4JQOA

Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with citrulline and inorganic phosphate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
338
structure length
338
Chain Sequence
QSNAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine carbamoyltransferase
publication title Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
rcsb
source organism Vibrio vulnificus cmcp6
molecule tags Transferase
total genus 133
structure length 338
sequence length 338
chains with identical sequence B, C
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jqoA01
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jqoA02
1I5OA 3Q98A 2FG6C 1NBEA 7AT1A 1C9YA 3D7SA 3L02A 2BE7A 1JS1X 2ATCA 4H31A 1EZZA 5AT1A 4BJHB 2QGFA 3L04A 1R0BA 2RGWA 1F1BA 1ACMA 4ANFA 1ZA2A 1A1SA 2BE9A 3SDSA 1RAEA 1TTHA 3D6NB 4E2FA 1ML4A 1RAGA 1AKMA 5G1OA 1OTHA 2H3EA 3L06A 4AMUA 2FZCA 1DXHA 5G1PA 4F04A 2A0FA 3M4JA 1R0CA 1D09A 1XJWA 4F2GA 9ATCA 1TU0A 2YFKA 4AT1A 3KZOA 4FYXA 4NF2A 4A8TA 2QG9A 3M4NA 4AM8A 4IV5A 3M5DA 1EKXA 3LXMA 3TPFA 3KZMA 3GD5A 3R7FA 2EF0A 8AT1A 1RAAA 4OH7A 1FVOA 1EP9A 1RAHA 2I6UA 3NPMA 4FYVA 1AT1A 1RAIA 4JHXA 4KGXA 1RACA 4JFRA 3TXXA 4KH1A 4WTOA 4KWTA 2AIRA 1PVVA 1SKUA 8ATCA 1VLVA 6AT1A 3GRFA 2FG7C 2FZGA 5ILQA 4KGVA 4EKNB 4KH0A 3MPUA 1PG5A 2IPOA 2W37A 1Q95A 4A8PA 1RAFA 2HSEA 4JQOA 1FB5A 3AT1A 2AT1A 3R7DA 4A8HA 3KZCA 2G7MC 4EP1A 4FYWA 1RADA 2FZKA 3CSUA 3KZKA 2P2GA 4KGZA 2OTCA 4FYYA 1DUVG 3L05A 1ORTA 3KZNA 1TUGA 5G1NA 3M5CA 3UPDA 3E2PA 1ZA1A 3R7LA 1RABA
chains in the Genus database with same CATH superfamily
4NU8X 4ARAA 4QLBA 1U6IA 3WBBA 1QV9A 2QUKA 4J0FA 3LUDA 1GT91 2JLSA 1FTGA 2VI5A 1M6NA 3QH4A 1IJKA 1SFRA 4LY6A 5FHRA 1R5OA 4C0HA 5DVZA 3EIXA 5K4GA 2TMDA 2EWMA 1UOPA 1W85B 4IFEA 5K0SA 5SY4A 4HAIA 4RX1A 1CTQA 2O1WA 3SKXA 1E3EA 1PJ4A 3NWBA 1M34A 2G5CA 2B1RA 3D8RA 1K8QA 5IC5A 3STHA 4MPJA 2XYHA 1XCBA 5FEUA 4AWBA 3WL7A 4J0EA 4LOJA 3T99A 1OH7A 1QPBA 3C3AA 1NSYA 1DKRA 1W5TA 3QXCA 1GO2A 5DK4A 5ALMA 4DXHA 1DAHA 2IH2A 5K1ZA 4U3JA 3OFNA 1I7NA 1MU0A 1RRGA 1S9HA 2AN3A 3HVUA 5EIAA 1SG6A 1VLLA 4B6EA 1R50A 5IU6A 2II6A 2Z3VA 3PDHA 2IUSA 4JBXA 2FSSA 2FWJA 4XWTA 4TKUA 4YP5A 1CR2A 3RI3A 3IBYA 3ROPA 3ADCA 1G5HA 5FCDA 1LSJA 1AN9A 5DTRA 5LLTA 3B9QA 1N6KA 2HRZA 3O0DA 3GLUA 1T43A 3BK1A 3HL4A 1ZU5A 3IVRA 1ZJZA 3NBKA 3UT5A 3AC0A 2R1VB 1DMRA 5GV7A 1E64A 5CT5A 1V5FA 4ZANA 1NAIA 4DVGA 1SUCA 5J23A 5J5VA 1N2BA 4DSOA 4R3UC 4TSRA 2HADA 4J7XA 4J3NA 3WSVA 5BOSB 4Z3KA 3MWFA 2CV1A 4PHHA 2AFIA 2XZTA 3RIGA 3UUGA 4IICA 3GFQA 2R7LA 4JR2A 4B09A 3GD5A 4N01A 3KR1A 2O05A 5IVKA 4HDNB 1I3OA 2H4HA 2DUWA 4J7AA 1P61B 4G5QA 1TM5E 4MAMA 4N3GA 3U4CA 3WOHA 1G18A 1WMFA 2AV6A 4FT4A 3PUXA 4W5WA 2J33A 4MB0A 2B25A 3F4BA 3O5AA 1RAIA 4PLCA 3AW8A 3SN6A 5D87A 2R85A 4Y2XA 2I9KA 4LV5B 4TRMA 4EF6A 2O3QA 1F2TA 3PRYA 1PLLA 1G291 1CJBA 3DFMA 1E4EA 1SY7A 3UCEA 1JG4A 4EDFA 2FEXA 3GMSA 1SUDA 1UJMA 2AFHE 4W7HA 3MCWA 3SMVA 4HNQA 3RFFA 1AE1A 2Q0SA 2QU8A 3GP5A 1W5AA 1Y5NA 1ISGA 8MHTA 1FSGA 1HYGA 3H2BA 3HBFA 3NX4A 1QAOA 5GJWC 2G8LA 3P2MA 5HJ5A 1JNYA 4P84A 1EEXB 3FIJA 4LZOA 3CLKA 5JR3A 4HZUB 5CFLA 3QYPA 2GEFA 3IB6A 3BXPA 1LTHR 2P2NA 4EEKA 3UUFA 2W00A 4EELA 4L85A 4JSYA 3BE5A 1L5GB 3ZCXA 1OAAA 2WYWA 3G7SA 3ILYA 5HMMA 4EJFA 3KJNA 5K2OA 3FOCA 3F9CA 2Y71A 3JWHA 4R9RA 4TUYB 1H3FA 2OC4A 2ERYA 5A04A 2JFBA 5ELMA 3UGJA 1IIRA 3BREA 5B2EA 1ONBA 2JHFA 1JKJB 1V96A 1EQAA 2YV3A 4LN1A 1U1IA 2A0UA 2GNPA 4R1QA 3ZBUA 2QN1A 4R05A 2VDWB 1LTQA 4O5OA 2VH2A 3SVZA 1MABA 2WP0A 3E9EA 3I45A 1YZFA 4PC2A 4UEKA 1OHHD 2G83A 1K7CA 3D6JA 1YRYE 2FFQA 2NGRA 4Y1RA 3WYEA 5KX5A 1Y80A 4W7IA 3O38A 2XB8A 2HHCA 1X7WB 1A77A 1WULS 2CUTA 3M3PA 2X3UA 4I9FA 4PBTA 4DIUA 3ET5A 1QIJA 3TTSA 1S1MA 4XXHA 1SKMA 2BHSA 2UXCB 2WIGA 1M5UA 1RYZA 3PTAA 4WZAE 3CX8A 1R0SA 3AB7A 4ETNA 1NXQA 1QZZA 2H2AA 3H97A 3I39X 3RSGA 2IKQA 1P1IA 3SIWA 3FTEA 3AF4A 2RJOA 4RQTA 2OGZA 4R2IA 2RMKA 3UWOA 3NDJA 1CZRA 2IXBA 3FFBA 4DUGA 1C1HA 2YHBA 2KB0A 1P5HA 1T2UA 3D54D 3DULA 1GNPA 5D01A 2HA4A 2Y1LA 1EBUA 2YASA 1C9MA 2ZR9A 1HZZA 3WMWA 4YRIA 1YCHA 1LLCA 4FSHA 1SGWA 1Y4AE 4RVSA 1N9ZA 4J0IA 3MK31 1T6ZA 2OM6A 4ON9A 3RPEA 2P6MA 3KYJB 3KDPA 5M04A 1EB8A 3P9CA 2IX9A 4XB6B 4CM6A 1C1DB 2MJLA 4FMPA 4X65B 3PXBA 1YBFA 3E70C 3MS2A 5H59A 3PC7A 3P0FA 3W3AA 1J8MF 4B33A 4TWJA 2C9MA 5AKLA 1NYQA 4QAQA 2IE0A 2JCVA 1PO7A 5JZVA 2RGRA 1X14A 3GAMA 2X0FA 1DZ3A 3KXKA 4ZC8A 3ML1A 3VO1A 4Q9NA 1KMNA 4WH0A 3SJ7A 1UBJS 1HZZC 3UPTA 3MTEA 3TW6A 1NJ1A 2R2AA 2B1JA 3GW8A 2GEJA 3ICWA 1PFKA 3PQ7A 3O8CA 4OHVA 3N6VA 2O9JA 4HCJA 3WWOA 4OLBA 4UD6A 2IT1A 3U7JA 1W2GA 1PS8A 1SOVA 1IHDA 1TZMA 4K6MA 4AU1A 3OECA 5CJ2A 1RZRD 3TLKA 3C7AA 4MRMB 4TKVB 4V0MA 4JLOA 3NPMA 4XM0A 4YP1A 4ZZ2A 1MC5A 3K96A 4NBLA 3G59A 5JQGB 4CM4B 2H85A 4X71A 3IUSA 3L0SA 1H9BA 4FDTA 1R6UA 1J0XO 2CSUA 2X7XA 2ZRMA 1YIDA 1IAVA 2UYYA 3HKEA 1VBFA 4C5BA 3D5QA 5J4KA 1QH9A 2BV3A 1QB7A 4GSKA 1NKSA 5FWXB 2ZWAA 2BGWA 2HNKA 4Q12A 5K8VA 1GPDG 3AVQA 3QV1A 2DPYA 5F5NA 1ULUA 4MP3A 3GARA 1XZKA 2JANA 3GUYA 2IU0A 4BUJA 3RAEC 4BQRA 1E0AA 1VSTA 4EQZA 1OYOA 4PC6A 4QXOA 1ZD9A 2PT7A 1DUSA 3PDJA 4AS2A 4ND1A 4NABA 4QDOA 2ACEA 3WYFA 2ZBDA 3PPYA 3NANA 2QAGA 2ECKA 2YRFA 2XWSA 5F5XA 4TTQA 3IHKA 4IJUA 2ZVPX 1GIAA 2IOFA 3HI6A 4DQKA 2HFKA 2VAVA 3G8DA 5BWMA 3IUQA 2QD5A 4NFHA 1T9GR 1TLLA 1NDUA 1UWKA 2W6QA 2ZAOA 1GQQA 3PD7A 3PHJA 5ECDA 2XOKA 4ZVLA 5AVWA 1P2BA 4G4GA 4MV5A 1P1HA 1YONA 1UK7A 2Z4RA 2ZTUA 2ZYHA 2O54A 2X2EA 1V1JA 1EJ2A 2NLOA 1Q17A 1MVOA 1CY4A 1W2HA 2ZAYA 4MZXA 1CZNA 1L1RA 4H9GA 4OEHA 4RQUA 5IKOA 4M98A 3E82A 4OFZA 4P3XA 2CV2A 3F6CA 1VYHA 1MC1A 2G1KA 3KX2A 4G5XA 5I7OA 1WD5A 1Q2UA 2QAGC 3G9XA 3W6PA 3CLTC 1MJ5A 3OTQA 3I2YX 1VKNA 3C2QA 5L8VA 4B40A 4DSNA 2CMKA 3RRNA 4WNCA 2ATEA 3K32A 1G9SA 4OBXA 4UUPA 2I4OA 2I4RA 3D7NA 3OLCX 3QVGB 1XMOB 4V0KA 3VRHA 5CCEA 1P19A 5KEIA 1JDBB 3BSFA 1MH1A 2GVZC 3NDIA 1I14A 2GB4A 4ZOBA 5F9HA 4I6GA 5K8CA 3FOFC 1AKYA 1FK8A 2ONZA 5EA2A 4RLFA 5EVJA 4FGKA 5K3DA 2E4XA 5FD8A 1HE8B 2V03A 5B7NA 4RCYA 1KQFA 1G8YA 3ZU3A 1A8PA 2RK6A 5DTEA 2GF9A 4DF3A 3PCRB 4O4IA 2DT8A 2RAPA 3OCZA 3GZJA 3U7GA 3A6HA 4F4HA 4EFKA 3H6GA 2Z2XA 2HSZA 3U3OA 2AYZA 4AMUA 5DHAA 1XCJA 4DANA 3DNFA 3IVAA 3VPDA 3MOGA 4RGVA 1NBOA 2P27A 1XI2A 1NFRA 4BNTA 3SVLA 2Z2KA 3O8QB 1PGQA 1ZCAA 4WOJA 1DOHA 1G20E 4CEIA 1XVIA 1D2EA 4PIMA 1Z4QA 4CKBA 4GNRA 2CW5A 2PZEA 3OHMA 4IZHA 1Q74A 1RWKA 2FZ5A 2FPSA 2PXXA 3B6KA 4P22A 1KRWA 3DDNA 2JFUA 1MKYA 3P9PA 3OT1B 2G9UA 4X6XA 4GP9A 3UJCA 1Z35A 4NZZA 1SCDA 3K8OE 1WUJS 4G36A 3PNOA 3H2GA 2ZIXA 5JY1A 1CF4A 1KWGA 1DDOA 1FVFA 2ATXA 3GRYA 5LIRA 3JSXA 5EG5A 2WF9A 2W6ZA 1AY0A 1S9DA 2AHRA 2YINC 5GGXA 4UXIA 5J1TB 4EY7A 2H2WA 4BNFA 1E3SA 1XDUA 4RJTA 3K9LA 1N3YA 1MQAA 4FD3A 1DTWA 2VCYA 5C1IA 3K70B 2AQIA 3LQKA 4K1LA 5I9MA 2NYAA 3QUSA 3OOHA 4PZCA 1EG7A 1SB8A 5FP0A 1ARZA 1RACA 3SD7A 1U2EA 1TCAA 3G2LA 1V39A 2XMZA 4LPKA 1HEUA 4MYUA 5SZKB 2LZ0A 2C03A 3MERA 5EIHA 3RC2A 3WSTA 1KXZA 2NM0A 1B4DA 3BMQB 1YOVB 2B6NA 3Q15C 3SZUA 1FLNA 3CBQA 3DV9A 3RVPA 1WBDA 3TZKA 3ICQB 2H1RA 3OKFA 4HD8A 1WXGA 2F3QA 1I6LA 4ALMA 2Q9AA 1DTSA 4FOOA 5KNDD 5HBRA 3KQSA 1L1EA 1KDYA 4EG5A 3RV4A 4DXAA 3VUFA 4KDCA 4X61A 5IT5A 5AW7A 1DRWA 5KYYB 4QPNA 4LGYA 5JAQA 1XCPA 3OJWA 3OM8A 2B6HA 2QTHA 1CZKA 2FGJA 4FFPA 3THSA 5EIEA 5FLEX 4FWIB 3IDFA 2G07A 5FWYA 5BW5A 1NBIA 1NW6A 1FDTA 2PQ2A 5T4EA 3TQTA 1KEWA 4C4PA 4D7AA 5EHZA 3EGCA 4P4UA 4AKEA 3FYHA 2LW7A 1V5IA 3KVRA 3QG5A 3QWHA 4IS2A 4ZCTA 4CDNA 1OI3A 1BMDA 1FMCA 2XUAA 4HL6A 4IF4A 1C30B 1O9HA 1NG1A 3NIDB 4YPOA 4B2PA 1XDZA 2EATA 1B8NA 3JZDA 5ES3A 3P45A 2UUCB 1XMXA 2PUDA 4JBNA 1QOZA 2G40A 1H9CA 3UPDA 4P92A 2HMUA 5BN5B 4DTIA 4RDIA 2C2OA 1E92A 4WLEA 1EK0A 1HORA 1C8BA 5GP1A 1TLTA 4PLPA 3MXTA 1PQWA 1GU0A 2QV7A 3SOPA 2OAQ1 4ZEMA 4IMJB 2ZBPA 1QP7A 2WSSD 2CFOA 4YO7A 2G4VA 4CM9A 4LJ5A 2W2LA 3MD0A 4MINA 3JQAD 4EG7A 5L4NA 4HH4A 1PV4A 4ZA2A 1UMKA 3OJFA 5CURA 3GRRA 1UKVY 4MLPA 1XDGA 4CIDA 2V7EA 4KNYA 3RSCA 1UZLA 4KXFB 1ACMA 3Q4GA 5AVRA 3V1MA 1PP4A 1LY1A 1N1DA 1JJBA 2DPGA 3ODPA 1GTG1 1L1FA 2LCFA 2WAYA 2CKDA 1E6UA 1Z0FA 1ZJ6A 1UPFA 4UKDA 2X2OA 1APBA 1BEEA 1FJ2A 1MQSA 3IOYA 5ELLA 3ZBTA 2VVTA 4JLMA 4JOCA 2YVKA 3A3NA 4O2AF 1PS9A 4E33A 3BWYA 3MJEA 2J85A 1FX0A 5DO9A 3WJAA 2R7NA 2P0EA 4JELA 3T5AA 1VLMA 3NKLA 5EP3A 1XFDA 1KI9A 1QFZA 4YCNA 821PA 2AXPA 1AA9A 1GKKA 3DBHA 1A9SA 3T7EA 4JYBA 4ML3A 5A7HA 3OMLA 1UMCB 5AI5A 3CRMA 1LBIA 2Q9BA 4QPPA 4BE4A 2D2XA 3FWNA 1U3VA 2VHUA 2R6JA 3LLMA 4A8TA 5HKKD 3WRYC 1E1KA 1SPXA 1T1EA 2P6RA 1PJRA 1XD8A 2XE4A 3QELA 5AKHA 4IIJF 4YRBA 3AGPA 2IYRA 2X40A 4QTUB 2DKOA 2PMFA 2GNAA 1UM8A 2H52A 2KS6A 2XVXA 3PGXA 2JFNA 5CXSA 5IF9A 4FSDA 2GZ1A 4KX5A 3CNBA 5C81A 2ZRNA 3STXA 4BLWA 3AEUB 3FKSA 4I9NA 1WDMA 4PEVA 5DDIP 1Z9BA 4DSZA 4WT7A 2VWGA 3VR4H 4RE5A 3ZJ4A 3FPEA 1Q1BA 4LJ6A 3V4PB 2EFDB 2XNKA 1W35A 1OH5A 4LNUA 2BFDA 3AVUA 2EZTA 2XH8A 3I23A 1ZZEA 4N3CA 4LF8B 2HF2A 1EVLA 3L6DA 4XX0B 2VQEB 2I91A 3OMXA 3CR7A 5FNZA 3T1QA 2XI4A 1EX7A 2A4MA 1LFDB 2J3LA 3K1ZA 1XZBA 1XP5A 4EX7A 2I6SA 5BMVA 4AJ2A 1P9RA 2HWXA 3HDJA 3B9PA 4LDZA 3IULA 4PHFA 2E0IA 4BVEA 3CPSA 4LZNA 3ZZUA 2BEWB 3WKEA 1XTRA 5EPUA 1VPWA 4UM7A 1NDHA 1JZTA 2OCKA 2PBZA 3BJRA 1BE0A 4KJXA 1KI1A 4TWIA 3IQFA 4ZODA 4B4OA 4EUEA 5I47A 5LB4A 2VYVA 3S1AA 3SG0A 3BTVA 3W5VA 1ZKMA 2FSIA 2WMNB 3PDIB 1M66A 2F43A 4MUXA 4OA8A 4U0KA 3H9QA 5JRJA 3PI7A 2IZOA 3T0IA 4I2NA 5IBRA 6REQA 2QRZA 3FZYA 4X3CA 4TTPA 5BQ5A 4PX2A 2REBA 1VLHA 4MUIA 2CL0X 4B31A 2QR2A 3LG2A 4B48A 5AD1A 2AR7A 5IAEA 2FEOA 3FGPA 2BI8A 4YXFA 5BSTA 2IV3A 2JK0A 2QTCA 2X9QA 1UBMS 1AC5A 1NBWB 4FPXA 3ZY4A 5C8DA 1XXHA 1NF3A 1Z5ZA 1YVEI 3PFNA 4LRXA 1KY5A 1Z6TA 2QWXA 3ZIUA 5LQAA 3FH0A 1BOFA 2XUIA 5B7GA 2XXAB 1MO4A 2QMEA 1ISSA 2RBKA 2W48A 3DZBA 3K7EA 5FBZA 4A10A 3CS3A 3WGIA 1O95A 1QYDA 3K2BA 3GHYA 1IN8A 3KVVA 2CJWA 3QP9A 4EMSA 2OHVA 4OAQA 1ODKA 3L7MA 4PF1A 3RBXA 3BTSA 4QYXA 3D43A 1XNGA 4AL4A 1H0RA 2O59A 3VH4A 2QJOA 4ZEWA 3QBTA 3VNQA 2BZ0A 3A05A 1H85A 3N2LA 1OB5A 1SXJB 1ABFA 1KIFA 3QBJA 3EDCA 5IRCD 1C3LA 2R8YA 3FBWA 4NMHA 3PD1A 2PLFA 4HFMA 4D82A 3DMPA 2UDPA 4Z7OB 4AW9A 3QFCA 1VLQA 1RZ3A 3FMGA 4B87A 3KJGA 3DM5A 5B6IA 2MIIA 2YUTA 3DD1A 2LCQA 1O95C 3NPAA 1Q7CA 3CV3A 3KT3A 3FNHA 5JNSA 1OYYA 1QBGA 2BFBA 2WIJA 4IMRA 2NXCA 2VR1A 4TZKA 4O2BB 2VK8A 4R8SA 5CLLA 2BYTA 3THOA 4Q4JA 1E61A 5ER6A 5I9TA 3SXJA 3KS9A 1FUIA 1YJCA 3NOQA 2QZSA 4NONA 3DD5A 5JC8A 2WU4A 1YD7A 1X9IA 4LMRA 4BN5A 5LU9A 4NS4A 2NUTA 3TMKA 3HXMA 4H17A 1F8XA 2I22A 4PYIA 4PNZA 5CHYA 4BPRA 3RVKA 4BV2A 5E3HA 1G7SA 1ZM3A 2GM9A 2D0IA 5IDYA 3Q11A 4DYVA 4TS4A 5IKXA 3VU9B 1SR8A 2QLFA 2ZUTA 1HNZB 4AD8A 2Z2JA 3IBFA 2I6UA 4X62B 3FCUB 1XQ6A 2A9RA 1P4GA 3L8ZA 4XYMA 2WB2A 1QLJA 1GL9B 4CKWB 3KLMX 1JI3A 4CMJA 3K16A 5KU1A 2FPUA 5I8ZA 3H1FA 2ZB3A 3IIMA 3C97A 3ZY2A 1UMDB 3KPWA 4ALNA 4E09A 4PNEA 4LXGA 1FDVA 3E9MA 1X2EA 5EZ5A 2OBBA 3C7KA 2W6NA 4FOTA 2HOQA 5DEIA 4EAAA 5TIIA 3C85A 1ISRA 1H4QA 3CZ9A 1XRLA 3DXZA 3RBVA 4G9BA 4KQWA 4JT4A 1QP0A 1Y7IA 3ZW7A 1NVVR 4LOAA 1N2JA 2E18A 2VFAA 3NUZA 1V48A 4H18A 2YQ5A 1WVGA 3MBOA 4TUYF 5A0VA 5JWOA 4WDRA 2OZKA 3WXBA 1LEHA 3BMOA 2NU6A 3I30X 2GOYA 3N6XA 4M6WB 4XM2A 1ZHHA 1WWKA 1SK8A 2A0KA 1PL6A 1ZPDA 2GHIA 1MR3F 2PZLA 3A3KA 2IDZA 3AP3A 3KPYA 5DN9A 5EC8A 4EW3A 4DR7B 4RL6A 1ECLA 1J06A 1P73A 5AVUA 3R2JA 1E98A 1VB3A 4PYMA 1BCSB 4NJEB 4YV1A 4MQFB 3LT5A 3E0QA 4A73A 1QO9A 1J0AA 1J2JA 4QBKA 4D9EA 1F20A 5F2OA 2GXAA 2BBSA 5JY6A 3DZDA 4ISBA 2WWWA 1QYIA 2DSNA 3BSSA 4BIIA 4G4JA 1E2KA 2HYIC 2JI8A 1Z7BA 4IR7A 3QWAA 4QL3A 1R0LA 3BMNB 1KZ4A 1R15A 2Q6OA 3HJHA 2FXIA 4Q7KA 3UB3A 3DOOA 1Z4NA 4B7UA 4W5JA 5D5PA 3VU8A 4MRAA 4RTPA 2ZXUA 1REQB 2CVOA 2JAQA 2WD7A 1IWPB 3JD3A 5ETJA 2AJDA 1TMOA 1JIUA 3LRTA 4YMIA 2I7VA 5C51B 2BP7A 4HOYA 4D9KA 1G17A 3S8EA 2R0QC 1EK2A 3OESA 4IDOA 5DGCA 2A1IA 2UVQA 2C5GA 4UAUA 3TG8A 4AIRA 4X1YB 1ESCA 4IDQA 1YIAA 2IV7A 5JISA 1JIKA 1SVLA 2NU7A 4B32A 3C5WP 4A03A 3QKSA 1IQUA 2ZSBA 1RC8A 3KD2A 3L84A 4B3GA 4LGVA 1JQ3A 1C3JA 4UHEA 2MR6A 5B1HA 1WF3A 4IV8A 5CJJA 4PG8A 3SYLA 9ATCA 2YDXA 2ZCUA 5KOJA 4EHAA 2DPHA 3S2EA 4M37A 5CX1B 1FFSA 1YVRA 3KEQA 2YJ3A 4HNAA 1H2FA 2XADA 4L07A 4IEIA 4LBZA 4XUEA 3VPCA 4CR8A 4DRYA 4IP0A 3PXDA 4O4HB 5H02A 1ETHA 3ROMA 2DBQA 3OPQA 1VSUA 4LS3A 4K6OA 3P7MA 5ALRA 1GAXA 3FF4A 1Z39A 4NK5A 2OEPA 2W4IA 2QR3A 3KUUA 3KNZA 1E4YA 5HIJA 2QTBA 4MUAA 4CV3A 3FCOA 4NEHB 4MGYR 4CN9A 3OZXA 4JP1A 1ODJA 2VPTA 3KR9A 2PT5A 4CUZA 3PNPA 3DL0A 4KL8S 4WZBA 2CXQA 5JQGF 4CFSA 4L08A 4ITUA 2ODEA 2QZZA 4G9GA 4UNPA 3ELYA 4BAGA 2O06A 3M83A 1JDNA 5IMSA 3RB8A 4NBSA 1SBHA 3EGDA 3EC2A 5G0VA 1J2YA 1GADO 2PH7A 2JEOA 1BO6A 2XGOA 3SIPA 3NV9A 1LTKA 5CLGA 2HA6A 4PO9A 2ASVA 3MUFA 3PJFA 3UV3A 3OU2A 5HE9A 4C08A 3V33A 1XXLA 3WQHA 4JMLA 2F8MA 1JMKC 2PUFA 4TL7A 4TYQA 1MN6A 3GH3A 4YACA 1L8OA 4L5IA 2COUA 3C48A 4RTJA 4AI6A 3LS2A 4M3NA 3BERA 1ZVKA 1IMJA 2FYTA 2IJGX 4XQEA 5FH9A 3GFFA 3O8BA 2PVCA 1RAFA 2W4MA 2EGHA 3RRYA 3WX0A 1JG3A 2Q5JA 4LC9A 3CXRA 4X8LA 1YV9A 2VC2B 3AB3A 5EESA 3STVA 1QYXA 2ZZKA 3IURA 2I1LA 3G13A 5FDFA 1OJ7A 3TCNA 3V7WA 2IQ5A 5BW4A 2OAGA 1ZN9A 1JN0A 1R00A 3CXUA 3KOMA 4HWSA 3GLGE 5F73A 3WIEA 2PRKA 5AOVA 4DDMA 3Q3JB 4YRGA 5A4DA 2VZ8A 1V37A 1T8RA 3VPFA 3URMA 3VOAA 2WILA 3B1XA 3CLVA 3F8WA 5I5GA 1EFPB 2W2MA 1V2GA 2JKYA 3K9FC 4RQBA 3UAWA 3AM3A 2X9VA 1NE2A 4CIVA 2FF5A 3OZIA 1PR1A 1CIJA 1W30A 2WZBA 3A6ZA 4GX1A 4RH3A 3GFPA 1K7SN 2OCBA 3UBMA 3VPGA 4WLVA 5BSWA 1DO8A 2VF4X 3HA5A 4HNUA 4B4WA 1JPUA 3KYCA 1GUBA 4L73A 3ET4A 2A57A 4EO9A 3LUBA 1Z26A 4RPGA 1EM8A 3FRIA 4JJIA 3L02A 4KI0A 3R7NA 5CIWA 3QVJA 1F51E 4PPNA 4A36A 4MR9A 4YRAA 1K6EA 3D6FA 4KN5A 3L04A 5IBCA 1KMCA 2ADOA 2CVPA 1KDPA 4RBNA 4TM7A 5HKBA 1PE0A 3NTLA 1MT3A 2ZYDA 3O03A 2R6R1 3H7AA 5K0GA 1YS6A 3RYHA 1QKIA 4DN6A 2DY0A 2HSGA 3ONWA 4UU8A 1WMAA 5FT9A 1R0KA 1GGJA 4NMXB 4MICA 4N39A 3ZNQA 5CPBA 4PN3A 2JRLA 3FPCA 5A03A 1DHTA 4Q4AA 3THRA 3EIFA 3DE3X 1UOQA 3ZWKA 4W5QA 4G3XA 2VHCA 4LRTB 1E2IA 2C1XA 5J59A 1UMBA 2JAHA 2DC1A 5FYQA 5BW6B 2QBYA 1Y4SA 5IVDA 2D2VA 3A36A 4TMVA 1JAYA 4CZ2A 5C4IA 2JFWA 2QVLA 5BNWA 3BJEA 4DC0A 4WUVA 4X45A 1TO2E 3OJLA 3EXIB 5FQNA 1SOUA 3LIPA 4FDUA 1VL5A 2WG1A 3H5RA 3KKPA 3Q7TA 1NUHA 3OIVA 4CKEA 1MIHA 1GV0A 3AFHA 1Q14A 1HY3A 2AMFA 5L7YA 1FTQA 1M2HA 3EH2A 3OIFA 4LKRA 4AJ9A 1H3NA 2ZSFA 3JTMA 3SNKA 3P9IA 4R8KA 5HEKA 1F0PA 1VYUA 2I33A 2BMEA 3AUJB 3Q5DA 3H5LA 4XEUA 3ZH2A 3ZU4A 4DWVA 4C0BA 2DHCA 2Q3LA 4C30A 4C7OB 1N2SA 4N0DA 2PH3A 3WV5A 3S4YA 1FX1A 3G2JA 3LX6A 3GPCA 2PO5A 5A9SB 4ZT5A 4DZTA 4F11A 1F1JA 3U7HB 3EDMA 3RVJA 4DCSA 3X2FA 8ATCA 3E4DA 4IDDA 4H7HA 4M54A 2BI4A 4KBYA 3FZQA 4MQ6A 5J1SB 3R9XB 1HDCA 5E0OA 3K9WA 3MLAA 4MWZA 1VBNA 2GRJA 1O96B 2B61A 2WMOB 3OCYA 1VSBA 1VXOA 4I5IA 4INAA 1BRTA 3M89A 2P2CA 4GE0A 1QAMA 1SJ9A 1MENA 3M4YA 4HQ6A 4MRPA 1NZJA 4PM4A 4XW2A 4Z0PA 1IHYA 2XDQA 4P4SA 2RGAA 1W88B 1E69A 3DE5X 5J4LA 5EMNA 1SD2A 2XJ9A 4D4JA 4AN4A 2PXCA 2QP9X 4K9LA 5AVXA 5JPCA 4W5TA 3FZNA 4OHRA 1GYPA 2DP4E 4HGPA 4BKQA 4RHXA 1QG4A 3CIFA 4X44A 1KAEA 4RPJA 1FY2A 5BY2A 1RWVA 1A8UA 2YZ7A 4TTJA 3F73A 3FPFA 2G1PA 3BWVA 5IFLA 1DC6A 3RBZA 1EUZA 3P27A 3ZQKA 1M67A 1DWOA 1PKEA 1CS4C 1SHLA 1WPQA 4YQEA 3OQBA 3D81A 3FM9A 3O95A 5JVDA 3BB3A 3BRQA 1K8ZB 4IX9A 2JEZA 5I7EA 4RHYA 1JP7A 3DMRA 4GI1A 1PK9A 4QPJC 4ADSG 3C6XA 2FHSA 1CY2A 2O7SA 2Z2ZA 2Z6VA 3OE5A 4RY2A 2VPQA 1JWBB 2R86A 1V8DA 1W6UA 1NW4A 4OH1A 4O4LB 3X1KA 1X74A 1ZGZA 4MWOA 3QWBA 2VYNA 3GEMA 5JTUA 1PSZA 4IMIB 2HLNA 4DHWA 3ZVKA 1RYBA 1RWBA 2ZI7A 3GB9A 3B3QA 4TLDA 1UFQA 3L49A 3EAGA 1PJTA 2QSYA 1NE7A 2H0AA 3N3BC 2SECE 1ESDA 4BB0A 1FYVA 3VU1A 3A6FA 4L5AA 5DI3B 1G60A 3NKFA 5CT4A 2QTFA 4MPRA 2J5RA 4RK7A 1SVSA 2NO7A 3O8RA 3AK4A 1OILA 5SYAA 3GLHB 1QC5A 1U80A 1R7RA 3LOPA 4O0MA 3B3JA 4GU5A 1CR1A 5AICA 4IBOA 2HLDA 3TZCA 3NYRA 4L6IA 1M1XB 4L8LA 1NVGA 4GE3A 5EJGA 3VR6H 3WLPA 4AYWA 1N25A 3IE0A 5IARA 3HXPA 3NRJA 2A3NA 4YJFB 4FCTA 2XA1A 4G5YA 1PGJA 4BX2A 3NUGA 5A3JA 1ISHA 1QCZA 1TVCA 1BFUA 4HH1A 2OBXA 4BC1A 5I48A 3KT0A 5F1OA 2XB2A 1Y3HA 2QX9A 3VNAA 2CDCA 3F5FA 1RIFA 3EDOA 1EKXA 4IFIA 1Z2PX 3VSBA 1T2EA 5TT1A 4C88A 5KINB 1DQPA 3AR6A 3LC1O 3K9NA 4G01B 4L8GA 3ZWDA 1P75A 1XEWX 1ZD3A 4AZ0A 4XGNA 5F23A 3MLBA 2FEKA 3A06A 4TLCA 2DLDA 4ZCIA 1YQQA 1QYWA 1TW2A 1RI5A 1KFEB 1P3JA 3G0BA 3I8OA 3O2QB 3GI1A 4TVBA 3F8SA 3JQ9A 4YMWA 2E21A 3GIDA 4UEOA 2EP7A 3H8SA 5JARA 4WD3A 3BGOS 1QORA 1NNSA 3R5HA 1OXSC 1QMGA 3NP9A 4QDXA 3KSAC 4DIMA 1SD5A 1ZYUA 1IN1A 3SSMA 1MOQA 1M83A 1OYWA 4RZ3A 2R1TB 2ETXA 3GLIA 2I3AA 1QR6A 4LQDA 1B1AA 3VJMA 2L2QA 4NOJA 1VG1A 4LQLA 1L7NA 4RXUA 3DMHA 1Y7TA 2WHQA 3A3YA 4UPEA 4P34A 1IWOA 2CLOB 2EX0A 2J9RA 4ONEA 1ZEMA 2CUZA 3M82A 2IITA 3UXEA 4G1MB 4KREA 2ZTMA 3JQ9C 5JEDA 3ASVA 4AK9A 4OHPA 5CCDA 2D5AA 3KC2A 4HAWA 1P0MA 1T36A 5AVVA 5DBHX 3JQ8B 3RVMA 3E58A 1PRYA 4N7JA 5BYKA 1UJ2A 1SEPA 1OASA 1GP2A 1WCIA 2J0UB 5LYJA 4E13A 2BZSA 3DOJA 2RIRA 4V1CI 1D2RA 5KQLA 3QF4A 1V7PC 1YMVA 1V9SA 4GICA 5AM1A 2VUTA 3H0EA 4PBSA 1NP7A 1OA1A 1S2NA 2NXJA 3PQDA 3V32A 5BPFA 1A8HA 2GHQA 3AUFA 3JWJA 2GPAA 4HZGA 1ZMBA 4BKMA 4F2HA 5JS1A 3SBOA 3EVFA 2C00A 5KJFA 4DA7A 3UF0A 1SXHA 3MT0A 1RYFA 4H35A 1UP7A 1DV2A 1OR8A 5KNLA 2XZLA 4PSUA 1FNCA 7REQA 4DHEA 1JHAA 2P3SA 3ZCSA 2BHNA 1TK2A 2BONA 4IHQA 1YDMA 2ALJA 3PGKA 4K2HA 4RV5A 3N8NA 1ZVVA 5ICGA 4BB6A 4MS3B 5LIPA 3EHDA 3D3NA 3LH5A 4L7VA 4E3WA 2E4UA 2E6KA 4PG5A 1U2RA 1R4MB 5K0CA 2GYWA 1V0JA 3BF8A 5IJ9B 3PQ8A 1F7VA 3HP1A 3IGFA 4ALKA 3K6KA 2QVGA 3S2YA 2Y0CA 1QLWA 4LSMA 5CVCA 1Y0BA 2DUMA 3VNBA 6YASA 1LCIA 4G0ZA 3A8TA 3ADPA 4OJKA 1PFVA 1G66A 3PJDA 4UVIA 1VE6A 5CXUA 7YASA 3SC2A 3K0BA 3V4FA 4R16A 3VJLA 1RTKA 4HLCA 2PSDA 2RHMA 3JYLA 2WA1A 4O2BF 3WICA 4BASA 4D5EA 2OHFA 3C5HA 5G1PA 2I76A 1IVSA 3MINB 4QTZA 1YRHA 1NMYA 4R8MA 3FSGD 4MVJF 4DB4A 2XYQA 2WU0A 3KJXA 3NEAA 4WN9A 1WY7A 1X15A 4DADA 2VDKB 4XWYA 3KZXA 5JCJA 4BJ3A 3M3DA 3VR2D 1SVMA 2G1JA 3HBAA 1C14A 4QYIA 2Z8YM 5CVDA 1J8DA 1E0KA 3VDRA 4P5EA 4XJSA 5L3VA 2JFOA 1J49A 3PNBA 4CGYA 3O2NA 4EG8A 2HQRA 3OQIA 4YT5A 1WCWA 3QE0A 1S3IA 3GJ3A 4G8CA 2O8VA 3FCXA 3O1HB 2AOUA 4NYMQ 3DONA 4L7QA 4CMHA 1WUHS 2JGJA 4OB8A 1FYXA 4RKYA 1MDFA 4CEHA 2VXBA 2XHEA 3FHCB 3AI3A 5TY0A 2IWHA 4EK9A 4JIGA 5AW0A 1W25A 4KIJA 1PFWA 3WDKA 5FXMA 2WHYA 3TLAA 3LI2A 4NU0A 1OXBB 5ITSA 3AJ8A 1Y7LA 2FFJA 1LLDA 1U0JA 1XIVA 2IYNA 1AJEA 5BV8A 3L8CA 4WIAA 3SR3A 3A70A 4CM9D 3DMDA 2ONKA 4IIGA 4KK4A 3JATA 1A5SB 3GRFA 3N2EA 3OPNA 4RWZA 1IJBA 2AGVA 5K45A 4Z8YA 1R0WA 3E2IA 2V6JA 3NALA 1EGHA 4A27A 1YA6A 4JJ8A 1LI4A 2O2JA 4L9AA 1E9CA 5CD1A 2IY8A 3CVXA 4QT4A 1G9TA 1V45E 5HSGA 4RD3A 2ZM6B 4N1AA 2RHHA 1Y1SA 3P32A 2ZWIA 4PN7A 5IPFA 3D7LA 1JU4A 1Z5GA 4XD2A 3ZHBA 3ER9A 2FN8A 2J3QA 3E22A 4KXXA 2RHJA 2TS1A 5TNXA 3UW3A 1THMA 4AICA 1W4CA 1DI0A 4BBAA 2AF4C 5TEWA 3UK1A 3ES9A 1S3GA 1J1ZA 4N0QA 2XB9A 4XUCA 1XRSB 3IEMA 5KVVA 3UBTA 3ZWQA 2FPGB 1PNRA 1VCMA 3GEBA 1N5DA 3L4JA 3KDSE 2I99A 1AUPA 3C5EA 3SHFA 3D8TA 4QXPA 5AVTA 2NACA 2GQ0A 4B4DA 3I4LA 2EKZA 2YWDA 1PSWA 5HVNA 5L3QB 3O8OA 5EL0A 3ITEA 4N5HX 3TOCA 3ZZ0A 4DAOA 1SOAA 3LE8A 2L17A 5FNVB 3L0CA 1NQTA 2H5LA 2I0FA 1B43A 1VBMA 5AUQA 3ZGXA 2BZ1A 4IFBA 4UU7A 2M32A 2I2DA 3WK9A 5L9AA 2O19A 2NSYA 3OI7A 2ZCJA 4OMUA 2QGFA 3AQIA 3TUZC 3UJDA 4RK6A 4RZXA 3T7RA 2VO1A 3AEYA 1QAQA 3I6ZA 2BN4A 5LZ8A 1JT2A 5ICEA 4TXNA 4LSZA 1JMVA 2H1VA 4AKIA 2YWEA 1MF7A 3CBGA 4DJTA 2GHTA 1AOXA 2A5YB 1SPBS 2LVBA 3DG9A 3IHLA 1JB9A 1E99A 1YDFA 1UKZA 2HAEA 4H77A 3IIKA 3GT4A 4HWTA 1GVNB 4Q4HA 3PIDA 1WZEA 3RS9A 1U8FO 3W6OA 4CKZA 3WAJA 1JKXA 1OXXK 1U98A 3ZPXA 2X5XA 3HCBA 3VI3B 3PDCA 1SAYA 2K2QB 2FPPA 2H1HA 4C4XA 4KIWA 1QVRA 4MR8B 2QG6A 3C8DA 3JYOA 4J9VA 2WT4A 4U8HA 2NYRA 3C5CA 2C8KA 2ZBEA 1HDRA 4O4HF 5FYDA 3U60B 2GBCA 3EIWA 3KLPX 3PNSA 3ETNA 3MTGA 1THTA 3MELA 3QW4B 1L5LA 2FFBA 4EATA 4J4HA 3I9OA 4M60A 5K0JA 2O3RA 2WJYA 1OZFA 2IOFK 2V6FA 1DRVA 3VDMA 2RH4A 5LDHA 4MWCA 4XD7D 1PL7A 2L19A 5KTOA 4H3KB 3L7KA 2J0QA 3CJRA 3ZVLA 2ZKIA 3H6KA 1P17A 2RI0A 2WFAA 4JT9A 4V24A 1XL0A 1KOJA 1PR0A 1TVKB 2R8XA 4URFA 2WT8A 1QUFA 3CEJA 3ZWOA 3OG9A 5FL7D 4LF7B 2PUWA 1ZP6A 3GDWA 5JS6A 5CYPA 2N9UA 1GPUA 4YLYA 4X66B 4AP6A 3I05A 3RU3A 2VOEA 4EKIA 2BBOA 3KFXA 2DQ4A 1KJQA 1SUWA 1OV4A 3D3EA 2PS9A 2C2WA 4KR3A 1A9ZA 1RT9A 4QM6A 3LGAA 4XTRA 3NWOA 1CPYA 2OLKA 2AWOA 4FBGA 1AVTA 4HDSA 2QM7A 3RM3A 4ARIA 2VJOA 4IJ6A 4QGHA 2QW8A 1P7VA 4GOJA 2X0DA 4ZYLA 3T5PA 1UZNA 3RYTC 3ENZA 5GM1A 3V6LA 1WS6A 4KAJA 1XMPA 2A94A 3NHAA 1T0PA 5J43A 2F3PA 2D0PB 4KRYA 1TU3A 5LFAA 2QRLA 5G4KB 4F6CA 4TL9A 5EJEA 3MBKA 1YS9A 3A4LA 1QU3A 1RCFA 1P5FA 5AM2A 3FBGA 2AVDA 2MYPA 4U2FA 2BEKA 4I3GA 1FP7A 4EJMA 4OGLA 4F4CA 4FZVA 2BKLA 3NTXA 4FGLA 2KQUA 3G1WA 4Z0NA 1A8SA 1UBTS 3B78A 3FZEA 1EE9A 3G2PA 2JARA 4MEAA 1C0LA 3BYZA 3I2KA 3OZUA 4GXNA 3E05A 5HF5A 4D3SA 3BB1A 2J41A 3IJEB 4IGIA 4K7JA 2EJWA 4JI2B 1UF9A 1GUDA 3R4CA 4DLAA 4HS9A 4QJ5A 1SHUX 2DWOA 4NARA 4KQ6A 1B6TA 2OOKA 2ZKLA 3EZLA 2XMRA 1ZGBA 3KFLA 3LU1A 2JVJA 3W9SA 1Z5OA 4TYNA 1DKNA 2WK1A 5TJ9A 3PKJA 4JKOA 4EHLA 2J0VA 3PHHA 2JL1A 5TC4A 1KFJB 5A3RA 4X20A 2ZUFA 1XTUA 1C50A 2B4YA 5A7GA 1VI6A 2PSJA 3EFHA 4HJXA 3AIOA 3PK0A 4Y6PA 1ULZA 1W1IA 4RTSA 5EUBA 3L4KA 1JLMA 2W2TA 2D3TA 2X8JB 1HL3A 3L8DA 3F9IA 2R6FA 2Z57A 2GTPA 3EVAA 4JUDX 1YHYA 4JN6B 1Z6GA 1Y98A 2Z9BA 4XIIA 4GZ5A 1GTJ1 1XTVA 1Z4JA 3OIWA 4L9SA 5A5VA 4N6GA 3CQ9A 3GP3A 5FUVA 4PXYA 1BHSA 1QGUB 3QKIA 4IGKA 1I2DA 2WOOA 3O73A 4CL8A 5CDHA 2UYHA 5LZ4A 2FUG6 4CE6A 5EJ7A 3NT4A 1F7UA 1MTOA 1RZRA 3IA2A 3SR4A 4PLGA 1YUNA 4IUBS 4P53A 1ISMA 4XJTA 2R60A 2WIFA 2QRKA 4AY2A 2C4NA 2YMPA 5T6BA 5AH0A 4CHGA 2C9OA 2I6FA 4LOKA 4IWYA 4F04A 2C99A 3H11B 5DW0A 1CUEA 1QK4A 3BD7A 3BFXA 1EJ0A 4I4TA 1E5XA 4QSHA 2OQVA 4DL9A 1PU2A 4M9ZA 5ECWA 3UWSA 1VHQA 2R8EA 2ZVQX 5JANA 1DV1A 3V2GA 3HJFA 1NNI1 1VKZA 1VECA 1V7QA 2YV2A 4TTRA 2XQFA 1PQYA 4BNDA 3WDSA 5MN6A 1KZYC 2REOA 4IO1A 5AI9A 5ALZA 3UMFA 1C4OA 4NKRA 4U6NA 2C3MA 2HU7A 4RNDB 2ZIZA 1Q19A 1DRJA 3NYQA 3P5BA 4GI5A 5CNJA 1QYCA 1Z0KA 4D4MA 4YUWA 5EGSA 4F6LA 3PX7A 1DJMA 3MIIA 1AHHA 2SCUA 2A86A 2A0YA 3R5TA 1PQ4A 4FFSA 1UZUA 3S1SA 1TGVA 3UV7A 3ICCA 1ADYA 1XCMA 1M54A 1A9XA 2NIPA 4BNXA 5EWJB 1BYIA 3QUBA 4JY7A 3AKYA 3O74A 4QYWA 3V7YA 3ZS8A 1NV9A 2VAXA 3DBIA 4GVPA 4Q1DA 3IP6A 4RGQA 1RWWA 2JGFA 4E15A 3SZOA 3E9QA 4X1KB 2HRDA 1V5EA 5KQSA 4X6LA 4KZKA 3OZFA 4DNPA 4LDNA 1VB5A 4D8UA 4XAQA 4YCDA 5D86A 3C6KA 4L4UA 2ZRCA 3ZXUB 3DHNA 2HA3A 4AO7A 3IUYA 1IEQA 2PWYA 2Q1TA 3EWAA 3QOYA 1L8AA 3SQNA 4R8LA 1F2DA 1R74A 1ZD8A 1KY2A 2C2XA 4MXDA 4W5HA 1O0BA 3CUEF 3DVAB 2DFKB 3B1VA 1CJSA 1N5MA 2UUOA 3L2OB 4MVJH 5AHOA 3T94A 3VKVA 4R2HA 2P1DA 4LC0A 2YJTD 3U7IA 3J7AC 3EEFA 4BVFA 4D0LB 2B21A 1EI9A 2CXXA 5KBYA 5C4GB 3PC2A 3L92A 1HA3A 5CITA 1AIPA 1ZOOA 1KRXA 3QQ5A 1ECBA 1SURA 2OHGA 4ED9A 1L7PA 1NUSA 3B1YA 3LW8A 2BCGY 5TV2A 1QHFA 2H08A 1ZO8A 2WFLA 3PB3A 4OHKA 5CLIA 3B1FA 2B1QA 3O2JA 4IJKA 1U0GA 3BF7A 2C7PA 1B8UA 3F71A 5G1NA 4RYLA 1NR1A 3NETA 3VZQA 3WGZA 3PBKA 1IB0A 3VHXB 4KQCA 4W5RA 4CMEC 1E9EA 2GARA 2R6AA 4O4LF 2VNHA 3AKDA 4BLQA 5E7IA 4QFDA 5FOVA 2PKRA 4HVAA 1CZUA 4RC9A 2EWWA 3MWDA 1J2RA 3H8VA 3OO1A 5JCZA 5FJJA 1S01A 3VDXA 5AW3A 4M36A 3LHSA 1A9QA 3HNOA 3IO5A 5ILGA 4MJLA 1N4DA 2H9IA 4R2LA 1C7EA 2AX3A 1KI3A 3CFYA 1E2QA 5GQSA 3F97A 1KR2A 2WABA 3EVTA 3OOEA 4U02A 2WUFA 2IH4A 2WZCA 4ZI7B 2CXUA 2P69A 2DETA 1M1NA 5GWXA 3CMCO 4LNAA 1ZINA 4QC2A 4V02A 5CT8A 5E1BA 5JC1A 2G6TA 1N8KA 1TQ8A 4NV1A 1MJHA 1HNXB 1S5PA 3BIWA 1W4BA 4F60A 1A88A 4H15A 3FPHA 2JFGA 4CL3A 1IJEA 2GUWA 3I92A 5AHXA 4C87A 5CDFA 2A0FA 2MSEB 1M5RA 2ZI4A 3HKDA 5KNCH 2ISCA 4WWHA 3RYFA 3WLIA 4OJNA 1F2UB 2C9YA 2WM2A 2YJ5A 5B3AA 1TFUA 1GTSA 1RMQA 3MGBA 4CM8B 1ICEA 1HLGA 4D96A 1IY2A 3T4XA 5KNDA 3WJ7A 4LHVA 1VDZA 2RHWA 1E6LA 2OLEA 3NC0C 1OWLA 1KZ6A 4NECA 1IBLB 5E9WA 4HX5A 4NYIR 4JENA 4K8OA 1K6XA 4FGWA 1GPNA 2IGTA 2XNCA 1K5PA 1ONSA 1YKSA 3Q1KA 4BFSA 2OHJA 4BBJA 4JMPA 3B5IA 5B6JA 4OHZA 1NW7A 2CFIA 1KZ9A 2F8LA 3HO8A 3OOYA 3G17A 4YEDA 1O4VA 1KJNA 2QX8A 3REGA 2DFVA 1KDTA 1ZONA 2OP0A 2PZMA 5HUJA 3ZJUA 1LPNA 1OGJA 1X2BA 3EYAA 3AERA 4I6EA 3GPDG 3W5BA 4GDFA 3DEHA 1JWLA 2WTUA 1YACA 3RJZA 5IVHA 1XA0A 3JYNA 3DXFA 3EGXB 2L69A 4PONA 3JQDA 5F64A 4M49A 4DWJA 1GQFA 1FMJA 1G8HA 4ASUA 5JNUA 3S2IA 4OUDB 4CV1A 1LF5A 4GPTA 1NI4B 4Z53A 3M6MD 1A96A 2X0KA 1QV7A 3NCTA 4C0XA 3CH6A 3FI9A 1C7IA 2GPJA 3JQAA 2PXAA 3L07A 4HDRA 1U8EA 1N2OA 5JJKA 13PKA 2WTMA 2R8OA 2G80A 4HFNA 5AJHA 1B16A 4U7PB 2VQFB 3GA0A 2NTEA 1SOWA 3B52X 4TQGA 2V54A 4RABA 5KWJA 1CQWA 4AWAA 3UXYA 4J0KA 2OCLA 3V7FA 1G8GA 3IP1A 2Q5FA 3VKUA 3GLFE 1O5TA 1WMDA 2FOIA 2GEKA 3CSUA 5CU7A 1ZCJA 3T95A 5AIAA 4XWWA 2AN1A 1AGXA 1F4VA 1AHPA 4D3FA 4U8GA 4N9WA 3KQLA 3L8FA 2W0MA 2UYGA 3AG6A 1JJVA 1NSTA 3FRHA 3WYGA 1PAUA 1S02A 2WB4A 1Z2OX 3LWBA 4H6PA 4YI3A 4HAVA 5LUBA 3JAKB 4DV1B 1UIMA 3I53A 4Y9SA 2G1AA 1MRZA 1YRWA 4JP3A 4OFWA 5EJMA 4ZTUB 2NWQA 1OLOA 2BGIA 2W6JD 4GM0A 2C88A 2BGLA 1ADBA 2CHEA 1I3LA 3P26A 4B4UA 5C8VA 1X1DA 1YTLA 5B58C 1UT8A 4RKWA 3NNDA 3JVVA 4BJHB 3N86A 5JXWA 3II6X 4RMHA 3H7IA 1I7PA 1L7EA 2IDKA 1XRMA 2V0NA 1Z73A 1SBTA 3DNMA 4NU6A 4WVLA 4TV8A 2C97A 1UT6A 1IOZA 2PZAA 3LXXA 5BRNA 5L3RA 4C43A 5EXEA 5ED4A 4KHPB 2RD2A 4L51A 3AO0B 1Q21A 2HPHA 5AKZA 4NP6A 5FLKA 5SZIA 5KCZA 1WB6A 3COVA 2BM8A 4X7MA 2PUTA 1AKUA 3U9LA 1NXOA 1P2UA 3IIIA 1J70A 3O4JA 5ES4B 2VQ6A 5E0KB 5TSDA 4OOFA 4ZVOA 5DGTA 2Q5HA 5FUQA 1OTHA 2J59A 3LY9A 3T9BA 2W6MA 3CGWA 4PU0A 5KTRA 1ZUIA 1JDJA 5CP8A 1OX5A 5BWCA 1KPIA 4ZTZB 4OP2A 1GG2A 5K7SA 5GIOE 2BSAA 5DLYA 3ZWNA 2WUGA 3AXSA 2W11A 4JBGA 4Z4EA 2I6GA 4ERXA 3AB8A 2GWHA 1WP9A 3OCXA 2P90A 2Q1YA 2V59A 3EQZA 2EJCA 2O7VA 4MMYB 1XTQA 1U9ZA 1JSLA 3NS7A 1V9LA 1T0BA 3RLIA 3A2NA 1NUTA 2EFCB 5HIIA 4ABYA 4DLZA 5JEEA 2PL9A 3OLVA 3GUUA 4AULA 3NHWA 4BTLA 4EJ2A 1O77A 3EX7C 1JR3E 1XL1A 2H1IA 4P35A 3RYIA 4L4ZA 2FZEA 2V6IA 5CX4A 1TJ5A 1ADJA 5HILA 3TZLA 4PSCA 3CN7A 5BRJA 2WTBA 3U39A 3VNVA 4CU2A 3AESB 4IAOA 4LDJA 3G9TA 1E9FA 2G04A 3T41A 3HQ4O 4NZOA 2PVPA 3FCAA 3U7FB 3TD2A 2DUNA 2RAFA 2JI6A 2ODBA 1PK7A 1U0TA 2YCBA 3O9MA 3UOGA 1Y8ZA 4IIXA 4GPIB 4DDUA 1FZQA 3C70A 3VR5A 4AZ3B 2E4YA 4FMCF 3HO6A 2P3OA 2MDTA 3QNWA 1OW3B 3E7WA 2AF3C 4WJKB 3QJGA 3OT4A 4DVJA 4N65A 5CG2A 3AXTA 1W4RA 3AVPA 3CH5A 4EX6A 2AYYA 3LD9A 1A5ZA 4FTWA 2AYXA 1PK8A 5A4JA 4YJ2A 4ZVSA 3TLMA 5JWHA 5THXA 1NVWQ 2V3VA 3DR3A 2Q45A 2GCOA 3MM4A 5KSPA 3CJTA 1SK9A 3MCZA 4Y2YA 3ZX5A 5AW2A 4RTQA 5J58A 1BEZA 1QDEA 3WGVA 4ENVA 3F6EX 1O6GA 5SY9A 4EP1A 5HX7A 1GILA 3KJZA 3PFKA 2YWRA 2VXYA 1AKTA 1MO6A 5HOQA 3C39A 1UDBA 4PYJA 1KERA 3U7QA 4ZZ1A 1GQOA 5JO0A 3O8LA 3VYVA 1G20A 3ND9A 2DR2A 3RS0A 3G6WA 3F3SA 5DIFA 1OXUA 3H4IA 3QMMA 5FNVF 2OAEA 4FW9A 1M6VA 1L8XA 3TDMA 4KMSA 4TQAA 2I8AA 4NAHA 4OGGA 3UC5A 4MJ7A 4YPFA 5M5BA 2PEZA 4LZLA 3LYHA 3R6DA 3I58A 2EKBA 3L0DA 1NVUQ 1LVUA 5ERGB 5FV4A 4NCBA 1ZMXA 5DW3A 4K0RA 2ZZMA 4N8SA 5DHPA 5CEEA 4D43A 1F0YA 1KXJA 2HU2A 1QSGA 2PKQO 3BFJA 3G8CA 1ODTC 3BGSA 1NQ5A 2OBFA 3QWFA 4DG9A 2VRCA 4GP6A 3Q5GA 2FPIB 4Y7DA 1V5WA 3GEIA 3ZWVA 2WKQA 4LVOA 5I7RA 3KSBC 2EEPA 5DEOA 3RC3A 3UJHA 1Y6JA 2QRQA 4EUKA 1TF7A 1Q1QA 1ZICA 5DE3A 1JHUA 3D0QA 3VV3A 5IZ4A 4BXOB 4L8WB 5G41A 3SICE 1Q6ZA 2ZSEA 3S7TA 1SVNA 2BEJA 3B53X 4KHZA 4X0EA 1SKQA 1M2JA 5DM4A 4WN3A 1ZWKA 5SY6A 2G9QA 4ACBA 5TMPA 1PT6A 3RSSA 1FFYA 3FYUA 1KKMA 4AG6A 3ZN2A 1ONOA 3PE6A 4BVJA 3DZKA 1X86B 1BQ4A 3M0EA 4KO8A 3DL4A 3BXHA 4JVSB 4K9KA 2VJNA 3EMVA 3F4KA 3V7NA 4EABA 1E7MA 3HPQA 3LCVB 1KIMA 2GA9A 4MLCA 2HEIA 2GGSA 4KO1S 2CZQA 3PUZA 4FEGA 3AHCA 1DHRA 5JE8A 4WGFA 5KPDA 1H5UA 4NCJA 1GGKA 1FDOA 1E2MA 1GTZA 1CS0A 3H65A 3M4NA 3GLQA 2PKEA 3O1LA 1Z5UA 2XVZA 4Z9BA 4ARZB 4Q16A 5BVGB 3EUFA 5M2QA 1CWUA 4UEQA 3FYUC 3WIOA 2DH5A 4WKCA 4EPVA 3HA2A 2ZJZA 5UKDA 4NI5A 2FCRA 4JEUA 4TS1A 3LKDA 4HUQA 3P9SA 5DWQA 5AUNB 3PL1A 2FDRA 2NU9A 4AROA 1PZXA 2WPDA 2ZRQA 4JOSA 5CFRA 2BGGA 2QENA 2YC2C 2ZEJA 4ZCSA 4G1VA 1BVYF 4Q3OA 1PLKA 4B8ZA 4BZWA 4BLUA 1WXDA 4J1TA 2WJ3A 5E4YA 5CNIA 4TM8A 2B8EA 5ECGC 2K2WA 3VAAA 3SZLA 3W6UA 3ZCPA 4GWGA 3TYXA 2P5SA 3BL6A 3TZBA 1X7XA 4EG4A 1FLDA 4KH0A 3NHBA 4CG1A 5JECA 1KTIA 5K0EA 1GGVA 1GKUB 2PBLA 3N0RA 4K81B 3O2SB 4KXUA 1J8VA 5U9CA 2OL4A 1H4SA 4RTNA 1N6NA 1QX3A 1TA9A 1PZGA 3B89A 3BDIA 3IR6A 3OPYA 4FFMA 3W1WA 4A5SA 1R8QA 3INTA 1RWPA 4J2TA 2OV2A 1RTTA 2PGNA 2FR0A 5EXXA 5CA1A 1O7JA 4J1TC 4MW6A 4Z51A 1NNEA 5C5DA 5H70A 3IVMA 5CEFA 2O5RA 4D98A 5EWMA 2BY4A 1OA0A 1P77A 5DSTA 4GQAA 4ZCRA 3TIGA 5AXBA 1NLFA 1NVEA 3H84A 2N1BA 4Z3DA 1NVBA 2GZSA 2HRRA 2Y1KA 3FNRA 1RJWA 1YI1A 2J9YB 4GOMD 3ABSB 3IAS1 4OA5A 4F45A 1QP8A 2F1JA 4D5GA 3CZQA 2PKCA 3LYAA 4R2XA 4RA6B 5YASA 5HZGA 1AQLA 1PYOA 3DWFA 3NHZA 4BMVA 4DMKA 1EFAA 2JKZA 3TW8B 1B1CA 4RVHA 5AXAA 2NN3C 2GLXA 4ZQGA 4S1WA 1ISIA 1BWRA 5C7LO 2GKOA 2QM0A 2Z0MA 4EBBA 3LLSA 1L4UA 3MEQA 2GPSA 1BCRB 1AD2A 2Y1OA 4M8SA 1PNQA 4QBIA 3E7DA 5CGQB 2QRJA 4J7UA 2XV1A 4LGMA 1SH7A 2VWQA 4I50B 3NHPA 1H2XA 1EUCB 3OICA 1A2KC 3ICEA 3H5IA 3LQ1A 2WTNA 4HGOA 4NFYA 4OIFA 4S35A 3OQVA 1JR2A 3HWWA 1IN6A 2AL7A 1L8LA 1SRQA 4U4AA 3TQCA 2B69A 3TGPA 4Q7LA 2G82A 1YZNA 3H8JA 3H0KA 1W93A 1GZ6A 3HJNA 3SHVA 3N07A 1SBNE 1WXHA 3KSRA 4LHWA 1W0CA 1IXZA 3M8KA 2NZYA 4DV7B 1ETUA 3QE3A 4G5GA 4REOA 4N49A 2YFKA 3E5MA 3LLVA 2ID9A 2M1XA 2BEVB 3LPAA 2DLCX 1XTTA 2C5AA 4UTZA 4ZHQA 5A6SA 2GJ4A 2YWJA 1JR3D 4ROSA 2WSLA 3QUQA 4CCYA 5JDCA 5FJIA 5K5EA 1L7XA 5HIMA 3CUUA 5BO5A 4NENB 3TECE 1GNVA 4LY9A 3F6YA 1T4CB 4LSWA 4Q48A 4DV0B 1G0OA 3HO1A 1G8AA 1OLXA 3NJ8A 4RQAA 1W9MA 2BMDA 3RWBA 4MS4B 4C0SA 2B5OA 4DBZA 3U4GA 2HUNA 3GJTA 3O31A 4NCKA 5E6SA 3W8DA 1ZD4A 3AILA 3L1IA 3MRTA 3NLLA 4WKOA 4XRRA 5AQEA 3DE6X 1YA8A 1ZSYA 4DMCA 5JBIA 1XNHA 2OT3B 3SIRA 4DQVA 2MTBA 3R0ZA 1T13A 3FKQA 4RZQA 1VJ5A 4CTMA 2WD8A 2RONA 1DAFA 1BMTA 1ZL0A 2R5WA 3FUTA 4MKFA 5JDCC 3VTAA 3WWEA 1U81A 2O8CB 4ZI7A 1L4MA 4M21A 3KCQA 1ULAA 4Q37A 3KUCA 3MGCA 2XUKA 3LUGA 3PC3A 2IU3A 2GD0A 3QU2A 1WQ3A 3G2HA 3RJTA 1ZGCA 2OGWA 4NXNB 1PJ3A 3QWIA 3GMIA 4A0QA 1F3OA 4WFQA 3NHFA 1M34B 3UPUA 1ZW6A 4J1SA 1SQGA 1SWVA 2C7BA 5CB6A 4RH1A 2H1LA 2F3TA 4AYTA 4IOLA 3DS8A 4WE3A 4BZXA 1XQ1A 1V43A 3Q3CA 1YKGA 1OFUX 1GZ4A 1DCTA 1JJFA 1M3SA 5U1PA 2Q8PA 1A69A 4NPHA 3ZWCA 4LG1A 1GRRA 2V96A 3AL0C 2C9DA 4TKUB 3IILA 5TB5A 2OZLB 2TSYB 4ZVUA 4PSKA 2EZ4A 3GZ4A 5HMLA 1U0OC 3JWEA 1P31A 3RTEA 1I7QB 3EXFA 4YDHB 1D1SA 4IIFA 3UT5B 4C6TA 4WK0B 3Q2KA 3G9ZA 1JFVA 3ORHA 4NZ9A 1OSNA 1ZY2A 3KL2A 2ZQ5A 1CSEE 4FCCA 3UEOA 4FOSA 4QDUA 1EUYA 3TMAA 1CR6A 2XUGA 1PDVA 3NDBB 2C82A 2JAOA 1MX9A 3FDZA 3GGJA 3HEAA 4BFXA 4CMKA 4ZI7F 3NT5A 1L7RA 4HF7A 1CQXA 1VMEA 4R41A 2CLEB 3D0RA 4GOLD 5KNBH 4TKMA 4IKOA 3ACCA 3B85A 3H9EO 1E2JA 3ZR4B 2JGMA 3A7DA 3KK0A 1OOEA 1RSZA 1X9GA 5IVPA 4L9WA 4BKUA 1N7IA 2P8JA 4JKYA 3S5JA 1D2NA 2Z8XA 1B76A 2CNWD 2VG8A 3VBCA 3VJKA 4BKPA 4JR1A 3NWEA 1F2TB 1G55A 2Q4BA 4JJAA 1QBKC 4XB1A 3TQFA 4QT0A 3VHRA 2ZTSA 3TNFA 1ODFA 1TT5A 4B6FA 1KP3A 3IAEA 2A2ZA 2FQWA 2FN3A 2YWHA 2R7AA 4P86A 4K6HA 1NU8A 1D9XA 3GH1A 4WXEA 3H04A 3VZPA 1ZNZA 4OD0A 1RYEA 3T4EA 4LPSA 3AG5A 2FX3A 4PX9A 3N0XA 4B8WA 1HK7A 2WOJA 4FYXA 3O91A 1NVMB 1AMNA 3R3XA 4QFCA 4F72A 5KVQA 5D7NA 1NPDA 2OZPA 3ECSA 1QGOA 2NVBA 5DULA 2WWRA 3PCXA 4FZ3A 5EZQA 2WJVA 3NRCA 1BKDR 3CB2A 4Y1EA 4LOIA 4PCUA 4MYCA 4HTAA 2BUCA 1PZFA 1XMIA 2LDXA 2PGIA 5LXTB 1XZGA 2GF0A 1ZGGA 2KHZA 2O2IA 3B3AA 3H5TA 3HWX1 4J91A 9LDBA 2AUMA 1ZAKA 2Q9CA 4NE7A 3WE7A 1SHKA 3GD7A 1FVOA 2DPMA 1BVHA 1A4UA 1CF2O 4IIEA 4N5NA 5DBGA 1PTJA 2FOLA 4XJXA 4WBSA 3QPAA 4CW7A 7GPBA 2FE1A 4PC3A 1DCMA 4FN5A 3ZU5A 1MABB 2X2FA 2RI6A 3V00A 2QMQA 1ZW1A 2W2NA 3GJRA 3QPWA 3DP7A 4HDAA 4Y1RB 1PJQA 5ESDA 3W34A 5A5GA 5IM4A 4EHHA 3ERCA 1EX6A 1HNWB 4XIJA 4BFZA 4AF7A 3DOUA 1TFRA 2DQKA 1H8HD 1T9BA 1E7WA 1Q11A 4GPAA 4IGFA 4KXLA 4M89A 4BNUA 1G42A 4OAOA 1WXFA 2CFCA 2YXBA 1L4HA 4XSGA 4TV9A 1FDWA 3IQXA 1PS0A 4RZUA 1PX0A 5EE1A 3TUIC 4JI8B 1YK1A 4OLHA 4GBMA 2R84A 4D9HA 4NU5A 1Q7GA 1R37A 3E3OA 4LV8B 2AEFA 4NZPA 5LCXA 1PTJC 1XC7A 4WK4B 4Y8VA 1N3IA 2XMBA 1CJMA 2X0NA 2JCBA 2QRMA 3FWZA 4FFLA 2LTAA 3TFQA 5LKRA 1ZJ4A 5CGZA 5I9IA 1K8YB 1DBPA 2LKDA 2Q2QA 1RADA 2QS9A 3GN1A 3IH5A 4EY8A 5C80A 3AKZA 1GVHA 4YASA 2P9JA 3WB2A 2H6EA 3QFSA 4JLSA 5MFZA 3RKRA 4MUBA 4WPGA 1PUXA 2YYAA 3LUAA 1IVNA 1AS2A 1MJGA 2OR3A 2YIVX 2QT9A 3LVBA 4OQEA 5EE5B 5EQDA 3OWXA 1WDLA 5ULLA 2FR1A 3CX7A 3GRKA 2BFNA 3T5GA 4EB6A 2Y9PB 2G28A 4C2UA 2IDJA 1FIUA 2YN2A 1XVAA 1D6NA 4O4JA 1T6XA 3SS8A 4V1CB 3H83A 4MI3A 1HEIA 1U2ZA 3U0BA 3R09A 4HG2A 2ZATA 3OPVA 4M76B 4V3CA 1JW9B 3TLXA 4DM3A 5KSYA 4DUYB 3VKHA 1LF0A 2OYRA 4YAGA 4LHXA 2J5XA 3UENA 3AKEA 4B1FA 5GZ1A 3MHTA 3FAZA 1W34A 5JI2E 1X13A 1BAPA 2BFFA 1BWPA 2GN2A 3R0QA 4R9VA 4LI0A 4RF4A 1USUA 4KJZA 3ESCA 1V3UA 2HH9A 5T6MA 1JLLA 1E6WA 4DM7A 1RP7A 4RH0A 3QE9Y 4ZZ3A 2I7CA 5DNUA 4AO8A 1CVIA 3HKEB 3X1DA 5IKMA 2M2IA 2WNHA 4RYDA 1SXJE 1M75A 1DXHA 3OEWA 1YQDA 3KHUA 4FI3C 2I3BA 2QA5A 2J9ZB 3LQRA 4GSYA 5TRTA 1UJBA 1EJBA 1XWIA 1B8VA 1H0KA 1F48A 4G0QA 1DSSG 1ODLA 3CUVA 3GK3A 3EA0A 4HJRA 4JLPA 4XKJA 1SZCA 3R8FA 3RC8A 3U44A 1GPKA 1UUFA 1IVYA 3BIXA 3EDRA 3WLLA 2QAGB 3DAPA 3GLGA 4Q1CA 1J7KA 4MVJE 4ZYVA 4PTLA 4AY5A 5ILOA 1NNLA 3IERA 3RVRA 4J43A 4WXMA 2J6HA 4M0PA 2JA1A 1LVHA 4DLBA 2WY2D 1FOEB 1VL1A 3IOEA 3KSZO 2DHDA 3OCUA 4RF2A 5DP2A 3W8EA 4UDXX 3ORQA 5KTSA 3UMRA 4X60A 4KE7A 1C9DB 1HE5A 3WGYA 1DBSA 1QZXA 1QG6A 2HW8A 1EFKA 2NXEA 3B6EA 2OUIA 4MQBA 4NQZA 4JB0A 2Q8QA 1GNSA 3LTNC 1H1LA 3GCDA 2EFEB 4OQ4A 4DRZA 1EX1A 3V2HA 4ZO9A 1ZNYA 3OQJA 5EE3A 1M7GA 1LV7A 2AZMA 1FE8A 1I5EA 4A23A 5DX0A 3I4CA 4M38A 1CQJB 2FCAA 4QJ3A 1U0BB 2NVUA 6ABPA 2WYIA 1VKRA 3PVCA 1VHWA 4GKAA 1LQUA 4FMBB 4ZZ0A 4AP9A 2JBAA 3GLKA 2QW0X 3SR0A 1ZIDA 3FYTA 4R6XA 4M87A 4YJ3B 4ZDIA 1UKBA 2IXDA 4QGGA 2X9NA 1Z06A 3O3NB 1NP3A 4GI7A 2AXQA 2RAVA 3QJYA 4O63O 4WA7A 1CB0A 4E5PA 4QQ8A 3V8QA 3EPKA 3ZDCA 1ZUNA 4R84A 2HJ9A 4GZ6A 4ZO4A 1CHDA 1ZK4A 3QBEA 2YJGA 3ZWBA 4ZMRA 3EMBA 4UM5A 4PRZA 1QNLA 1YU9A 1H1TA 2CYBA 4F5ZA 5KREA 1V1MA 521PA 1JEYA 5J5AA 3C74A 3LA8A 3LDUA 4L57A 4WNYA 5AKKA 2PAAA 1VIDA 3WR5A 5I7FA 2REQA 3TKAA 1MAAA 2EW1A 1IC6A 3HRKA 4DCVA 4BMXA 1YR7A 5EIBD 1HFEL 1TD1A 3IC5A 3UJPA 1EIZA 2HZ7A 1C3OA 7AT1A 3VNUA 3OSZA 2AB0A 5JJLA 5JSFA 3QPVA 4PLHA 1TXGA 3VPSA 3EVDA 3CLSD 3KQMA 3R7WA 4TLAA 1W29A 1UCFA 4YFYA 1EWVA 3ANXA 3SDBA 1FYEA 4EG3A 4YRZA 3CE6A 3M7IA 3FX2A 4Z2YA 5ALJA 1A9XB 2RGWA 4G1FA 3DPUA 3BM5A 4L22A 2O8BB 2DPLA 1P9LA 1C8LA 4U5XA 2QDXA 1PW5A 1RRFA 5CW1A 1T8UA 4ZO8A 4MTCA 5DM60 4ZZIA 3BORA 1DTWB 1TOAA 3HUEA 3FF1A 4LYFA 4B0PA 2QPAA 3RUIA 4ITRC 3HK2A 3A58B 1Z2CA 3G7UA 4BMOB 1SQ0A 1E9RA 3RHFA 3BHMA 4MVYA 4AUNA 3ESXA 3KJQA 1U0SY 3IEIA 3L1JA 2WJGA 1N5RA 1XA4A 2NNLD 5DRYA 3E3MA 4A6EA 2HJVA 4ZOLA 3LNTA 5FPPA 2R66A 5E2IA 3C7DB 5T5QA 2BMJA 3UJ9A 1HQYE 4F9FA 1NR7A 3OUTA 5E4JA 3ROXA 2B1IA 2MSDB 5LZ7A 2HQ1A 5ECYA 4HP8A 2GZDA 2IZZA 5CB4A 3TB4A 1FSSA 3T1TA 4EG0A 4YUXA 3DV2A 3HLYA 1SU8A 3TLZA 3I1IA 3MB5A 2GZ2A 1V4NA 5FWYB 4HH3C 3RAJA 3TIXB 2WJWA 4BJ6A 4DM4A 1HYEA 1W9HA 1SC6A 2ZWMA 4J4TA 3K94A 1ZDMA 2Z98A 4PFKA 5F51A 1Z56C 1T4GA 1YMUA 4WKPA 2UYCA 3QX3A 1P3Y1 2ECOA 4G0NA 4I55A 1FUKA 2ET6A 2KPOA 5JHHB 4HX9A 2JGEA 4NYIQ 3VR0A 5CTJA 1PFQA 2JNWA 1BHQ1 4Y7CA 2GMWA 1G63A 2I2AA 5K6RA 3VZDA 4GGPA 4HRYA 4JYAB 2ZIFA 2ZROA 1JA0A 4RD1A 3SZ3A 5ADWA 1TA4A 2RBGA 3ZTYA 2IS6A 3QVTA 1X19A 2F59A 2EXXA 3KO8A 4C5CA 4O5AA 2FMTA 4INPA 5IJAA 2DE0X 2FG7C 4G89A 2ZJ6A 5JH7B 3ESAA 3U1VA 3FOZA 5DYYA 2C9BA 1CUDA 3T3NA 1JFLA 1X7GA 3V3KA 3TTUA 3WJ1A 4Y67A 1AO3A 1MXFA 3W2IA 2OGUA 1I4DD 1DC3A 1Q15A 1AUVA 2EC5A 4J1QA 1UC4B 5AHRA 2WQ6A 3RE1A 4G23A 4TMXA 5G3YA 2VDQB 2B5WA 4KYTA 3QU5A 4LXHA 1LBEA 2ZUSA 2VQDA 3Q3IA 2R751 1WHSA 2IF2A 4DARA 2OMKA 3LXUX 1SXPA 3ER8A 3FVVA 3M6LA 4JLBA 4ZU3A 2OQ2A 3TCKA 5J2TB 1GAEO 3Q9LA 1V41E 3ZKWA 1GLNA 1GKYA 2XCRB 1D2MA 1RJ9A 3GR6A 1T3HA 5DHFA 1L3CA 3SFTA 3ZLUA 3LWZA 3H5WA 1N78A 3EWSA 3NATA 1FX0B 4DPMA 1WG8A 4R1NA 3TXAA 5C35A 4KQ2A 4L5YA 4URVR 1P29A 1CULC 4FNGA 5G02A 1NVKA 2DFNA 1W1UA 4EGJA 2MINB 2C5SA 1OLUA 2MYTA 3PXUA 4US1R 2VTDA 5IXJA 1TGYA 2Z8ZA 3NOXA 3K2IA 3RJ9A 4GW3A 4TGLA 1KO5A 1NY5A 2PHZA 4I50F 3DNPA 3HGQA 3MTIA 4RHFA 4JUIA 3ZDBA 4XD7A 4HVCA 3QELB 2VHVA 1XCLA 4HWKA 4IEFB 2C4UA 4RGBA 5DT9A 3M5PA 4Q19A 4EY6A 2O8EA 5IJWA 3CNQS 1KE2A 3NUQA 2ZXEA 3FW1A 2IHNA 2H4FA 4CQMD 1GTL1 1O9BA 1EXDA 2HGZA 3JRWA 1KYIA 2GJ8A 2J6CA 4ANFA 1DG1G 1ES9A 5LVAA 2E1PA 4UAVA 5BXYA 1Y1KE 4K5QA 4GR5A 5DWDA 2C4VA 2XWBF 3EK2A 4XVQA 2XMDA 1FVHA 5EUMA 1SQSA 4E5DA 2O7RA 4V03A 2QSZA 3BE8A 1G8PA 3HKCA 3QPUA 4F0JA 1ML4A 1U0LA 3Q85A 2BFDB 3A3OA 5P21A 4H7DA 1F9EA 4CF5A 4PGMA 3L06A 3OZRA 4KB5A 1YF3A 4MX8A 3G23A 4FEAA 1QVZA 3IOCA 2YXNA 4FE3A 5H5JA 5CLHA 2OUKA 1EUQA 3RHSA 2FJ0A 1CEXA 2OD2A 1GZ3A 3GYBA 3I0MA 4GR4A 4M9CA 4EJ0A 5BMVB 2J45A 5JSUA 3GVIA 3QSYA 1SC1A 3ZV3A 2BTEA 4HKTA 1I4WA 1TUIA 1OF1A 1YBVA 2GCGA 2WM3A 1DP4A 1W5EA 2FI1A 2OD9A 4EYOA 1RJGA 2G4LA 4OATA 1IXYA 1CU1A 4KRGA 4X97A 3WSWA 2NP6A 5BYBA 3L43A 2Y9MB 2F43B 3R0IA 4UNIA 4DRXB 2QM8A 3I12A 4MS1A 1QUEA 4WY2A 4Q9LA 4RY8A 3VR1A 1FSFA 1S8NA 2E4ZA 2OPBA 1JLSA 3RC1A 2R1UA 3KQTA 4LKOA 4M9SA 4MZDA 5C8XA 4TYYA 3DEJA 5ERYA 1YIOA 1HC7A 4R6WA 1ZVMA 3VR3A 1Y7PA 4FDVA 2A9JA 1P9WA 2QY9A 2PJUA 3L4EA 2C7QA 1JDZA 1Y8QB 5DNWA 5B57C 3BFPA 4MQUA 1GRCA 2O0JA 2XRZA 5DLPA 2E6UX 2XJ4A 1XXHB 1GWNA 4UHHA 4DIKA 4IGAA 3VM6A 3ZC3A 3TOXA 4ZV4A 2C2MA 5ICFA 4B8YA 1CQZA 5D3QA 3FROA 3UTDA 1WUTA 4CL0A 1HKHA 4PLWA 1ZK1A 3R40A 3ZGVA 4P6VF 3I9V1 5LQRA 4ZREA 4DMUB 1F9AA 2JLAA 5REQA 4JBLA 1J1IA 1J0DA 2YR0A 3IBSA 2CJWB 3UW1A 2BJHA 5JCOA 4ZI3A 4QVIA 1IBMB 2D2IA 1H6DA 4YIKA 3EVEA 2A1UB 1ICIA 2W6OA 4I0WB 4QTTB 4UM9D 5D1HA 1L5VA 1R6AA 5HCNA 5KYXA 2ZT6A 1RNLA 3KLBA 1E2HA 2Y6UA 5EMHA 3I6YA 1R3UA 4ZYWA 4W5NA 4IDBA 1Z6XA 3RWOA 2XGSA 2R5FA 3IJ5A 4J0GA 1HXHA 3R6LA 4ZCPA 4LF9B 4N5MA 4KDRA 1T0HB 4CETA 2HDWA 1R16A 3O0TA 1MRNA 1Y9DA 1LXCA 2W7TA 1C7ZA 2PZGA 3RHTA 2ZW9A 1J00A 3VYRB 4HXGA 2BFBB 2F1IA 2H1OA 3KSUA 4X92A 5DYIA 3T1VA 4M0FA 2Z1DA 3OIDA 5JCOC 1RP1A 2CUNA 4DMMA 4QU9A 3N28A 2JCGA 3ZD9A 4LDAA 1UXKA 4GDMA 3N0WA 2EGGA 5HA5A 5ALKA 4CCSA 2L42A 3C3MA 1DE0A 2VA9A 4U6SA 3ZY5A 1VE1A 1M73E 2D5BA 3AHHA 1PDOA 2JPDA 4D9FA 2ZJYA 1S4QA 3LCJA 1H8EA 3RVNA 3KQNA 3E5RA 1E9AA 3G0OA 4IZOA 4UBKA 4XGRA 3L6EA 4X1IA 2EJBA 4DR5B 2ANCA 3G0IA 1GRNA 3VSEA 2JA2A 2C07A 3P52A 2XHZA 3DB1A 1M1YB 2VK2A 1VJRA 1EQ2A 1GFSA 2QN2A 3EG9A 2AG1A 1TF2A 4FS3A 5I7VA 2H8KA 1Z7YA 1GA6A 1M2KA 2W42A 4DUGD 1FU4A 2CBGA 4PPFA 2CLIB 4KQIA 3WKDA 1GPBA 1UDCA 4DDKA 2C5LA 4MQEA 5L6LB 1M33A 2HIMA 4FJ1A 1H3EA 1P9NA 1U9YA 5F7OA 4RA9A 1E7RA 2ZS8A 1YQEA 3V1UA 1WU8A 4P2GA 2V9CA 3N0TA 4Z86A 1AZTA 2NVOA 3RK1A 3LSTA 1V3QE 2GJAA 1YE8A 2I2FA 8GPBA 4EYQA 3O9VA 1JH9A 1CT9A 3PUYA 2ZIAA 2IHYA 4UD2A 3R7BA 4F3TA 1NR5A 4FGSA 5LXTF 1O54A 2FQYA 1PV1A 5CDSA 5E8RA 1D2HA 2NT3A 5FUBA 1T6NA 1HBJA 1KQ3A 3A6KA 1HZJA 1ND5A 1QIEA 1E63A 2AMLA 2SICE 3BMOB 3BMCA 3I1YA 3ROEA 5CFZA 4F4JA 3I5XA 1XTZA 3ANLA 3AONB 3QKUA 2YV1A 1FXWA 3AL2A 3IV9A 2OKCA 1RAAA 3ZK7A 1CE8B 2P9GA 1B93A 1Q1GA 3EFBA 4FVTA 5HFNA 3ZU2A 1XAIA 4AY3A 5CH8A 3RASA 5KX5F 3EEYA 3CF2A 2B4AA 3TK1A 4C22A 3KYBA 4QG3A 2BFAA 2VJKA 1JGTA 1NI3A 4Q1FA 1P2FA 4JBYA 2Q1WA 3AYZB 1ID1A 3HCRA 5HKOA 2R6ZA 1QZUA 2ODQA 1J25A 2JGDA 4RVOA 3FTCA 2QZJA 2AE2A 4R81A 1DDGA 2ZRDA 3D6UA 3BJMA 3NFYA 4LNHA 2B37A 3K4HA 1B0PA 1MQ8B 4PC1A 1XQWA 2R4TA 4MQ4A 3BX1A 3D2AA 5JBNA 5FOTA 1I13A 1P4RA 1VKJA 2QMHA 3LQQA 4DQLA 2WD7B 3HTXA 1RWOA 3SPXA 2V6MA 3IKJA 2E2WA 1PZNA 4YH1A 4LBVA 1FBTA 2BP7B 3RVQA 4DBLC 1Z7EA 3M9LA 4K40A 1XPOA 1VHDA 4Z99A 2GCPA 1JX6A 2ZUBA 4IQ8A 2H18A 2QLTA 3DH0A 5EAIA 3EIOA 4OGKA 2ZS9A 3DWGA 3PL5A 1JEQB 3H05A 4CWAA 3DM9B 3MMXA 3Q0IA 2HJRA 4J90A 3RIXA 1QVAA 4ESOA 1LWOA 1R66A 4QOJA 4GI2A 5INTA 4NQRA 3KTFA 1CERA 5A6VA 4M1WA 1UZAA 2O2GA 4OHBA 3F3MA 2BFPA 3QEMA 4I7EA 4XGQA 5JSKA 2JASA 3WL3A 4C4OA 1NF9A 4KQMA 4FILA 3UHJA 4A92A 4HV4A 5L7WA 5AO9A 3NHSA 5KOJB 3A1WA 1W0JA 3H86A 221PA 3H8WA 4RM2A 5ER9A 2CGEA 4YP6A 1CIVA 3S2SA 5EHGA 3AU9A 4HNAB 3Q98A 1ZOIA 2I29A 4M86A 1YDGA 1D5WA 1SXGA 4S2UA 4QICA 1W73A 1ZJYA 3O82A 4WDQA 5F77A 1QJCA 1MAUA 4JCOA 4DV4B 4ESVA 3WAKA 3AUSA 1A5BB 1XZJA 1AMOA 1MG5A 1RI2A 2BE7A 1Z7WA 1QRTA 4WADA 2VP6A 1YZVA 2GRUA 1T2CA 3N5CA 1OWNA 3AVYA 2P4QA 3TRFA 3GROA 5HOEA 1V3VA 2EIHA 3HYSA 5K0BA 3CSDA 4WZBB 3W77A 3K6SA 3CX4A 4JVNA 2O8DA 4I8DA 4RHUA 3NASA 4AUEA 1CQIB 4QLAA 2FX2A 2YZKA 5IP5A 4N47A 1NUAA 2BDUA 3GGDA 1SHJA 3EGDB 4FHGA 2D00A 1NLUA 4HLQB 3GDOA 4US2R 1OY1A 3JWIA 4V0LA 1NFQA 4UVGA 5JS7A 4E30A 1GZUA 5CH3A 1YMQA 5CPFA 3TZ6A 2Q4DA 4D4IA 1F2VA 1K2VN 1U3UA 2WM9B 1O2DA 3AEKA 4NJMB 1PIWA 3TFWA 1KAOA 2V5VA 2D74A 3MWGA 4E94A 1GNQA 1FQWA 3EMDA 3BKXA 5I6DA 2HK6A 1GYRA 1Z2EA 1V9CA 4KQGA 3AR9A 3GP8A 2ZR0A 2VDLB 5LB2A 4GOKA 2Q1UA 2Q62A 2X7JA 3CPHA 1DBWA 4PYNA 4M1QA 4P7GA 1IHPA 5DXFA 4E5KA 3NIGB 4CM5A 3BH6A 1JEOA 1KVTA 3DMFA 4DJFC 1J7JA 1XV5A 2Q50A 4KMMA 1G21A 1GOTA 1M7HA 2GX6A 4NG4A 4F9GA 5L51A 2RKOA 3S1LA 4Q9IA 4XZ3A 2HU8A 4FDAA 4P9NA 1XJ0A 2CLLB 5AI6A 3TAHA 3NHLA 1K7YA 4K28A 5B1SA 1DINA 2PUBA 3AR3A 3CH4B 4KUGA 5I3ZA 2HBYA 2M6KA 3EAQA 4XR4A 1XHEA 4RO0A 1VG0B 5AM0A 4PCAA 4H4DA 4WZ6A 5CW2A 2OFFA 3KYCB 3OZAA 4U2DA 3WP0A 2QSJA 3G0DA 4CN8A 1PVVA 1XZHA 1TIBA 4JBIA 3RNLA 3TH5A 4ER5A 4I5FA 1MW8X 2WMYA 5IKPA 1EM8B 2DOKA 2X6QA 2Z09A 4MR9B 4YJ3F 1ZXBA 2LUOA 3QFTA 3I5YA 2ZWOA 5E3IA 3L7CA 4NMLA 2KBEA 4Q18A 3UIEA 4RCVA 3AF5A 3F6PA 4JJ6A 3ZWMA 3I0ZA 2Q4OA 1F8FA 2WKRA 4OMCA 2R6CA 3ZDFA 3LA6A 1NU6A 3RYHB 2O2DA 4F7DA 3QVSA