4JRYD

Crystal structure of sb47 tcr-hla b*3505-lpep complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
201
structure length
201
Chain Sequence
b'ELKVEQNPLFLSMQEGKNYTIYCNYSTTSDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSTLHITAAVHDLSATYFCAVGGGSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title Highly divergent T-cell receptor binding modes underlie specific recognition of a bulged viral peptide bound to a human leukocyte antigen class I molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2013-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jryD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jryD02
2BHUA 1ZS8B 3L5HA 4Z7OF 2P5EA 1FFPB 2OMNA 1A7QL 3RUGE 2VXUL 4DN4L 3VXPB 3GRWL 5C8JB 3FO0H 3O6FA 3ARWA 3HE7D 2A6JB 4RNRB 5EBMA 5CP3A 5L2KD 3BJ91 1WCQA 4ZYKA 4JN2A 3MZTA 2PTTA 2VTFA 4HW6A 4M1GL 4EIZC 3JV4A 2UUDH 1G7LA 2XACC 3B9EA 3JV0A 2KQNA 4PRHE 4PRAB 3U36B 1ZSDB 4X7EC 1ZAGA 3R06B 2IAMD 3G6DH 5L2JB 1Z3GH 5B3JE 1NL0L 3EYSH 5I71C 4JRYD 3ULUD 2Y07L 4GAYB 5DDHB 1OQXA 3NCCB 1Q94B 4LFHD 1MCWM 3LY6A 1QR1A 2C3VB 1ZLWK 3N1FC 4L3EE 3FB8A 2CXGA 4XRCA 3CCHA 4M1DL 5DUPL 1YEJL 3AXLA 1ED3B 1UB6B 1HHKB 4WWID 4JVPA 4KK5C 4DKEH 1CDHA 3TBWA 1O7VA 2GCYB 3OXRB 4LVNC 4BSVB 1NFDA 4GG6A 2JK5B 3C6LC 5F7FA 2UWEB 4I18B 3U6RB 5TDOA 5JW5B 4JHZA 3OPZH 2ITDA 3HMWH 4C56B 5BVPL 3EJYD 2HFEB 3ZE2F 4WEMB 3IDYC 3RX7A 2YD9A 4WEBH 2D4FA 4WTZA 1D6EA 3VGEA 2YSSB 4KI5E 5ISZA 3EO9L 3G08B 2BVQB 4JRXA 1QSEB 2JELL 1GZPB 2XPGB 4IRSC 4HF5L 3EO1B 2AK4E 3N85H 1PGRB 3GHBL 2BP3A 5DJDB 2BNQE 5DJXB 2Z92A 4CW1B 4ZAKB 5DJ0B 5JLZB 1MJ8H 4G6FB 3GMPB 5CEZH 1H3WM 4LAQH 5GISL 3ARUA 2XKNA 4KFZC 3FO2B 4LEXL 1I3VA 4LPXA 2DI8A 5CJOL 4JCMA 1NCAH 4KVCH 1TJHL 3TA3A 4IOIB 4NCC1 4XWGL 3BZEA 3SKOB 4IJ3B 4JLRA 3MJ9A 4ELKA 4IRJC 4M4PA 5JR1L 1WCBA 1JI1A 1FL3B 2I24N 3MQIA 1MCHA 4NZRL 5IV2A 2PN5A 4NDMB 1LILA 4PLOB 4ZXBD 4G8FB 3STLB 3T0ED 4KROB 1UH3A 5I1AB 4PJIA 1FYTB 1DCLA 3K4ZA 7FABL 3QUZC 2OI9B 3CFCH 5J6GA 2B2XH 3QUYC 2DTML 1S9XA 4JKPL 3MRDB 2VLKB 1U8PA 4KTDH 5DSCB 5I1JH 4EDXB 2BC4B 4XC3L 2QQLH 5DRZA 4FQCL 4BH8A 1PZ5B 5I6XB 2BNRB 1T1WA 3H9YA 4G8GA 5C0BE 4QTHA 3SY0B 3GM0A 4GBXC 2Y36H 1KF9B 4YZFE 1AXSB 3P4OB 3KPOB 4UI2A 1QLRA 2EDBA 4Z7WE 1XGQB 1XGTB 3TJEH 1J5OH 3QPXH 2A77L 3WFHB 4G43B 5MEPB 3RGHA 3QDMB 1NANH 1YN6B 2BK8A 1U8HB 2WWMD 4E42B 5HJ3B 4OBRA 5CSZA 1DL7L 1JTPA 2FYYA 4OCWL 4YUEH 3BGFC 1LDSA 2ZUWA 1KLGA 4P46B 2NY1C 1VADA 4FQJL 4TVPE 1Q9WA 3BQUD 1CICC 1T1ZA 2OJZL 3ARVA 3ZZ1A 4JFDD 5KVEL 1H8OA 2ESVD 3HAEG 5DQDL 1B0WA 2ZNXA 5DMJB 4NJ9L 3FFDA 1NFDF 1AY1L 5E5UB 4OLZH 3OQ3B 4G80A 5DRXB 2VJXA 2CKBB 2BSTB 1MCPH 1Q8MA 1RUMH 5LAXA 2D31A 3FQWB 2PUQT 4MCZB 1Z5LB 3NVQA 2EH8L 2A0LD 5J56B 1AGCA 1CVRA 4A6YB 1G6RL 2VL5B 1MVUB 1T83C 3TWCH 2QQKL 4LOUC 3D39E 3MUZ1 5EC2A 32C2B 2APTA 2XIDA 3DX6A 1ACYH 1R5IB 3P0YH 3QQ4A 4C58B 5E2UL 4P2OB 2FBJH 1YJDH 2OTUB 2EIZA 2GJ6B 5C71A 3GSWB 3DX7A 5DUBA 1IVLA 1U8NA 5D5MA 2E27H 3A6BL 1RZJC 2GEEA 3WCYA 3X3FH 4M6AA 5DC0A 2V7NA 3DX9B 2R8SL 1PX3A 4NHUB 4TUOB 1S7UA 4XPGL 3LKPB 3RHWF 4EN3A 4K3GA 2OZ4A 2PYFA 1G1YA 3QCUH 5D2NC 4L9DA 4NWUH 4PP2A 4L5FH 4F7MA 4X8XA 2QTEA 4K3HA 2C7UB 3TZVD 2W91A 3TN0C 5IVOA 4PJ5B 3HLAB 5C0CE 4OZIA 1KENH 1RFDL 4J3TA 1EK3A 2EIDA 1NMBH 4PJEB 3DMMA 4Q7DA 5ACLA 3MLTB 5IROC 4HBQA 1DLFL 2WIIB 1NUNB 1RVFH 4PJIF 2P46B 3EDEA 3N1MC 3UTSD 2JJVA 1UWEL 2XRAL 4MA3B 1Q38A 4DEPB 1BMGA 5SV4A 2NY4D 2EC9T 1FNEB 3WN5B 3GMNB 1G9NC 3OTTA 2Q20A 4LU5L 1CFNA 5FB8A 1TZHB 3PDOB 5IQ7L 2I60H 2YK1L 3E2HB 1CTOA 2EYTA 1TMCB 3RKDD 4KC3B 2OR8A 3HS0A 2KKQA 4G3YH 4G8EB 3F7RA 3LKQB 3IFOB 4QCIA 3SDCB 2HFGH 4LPWA 4FXKA 3MOAH 4OCLC 2W1NA 2A38A 5KS9B 5H2BA 1FNHA 3C5SB 1AGBA 4XP6H 3K7UA 3AMLA 2VABA 3O2VL 3DUUB 4Q9RH 2AJVH 4JO2L 4WU5A 1OY3B 1NGPH 1X5AA 4RIRB 1RJYA 4JFOA 2CDEA 3TV3L 1IEHA 1IKNC 3S5LA 4JCLA 3C08H 2V5MA 1CT8B 5JOPD 2X09A 2BVUA 4JY5H 1V3MA 4JZJB 5DJ6A 3BWUC 3TIDB 2FX8H 4QHUA 2B1AH 4E41A 1TVDA 1U36A 2DAVA 2A6IB 3H3PH 1T2XA 5D96C 5GQBA 2YZ8A 4OI8A 2AK4B 4LRNL 4PTUB 1OM3H 1TETH 2BNQB 1T5WA 4XVUC 4KTYA 1ZVYA 1MUJA 2MPAL 4XI5D 4AEIL 4RGND 4KDVA 4JFEE 3L5XH 1A3LL 3BD5A 4NQXB 4HIJB 3NGBB 4EI6B 4LCUA 5D5MF 2OK0H 4LRIC 4V1DA 1X3DA 2YXMA 4R4FL 2MOVA 4OUUA 2FSEA 3DVNB 4HWBL 1YPZE 1HOCB 3BKML 2JJTA 4IEFB 1S5HA 3JUYA 3OR7B 1CGSH 4Z7VA 3INUH 2XKUA 1JNJA 1XIWC 5I19L 1TJGL 1WVZA 4PJ8C 3DGGB 4LK4A 5CJBA 3T09A 4Y1AD 1HXYB 5EZJA 1UJ3B 1BFTA 1D9KD 4Y4HA 4NSKA 1ODAA 2VOTA 5JA8B 3O6LL 4OZIF 1XGUA 1DQDL 4XMLL 4HV8B 4MMZC 5JORB 1WBZB 1FL6B 3FRUB 1J8HA 4NP4H 1JF5A 5EIIB 5F7UA 3SCMB 5IEKB 1MSPA 1DVFC 1G7MA 4P4KA 4Y5VC 1KELL 4H25B 3OAZH 2P5WB 2X1XR 3O6FC 4GQ9H 5CJXC 5LCVL 5JPMB 4JFXB 2B5IB 3RX8A 1A6AA 1DSFL 4JO3H 3QDJE 3SO3C 4HC1L 4O02H 4PJXA 3RIFF 3TP4A 4NN7C 1I8KB 3B3IB 3MV9E 4IIQC 2O5XH 1DEEA 1I7TB 4HG4J 3J8F7 1T89A 2WNGA 1CG9B 1KTLB 2DF3A 1AD0A 3WUWA 4G9FA 4NC0B 3MLXL 1IL1A 4KU1A 4N90D 5IJVB 4XH2A 1EJOL 1NH6A 2VR4A 2L7UA 4FQHB 2XKSA 1NUDA 3B6SB 2PKDA 3HZVB 2O93L 2N56A 4QHMA 2R29H 1MRFH 1RZJL 1HQRA 2DL9A 4F7CB 1BQHG 4JGMA 4J12A 5ITFB 3DRTB 5D1XD 1SYSB 4ODXB 1GOFA 3AFLA 3UTTD 3SBWC 2H9GA 4U3HA 3BH9A 1NEZA 4P0DA 4BSJA 4YK4C 5B39B 1YEKH 3BP6A 4C55A 1SJEA 1DUZA 2DQEH 3OX8A 2GYSA 1F97A 2SEBA 4JHAL 1UM6L 4LDLB 4C4KT 4H20L 1UKSA 4PR5B 1XH3A 2GFBB 2YPLD 1EMTL 1JNLL 4AL8L 1RULL 4EDWL 1EHNA 4OBSA 4KK6D 4I0KA 4LSQH 1SY6A 5IVXB 2AEQL 3GO1L 4XNUL 4DTGH 2VDKL 2P24A 4O2CB 2W9DL 2WK2A 2NW3A 3ZSTA 3QEUA 1YECL 4OIIH 3TVMB 2O5ZL 4RMUA 4PJ9D 5HGDB 1RSFA 4MNGE 4HEME 3C5ZD 3OBAA 1CFVL 5AEAA 3DIFA 4X7SH 3K0WA 4J3SA 5CEXB 1JHTB 1RIHH 4LP4A 1NJ9A 3EYOA 1A14H 3O0RL 3UO1H 2DTSA 4MDIA 4LVOB 3MRGA 1J8KA 1G9NL 1DR9A 4KDWA 3KVQA 4LCIH 5BMFH 2ICWI 3RDTD 2FEEL 5B8CB 4JB9H 4PG9B 4UV4L 3IXTA 3MRJA 1XGRA 1FGVL 2IG2H 4DVRH 1Q72H 2W9EL 4F58H 5CBEB 1YYMH 2COQA 1IFHL 4UBDD 3QRGL 5M95B 1GJIA 5EU5B 3ZE1E 35C8H 5C0CB 1C08A 4MNQA 2IPUK 2E7CA 2HT4D 3SDAB 4OAWA 5C08A 4R96B 4MAYB 1EO8L 4WW1B 2EO1A 1QYGL 4J6RL 6FABH 4NHCL 2DOCA 3GSQB 3C60B 3CAFA 1A7OL 5KAQG 3SKUD 5EO1B 1KCSL 2YBRA 1YMME 4LFHG 1CXKA 3O6MH 43C9B 2OR9L 3VXME 3NAAL 3T04D 5D7SH 3VFPB 3ZKXB 1OSPL 4ODBD 3GK8H 4MJ6B 4KMTL 5JW4N 4JJ5B 1OGTB 5EBWA 1NAMB 3MRLB 1DQQB 3AREB 5F7KC 1QVOB 2OJEB 5AWNL 3MLVL 3BIAX 3GSOA 3FT3A 1L7TH 5EORH 3TJHC 1UWGH 2BSSB 1QLEL 4KQ3L 4KGJA 4PRDB 1QRND 4EOWL 4TTDD 2HJLB 3KJ4C 2A1WH 5DF0A 1I1FB 3U46B 4HDIA 3TT3H 4KAQH 4XNYL 2OL3A 3MRCB 3SDYL 4M7KH 2B4CC 3IDNA 4Z0BL 4M3KB 4WDIA 4CNIB 4CN1A 1CD8A 3UTQB 3KHOA 4MQSB 3D25B 4Q9QL 3MUY1 3NACH 4KK5D 1BZQK 1T20A 1MPAL 3C6LD 1UC6A 3VXNA 2UYLA 1CZ8H 5E95B 1WISA 3LV3A 2VZUA 1HDMB 3PL6A 2FB4H 4PRPE 2IPTL 1TVHA 3L9RA 3CVHL 4IRSD 4WGVB 2VDRL 1ONQB 3L3DA 3LRGA 2WANA 4ONHA 2IF7A 3LRHA 5CZXC 2FZ3A 4HG4K 3T4YA 2X4QA 5EOCH 3CU7A 4NO3B 4HBCH 5IB4A 2LV4A 2F54A 5DO2C 2GY7B 4RFEA 4EN3C 4U0RC 1U8QB 4NKOA 2APWA 3MMEA 4L3AA 2VLLB 3BIBX 4NOFA 2K9UA 1G9MH 4IRJD 1LP9E 2N7AA 3FQRB 5KG9B 1N0LA 1UZ8A 2M2DA 4M7LT 1GGYA 4R2GB 4NPYB 1LEGB 4FTVA 1OAZL 2AXHA 3ULSB 2VITA 2IADB 4RGOH 1KJ3L 1U92A 4NZUH 4X5LA 4JFZH 2VWEC 1B0GA 1YEGL 3IS0X 5DMGC 4F7PA 1I7RB 4YE4L 1FCCA 4Y5YB 4WI7A 1T2QL 3QUZD 3EJJX 3VH8G 2O5YH 3HG1D 4J3XA 5FKAB 1NBVH 2VXVH 5ID1A 4M3JA 2QADC 2E6PA 3QFDA 1ZLSH 3QUYD 3BP7B 1RAMA 3O9WA 4LNRB 4FP8H 4P2CG 4U1SB 1T1XA 5AZ2L 1IQDA 4YIQB 1YMHB 4ZFGL 1BREA 3QNYA 3VFOB 3P4MA 2DIJA 3QDJB 3P4NB 3MXVL 1A2YB 3TBTB 4NRYB 1PLGH 4GLRH 1RJCA 5JHDE 5EUKA 5GGSA 5FGBC 1L0XA 1D5MB 3PWJA 3QB7C 1ETZB 1EZVX 1TFHA 4WTXA 1KJ2L 3IU4L 1QA9A 5IQ9B 2H32H 1E4XL 2E7LA 2IANA 5E4EC 2EE6A 1P4LB 3BKJH 2NY1D 3P0VL 2UVFA 2ORBL 3MV8D 1CICD 1OTSC 1KGCE 4MJ2A 3HUJE 3BUTA 1FV1A 4HS3B 4H0HB 5IKCA 3UTZA 3MA7A 1G7IB 5I1IL 3VFGL 4Y4KB 5I75C 2YN3A 1HK6A 3CDGA 4O58H 3MCLH 4EUPH 3RZCC 1R5VA 2EDOA 4JAMA 1YYLH 4GW5B 4OB5H 1AQKL 4H5SB 4XP5L 4MD5A 1C7TA 4KVNH 3VRIB 4JPIB 1UB6A 4OD2A 5D72L 3ARBC 4DCQA 3V4PL 3GM8A 4M4RA 4YXLH 2DS4A 4LOUD 3TYFA 4YWGH 2EE3A 1NGYA 2HKFL 3GGWB 3VWJB 2ZCLL 4NYLA 1T0NA 3VXSB 4G6MH 2GIYA 2X4OA 3NA9H 4ISVB 3LEXB 5D7IF 1BQLL 3VJ6A 1S8DB 1N8ZA 4PRIE 4JM2C 1I1AB 3VMOA 4RAHA 1Z9OA 3IU3B 4ORGA 2AJXH 3ARDA 3OJ2C 5I1KL 4JFQA 2NZ9C 4CW1A 3NFSH 1CLYL 4HGWA 2JJTC 4NC1C 1GGBL 2Z4QA 4FQIH 5CSBA 2DLIA 4UQ2A 4TNVK 5C07D 4AG4L 5GIRA 4D9QD 4NRZA 4Z18A 5FYKU 5F7DA 3QEQE 5D1QB 1ZLUH 4YHKH 1AIFA 4AEEA 3TN0D 1AJ7H 1PD6A 5IFAH 4JFYA 5FOJA 5TH2B 4M93C 2B39A 3SQBA 5E56A 4GKSB 4KK8C 3OGCB 3LKSA 2B4CL 3SE3A 3EAKA 4LMQI 3QWOA 4NQCB 3HAEB 1BEYL 1MCWW 3KPRA 4L8SB 1CI5A 3GI9H 5F89B 3D2UB 4R97B 2F5AH 43CAA 1N3NB 5DVLA 4PJCE 2HH0L 4JJHA 1DBMH 1JPFA 1YN7A 4HIXH 3WXVL 1ZANL 5IGXL 3FB5B 4LBEA 4UNVA 1JFQH 1WFTA 1I8IA 2FJFB 4PREB 5IBLC 4EJ1C 5J13B 4WW2A 3ZDYF 4OZHF 5TE4L 1T89C 3MTRA 4U1HB 3REWB 2ICCA 4G7YL 5FF6B 2X42A 1V7MH 3MRDA 4O4YH 2A6DB 5C9JA 1J1PH 4PP1C 1PG7L 2G75B 4JZNB 5JW3H 1P7QB 4WENB 3RIFK 4Z77A 1J1OL 2H1PL 1Y0LA 5FYKH 1FE8H 4ZFZB 4PJGB 1WLHA 4UIMB 3VU2A 2UZXB 4P3WA 3HMXA 1PSKH 2X89D 3FAWA 4X6BB 1JTTA 3DROA 4FRWA 1UA6H 3CVIH 3MACH 2OZ4L 3KPSA 3CFEB 3O4LD 3VXOA 1B4JH 1GIGL 2EE2A 4AH2A 4C83A 3MRHB 5F44A 5L2KE 2VLJD 5HJ3A 2PYEB 2G60H 4NQDB 4QO1A 4WUKH 3TNNA 4D0DA 3BH8A 2L7JA 1T3FA 2X70A 1RURH 3GSNA 4QRPA 4GOSA 2DM2A 1DQJA 2J88H 4W4OA 1J0YA 5IEHA 5ECJE 4JRYE 4PRPB 3ULUE 4GAGL 1AHWA 3P40A 2Z31A 2OLDA 4AYFA 4MJID 3TO4C 4OFKA 2C4XA 4GW4A 3V6OC 4XVUD 3G5ZA 4QNPF 2VC2H 3MJ8B 3SJVB 1HI6A 5CWSA 1NANI 1KCKA 1FVCB 2W92A 3GSUB 1JPGB 4PJ7A 2Q76B 4XC1H 1LK3H 1JZ5A 5A2IH 3F7YA 1NEUA 4JDTH 5C0GB 1IGJA 3DPBA 5EO9B 4K8RC 4XNXH 1G7QB 5CS7A 3IDMB 1PG7X 4UIKL 2FGWH 5C6TH 4POYA 2DB8A 3WSQL 4E5XA 1AGDB 5EG6C 1QFUH 25C8H 1NCBH 5HGAB 3H9HB 1XIWD 4JDVA 1JGLL 3ZYOA 1QO3B 3PGCA 3UPCA 4PJ8D 2ADGA 1IM9A 5FK9B 3L3HA 2J3SA 4ZOEA 5CZVL 3UXFA 5BCAA 1JGUL 2P5ED 4KPHL 3JV6B 2ADIB 3C6SB 3QZWG 2YS4A 3GJFB 4BQ9A 4EXKA 2C3WA 3LIZL 1DVFD 4X0KA 4WWKB 4D0BB 4L4TB 3GMMB 1QHPA 3QXTA 1I9RL 3O6FD 1EDQA 2CKBH 2HJKA 1TENA 4QWWC 2NQCA 1IAOA 4Q9CA 3K80A 1EX0A 3DSFH 5H37H 4BKLB 3VI3F 5IFHL 1E0OB 1M71A 4HKBA 4A6YH 3M17B 3MLTA 1XF5A 3KLAB 4I77H 3QHZL 4PJHB 2PTVA 3OB0H 3CSGA 4BZ1H 4WW2F 2CDGA 3RUGA 4P23B 1BOYA 5KVMC 4KH2A 4U1MB 5JHDB 3O8XC 2V5RA 4YHOL 4IBLT 2ZSWB 3BSZH 4RA3A 4HUMB 4Q97A 3QQNA 5HI3C 3LH2L 3RNQB 3T0EE 3QNZA 4YHLH 5J9PB 4PRHA 1HH6B 3C5JA 2XZZA 1H3PL 3G5VB 3V0VB 2XWTA 4KJYA 4X83A 1RIUL 2ZUQB 5K9QI 1ZHKB 1N5AA 2ITCA 3MX0A 1NBZB 1S3KL 1B6UA 1X5XA 5HI5C 3TIEA 1M4KA 3JZ7A 1FORL 5TE6L 1NC4A 5E6IA 4OT1H 4OCRL 1FVDA 4XPBH 1NBYA 3SE9H 3IDIB 2Y5TB 5ISZD 4XVTL 2VUOA 4L3EA 3UTOA 4HULB 5ADPL 3CK0H 4UUJB 5E8EB 1ZT4B 2Y06L 2OS7A 3ZYJA 4DK3A 3MLYL 4Y19A 5FA4A 3Q6FB 5I8CA 3W9DA 2XA8L 1WWBX 3BE1L 2D03H 3MGAA 2GK0A 4DGIH 3I85A 1RHHA 1OSZB 3CD4A 3OKNB 1HSAA 4ZPTB 3O41B 3C87A 3ES6A 5I1LB 4HXAL 4R7DB 3O3UN 2A6KB 3MYJA 4FQLH 1NC2B 1V3JA 1F4WH 1KG0A 1HQ4A 3I75B 2H3NB 1XGPB 4GMTL 4JFDE 1IC1A 2ESVE 4L1DA 4PJ7F 4RFOH 1MEXL 2NTFB 1AGFB 1OCWL 2BRQA 2VDLL 3I50H 3QJFB 4HQQL 4ODTH 3FOLB 4Y4FB 5EA0H 4NKIL 1IGML 4ODHL 5T5FL 3GI8L 1F45A 4EI6A 5E2VH 3QEQB 4PJFB 3UPAA 3HNVH 4PS4H 4ELMB 3NPSB 3D85B 1KCVH 2WV3A 4LPYA 1T7YA 2W9LA 4U6XB 2DYPA 1BLNB 2FDBP 2V2XB 1U6AH 5EWIL 3FB6A 3TEUA 3SGEI 1MHEB 4U6VH 3K4DA 3O9WC 3NTCL 3BPOB 2ID5A 5DT1L 3O3AA 1XCQB 3BPCA 4J8RA 1YEEH 2GSIA 5BV7H 4G8GD 1TCRB 3VFWB 3DRQB 4XZUB 2H2SC 1A7PL 1F3RB 5DD0H 4JM4H 2AV7A 2W0FA 2XN9B 1NKRA 4NKDA 1NCCL 4WNQB 1H8SA 3ILPA 4N0FA 3SO5A 1SY6L 2Z8SA 4QRRB 3KYKL 3QAZC 1OAQL 1UXWB 2IC2A 3TJHD 3GB7A 1GRWA 1EHAA 4BFEA 2EDYA 3RUGF 5T1KA 5EOTB 5D71L 1A9BB 4IRZH 4QHLA 3V6ZB 4WCYL 5C0BA 3VD4A 1I7TA 3PDDA 5T1LA 5BXFA 3A6CH 5E8PB 1BZ7A 5FOBA 3GKWL 3Q6GH 2E6QA 1MFDL 1ZKAA 1C5BL 3UTSE 4Z7WA 2DI9A 3I6KA 4X80L 4K8RL 5TDPB 5FM4A 3DVGA 3KPLA 3MLWH 5B3JF 5J3HC 1ZGLA 4X4XA 3GBLA 5INCB 2P8MB 5IVZA 2DQDL 2CSPA 4ODSH 4TUKH 4YFLI 5INDB 3K74B 4MQ7B 5C0AB 4DN3H 3H9SA 3LOWA 3QO1A 5ESAA 1A0QH 1QLFA 4I3GA 3BWAB 1MWAA 1MFAL 2Z93B 3WFBL 2AJZB 4JRYB 3VFTA 3RL2B 3T2PA 1ACZA 3W9EB 2WQRA 3MNWB 5GGQL 3MREA 3LKRA 4NUGH 4U3CA 5JO5A 4ONGL 5CZXD 2V9TA 2X1PA 4I5BA 4WY7H 1DLHA 5KBNC 3EDFA 5DO2D 3BYYA 1OLLA 1KIRB 4AIOA 4UDTA 4D3CH 4HIEB 4EN3D 1VFBB 5H94A 4KI5F 5DMIL 4X6EA 1U41A 3D39A 5JOPE 3ROOA 4O51B 4ZO9A 3SOBL 4NN5B 4DKAA 1T5XA 2A9ML 4MVBD 4GG8A 1KFAH 2OXHA 3HC4H 3LHPL 2OP4L 1EBAA 2ZKHL 5T1MB 2PW2B 5J1AB 2D7PA 3CFDA 5IW6A 4XCYA 1REIA 2ATPB 1H5BA 5FUZL 3SE3C 5EPMA 3RA7L 2LFGA 2DQHL 2FD6H 2ZSVB 4MSWB 5JOEA 4QTIL 2X4PB 4WUUA 2BFVH 2G9HB 2XZCH 2NY3B 4OSUL 5CJOH 4M02A 1HCFX 4TNWF 1TXKA 2QADD 4OFYD 4RGNE 5I8KL 4TSCL 1DBJL 3UTPD 3NIGE 3WNMA 4F3FB 5E6ZA 5ITBH 3P30H 4YAQA 5C0CA 1MI5B 5TQ0H 2AQ3A 2WAHA 3TYGH 3HZKB 1VENA 1F6AB 5HTSA 3GSQA 1G7HB 3IDXH 2VDQL 2VN7A 1NAKL 4UTAH 2ZPKH 4CMHB 2DQFA 2NY6B 1CD1A 2FL5B 5EIVA 3X12B 4LSUL 2XWBA 2QQQA 4KKAD 2R56L 1OTTC 1MH5B 4F8QA 4ZXBB 3T0EB 3MOQA 1OTSD 3PHQB 8FABA 4M48H 2NY5L 4YZFF 4ZO8A 3FTGA 5E08H 3BAEL 3GUTA 3UCRA 1HILA 4WI4A 4RSVA 1D5XB 3ZYIA 4Z7WF 1ITCA 3CFKB 3IRPX 3AGVA 5HVFB 2QHRH 4YXKH 3AS0A 1QQDA 3RZCD 1C16B 4L8BB 2BNUA 5HGHA 1WIPA 5DFTA 3UTQA 1Y6KR 4E41D 4NQSA 1W0YT 1WTGT 4K2UH 4OCWH 1FLRL 4QT5B 5FXCH 3ARBD 2GUOB 1MCDA 4QYOA 4WI8A 2VUYA 3IF1B 2MTPA 4N90E 1LO5B 5KVEH 4U1NA 5LGJA 4WO4C 5T1DL 3O2DH 1AC6A 5DJCA 4MHHI 1GVIA 4ZSOB 1VSCA 1XFPA 4V1DD 4LSVL 3P9MB 4N0YL 4XPFL 2NZ9D 1ORSA 3UTTE 1CFQA 4G9DA 5DJZA 3T0WA 4YDIL 1ZA3A 2VDNH 3O11A 1G6RH 2H6PA 4TUJB 4YHIB 1U8KB 1BWWA 1IKFH 3VXUB 4FMKA 4ZS6C 1RUKL 3CDYA 2YA0A 4ZUUA 4L9LC 5ANME 3VI4E 4OZFB 2X4SB 2YPLE 4JFEA 4X9GA 1CVSC 3CUPA 1K8DA 1U8QA 3QFJD 1EVTC 1NGZB 2DM7A 4X99A 4R7NB 4KK8D 4BSWA 5GRJL 2BERA 1EZVY 4P4KD 4AENB 4XCEA 1YPZA 3HC3H 1NSNH 1BD2D 3F7QA 3U2SA 2ED8A 2J6EH 1TTFA 1UT9A 5I8OL 2BSRA 3OKLA 4XCFL 5E94B 5EZOL 3L5JA 2AABL 4HPOL 4HT1H 2H2PC 5IESH 4QXUH 1LO4H 5IBLD 2BHYA 1K3IA 4HD9A 5HHMD 4H1LB 4HS8L 2R0LL 1BJ1J 4MXVF 3FKUS 1P9MC 4ZUSA 3QI9B 1JK8B 4G9FD 4PIRF 3QUKA 4PP1D 4WHYH 4NO2A 2Y6SC 5KSUB 3MR9B 2JJSA 1YUHB 3I02A 5GRZA 3PP3K 3O6KL 1CU4L 5TPWH 4UOW0 1WIOA 5ADOL 2DQIL 3MV9A 3JTSA 3FQNA 1FDLL 1UCBL 1FJ1B 3CMOL 3T3PE 1N2RB 5F21B 3W5MA 1E4WL 2ILLA 3UTSB 3VGFA 1E27A 1CDJA 5GS1A 4HJJL 5TGBB 1CF8L 2YC1B 1S9YB 3DHJA 3RL1A 1TZGH 2FWOB 3U1SH 2YRPA 5SWZD 5BOPA 4OTXL 3WD5L 3QWQB 2IGFH 1JNHB 3HI6H 1LEIA 3AB0B 5CFHA 4OD1L 5EU6E 2ZOKB 2YUXA 3TO4D 3WFEH 1QRNE 5C0DB 5DVMA 2QQNL 3AROA 3K2MC 1F90H 4X4ZA 1KPVA 3WXWH 2R2HA 5IK3A 1NDGA 3LKNA 2YPKA 5JIPA 2YR3A 3VRLF 3GSVB 2QL1A 5FCUH 3EYFB 4JFFB 1B9ZA 1LE5A 1OGAE 4NGHL 1EEZA 1VB9A 2MCPH 4D9LH 4Y2DA 3MO1B 5SX5K 3I6LD 3BDYH 3L95B 4K8RD 1A7NL 1I9JH 4QHKI 1ZA6A 4MNGA 5CMAA 1BBJB 4M5ZL 3VW3L 3FJTA 3S96B 3BGAA 5CJ8A 3QIUA 1Q1JL 1QPXA 4NFDA 2BOCA 1BJ8A 5DK2B 4JPWL 1T66C 4MNQD 5MEQA 1ES0B 1W0VB 2V2WA 1V5JA 3MGTA 4XVSH 5C08D 1A6VL 3HMXL 4MDJB 1HHJA 2Z91A 5C0JB 3QIWA 3HI5H 5AD0B 4LGSB 2X4TA 3HB3C 3G5XA 5BQ7B 4TRPH 2VQTA 1YPZF 1MIML 1OP5H 2FLRT 5TH2A 3VWKC 1Q9KA 3H0TA 4QWWD 1FNGB 3C8HA 5GS3A 1NDMA 3G9AB 4HH8A 5KSAC 4CDGC 3HAEA 4GRWB 2FX9L 2PO6A 1OF2B 4QRTA 4X6DF 1KC5L 4R90L 5C0NC 3B9KB 4PRBB 3ZL4H 1AR1C 2I9LB 4X6CF 4PJBB 2VXTH 2CK0L 5C3LD 1ERNA 3V0WH 3AU1A 3O8XD 5L0QB 2Y5EA 4OLVH 1HWGB 4ZUWB 3ARGB 1YMMA 2IPKA 4NQEB 1RJLB 4LCCA 3VXMA 1YNLH 1EIBA 4MX7B 4Y1AB 1A3RH 5HY9A 5HI3D 5LXGL 3REWA 3D0LA 3NCJL 1NMCC 3HG1E 3KPTA 1CE6B 4YO0B 2UY6A 4Z76A 4JY4B 1L9MA 4PFEA 3U0PB 3O2WL 5DA4A 1ZWIB 5HI5D 4OCMC 3L3KA 4PY7A 5J12C 3RAJL 4LCYA 4P4RB 3ZE0F 2FIKB 3IFPA 4I13B 4JPKH 5F97E 2P8LB 3C9NA 2H8PA 1ZHLA 3MLXH 5IT2H 5GSRB 1L7IL 4MA7L 1OLZA 1S7XA 5FGCE 3QG6A 4J3VA 4XVJL 3QDGB 1UKTA 2YD5A 1A8JH 1W72A 4DKFH 2YWYA 4M9OA 4YHPB 1GL4B 2ZJSH 5MEOB 3IDGB 3MLUL 5L8KB 3WJLA 5TJWK 2RQ8A 1DZBA 4M62L 4OJFH 1QFPA 2EDKA 3W5NA 3REVB 4UT9L 2YEZA 2F54D 1I1YB 2DKMA 3MV8E 1TPXC 4MA8H 5GJSH 5TF1H 3LKOB 4NCDA 4OGXL 5K9KA 3LRSA 3S37H 5D70L 4BFIB 4XGZA 5HYQB 5BRZB 5D1XB 4POZC 3THMH 4O00A 4RX4A 3MNVB 4YFLF 5GRWA 3UTTB 1GAFL 4JO1L 4I3SL 3GHEL 1DBAL 2J8OA 4B0MM 4XNUH 1Q9LB 2VDKH 3ZO0A 5F9WB 3QO0A 1WIUA 1IGIL 1BVKA 3KPQB 1N0XL 3CDFA 5M7QA 5DHYB 4P3CL 3MJ7A 2X4UA 5ANMB 1AXTL 4N9GB 2YPLB 4XP1H 3HR5B 1BZ9A 5GGTH 4CMMB 5DVKA 1S5IH 1S7WB 4R4BA 3SDXE 5K9OA 5HGAA 1HHIA 4F33B 3Q5TA 4OLWL 1LO0L 3O9WD 4PJ9B 2WBJC 1LP9A 3BX7C 2HVJA 2G2RA 2EDHA 3UDWC 1PQZA 1WZ1H 5J11B 3SDDA 1LGVA 2HN7A 5DEFB 3O3EB 4R8WL 4QRSB 3QDHA 2H2SD 3VG9B 5IWLC 1E28A 4U1KA 1JYNA 4TNWK 2JB5H 3MBEA 4YHNA 5C07E 5C0FA 5D2NE 4D9QE 1JF1A 5DD1H 5J6HA 4HSQA 4GW1A 5I1GL 2QBWA 2F19L 2GY5A 1MAJA 3S6CA 1FN4A 1J86A 1I3RB 2IAND 1Q9OA 2XQYK 4JFHD 1YJDC 3VFUB 5DHVB 2M1KA 1EV2E 3NAAH 3QJHB 1BOGA 3FO0L 1MIEH 2F8VA 2ZUSA 4JHWH 4HK3J 3RGVB 4E0RA 1Y18B 5FV1L 4NNXB 4I0PA 2X4NB 4ZPVB 3TH3T 4R0LA 5AZEH 3I9GH 2DM3A 3BDBA 3L6FA 5J3HD 5C09B 1CK0H 5D7LB 3G6DL 4DZ8A 2CJUH 5HDQH 1KPRA 4FZEH 5IOPB 4RMVA 2DLGA 3EYSL 5E7BA 2DBLH 2ARJQ 4NJAH 3G6AB 4Q6IA 5MP6H 3S35H 4M00A 3HUJA 1Q0XH 3FQUB 2EYRB 5K93A 4Q9QH 3KDMA 3C8KA 5B3NA 2WM0A 4OM0H 3VXRB 1X4XA 3M1BB 4GKZA 1KCUH 4PGEA 4DKEL 3SGKC 4I48A 3WKNA 1X5KA 4R26H 3SEPA 3PV6B 3GIZH 4CAGA 5I2IB 5JXEA 1MF2H 1XF2A 4C59B 3OPZL 2DM4A 3HMWL 3ZE2E 1U91A 3TPKA 5HHNB 3O4LE 1X5IA 2CLZB 3N9GH 2E5EA 4JG0H 4WEBL 5IB2A 1FFNA 3MJGX 3STZA 2VLJE 2X4RB 1X5GA 3IETA 1LD9A 1PYWA 4KKLC 1JCKA 4ZQKA 4Y2OA 2ZOLA 4UB0H 4GUPB 3N85L 2GKIA 2AJ3B 4PRIA 4PUBH 3BO8B 2DQCH 1CDGA 1MJ8L 4GS7C 5DJAB 5CEZL 1BIIB 3IKCA 4IRSB 4LAQL 2H32A 4MJIE 1G7PB 2FGZA 1CXIA 4RAUA 3S4SB 4BUHA 2FHFA 4LVHB 2HFFB 3VGHA 1DQMH 4WI2A 1IM3A 1UVQA 1NCAL 4P9HC 4YC2C 4KVCL 4S1SH 3UBXG 4N9OB 1LP9F 3VFVA 1BQHA 4U7MA 2DWDB 4RZCB 4FQXC 5E0QA 1WICA 1T7XA 2CR6A 4XPHH 1X7QA 3QUXC 3ZMRA 4GH7B 4Z5RA 4MNHA 5LQBH 5EU4B 4BFGA 1JUFA 4NT6A 4YBLC 4YFDB 2YMXH 4UT6H 2GTWB 3QA3B 4IRJB 2E7MA 2EZ0C 5I1CH 3V4VH 2FR4B 2JJUA 4GRLC 4NO0A 2X7LA 5JMRA 3F7VA 4PJCA 3KLDA 4YDVB 5L8LB 3DRQA 3PXHA 3IVKA 3W0WB 1QG3A 4LHUD 4YGVA 3WL9A 1I7ZB 5FO9B 2XYCA 3CFCL 2B2XL 4N8CH 1OTTD 1TJIH 4KTDL 5FA3B 1FH5H 3WEXB 1KXQE 3RTQB 5I1JL 5KVFH 5KSBB 1F2XK 2QQLL 1VFOA 1KTDA 3L3GB 1Z0NA 3MRPA 3BT2H 2YUWA 1FAIH 2Y36L 3QUYB 5IMLB 2X10A 1XMWA 2R69H 2J1KA 3MLSH 4F2MB 2AKRB 4XBGB 3NH7H 3TCLB 5T3XH 3V6ZA 3TJEL 1J5OL 4QRPD 3QPXL 5F7MC 1YEHH 3IU4H 5ILTH 1VACB 4Y16C 3OKYA 4MD0B 3VXTA 2NPLX 3WNNA 3QP3A 4YUEL 3T1FB 3FONA 3WS3B 5BZWA 1OPGH 5JUEH 1UJTA 1DDHB 4PBXA 3HE7A 4BM7A 5E1AB 3HUJF 4WO4D 5L2KA 1HHHB 4NFCA 5EO0A 2CUHA 3O4OC 1R5WB 2BVPA 4C57C 1JGDA 1R3JA 3FCTA 1GYAA 3X14A 2A74B 1JPTH 4ZFFB 4J3UA 1T04B 1P7HL 4WV1B 2NY1B 2IAMA 3CXDL 4RDQG 3CSBA 4OLZL 1IGYB 1MCPL 1DUYB 3KPPB 4QY8B 3I3BA 3WIHH 2BOBA 3ULVH 1R3KB 2FCBA 3MRBB 4J3OC 4XNQA 2CIIA 1CLOH 1JV5B 3O45B 1EFXA 4EI5B 4ZS6D 5FKPA 3QIUC 3TWCL 4ETQB 2CD0A 2JCCB 2EDRA 4W70A 4XBPA 2A83B 1ACYL 3P0YL 5GS0H 4P5TA 3DURB 1MCLA 3T2OA 2I9TA 2FBJL 1YJDL 2AEIT 4HLZG 2HA1A 2OBGA 3QIWC 5DRWA 2E27L 3BHBA 3RWIB 2D7TH 4F7TB 3CZJA 1T0PB 3X3FL 3E3QC 4ODWA 1MLCB 3HNSH 5FECA 5E8OB 1N59B 3SDXB 3QULA 2NLJB 3MV7D 2PW2A 1CQYA 2CKNA 2HT3C 2CDFA 4Q9BA 5GGUB 2H2PD 4MSWA 3QCUL 3WUZA 4HIIA 4NWUL 4ZFOA 2X4PA 5AAMA 1FG2A 4S1RH 3ALPA 4XP9H 3RZWA 2WBWB 2QKIA 4F37F 1KENL 1E6OH 3HPJB 1EXUB 5ELIA 4AY0A 5C07B 1NMBL 1MJ7H 1SQ2N 4LLWB 5HGGS 2Y6SD 3ARFB 3SN6N 2JIXD 4OLXH 4NZTH 4YX2H 1KJMA 5JW4M 5DQJA 1RVFL 4PJCF 1NMAH 5KVGH 2J5LC 4HUUA 1AI1H 4I2XA 4XXDB 4U6YB 4F7EB 3N06B 2YKLH 5D2LE 2YUZA 3FOMB 1AFVH 3TM6A 1HSBB 2IBZY 3UZQA 4HJGB 3CFJA 4QF1A 5MI0C 2I60L 4G8GE 3BUYB 4Q2ZB 1MCRA 5I73C 3N1PC 4J4PC 1AO7D 4N0UE 3ZHLA 4G3YL 3T0EA 4ZODA 5AYUH 2NZIA 1I7UB 4J1UB 2VNCA 2HFGL 3OKEB 3KXFD 2H1PH 3QXAA 1SYVB 3MRFA 4RAVB 4PGDA 3MOAL 4LLVA 4XAWH 4MLIA 4Y19D 4P3DA 3QQ9C 4HLJA 5ICXA 5IR1A 3F12A 4XP6L 4XWOC 4S1DC 3UYPA 1BGXH 1U8LB 3VFRB 2AJVL 3ZHKA 4Q9RL 3D3VA 1NGPL 2A9NH 2OYPA 3RVVC 2DMCA 2ICES 4X5WB 3W39A 1QR4A 1MY7A 3C08L 4KJWC 4PY8I 2ZG2A 3BZFB 2Q7YA 3VH8A 1A1NA 1ZHBA 3EOBA 3MODH 3HHRB 4LGPB 4S0SD 1MCCA 2Q8AH 3RWGA 4JY5L 4KV5E 1AQDB 3MRKA 1OAUH 3OKMA 2FX8L 4HAGA 2B1AL 4HXBH 5KAQF 1Z6JT 1CGYA 2B8OT 4PJDF 3H3PL 5A43C 3BQUA 3ZDZF 1TETL 3RY6C 4JFDA 2ESVA 3SKMA 4AEFA 1H8NA 2XNAB 1FZMB 3WIFA 3JWOC 2WLYA 4YHIA 3CSYB 3L5XL 3WDHA 3F5WA 4NNYB 4YDLC 1FVEA 3HB3D 5D7JB 1ZMYA 3PQYA 2OK0L 1U3HC 5EU3B 4UNUA 3SDDC 2I27N 5GGSY 3VWKD 1GSMA 5IMKB 4OF7A 5IIEA 1K4DB 2X1WL 4OIAA 3RFZC 5KSAD 1G0DA 1A1OB 5I74B 3INUL 3MBEC 1H15A 5ESVA 4BFBD 3SHSA 1ZT1B 4ZMAT 5CZVH 5C0ND 1AR1D 1T80A 3KYOB 3RP1A 3KR3H 1UYWH 4O2FB 3ZKNC 4YHYB 1JE6A 4LSRH 1XIWB 3EOAB 4XNMA 4NP4L 4L4VD 5CEZD 4AJ0A 2VWEE 1FZJB 1EEQA 2AXFA 3HE6B 4GQ9L 5LBSH 1B0RA 2P5EB 2PETA 4NWTH 1X4ZA 4QXWA 5CEYA 3S98A 4BZ2H 4G6KH 2E8YA 4JO3L 4PJAE 1T2JA 3X3GH 1ADQH 3UTPE 4O02L 3QHZH 3TZVA 3O6FB 4N8VG 2O5XL 2XFXA 5I18H 4NNPH 4PGCA 4ZYKB 4JN2B 3EZ8A 2PTTB 2EXWC 2BXZA 1ZTXH 5JXAH 1F58H 2Z9TA 3JV4B 1G7LB 4F15C 4X7TA 1FP5A 3H9SD 3RWDA 2BRRL 3PXJA 1JHKH 4FXGA 1N2RA 1S78C 2YOCA 1JZ6A 3T8XA 4LEOA 2R29L 1MRFL 5TGBA 2W38A 4LLQA 5DLMH 1QR1B 1XEDA 4BUGA 1R3IH 4IMLA 1MCIA 5ETUA 4G8IA 3FB8B 2K3TA 2X5PA 4XRCB 3CCHB 1YEKL 3AXLB 4M1CC 1GGCH 3TBWB 4X4MA 1AXIB 1NFDB 2D7QA 2DQEL 3PNWA 5ADPH 4GG6B 4POZD 5TDOB 3X13A 2NY2C 2XY1A 1D5BA 2ITDB 2R1XA 4KWUA 5IW3A 4AMKH 1VPOH 3EO0A 2QEJA 3P73B 3H3KA 4LSQL 4E41E 2IQAA 1GOHA 1D6EB 3K3QA 3FFCD 5ISZB 4JRXB 4YPJA 4OIIL 5KANI 2Z92B 4WUUD 3O3DA 1PKQA 1BPVA 3P3YA 1F3DJ 4X7SL 1DANU 1U93A 4RFNB 1RIHL 3UO1L 1A14L 1VEPA 3VFNA 5HYJD 4YXHH 2WBJD 2GJZA 4YPGA 1UEMA 2XKNB 4WFGD 5CGYC 1X5JA 4LCIL 5BMFL 5EOQL 4OCYH 1IGMH 4JB9L 5SWSA 1E4KA 5IHUH 4NC1E 1QBMH 4P5MA 2IG2L 4DVRL 2R1YA 1Q72L 5D1ZC 4YJZL 1U95A 3TA3B 4F58L 3BZEB 4JLRB 3FZUC 1OP9A 1YYML 3HCVA 4ELKB 1LK2A 1DN0A 2LQRA 1WCBB 3V6FA 1IARB 35C8L 2R2CA 1WT5A 5FYJU 5IV2B 3QFJE 5BJTA 1SHMA 4DUVA 1JIBA 6FABL 2XI9A 5J1TC 4PJIB 3ET9F 3O6ML 2F53E 1BD2E 5D7SL 5J6GB 3H8NA 1X6LA 2AW2A 5DZLA 1JF6A 1J12A 2GAZA 2V5YA 2V7HA 3GK8L 1S9XB 4BH7A 3AAZA 1U8PB 2NXYB 5DRZB 4BH8B 4H0GA 1MNUH 1D9KA 1T1WB 4Z0XA 4G8GB 4QTHB 3RPKA 1L7TL 5EORL 1UWGL 1S7VA 4WVRA 1QLRB 1JWSA 2A1WL 4G9FE 3TT3L 4KAQL 5ALBH 4M7KL 3JWOL 3ROLA 3N50A 5BW7A 3WJJA 4I18C 1P5VA 5CSZB 4HX1A 2YD2A 2FYYB 3NACL 3Q1SH 4K8RH 4U6TA 4M7ZB 2IFFH 1KLGB 3H6JA 3RVTC 1VADB 4L3CA 5FYJH 5F3BA 3IAPA 4GRWH 1H0DA 1T1ZB 3QZWA 5GS2D 1CZ8L 3F7PC 3KYNA 3GSRA 4PLKC 4KMLB 1A6ZA 3FFDB 2FB4L 4KKLD 1F4HA 4ZAKC 4R9HA 4G80B 4YFEA 1C1EH 5LAXB 2D31B 5SWZE 4W6WB 1HXMB 4ERSL 2EDLA 3JWDH 4H26A 5EULV 5E5RB 1AGCB 3RVUC 5DS8B 3I3EA 4ODUA 5EC2B 3STBA 3DX6B 4CKVX 5EOCL 3OJDA 3QQ4B 5EBLA 5F3HB 4HBCL 3V6OE 3B83A 5I76A 2V9QA 4EQ2A 2EIZB 2EKSA 5DUBB 3DX7B 1IAIM 4HUVA 3T65A 2C4FU 1U8NB 3DX8A 4IJ3C 5D5MB 5GRVK 3EW3B 5D6DA 5ACZA 5CKGA 1A3QA 3EHBC 2V7NB 1QHOA 2JB6A 2HLFC 4LHUG 4HWZA 1G9ML 5JNYA 1S7UB 4NKQB 4FQXD 3I6LE 4EN3B 2I25N 3HA0A 1EA9C 2PYFB 4JFPA 3QUXD 2EDTA 4CL7A 4HGKC 4KROC 1J0ZA 3C5ZA 4PP2B 4F7MB 4RGOL 1F11A 4CVZA 1BFOA 4TTGA 4P2QD 1MCEA 2EZ0D 4JFZL 2OI9C 4LF3A 2OM5A 4OZGE 4B7LA 4GRLD 4OZIB 1F5WA 4MNQE 5GHWH 4OFDA 2O5YL 1NBVL 2VXVL 3NIGF 5C08E 3DMMB 3O2DA 1ZLSL 5JQHC 5I6XC 4F37K 4RWYH 3UPRA 1F6FB 1A6WH 3RDTA 3I6GA 4FP8L 3R1GH 1VFAA 3BPNC 2NXZD 1XR8A 4P48A 2VAAA 3LQMA 3GMLA 1TNMA 1CXFA 3DV6A 5GRVL 1PLGL 4OF0A 1G6RA 1CFNB 3U4EA 5FB8B 1GZQA 1VCAA 4Y16D 2CMRH 3BEVA 4MA1B 2EYTB 5HGBA 4P46C 3MLPA 2MWCA 3HS0B 3GMOA 5F9JA 4QCIB 3BKJL 4KKCC 4FXKB 5DD3L 3BAEH 1JJUA 1AGEA 3EFDH 5H2BB 5E4EB 1AGBB 3WDJA 4HKXA 2VABB 5MERA 4WU5B 2J6EA 4XHJC 5FO8A 4TSAH 1ZLUK 2HWZL 1RJYB 4GFTB 2CDEB 4JFOB 1KJVA 4O58L 3MCLL 2EC9U 5BOZG 4CN6A 3O3BA 1JYWA 2YPVH 2NMSA 1YYLL 3BD3A 5EU6A 4OB5L 4ZS7H 4YQXH 5KJRH 3S36H 4KVNL 1QRNA 2WWKO 4S2SA 4YXLL 5DJ6B 3QIUD 4P2OC 3RWCB 4K3EH 5IVXF 4YWGL 3RI5F 3V5KA 4QHUB 4GQPH 4HHAA 4E41B 4YDKH 1MRDH 2AEPH 3QWRD 4G6ML 3NA9L 3OR6A 1OGAA 5D7IE 2CLZA 3C6LA 3QIWD 2KPNA 5D9SA 4AIZA 1T5WB 2AJXL 1MCQA 2B20A 3BFOA 1ITBB 2F54E 3L3OA 9CGTA 2R0ZH 3NFSL 5DA0B 4HUNB 1SVZA 1QSVA 2KQMA 1UXSA 2HT3D 4FQIL 4LCUB 1H3VA 3WLWD 4LDEB 4V1DB 4OCNC 3SKJH 2FSEB 4YHKL 3OV6A 1NUGA 4OF3A 1AJ7L 5IFAL 2C1PA 1S5HB 4KKNA 3NFPA 4Z7VB 1CBVH 4NKMA 3IFNH 3QH3A 1S9VA 4Z7UE 5EZJB 2Q6WB 4NSKB 3HFMH 5HHOD 4DEPC 1XGUB 3JTTA 2F5AL 1J8HB 1CCZA 1RZ8B 2QJDA 3WN5C 1T0MA 1G7MB 3GEWB 4P4KB 3V5DA 1DBML 4HIXL 3E2HC 2VDOH 5C2BH 3D48R 2YD6A 5B38G 1RMFH 5GSVA 1BD2B 4KI1A 2R0LH 3V8CA 3K8KA 4OZHE 2J12B 2VDMH 1A6AB 2F15A 3SDCC 2BCKA 4J4PD 2P43B 4PJXB 1I4FA 1V7ML 4O4YL 1ZLVH 4KQ4H 5HHQA 2LAAA 1DEEB 1I85C 1J1PL 5CP7A 4P2RD 1B4RA 5HHMB 5JW3L 3QUZA 4NN6C 3HG1A 3V5HA 3QQ9D 2MKLC 3QXVA 2P49B 1ZHNA 2EEBA 1FE8L 4LARH 5FYKL 1AD0B 3TFKC 3WUWB 4G9FB 5A16A 1IL1B 2IANE 4S1DD 4XH2B 2PR4H 3OJMB 1PSKL 1FCGA 3RVVD 1QNZH 1UA6L 3CVIL 4GBXA 4M7JH 3MACL 4UINH 1HQRB 5IBUG 5DHXB 1B4JL 2NY0B 3U0WH 5DMKA 4JZJC 5E5MA 4KJWD 2GITA 4B7IA 2G60L 3K46A 4ZFOL 5BV7C 1B3JA 4WUKL 5E2JA 4MAUH 2H9GB 3BH9B 1DDHA 1NEZB 3BP6B 2VISA 1RURL 3DXAA 2J88L 1R5WA 1SJEB 1DUZB 4X9BA 3QUMH 2SEBB 1X44A 5E8NA 5LVEA 3N1GC 5DJ2A 1J1XH 4ETYA 1L9NA 1XH3B 3MV8A 1CICA 1QUNA 2OTPA 4DWHA 3NIFE 4QNPE 5IFJA 2VC2L 4G6JH 2P24B 2HVKA 2NW3B 4GSDH 3QEUB 3CNKA 4XC1L 1LK3L 1NPUA 3R8BB 1U3HD 4HC1A 3BMWA 3DIFB 3SDDD 5F7EH 2PTUA 1AD9A 1NJ9B 3EYOB 4JDTL 3DURA 4XNXL 4MDIB 4OGAC 3MRGB 2FGWL 5C6TL 2HLAB 1WV7T 5HYSG 1QFUL 3KPNA 25C8L 5HD8C 1NCBL 3MBED 3MA9H 2YA2A 2F9BT 3PABA 3IXTB 3MRJB 1EFQA 5H35A 2WP3O 1WT5C 2C26A 1XGRB 3SCMC 4FZ8H 2XTJB 3QQ3A 4QHNA 4LLYA 3ZKND 4FOMA 5GGUA 3B4NA 2DMBA 4FABH 5EFIA 4YLQT 1C08B 4FQ1H 1QD0A 2B5IC 4MNQB 2V2TA 1FSKB 3V0AC 5F1KC 2CKBL 5IB1A 2YRLA 4OAWB 5C08B 3LZFH 4KRPB 2QSVA 1JI2A 1UGNA 4LHJB 1FYHB 3DSFL 2NTSP 3VI3E 5D2NA 2NY7H 3B9DA 4A6YL 4CJ0A 2YBRB 3TN0A 3IDJA 4JEGB 3MCG1 4I77L 4YDJA 1M6OA 4FNLH 4BZ1L 5SWQA 1BFSA 1F6LL 3DV4A 2XQBH 5EBWB 4U6YA 3BZDA 4QOKD 2B7DT 5IROA 5HVHB 5K9JH 4GRMA 2WUCH 4A2LA 3GSOB 1N5YH 4HZLA 3BSZL 1LHZA 3FT3B 2YD3A 5E9DA 3S88H 4YHLL 5EU7C 4Z7QF 5GGTA 4D8PA 3H7BA 4HDIB 4IDLA 3PUCA 5IB3A 1CE1H 2OL3B 4K7FA 3IDNB 4WDIB 1MCFA 3HRZA 4M1CD 3EYVA 1WBYA 5F9AC 1T20B 4OT1L 4XPBL 3U9UA 1D3CA 3SE9L 1RY7B 2NY2D 3VXNB 1JPST 2UYLB 3CK0L 3MLUH 4LPVA 3QCTH 3HZYA 3VD5A 3LV3B 3GIVA 3TVMC 1YC7A 5HYIA 2PXYA 5DTFA 3PL6B 3MCKA 4PB0H 1TVHB 15C8H 1FFRA 2X89A 3L9RB 2D03L 4DGIL 1IKNA 4LVOC 3LMJL 3L3DB 3O4LA 1IGTA 4F9PC 4FQLL 4ONHB 1F4WL 2VLJA 3PF2A 3AMKA 5DD5H 1KBGH 1JNNH 4N8VB 4F9LA 2X40A 1NCWH 2FZ3B 3C2AH 4EZMA 3ALWA 5D6DC 1PEWA 5B8CC 2X4QB 2GT9A 5GRUH 3RNKA 5IB4B 2UZIH 1INQA 5CGYD 3MRRA 4K71C 4LDOB 1RU9H 2F54B 3I50L 4CGTA 4ODTL 1IGIH 4RFEB 3NA4A 4XAKD 1IEAA 1N0XH 4NKOB 1F42A 4UTBH 3MMEB 5EA0L 5D1ZD 4MJIA 4QXGH 1FHGA 5E2VL 3P11H 3HNVL 3SDAC 3CFBA 4PS4L 3LS4H 1KCVL 1UZ8B 4FTVB 4KZDH 4UQ3A 3NCYS 1U6AL 2VITB 4LRIA 1U92B 2IFGA 1BJMA 5GPRA 4P5KA 4U6VL 3ZKXC 1B0GB 4KJQC 4R8WH 5GGVH 4F7PB 3P2TA 1TLKA 5BV7L 2HRPH 4LSSH 5ID1B 2N4IA 3AREC 3QFDB 3MV7E 3WO3B 5K9QG 4HAFA 1XIWA 5E00A 3O9WB 2DQUH 1EPFA 1S7QA 5DD0L 4JM4L 4PJ8A 1IQDB 3OZ9H 4KZEH 4OZHB 1RIVH 3CVHA 4K3JH 3QNYB 3P4MB 1JRHH 1CFTA 1I3UA 3PWUA 1J0JA 1DVFA 1QSFA 4Y5VA 5EUKB 5GGSB 4IRZL 1INDH 2ARWA 3PWJB 5EN2A 5CJXA 3UBXI 4PJGF 3H9ZA 5DYOA 1QKZH 3QT2A 3A6CL 1QA9B 1ROWA 3CXHJ 2IANB 1GPOH 3Q6GL 3NZ8A 2BZDA 1VGEH 3RVTD 4APQA 4IIQA 4FFYH 3PIQA 1HCVA 2P1YA 1UCTA 2Q3ZA 3GNMH 3HI1A 3MLWL 1KB5H 4JZOA 1FV1B 1QSED 4PLKD 3IKKA 5IKCB 3UTZB 3MA7B 1TNNA 2VZ3A 1XF4A 4ODSL 5I17A 4TUKL 1EFXD 4DN3L 1WC7A 4ZAKD 3CDGB 3U79A 1AO7E 1R5VB 1A0QL 4G6FD 4JAMB 3U82B 1DANT 5DEGA 2Y7QA 4P5TD 4MD5B 2AP2A 3KXFE 4RBPH 4OD2B 1MLBA 4NUGL 4DCQB 4LLMA 3RVUD 3AC0A 4N0RA 4Y19E 3TYFB 3LPWA 3RWHA 3SBWA 3DUHA 5FYKD 1NGYB 4BQ8A 4M7LH 4WY7L 1YEIH 4NYLB 2CQVA 1SEBA 1T0NB 2X4OB 5DVNA 5LG1A 5CP3H 3P73A 3VJ6B 4D3CL 1N8ZB 5HHVH 5JQ6H 3RI5K 4ORGB 1LNUA 3BRDA 4DK6A 3QNXB 3ARDB 3EHBD 2Z0BA 1RK1A 1JMZA 4JFQB 3LAFA 2HLFD 5KVDH 1YZZA 5F8QC 4Q74A 1T21A 3FT4A 4HGWB 3ZSSA 1KFAL 4WFFD 2Z4QB 3HC4L 1P6AB 4UQ2B 4N8PA 1KEMH 1KJ2A 1EAPA 5GIRB 4NRZB 1CR9H 5F7DB 4Y5YC 1FC1A 3ARQA 1AIFB 3GMRA 1FZOA 2FD6L 4JFYB 3B9AA 8CGTA 2BFVL 4CU6A 2XZCL 1U58A 2C1OA 3LKSB 3QWOB 1LVEA 4X5XA 2BNRD 2DICA 2FRGP 3KPRB 3VCLA 1SMAA 4JO4H 4I4WA 2V17H 5ITBL 3P30L 3T4AA 5TQ0L 1WZKA 43CAB 2QSTA 3SPVA 1X5HA 5HI4C 4XPAH 1KB9J 3TYGL 4NO5A 1JPFB 1YDPA 1YN7B 4MYWB 1MAMH 3QDMD 2OSLA 2QLVB 3WO4B 4LBEB 2GTZA 1RJZA 3WIHA 3IDXL 1CDIA 4LMQE 1I8IB 2ZPKL 4UTAL 4WW2B 1IAIH 3Q48A 3LB6C 2PCPA 3GMQA 3DECA 4N68A 3NCYP 4LSTH 4P46D 4WHCA 5D2LA 3RX5A 3G6JE 3MUJA 5C9JB 2NCMA 4U3XA 4U0QB 3R0MA 4KKCD 3RBSA 3D3VD 4L4VE 1N4XH 4KTEH 5CEZE 5E8DH 1A21A 1JHLH 1ZOXA 4Z77B 1Y0LB 2FO4A 4Y4KC 4M48L 3MRNA 5E08L 1A1MB 4N0UA 4X6FA 4OZ4A 4XHJD 3BI9X 5M94B 1GGIH 3DROB 3MJ9H 2QHRL 4YXKL 3KPSB 4TQEL 3VXOB 4AH2B 3B5HA 4C83B 2Q8BH 3R8QA 5A2LH 4K2UL 3VWJC 4JDZA 3TNNB 4D0DB 3BH8B 1RZIA 4XNZC 2EC8A 1T3FB 4P2OD 1R6VA 2X70B 3H9SE 3GSNB 4QRPB 5I8EA 3T08A 1DQJB 2AJYH 4LSPH 2C3XA 4WJ5A 2C4FT 5IEHB 3O2DL 3PP4H 1L0YA 3ESVF 1AHWB 4LKXB 4RMTA 4XBEH 5ICYA 2Z31B 1UM4L 3CXDH 3ZTJG 1CN4A 5IBTH 4GW4B 4OV5A 1U8MA 3PQYD 3G5ZB 2FJHA 4LLAA 1HI6B 4K7PH 5CWSB 1HXMA 3T77A 2WWKT 1BQSA 5D1QC 4PJ7B 2VDNL 5GJTH 2B0SH 4N1CA 2OQJA 5DK0B 5DS8A 1V7NH 1IKFL 1YNTA 3F7YB 4EEEA 3CXHK 5F3HA 1IGJB 3P9LA 4E5XB 5CBAA 1RQ5A 3IFLH 4G7VH 4L8SC 4JDVB 4HUXA 3FFCE 3PGCB 4LCWD 4Q0XH 3EGSA 2ADGB 1KOAA 4R97C 1W0WA 1IM9B 2KZWA 5DD6A 3HC3L 3L3HB 2NX5E 1NSNL 4WUUE 5I30H 1QRKA 3UYRH 1FG9C 2J6EL 3LD8B 3WIIH 3LPFA 4X0KB 2IALB 5HYJE 5J13C 4HT1L 5JHLH 5FDWA 5IESL 4QXUL 1LO4L 2GHWB 2HJKB 4QRUA 4WFGE 5DWUH 4F8TA 4I3RH 1IAOB 4QRQA 2I07A 3ZKQD 3SDCD 4MXVE 1M71B 4HKBB 3AS2A 3QYCA 2R9HC 1XF5B 3LPGA 3ULVF 1CXLA 4F57H 1YEDA 3LQAC 3PWPE 2CDGB 3VRJA 1JWUA 3RUGB 3TBSA 4OFYA 4LIQH 3MRIA 3TFKD 4PJAA 5D2LF 5GS2H 5DRNA 5TPWL 2QSCH 1D6VH 3ABZA 1ZV5A 3F8UB 3EJZC 2DD8H 2UVEA 5HVWA 4U1GB 1K9TA 4FFWC 3QNZB 2J8UE 4MHHG 4PRHB 2HFTA 3C5JB 4LKCA 2XWTB 5C6WH 5GGRY 4KJYB 4MJ4A 1WFUA 1AE6H 5FGBA 4M61A 1N5AB 2ITCB 3H42H 1TZGL 3O81A 1RUPH 3U1SL 1BWMA 3IXAA 3TIEB 3Q0HA 1NC4B 4NM4H 5E6IB 1AP2A 2IGFL 3HI6L 3UBXA 1FVDB 5F1IA 1JTOA 2PXYC 1NBYB 1OP3K 1MJUH 1FGNL 4S10A 4N1EA 4L3EB 3WFEL 3W2DH 1KB9K 5E2WH 3ECBA 1OP5K 4P9HH 1F90L 3WXWL 5FA4B 3KJ6H 4Y19B 5I8CB 3W9DB 4OFVA 2WINA 3VRLE 1II4E 3GFUA 4LGRB 4F9LC 5FCUL 2GK0B 1RHHB 1HSAB 1R3LA 4KV5F 2MCPL 3RWCA 4D9LL 3ES6B 3RZCA 3MYJB 4LIQE 4RMQA 3PE9A 2P8PA 1KG0B 1HQ4B 3BDYL 1ADQA 4HS6A 4OGAD 5SWSD 1I9JL 3SGEH 3WKMH 3ARBA 3GBMH 1J9CT 1WWAX 2P44B 1RZGA 5HD8D 3U7YH 3SGJC 4RGMB 3NMEA 1WFNA 5AG8A 1GGUA 5CIPA 3MUGA 3RIAK 3SCMD 2DJ4A 4JM2A 1PAMA 1DQLH 4XVSL 1I9EA 4UU9A 4JKMA 1LDPH 2ZUXA 3HI5L 1KXTB 3I2CH 3QEHA 2DMKA 1IZJA 4TRPL 2CO6B 1PVHA 4PB9H 5E1HB 2DYPB 2DI7A 3RRQA 3L5IA 5FIEA 3FB6B 5F6HJ 1K6QH 3S3JA 5I15H 2DDQH 3O3AB 3BPCB 4J8RB 4P23C 3UZVB 2Q6WA 4X6DE 2GSIB 4ZNEE 3CLFH 3CH8A 4RCAA 3QFJA 3ZL4L 3ZKMC 2FIRT 4X6CE 3VD3A 2VXTL 1RZ8A 3UMTA 2APFA 2AV7B 2W0FB 2F8OA 3V0WL 5IB5A 1J05A 2ENYA 4M8VA 4NKDB 4OLVL 3P77A 1E4JA 3SKNA 1K8IA 4N0FB 3ILPB 4PGJA 2F53A 1BD2A 2IJ0C 1YNLL 3OAYK 4P2QE 1A3RL 5FAAA 1A6UH 3GB7B 4UILH 2ZUQC 1CGXA 5T1KB 4Y88A 2FHBA 4HKZA 1WBXA 4PJAF 4QHLB 4APQC 3PJSA 5FHBH 5C0BB 1EHLH 5T1LB 5I1DA 5BXFB 5ICZA 5CGTA 1BZ7B 2H26A 5FOBB 4IOFC 3BP4B 3ZE0E 3X17A 2K7PA 4Z7WB 1U8JA 4JPKL 3BIKA 3I6KB 2BRRH 5IT2L 3DVGB 3KPLB 1ZGLB 2ZCHL 4X4XB 1MCOL 3LEVL 4DKFL 4NZDA 5IVZB 3TVMD 2ZJSL 3FO9A 4U49A 3DUSA 4TN9A 4DUXA 2PF6A 5CILH 2MQ3A 3GZKA 3H9SB 1FO0H 4OJFL 3QO1B 3RPIA 4EUPG 5ESAB 1QLFB 2AJUH 1MWAB 1FIEA 2GJJA 3B8YA 1YA5A 3B5GA 3VFTB 1T4KA 3MREB 3LKRB 4MA8L 5GJSL 5TE7H 5TF1L 5JO5B 3B5TA 1KLFA 3S37L 4I5BB 4RRPG 4K94H 5JOFA 1B2WH 3ZTJH 1EERB 3THML 1DLHB 5SWZA 4Y4FC 3IJSA 4KK9C 4UDTB 2APXA 4WI6A 1MHCA 4JG1H 5H94B 1IT9H 3BPLB 3NPSC 4X6EB 3D39B 3ROOB 1FRGL 4OKVA 3TO4A 1M7IA 3V6OA 4I1NB 3SDAD 1T5XB 2W07A 3EYUH 3U7AA 4GG8B 1S9KC 2VE6A 4HCRH 4XP1L 3NZHH 2HG5A 4OQTH 5GGTL 2C3HA 5C0RH 1S5IL 3CFDB 5IW6B 2HLAA 3BPOC 4XCYB 4JM2F 1H5BB 5IG7A 3DOSA 5TDNA 5EPMB 5HHPA 5EOQH 4KJQD 4WUUB 3VD7A 3E3QE 1WZ1L 3G9VA 3EYQC 1N6QH 1FZKA 3MFGB 1P2CA 3JVGC 1UQSA 3ARED 5F7HA 1D5IH 5EUOE 4OZGA 1Q0YH 2JB5L 4YAQB 3ULVC 1FNSH 2ED7A 2EXYC 1HHGA 5EZLA 5ID0A 5DD1L 5DI8A 1J11A 3TNMA 4RDQF 5GS0C 4M5YH 1WSST 3R0NA 3S37X 1F4AA 5FFLA 2DQFB 1CD1B 1U42A 1MFEH 3MPCA 3T0VA 5E2TH 2XWBB 1MIEL 5HHOE 4MXWH 1QSZA 2DWEA 4JHWL 5DK3A 5AZEL 3I9GL 2XWJA 4EQ3A 1G1CA 8FABB 1U8OA 1CK0L 2ZP0T 3FTGB 2CJUL 5HDQL 5EU6D 1OD7A 4FZEL 2ENSA 3GUTB 1WEJH 5FEBA 1HILB 4DVBA 1QBBA 3O8XA 3ARXA 2DBLL 1CLZH 4NJAL 1QQDB 1KN2H 1IC7H 2BNUB 3JWOH 3KNBA 5HGHB 5MP6L 3D18A 3S35L 4Z8FH 3OKOA 4X9IA 1Q0XL 4NQSB 3ARSA 1ZGLM 4P2RE 1OGAD 4OM0L 1G7JB 4QYOB 2ZWLT 1KCUL 1FLTX 4R26L 4U1NB 5LGJB 3GIZL 1EGJL 1MF2L 2MJWA 4QXTA 5DJCB 5F70A 3TPUA 3N9GL 4JG0L 3RWJA 1MELA 5TQ2H 3BVNA 3AY4C 1ORSB 1CFQB 4G9DB 4ERSH 5DJZB 4UB0L 2FECI 1CQKA 1KNOA 5D7IA 3LQZA 3WE6A 1ZA3B 4PUBL 3O11B 2H6PB 4IMKC 2DQCL 4N8VA 3DBXA 1LE9A 2NY3C 3PHSA 2RJMA 1WJ3A 4Q6YA 4P9MH 2OL3H 2RIKA 4ZUUB 4X7DC 4JFEB 5EDXA 3CUPB 4O2EA 1K8DB 4X99B 1A9EA 4BSWB 2IH3A 3UC0H 5KSVA 3VFSA 1DQML 1IAKA 1JWMA 5FGRA 4XCEB 4WI9A 1YPZB 4S1SL 3UJTH 3U2SB 5IJKA 1EVUA 5HI4D 3RWEA 5C0IA 2N7BA 1NGXA 3D0VA 4XPHL 2BSRB 3OKLB 4CMHC 1S7SA 3MUHL 2NY6C 3RHWK 1D5ZA 4Z7UA 3NCMA 1BVLA 5LQBL 4JKLA 3LSOA 1CGTA 1GH7A 4OZGF 3UJIH 2YMXL 4UT6L 1DE4A 3LB6D 1CFSA 4X6CB 5I1CL 3V4VL 4FQQA 5H37G 4HKJA 4ZUSB 3MRMA 2FEEI 1ORQA 3QUKB 1RUAH 4NO2B 2F58H 4N8CL 1SJHA 3RWFA 3TO2A 5LJYH 4XT1C 1TJIL 2Q7NA 3U0TA 4OZHA 4P49A 1FH5L 1JMXA 1XCTA 5KVFL 3FB7A 4B50A 3BGMA 4GBXD 3I02B 4Y4KD 4U6HA 3LS5H 3BT2L 1KN4H 1FAIL 3MV9B 3JTSB 2WIMA 3FQNB 4BQ6A 2R69L 3MLSL 1C5DA 3OG6B 3NH7L 5T3XL 2NXZB 3VXQA 3MNZA 3DXAD 4U1LA 1YEHL 1E27B 2Q3AA 1DQTA 5ILTL 1T03H 5GS1B 1NLDL 3L1OH 3VWJD 5CKAA 2N1KA 1LMKA 3MV01 4CADA 1U2HA 3VXSD 3RL1B 5DD3H 1V3KA 1A4KA 4X7CC 4QOKE 1OPGL 5JUEL 1IGFH 1R24A 4CU7A 3V9FA 4LLUA 1LEIB 2Y23A 1RK0A 4MZ2A 1JRHI 3Q2CA 2HWZH 1JPTL 4L29A 2W0LA 4DOHE 3F62A 3GKZA 1KPVB 5D6CA 2R2HB 5IK3B 1NDGB 3LKNB 2YPKB 5CINH 4OLUH 5D1QD 1LE5B 3FN3A 3WIHL 3ULVL 1EEZB 4Y2DB 1CLOL 3L5WA 1NFIA 1NGQH 4O9HH 4XB8A 4X8JA 1JN6A 4KGLA 2DJSA 5FM5O 4OUOA 4NQCD 5GS0L 2V5SA 1ZA6B 4UAOC 4MNGB 5CMAB 3GJEA 2HJFA 5DVOA 1KXVC 4KDTA 3BKYL 4BK5A 3QNXA 3D2UD 3QIUB 1KIQA 2BOCB 2F8XC 2VQUA 2D7TL 3L7FA 5MEQB 5EH1A 2V2WB 3MGTB 3HNSL 3E8UH 1AKJA 3OG4B 3FN0H 1HHJB 2Z91B 3QIWB 1SM3H 1UH4A 4I0CC 3HPLA 2X4TB 4JKWA 5KTEH 4TULH 4HK0A 3G5XB 4UT7H 4KMQA 4DW2H 3U4AA 3QI9C 1Q9KB 3H0TB 3A6OA 4M43H 2F5BH 4ALAH 4S1RL 1NDMB 4XP9L 4XAKE 4PLNC 1M05A 1E6OL 2R9HD 1P7QD 4GMSH 4TOYH 4K3DL 2R4SH 3WHE0 2PO6B 3QUMA 4Z7UF 1R0AH 1MJ7L 1OB1A 4QRTB 2W65A 1L6ZA 2ICWA 3G04A 5CGMA 5E9DD 1SEQH 4OLXL 2DLEA 4NZTL 4YX2L 3V4UH 1SVCP 3AU1B 5KVGL 1NMAL 1AI1L 3B2VH 3G5YA 5BVJA 1YMMB 2IPKB 2YKLL 4LQFH 2VZSA 3ARTA 1XZ0A 3EJZD 4JVUA 4LCCB 5FUCC 3VXMB 1ZT7A 4PV9A 4ZDHA 1AFVL 2PYED 1TVBA 4NZJA 2APVA 4FFWD 5HY9B 4NQDD 4WHDA 1WTLA 3D0LB 2E9WA 3AM8C 3L7EA 4UDUA 5ERWA 4EBQH 1UB5A 5I1HH 1W8OA 5L6YH 4Z76B 1I9IH 3AB0C 4P2YA 3L3KB 2R0WH 3U4BL 5AYUL 4PY7B 3WLBA 4LCYB 3IFPB 2PXYD 2H8PB 3C9NB 4LHUA 1ZHLB 4XAWL 3SE8H 1OWRM 1A1MA 1S7XB 1F4XH 1BBDH 3QG6B 3SJVD 2AV1A 5JW4Q 1P1ZA 1N6VA 4HUWA 1W72B 1QFWM 1BGXL 1K2DA 1A4JA 2VR9A 3TH4T 2A9NL 3CU1A 1JGEA 5AUMA 1JZ3A 1IAII 3W11C 2UWEE 1A5FH 2RHEA 4N0CC 2GW5A 5F6IB 4QGTA 2YEZB 4U1JA 4JPVH 3MODL 2VSDA 2Q8AL 3NFNA 4LP5A 2ZUVA 1OAUL 5K9KB 3LRSB 2R4RH 4XGZB 1QSEE 4LKXA 4HXBL 3SQOH 1TTGA 5J7CC 5J1SC 4PJDE 2MHAA 1MCBA 1T1YA 1HKLL 3NIFF 3E6FA 4WO4A 3ZDZE 3OKDA 3VGBA 3OKKA 2IQ9H 3QO0B 2LTQB 4AEHH 4L4TD 1BVKB 3W81A 5DK0A 1SJVA 3KHQA 1UEYA 1G84A 3MJ7B 2X4UB 5MENA 5FYKE 4JANB 1BZ9B 4CDHA 5GZOC 1HWHB 3N0PB 2CRIA 5L7XH 1GGTA 4R4BB 3E1F1 1BF8A 5K9OB 5F93C 5SX4H 1HHIB 2Y1VA 1LP9B 2X6MA 2HVJB 3B9KC 3JUZA 2G2RB 4L9LA 4P23D 1PQZB 3ZHDA 2GQHA 3SDDB 3U30B 2HN7B 3GSNH 3IAQA 3U48A 3ZKMD 3ARGC 2FATL 3KR3L 4LASH 4WFFE 1UYWL 1E28B 4U1KB 5C9KA 2IALA 1QSFD 4PTTA 4LSRL 3MBEB 4YHNB 2GI7A 5C0FB 3CZFA 3JWDC 1JF1B 3S3SA 4MZ3A 4JGJA 5J6HB 4ZUTA 5IM7A 3ETBF 4GW1B 3PWNA 3LDBB 4BQBA 3MV7A 2R0KL 5T3ZD 5LBSL 1FN4B 4UZGA 4NWTL 3EKCA 1Q9OB 4RQQA 4I2XE 3X11A 4BZ2L 3VE0A 4G6KL 4APQD 5HDOA 2BNRE 3X3GL 1ADQL 1K5NA 4L8DA 5D93B 4MJ5A 2XY2A 1BOGB 1NBQA 1LEKA 4IOFD 5I18L 2CLVA 4NNPL 1P9MA 1QEWA 5JXAL 4E0RB 1ZTXL 1NKOA 1F58L 4I0PB 2EKJA 2RFXA 4R0LB 3QDME 4DQOL 3L6FB 3UJJH 4DZ8B 2BY1A 2JIXA 1JHKL 1KPRB 2VRAA 2Z8RA 4F15B 3RJDA 4Q6IB 3JV5A 1YEFH 5DLML 3HKFA 5CHNA 5FO7B 4XMKH 3HUJB 1K4CA 5J06A 1R3IL 2XV6B 4WU7A 4PGBA 1ZK9A 4DZBA 3KDMB 3C8KB 3D3VE 4M6MH 5A2KH 3BP5A 4GKZB 4UMGA 1JYVA 1I8MA 2X41A 1GGCL 4PGEB 5JDSA 3MRQA 1AO7A 1EJ6A 4I48B 4YBQC 5DQ9A 5DJ8A 1JZ7A 2D0FA 4Y4FD 5F9WC 1XF2B 4E9LA 4KK9D 4JREB 5DZOA 3KXFA 1LO3H 1MHHA 2FBOJ 4AMKL 1U91B 1VPOL 5E70A 1C12A 5T3XD 2WW8A 5KN5A 5IB2B 1FFNB 3D85D 3STZB 5B38A 4PD4J 3IETB 2JCCF 1LD9B 1PYWB 2IBBA 2NY2B 2AI0H 4GKNA 4ZQKB 1OL0A 3LMJH 2ZOLB 2EDEA 4PV8A 1U8IA 3WNKA 1F3JA 4PRIB 1TQBB 1EH9A 4HWEH 4CUCA 5K33A 4G5ZH 1M7DA 5J11C 2EEAA 3BJLA 3IKCB 4YXHL 1OAXH 2H32B 3UX9B 1RHFA 4C54A 3VG9C 1IQWH 3PQYE 1UWXK 3EYQD 1OAKH 4U1IA 5IJKC 4ZOBA 2ERJB 4RAUB 2XN9D 1CIDA 4OCYL 4D0CB 1MQKH 1BJ1H 5IHUL 1ND0A 2MSPA 4QRRD 1QBML 1KB5A 1NCTA 5F9OH 1IM3B 1BX2A 1UVQB 4Z6AT 3VFVB 3ULVD 1BQHB 1VKXA 2EXYD 2JE8A 5GRXG 4PJEE 1X7QB 3NIDE 1MREH 3DLQR 4QEGA 3GSXA 4Z5RB 5GS0D 4MNHB 2MCG1 1JUFB 2HT4C 4FQ2H 4NT6B 3RQ3A 3V52H 4LCWE 5FYLL 4NO0B 3VWKA 2X7LB 3RGVC 3F7VB 4PJCB 1C7SA 1RZFH 3PWVA 3IVKB 4YGVB 1KSRA 3WL9B 4X4YA 5KSAA 2VLRA 1TQCB 2YWZA 5DXWA 4WHYG 1OARH 4PYGA 4ENEC 3TBYA 4PG2C 3PWLA 1FNLA 1T22A 5I16A 5C0AD 4P99A 1BVZA 1KTDB 1MNUL 3G6JA 3MRPB 5B21A 3MZGB 4RMWA 4L4VA 4B5EA 5HYSA 3DTXA 5EC1A 5KS9E 4TTDC 5ALBL 3MFFA 3OB8A 1IAMA 5E7FA 2VIRA 3BP4A 4FQPA 2P45B 3VXTB 2HKHH 2O61A 1CGVA 4LQ1A 5KANG 2HTLC 3Q1SL 3FONB 5BZWB 3HRPA 1BAFH 3ARZA 2IFFL 3CH1A 5FUOH 3HE7B 5FYJL 3PDGA 4M8QA 1SJXA 1QFHA 5L2KB 2AXJA 2W0PA 5J8OA 5EO0B 2BVPB 1JGDB 1R3JB 2NNAB 3FCTB 3X14B 3VG0H 4HFUH 4X4ME 2P48B 2IAMB 3DGCR 1KV3A 1IBGH 1CL7H 4YHMH 1C1EL 2D7NA 3IB4A 4IDJH 1UFUA 1LQSR 2BOBB 4Y5XA 2XT1B 4PJDB 3JWDL 2CIIB 4XNQB 4F80A 3TC9A 2OCFD 4KDTC 1EFXB 2NY3D 5FKPB 1IILE 4BYHA 3T2NH 3S34H 4NM8H 4LVHC 4XBPB 3OHXA 4QKXB 2ICWJ 2I5YH 4P5TB 2I9TB 1PKQE 2YD8A 5DRWB 1MI5D 3BHBB 2FLBT 2P47B 4FG6C 4XCNA 4ODWB 3ARPA 1YQVH 2AAVA 2RGSA 3NN8A 3T3ME 3U83A 3WV0A 5FECB 4JN1H 3QULB 1HH9A 2J2ZA 4H88H 3WHXA 4YHZH 4CVUA 1FPTL 5SWSE 3WFCH 3FFCA 2NY6D 3OWEA 2Y25A 2CDFB 4TVPH 4HIIB 4ZFOB 2NX5A 1MWAH 5DMGD 1N6UA 1FG2B 4KHXH 3I84A 4UOW1 2QKIB 3F6IA 5F1NA 5HYJA 5GHWL 1WAAE 3RTQC 2WBJA 4R4NC 3ZTNH 1GOGA 2P5WE 4OGZA 3UDWA 5IW1A 4RWYL 1N64H 1HEZA 1A6WL 4MGXA 4PD4K 1EEYA 1KJMB 3R1GL 5DQJB 2P42B 4GXUN 4HUUB 4BK4A 5IWLA 4I2XB 3AS1A 1KIPA 3HZMA 1X4YA 3BXNB 3RU8H 3PWPA 3BPNB 2KUTA 4M6NH 1F2QA 3CFJB 4QF1B 3G6JF 4MLSA 3ISWA 2CMRL 1MRCH 5CLWA 4K07A 2J8UA 4GJTB 3QXAB 3MRFB 3FQXA 4OCSH 4PGDB 1EUTA 4LLVB 1VGKA 4UOJA 4P3DB 5HBBA 4IHOA 4WV1C 3EFDL 4P57A 1BFVH 2RCSH 4ZUVA 5ICXB 2DLTA 5IR1B 4L1HA 3F12B 5EU7E 1WUNT 1XR9A 1YY8A 3C2SA 2IH1A 4TQEH 2XXCB 3D3VB 4TSAL 5IMOA 2LU3A 3IJYA 4GG6F 3K8LA 2X05A 2YPVL 3W39B 3VXUD 2DIBA 4EI5C 3NPZB 4NIKB 1G7JA 3OAUH 4ZS7L 3FMGH 4YQXL 5KJRL 3S36L 4OKDA 2Q7YB 3VH8B 3BZ4A 1A1NB 1ZHBB 3EOBB 5ESQA 3RWGB 3QXDA 4G42A 3TLRA 3MRKB 1TTUA 4K3EL 1RZ7H 3OKMB 5IVXE 4TSBH 4XPTH 4EIGB 2R2EA 4YDKL 2R2BA 1MRDL 4JM2D 1UM4H 2AEPL 4HIHA 4NRXA 2CH8A 4IS6A 3SGKA 3TH2T 4KRNA 2IBZX 1NAMH 3BQUB 3EDKA 4ZTOH 2ADFH 4JFDB 2ESVB 3KYMA 4PRNA 1P6FA 3SKMB 5I66A 3WIFB 2R0ZL 3L3IA 3F5WB 1R3HA 1FVEB 3PQYB 1ZLVK 3SKJL 1NGWA 3QI9D 2P7TA 4OQ1A 5IIEB 2NR6C 4ONOA 1KULA 5I9QB 2D7MA 3ARFC 2PW1A 4KRLB 3CFIC 1WZMA 1H15B 5ESVB 1CBVL 3AUVA 3IFNL 2ICEA 2F53D 2UV3A 3VMPA 4P59H 2D2OA 1P7KB 3KWWA 1O0VA 3HFML 1TIUA 4XNMB 4W81A 4LCWB 3NCFB 4HH9B 4PPTA 2VSCA 2GSGA 3NCEB 3S36X 4X6DA 5FGSA 5T5NG 4AT6A 4ZNEA 2AXFB 5C2BL 2VDOL 4CN4A 1RMFL 4FQXA 4X6CA 1B0RB 5CEYB 3QUXA 2OX5A 5F1OB 2VDML 1P53A 3TZVB 4P2QA 4KQ4L 2A2QT 3C09C 4GRLA 2UY7A 2XFXB 4PGCB 3LN5A 1WWWX 2H41A 2JKXA 5DMYA 1IEBA 3W82A 4X7TB 4XXCC 1O7SA 3BOVA 4LARL 5IHLB 3P9WB 5EIQA 3RWDB 5IMMA 2DLHA 4DGVH 4FXGB 2PR4L 1RV6X 2J8UF 4JFFD 4U05A 4NN6B 1T7VA 4WHTA 3T8XB 1QNZL 4LEOB 4M7JL 3W11D 5E6YA 2DJUA 4TPRH 4UINL 5FYLD 1A7RH 2DN7A 3OF6D 4EVNA 4N0CD 3U0WL 4LLQB 2NY4B 3BW9A 2X1OA 4IMLB 5ETUB 2A73A 4G8IB 4MAUL 3QHFH 4H8WH 2VYRE 3OJVC 4XCCH 4Y16A 1F13A 1FGNH 3QUML 3PNWB 5BV7B 3E6HA 2Q86A 3X13B 3IYLW 1D5BB 3QXUA 1WK0A 2R1XB 4B41A 1J1XL 4Y89A 1SBSH 3UAJC 3EO0B 5AYQA 3D69A 4OLYH 4Z7NE 3TBVA 3A67H 5F88A 2IQAB 3EFFA 5D7JC 1PFCA 4G6JL 3D1MC 1OW0C 1I8LC 4TNVF 4R3SA 4GSDL 1DJSA 3O3DB 1PKQB 4GT7A 5GZOD 2CLRA 1CIUA 1QBLH 1U93B 5F7EL 5FYJD 3Q3GA 3VFNB 5I74C 5C0EA 3PG2A 1I1RA 3FO1A 4JQIH 5I1EL 4LLDA 3FHAA 1QFWH 2GJZB 3B9KD 4YPGB 5DJYA 1EHXA 3MA9L 5JZ7C 5F1SA 4YHYC 3QWRA 5SWSB 2VLMD 2XXMB 3ARGD 5BS0A 2V5TA 4FZ8L 4NQED 4P5MB 2R1YB 1CTNA 1U95B 3HE6C 3VFMA 1FAKT 5HPMA 3HCVB 5BO1H 1LK2B 1DN0B 4FABL 4NBXB 3V6FB 1I3GH 4FQ1L 1FO0A 4RGNB 1OAYH 1KCRH 5JMOC 5EUOA 1RUQH 4AM0A 5ENWA 5LWYH 4LAJH 5BJTB 3LZFL 1I1CA 1ZVHA 5J57B 2NY7L 1LO2H 1OT2A 3DO7A 3RBGA 3IRZA 2KL6A 1FIGH 4MWFA 3BEWA 2AJSH 4FNLL 4PGZA 2G5BA 1GC1H 1Z9SA 3QDGD 2GAZB 2V7HB 4BH7B 3AAZB 2XQBL 2AXGA 3CC5A 4KHTH 5K9JL 1D9KB 3U7WH 4Z0XB 2WUCL 5DGRA 1PBYA 5HHOA 1N5YL 4U2YA 2ATKA 1S7VB 3S88L 4HCRA 4NFBA 4S1QL 5SV3A 4Z7QE 4OQTA 1JWSB 3B8SA 1ZVSA 3QR2A 1CE1L 4WFED 2FECL 3J7HA