4JQOA

Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with citrulline and inorganic phosphate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
338
structure length
338
Chain Sequence
QSNAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine carbamoyltransferase
publication title Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
rcsb
source organism Vibrio vulnificus cmcp6
molecule tags Transferase
total genus 133
structure length 338
sequence length 338
chains with identical sequence B, C
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jqoA01
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jqoA02
4JHXA 3GRFA 3AT1A 1PVVA 2AT1A 1F1BA 1ZA2A 2QG9A 1ZA1A 3L02A 1Q95A 4BJHB 4KGVA 1C9YA 1RAHA 1ML4A 4KH1A 2A0FA 3L05A 1DXHA 2FZGA 1ORTA 4JQOA 1JS1X 3M4JA 1R0BA 1AT1A 1FVOA 1ACMA 1XJWA 3CSUA 4NF2A 3R7DA 3E2PA 1RAIA 3KZNA 1VLVA 2EF0A 1RACA 3M5CA 4AMUA 5ILQA 2P2GA 4FYWA 1RAGA 4E2FA 5AT1A 1RABA 3SDSA 6AT1A 8AT1A 3GD5A 4ANFA 3D7SA 4EP1A 2H3EA 4OH7A 1DUVG 1RAFA 2QGFA 3LXMA 3M5DA 1FB5A 1PG5A 4F04A 1EZZA 2FG6C 1TUGA 3L04A 1NBEA 4FYYA 1RAAA 2AIRA 2HSEA 3NPMA 4AT1A 5G1OA 1I5OA 2W37A 1EP9A 2IPOA 2FZKA 3KZOA 4KH0A 4IV5A 4A8TA 1SKUA 1TU0A 3D6NB 2YFKA 2OTCA 2ATCA 3R7LA 2FG7C 3KZMA 3MPUA 4FYVA 3KZKA 2I6UA 4KWTA 3KZCA 4EKNB 1AKMA 3M4NA 8ATCA 3TPFA 3TXXA 1RAEA 1A1SA 1RADA 4H31A 3L06A 5G1PA 1OTHA 7AT1A 3R7FA 1TTHA 4WTOA 4AM8A 4KGZA 4JFRA 3Q98A 1EKXA 1D09A 4KGXA 5G1NA 2BE7A 4A8HA 4A8PA 1R0CA 2FZCA 4FYXA 2G7MC 3UPDA 4F2GA 9ATCA 2BE9A 2RGWA
chains in the Genus database with same CATH superfamily
3JQ6A 2VAMA 4OSOA 3TL6A 2I99A 2UYQA 2UUOA 3V2GA 4KN5A 4G0XA 4KXMA 2JIRA 3T3MB 1Q95A 4U6NA 4ZALA 5FBZA 4P33A 2GN4A 3GWGA 1LH0A 4L51A 1XEWY 2WSSA 4Z99A 2X0EA 4E12A 4JJGA 4NTZA 4D8XA 4Q0MA 3ZE2B 3MHPA 2POCA 4TVKA 2FZGA 1L7PA 5JJKA 3LA6A 3OLQA 3S8EA 2WHPA 5EMJA 4ZT5A 3D0OA 5TV2A 5BXQC 1ZCFA 1GZ6A 3MYYA 2Z5VA 2XUDA 3C39A 3EF3A 3QXJA 4OF4A 4EF4A 2YMQA 3PA6A 1SXJB 5EIAA 2H0QA 5LKAA 3H7IA 5BT8A 4LXHA 1ZH0A 1RJGA 3HG7A 1CUCA 3PUZA 4OU5A 1VHJA 1YACA 4DUZB 3S7ZA 4BY9E 3JWGA 3C1AA 1ZH6A 5EN4A 4XQEA 3D3JA 4DR5B 4DQLA 2H1OA 1WF6A 1EA7A 4QOSA 4DR3B 5IHPA 3EXEB 2Q2QA 1OLUA 1NE7A 3I2IA 3NBXX 4IDHA 1L4NA 4L8LA 4M6WB 4O1HA 4C4SA 1N36B 1QQAA 3I1FA 4MITA 4N18A 4OMDA 4F96A 2DBZA 3GK3A 3FCSB 4DNQA 1IHXA 2NZVG 5IT5A 5BO5A 4CKXA 1JR3A 4IJKA 1VMIA 1OJLA 2OM2A 3FOCA 2ODNA 3K0CC 1LUAA 3KL2A 4KNWA 4YMSA 5BW6B 4UFPA 3EXG1 2C59A 1YBMA 3O74A 4QL3A 5DTJA 3SVZA 4XIGS 4Q7EA 1QK5A 4KQ2A 4ROSA 4UHBA 3RFCA 2PWBA 1WCWA 4RK0A 2D0PB 1U2ZA 3VGPA 3BA6A 2C2BA 1GZ5A 1MJGM 3KSZO 4I3HA 5JAMA 1HXHA 3RFUA 1ZWLA 1TJ5A 4L8WB 4NZOA 2WZBA 2X4LA 4TUYA 5JADA 4LBWA 1PYGA 4JYPA 3WNBA 5CB4B 1J1UA 1B73A 2O2YA 4RMIA 3VISA 3I9FA 3HABA 3N7AA 4YCMA 1KO5A 4KQMA 3DO6A 2PS0A 2JGJA 2R4UA 3ELYA 1UJNA 5F5XA 3UCEA 1MZVA 1U2SA 3BZBA 4MTLA 2FFRA 4URFA 4D8TA 3IT0A 4CQLA 2UZIR 5KIAA 5A5VA 2M32A 2I6QA 2VXCA 3GPIA 3UT6A 3B6JA 3F6PA 3D8SA 3FVVA 4CLEA 1UC4B 3HZRA 1E89A 1G5PA 2P1DA 3AUXA 3KFXA 4V24A 1E1RD 4L5BA 4PYRA 4F6RA 4CLDA 3R9WA 3HLTA 1JG4A 3LC2O 3N6RA 3QWAA 1IAVA 3ORFA 4KGZA 1NP7A 4M7RA 3OTQA 4D0NA 2R1UA 3GFVA 2W98A 3KETA 2PFSA 2HX1A 4LOLA 3MPOA 2IYWA 3H2GA 4RPIA 5IFLA 3DAOA 4ZCIA 5JFGA 1ZONA 1AQJA 1EVQA 2JFNA 5L4LA 1OFHA 1VYHA 2AYXA 4FYXA 3VHRA 1H1LB 1UT8A 4URWR 4URHA 5LDDC 4P5EA 5J23A 3PXGA 1RYBA 4B5KA 3Q7RA 1UC8A 5B2FA 5AW4A 2OO5C 3W05A 1KWGA 3EUWA 2PD4A 1ZD2P 2AKAB 3D3WB 5HW0A 1I94B 4NU0A 1A9QA 2IYQA 3NHSA 4YX9A 3L18A 4BPBA 3D02A 2EZ4A 3URMA 5A5DA 5A0VA 1TLFA 5DF1A 5HCUA 4AKEA 2QNBA 4PX5A 5F2KA 1TU4A 4AY4A 4KITB 1CUYA 2DSNA 1KWKA 2UZ1A 5IXSA 4M0LA 3OECA 3DYBA 3TM4A 1GGVA 1FY2A 2OE2A 1SG6A 4G5OA 1TPYA 2ZJ7A 3L41A 1CBUA 2GD1O 1KYVA 3H1EA 1SBHA 2QTLA 3AF0A 4EI8A 1ILEA 4Y1RB 1G55A 1D2CA 1QFJA 3NATA 4I4TB 2LZ0A 1WBBA 2WIJA 1EM8A 3SQMA 5CFOA 4GLBA 5M5BA 2FSGA 3HJBA 1IRXA 2DFLA 2FZ5A 1LNSA 1YR9A 3G9XA 2MT9A 5H3CA 4LF8B 2DUWA 2VPXA 5DM70 2WABA 3HYRA 3WGOA 2VUTA 1TO1E 2I1LA 5HRCA 4BGUA 4JLVA 4WXPA 3IPRA 2W58A 3TKLA 1QMPA 3K9FC 4MVJI 4RD3A 5AJVB 2CEAA 2NLOA 4MRSA 1N4AA 3T5TA 3TMAA 1U4SA 4R16A 3A32A 3DD5A 3ZE1B 5B7NA 1E2UA 3QW2A 2V65A 2VJDA 4G63A 3IYLW 3UK2A 4ZARA 4AWXA 2BFOA 1O54A 3N05A 4NU6A 4TKZA 1BMFA 3FPBA 2NVWA 4QVKA 4JA2A 1AHPA 2GD0A 1M10A 2BISA 1ZOLA 5JMPA 2WA1A 2GK7A 3EXG2 3DV2A 2FPIB 1ESCA 1XZFA 3K0AB 3PRHA 3L04A 4NMXB 2R86A 4OI2A 5EY5B 4QTZA 1M6HA 3H5TA 5AOAA 2AV6A 4AT1A 1U2DA 1S7GA 3IEKA 3VTAA 3WWOA 2H4YA 3GN1A 3F73A 5FPKA 5JNLA 1REQA 1U04A 1E1QD 1Z35A 5FIUA 1Z17A 3H2ZA 1HF3A 2J59A 5F4BA 2GTHA 2I65A 4EMTA 5LMNB 2FR0A 4HVTA 5AKEA 2Z8YA 3L1JA 2ZTSA 2DGDA 1E7QA 1TK3A 1UP6A 1WLYA 3IQHX 3OKFA 1UJ2A 1I7SB 1JEYA 2W42A 4WLNA 1L4KA 4NU5A 3HEAA 1ZNXA 4RLFA 3T1HB 2IUSA 2YS6A 1P17A 1V9LA 4ZAZA 2C3MA 1BGVA 4YDSA 8ABPA 1IMOA 5ITZA 1Q0QA 1C0LA 1LNQA 1KJZA 2FPSA 2ZAIA 3LCVB 4B75A 1HX7A 1FS4A 2YWBA 1CFJA 3TQTA 4Q3NA 3T3EA 4XIYA 5HIJA 1I7LA 3RS9A 2OQVA 2PGLA 1T8WA 4EEKA 2GJAA 2XMBA 1JJIA 1JYSA 5KYGA 3D7LA 1EFVA 1V6SA 4Q15A 1QOQB 2NOAA 3TAUA 4QGHA 3LTEA 3X1MA 2H52A 1AKVA 1PWEA 1XRNA 4RX1A 3L84A 4TKUA 4BKMA 5GAJA 3V55A 1ELOA 5JYCA 3RWMB 2F67A 4RJKA 1W76A 5J4KA 2XMZA 1NVUQ 1XDWA 3PTAA 1X70A 3EMBA 4WH0A 3KO8A 1OYWA 4CL3A 3GDHA 5DLDA 5CCEA 3B9QA 3RODA 1CULC 1OWOA 4ENRA 3ED1A 3HBFA 4PWZA 1JZSA 3D8TA 5IC6A 2JS7A 4CTNA 2AWOA 2IUEA 1EBFA 4I1UA 1Q44A 4Z6KA 3UN1A 3AUYA 4WRRA 5TS2A 2WBLC 3LQRA 1XDDA 4BEWA 2I2XB 1JIUA 2ZRAA 3ESQA 3T4XA 3FUTA 3MWLA 3S40A 2YC2C 2QG9A 4ETIA 1VL5A 3G1UA 3WLLA 2C7VA 4CKEB 3BXZA 2B25A 2F48A 3UAYA 2ZIWB 3ZY5A 4A10A 3GXBA 3NBKA 1W36B 1E2JA 1SC1A 4ESOA 1GT6A 1LLFA 4TS3A 4CUJA 4E51A 2GAIA 2LBPA 2AMVA 4RPCA 2H65A 4W9NC 4KLNA 4H7PA 1TA9A 2W6JD 4ZVVA 4ARUA 1RRPA 4DSOA 2WT4A 1LBHA 3DMFA 1FDUA 1OX5A 2ZDHA 3H1GA 5E4YA 4CZ2A 3BSSA 3CSUA 1CUIA 1CR4A 1I80A 1AKRA 3HVKA 4HPWA 2FX2A 3AEQB 2XOKA 821PA 4NX2A 3QVLA 1CUVA 1F14A 1NXTA 4BRSA 1Q74A 4QTUB 1K98A 3UFXB 3L2OB 4CCAA 1N9GA 4DR4B 1XLTC 4I7EA 4F7DA 5GONB 2CV1A 1RQPA 1B3BA 1ZIXA 3ZCPA 3KUXA 1MQSA 1WHTA 1RR6A 1PVDA 1H2BA 1KSFX 4RK6A 2XZDA 1VGQA 3GROA 5CNMA 4E5DA 3B6IA 1DO8A 1XJQA 4LYJA 3ZXYA 3K5IA 4HQ0A 2MWMA 3JQAB 4N4AA 3SSOA 2J46A 3RROA 2DVMA 4B6OA 4DV1B 2ID9A 1ID8A 4AMVA 3AZOA 4IBOA 5DNAA 3DZKA 4X0EA 4EF6A 3MMPA 1JR3E 4KV9A 5ICCA 1TYDE 5CDGA 1QHIA 1C8BA 1X1TA 2BFEA 2VTDA 4FLEA 4JJ6A 5EUMA 3UYLA 2C84A 3C7CB 5CFRA 4ZTUB 5DW3A 1JDUA 5EE0A 2X9LA 1E9DA 1VPVA 4IFTA 3L0CA 2RONA 3G2OA 3KLBA 4QEZA 4CT4B 4EYKA 2JGEA 3TZCA 3O4JA 1G6OA 4DV4B 2AQHA 1A9RA 1D9XA 2BY4A 3WB0A 3HY4A 4GC5A 5M34A 1HZZC 1Y89A 1YS6A 3OQIB 1KYZA 1CV2A 2IFTA 2ZBEA 1UFKA 1UDXA 5DGDA 3OTGA 4A2WA 3CLHA 4B09A 1Z36A 4EPWA 4UUNA 1FIUA 4LHEA 5FWAA 3PXDA 5D7NA 1UBHS 3AI2A 5F35A 2NSYA 3KOWA 3AY7A 3PL1A 4HI0E 4LSWA 3UCFA 2J3IA 4BNLA 1XTPA 1JEDA 1U8FO 4MV0A 3U80A 2IU4A 5EERA 5HOEA 4D3FA 1S3SA 4PG7A 3K1ZA 1ZXLA 2FY8A 2Z4RA 4JGIA 4QXOA 5EG5A 5TR9A 3LIPA 1TQ2A 4I2NA 3J81A 5BOSA 2GN1A 2PUJA 1M2WA 4DCOA 3DWIA 5I7WA 1I2MA 2FQYA 2QQGA 2DLNA 5ALWA 1MT3A 3JPWA 4LYHA 4YONB 2YW2A 4JBXA 9ABPA 4K88A 1Q0LA 3LW8A 3AH8A 4DEYA 2YWRA 3CT6A 2UUCB 4V02A 4YGXB 1DT5A 5F4ZA 3OKCA 2HBRA 2ZYDA 3V1UA 4BS9A 1AKUA 1ZESA 1RKVA 2ATXA 3EVFA 3NBYC 1AS3A 2PN1A 3WGVA 1A0OA 3HB4X 2HFKA 4F2GA 1AUOA 1OVGA 3I23A 5JW6A 4AY5A 1L5LA 4JXZA 4U7WA 2D1FA 5IN4A 3ORQA 3N07A 4P3KA 1WBDA 2OO3A 4J76A 4EF5A 3NGLA 3QU7A 1SOMA 1NF9A 2JLCA 2FOXA 5HZKA 4S2UA 4FLFA 3D59A 5JPIA 4OXXA 1VJ0A 1N7HA 3SC2B 4CTKA 1RVV1 3FNBA 2EFCB 5CW2A 2OAGA 4YC7A 4CMIA 4EITA 3DUFA 4Z9AA 1SA0B 3RI3A 5SV2A 1OLSA 4GI3A 5ALOA 4ZZ1A 3WKDA 1R6VA 2F9LA 1BIFA 4R9NA 1V16A 4OUKX 3ZU5A 3EGWA 4QARA 4IIUA 5K1ZA 2GM4A 5DCWA 2HLDD 3O8CA 3TX2A 4RE6A 4NCBA 2Q6KA 2BFCB 1A8QA 3KB2A 4EG8A 2YN4A 4Y7CA 2VF7A 3ODPA 3L82B 4LGMA 4R9UC 2W2LD 3DDCA 4OP2A 3ABOB 3HDQA 5JU6A 4ZMRA 2GBPA 1C7JA 2V6FA 3FHJA 1WU8A 2P9EA 2BRUC 4WY5A 4MHTA 4Q16A 1TTTA 1YRAA 4MUEA 4U7JA 1C3XA 1UXOA 1XF1A 1TAQA 2AEMA 2QYOA 1E96A 1SM4A 4HH3C 4UUBA 2ZIUB 3HE3A 4UC0A 4WNYA 2IHBA 2C5BA 3CPHA 4Z4EA 1M1NB 4I6GA 1D7OA 2ZPUA 4ARIA 1QRRA 3A3PA 4QTXA 4FS8A 1PRYA 1UXIA 3ND6A 4J16C 4QBGB 3EZ2A 3KAKA 2DP4E 3B52X 1RI2A 3AP3A 3G2MA 2OOKA 4L3WA 4DY6A 2IW1A 3DM9B 3UWMA 1WSAA 4GE0A 1DJLA 2IVZA 1NUHA 5CVEA 2Q28A 3N0RA 2C88A 4JLKA 3BTVA 4LJLA 3WLQA 4DPMA 1H2WA 2CLFB 3N8GA 2Q62A 3U3MA 5JRJA 4NEHB 4OLHA 4FE4A 1CX9B 2A8YA 4OKIA 3V4VB 3K8OE 1KOGA 1O77A 1SCBA 1VCIA 3D6NB 4FQ8A 4G65A 4MXDA 3VKUA 2XE8A 3A1SA 3ZUGA 1MAHA 3BWDD 4P31A 4RVNA 1RRMA 1X6VA 1VPDA 4MCJA 5DN6A 1FJ2A 3DSRA 3HQ4O 1VBFA 1FYFA 3Q3VA 4AKSA 1PE0A 1JSCA 1ESZA 1PJSA 4ZI7B 4E88A 2P40A 4OB8A 3NU1A 2BMEA 4XEHA 3RJZA 1S3IA 5FCDA 4ER5A 4QRHA 2A9VA 3U4HA 5K3OA 3N5KA 2BFBB 1F20A 4F38A 5JY6A 5CEFA 3OAAD 4G1EB 4EECA 1O0SA 2HK8A 1HFEL 4C88A 4E31A 1U8UA 1V37A 1ZN8A 5G40A 4B85A 4YCBA 2HT1A 3V4FA 2O8DA 2XQFA 2NU7A 4A6PA 1LLQA 3BDVA 3C5WP 1LY1A 3TTSA 4JB3A 1LDNA 2JHGA 2MYNA 5JZBA 5TQ0B 2PKCA 3BWXA 1XZBA 5IJZA 3GJ5A 5LQKA 8ADHA 4QU5A 2GILA 1D4FA 3PUXA 2C2MA 1OIXA 4MJ7A 5MF6A 2ZWOA 2G0NA 3WIBA 3ZWVA 1P6XA 3WHLA 3UHOA 2PTHA 3N2EA 5FL7A 2QN2A 5TGZA 1IPHA 4CFYA 4CM5A 5JZOA 4DUYB 2JANA 3NTXA 1KI4A 3NNSA 4MRAA 3GLIA 1ZRHA 4AJOA 5EPEA 4MA0A 1IZ9A 1NPYA 4AO7A 1C9YA 4E5PA 1L7AA 3UXHA 4DLSA 4M53A 5I7OA 1H66A 3AV3A 1T25A 4RAOA 4TS1A 1C9MA 4WQMA 4EEXA 1A8UA 3HRHA 3K92A 4JCCA 4JOSA 1AA9A 4TXHA 3UA4A 2PSJA 2WAAA 5HE8A 1BX0A 5H68A 5KTNA 2O14A 4BVJA 1LSOA 1CE8A 2BZGA 3L43A 4FUQA 1E6KA 1CIJA 1RWXA 3T5AA 5LIRA 2JJYA 1N2SA 1U1GA 1NP6A 2A6PA 2GARA 2ZWMA 1MG5A 3AERA 2P2LA 2IUTA 4MYUA 4PPNA 4PBRA 4IIBA 3Q12A 1LPNA 2A0UA 2OGSA 2EEPA 2IEZA 3D54D 2IS4A 2BKAA 1LVUA 3NDPA 4CW7A 3GIDA 1BMQA 4MMXB 3S28A 4N7BA 2ZUDA 2VYFA 3KPYA 4U2EA 5A3VA 2FKNA 1CKEA 1G291 1R3DA 2F9MA 4YCDA 4Q34A 1ISIA 4K8RB 1ST3A 2J0UB 4J1QA 4D9FA 5AUNB 4DV6B 5JAQA 1V4NA 3BMNA 2VPYA 2EC5A 4Z7OB 4M0PA 3SS7X 2AB0A 4ZAWA 1ATZA 4I9HA 4RFLA 5KJEA 4S1OA 2NTJA 3KKEA 4DIOA 5EHZA 3VU8A 4KQ1A 4B0PA 4EKGA 5HF9A 1QBGA 5DV9A 3TAXA 3CJQA 4FC6A 3KOUA 3WE7A 3ZHBA 3GO4A 4F4IA 1CEQA 1BXZA 1ZUIA 2O1EA 3PUHA 2RHLA 3EH1A 3LQYA 5L53A 2SKEA 1T8RA 4RVFA 2JFWA 2FPKA 4JC5A 1CRZA 1T0UA 2IXDA 4X3PA 5CLJA 2B8NA 3RC9A 3SLKA 5K8UA 3TG8A 3QHQA 2HJSA 2JJ1A 3CNLA 1UBSB 1FDWA 4MDHA 4K9MA 4AY6A 3CG4A 3AEYA 2N75A 4F6LA 3PFCA 1BVYF 4CNBA 1UPFA 3K9LA 1J33A 2HRRA 4W6QA 3RSCA 1X7GA 1HR0B 4WJLA 2Y71A 3LX4A 4MQEB 3SSMA 4WJZA 4OA5A 5KDOA 2JCGA 3RTDA 2QSZA 1YB6A 3CYFA 3MBOA 1KHHA 2BFDA 4JKOA 1DC6A 1RLMA 2FJ0A 3LVQE 4TTRA 4MV9A 2XRYA 3RTAA 5D00A 3WLIA 1TTHA 4L9AA 2AJBA 2GYUA 1Z08A 1A9SA 3E81A 2Q3DA 1MV8A 2PZ8A 3CLTC 5KMGB 1CZRA 1EIZA 3IBYA 5CDTA 3CA8A 2PNJA 1T3GA 3U44B 4PINA 2DH6A 3AIOA 3C14C 3ZBPA 3PFIA 4ITUA 3U7HB 2Z98A 1BYUA 5AM3A 5KDDA 1C3OA 2UYYA 3RKRA 4EG4A 1ZSVA 5CNJA 4HY3A 4AROA 1XD8A 4J75A 4D96A 1W2GA 3EBOA 1DRKA 4MPRA 3ETCA 4BIIA 5DM1A 4HNQA 4DA7A 1I0LA 5KQGA 1EQAA 2Q27A 4OU4A 5K0EA 1QZ3A 4WKGA 1ZGHA 1VHQA 1NF2A 2PMWB 4HQLA 4XDYA 3CC8A 5C35A 1H2RS 4YRDA 3LGSA 4JQYA 1X2EA 1X9HA 2K4MA 2WPNA 3ZD8A 1O2DA 2IHYA 2XJ4A 3G9QA 4H17A 3ZWYA 3TD6A 1NVVR 5CP8A 5I7RA 3DC2A 3EARA 3H6GA 2UYHA 3CZCA 2C5FA 3G2NA 3Q6MA 1YIAA 2YYAA 4Q24A 1HEIA 3DYIA 4J7XA 4REQB 5IK2A 3EXFA 4DYVA 1DSSG 2RIPA 1F3OA 4NZ9A 4PNPA 4R7ZA 3TLCA 1N3IA 2IPMA 4HYYA 4ZIRB 1HV8A 2QRVA 1F2VA 1WULS 4KN8A 1UKZA 4DIEA 5H4GA 4C03A 3AO0B 4DCNA 1P7VA 3T7TA 5A2GA 3OUTA 4DXAA 3COJA 3A6JA 4TXMA 4R0VA 1DXYA 4MS3A 4YRBA 5LOVA 3OTWA 2IP2A 3NZEA 4X1IB 1P5RA 5ILQA 3R6GA 4K05A 1Z4KA 5THKA 5JFOA 2ZI5A 6REQB 4N5MA 4TWAA 5LQSA 3ICEA 4R71A 1AGXA 2ZT5A 3M6MD 3DONA 2AOXA 5BMOA 7MDHA 4O29A 5CT4A 1T3SA 1R3UA 3HA5A 4DLAA 1YAHA 4TLMB 4C01A 4B4KA 1NX9A 2B1QA 4XIJA 1Z0SA 3RM3A 4X66B 1RPAA 2J5QA 3K6SB 4D26A 4LFAB 3U1VA 2HWXA 2QYSA 2Z5FA 4PIVA 1WLSA 3QGMA 4RH0A 5AKZA 4CU2A 2DT5A 2ZJFA 3CZ4A 2VJPA 3KDSE 4B46A 2A30A 4G4IA 4KMSA 5ER9A 4MPTA 3TVDA 1PG5A 3NEJA 2Y9PB 1Q0PA 4PIPA 2XV1A 1N5DA 3C74A 3QF7A 4WKOA 3LC1O 1AU9A 3H9UA 1N6HA 5B6JA 3KOOA 3MUEA 3NIGB 4IYRA 5DHAA 4A92A 1YB5A 1X8XA 3IBCA 1R4MB 4YMWA 4BWYA 3STUA 4FN5A 4TTIA 1ECCA 5EYPA 1W46A 1WZNA 2IDMA 3QMVA 1AQUA 4HADA 4KSBA 2P6PA 4V0OA 1N2XA 2GTPA 1FMJA 1AKNA 1S96A 4OJNA 2OC4A 3RU9A 2N3ZA 2WQ6A 1RZRD 4ID9A 1ZO8A 4QOJA 3SJAA 5GVSA 2CF6A 3SF8B 1DJNA 1E6EA 1UAYA 2DWOA 2FW8A 1UBOS 1X1AA 3W5SA 1SOAA 1DCKA 1YE8A 1QE3A 1UXGA 2PPVA 3L0ZA 1XCGB 2Q46A 4UM9D 2OXIA 2N1MA 3VRHA 3GVIA 1E2NA 1E60A 5GQSA 1PO7A 1JYEA 1E4VA 1UEJA 4X1OA 4IDEA 4LJ9A 3RSZA 2O3QA 1MEOA 2R00A 4D46A 3BE5A 3LF2A 4PHHA 4MB2A 4OXYA 3VH2A 3SCZA 1BVUA 1GUDA 1DPGA 1MCZA 2Z43A 2C4WA 3KVYA 3LHDA 4KQ9A 5HG0A 1XNRB 1BNCA 1FDRA 1HUQA 1P4HA 2ZKLA 3L7BA 3KOMA 1QCZA 1V11B 3THRA 3EGXA 2Z2XA 3ZWDA 3LWNA 4W9NA 3T95A 4BBZA 1FK8A 2B35A 2AYYA 2JK1A 4N8EA 1E6WA 5EE3A 3J81k 1ZP6A 4JVMA 1OWMA 2BOVA 5DBEX 4QOEA 4XOIA 1XZAA 1C0PA 2R1VB 1XEXA 2R6CA 4R83A 2X1VA 1KEVA 2QVYX 2VPTA 3D9QX 1ZUD1 1MC8A 1IXRC 3G0DA 1R4NA 3JWPA 4JBYA 1EWKA 5COAA 4EW6A 4I1OA 1T26A 3OZXA 3X2FA 1XLTA 2BE9A 2GAOA 3DCYA 1RMQA 1YQ9A 3FYUC 4OJQA 5FQOA 5JEEA 3PXBA 2OCIA 3H2YA 4EPXA 4ER7A 1MOQA 4LF4B 4PHCA 4DQDA 3TF5A 3RIYA 3S8MA 4EEZA 4L6CA 3SNHA 2GN2A 3AVOA 3MCTA 4YJHA 5DTQA 4DWWA 3QTBA 5F7XA 3E9YA 4GW3A 2H7XA 1JAYA 2EARA 3H84A 4PNHA 4RENA 1A2BA 4PPFA 3G0BA 5F1OA 4IGAA 2A84A 5CM2Z 1CJKC 2CXXA 2ZB8A 1A1VA 2VNAA 3DAFA 1R5JA 3EDMA 2PD3A 3CV3A 1CP2A 5F64A 3IB3A 4FFWA 5ALUA 4DTCA 1JI0A 2F1JA 2YJ6A 1HM5A 4TMVA 3HA2A 1X1SA 1N2CA 2XD9A 5BSTA 1NONA 3M1LA 4XR4A 1UIMA 1JE0A 1K8RA 2B99A 2HU2A 3MLBA 4O6VA 4EJ2A 2Y1OA 4ASUA 1SGWA 1PFKA 3E58A 1CNEA 3LV8A 3FIUA 4BLVA 1F38A 2QL5A 2WUEA 3UHPA 4FYWA 4HNRA 2KJQA 1HZZA 4IS2A 4MKZA 1T8UA 1U0RA 3N0TA 2G70A 3D64A 4JYCA 3ZDCA 2R7NA 2Q3MA 1P7PA 4HG2A 4FGJA 1U2EA 5EQFA 2D0IA 1A8HA 4LRWA 4W9MC 5TMEA 1NF3A 2JGRA 2E82A 4LY0A 4FW8A 4ARAA 3QITA 5L9AA 1FPMA 1A9XB 4IFIA 4PS0A 1G3UA 4LBYA 5JZMA 3NP7A 1VYVA 3LM8A 1CUZA 3FGOA 3IBFA 4F04A 1UK8A 1HE3A 2CVQA 2WSSD 3VI3B 2O59A 4RHUA 5LB4A 1OW3B 1YVEI 3EIHA 1DRWA 2FK8A 2R1ZA 2VZ8A 2QW8A 3PE3A 5AIAA 3AR2A 3HN7A 4BNFA 3WRYA 1DO0A 1NAHA 2P1ZA 3V4LA 1QXSA 4YRSA 3CVUA 1MAWA 4G1VA 4I50F 5IDVA 3HUUA 3VU0A 1AV6A 4PRLA 4UTVA 2EV9A 3NHUA 4HZIA 2IS2A 4YUZA 1V8PA 1XA3A 2OD7A 2Q4BA 2YFKA 2QUBA 5E7IA 3U17A 1EWTA 2VWGA 3I5MA 3VMFA 4BU0A 1O6GA 4MDFA 3UG7A 1D2AA 2JGFA 2VLBA 4P35A 3DCIA 5C4MA 5EGNA 4KW7A 1IBKB 1NVTA 3C7DB 4QDKA 2WHEA 1HOXA 3BEOA 4UVEA 3WK9A 5JNUA 5KVVA 4KV7A 2CCGA 2H0RA 3PFGA 5LNK1 4Z4IA 5CVTA 3U4QA 4YCNA 1MEJA 1I33A 4ZFNA 1QRSA 5DYYA 4BFTA 2FEAA 2PUFA 2RIRA 2QTBA 3FW1A 1QH9A 4F4UA 1G6KA 4M8KA 4MS4B 4ZEVA 1ZC3A 1YV9A 2BM0A 3L06A 5CAEB 4L5JA 5KOHA 3ZVMA 1JR3D 2FK7A 2WF5A 4P4SA 4N9QA 1OY1A 3LLMA 5L7WA 3RNLA 1JDVA 5T4HA 1E9BA 3GJQA 4TTQA 4B8ZA 1QRUA 1P9NA 3BH6A 2QK4A 5EZ6B 3DMNA 4EHNA 2R6GA 4YS6A 1TA0A 3ZDQA 2ZQZA 1FQKA 5B12A 1M1UA 1X8KA 2HGZA 3L7CA 3UAZA 4E08A 2BDUA 1IK4A 2G7ZA 3LPCA 3DFMA 2L42A 3LY9A 4RHXA 4TYPA 3HEBA 5J2TF 3O21A 3ZCTA 4DWOA 5EIEA 4CNQA 5C5EA 4XPIA 1EE2A 1SOUA 4JLPA 3A7DA 1NMSA 2BRUA 2HNAA 1PDOA 3V00A 1FSFA 2QOEA 4LQDA 4AMZA 3KAPA 2BJHA 1SVMA 3QY9A 4B6PA 4C6RA 4EI2A 4WL0A 1Q3HA 2C2KA 2ZKIA 4V0KA 3USZA 4UNRA 1F9EA 1U5BA 1QYRA 1ZM4A 2HCBA 4J16A 3DOOA 5L95A 4ETWA 4AJ1A 1FJHA 3B85A 3EYWA 3AEKB 4JGGA 2C00A 2FN3A 2WVHA 2YJTD 1HFKA 4JQOA 3U0VA 3ZCSA 4YPVA 2EGGA 1KE1A 3P0HA 4YA6A 1CUDA 1DELA 2B2NA 2ZXFA 3HNPA 4DZZA 4KREA 3F4LA 3PGMA 4DDWA 3G17A 5HQTA 1HFJA 3PUKA 2RE8A 1PEAA 4XX1A 1EBUA 1T9GS 3LSTA 1I24A 2ODWA 1F0KA 2OECA 3O7WA 2P35A 1NQAO 2WIDA 4UAJA 3SPXA 2XWQA 3ECCA 2N9UA 3FPFA 2IA5A 3FUWA 2WMNB 2HBQA 2H2GA 1GG8A 3QVJA 2GZDA 1U94A 3AR9A 5DK6A 3NNNA 1A7JA 4CPDA 2PRSA 4V1CI 1U80A 2V3VA 2ZTLA 1BAPA 1T2AA 2C77A 3N9IA 1SEVA 1Z29A 3NKLA 1HT2E 3OQ6A 4ZRDA 1PVOA 1N0UA 3VPGA 2HSGA 3DLBA 3GJ7A 4K7JA 4AO8A 4DQXA 1EDZA 3DNFA 1NR7A 3HN2A 5COBA 3N86A 1I6WA 3GLIB 4I4NA 3AHJA 2IHKA 3KVRA 4GHWA 1GUZA 3R23A 3RABA 3MBIA 3WMGA 4Q1AA 2C4KA 4CCWA 5B64A 4YAIA 4DRXB 3I6IA 4TWIA 3R09A 5BSHA 1U98A 2OKGA 1JKMA 2IIBA 3DG9A 5K45A 4Z54A 2TMKA 2G0TA 3JATA 5LJLA 1PNOA 2YIDA 4BLUA 2E0IA 1Y4ZA 3HB7A 2NTEA 1V5FA 5K6AC 4RJIA 2AK2A 4NFSA 3CF4G 4M0UA 5DXAA 3RAEC 4R05A 2DCUA 1WE2A 3FMOB 3OP1A 3PFBA 1HNWB 1YHZA 2HQ1A 4G5GA 4GVPA 3VM6A 5K51A 4US0R 4XGRA 4I6EA 4OGFA 3UG6A 1JHPA 4BP8A 5IKOA 3COSA 4JK3A 4W1RA 1FMFA 5HOQA 3RT9A 3A1WA 3UCXA 1V8FA 2QI9F 4O2BA 4FU0A 5T6BA 3MXTA 4EVIA 3KELA 4K6CA 4GLLA 6ADHA 2QL7A 2HHAA 2QGNA 1UCFA 2G6TA 2M98A 2OCXA 2EKDA 1G3IA 2Z2IA 1F06A 2VP9A 3ZDYB 1XZIA 4GPD1 4P3PA 3WL7A 2KYRA 5ABPA 4BQQA 2FZEA 3EDQA 1XMXA 1BMFD 1QAMA 3MGAA 5HS6A 4B7UA 5EE9A 3RAPR 4LYFA 4A3SA 1GTL1 1AKTA 3B2NA 3WQSB 3B78A 4WDQA 4EPRA 1O4WA 3H2HA 4DJEC 5GV8A 1ZMTA 3TW8B 3EPPA 3LUDA 5TSDA 5JAOA 2HU7A 3GAFA 4Z0TA 3FFWA 1PBNA 1TZKA 2NYRA 1ZCBA 2XAUA 3Q7TA 4AJLA 2W2PA 2K2WA 1YXMA 1J0CA 1IOVA 3NLLA 3HO1A 4EX7A 3ZTWA 2QPLA 3THXB 3TMKA 4HQ6A 2YJ3A 4G0QA 2WKQA 2FMFA 4Z9FA 2X3UA 4AJ9A 1XRRA 5FFFA 3VU9A 5HX7A 1EGHA 1IBRA 2R8EA 4EK9A 1IEVA 1OT3A 1XZMA 3ENWA 2I4NA 1XTRA 3KYDB 2QZ4A 1Z0AA 4QFDA 4EYEA 5DYTA 2YMLA 2AK3A 3OFNA 3PS9A 3HUEA 4X20B 2A78A 1NW3A 1PEDA 3KYJB 4S3MA 4WV3A 1KJWA 5LP6B 2PBFA 1F6WA 1W1IA 2FSUA 1WTAA 3DHYA 2EP5A 3HWSA 3KJEA 5E0KB 2R7AA 1IM2A 3CH5A 5TVKA 1YE5A 4REOA 2VTBB 2OCKA 1GTMA 5IF3A 1RIFA 1RJ9A 2BMAA 4GD3Q 1EDEA 2W6NA 4PHFA 3SR3A 5AIBA 4HL6A 1EVEA 2LDXA 1OX4A 1QONA 1YJBA 2WIKA 2ZYRA 3PDJA 4FFBA 4MUHA 1R5OA 3FTCA 3OOWA 4ZO6A 1XNGA 4QWWA 3Q5EA 4B7AA 1D1SA 2HA6A 3E7DA 1HDGO 4JT4A 4CUZA 5L6MB 1MX1A 4MQFB 5AM5A 4L4YA 4DCJA 4PX2A 4ZGBA 1N2CE 3CUEF 1KI6A 3OUZA 4UTZA 3PF9A 4XVRA 5DHFA 2IZ6A 2H4JA 3T15A 4MGKR 9LDBA 1M34B 3HM9A 4K0KB 5FKJA 1XQ9A 2JFQA 2RDMA 1PU2A 4ZDIA 1P33A 1S02A 4OGKA 1GPNA 1MHPA 3OZRA 4XFDA 3C8HA 5T8KC 1AUQA 4EPYA 2MMGA 4J1TC 2RK3A 3JWHA 5FI0B 3CKLA 2Z3VA 3HV0A 5U4XA 4G1CA 2EJTA 2KHZA 1LU9A 3CRZA 3PDWA 3O82A 1C3LA 4K8OA 2ZTUA 4PXYA 1R7RA 2PZLA 4G8BA 1NVVQ 1X86B 3ZUPA 4ZCSA 1AQIA 1UWKA 5IHXA 1N2OA 2CNNA 2XMRA 2YY5A 3G0GA 3REQA 2ZBRA 3DFFA 5KKCA 2LKCA 4JJKA 3MIIA 4L95C 2JGKA 3OZDA 3L7YA 1ETHA 1DWOA 1W4CA 5EJ9A 1QLWA 3EPKA 4B34A 3U31A 5JATA 3WGHA 4MS1B 1YIOA 5BPFA 4YMVA 2GPYA 3F5FA 1NC1A 1FU8A 4QNNA 3SYRA 3W2HA 3WGNA 3KT8A 3GAMA 1XEFA 2XOKD 3C16C 1L7EA 2FEKA 5KTMA 3EFHA 3DEFA 1A7UA 3DV0B 1A82A 1P7YA 2IYVA 2XUOA 3N28A 1E59A 4QEKA 3FHCB 2Q4TA 1QYIA 3HDHA 3HGMA 5K5EA 4D56A 2O5EA 3D6TB 2QN1A 3PQ6A 1SVIA 3AVVA 4B44A 2DUNA 1E1CB 4Z9YA 3OZIA 1L3CA 3GRRA 4PZPA 5I7VA 4F7WA 1QH1B 5IKEA 5KC8A 2FKAA 4WDRA 4AICA 2WTUA 4W5WA 3FWYA 2LV8A 2Y0DA 4LNUA 4HNAB 1C8KA 1RRKA 3B1XA 3IQEA 5JZVA 3M2PA 2XXAB 4D74A 4R2LA 4DYHA 3CRRA 1L5NA 3VR3A 2GN8A 3I05A 3AEXA 5EXPA 5BWBA 2QUAA 1J9EA 4M86A 4QLOA 1E7YA 2P65A 2HTEA 3L40A 1BO6A 2TYSB 4RTLA 1L7XA 5D85A 1X1CA 3FUVA 1MW9X 1EFRA 1MJNA 1X3LA 1J09A 4OIMA 3UTDA 3LY7A 2QY9A 3IP7A 4IVQA 3T5CA 1IJEA 3JQRA 4NMWA 1RHJA 1XTZA 3M1IA 4PAGA 5KI6A 1UM9B 3F78A 3MJSA 3SBDA 4IUYA 1LCIA 3QX7A 1XHLA 4U8HA 3TJZA 1FU4A 5AWFC 1NJGA 3H2JA 4BLOA 1EVLA 2D00A 3KDPA 4JDPA 2HZBA 4BB5A 2AKEA 2IOFA 1ORTA 2HCFA 2ARKA 1T3ZA 4HQFA 1LXCA 4PO9A 4B4WA 4DDUA 4XRGA 3E2IA 2G5CA 5ALLA 3PI6A 3CX6A 4XWYA 4EM6A 5AM2A 2HUNA 3BG5A 2WWFA 1Q2XA 2LGJA 2PSFA 3O03A 2ZITA 2ZQYA 3SBOA 3VPHA 5AJYA 1FRVA 4COKA 4EFLA 1GPWB 1J8QA 4M21A 2BF4A 4HFMA 1GPDG 3EQ6A 5L8VA 2B34A 3W7VA 4JS0A 2CXHA 3AU8A 4X8MA 3V6MA 3WL8A 1ODCA 4HBZA 4YWJA 4ZWNA 1UOPA 4NZZA 2Y92A 1MD9A 1MB3A 3MG9A 1K2WA 4LI3X 3HCAA 5AJZA 2VJMA 521PA 1GCOA 4EUKA 3WB1A 1NVGA 2OCGA 5JJIA 3UC9A 1WJGA 1YZFA 4FKZA 5C1BA 1PX2A 3D0RA 3PHJA 1TMYA 2N47A 2AG5A 2VDUE 2D62A 2GAFA 3C3JA 1GA1A 2REQA 3DKKA 3KEGA 5IVIA 3WGKA 4HV4A 1MHTA 3AF3A 2EFGA 1R6TA 3NONA 4XJTA 1UPUA 3I8SA 2FQ1A 3P32A 1H2HA 1D0IA 1KDPA 2Z6VA 3KQTA 5CXUA 2IXTA 4XVUA 5IZCC 1GD1O 2G88A 4U9UA 4JUIA 1O97C 1VB5A 2I66A 1EB9A 1FTGA 1H5NA 1UUFA 1MC4A 3I45A 3NASA 4ND5A 4EJSC 1T9GR 2DHCA 1ISGA 3GWZA 2G28A 1Y81A 2H2FA 4CCYA 4R2HA 4KHPB 3MCAA 4HAVA 2VC2B 4AJKA 1FRZA 1YJXA 3MAGA 2VJBA 1CJVC 1QV6A 1WDWB 1XWFA 2QTCA 3DDOA 3HCEA 3OZCA 3M9WA 4R51A 2A5FA 4I9GA 4BNJA 3KTAA 3PFFA 1S2NA 1GFSA 1UWCA 1PR3A 2WU3A 5I9BA 1J2TA 2FMUA 4NOMA 3DXFA 4QLAA 3EGVA 5MN4A 1WHSB 5AW3A 3FYUA 4EAQA 3MTJA 1D2GA 1R00A 3OICA 1Z22A 3CNNA 1C4OA 3LWZA 3WMFA 4UQLA 3NJ8A 4CN8A 3W2TA 2RGYA 3D6HA 3ITNA 1YVRA 5F3RA 2VP0A 5IDWA 1NQOA 4FEYA 5JIBA 3Q9SA 1DGQA 1QHEA 1T4CB 4CL8A 4NLLA 3AKYA 4B3SB 1N6RA 2NT3A 3BDIA 2JAWA 4D9JA 3G0IA 1XP8A 4HK4A 4AWBA 2JLYA 4OSPA 1PT7A 4L9RA 2HH9A 1LC3A 1GPMA 1U6KA 2VYQA 4LY9A 3PHLA 4G86A 1KPGA 3Q7QA 4RY2A 4NH4A 1CY4A 3OF5A 3TEFA 1JQBA 3U49A 4CLRA 1N6IA 4M0EA 5U4QA 3WGYA 5KYUA 1KDRA 2I87A 2XR1A 3EEYA 3I9MA 1UJ6A 4M49A 4MVJM 1Q16A 1V95A 1RQGA 2Z1DA 5TT1A 5IT0A 2H5IA 4C0QC 4NATA 4Q82A 5DT9A 1Z33A 3JZIA 4Z3OA 2Y1GA 4ZQCB 2J08A 1MW8X 1UJMA 2QQ5A 2JLSA 4IGIA 5SYMA 2YIMA 2ZR7A 5DN6D 5LA6A 1M2HA 2HGSA 2XMSA 5FPTA 3SICE 3T7SA 2QN7A 4ZZ3A 3TO5A 3KJIA 3C8DA 3IH5A 2FN9A 2FUKA 4FGKA 2HJVA 1XAGA 2YDYA 4M46A 3UFBA 2WNHA 3DQZA 4LDQA 4O63O 3C3AA 3BGSA 3NM5A 5F5LA 4EB0A 1Y5MA 2QX4A 2VDQB 1GZHB 4HNGA 2JGMA 4ZYLA 3R3VA 4EFNA 3MWDB 3IHKA 4A0RA 1K68A 3KFVA 3OJFA 4YY3B 1Q21A 1XCLA 2A0KA 5MFPA 1G63A 3AHDA 5K2MA 3ZVNA 2F4VB 3DAYA 3WTBA 4JI5B 3V7WA 3GAZA 2XUHA 3MT0A 2YXLA 4GNKA 2NVOA 4E2XA 1N9KA 2QUZA 1D2EA 1U7PA 1VE3A 4GSLA 4YFVA 2IF2A 3R5HA 2AFRA 3FCUB 4JNKA 4DT1A 3PEEA 2EF0A 4AMUA 1L8LA 1J21A 1Q6YA 1DBSA 3FFAA 2QVZX 4P4LA 3T7DA 2PFKA 3WGJA 4XX0B 3T5PA 1FTSA 4EUNA 1MLDA 4KXLA 4FB5A 3OH8A 4FHFA 3K30A 3OTHA 1FFHA 4XTCS 1N8SA 5FL7D 3V2UA 4A5SA 4DB2A 3PYLA 4HQRA 4DQ0A 2W8BB 2WD8A 2P78A 3C6ZA 5LQRA 4WLFA 3SSAA 2GZ1A 5L45A 1KAOA 4ZICA 1SBQA 2FRDC 3KNZA 1X7XA 5E8RA 4QYIB 1Y1LA 3RUIA 4OVKA 1MFPA 3MEQA 1I2AA 1XB2A 1U7TA 2KQUA 1GQ2A 1N7JA 4UHJA 2AUTA 2AXNA 3KQQA 3VYUB 1ODSA 2JC3A 3G5TA 3TUIC 2TECE 3RCBA 4ZCTA 1DDOA 1KY4A 2VTKA 3IRUA 4U02A 2GZ2A 1V48A 2BBWA 2QDXA 3H1BA 3KZOA 4HLDA 4JUAA 3RUDA 5H70A 4CLRB 4YRAA 2FNAA 5D01A 4MI9A 3JQ9C 1JEEA 4R2MA 3UOAB 4DZTA 2JIBA 4IDNA 3NXSA 5FJJA 4PRZA 2FPGA 1Q5PA 3P71T 4FFSA 5KYNA 5ISMA 3SKXA 4QLBA 1VA5A 5KYXA 3RC2A 3QA9A 5LZ5A 1A9YA 1P2BA 3C8MA 1PDWA 1U8YA 3SMVA 3SR0A 1NYTA 3ORHA 4E11A 1USKA 4B6SA 3DOJA 2Y66A 4Q00A 3SC6A 2Q29A 1E58A 3W1VA 3O1JC 4Z7QB 4NNOA 4NXMB 5TXGA 1G9SA 1T36A 2QD4A 4IMIB 1R4AA 3GFBA 3N2YA 4ED9A 5BYJA 5M2QA 2DU8A 1VJ5A 2IUYA 3EIEA 1ZM7A 4UM9B 4ZHQA 3DTNA 1TYAE 2CLMB 2QMYA 1TVEA 2A5YB 3I2GA 4IINA 1E99A 3UMMA 1VMAA 3COYA 4B3JA 2BKXA 2ERXA 2QVGA 3KALA 2YXNA 4P3YA 1U7ZA 4PLPA 5CVDA 2HWYA 3I5YA 3D3NA 3EEBA 3TCNA 1F4PA 3T9AA 1EUQA 1L9KA 2PUTA 4MNTA 5HUHA 3KBBA 1K6EA 4IZHA 2JRCA 4KIGA 4P54A 2RHWA 4EYQA 5HJEA 1K8YB 3DO5A 3NHRA 4LWPA 3R74A 2Q1XA 4BVHA 1P18A 1P0FA 2PZEA 1US8B 4RA6B 3TGWA 3EFOA 3SZMA 1YCGA 4EGCB 1N2GA 2SHKA 3FJ1A 4LWQA 2ZSBA 3FOAA 1KKLA 4PC7A 4CKBA 1QZZA 5EJEA 1N6OA 4N8DA 1ZR4A 4LMPA 5K0LA 1QKKA 1HDXA 4UUOA 4WERA 4DKXA 3GRFA 4PTYA 1T9CA 3FDZB 2BKUA 5J2UA 4DR1B 2JJ1D 3FGZA 4FOPA 2NXCA 3RHZA 5BNTA 2ZUFA 4GYYA 1FFGA 3IP3A 3CTPA 4PFJA 4LRSB 1L4HA 2OSBA 4O4HA 3WZ2A 3UZUA 2NV0A 3H7AA 1O3YA 4G5FA 2PMEA 4IJWA 1KK2A 1A9TA 4RS3A 4AQDA 1FMLA 2O52A 2IHVA 1V35A 5JD4A 1CFZA 1R66A 1BFUA 3RAJA 2JBAA 5CW1A 5LU9A 5LA6F 5IDQA 5AM4A 3QLVC 1TKAA 2VLIA 3FCCA 2UXDB 3GQBB 4Z51A 4IJUA 1ZWKA 3DVAB 3OD1A 3R3WA 3ND7A 4I08A 4UMFA 4WFJA 5JQGB 2NZUG 2HV9A 3RS8A 1M0WA 3DBLA 3K2IA 3EMKA 2XQGA 3L7KA 3QLEA 4RF3A 3KJGA 3KM0A 1AB6A 4ZCMA 2BTEA 3GBPA 4WBNF 2LVBA 2CFSA 4G1UC 1V1RB 3FY4A 1D3AA 1ANKA 2Q2VA 2DC1A 2ZP1A 3L1VA 5F2OA 3T52A 5LYJF 1QORA 1UJ4A 2EG9A 4RZXA 3ESZA 4QPJC 3A36A 1M66A 3SFZA 4GGPA 3W5HA 3QSYA 4G0VA 3ESYA 4B9AA 2YBEA 5E2AA 4KC0A 1RKBA 1NFFA 3FETA 1OTYA 2CE7A 4WA8A 1PCXA 5K3FB 1RQ7A 1INLA 2QG4A 4WJKB 4XWWA 3JY6A 4YAJA 4OH7A 5DNYB 1EXDA 2RGAA 1CERA 3H4TA 4FD3A 4OGGA 4S12A 4RTMA 1Q92A 4BC0A 4X5OA 1Y6RA 2BDTA 1H0KA 2BGKA 1GNVA 2HF7A 3OURA 2ROQA 4C05A 5BMVB 5JAHA 2ECFA 3OWHA 1AV7A 3OE4A 4NDNE 3HP4A 2BLLA 2O6HA 4M1ZA 1KQNA 2V9ZA 2J3MA 1QKIA 2JZNA 1OFVA 3CG0A 3EVTA 3GRPA 1KQPA 4OHRA 4PQYA 4UREA 5K3SA 3ANSA 2LXNA 2Y1EA 3C70A 4QT0A 3ROPA 4XSVA 4WLUA 5IK2D 1GGKA 2AQIA 1EEHA 5KQRA 1IN1A 4NI5A 3U7RA 2GEUA 2PZMA 5JLAA 1SKQA 3C4JA 3ISJA 3Q85A 3HZOA 3ZYCA 4X9XA 4CKZA 1Q22A 3QF4B 3HXOA 1M8GA 2ATCA 2B2CA 3FTDA 3DOIA 4QBTA 5EIFA 1NLFA 3SHFA 1YCDA 1OGIA 2V7VA 3DDSA 3OQBA 4WGGA 5ALVA 4E03A 3SQOA 5CDHA 1YS1X 2X8JA 2XIQA 4EZBA 1XTSA 2RHDA 5DOVA 5IFKA 1XJCA 1UMKA 3AF5A 3AR6A 3PBKA 2ZZMA 4RTJA 2C3YA 4ZVMA 4TTSA 2O8EA 3K16A 1LDYA 3DMYA 3NANA 4IVRA 1G16A 2QZSA 2SBTA 4D4HA 2BGUA 2EFEB 3PRKE 4CIBA 4HQNA 2PWPA 3QEOA 4K1LA 4RM3A 1SXJC 3PD7A 2EAUA 3F7TA 2HSZA 3ZI0A 5FL3A 1FXWF 1YKFA 3EXIA 2C9DA 4TLAA 2X0JA 4R98A 4DHEA 1OA1A 2G8NA 3GN2A 3PYMA 4DWJA 4E5MA 3JQ8A 3KSUA 3QXCA 1NV9A 4GDMA 5ICFA 4A8PA 5JHHB 4OLBA 3VYVA 2V0NA 3GDGA 2OMEA 4J4HA 5CX1A 3OFJA 2NVUB 3PDHA 4OQXA 1KVUA 3I2FA 4DLNA 2GPTA 2QLMA 5HEKA 2VO1A 5JMTA 5ECDA 3KQNA 3BD9A 2PX5A 3RHFA 3JAKB 1P4SA 4OAOA 1LVHA 1SUSA 2WTNA 5D5HA 2O8CB 5FTNA 2EKZA 3G2QA 3LX5A 3C4VA 3X44A 2HDNB 1EESA 2QE7A 2IEBA 1VMKA 4IX1A 2J5XA 1K75A 3HSKA 3A6LA 4J1TA 4TUYB 3ENKA 2ONJA 3OQNA 1QR6A 2IYEA 3HU5A 3DVSX 3QKWA 1JH9A 3RVSA 4S1VA 3U7IA 1UBFA 1UM8A 1CHNA 2Q0XA 3TDMA 3BF8A 2Q9BA 1ZJ5A 3HDYA 3P0IA 4KN9S 5CR9A 1U31A 4A1OA 3U19A 1BW9B 5J2UF 5H81A 3RD5A 4IL5A 1RWBA 3GLVA 4IS3A 4XIIA 4L0DA 2XZLA 1X0VA 2YZ7A 4EX6A 1U3UA 3OOHA 2UZ4A 5DTEA 3E8XA 3HU3A 3OQVA 1RYZA 1NU8A 4H08A 4IH1A 2FWRA 3ZD6A 4JP1A 1H4SA 5LP1A 1K89A 3CSDA 2JD0A 1DNPA 1TVCA 2D54A 3WIOA 2NYVA 4QPNA 4D25A 2JGDA 2CC2A 2WT8A 2DBYA 3QU4A 2PY6A 4F6RB 2C4NA 2LCQA 3KJNA 2CHGA 2P62A 1XD2A 4R69A 2I55A 4UDXX 3I3SR 4GPZA 1J8FA 3KR0A 3EDYA 3Q0TA 4OK6A 4YRGA 2OFPA 1K5GA 2HEIA 2AS0A 3HP1A 3WK6A 3G82C 3WI7A 1G0OA 2VUSA 1N7IA 4HDSB 4RESA 5LMCA 4EJFA 3RSGA 3IR6A 5DISB 1R27A 2NO1A 2OD2A 1VI6A 2GNPA 4XDZA 3S1AB 3M5DA 3RK0A 1Z2DA 2YOHA 3GRZA 1KMNA 3CUYA 4N5NA 3LA8A 3EW9A 2WD7A 4YRKA 2FMTA 3BKWA 4Q47A 2N1BA 1RT9A 3DZ8A 5AVVA 3DT6A 4HAWA 3RR2A 4HUTA 3DE2X 5HRUA 4OI1A 3X1JA 2FZVA 4H7KA 2D06A 3LBFA 3WSVA 1DBRA 1XPRA 1L5HA 3RARA 1OI4A 4B6JA 5MFZA 1EVJA 3UANA 2UZ1B 2CDBA 3WQHA 5FTMA 3S2GA 1JFSA 1QU3A 2IHUA 1IQPA 4QRIA 2OHGA 2VUUA 4BE4A 3MS4A 3PEVA 3DMGA 4ZVRA 5DMHA 1TLTA 2CBGA 4KIWA 2RGEA 1H9AA 4G67A 1N0VC 4NCKA 4Y2GA 4DVGA 4HDRA 3DW3X 1CUAA 3T3DA 4ASUD 3KQLA 4JLSA 1V1MA 5ICGA 1DP4A 4LZWA 4I8XA 2BKEA 1J1IA 3H0EA 4BOYA 2ZATA 4E5NA 3TBKA 4BV3A 4PLGA 1T5DX 2AW3A 1ZIYA 2OV6A 4GFDA 4RA9A 4U2KA 4E5VA 4E30A 4GU5A 1H9BA 4ZAFA 1SUWA 4OM8A 1SU8A 3LHKA 4P3NA 4FNGA 4RKFA 4C78A 1ZI8A 1QTIA 2LKDA 2EFHB 3BMOA 2ZG6A 4DV0B 3A1NA 4I46A 3GU3A 5FUWA 2FP4A 1QHXA 3U7JA 2J3HA 2YINC 4IW3B 3K2EA 3RQIA 3K15A 2NYAA 2H2WA 4HH0A 1XCOA 2HK7A 1CR1A 5IC4A 1B3RA 4IR7A 1ECFA 4GPIB 3MJTA 1NTRA 5TPZA 3HMQA 1J6UA 5FTLA 3ZY6A 3ABZA 3CVYA 3L7MA 3S4YA 4FOOA 4TYMA 1YNOA 1SU7A 4N8SA 5EXEA 4UEQA 1C0EA 1FDIA 4ZVOA 1EFCA 1IBCA 2PLRA 3QI7A 4YHHB 4HDOB 2Z5LA 3ZIAA 2IYTA 1QTQA 2WSYB 2Z5GA 1M6VB 1C7FA 3WBJA 1REQB 2EJUA 4FGLA 3RTBA 2CDRA 3RRXA 5IJ0B 4PZUA 1JDTA 4K6MA 5BN5A 2H7CA 2XMDA 4KIJA 4Z7NB 4ZANA 3M5PA 2VJLA 4HO1X 2W2TA 3D2CA 2JAXA 2V3WA 1QCYA 5IZCA 3WJ7A 1JEYB 2BJWA 3MF4A 4N54A 1WQ1R 4C1NA 1QAOA 4CFSA 1DB3A 1LBTA 2GGSA 3GOQA 3KJZA 4EJSA 1SBCA 4XW2A 1MF7A 2EL7A 3C4QA 4IUBS 1K9SA 3LKBA 4GIBA 5BP7A 2ZXEA 4X90A 1YHNA 2CJWB 2A9JA 2H1FA 4OJYA 4Q3DA 2VOJA 5AJUA 1NJ2A 3EHDA 2PWYA 5DBIA 4URZR 1V71A 1YI1A 3OIVA 2A86A 1QHNA 4RIIA 1GPJA 1OYYA 1QX4A 1FFYA 2X1HA 4Y98A 1BMDA 3HWWA 5EP2A 3X1XA 4C7VA 4JBIA 3FLBA 4HFNA 2FPRA 1X1RA 4J03A 2PS1A 5ER6A 3I9V6 5ICEA 4HBGA 3EVDA 3GZ4A 1A2KC 3P27A 3KKQA 5GINE 2IGBA 4MUXA 3DNPA 3CZ5A 4B4VA 4X41A 4EMSA 4TZTA 1TM2A 2CE2X 4YIKA 1X1EA 4FNOA 1JPVA 2HHJA 1NXQA 3OQ1A 4HB3A 1M8PA 5FWXA 3RVPA 3ZNNA 1KMHB 4D9BA 1DX4A 2OEPA 5B6IA 3I58A 1CZNA 1PWZA 1MAVA 4L28A 4YV0A 4S35A 5TC4A 3AUJB 4HYEA 8GPBA 1NKTA 1NBEA 4OLFA 5DI9A 3KEFA 5DLEA 4ZREA 4JC4A 4A4DA 3DBHB 5A4MS 1MV5A 2ZI4A 4E2WA 2ADFA 2HLHA 1YZNA 4BX8A 3GZNA 4UPEA 5D84A 1QYCA 3D43A 3Q0EA 3DBRA 3PICA 3OCWA 4M1EA 5BSKA 3DBVO 5JXGA 4JJZA 2BT4A 2E5LB 1UXHA 4YXWA 3CKMA 4LSMA 1SOWA 4YFYA 4C6TA 2A1TS 2QLJA 2WFAA 4G85A 3EPRA 1E1LA 2A0XA 4QSMA 3RO7A 1TGVA 3LNTA 1EJ0A 2CY0A 5C32A 1LLUA 3AM1A 4Q05A 1OSNA 4FSDA 4P93A 5CD9A 4JSYA 3V4OA 1YRQA 1E5DA 2WNSA 2CN1A 3V7YA 1QHFA 2ATEA 2O2DA 3AP1A 4ZDJA 2GASA 2AG1A 3K4HA 5K0JA 4JLMA 2O2ZA 3A6FA 1DQRA 3FWPA 2DECA 4INPA 4FM9A 2FTKE 3H5IA 1TJNA 4NZYA 4OOEA 2XB2A 4R0NA 3J80A 2E4VA 2BZ0A 1X80A 3AY3A 4PO3X 2ESRA 4JSRA 3IQDB 2ZXUA 2EG5A 1RJEA 3HDGA 1HEUA 2JFBA 1BMTA 1XT6A 2ON6A 3IQFA 3OMWA 3BORA 4IJVA 4MVJF 4BCCA 3QFCA 4A8HA 3FAKA 1K8ZB 2KM1A 3FDFA 4G5RA 4PLCA 3L3BA 4K3UA 1JP7A 1BX3A 3HZHA 1UWLA 3V34A 2BMFA 4HSGA 4NBUA 4PEVA 4X94A 5KNCA 3HCDA 1BDBA 1JJVA 2EL9A 4ERNA 3H1PA 2BHRA 4LDZA 3ZK8A 4QDXA 4DLRA 2F00A 4O4LA 1PG0A 3O8NA 4FSXA 4P3OA 1GEEA 2O0MA 3QPVA 4ZQBA 3TLZA 4ALMA 4JENA 2OESA 1Z5GA 2ZJBA 1UDCA 4BNGA 4HFJA 2JFFA 5EWLB 1G1AA 1WMBA 4FFLA 5A05A 2FRDA 1BZYA 1UKVY 2CXPA 3UUGA 5C7LO 3U09A 1B76A 1KXZA 1ESDA 3PGJA 1GTSA 4IF4A 3AY6A 2CEKA 2V6JA 2ZYTX 4JJEA 1G60A 4HRAA 3CRNA 2QSYA 1E79A 2VDMB 4NOLA 2XUJA 2YZGA 4FBGA 2H4WA 1XJ5A 2CUNA 1WD7A 2IIQA 5DX0A 1KMCA 1E1YA 4OHWA 4Z2YA 2YUTA 4OHPA 1VPLA 3LDAA 3HYSA 4IQ4A 3H3JA 2BLNA 2FH5B 3MFYA 1IK6A 3TSZA 4JI0B 5JWHA 3UXMA 4FNAA 4RPLA 3JQ9A 2VH5R 2P9QA 4JBGA 4WHMA 3WYCA 5L4SA 3KSBC 1N0IA 2IH4A 2R751 3T34A 2H08A 5TGDA 3W9UA 5DBHX 1VHWA 4QXQA 3SM3A 4YH1A 3ABRB 3E8SA 3WLJA 2ZRCA 3H8SA 3K31A 3EPLA 2O6LA 5A5GA 4HMOA 5CLFA 2QLTA 4IDOA 1KBZA 1IM5A 4OFXA 4A15A 1DHTA 4HTFB 1J5EB 3A2NA 3O8LA 1Z7GA 3D81A 3Q6IA 3OFND 1VCNA 5F9MA 4YIHA 4B3RB 4KRYA 1FSGA 5B4VA 1K6JA 1UOQA 3DQQA 1PSDA 5ETJA 2O7SA 1ZSNA 3Q2KA 2YFQA 1ONBA 2BIFA 2OYSA 1MRNA 1P1CA 3ILSA 5JYBA 2IT1A 1TF2A 3PHBE 3ZQKA 1G41A 4EW3A 3BWYA 3ISTA 3I4CA 1B0AA 1LRJA 1ZK4A 1ZN9A 3HBAA 2VL7A 3HYCA 2QXTA 1VI5A 1PYDA 4KFTA 4KH0A 4HX5A 1N75A 3HUTA 1FBTA 2YVUA 4XGIA 5GY7A 1NVBA 3MBKA 2AEFA 2CVFA 5EE1A 1J2EA 2WVJA 4X7BA 2Z30A 1LRLA 4C3ZA 4PYMA 5AJWA 1G7TA 1JZTA 1O58A 3A9SA 1JG3A 1TYZA 2YZ2A 1OLSB 2V9CA 3BB1A 3E70C 3FJYA 2WOJA 4QUIA 5KJCA 5KYYA 5FBQB 2W2VA 5KTYA 1ZBDA 2GXQA 3AESB 1PHPA 3GGSA 1F8XA 3K0KA 4GX5A 4JR0A 2Q6OA 3M3PA 2YWXA 4GI1A 4FT2A 4L4ZA 2BGIA 1UL1X 1RXWA 1W88A 2F9FA 2H9AA 3PWTA 4ZOAA 5AI9A 3CQ9A 2P2SA 2VWPA 3AXSA 3MCWA 4MP6A 2AF3C 4CGYA 1EE1A 4O4JA 3H0KA 2FE1A 1PEKE 4GMKA 3SS9X 4A2QA 1UFOA 4G26A 4UHKA 3W4IA 4BQIA 4GKJB 2FUG6 1U81A 2GRJA 2OFOA 4KO3S 3C7TA 2EBHX 4MVJE 1QP0A 2GCNA 2OFWA 2PGOA 2BMVA 1ENOA 2X77A 2XKJE 1O96A 1A77A 1WA5A 2V7EA 4KQWA 4XJVA 3ILYA 4BN5A 2XDQA 1MXHA 3QLVA 3KQUA 1QV9A 1W2HA 4WPGA 3VBCA 2PL9A 2CLIB 1ZD9A 3RHTA 1A97A 5BN4A 4CXMA 2RHHA 2I0FA 2ZBUA 1CJUC 3E3MA 4JCOA 5AW5A 1DQZA 2WPDA 3GIWA 4WX2B 1EK0A 1YZVA 2IIVA 2Q0SA 2V55B 3CLTD 1TGYA 1YQEA 2SKCA 1T6ZA 2L18A 2RSLA 3DMRA 4UEJA 1D6MA 1H4TA 1JQDA 5CITA 1KI8A 3QIAA 2X76A 4GICA 3ER8A 1DZ3A 2HMUA 1FQWA 2JHFA 3KQSA 4RPKA 3URKA 3THYB 2QYHA 3EGEA 1DG3A 4EG7A 4ZAGA 1AGPA 4LVOA 5G4KA 3SJ7A 3KQWA 2HY7A 3RH0A 1NW6A 1VLMA 4W4TA 2OBFA 3RBAA 4EY5A 3FMVA 4JLNA 3L0OA 3ZJ4A 4RNCA 6NULA 4X97A 2P79A 4YRZA 4NONA 3K20A 3QRWA 1D2HA 5EXTA 4W7HA 2CNOA 4U2GA 2NX2A 2Q4DA 2H63A 3JQ7B 5CEJA 4F2PA 4MLCA 4KPGA 2Z3WA 3ER9A 4F9FA 3BCRA 4OEHA 1K7XB 1RE1A 1DT3A 1U7HA 5D6NA 5K01A 2I9KA 2BDEA 1Y34E 3WBFA 4KDCA 4NVRA 4BO4A 1TAGA 1YJ8A 1S9DA 2HNBA 1R0RE 2GN9A 2GDZA 1ZUHA 3PKJA 3FWKA 2UVPA 3VR3D 5HQ3B 3BF7A 5CD1A 4XIFA 1KZ1A 2VSFA 4P84A 4L78A 1JHUA 2JD1A 3AFNA 3B5JA 9GPBA 2WJGA 3OIUA 1GGFA 2ORED 5KKNB 5K4AA 2I91A 4PFKA 1Y8ZA 1JLKA 3NHLA 1RWVA 2PUWA 5CPFA 3UPTA 2HYIC 1LSSA 4DADA 2O5VA 1Y8CA 5C5IA 5CBPA 1J0XO 3D4IA 3PGKA 4P58A 2IPXA 1II9A 2FB9A 3CNEA 2HCTA 1RAFA 3KUUA 4NOKA 5AVJA 5HTKA 3AGPA 3C5HA 4UEOA 3RASA 3ZHTA 1CR6A 1Z47A 2W6MA 2OPBA 1NVMB 2ZJOA 4NV0A 4Z0NA 3UGJA 3PLNA 4PPYA 1SXJA 1OD6A 4GBMA 1IG3A 4Q7QA 5K8CA 3ROXA 4DBVO 4R7TA 2JF0A 3ADKA 1VPTA 2C4HA 3JYOA 2Y1XA 4L2IA 1QPZA 3GOHA 3GGOA 2RI6A 1B0PA 2J9GA 2QZPA 4DCVA 4FB4A 3IUPA 4J0FA 1G5QA 1RVDA 2GHIA 4ETNA 1L9XA 4GUAA 1VSQA 4GYJA 3WXBA 3EXEA 3BGOS 1I51A 4AIIA 5INTA 4G4GA 1COWA 1KJ8A 1QH8B 1KRWA 1SBZA 1XHEA 4IWXA 5IAOA 4NV1A 1OBOA 2OORA 1I3CA 2PUCA 3V1KA 2JEZA 5HK8A 3K1TA 3TS1A 1H05A 3DWEX 5JTUA 3UXEA 3OEYA 3FPHA 3C5VA 1CE8B 1YSCA 1SC6A 2HA4A 4D97A 3THWA 5C3UA 3O95A 1SPXA 1U99A 2CYAA 2I6UA 1W4LA 4U6QA 3ZXUB 4MAFA 4BPRA 1OLXA 2R47A 3PK0A 3WLAA 3QEKA 2LIPA 1C2TA 3IOYA 2I6SA 1K8QA 2VSXA 1EDBA 2VSYA 1WVMA 4PRYA 5UKDA 1A1SA 3C7AA 3OQOA 1YKSA 2I4MA 3FNQA 3CUKA 1N8NA 3IA7A 1PR2A 3OOSA 4IKPA 4PAMA 4DCGA 4GZ5A 4UHCA 3MUFA 2FF5A 3I04M 4D0GA 1GG9A 2IEDA 4FCCA 1HDIA 1P7CA 2PAAA 4GZMA 5ALXA 1RW4A 4LW8A 2A1TR 4DCMA 3CX3A 1XPOA 3AKCA 5C5DA 2O3RA 2DOKA 3C1UA 2X6TA 4LF7B 1ZD4A 2V6IA 4H77A 1JBKA 1T8YA 2J7PA 2VQ3A 3QQ5A 2JJ2D 3BMNB 3CCFA 4LJ4A 2WD9A 4UD6A 4B43A 1DEHA 1A95A 2GFQA 2H1VA 2Y3IA 3L0DA 3NW9A 4ZOLB 4IDQA 4HDQB 1RTKA 4RPHA 1JLMA 3IMEA 3WWYA 4RLQA 4EY6A 1ZD5A 1NLUA 2UVPB 2YICA 4DJFC 4ZZ0A 1PJTA 1PVVA 5H16A 1T8SA 2QRPA 1DINA 2R68A 3STTA 3AL0C 1TRHA 2C96A 3L8ZA 2RHTA 3QOFA 1CEXA 3WLOA 3GP3A 2C8JA 3VJMA 1A8SA 1NUUA 1FW8A 1JQEA 3EY4A 3MK31 3K5HA 2P69A 3LOUA 4QNMA 3OLZA 4WKNA 4JQCA 4QYWA 4R1SA 4AUKA 3MELA 1H42A 3OCVA 3TRJA 3FRIA 2ES4A 3LCUA 1P91A 3X1YA 3MT8A 2CLCX 1YK1A 3NAQA 2HRZA 4C2BA 1H1LA 5JT1A 2LUOA 3A8TA 3R3JA 1SQ0A 4DLXA 4J2TA 1KY5A 1FJGB 1NBHA 3D3WA 3IPLA 1CIPA 3V4SA 4DIKA 4TMTA 4P7KA 3SYMA 1SIWA 4MX8A 3RS5A 3M5WA 4UCFA 1UZLA 4AW9A 1YUMA 3CZPA 1XEAA 4HGZA 1XU9A 1QQ6A 2O7NA 2WP8J 2AZTA 4E5YA 4HH1A 2EX4A 2JGLA 4MKFA 3UKDA 5AK5A 2FCAA 3C1TA 3I62A 4AB1A 1UJBA 2BCEA 2W2MA 3U56A 1WKCA 4ZQHA 3K0HA 4F71A 3TIXB 1MJ5A 2WG2A 2YN0A 1N5JA 4EHHA 3TEMA 1P3JA 4FOSA 1B8VA 3MCZA 4RIHA 4LZJA 2YC4C 3KBOA 3WJ2A 1TTPB 4BEJA 1C3OB 1Q7EA 2PPLA 3AF1A 2A9RA 4I4TA 5E4JA 1NRIA 4NWIA 1IM8A 3OZSA 1R9JA 3WDMA 4TLCA 1MN6A 1C81A 1Y9EA 1YBFA 1YR1A 7REQA 3HADA 2NPOA 4FMCB 1CD5A 1I6LA 1ZGBA 3PFHA 1BE1A 3S0JA 2GFIA 5CYOA 2GERA 1LDEA 2CHUA 4URVR 4A5OA 1YRWA 4YJKA 3V3TA 3VFDA 3KRTA 4Z49A 2XA9A 5LWQA 1J2RA 3AVUA 1C2YA 2CVPA 2VBGA 4WD3A 3WHKA 1KU0A 1ZGJA 2YXPX 3TX6A 2IXEA 4DM7A 4D3SA 1KPHA 5EIWA 1R0SA 5AR1A 1GHTA 2ZJ4A 3PPYA 1S8AA 3EXFB 4XYGA 1FLAA 2YKGA 2ZJYA 1FS6A 5AVOA 5AYVA 4UNSA 3WK5A 3NYQA 2EJBA 2ZE5A 4FGUA 4R6WA 3ZIUA 4DM3A 2FPIA 1CVLA 1NW4A 1YWGO 3K0AA 3LPAA 5LOVB 1H5UA 3I4LA 1IN6A 3UJHA 4EYGA 5T64A 4KKXB 1PEYA 5DU2A 1W29A 2A3RA 4MRNA 4Q7JB 3OLYA 3AI7A 2TMGA 4LC1A 3ZU3A 4AS2A 4D4GA 3O38A 4XARA 3ABSB 3FSJX 4FWIB 3Q7EA 4EHKA 1X77A 3LPDA 1UT6A 3B7WA 3RGGA 1B0UA 2W9XA 4R2JA 3DZJA 1IN4A 4UPDA 1KEPA 4X61A 1AA6A 1K0FA 5AW1A 2P4EA 5HRAA 2VP6A 3QIVA 4EGSA 4AUMA 2VBIA 3TRDA 1DQSA 2X13A 4TM8A 4F5ZA 3NWEA 1K2VN 5CB4F 3GT0A 3V4RA 3RYIA 2I2AA 3VKVA 2Z6UA 1QJCA 4L8YA 4QYXA 4KNYA 1NWCA 3V1MA 4UAVA 4NNPA 1SBYA 1X94A 1R10A 3C3KA 3F9IA 4AAYA 1Y5IA 4DTIA 1E77A 1QE5A 2R25B 4Q93A 5FXMA 1WD5A 1Z4OA 3RRYA 3W77A 1P1FA 3A25A 4P5PA 2G83A 1Y8RB 3BULA 4BFCA 4ML3A 3LT4A 2VK8A 4MWCA 5DKFA 1V2HE 2P9CA 4LDNA 1IE3A 3SXPA 1IIBA 3OFKA 3T3PB 4BNNA 4ZI2A 4AWAA 1EE9A 3WLTA 1RWPA 2PANA 5EQTA 1BWRA 4XWGA 3AFMA 3NAMA 3TL2A 3O0DA 3TNDA 5IPFA 1R0BA 4HAIA 5DEIA 2H16A 4H60A 4QO7A 4I3FA 4DPLA 1NZFA 2O8FB 4OUDA 1Q11A 4LSZA 3L49A 1IXZA 4OBBA 2BTQA 3N7TA 2WQZA 1Z8FA 1U11A 3HL4A 1BHJA 1XQXA 3KTOA 2JFPA 4PZLA 1J8DA 4YRRA 4AVYA 3QNMA 5LC1A 1NQ5A 1VJGA 2LWIA 3HXKA 3GLSA 2OXFA 1QO7A 3KUCA 4NECA 5HCIA 2QPTA 4EG5A 2AJLI 1I0ZA 1QG2A 2O2IA 1IUOA 3P97A 3Q9UA 4HGQA 3N2GA 3TTXA 3WRXC 1C7IA 5JNWA 2R85A 3RW9A 3UB2A 1OVMA 3OP4A 1YZHA 3Q8KA 4F93B 2OCPA 3VNAA 5HKKA 4J9VA 3FFBA 1M1XB 1XEXB 4HRXA 2ZIZA 4EYOA 4P2GA 1PQWA 3RF7A 5B58C 1JR6A 2RGGA 1DJMA 3ILXA 3WMEA 2R8BA 4PR3A 1R4NB 1ZN7A 2W0MA 4ND7A 3IDFA 3ICCA 4UBLA 3U0BA 3VZRA 1B1CA 2GPWA 1CJBA 1U7DA 4X8OA 5H1YA 5KZMB 5T3UA 4OQYA 1B00A 1JF8A 3ZG6A 4OX9Y 1E2LA 1PUJA 1SXJE 4YJHB 1GV0A 4QGAA 5DHSA 1YQGA 1I6MA 4DWVA 1NN1A 3MC1A 4I4TF 5M7EA 1NW9B 1W35A 1ZMRA 2IYZA 2PMBA 3D31A 5B3JC 3JARA 1KQGA 3MIZA 4BLPA 3ON5A 4GSYA 5L7TA 1KJIA 1N78A 3AJ8A 3CE9A 3QPDA 5B3KA 4QZVA 1BHSA 3E5NA 2A5DA 1VKOA 4ILEA 2AE2A 2R5WA 3ZEIA 1TDJA 1TL7C 2AZDA 3JQAA 4P8RA 1H6CA 3KHKA 4W8OA 4C14A 1GZSA 5FUBA 1ZCZA 1N2CB 2HU5A 2XYPA 3PG5A 3WYFA 5SYAA 4TM7A 2PMDA 5C51B 1NJ6A 4YV7A 1NX6A 2WR8A 3FMGA 3N58A 3PDCA 4C22A 3WB9A 4DCCA 3UJPA 2JVKA 1KIAA 4MEAA 5DYIA 3TQRA 5D1HA 2W2NA 2OZVA 1DC7A 3JS5A 3Q3HA 4MKRA 3SQWA 3PHCA 4PU0A 4CE6A 2QD2A 3GFOA 4UASA 2FJPA 4NIMA 1BQEA 1UQRA 1Z5UA 3DDUA 5AHWA 4H7EA 4MQ6A 4A6XA 1E4OA 3DZCA 5LMZA 3LYLA 4QYTA 3T3OA 3PVZA 5E1DA 3DMDA 4LOJA 1ZNZA 3E84A 4RABA 3TB4A 1BH2A 1RMTA 3BIWA 1T2NA 4IFBA 5T41A 2ID7A 3FPAA 3O0TA 3KHUA 3I2HA 1WV1A 4HD8A 5C52B 3K1YA 2BYTA 3RIMA 4TMZA 3FTNA 4XTRA 3V32A 3NALA 3O2JA 1NXSA 3UW1A 1M8FA 4IHJA 2BCJQ 3CBQA 1GZ4A 4NZMA 1SXQA 4Z53A 4RDIA 3MWEA 1CETA 5GOTA 3H87A 5DNUA 2A67A 3GLHA 2AJTA 1TYEB 2Q5IA 2QLFA 3E5MA 4J49A 3REOA 4ARVA 5LPNA 4LXGA 4BQSA 2B7CA 1T9KA 1BSVA 4MO9A 4G5HA 3G0HA 2ZOSA 4UZFA 2OENG 2YRWA 3AW9A 1VDMA 2QTTA 2BSQA 4EFDA 1PS0A 4L0CA 1Z62A 5LUBA 2A1UB 4PX9A 3H9EO 3PEFA 5AW7A 1F60A 1CZHA 2NO5A 1PJ4A 1LJLA 1YJCA 3B6MA 1FVOA 4PO8A 4B31A 3IVMA 5A2QA 5EJ8A 5BSMA 2E37A 1VL0A 2FSIA 3RPEA 4PZYA 1SFRA 1C1YA 1B14A 3EOAI 3OVMA 4YLGA 2MINA 3GVXA 3TQFA 4RL4A 1Y3AA 3AETA 1NJSA 4C0AC 5T7BA 1TK9A 3WNVA 2I8CA 4YP5A 4QVIA 3WS7A 3HGQA 4S2EA 5KOHB 3V8MA 2XNKA 1JFLA 3HLYA 3S3TA 4BKRA 4C89A 1WOYA 5EMHA 3ESCA 3P9KA 1CUJA 1FFXA 3UPUA 2ZYIA 4BVFA 1BVHA 4TL8A 1D1PA 1KBQA 4ZQFA 3D8UA 3SC2A 3VHQA 1O9GA 5EJ2A 1EAMA 2X42A 2HPAA 4G0OA 1SA0A 1DWQA 2JLRA 2EU8A 3OCJA 1KTVA 1TJ3A 3F3KA 3IIKA 3IV6A 1G66A 1PJQA 3STXA 3CHYA 3FKSA 2JIOA 1I9GA 1XX6A 4N5LA 5FUYA 4ZHQF 5CFQA 2F4NA 3QSGA 4OMFG 2PYIA 3BREA 3FWZA 4YRLA 3WL6A 5E1OA 2EBWA 1FYXA 4DDHA 2BFCA 2EVWX 1ZRMA 4AS3A 4MQBA 1NNLA 1DV1A 4DL9A 3GLFB 1EP3B 2H2HA 3R7BA 2AMYA 4II3A 3EMVA 1W49A 3GEMA 4MQ5A 1QX3A 4DREA 2ZPTX 3TIVA 2G76A 4JXXA 5EGSA 1MEEA 1A3CA 2ECQA 4L08A 3OOJA 2Q99A 3HB9A 5HZMA 5KMGA 3IALA 4KXWA 4LYEA 3SJBA 4DR6B 4XWTA 5D86A 4X95A 2AQ8A 3GEBA 5AI5A 3VPSA 3R0QA 3IKTA 1M1NA 2J5BA 3NOXA 4H4EA 4C7JA 1FTYA 4MW2A 5BXYA 4D79A 5GONF 1Y48E 1NBIA 4IJMA 2AFIA 3B3GA 4NU8X 2XXAA 2QF7A 2ZWPA 3DLIA 2JKZA 1QE0A 1NQXA 3QEJA 4YDQA 1JE1A 1SNYA 2GZHA 2QB5A 1UJCA 1WPRA 1Z3IX 1OTHA 2C9OA 2ZYWX 4FYIA 3UA3A 4EVQA 1DKRA 3CRW1 1BEEA 3EF1A 1WXDA 5L3RA 3WX0A 4RUKA 4AZ3A 1E2PA 4RTRA 1YA4A 1RBZA 4MWGA 1F17A 2YJNA 3K53A 3CCCA 3ZHVA 4WK6A 1J99A 5H0IA 1GT91 1XROA 1FZTA 2ZJAA 1C1XA 1Y5LA 2ONZA 2MYUA 3TBHA 1ZK3A 3ZCUA 3IJ5A 5FYDA 2UVQA 4D82A 3O3OB 2ZRBA 4CFZA 3ZVKA 5CK5A 3TXYA 2MIIA 2BFBA 2QR2A 4DCUA 4S05A 1QGAA 1RLJA 2XNSA 2YH2A 1DBQA 3IQZA 2VZ9A 1KORA 3K2QA 2FPOA 2LD4A 1KOFA 3DDWA 1DTEA 4QPPA 3M3DA 4CL2A 1ZJ6A 4EHIA 3WMRA 3LXXA 2QEQA 1IY0A 1ZVJA 4FDLA 1XJ0A 3FKJA 2HXYA 1V45E 4L9SA 5EZSA 2IWHA 4CF6A 5JD6A 2VK2A 5DX8A 2F90A 1GPAA 3VNSA 1PR5A 1E6LA 1Y82A 5TQ0A 2I1WA 3B1ZA 3R5XA 4NJMB 1JLHA 4O2BB 4BZZA 1T5IA 4AO6A 2YBDA 3UJ7A 2EJWA 5CURA 5ALSA 1T9ZA 5JEDA 2G4CA 3KJQA 4OO3A 4DJJA 3BZWA 1VIYA 3O8QB 4C06A 2NZWA 4Y2JA 1SHUX 2DFNA 5LLDA 3RAGA 1PR4A 1RWMA 2F8LA 3FYHA 3HR4A 3JYNA 4I6JA 1ZXBA 2YQ4A 5TPZD 3KB8A 4FPXA 3UK0A 4KLCA 3E82A 3I5XA 2HNKA 2ZCJA 4G0UA 5KSPA 2AR7A 2X22A 3T3IA 4KO8A 3ANTA 2CSXA 1W2WB 2EERA 5CFLA 3QEAZ 2IYRA 4ZC8A 4IRMA 1UDRA 2CJXA 4IVNA 5CHYA 5AHRA 4FILA 4PRKA 2QS9A 3JQDA 3ELUA 2B20A 3KT6A 4PGGA 4XGNA 5H59A 1CY1A 1HE5A 2F2TA 2YHSA 3NRBA 2VP2A 3ZIAD 3X1ZA 1CLEA 2BFPA 2GCIA 2RH9B 3R5SA 4DYDA 3FSGD 2TMYA 5TNXA 3LXMA 3L93A 3M70A 4JVOA 4OREX 5C7IO 5AQ1A 2WAMA 1HYGA 2HJHA 4UHDA 1UT5A 3VU9B 5I9LA 3ND5A 4EUFA 1TD1A 1N0WA 3E3LA 3GUVA 1T3LA 4C30A 3RFXA 1E3TA 1T2UA 4Q9DA 5HIMA 1O97D 3W78A 4YUAA 3VHXB 3N0XA 1L7OA 5FX2A 1JG7A 1OV4A 4P7JA 1M5UA 4D81A 1H93A 1KYYA 1MPXA 2C99A 1MVNA 4EIWA 2JNWA 3WJ1A 3B3AA 3QPAA 2I34A 2E9SA 2JHCA 3HY6A 4QVGA 4CF4A 4ILKA 4BKUA 1EPUA 1EQ2A 5SZKB 3OD5A 4AQ7A 2J0UA 1RJ9B 3H5VA 3O8OB 3H18A 3N2LA 5LP6C 3W2IA 2XZOA 2WHXA 3U39A 3JQBA 5BORA 4BQRA 3RREA 1MMFB 4KDRA 2E6KA 1Y63A 1YRYE 3H97A 3PQ2A 4UVIA 4OHVA 3U3JA 4KN6A 1NXWA 8ATCA 1O08A 1BFDA 3JWIA 1T5SA 3GY0A 1GDTA 1W47A 4LKRA 4MV6A 3MMZA 3UWOA 3H0CA 3WK7A 4Q7KA 1MTOA 1TMOA 1KZHA 2W5UA 3QX8A 2GAAA 4PXSA 4F2HA 1P74A 1G17A 2AHOA 4M87A 4Z7JA 3AXTA 3BWMA 3E22A 1YQXA 2IXBA 3T61A 2MDTA 3E27A 4BGIA 1GKYA 2CT8A 2NZ8A 4PS1A 4E0BA 5BVGB 3JSAA 4IRXA 3QFSA 4JI1B 1T4GA 4RSHA 2KI5A 4WY8A 4CTJA 3R44A 4YMTA 5JS2A 1YTLA 2F6RA 2OP1A 2Q0QA 4PO1A 2PLFA 1TYBE 4JA0A 3PNYA 4F8JA 1V5IA 5F21A 3LXUX 4YXWD 1BJKA 1Z7YA 2X14A 3OBBA 4KBYA 1NMXA 4NENA 4X60A 5JH7A 3LBNA 3BVPA 3RYTC 4ZCRA 4Z5XA 3L02A 5T3YA 4ZI7F 2EYUA 1J49A 4GYWA 2VP3A 3EBLA 5AKGA 3KTFA 4RY0A 3L92A 2PGIA 3EYAA 4CKYA 3ORSA 2OQ2A 1YFKA 2D6FA 3GLHE 4YV2A 5JROA 1JI3A 4RHYA 3N53A 1TM4E 2XEXA 1MVOA 3WYDA 1E3LA 1L6RA 3ACBA 4Y7DA 2P11A 1Q1EA 3Q1KA 1C14A 4A0SA 2P0AA 5KREA 4GI7A 4NF2A 1PJCA 3JTMA 1HG0A 1V3QE 2PX4A 1ECLA 4PG4A 4RZIA 4TKMA 3OEEA 3L4EA 4W5JA 3WGZA 4B2IA 4EUEA 5IVPA 5IWCA 3BX1A 3CEPB 4DMCA 3R40A 1XL1A 3I9V1 4HEA1 3HA7A 4Q03A 3ZWMA 1JIKA 2WU4A 4L5AA 2ZROA 3GNQA 3SEAA 3ZTYA 1NRWA 3GELA 2V0CA 3HJAA 4A82A 4MVWA 3VJKA 1U9YA 3A06A 2C58A 2CWDA 3KSRA 1OBHA 1T0BA 3CPSA 3JV7A 3P4YA 4UTXA 3U7EB 3V1TC 2I8AA 1LK7A 4PCVA 4A8JC 4WKBA 4LQCA 1IIRA 3RLFA 2YRFA 3EXHC 2DAPA 3QM1A 3UBTA 1OZFA 4MPPA