TYZA 2QX7A 5J59A 4C88A 1M7GA 3AR6A 4EJSA 3K70C 3TKYA 4TVSA 2GVZC 4EB3A 2HT6A 5BWMA 3PU6A 4FMCB 3PT5A 4ZAGA 2H8GA 1Y1QA 1L7OA 2X4LA 2JGEA 2NU9B 1ZIXA 3GARA 4FONA 4IG4A 3EW9A 1A2QA 3ZQUA 16PKA 3DZDA 4DMMA 3B1FA 5FF9A 2R00A 1Z8HA 2Q5FA 2XDQA 4HUQA 2Z8ZA 4S04A 5AQEA 3KUUA 1C3OB 1GZUA 1V5WA 1JAHA 4AJPA 5CM9C 4WADA 3JV7A 3OU7A 3IO3A 4RPKA 2ZYRA 3RYFB 3I9NA 5BSEA 1U1FA 2A5DA 1Z2CA 5B1HA 1FS5A 1JHVA 5TMPA 3V6LA 2VYFA 2F4NA 2GH1A 3S2YA 3R9XB 4NOLA 1FFXA 3GYBA 3PHCA 2R4QA 3ABRB 4O2AA 3C7TA 3IFSA 4JJFA 4TX1A 1ZRHA 5KYUA 3UWSA 2K7FA 5FUYA 4MCHA 5BRAA 2MSEB 2FZLA 4G67A 9ABPA 4WNIA 1XVAA 3F47A 1SEVA 3TX6A 5DCYA 1M73E 2C4UA 2HU5A 1V3UA 1TW3A 2X8BA 1KS2A 3IOEA 1LLQA 1YHZA 2F2TA 3IKJA 2PL5A 5LU9A 3NGMA 5I7FA 4IR7A 3T0FA 3O8BA 1ZVKA 1M2JA 2W6CX 3GVPA 4LZAA 4HH0A 1AUPA 2QJWA 1XDSA 3N2YA 1PGNA 3I6BA 2HL6A 1IEQA 3LVQE 1J6UA 1UJ4A 1M2VB 1N5MA 3AM5A 1QYCA 3T5DA 5HR5A 3MC1A 2WZBA 3AFOA 3RTDA 4MB6A 2EBWA 1NC3A 5AW0A 1A97A 1VHJA 3PB3A 3I39X 4XJXA 2VJMB 2X8JB 1RWMA 2XNDD 5GOTA 5JC1A 3USZA 5J3JA 3JQ8A 4TN5A 2YWEA 1Y8RA 2I8LA 1LCIA 1K7EB 3TM5A 5AW3A 4DMUB 4F4IA 4CQMD 3HCCA 2VQDA 3NORA 5EJEA 1XNJA 5J47A 2XH8A 3A32A 4HAWA 4EG5A 2I9KA 4BXOA 1Z37A 4XRRA 1FFSA 2FX2A 5C80A 5KWJA 4JYZA 4GOKA 2DFLA 3ZU4A 1PVOA 1ORHA 3WGVA 4CM8B 3TGLA 5KI6A 2CUKA 2QRLA 3F78A 1C7JA 2XTAA 4D9GA 4V24A 2R1TB 4X1IA 4ZKDA 3STVA 4HDNB 1WXEA 4PAWA 5KTYA 4RQBA 2O2EA 5DB4A 1USKA 5FKJA 5EPEA 5CFOA 3FFBA 3SS7X 4ACBA 3OQ1A 4H1TA 2A88A 1NQOA 1UF9A 1WR8A 4I14A 3CKLA 1YQGA 2BHRA 4DV1B 1X80B 4IO0A 3FUUA 3CSUA 3ZN2A 3AZOA 1KFCB 2FNAA 1XDGA 4PNEA 1OTYA 4GP7A 4OKIA 1TQ4A 5JD6A 1OAOA 3FAKA 4RZQA 1U3DA 4XB2A 5HMLA 4QDKA 1D9ZA 3B1XA 3H7IA 3K9CA 3H5NA 3FPEA 3OC6A 4POAA 4B7CA 2IEAA 1IATA 3JAWA 3NT4A 1H4VB 1U8FO 4MKFA 4AS2A 1EGVB 2JDID 2CDAA 1HRKA 2VBFA 1OFUX 2GOYA 2Q5JA 2QTAA 1IQRA 5FBRB 1QLWA 5IJ0A 3IEXA 1COZA 3FE2A 3T38A 3BE6A 3W5JA 4D9JA 4K87A 5B2EA 3Q41A 1JEOA 1NYLA 4BVLA 1EGMB 4PCAA 3FFXA 1EJBA 4O4HA 1U28C 2ZJ8A 3ITKA 3LKVA 1M83A 1XZHA 1T2AA 4I1SA 2AZDA 4RLFA 2XADA 1ZVQA 5HDBB 1N5LA 3GWZA 3ROKA 2BTOA 4F6CA 1FNDA 1G5FA 1Z2DA 3KB8A 5JMTA 3W5SA 4LBZA 4F97A 3B89A 3VC2A 5KWIA 1HFWA 3MAGA 2BTQA 4OJYA 1BHJA 5H7XA 4M1QA 5B36A 4JC8A 1IZ9A 3PL5A 2FH5B 3VC1A 3I9MA 2RGWA 4B5KA 3QE0A 2GZHA 4EI7A 3KYDB 2JFOA 2VNHA 3C97A 4KGZA 5E6SA 3ROTA 3HQ4O 5IBQA 1N8NA 2VZLA 3QSGA 2EC5A 1BA2A 2B7BA 2P5TB 3LYHA 3VPFA 4M7PA 3BGOS 4UFNA 5BP7A 3K8QA 4CKZA 4XIIA 1ZXBA 3VKGA 4FW9A 3H2ZA 3HP4A 2WM9B 3OZUA 3A1NA 5F9MA 3ZK8A 5IWAB 2QTCA 1L7NA 2HREA 4MVYA 1X2EA 1DQYA 2HEGA 2OO3A 4Q00A 4U7HA 4BMOB 1DOZA 3ZIAD 1RRGA 3MS7A 1C8KA 3WSWA 3FGNA 5F23A 2XCRB 3MTIA 3QVTA 3T3MB 5A7HA 4OLAA 3AHFA 4F86A 4JCCA 4OFWA 4Q3BA 3M33A 1X74A 3EC7A 2JANA 1RW4A 3QBEA 3CW2A 4KSYA 4EW2A 1RYFA 2XUOA 3T7JA 4EZEA 4BMYA 1HNNA 7MHTA 3G23A 3V9AA 4YRQA 4CRWB 4JQSA 2AJTA 3ZTTA 2E6UX 3HDJA 4QEKA 1HGXA 4NCHA 3EIFA 4TV8F 4OX9Y 1YBHA 4A5OA 3GVXA 5D5HA 2YWFA 3UFBA 5JH7A 1CIVA 4I81A 1G7TA 2J9FB 1SZPA 4Z3OA 1HE3A 3HGMA 4F4CA 4LJ8A 1X9GA 3TIXB 4ARZA 2ZJZA 1RQ2A 1A4XA 1X92A 2I4OA 1OZAA 3Q2KA 1AQLA 4Z1MD 1NTOA 3FYTA 1YS4A 3OSUA 1QRRA 4IZIA 4LQ4A 1H0KA 4RQTA 4I3HA 2NMVA 3W8EA 1SHKA 3FTFA 4TN1A 3LIPA 2IP4A 2G06A 3GPBA 3GJYA 2ECOA 2Q4RA 4BWVA 3QENA 4E5MA 3SSAA 3CUWA 2D3WA 1Z2NX 1RZVA 2I29A 1SVUA 2D5BA 3M82A 4MWGA 1NDQA 1O54A 1GDHA 3NBMA 3JQGB 3IQDB 2J0VA 4HB0A 4HQKA 4Y1RB 121PA 2UVQA 3S68A 4MUBA 4JQCA 2GEBA 2X19A 1UJCA 2BHSA 4CMIA 4IIJB 4JP8A 4UPVA 1I1NA 1R15A 4U00A 3LCRA 4H7DA 4PHHA 4UOEA 4E11A 1OWLA 1T9GS 4EVIA 5CDHA 3ESAA 1FJHA 2CJYA 3WX0A 4D6XA 3RUFA 3PX7A 5K0TA 2HHLA 1JMYA 2NZWA 1F14A 4IGKA 5CUQA 2IXDA 3DMHA 1IONA 5FFNA 3VKFA 4YMUA 2A0KA 4ARVA 5DM70 1SBZA 1TQHA 3V1LA 5C52B 1I13A 5LDGA 5F35A 2WT8A 4DIOA 2PSSA 1P2SA 1H2HA 2QT9A 4H1VA 4PC3A 4ZQIA 3OEHA 5JZ9A 4DSNA 1A9ZA 5ALYA 4EGFA 1QUFA 1F9EA 3AJDA 3Q7QA 3ZKAA 1L4EA 1PWZA 5JQWA 2G7ZA 4C0SA 3AF0A 4REQB 5ICFA 4U5XA 3KD3A 2WINI 2W2LD 1GPUA 4I4TB 4TS9A 4EF4A 3BHJA 3QLUA 3ZGOA 3EH2A 4QJ4A 3VOAA 4B3CA 3FTQA 4KO4S 2FMIA 5KJ1A 3ZCTA 1RKQA 1FFBA 2Q5QA 4JVSB 2QVCA 2CVPA 2Y1KA 1KPHA 3QVSA 5A4AA 1H05A 2CVHA 1L4FA 1UXKA 3R7WB 1O94D 3SQLA 4BNHA 2GZRA 3BH6A 4A0RA 5CDYA 1EDDA 1M2KA 4S1TA 1U1IA 5B53A 4XVQA 3MPOA 4WX2B 2GF0A 3OPNA 2FX5A 3ZI0A 3ADCA 4HP8A 5DLDA 2VDNB 4GKBA 1EP1B 4DC9A 3KR1A 2K2QB 3QBTA 4NG4A 3B1YA 4NCNA 4Q4DA 2VPYA 2A1UA 1EE9A 2HGSA 3PV0A 2R86A 5B1IA 4H1UA 2VNSA 1AUOA 5LZ2A 3H75A 1U3UA 3BWMA 2Z58A 3RU2A 5TIIA 1UPAA 2PBZA 2OBLA 4XYGA 1HTBA 2CNDA 3A2MA 4DLTA 1IOLA 2Q0QA 4N82A 4QDUA 2MSNA 5KSYA 3S2IA 1YJ8A 3BL8A 1RJEA 1XTQA 2IYVA 2JLBA 4O4LB 5DGHA 5KYTA 2JZCA 1LW6E 4PHTA 1SVSA 4PX9A 2XQFA 3ORRA 4MAFA 3AW8A 4PIMA 4DIBA 4YUYA 3GLRA 1ONNA 4OFXA 3R4VA 4PZ0A 3ZXYA 1JI3A 1ZY2A 3DEFA 3HXOA 3UBMA 3UKOA 4G5HA 4O4JA 1EK2A 2QXTA 4NBNA 1JWBB 3EULA 4WZAE 3ZWWA 3WLSA 4AULA 4C4RA 5FAKA 4KIUA 4JGBA 5BRJA 1ADYA 4XVHA 2F55A 1KIMA 2I2FA 3PNVA 3TRKA 5EJ9A 3DUWA 1MT3A 3QVUA 1TJYA 4JXKA 2IBTA 4UJ5A 4MW4A 2X1LA 2H63A 4XD7D 2FEWB 1DVRA 1PSWA 3LH5A 3ADBA 5AK0A 3LZ6A 2P67A 3C98A 3OUTA 2JHFA 4CFSA 3R6LA 5I7OA 5DT2A 3NDBB 2QGFA 2BGIA 4B6EA 1KSJA 2WJGA 1VSBA 3LC1O 4ML3A 3P9QA 2C7VA 3FZEA 2PA0A 3GRPA 3DDNA 1QRSA 3KQNA 3DBHA 4RIEA 2IYEA 3E9QA 4EKIA 6LDHA 3BE4A 3ELYA 4F7WA 1E77A 2PZAA 3OUZA 4B0PA 4P3XA 2FGJA 1V41E 1ZM4A 2FW6A 3V4SA 1JR3E 5AKGA 3ZIDA 2QMOA 1CJUC 4LV8B 4PC7A 2V8BA 1MEOA 5HIKA 4ZT5A 3PXAA 4L07A 5AKZA 2MR5A 3FKQA 4NQZA 3GLIB 1E63A 1JGTA 5C8VA 1P5ZB 1TNDA 2BKAA 3KWMA 4GBMA 3THWB 1Z26A 3JR7A 2WWGA 4C1BA 2ZKLA 2G76A 2ODBA 4IICA 1YDFA 5AOAA 2WW8A 5JS8A 2CZQA 1Y48E 2WMNB 1VM6A 1J06A 2ZUVA 3NKLA 3Q85A 3ZG6A 4OREX 4AJEA 4Z4QA 1JPJA 2ZU0C 1E58A 2FW7A 3WL8A 4ZOQI 1IY1A 3B52X 4UAJA 4UQLA 3J80A 3I1JA 3W9YA 2VC2B 5FXMA 2CJFA 4BO4A 2O8FB 1QAMA 2ALJA 2XB4A 3PPVA 1TJNA 1CY4A 2NOAA 2DUWA 3GJ8A 5BOSA 2W37A 5BSUA 1DQRA 1LDBA 4X63A 5DP1A 1GG2A 4YQZA 3WBKA 3WK5A 3NX4A 4OHMA 3T5PA 1CRWG 3DZGA 4NBVA 4MHOA 2J5XA 2ISQA 4TTIA 4HI0E 2GXSA 4JLAA 3MTAA 4GVPA 3GZNA 2R1VB 4DNXA 2YXDA 5JEEA 5CB4F 1N6RA 4K6MA 1TPZA 4CTOA 1YUMA 2R97A 1NRIA 1YA8A 1QFXA 1KZGB 1QKIA 2QN1A 5KTRA 2VRCA 1L3IA 2TECE 4DLBA 1JR6A 3U6BA 4ZCQA 2XSZA 4OP1A 5CXUA 3IIEA 3SQMA 2DB3A 4G41A 4G0MA 2VJOA 4OFZA 1HURA 3MJTA 5L7TA 5JMPA 2BEVA 4RGYA 1NJ1A 4TMXA 3E9DA 3U44B 5ALFA 3S7ZA 4ED9A 4D3SA 5TPWA 2F3SA 3TLGB 5JCJA 3GRUA 4RDIA 4IFIA 3L7CA 3KZMA 3NEPX 3D9QX 4Y2JA 3MGKA 4HQLA 4ZHQF 1GA6A 2H0RA 1UJ5A 2QP3A 3IOCA 1JFFB 3PSAA 3AK4A 4FNGA 3CH6A 3RRZA 4OK6A 3NTXA 3OFND 4MYCA 2TYSB 1DX6A 5LA6A 2SBTA 4YPFA 3GJTA 2HRCA 1YZGA 2IZ0A 4H4DA 3WJ2A 5KNCA 2GHQA 2G40A 4V38A 5ALZA 2BN4A 2EKPA 3BXGA 2FY8A 3PYXA 4YDSA 3Q3CA 3H16A 5K0FA 2NTEA 3KOYA 1E3LA 5ITSA 2R48A 3IAS6 1AGNA 3F6BX 2VH1A 3PI6A 4N01A 2IF0A 4O2RA 4TV9F 2XTNA 1PR0A 3EQ6A 3OF3A 5E4YA 5IANA 2QX4A 3OKAA 4MV6A 4NH0A 2EKDA 3CX4A 2O4UX 1L4HA 3IXLA 3L4SO 3G49A 5EA2A 3SDBA 2ZPUA 3H99A 1CB7A 1FW8A 2WP8J 4JYMA 1ZD8A 4OCZA 3O93A 1OIXA 1VE1A 3ZJ5A 3IURA 5KJFA 2O8VA 2I0FA 1E94E 1QCDA 1TAQA 1GTZA 1KDRA 4LJAA 1J49A 4X6LA 1BHQ1 2AQIA 5DGCA 3UWDA 4D9KA 3NHAA 4A0SA 3O2JA 2FSVC 1E7QA 1P61B 3EEBA 3QRWA 5FWXA 4S1PA 3WHKA 2AFHA 3CG4A 5U1PA 2PS0A 1N3YA 4BBPA 2YJ6A 2OBYA 3L04A 5LD2C 2D1SA 2VH5R 3KX2A 1VCIA 4BO9A 1TECE 4MRRA 4DSAA 1Q0HA 1N36B 3S2FA 1K92A 5B64A 1W5FA 4IHQA 4OB8A 1SCIA 2G4VA 2WWVD 4GO1A 4RSMA 4EA6A 3GLHB 3JTMA 1UBGA 2WYHA 3QVMA 2ZBPA 3OTIA 4URYR 4S24A 4AMUA 4R2WA 5JXHA 2B2CA 2IYZA 3N3AC 4PSVA 3BQNB 5BMOA 1IIRA 2V3WA 3O8RA 3FNRA 5EHQA 4O4IF 4UM8B 1FBNA 1SXQA 4MKHA 1ZNWA 4MWCA 4WESA 3PD7A 3AGQA 4JLMA 3PGMA 5GTDA 2CT8A 1OYYA 3NR2A 1M5UA 3EASA 4FGZA 5H80A 1YVEI 1JFVA 1NOKA 5DNUA 2SKDA 1ATZA 2TRSB 4Y2YA 4HB2A 5AUOB 4XCVA 4OHVA 3PR2B 1R18A 5JU6A 1KZ7B 1DMSA 3N0RA 2ZSFA 4R0NA 5TMEA 5LP1A 2FMTA 3W5IA 1FDWA 4LNUA 1E2PA 2JVIA 5K4GA 3DNFA 2HWKA 1N5OX 2A5LA 2UZ1B 3AU8A 2CNLA 2BFNA 2GRAA 3CEHA 4RK6A 3UYLA 1ZKDA 1ZH8A 1T8YA 2FPOA 4I55A 1TUIA 4QPCA 5L3SB 1JU9A 4YRSA 4ZJUA 5JBNA 2PSEA 1QRAA 2ZIXA 3M1IA 3OKCA 2OUKA 1JAXA 3E4DA 4O2BF 3EVAA 1NV9A 3NTVA 1VLQA 2HNAA 5A0VA 1RLJA 4Q93A 4S1WA 4HB3A 4L5YA 1HA3A 1MAAA 4X85A 5HBRA 3UWKA 2RKBA 3CFYA 4XPZA 1ISIA 1BO6A 5I5GA 2QV0A 1E6UA 3GNLA 3K0CA 3QWBA 2G5CA 1GGNA 4Q9AA 3VDMA 4BVKA 1OB5A 3RRNA 2WVAA 4AX4A 1DKRA 2YN0A 3SHTA 1WW3A 4KVFA 5HFJA 4C3VA 4MJXA 3FJYA 2GBLC 4MVWA 2P9EA 3A0RB 3CUTA 4RAQA 5ERYA 4U7WA 3EXHA 2O7RA 1JG7A 3H1GA 2BFDA 2CL5A 2ASEA 2ZREA 3LPMA 3PHLA 5LCXA 3GFQA 4LV5B 3WV4A 3GK3A 3FKSD 1A7KA 1OSNA 1TVCA 1D4OA 4OHBA 2WAYA 5JAOA 3PDUA 2KLHA 2R87A 3IAHA 5G0TA 1YRHA 1IVYA 2NXEA 5FA8A 1RQ7A 3VKUA 4B85A 2HYDA 1YDMA 5JO0A 4N0DA 3D8UA 4PTZA 2WT4A 2HJSA 3D3JA 2PANA 3WLQA 3OJCA 1Z33A 2B5OA 3IOBA 5JAUA 2ODWA 3DEZA 1G3QA 4ICIA 5EKXA 5HA5A 1H4TA 5JC8A 4G9EA 5G1PA 3DUFB 2Q7DA 4JFAA 4Y6QA 1YCHA 4INOA 2NU9A 1LC0A 3L82B 3D3NA 3LWBA 4ZCPA 1LQ2A 2IEBA 2Q3MA 1M1UA 2HRZA 4TRJA 5K0SA 1NMSA 4BU1A 5JBQA 4PLYA 1REQB 3HBFA 3BX1A 5AOVA 4J3NA 1IY0A 2DHEA 3DDSA 1C3OA 1GR0A 1LK7A 2WB2A 4P22A 4NEHB 4BEJA 1RXCA 3AI3A 1D0SA 4JJEA 3RYFA 1NW8A 1NP6A 1A8SA 1TUEA 4CZ2A 5ALRA 2Q27A 5IKMA 2C2WA 4U7TB 4CMGA 1EDEA 1UFOA 3I9OA 3B7WA 4TYPA 4BWFB 1QF6A 2P2NA 4GX1A 3SG0A 3C7KA 1K1EA 4R3WA 3R9XA 3TXAA 4BTLA 1RWNA 1F60A 2QF7A 1V6AA 5SZKB 5KBYA 1BDMA 4YONB 2C0CA 1XXHE 3GJ7A 2FEXA 3PGLA 1W36C 3LBHA 5IX8A 5FEMA 1FYDA 1CJCA 3EIHA 3PVCA 1T1EA 4U7PB 3ZCUA 2C2GA 3N2ZB 5TPZA 4B3DA 2RGRA 3SZLA 1F8XA 4G9BA 4QBKA 2C2ZA 3W8NA 1JEDA 2CE7A 1E1NA 5AH0A 3RH0A 3SQNA 3ZXIA 2DHQA 2WFZA 3NV9A 3QVOA 4KH1A 3AHIA 5DHPA 3KBOA 5AM2A 3M3HA 2C2XA 3CLRD 3FLEA 2EDCA 1LBIA 2WHYA 5DXJA 5KAPA 4HQ0A 4LRWA 5PGMA 3WNBA 3Q87B 1K9SA 2COKA 1M2VA 3M34A 5JNUA 1UK9A 1P2TA 4YEDA 1EB9A 4KYIB 1V7CA 1M6WA 1R5NA 5BORA 2FN8A 4BIMA 4L9SA 2VJMA 2X8JA 4AKSA 5ICSA 1OBFO 2P90A 5E2AA 2Q3LA 4FE4A 4JC0A 4FGLA 3NIDB 3KSUA 3E23A 3LFTA 3OHPA 5JY6A 1SKYB 1PL0A 3UMCA 2C2OA 4LX0A 3CLUD 3ED5A 4G4GA 2GEUA 2ID9A 3NS7A 1GSHA 1Y1LA 3FCCA 4R8MA 4YAWA 3W3AD 4CT0A 3FOBA 3WP1B 1EYZA 1RXVA 2ZSUA 1Y9AA 4CM8A 2RHLA 2X86A 2P1ZA 1ISSA 4TGLA 3MTEA 2R1TA 2CLOB 2PKQO 1V8ZA 2YJZA 3D4IA 1HLDA 4HDNA 4LXYA 5C5CA 2OWDA 2G88A 1JG4A 1XVUA 3Q1LA 1D1TA 3OBIA 3EOBI 3NHUA 3ZV6A 1MW8X 5K2OA 4JLBA 1B1AA 4HDKB 1R0KA 1EDBA 1N7HA 3ENNA 3RLFA 3GRKA 2P5SA 2QP9X 1JS1X 1X80A 4EH1A 1VFPA 3L41A 4HL6A 4B3BA 4NXMB 4BQEA 3PUZA 3PEWA 5JALA 1QZXA 2H7XA 3GHHA 2HEIA 2FWIA 3N2EA 3W04A 1R9GA 1M1ZA 3M4YA 4B31A 5I8PA 1XHFA 2CHEA 2H11A 4UAUA 4WKGA 1I3LA 4AF8A 3QHAA 5LZ4A 5BSVA 5K20A 1LGYA 3ZH2A 3UK1A 3LQ4A 3B5JA 3ENVA 5TEWA 3CRQA 3KXPA 3PA8A 1JHUA 3PGVA 2Z30A 1SH7A 4NYIQ 5JNSA 4EFLA 3ONFA 5F1PA 1BQ4A 5HM6A 2XZPA 3VR2D 4YUZA 1IPEA 5IT5A 3CO0S 4YRRA 4KLZA 3RUIA 1Z15A 1RRKA 1ADCA 3SVZA 3WHPA 1Y6QA 5DSZA 4QNNA 2PV7A 2HPZA 4B33A 1QIDA 7REQB 1LSUA 2PZFA 4LZJA 5AT1A 2ZJYA 2V54A 3I34X 3KYDA 3B6KA 2IYNA 3QXCA 3W1WA 1UR5A 1KMCA 1JZQA 3A9SA 3I2GA 5KUTA 1JDBC 5CB0A 2JFWA 2JD1A 4X5OA 5JYBA 4G24A 3TW0A 4DM4A 3C24A 1N2OA 2XUZA 1LFAA 2B9VA 3DOOA 1NVVQ 3L8EA 1J4AA 2V03A 2VLBA 1NR5A 3KU4A 1D1QA 2H4YA 3TW6A 1LTQA 2X22A 3KKQA 2JARA 4UZSA 4EECA 5H8WA 2EZTA 1NP7A 4PSCA 5JJIA 1YIDA 2CLCX 3H9JA 3N1UA 1CW2B 1GL3A 2BI8A 5T4EA 1K68A 2AFRA 2SKEA 2QAIA 4RJKA 3LJKA 4GMDA 4Q05A 1NM5C 1TTTA 4LYFA 3BSFA 4V3CA 3LU1A 2O9JA 3SK0A 3BORA 2P2DA 1F4LA 4KI0A 2W6JD 1DIHA 5HS4A 1GITA 3KL2A 2WIKA 1VG0B 2Q6IA 2Z5GA 2ZIAA 5BQ5A 3P2KA 4FNOA 3FF4A 5ENZA 3RWMB 5EVJA 1EVZA 3TBFA 2QZJA 3AFGA 1L5SA 2J9FA 2AWOA 3RAEC 1I4EB 4QXQA 1T9AA 3G2OA 2XUJA 3BK2A 4KPUB 3V4OA 1MBZA 1DADA 2AWNA 3U56A 1KNQA 2YJNA 1E1RA 1LTKA 1QR6A 3T54A 3V55A 2OGTA 4OYYA 3QPUA 3CF6R 1KIFA 3MLBA 1IJFA 3P2YA 3GT4A 4DJDC 5KQRA 1NX6A 3EWNA 3QXXA 1FFDA 1NVEA 1YJCA 2IOFK 4IRUB 5KVVA 2CXNA 2D1RA 1KS9A 4J91A 4TL9A 1CZLA 3A7EA 1SC4A 4UNQA 1B2LA 4O29A 3KSBC 1DBVO 1X9IA 1QNFA 2BEKA 5DCUA 3G1WA 3VNRA 2Y2VA 1H6DA 3JQGA 2QN2A 1XTJA 4Y1RA 1SXIA 1Y4ZA 3ED1A 5FV7A 4KUEA 2GO7A 1UJ6A 1X77A 2PJDA 4IIJA 4MSUA 1UDWA 4PWYA 3W2TA 2CNNA 5HKBA 5JRJA 5KKNB 4UQOA 1OZ0A 2OQIA 4AI6A 1EAMA 1JJ7A 2IPMA 5IM5A 1NBEA 4HTFB 1FP6A 2Z0MA 5I9LA 1SOVA 1BN7A 1MQSA 3I01M 4FIDA 3W3AH 2FU5C 2AJBA 4TT8A 4MH0R 3WWDA 1U0EA 2DUJA 3IR7A 4IUBS 1ADBA 3W6OA 2HYIC 1KO8A 1I5OA 1XCOA 2F1RA 3LQ2A 2V3CC 3DL2A 2D3TA 1QC5B 3ZW9A 1TJ4A 4YJGB 5GZ6A 3GA7A 2DCUA 2XWJI 4KQMA 1Y3BE 4E1VA 3NAQA 4REQA 1Y80A 5BMVB 1OGJA 1WXQA 2QTVB 4OBXA 3LT4A 3BICA 4I4TA 1N2XA 5INTA 2C5AA 2GCNA 3A9WA 3ZWBA 2PV0A 1S4QA 1Q0SA 4M54A 4XUGB 5IAGA 1NBOA 2D0DA 4YYEA 1UDAA 2YHIB 2YZ2A 3H0EA 3OEED 4KPGA 1VLVA 5B3JA 1SD1A 5AICA 1QGOA 1MJFA 2ZXEA 2H4WA 1GKYA 3G8CA 2JGDB 4WN3A 2R84A 3NRBA 3WZMA 2NVWA 4LRXA 1ILEA 2WI8A 2HWWA 2RSLA 3R7WA 4U7DA 1YE5A 1U6IA 2A4KA 4P3OA 4KXYA 3WK7A 4KTVE 1I0IA 5E9AA 1GADO 2CL7X 1DJPA 3BB4A 1ZVMA 1LI4A 3IOMA 2RBEA 2HCTA 3VOSA 4EJ6A 3OU2A 1UANA 1NTRA 3HVIA 4D4MA 5L8VA 3ZWKA 4URVR 2RD2A 1H66A 5DM0A 2AKYA 4E3ZA 1G3IA 1CT9A 1U1CA 4NATA 3ROFA 2WWFA 3AR7A 3IJ5A 4Q4CA 3C14C 3SI7A 3AEXA 2ACKA 3EBPA 3OZWA 2QY9A 3NT2A 4R2MA 1PG2A 4UTXA 2AJLI 4WOJA 4QYWA 2G7MC 3UT6A 1VYHA 4ND6A 5FOWA 2XECA 4E15A 2PGIA 3AFHA 2F1IA 3ZWNA 3WWPA 5KJEA 5C1PA 4JY7A 1O97C 1Y81A 4HFJA 1VG9B 3A4IA 4PC1A 2W43A 3K4HA 4MKRA 1T35A 1XZIA 2BJWA 3D5QA 4A2CA 4C03A 2VXBA 4HNAB 2R47A 4TVBA 4O4LA 4DLPA 3N8IA 5J2TA 5DO9A 5GJCA 4K9KA 4ECAA 2EJVA 4B7ZA 2G28A 4B43A 1YFLA 1YV9A 1M7BA 4COOA 3WHIA 3RS3A 1C3EA 2V8OA 4B7AA 2P91A 2ZUSA 1RPJA 3TLCA 2VXYA 2HF8A 3DOIA 3E5HA 4EKEA 5J4YA 4XSHA 4WGFA 5EXTA 5AKHA 4HWOA 2CYCA 2IC5A 1IN8A 4G37A 3L5OA 1S9DA 2PVSA 5FOXA 3VAYA 4D0GA 1QGUB 4NPAA 4CL3A 1NKVA 2QMQA 2HSWA 1N92A 1ESEA 4PY2A 5FBZA 2NSYA 2I2AA 5DYGA 4WGGA 2OV1A 3C3DA 4ZK6A 1ZJ4A 3C85A 5IEJA 4AN4A 4AY3A 1S3IA 3UIEA 4G2NA 2VXCA 4Q34A 5LN1A 4XUCA 1U4OA 5JS2A 1UADA 2IH2A 1M33A 1TXGA 4OA8A 1B23P 3H3XA 1L4BA 1XEXB 1Z17A 2CD9A 4FU0A 4Q12A 2Y9PB 2H2GA 4OQ4A 5DNAA 3B12A 4RUKA 3TQCA 4LYYA 3T4EA 2F6RA 3TMKA 1J7JA 4LNAA 4QU9A 2WZDA 2PZLA 3BXFA 1CNEA 1TTHA 3K0FB 3MWYW 4Q3DA 4TMWA 1FFEA 2V5VA 5EXEA 4OXQA 1DKUA 4LY6A 2XD9A 3CE9A 4MAAA 1B14A 1CNMA 4JS0A 1YS6A 4EO7A 1T2DA 1XYGA 5EIBD 3GLIA 2BM8A 3N75A 4BLWA 4URUR 2DQZA 3NETA 1B6GA 5BVHB 3GZTB 3THWA 4GSYA 3A6DA 3HCDA 4L72A 3D5EA 2IU0A 3T5AA 5AUPB 4UAVA 2APJA 3K7EA 2WVJA 4ZO7A 2Y0EA 3U4HA 3BUSA 4ZHSA 3O4IA 3CZ9A 3EDMA 1Z56C 2A9JA 2Q62A 2XB2A 4MRNA 4C08A 4RD2A 3A8TA 4JIMA 2H1FA 4JBLA 1VL0A 3H5OA 4J7AA 4U2FA 3TE7A 1G21E 2W6QA 3CBQA 1YZVA 2PVCA 4RDCA 1FOEB 1OWPA 5HF8A 2O8FA 2I2CA 3IILA 4PNZA 2ZSEA 2LNDA 1NPDA 1KSGA 4RH0A 5I7VA 3OECA 5KNBA 1FQOA 4NV3A 3SJBA 4LNHA 2QMUA 5FL3A 1G3RA 3U7EB 3VZRA 2H9YA 4ZXPA 4GC5A 3VKWA 3LY9A 1TKRA 3I6QA 5CVUA 4BGDA 1RQGA 2NO9A 3Q9LA 3MA0A 4KYTA 1SKAA 1G291 1QHIA 1WB5A 5JVDB 2R1VA 4YMVA 1NT4A 2A1IA 3MGAA 3A14A 4JODA 4Y9UA 3TOCA 2HA2A 5F7XA 2IL1A 4LRSB 1X8XA 1NW5A 2M32A 2HW8A 5CTAA 1RJ9B 2HNKA 2YIJA 3LLCA 2PUGA 2VYQA 1K6XA 1MG0A 1Q1AA 1QHGA 5KNDA 1AXEA 2ZIVB 3TTVA 5CCEA 5FR2A 2E89A 4FMBB 3MHPA 2R2AA 1A9QA 2Z3WA 4WEQA 4WL0A 4UEJA 4YUVA 4DV2B 3U44A 3RTAA 5NLLA 1GNSA 2K2WA 2QAJA 5ECGC 3WA7A 2HO4A 3HU5A 4QXRA 2WF7A 4MEJA 3OBBA 3TLGA 2IS2A 4HGQA 2B21A 3OEWA 4KX5A 4WXMA 3AKDA 3ZOZA 3Q2OA 1BMTA 2NADA 3ICVA 3K09C 1BVUA 1JFFA 3K35A 2B6NA 2H51A 5FNVB 5TQ2B 4TYWA 4ZA2A 2WY2D 1OCEA 1QJ4A 2OGZA 2YNMC 4ZVSA 4C0BA 4EVSA 2GM3A 2QLFA 1I14A 2W58A 3GLSA 1FC0A 3QQ5A 4PG7A 3PVZA 4RS4A 2EWMA 2YHSA 3ZJVA 5CDFA 4G97A 5IDWA 3BN3A 3F6SA 3RBAA 4X65B 2GBPA 5FOTA 4MVJM 3RUDA 3U3RA 5A4JA 4N49A 5AVRA 1TYAE 4HVAA 1J5XA 1NMZA 2B8TA 5FFFA 1JQDA 3BILA 5BQPA 3TAUA 3F7OA 1YHNA 2QDKA 3IEKA 5FBVB 4Q47A 1BWQA 3DMPA 1IULA 3HJRA 3O94A 3SNKA 3TCKA 4GMGA 5FH9A 4RTQA 3NWOA 4X7BA 4CHGA 4ZANA 2XBMA 1UJ2A 3JVIA 4HHEA 4BKRA 2I03A 5JQGB 1KY3A 2OHOA 4JUCA 5JPDA 4J4BA 1DBIA 3TOVA 1N6OA 4RK7A 4BVFA 1UJBA 4C43A 1S9HA 2AV6A 2V59A 4C6RA 4ZDIA 1MJ5A 2JFYA 4GEKA 2P3OA 1BCSB 1LRJA 1G20B 4CFZA 2C77A 1QFZA 2QD4A 5ILQA 3AEKB 2OQRA 2Q0XA 4RU1A 1NASA 3ANLA 1ICIA 3ETEA 3P4XA 2ZUFA 1MV8A 1GYRA 1TAHA 2GGSA 1JECA 1S2DA 1YQEA 3ISTA 3GLHA 3L8YA 1K8YB 1VJDA 4KDFA 4I36A 2J4CA 1EXMA 3FMOB 1P6XA 3AZQA 3QEJA 5DEOA 4CF6A 2DWPA 1DKNA 3U4DA 2HHHB 2FOXA 1BZYA 4A82A 2TSYB 3GEGA 1V4BA 2VF4X 1NC1A 4KLNA 2FRVA 1KH3A 2HJHA 1SEPA 2GM5A 3HJNA 2PT5A 4LJ7A 4MO2A 1CULC 1JX6A 4Q9HA 4DCSA 5HP4A 3P2IA 4YV1A 3LX5A 2IK8A 2Z3VA 1JEQB 1R4ZA 5FA5A 1LPBB 4V2UA 5LWQA 2XWBF 4J0KA 5EJAA 1C9EA 2AG1A 1USIA 3ICPA 4C21A 3SDZA 1CJMA 5CFZA 3COYA 3QKSB 2JVKA 2ECPA 1CUIA 4AP6A 1C2YA 1J0XO 4H15A 4YJ2F 1VSUA 3RSZA 4XWAA 2HRQA 4K8OA 2UZ1A 4N3NA 5LBTA 4BRWA 3FGOA 5FL7A 1GKKA 2O07A 4LZLA 1N3IA 4Q48A 5HFNA 5K3EA 5L3SA 2ROQA 3KZVA 3TZQA 4FHCA 2JBWA 5AI0A 5KYNA 1C1YA 4I99A 2DE0X 3FX2A 4UVHA 5GIPE 1Z7YA 2ZRQA 3OTOB 3OIYA 4ZOLF 3T35A 2V6FA 4KR0A 2PVPA 1N2CB 5U4QA 4RHFA 1RZUA 3K30A 3ZK7A 1LH0A 2WLTA 5JSKA 3ZLUA 4KCGA 3R5FA 3M49A 1RXWA 1ZNXA 3I4LA 4P9NA 3ZNPA 4KVGA 1OREA 4WJKB 1YJAA 4FJ0A 1NI5A 1VHLA 3BIJA 2C0QA 4WXYB 4AFNA 1XYYA 3ELWA 5KVQA 2IEDA 3ON5A 3RHZA 1SB9A 3PRKE 5ULLA 2PD4A 1P77A 2CFRA 1QX4A 1UJMA 1YAJA 2I34A 4LGVA 4J2HA 3U1BA 3RUCA 4JFRA 1CUFA 2F17A 4MMZB 3OF2A 2YINC 3QUQA 4FR5A 3RVNA 3I9JA 1KQ3A 3T6KA 2YFHA 4PZ9A 4C30A 2Y0CA 1SC9A 3JY6A 5FTNA 2DTXA 5K0CA 3RRMA 3ZNOA 2JGIA 2R85A 1A5AB 2I3BA 3OZGA 1ULBA 1JYFA 3HPRA 2CXRA 2DM6A 3DUFA 3IA7A 3ORYA 4IXNA 3ZHRA 5EIEA 3RDPA 4Q3CA 3AV3A 4BUCA 2BMDA 2GBIA 1ORRA 2RIPA 2DJIA 4X91A 5KMGB 3CG0A 2IHUA 2XX3A 1QO0A 1RE1A 1REQA 3LCCA 5ALTA 1N9ZA 1SA0B 1DHTA 2R6ZA 1UT5A 1K5GA 4P3YA 2QM7A 5JS6A 3NEJA