4JRYD

Crystal structure of sb47 tcr-hla b*3505-lpep complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
201
structure length
201
Chain Sequence
ELKVEQNPLFLSMQEGKNYTIYCNYSTTSDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSTLHITAAVHDLSATYFCAVGGGSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title Highly divergent T-cell receptor binding modes underlie specific recognition of a bulged viral peptide bound to a human leukocyte antigen class I molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2013-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jryD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jryD02
3W39B 1AFVH 1KELH 1RUKH 2MWCA 3LH2H 3RAJH 1GIGL 3HPLA 4OI8A 4DGVH 1S9VA 3CXHJ 4NO0B 1DQLL 4Z95H 3VFNB 5DJ0B 2FCBA 4HPYL 4XNQA 4LSSL 2JJTA 3FFCA 2BOBB 1EO7A 1U8QA 1W8OA 3VXOA 4N0RA 4F57H 4LCWB 4PJDA 1JNNL 5GGTH 3V4UH 1A7RH 1SY6L 1NANI 1X5JA 1AD0A 3RWIB 3E2HB 2CDGB 4M1CD 4CVXB 2BNQB 3O2DL 1UM4L 4FQQB 4RQQB 4YIQA 4EI5C 4JN1L 2R8SL 1HYSD 3LQAH 1AQDB 1S8DB 4WDIA 4OLYH 3QAZB 3GHEH 3V52H 3W9EA 2ICWI 1UWGL 1MWAH 3GSQA 4JRYB 3WIHH 4ZFOB 3RZCA 1R5WB 2ZCKL 3VRIA 3GSRB 3TN0B 4MMZC 1ITBB 4POZC 3RBGA 3I3DA 4FQPA 1JGDA 2R1XB 1UADC 5C09B 3FQTB 1DSFL 2O5ZL 1BD2D 4XMPL 5E9DA 1FYHB 1DUZA 3VFWB 4FABL 3CK0H 3CH1B 2WIIB 1NGWB 3IDXL 4PBXA 1QFWL 3Q1SL 2GJZA 4UT6H 5J56B 2NX5B 1OF2A 3LN4A 1JYXA 1U42A 5I8OH 4F8TA 1ACZA 2YC1A 1A2YA 3BPCA 2MCPL 3CVHH 3IDJB 1FJ1B 1CVSC 4ZYKB 5BXFA 5E6IA 1JGVH 3HZKB 2MNUA 2EYRB 5HI5D 3QISA 3OJDB 1BVKB 4WU7B 4J6RH 1BD2E 3EDFA 3EDEA 5D7LB 5DMKB 2DWDA 4K7PL 8FABA 5C08B 5DS8B 3C6LA 3MGAA 1WBYA 3QUYA 2A0LD 5FF6A 1FQ9C 2V9QA 1OB1B 4O2EA 4OCWH 3O3DB 1BZQK 3SDXB 1SY6A 4TNVF 2NTFB 4ALAL 4LSTH 1IGML 4LPXA 4LIQL 4NM4H 1HEZA 4K23L 4FQIL 3VXPA 5IKCB 4BKLB 2H8PB 5TF1H 4PLKD 1XEDA 1VADA 5E2WL 3VMPA 3TH3T 4KTEL 5A2FA 1MFBH 3LHPL 4LHUB 3BKYH 4QNPF 1MCIA 2C4FT 3JUZA 5JW4Q 3D2UA 3W82A 4PRAB 3WHXB 3WSQH 3H3BC 2XT1B 2H45A 4FQJH 4PPTA 1VEPA 3HRZA 5HJ3A 2YPLB 4TVPH 1KPRA 3EO9L 1OSZB 3W2DL 3MLYH 1YQVL 4Q0XL 1AJ7H 3MO1B 1ORQA 3IRPX 2FHBA 3GK8L 5KZCB 1AGCB 3L3HA 5GQBA 5KOMC 2P5EB 3TO4D 4I0CC 1HQRB 3TT3H 3ARGB 1KIPB 2R69L 1RZ8B 2WM0A 3H9SA 1FNSL 3TNMA 1HCFX 3OAYK 3BSZL 4IRSC 2Y07L 1T4KB 5GS1A 2R0LL 3UPAA 4QF1A 1RK0B 1S3KH 2PYEB 5T3ZL 1UCBH 3GBMH 3CFEA 4NQCD 5AD0B 4U6HA 2HFEB 2VL5A 5ITBH 5JPNB 5T5NG 5E99H 3TBWB 4XAKD 2GTWA 4HV8A 2HKFH 1A9EB 1RVFH 2YA0A 1F4WH 4ZUTB 2BMKA 4O4YH 2AAVA 4ACPA 3F7RA 2NYYC 4HD9A 3SCMD 1A6TA 1JNJA 4XPGL 4L1DA 1V3MA 5LWYH 5KSBA 3VW3L 4ZODA 1OAKH 3KYKH 4XC1H 3GJFH 4JFYB 2Q86A 4K7PX 3MPCA 5DJCB 4NQCE 2JCCA 1FVDB 1ZVSB 2I9LB 3CIQA 3MOBL 2GITA 3PDOA 4MGXA 3IDNB 4XCCL 5JZ7C 3QNYA 1AKJD 1NC4B 3QIUD 1BLNB 5DEFB 1U8JA 3ZE2E 2FJGA 3TJEL 3QT2A 3TA3B 1FHGA 3VA2C 1N8ZB 3RGVB 5FCUH 1Q1JH 1Q9KA 2A77L 2JJSC 4HQQH 4F9LA 1IGIH 5MEOA 1OPGL 3D25A 4G8GD 3BPLB 1PKQB 4IS6A 4JFOB 3EOAA 4LLAA 3S4SA 2CK0L 1CFNB 4EUPH 1JYWA 4Y4FD 1TETL 1P4IL 4MXWH 1GPOH 1PLGH 5I8KH 3BZEB 4XXDA 1U8HB 4GJTB 5TH2A 1JWUB 2FJHA 3QCTL 32C2B 4ONHB 3S96A 1ZLSL 3WUWB 4F37K 2H3NB 4RBPH 4G8GE 2EE3A 2NY0B 3VXRA 4OTXL 5C0CD 4OF7A 1I1FB 2YD5A 5BZDA 1EFXD 5JIHA 2WW8A 4K71B 3QEHA 4NZRH 4HKXA 4NQVA 1FC1A 4ONGH 5C3LD 2CD0A 1JYNA 2X4NB 4XWOC 1YYLL 1ZT4A 3ARDB 3FQXB 2P4AB 5ICXA 4OZIE 2JELL 2X1OA 1MHCB 1M7IA 2XN9A 3OKNB 3PWPD 1RUAL 2BHZA 3FQRA 2BSED 2WBJB 5KANG 3U83A 2JE8A 4JRXD 4TUKL 1T1XA 2C3VB 2GTZA 5ICYB 2O26U 3CSBA 4YHZL 3LY6A 4YAQA 5GGUA 1F90L 4XNZB 1XF5A 1MCRA 4PJCB 1NGPL 4DQOH 3QO1B 1NMBL 1MWAB 4PG9B 4OCXH 1HHGA 1NQBA 3QIBC 4LNVA 3QUZA 1UVQB 3K1DA 3PWPE 4OBRA 1D6EB 4L4TB 4FA8A 1D9KD 3BGAA 4KUZL 1G0XA 3U0WL 4JRXE 5HYSA 3QO0B 4GW1A 4X7EC 1INEL 1ED3B 1AXTH 4Z6AT 2WMPA 3GHBL 3UBXA 4U1LB 4WHDA 3KLDA 1ZHKA 4Y1AA 4EIZC 5EIVA 4JANB 3HNVL 2IAMC 2BDNL 2C4FU 3L3IA 4Z7NF 1JUFA 3CVHB 3DETC 1J11A 4R96A 5D93B 5DJ8B 1KTDB 1LE9A 4DGYH 4QHLA 5DFVC 3QXTA 2UZIH 1YECL 3UDWC 4BH8A 4HGWA 1YYML 4V1DB 1IAMA 1U3ZA 1S5IL 3DTXB 3PV7A 3GB7B 3I6GB 3HLAB 1FV1B 3TGXA 2WWMD 2RAMA 4HHAA 2V9RA 3QWQB 3EOTH 5INDB 1DBJH 4NNYB 2XY2A 4G43B 1GAFH 3NCBB 2WLZA 3TM6A 1U2HA 2H32A 1U2CA 2PCPA 5J9PA 4AEEA 3LKRA 3L5IA 3GBLA 1KEML 4OZGA 5DO2D 4QKXB 5HHOA 2F53D 3OB0H 4OV5B 2OXGA 2DBLH 4FFYH 3ZL4H 4KK9C 4Z7WF 1E4JA 5J06A 3QDJB 4NWUH 2OJZH 3K7UA 4L4VD 1CD1A 4K8RD 1QFUL 5IB4A 4M9OA 2PO6C 1AO7B 4APQB 2WQ8A 3BP6A 4LEOA 3C8KB 4M6NL 4X7TA 1OAXL 1P4LB 5EZOH 3JVGC 4DKDC 1TNMA 3LDBB 2BJMH 2F53E 3PQYB 4MXVE 3N1MC 3ZE1E 1HHKB 3U9PH 4JZOA 1MAJA 15C8H 1GHFL 3SPVB 4HAGA 3HRPA 5IHZA 3T1WA 1DBKL 1YDPA 5DI8B 2Z93B 5DRZA 1A3LL 4N1EA 1R3KA 4L4VE 1FZMB 1TVDA 2UV3A 4P3DB 1T1WB 3TA3C 1XAUA 5SX5H 5J11B 3MV8D 3RGVC 4BSVA 4FXKA 5IROA 4PV9B 2C26A 3B9AA 1KLGB 1IAOB 3DHJA 3PDDA 4UV4L 4P23A 2R0KH 4OGXH 3BP4A 1MHEA 3MGOA 3RP1A 1RZJL 3U48A 3VDBA 2YS4A 4Q9RH 1F58H 5F3HB 2VZUA 1E6JL 2Y4SA 3MLWL 5CEZL 5IMMB 4X5WB 2Z8VC 5T1LA 2XZQL 2BNRA 4IJ3B 1NBYA 3MV8E 1NEZA 3B2UD 3GJFB 1XR8A 5JOFB 1A4JA 2AEPH 1NC2B 4OBSA 4IRJD 2FGZA 1Q0XL 2R29H 4ZXBA 4M5ZL 1MFNA 3LSOB 1P53A 1ZEAL 4K2UL 1HOCB 4G8EB 4HFWB 3EO1A 2EZ0C 3M17A 5C86A 4P9MH 3QXDA 1YEDB 2CR3A 4NUGH 4XCFL 1REIA 4XGZA 4E42B 3MODH 4PLNC 5HGAA 3BUYB 3MRFB 5J13C 2Z35A 5HYQB 1WWWX 1PQZA 3W0WD 1CICC 1HH6B 3GSOA 2WBJC 4EUPB 4Y7MA 3REVB 5E5MA 1AP2B 5T1KD 2IBGA 1ZXQA 4GRLD 5TPWL 4KFZC 4F7TA 3M45A 1B2WL 5D7JB 4OM0L 1JNHB 1EGJL 1F4YH 1MCHA 2V5RA 4K9EH 4Y5YB 4JFQA 1TDQA 4AH2B 1KCRL 2C3HA 5IHBA 1K6QL 4ZS6C 4RWYL 3L3OA 2IFFL 3AM8C 4NQEA 3RDTA 3MREB 5D1QA 3W0WE 4R4NC 4KKAC 3WNNA 1QSEA 4MQ7B 3MLPA 1KYOJ 4GXUM 2MPAH 4ONFH 1OAQL 1XGPB 1G7LA 3CCHB 3HFMH 1BEYH 3T65B 2ATPB 1T1YA 5C6TL 1W0WA 3HR5B 3OKKB 3OPZH 4AM0B 4B50A 1FSKB 3V6FA 1EO8H 4JFFB 1NANH 4CDGC 2FH6A 2MQ0A 3R06A 1C8PA 3P4LA 5ID1A 3QIWA 1YMME 3FN0H 3QDGB 2BVOA 1A7NH 3FB6A 4XAWH 2IMMA 3TZVB 1FLRL 1DL7L 2B2XL 1QKZH 2EDQA 5FIEA 4JZJB 1BZ9A 4JR9H 2H9GB 43C9B 2CR6A 1N2RB 2B1AL 4U6XB 1ZA3B 5FHAL 5JR1L 4FNLL 4WI3A 3MZTA 1IJ9A 5E7FA 1BM3L 3MRNB 1Q38A 4RSVA 1KG0B 3MA7B 1U91A 3R0MA 3NVQA 5F7EL 2QR0A 4Z0BH 3ZKMC 5IHLB 2WSKA 3QPXL 4JQXA 4NWTL 3UPCA 1TZIA 3KWWA 2SEBA 4LPCA 4W6WB 3B8YA 4APQC 3LKOB 1MEXH 5HHVL 1NGQH 5DMYA 3CLFH 2V5TA 3F7YA 4M93B 2JIXD 4AG4H 4NO2A 1CFVH 5F7NC 1UM6L 5EB9A 3X3FH 1J1PL 4YC2B 3O3AB 3FQNB 3R0NA 2DIBA 5C3TA 3RWJA 4U1NB 1IZKA 3I02B 3WUWG 3B5GA 1Z2KA 3MV9A 3ZE2F 3QZWB 1RU9L 1T1ZB 4OZHE 1K8IB 4GAYB 1P4BL 3X12B 4P2OC 4FQ2L 2J6EH 2Y36L 1T22A 5MERB 1JPFB 4ZNEA 1CYGA 3DBXB 3IU3B 4LASL 3DX7B 4MD5B 2BFVH 3JV5A 4TYUA 4NRXB 4GQPH 1AR2A 1CGWA 3WIFB 2UWEE 3ULUH 1JTTA 1V5JA 3BAEL 3LS5L 3PL6C 2P44B 4UOW0 5J6GA 4J4PD 1FVCA 1IAIH 4PRHD 1BX2A 4IJ3C 5DTFA 2EXYD 4XB7A 3MBXL 3RBSA 4WUKH 3K4DA 5I9QC 3DYMA 5HD8C 3GIZL 4MJ6A 2B4CC 2F58H 2ZUSA 4BK4A 4LKCA 1MRFH 1G0DA 2YPKA 1DCLA 3O11A 3PV6A 3GIVB 3TBTA 4L9LA 5DHVA 1QRKA 4IRSD 1G7PB 5EUOE 5GRXG 3EYVA 4PIRF 3DMMA 4JN2A 1WSST 2Y7QA 4PRHE 3RNKB 1PVHA 3O4LB 4I18B 3H0TB 2ZNXA 4HS6A 3H7LA 4MNQA 4OZIF 5IQ7L 3JV0A 5FO7A 3QDMD 3KR3H 3GSWA 3JXAA 5FYKL 1MVUA 1IKFH 1OTSD 4LRIC 1KULA 1SHMA 1CN4A 4LVOB 1YEGL 3KJ6H 3SKMB 2GCYB 3S37H 5BQ7B 2NYYD 3G6JB 5D7JC 1UCTA 2VLKA 4XX1E 4Y5YC 2EEBA 1F4HA 3OJVC 2GY5A 3G08B 4HUUB 1XR9B 4NJ9L 3V0AC 4OGAC 3QDME 1FLTX 2AABL 3SDAC 5JZ7D 4I2XE 5ID0B 2ILLA 3BPNB 4LARH 1GGBL 1JPGA 1UWXK 2JKXA 3HAEA 3T0WA 2XZAL 3S35X 4XPBH 4NO0D 4FXGB 2HLFC 4P59H 5CILH 1L7IH 3EJJX 5J6HA 4Q6IC 1X5FA 3KHOA 4JY6B 1NJ9A 5CEYA 1CE1H 4AJ0A 3T4YA 4LCWD 5DUML 3BJ91 1YNLH 3KYAA 2IH3A 5HSFA 5ILTH 1FSKC 4LCIH 2BNQD 4ODXA 3O6FB 3BI9X 2HVKB 3VWJA 5E8DL 3FO0H 2D31B 2NXYC 3F7VB 1MJUH 3CMOL 4M7JH 4NN6C 3ZKXB 4F33A 2DS4A 5C0RH 1IGTA 3FRPG 3QQ4B 3MLUH 1S9WA 4KGLA 3TZVC 3F62A 4JRYD 4GT7A 5E2TH 3UJJH 4NFCA 3IS0X 3ZTJG 4LCWE 1E0OB 4JAMB 5IIEA 2HFGL 5EN2B 4S1DC 3TN0D 3S7GA 4ORGA 3GI8L 2BNQE 5C09D 2HMIC 3GKWL 1IT9H 1FNGA 4HZLA 5BW7A 4NBXB 4UIMB 5EZJA 5ESAB 3CFBB 3V5KB 3I50L 4KHXH 3VFSA 3U4EB 5L2JA 4XWOD 4HSQA 1LQSR 2Q6WB 5HPMA 2NX5D 3HC4L 4HF5L 4O2FA 3IJSB 3MLSL 3OBAA 1CLOL 4JRYE 4AT6A 1AXIB 2ADGB 3BX7C 1ZT7A 1LILA 1QO3B 1ETZB 2ED9A 3MRBB 4BUHA 2O93L 4P5KA 4Y8AA 4S1SL 2RQ8A 1GZQB 3THML 5GIRB 5KVEH 4NN5C 3NCYP 4ZUUA 4M93C 4JG1H 3ZE1F 1UACL 3PWNB 3Q6FA 4M43H 3UO1L 2QQNL 4LOUC 4H20H 3RL2B 5C08D 3DROB 4WFHD 4YC2C 4KJYB 4KVNH 4I13B 1JGUL 2ICWB 3CX5K 2NX5E 4KAQL 1C5DB 1R5IA 1SM3H 1ZLUK 3DRTB 4G5ZH 4XPTL 3T04D 2BVYA 4NZJA 3MACL 3OAZH 4ODWA 3GEWB 3BGMB 1NFKA 5L2KA 3PNWA 3KPNB 3B6SA 2BHYA 4JM4H 1HQ4A 3HG1A 1UQSB 1NSNH 3FO9B 4N8VA 2FO1A 3SGDH 4EBQH 4Y19D 5C08E 4LHUD 1AC6A 1BREA 5HVHC 2A6IB 5ACZB 2IADA 4L8CA 3DETD 4ZO7A 3QUML 3DVFA 3VGHA 2J5LB 4BZ2L 2Q8BL 4N0FB 1NCAL 4CUCA 4FFVC 5DFVD 1G7MB 1E28A 3SDXE 1JV5B 1KN2L 1A22B 1S7QB 1ZHBA 2YPLD 3GMMA 4PP1C 4R90H 4XVUC 3ZSSA 1U8MA 1L0YA 4PY7B 2EDOA 2VAAA 1IEAA 4TRPL 5E08L 5FA4A 2DQDL 3CDCA 2C7UB 5KZCD 2Y6SC 5AZ2H 1MNUL 2DWEB 1S7RA 2P5ED 3R8QA 4Y19E 3LD8C 3ILPA 2DKSA 3UTQB 2HAZA 4HT1L 1KPUB 5DD3L 2GYSA 4YNYB 5DHYB 1OWWA 2EYSB 4XP1L 4JGMA 1MRDH 1CR9H 3A6CH 2PYED 2YPLE 4GS7B 4JB9H 3GNML 4KK9D 3U0TA 1E27B 4X4ME 5IFAL 4HLJA 2UVEA 1XH3B 4NRYB 2G5RA 1BBJA 1BOGA 4MSWB 5F21B 3ALWA 12E8H 4O9HH 4OCYH 4PGBA 1Q9OA 2YD9A 4AEFA 5HYJE 5I15L 2P5EE 1EJ6A 4F7PA 3STZA 2YKLL 3MUGA 4KPHL 3VRJA 3HUJB 2Z92A 4HWBL 5D2NB 3DX6A 3SGEH 1SBSL 1J12A 4FMKA 3MLVH 2IG2L 1CXIA 5F7DA 4X6FA 2PYEE 3FO1B 3VI4E 3TCLA 4D9RD 4B7LA 4Y0GA 3FN3A 4QXTB 4N1HB 4OD1H 1VGKB 5FOBB 5CKGA 2ZUYA 3T2NL 1CL7H 3D0LB 2YXFA 3BPNC 2F5AH 1CD8A 1J0KA 1NC4D 2MHAB 4L8DB 43CAB 1BFTA 3MFFB 1KCVL 4ZTPL 4PLJC 2DOCA 3TA3D 2X1WL 2X4RA 4HIEB 3EW3B 3B9KA 3QUMA 3NA4A 4PG2A 3AUVA 1T7YA 5FDWB 2C1PA 3RGVD 3S9DB 3SDDC 3DRQB 1LE5A 3I6KA 4NOFA 3CFIC 2X4TB 5JNYA 4D9RE 4N8CH 4C56A 3GRWH 1OCWL 3S36H 5T33L 3MGTB 3WNLA 1KFAH 1MVFA 4MAYB 1PYWA 1YEIL 4Z7WA 4FZEL 3CJJA 4M7LT 3BD4A 4U1GC 1GJIA 5IB2A 1G9ML 1J05B 1HIMH 4L3EB 2DJUA 4P57B 3AROA 3ROLA 2F5BH 1I7UA 1FCCA 2Z0BA 4KUCD 5IEHA 3T2OA 1RUPH 3FHAA 4HUXB 1NLBH 1DANT 2X4UA 1X6LA 3RVUC 5C9JA 5IWLA 2AJYH 2LVEA 3VFRB 2NY0D 5HTSA 5C8JB 2XQYG 1PKQE 4D0CB 1TJHL 2NXZB 5D4QA 1JZ7A 3OV6A 4MDJA 2EZ0D 1F45A 3G5XA 4ZPTA 4HWBA 3SDYH 2ZOKB 5J1AA 4RAHA 3M8OH 3ARDD 3CDGA 1EMTH 4S2SB 1Q72H 1CXEA 5E8OB 4NQSA 2FR4A 2BVQB 2HJLB 1DJSA 4YK4B 1AI1H 2HN7B 3TPKA 3LMJL 5EU5B 3HE7B 1CICD 3FRUA 3FT4A 2WBJD 3QJFB 5DLML 5DJZA 5B21A 1ZLVH 4M6AA 3MXVL 3VJ6A 2YN5A 3BT2L 1OAYL 3H7BB 4XP4H 1E4WL 1FN4B 4Y5XA 5I1EH 1CF8H 3VXQA 5DRWB 5E94A 4ZS6D 4UINH 1EJOH 1KLFA 3IXTB 4L4TD 4OZHF 4YDIL 1V7NL 4R4ND 4GKSB 4KKAD 4MS8C 3F5WB 4YEEA 5DDHA 1HHHA 2VABB 1OWRM 5KVFL 5ALBL 5JORA 1T80A 1MIEH 4PJCE 1MCSA 1IZJA 1BQHB 2YUZA 3STLA 2XWBA 4ZAKC 3T0EB 4PJEB 4QRTA 2W65B 2I26N 2VH5H 3IGAB 4WWKB 2CKBH 1MI5D 2YRLA 5DJYB 5HGHB 4JG0L 5F97E 2J5LC 1IM3A 5ELIA 1CVRA 4DUXA 3PWVA 5CINH 4L4TE 1MELA 1EPFA 5MEPB 2OK0L 4V1DD 1JF6A 1IGJA 3IXAA 3QCUL 5HHXL 3P4NB 3DV4A 2FATH 1RK1B 4R9HA 1N6UA 2K3TA 2DQIL 2HH0L 1ES0A 4W6YB 5JXEC 4ONOA 3VH8B 1BD2A 2JTDA 4Y5VB 1MI5E 1MJ8L 4O2CB 3ME0A 3RZWA 2PXYB 4U1KA 4X6EA 4M62H 4V1DE 5F9DC 3ULVC 3JWDL 3QDJD 4PGDA 1J8HB 1U92B 3F58H 4TUJB 1J7VR 3ZKMD 4YQXL 3QP3A 3ULUC 5LAXB 1L4IA 1N7MH 4K3DL 4Z76A 2ARJA 8CGTA 2QSTA 1AO7D 4APQD 3SOBL 5TE4H 2AK4B 5IJVB 4EN3B 2J8OA 4TVPD 5K59E 1L7TH 1UWEH 4BZ1H 5BMFL 3F7QA 3PQYD 3VGFA 2LAGB 2HG5A 4OT1L 1R3LA 1M05B 4PJ8B 5GGVL 4H0GA 4KZEH 2HKHL 4XC3H 3QDJE 4RAUA 1FFOB 1AIFB 4UILH 3A6OA 3FONB 4JKKA 4XB8A 5BJTB 3GGWA 3BXNB 3L95B 3IFPA 4LQFH 4C57C 2DQTL 1NCWH 4YXLL 1AO7E 4N0CC 3P77A 2BSTB 2W59A 4WW2B 4R7DA 3SDCB 3UTZB 1U8PA 3FCTB 1PW3A 2VDPL 3B9EA 4G3YL 1HSBB 3BZ4B 3QULA 5FGRA 5D71L 5AYQA 4M7KH 3WLWC 3G6AA 4RNRB 1H3PL 1AD9A 1DTUA 3WS3A 4ZO6A 1U8LA 2VC2H 1D6VH 2XA8L 4P49A 1M7XA 3BDBA 4XCEA 1QYGH 2XQYK 1QLRA 5C6WH 3T0VA 4Z7VE 5BVJA 2G2RA 4E5XB 2FX7H 3TO4A 1J18A 1HINL 2AQ3A 2NY7L 5DYOA 1U93B 1NC2D 1M4KA 1IGYA 1EUUA 1DANU 5HD8D 4XP6L 4HK0A 2ARJQ 2C3WA 1T0NA 4YDJB 2VITB 5KVMC 1KENH 3NGBB 2VMFA 2EDEA 4V2CB 2Q76B 2HRLA 4K07A 1U6AL 5CD5C 4JHWH 4NQCA 3W9DB 3SE9H 1JF5A 5TGBB 4MAUH 4Y88A 5K9JH 1I1YA 1E4KC 3SGKC 1DQML 1U8KB 4HKJA 2EKSB 4YK4C 4YHKL 3HE7C 1IGFL 4PRDB 3SCMA 5JLZB 3A6BH 4BQCA 1DLFL 5IGXH 1ACYL 2IFGA 5I0ZA 4R3SB 4B41A 1WWBX 4BSWB 5D7JD 1IQWH 3O6LL 2P5WD 1HHJA 5E6YA 1AKJA 4O58H 3QIUA 3EJZD 4R4FL 1BIIB 1DE4A 1GOHA 3L3DA 4H1LH 4OGAD 4OLZL 4NQXB 5I17B 1IKNA 3SDAD 2A74A 1JGLH 5GGRB 4MDIB 2BY0A 3CDYA 2EKJA 1AQKH 5IMOB 2XG5A 4G8GA 1KCUH 3UZVB 3T0EC 3EOYG 2P5WE 3QA3B 2GK0B 1FIGH 4WWKC 5C0DA 4Y4FA 5F9AC 4HIJA 3T3PE 1JPSH 2BRRL 5DUPH 1F11A 1Z9MA 2CK2A 5DJ6A 4JFFD 3SDXF 2R56H 3MRHB 4OF3A 5FA3B 4DTGH 5K9OB 1GZPB 1G9NH 5H35B 3QDGD 5CSZA 4H8WC 4F2MA 4HC1L 1RURL 1WC7B 3TIDA 4TPRL 2I27N 5E2UH 1I8MB 3TZVD 4QOKB 5C0CA 2ZP0T 1K4DA 2HRPL 4KRPC 4GAFB 5C0FA 3MRMA 4CW1B 1EFXA 4Y5VC 4S1DD 3X11B 3LZFH 2DMCA 2VDKL 2HMID 4JFFE 4POUB 1GGIH 4KDVA 3MV7B 4OLVH 2NY5L 3IFLH 3JTTB 3PWPA 4U1MA 3QDGE 4NYLB 1RJZB 4JRXA 2EH8L 3MOAH 3KYMA 2CKBB 4G8IA 2A6DB 1A6UL 3VG0H 1EVUA 3WKNA 3VXNB 2Y72A 1Q94A 1NCUA 3OR6A 1W0YT 1A6ZA 1BQUA 1K8DA 1LO2H 3U6RA 4EN3C 3CLEH 3P11L 3EYSL 4LSPH 4QYOB 2OTUA 4K8RL 2WAHA 1F2QA 3NCYS 5JHLL 4PJ8C 1CLZL 3HC3H 4LOUD 1A5FL 1DEEB 4NZUL 1KIRB 1VFBA 3D85B 3QRGL 4MLSA 4JEGB 4JQIH 4Q74A 1D9KA 2HFTA 1DFBL 5CEXB 4UT7L 1JJUA 4NPYA 2OL3H 2AXJA 1BMGA 4R6UA 3VFOA 2D03L 4HBQA 4YHIA 1GYAA 4OKDA 4LSDA 4WW2C 5HHQB 4TSBH 3SDCC 4DVRH 2LFGA 4F7CA 4LU5H 2DIJA 2R2BA 2QV2A 5TQ2L 4Z7QE 1M6OB 3C6LC 3QNZA 2LU7A 5EIIA 1ONQA 3OXRB 2FGWL 4OB5L 4UV7L 4QRPB 2V2TB 5F1NA 3GJEA 1Z3GL 4LCCB 1YPZE 3DECA 3VXTA 3V5DB 3QH3B 1B6DA 3OKOA 5GS2H 5I1DB 1I9RL 2Z8SA 4FFVD 3S88H 2ZG3A 1YEKH 4JHAH 4P5MA 5B38G 3S34L 4XVUD 5E00A 4PP1D 5JXAL 3VFMB 4PJ7B 3ESVF 5CUSL 2YR3A 3DX9A 4XPFH 1IBGL 1HDMB 3IFNL 4NRZA 1MCFA 1JE6A 1UGNA 1B0RB 4ZNCD 3CSGA 3TV3L 5ACMA 3B9VA 5HVGB 5DMIH 2CIIB 2F53A 4OQ1A 3BRGC 3BMWA 1S7XB 3NGBC 4L8SA 4R8WL 3CUPA 5I0DA 3BMVA 3BQUB 3FTGA 3O4LD 4G80B 3CFCL 4XH2A 4XNXH 3LEVL 4L4VA 4UB0L 4KUCF 4JKWA 2XRAL 4GW5A 4HULB 4ISVB 4QT5A 3RWEB 1IFHL 3VFGH 5DRXA 1J0YA 2KBGA 4NHUB 3VI3E 1WCBA 4WV1B 1G7IA 3OGCA 4H0IA 2W0PA 2OR9H 1X4YA 5GS1C 2ZJSL 2VB5A 1XGYH 2G5BA 3AU1A 4I77L 3LQZA 3TC9A 1F8TH 4PREA 4NKIH 3VXUB 3O4LE 5FYLD 1G6RL 3HI6H 4QCIA 1KBGH 4N9OB 3LRHA 4ZUVA 4L5FL 2VXSL 4NQTA 1X5YA 3MV8A 4X99B 1FNEA 1T20A 5I66B 4PLJD 3VH8G 1T0MB 1NUGA 2VXQL 1RQ5A 4PJCF 4JFXB 2ITDB 5EO1A 1NGXA 2P8PA 5IMKA 2NY6C 3QB7C 5FYLE 4G7YL 4NBYB 3DIFB 4UUJA 3EHBC 4OCRH 4OQTL 2R2CA 4C55A 4OF5A 1SYVA 1V3LA 2AJVL 3GSNA 3HCVB 2XWJA 3ES6B 2DI9A 3IDIB 1H0DA 2FX8H 3DLQR 4IRJA 1A6AB 1BZ7A 3H9ZA 2A6KA 2NW2B 1FAIH 5DZOA 2VXUH 3X3GH 3BWAA 5F7KC 4H1LB 3RWHA 3RVUD 2HVJB 2BXZA 4P5TB 4WW1B 1BWWA 1FZJA 2FB4H 1C1EH 2P8MA 4QXUH 3K4AA 3OZ9L 5BO1H 1KCSH 1BJ8A 2BVUA 2WBKA 1IQDA 2AQ2A 4YPJA 5IT2L 3S35H 2VDLH 3W0WA 4DUWA 1OM3H 1JFQL 2NLJB 5DJ2A 2R1WA 1F2XK 3FB7B 1CTOA 2AJ3B 5F7UA 5T1KA 1A1MA 1WBXA 4KVCH 1F02I 4XVSH 4G6JL 1G6RA 2R0ZL 4GRLA 2P49B 3G6DH 3WXVL 3PGCB 5CZVH 5IW1A 4HLZG 2XKNA 1CGSH 5K59F 2DKMA 1F3JB 3C9NA 2VDNL 3L9RB 4HIHB 3A67H 2IALA 3X13A 2K7PA 3LCYA 1CDIA 4HZAA 2X2YA 4GW4B 2F74A 4JY4B 3SKOA 1RFDH 4BM7A 4NZTL 2FHCA 4XCYB 5L6YL 1JZ3A 1T5XA 2C1OA 4MS8D 4OQTA 4XMLL 5T5FL 1S7WB 4O5LH 3RKPA 7FABH 5IM7A 5LVEA 3VRLE 4X4XA 2DRUA 5F1OB 1DQJA 1ZMYA 5HGDA 5DEZA 5I30H 5KS9B 4KK6C 5E8NA 2ENSA 5EU3A 4AEIL 2VDRH 3I2CL 4K3HA 4WEUD 1XCTB 3RWGB 2VSDA 4NP4L 3VWKB 3O3EA 1R3IL 2C4XA 4Z7VF 1WWAX 2F19L 2CLRB 1CE6B 3K8KA 4LK4A 3U9UB 4MZ2A 4CVWA 2FRGP 4OAWB 4X9FA 3IJHB 3OXSA 5DSCA 5JXED 4NT6B 2HFFB 1Z9SA 4X0KA 3TH2T 4YR6A 4PP2B 3ZZ1A 3L7EB 1NBZB 2CDFA 3BQUC 5E8EB 1TVHA 3TJHC 1JCKA 4LLYA 3L6FB 5KW9H 4H88H 4MZ3A 1DLHA 4GMTL 2QADB 3O4OB 1IGCH 4OZHA 4BFIB 5A1AA 1S5HB 3KPSB 3ULUD 4EOWL 2E9WA 4X7DC 1LNUA 4QRQA 2JIXA 4HFUH 5A43C 1CBVL 4DZBA 1EAPB 1N5YH 4XVJH 2UWEA 3C08L 3T0XA 5EFIA 4M1DH 1FL5A 3RX8A 1T2XA 4W6XB 3HNSH 1GGCH 1R3HA 1EEQA 4LBEB 4OFVA 4C4KT 1NKOA 1FZKB 1EEYA 4L8BA 3ULUE 3MYJA 5HI4D 1FFPA 4YWGH 1XF2A 1BF8A 1VKXB 1FCGA 4XNMB 5GSVA 4JPKH 2PW1B 2OR8A 3L5XH 3HUJE 4N0CD 4P9HH 3E8UH 5IBTH 3CGTA 4PFEA 4G7VL 4ZSOB 2BHUA 4NDMA 5JQHC 4W81A 2HT3C 2XQBL 4ZFGH 5MP6H 5EBMB 5EUOA 3T3PF 3WLWD 5CJ8A 4JREB 3MBEB 4J4PA 1ZAGA 4PRHA 4YHMH 5C0EA 3CFJA 4CRPA 3GSXA 1S7VA 3VFUB 3PHOB 1YJDC 4L3ED 35C8L 1ZSDB 1UXWA 2K9UA 5IROC 1M71B 3U79A 1HKLH 2FEEI 3C6SA 1U9KA 1W2KT 2EEAA 4IRSA 3DGGB 5I16B 3IVKB 3WEXA 3PE9A 4ZFOL 5D5MB 1OLZA 3J7HA 2ICCA 5CD5D 3TYGH 3NIGE 4C58B 1MF2H 1YEEL 3CDFA 3QDMA 1FGNL 1A7QH 1NCDH 5IEKA 2BVPB 4I2XA 1CGYA 4L3EE 3WCYA 3RWDB 3F7PC 3KNBB 1MHPL 2W38A 1EDQA 2FECL 4YHPB 5TDOB 5IFHL 3HE7D 4N0YL 2EDWA 5HY9B 4UDTA 1XGTB 1WZKA 4NKOA 3HN3A 4ZUWA 1KTLA 5EORH 4I3SL 1QR4A 5A16B 4F7MA 2DM2A 2YMXH 2ZKHH 3LKPB 3W39A 3EYUL 5HYSG 4XI5C 2X05A 5I8EB 3ARUA 3MYZA 4P48A 1DBAL 5EA0H 3ZT7A 3UBXG 4NO0A 1MJ7H 5F96H 2CRMA 3VFNA 5DJ0A 3B83A 2A9ML 5TDPB 3BKJH 5ETUB 2BOBA 4JPVH 2M26A 3QQ9C 3BDYL 5F7YC 4P2RB 4LCWA 1KJ3L 1MFDH 3KPRB 4DN3H 4Z7QF 1CLYL 3RWIA 2CDGA 4Z7OE 2BNQA 3T0ED 4FQQA 1KACB 2CPCA 4WWKD 3ARQA 1QBAA 4HPOL 1YPZF 3UYPA 1AQDA 1S8DA 3VWKC 3QWOB 1MCPH 3NZ8B 3TEUA 3QQ3B 3GUTB 2V5YA 4JHBA 4JRYA 4XNUH 2W0KA 4ZFOA 3HMWH 3GSVB 1YMHB 2IH1B 3N1GC 4K7FB 1R5WA 5DQ9B 4M1GL 3TN0A 3EO0B 3REWB 3UTSB 2ORBL 3T0EE 5DK0B 4PJEE 2QSCH 2R1XA 1CZ8H 5C09A 3FQTA 1T5WB 4U6YB 5H8DA 3F12B 5EBWB 2DQCL 3FZUD 3VFWA 1JPST 3L7FB 4XRCB 3CH1A 2WIIA 1NGWA 1C08B 1FFNB 2NX5A 2DI7A 5GISL 3IKKA 3ZE0E 3O4OC 1G7JB 3N06B 2VOTA 4KHTL 1J8HD 3FFCE 3GMQB 3IDJA 2AK1H 1FJ1A 2V7HB 3HZKA 1NUDA 2EYRA 1RJLB 1BQLH 1TJIL 4YXHH 4OZFB 3OJDA 1BVKA 5KJRH 4GAJL 4MXQD 5D7IB 4DOHE 1MCOL 3BKMH 2AK4D 3DVGB 3VI3F 5DMKA 4EN3D 3L5WB 3BP5B 1EHLH 5C08A 1UKTA 5DS8A 1TTFA 3MRCB 4NO3B 3GBNH 4PJ8D 2LU3A 1WVZA 1OB1A 3QEGL 1WFNA 2E3VA 1DBBL 2Y25A 4JLRB 5B8CB 3O3DA 2FIRT 3SDXA 4OFYD 5C0GB 1J8HE 1FPTL 1FGVL 4JQXC 5GRJL 1NLDL 5DJAB 3HB3C 4BKLA 5IKCA 2H8PA 4H1LG 1LD9B 2XWTB 4PGJA 3DV6A 2AK4E 2CQVA 5K93A 4Y19A 3SDCD 3T2QA 4LHUA 1R0AL 4MNGB 4NKMB 3FT2B 4PRAA 3WHXA 4CMHB 3D6GA 4PB0L 3LKQB 5KVDL 1UYWL 2D7TL 4JREC 4G42B 1ZHLB 4LSRH 2P1YA 2YPLA 4L3CB 3UDWA 4X4MA 1OSZA 1K2DB 1TIUA 4ZOAA 1MQ8A 3MO1A 4OCSL 4YDVB 2ADJB 2QQKH 5L7XH 2P5EA 1HQRA 2R4RL 3ARGA 4LPWA 2VERN 1KIPA 1FBIL 3CZFB 5H94B 3FQWB 1RZ8A 1N3NB 5EULV 2DICA 4RGOH 4GKZB 4NM8L 1RV6X 5GZNC 3LEXA 3WFCL 5IB3B 2E9IA 1N59B 2X40A 2VUOA 1T4KA 2VN4A 1RK0A 3RY4A 2PYEA 3INUL 5IESH 4CBPA 1F3DJ 1RHFA 1AFVL 1KELL 2BVEA 2M1KA 5AD0A 4CAGA 2HFEA 5I1IL 5I1KH 3LH2L 4WUUB 5JPNA 3RAJL 1RMFH 3TBWA 1TCRB 3C5SB 4DGVL 2XYCA 4WJ5A 3DYPA 1T2QL 3IDUA 1T66D 4Z95L 2Q8AH 1A9EA 2B1HH 3RL1B 3C2AH 4KDWA 5GGSY 5L9DH 3JSSA 4B5EA 1XIWB 3L1OH 3WXWH 1A64A 5GGTL 3V4UL 1A7RL 4KMLB 3FFDB 4F15B 4WI6A 4PB9H 4JFYA 3TBYB 4R0LB 4Q9CA 5DJCA 1FVDA 1ZVSA 3L3JB 3QPQC 2EDNA 3IDNA 4HAFA 1NC4A 2ZSWB 1BLNA 5DEFA 3DSNA 2I25N 5B3NA 4OLYL 3GHEL 2APBA 3LEYH 3TA3A 1MWAL 3WIHL 1N8ZA 2HLAB 4PRNB 1A3RL 4RZCB 3RGVA 1Y18B 4EZMA 2VQUA 4JJ5B 1VENA 3EDKA 3DO7B 5EC2A 3MRGB 3VRLF 3LPWA 3D9AH 4Q9QH 2Z4QB 4XZUB 3BN9C 4P2CG 4F7EA 3UC0H 1PKQA 4JFOA 1HK6A 4DKFL 1CFNA 1MCWW 1ADQA 2NY6D 4JE4B 3WNOA 4F3FB 4OV6F 1S7UB 3CK0L 3BZEA 1U8HA 4J1UA 3EHBD 4DK3A 2EIZA 1IMHC 5KSVB 1VSCA 4NNPH 3KYNA 2W1NA 1JWUA 32C2A 4ONHA 3CVHL 3HMXL 1GIGH 4KK5D 1J0HA 1K5NA 3WUWA 3TLRA 1RD6A 1JGVL 4M8QB 2H3NA 3HR6A 2NR6C 4QOKD 4LSSH 4DEPB 1I1FA 1EEUA 1ZANH 3MMEB 1P7KB 1R3JB 1OARH 4M4RA 2X4NA 3VWJC 3ARDA 5FB8B 2IQAB 3FQXA 5J1TC 1JF1A 5GGTA 1UM4H 3MV7D 4OCWL 4XCNB 4GMSH 1MHCA 3MZGB 5ADOH 4JVUA 3OKNA 4UQ2B 5A3ID 3SKJH 1CICA 4NM4L 2J88H 2WBJA 2C3VA 5ICYA 5TF1L 2NY4B 4QOKE 5J89A 4Q6YA 1GSMA 1MFBL 1CQKA 4PJCA 3BKYL 2ZCKH 3QO1A 4DW2H 2YXMA 1MWAA 4CNIB 3WIHA 4PG9A 5FO8B 2VRAA 4I48B 3WSQL 3PP3K 2IBBA 3EGSB 3MV7E 5FYJU 4FQJL 4PY8I 1DSFH 2O5ZH 3T0BA 1UVQA 1XGUB 3AM8A 4TVPL 1L6ZA 3ULVF 1D6EA 4L4TA 4MB3A 3QO0A 3ULUF 1QFWH 3P4MA 1AJ7L 3ZT5A 5CJOL 5JIPA 4LFHG 3TF7C 1ED3A 1DN2A 2AJZB 4WI7A 3IKCB 5D1XC 4U1LA 3HUJF 1X5ZA 1I1RA 4UDUB 4LPTA 1QRNB 1CG9B 1ZK9A 1CXFA 3OR7B 4JANA 1WTLA 4RIRA 4PJAB 1MI5A 1LDSA 4XNYL 3CVHA 3HMXA 4CMHC 2YUVA 3V4PL 3Q2CA 4KK6D 5DJ8A 1KTDA 5JA9A 1UCBL 3Q3GB 4HKBB 3MNWB 3GBML 2FECI 4NC1C 3OL2A 4V1DA 1A7BA 3DTXA 4Y2OA 2WWKT 5IB1B 3GB7A 3I6GA 2E7HA 1FV1A 2QHRH 3HLAA 5DD0H 3L5HA 4JO4H 4Y16C 1A02N 5INDA 1CLCA 2HKFL 4G43A 4NNYA 3SBWC 2X44D 1RVFL 1F4WL 1WZ1L 4O4YL 4LIQH 4YH6A 5LWYL 1ZOXA 3CAFA 3KYKL 4XC1L 4OV5A 4KTEH 4OM1L 3T2PA 2P42B 3WUZA 5FUCC 3RRQA 3BQUD 3NIGF 3QDJA 2GUOB 4FZ8H 1PG7L 2B4CL 4KXZI 2Z91B 1NGYB 1IAIM 4D0BB 4PJ7E 4FN0A 3W2DH 1AO7A 5FCUL 1NDMB 5FKPB 4APQA 5HHNB 3C8KA 1Q1JL 3P0YH 3E6HA 4HQQL 3DNKA 1P4LA 3FRPA 1XIWC 4J7RA 3PQYA 1U8IB 3D0VB 1VGEH 1HHKA 2CJUH 4F15C 1NMAH 1PG7W 2D0GA 3SPVA 3ULSB 1TQCB 2EC9T 2OMBA 3QRFM 3HAEG 4MXWL 1GPOL 1PLGL 1OAZH 2JF1A 5DI8A 5I8KL 3VXUD 1KCKA 3FAXA 1FZMA 4P3DA 1G0YR 5CSBA 1T1WA 5IR1B 1LO4H 1JK8B 3F65A 5CS7A 4Q2ZB 1CFTB 4PV9A 1ZV5A 4QLRA 7CGTA 3QG6B 1BP3B 1IAOA 1KLGA 4TSCL 5ISZB 2AS5M 1YN6B 2UUDH 1T2JA 2VKWA 3QQNA 4Z7OF 1OQXA 4NZRL 1HXMB 4YUEH 3VXUE 5F3HA 4ONGL 2HT3D 5IMMA 5F70A 2DJSA 3GMRB 4X5WA 5J4MA 1OY3B 4NCDA 2W0FB 4XVTH 3BE1H 3V0VB 4YIQB 4MNHB 4GG8B 4DWHA 4YHLH 2DL2A 3GJFA 1X9QA 5C0AD 2ZSVB 1Q9LB 9CGTA 4OZFG 4HJJH 1NC2A 3RX5A 1PY9A 2Q3ZA 1R5VB 3HZYB 3LSOA 3OG6B 2XNAB 4JGUA 4DEPC 4DQOL 5CGYC 1PX4A 2A77H 1HOCA 4G8EA 4HFWA 2I5YH 3D18B 4OCXL 3QUKB 4P5TD 1YEDA 2MSPA 5F1SA 4PGEB 1Y6NR 5E9DB 4E42A 1DUZB 3BUYA 3MRFA 4K94H 5C0AE 4EXPX 2PETA 5AZEH 1B0GB 3ZE0F 5HYQA 5GHWH 4HUVB 1HH6A 1PD6A 4EUPA 4LRIA 5CD3B 2CO6B 5ICZB 1QFOA 3REVA 4PJBB 1AXTL 1AP2A 3VD3A 2D3VA 3O0RH 4S10A 3C60B 3FKUS 5D7JA 4BK5A 2EDRA 5C6PB 1EBPA 1MJJB 5EOCJ 4Y5YA 1YZZA 4DGYL 1DVFB 2UZIL 1RI8A 3PWUB 3SDAA 3MREA 4XI5D 1A6WH 3QNXB 4NC0B 1KC5H 3LAFA 1PZ5B 5LG1A 1X5HA 4KWUA 3ZLQC 2AP2A 2XZCL 4YEFA 1XZ0B 4MQ7A 1P5VA 3EOTL 4GLRH 1DBJL 3TWCH 4G9FB 1GAFL 4HMEA 5FYJD 1XGPA 5CHNB 3V6OC 3T65A 3QQ9D 2ATPA 5E2JA 1DZBA 3MX0A 5I1GH 3HR5A 3KLHD 2A73B 1H3UA 3OKKA 2ZUWA 2AV1B 1TZGH 4AM0A 1A14H 2DBLL 4XBEH 4X9BA 4N0UB 4Y5XC 2VLLB 3ZL4L 4JFFA 3HE6B 3B9DA 1WF5A 3LVEA 4NWUL 1LK2B 2OJZL 4QRSB 4NOBA 3QDGA 3VWKD 5DVNA 4PTUB 4TNVK 5FYJE 3TZVA 2O5XH 3BD3A 4WW2F 3U0WH 3NACL 5IHUH 2H9GA 5EZOL 1N2RA 4D0DB 2BJML 4M1CC 4U6XA 1ZA3A 5KS9E 4X6CB 1J88A 2A83B 1U58B 15C8L 3QEUB 3MRNA 1QLFB 5GGSB 3H9YA 3HNVH 1KG0A 5FM8A 4UAOB 3MA7A 4MJ2A 4JZNB 1XF1A 3ALXA 5L88L 4WEMB 2Y5EA 2VXVL 2QADD 3GMLB 5FYKU 2NY2B 1SVZA 5IK3B 5CEZE 1S5IH 1QOKA 3LKOA 3KPSD 3O81A 3RUGB 3MNZB 1UKSA 1OAUH 1HCVA 2E7LC 5ITFB 5DD6B 5GS2D 4NZDA 4OGXL 2PTVA 4YXKH 4OIBA 1VA9A 1F58L 2FYYA 1TQCC 1B4JH 3O3AA 3FQNA 2EC9U 5KSBB 5HGBB 3K8LA 4U1NA 2OX5A 3I02A 2JCCB 2CO7B 3LN9A 2R15A 3PDOB 3QZWA 1GXEA 1T1ZA 3H42L 4GAYA 3S6CA 3X12A 3KPSE 2P46B 1I1AB 5MERA 1JPFA 1EK3A 2A1WH 3DBXA 3IU3A 2R29L 4HG4K 4X6BB 3DX7A 4MD5A 3VD5A 4NRXA 4QHUB 4UOW1 1INQB 3E6FB 3WIFA 2VNCA 2YD4A 4P9ML 3AS0A 5H37G 4NUGL 5CAYB 3S4SB 2WANA 3MBED 5BOPA 3MODL 3MR9B 1MSPA 1J0JA 1XCQB 3AC0A 4FQHB 4LVHB 1G9EA 3C5JB 1EVTC 1M7DB 1YY8B 4P3WA 1QVOB 2FJHB 3S97C 2I60L 3S96B 4GSDL 5IVZB 1BFOA 4LFHD 3HI1A 3PHQB 1EHAA 3ALPA 3GIVA 1F4YL 4K9EL 4AENB 1G7PA 5DC4B 5F3BB 3RNKA 1RZJH 3O4LA 3H0TA 3MV9E 4YGAB 4KV5F 4HBCH 4RMSA 5T1MB 3GMOB 1LP9B 3BEVB 2XACC 2YA1A 1BFVH 3QXAB 2XZQH 2MPAL 4ONFL 4JVWA 3WE6B 3SKMA 3HFML 3P73B 1BEYL 2GCYA 5KN5B 5BQ7A 1T1XB 1Q0XH 2EDHA 3OPZL 4POYA 3G08A 4HUUA 1XR9A 1DVFC 1ZHNB 3QPQD 1EO8L 1YEJL 5ID0A 4UU9B 4ZDHB 3UCRA 3FN0L 1T0PB 2GJJA 5JHDB 3T1FB 4LGRB 1IC5H 4LLVB 4WI5A 4XAWL 3S3SA 4FXGA 2QL1A 3SCMC 4JY6A 1DBMH 3VGGA 4JR9L 4GW1B 5AWNH 1F3DH 3PABB 4P2RD 4MD0B 4IEFB 2YK1H 2WINB 4TSAH 1ZHKB 1QHOA 3JWNC 3KPRD 4OZ4B 3BN9D 5TPWH 1LO3H 1MIMH 2HVKA 4PYHA 1SEBB 1TZHB 3KPPA 4MNQE 2D31A 2FD6L 2KKQA 2EYTB 3F7VA 3GM8A 1FFRA 2IFFH 3IRZA 4RFEB 3MLZH 2DQHH 1CDYA 3MJ8B 4X9HA 4P2RE 5JW4N 1NGQL 3B3IB 4JAMA 1I9IL 5I18H 3KPRE 2NR6D 4W4NA 3UTSD 1OAQH 2HT4C 4QXWA 4AG4L 1H5BB 4H5SB 2OZ4L 1CFVL 3X3FL 3LKRB 4KDTA 4UIMA 1IVLA 3IYLW 3VCLB 1QPXA 3C87A 2QTEA 3CFBA 3V5KA 1T7ZA 3WJLC 3U4BH 3U4EA 4UAOC 3VD4A 5DA0B 2BOCA 4LPVA 4GOSA 1WV7T 5HDLA 4RGMC 2G9HB 3VGAB 3IJSA 3O2WH 4PJ7F 2HTKD 2ADGA 2J6EL 1QO3A 1ETZA 1UENA 3MRBA 4Y4HB 5JW3H 5D2LE 2MCG1 3FOMB 1GZQA 3UTSE 4U6VH 2NPLX 5GIRA 2BFVL 4EDXB 3G5YB 3PWNA 3ROOB 1KJVB 2YBRB 3ULUL 5FYKD 3RL2A 3DROA 2X70B 1KJ2H 1VACB 5JR1H 5FHAH 2ZCLH 3MRLB 2ICWA 1WEJH 4M5YL 1C5DA 5BZWB 5FFLA 3DRTA 4NKDB 5EOTB 2VUYA 4R2GB 1TFHA 1RZ7H 4WUKL 1I1AC 1WAAA 3BGMA 2RIKA 4NWTH 3KPNA 3K74B 6CGTA 1AGEB 4OF6A 5D1XD 1UQSA 5DHVH 3RVVC 3FO9A 5FYKE 3ZHDA 1MRFL 1FL3B 2F8XC 4F9PC 4U1JB 3FB5B 1IARB 4CU7A 2A6IA 5ACZA 1D5ZB 4Y4KB 2FIKB 2DQFB 2DLGA 4N0FA 5HHMB 1BIHA 1G7MA 4OFPA 4ERSL 2FSEB 1JV5A 3KLAB 3MRPB 3QFJB 4RMWA 4LVHC 3KR3L 1R24B 2R0WL 2OZ4A 5EUKB 4PY7A 3MNVB 1UZ8B 1IKFL 2VSCA 4Y16D 5F71A 3AB0B 4G6MH 1BVLA 2BNRB 2DWEA 3KJ6L 1KB5H 2P45B 4BSJA 5JXEA 3S37L 1WLHA 4MNGE 3UTQA 1QA9B 1KPUA 4YNYA 5DHYA 1WT5C 2EYSA 5DD1L 4NC1E 5CP3H 4D2NA 1FDLH 4D94A 1E27A 1XH3A 4NRYA 4WUUD 1LEIB 4P2YA 3BAEH 3LS5H 3U36B 4MSWA 4FP8L 4XGZB 4XPBL 2BC4B 4ZPVB 4QTIL 4P59L 3MRIB 1L7IL 2Z35B 2NY5C 3HUJA 4L9DA 4HH9B 3MBXH 5D2NA 3LKNB 2XICA 3JWOC 4JHZA 1CE1L 1H3GA 1QSFB 1XIWD 5CZXD 1C5CH 1YNLL 4TVSa 3MJ9H 3RVXC 3FO1A 4F7TB 3K2MC 5DVLA 3KJ4B 5FUCE 4QXTA 4RWHA 4WUUE 1LEGA 1VGKA 1RIUH 5FOBA 3ZDZE 3D0LA 3PXJA 1F6FB 4M7JL 4K8RC 4L8DA 2APFA 43CAA 3PUCA 3MFFA 2XTJB 2H2SC 5C0RL 4NFDA 2WUBH 4HIEA 1MREH 2VLJB 5E2TL 3UJJL 3WNPA 1PEWA 5FDWA 4CN6A 4IIQB 3DRQA 3GMPB 1IC4H 3NAAH 4XMKL 2X4TA 4M4PA 2VIRB 3KAAA 2W60B 3WL9B 3MGTA 1IT9L 3BRFA 3OKEB 4MAYA 1W0VA 3V0WH 4OLWH 3EDDA 4QHKJ 4RFOL 5JUEH 1P9MC 2XG4A 1J05A 4L3EA 5JIIA 3V6FB 1CDJA 4P57A 3SE4C 2DLEA 4AIZB 1LHZA 3BIKA 4HUXA 2YWZA 5A40E 1ZWIB 4R26H 5HVFB 2MFNA 3FB6B 3VFRA 3C2SA 5DJXB 5SWSB 5KVEL 1C5BH 3VFPA 2QLVB 4JG1L 4D0CA 5C8JA 5KS9F 2CMRL 3EKCA 1H5BC 2ATKB 4M43L 5CGYD 4JFPB 4H20L 3EZ8A 2VR9A 4KVNL 1CXKA 1J86A 3B2UC 5JDJA 3QI9C 5J57B 1SM3L 1E4KA 4S2SA 5E8OA 2VZ3A 2HJLA 1ZA6B 3CH8A 3V5HB 4IRJC 5E8DH 1U91B 2BCKB 5EU5A 3HE7A 4AYFA 1I3GH 3CMOH 3QJFA 2E6PA 4JM4L 2NY4D 4IM8A 1NSNL 1RZKH 1BBDL 3AREB 2NW3B 4EBQL 3VE0B 1GL4B 3H7BA 4PD4K 1FN4A 4BQ6A 2OTWB 1J5OH 2VISB 5DRWA 3W5MA 4WEBL 4CMMB 1Q0YL 3GKWH 3IXTA 4R90L 4UNVA 3I50H 1BOYA 3RWJB 3UXFA 3F5WA 4OIAA 2VE6B 2CUHA 2VABA 3LN5B 5GS0C 4HF5H 5DQDH 5AZ2L 3U82B 2EEDA 2KQNA 3JTSB 1VDGA 1BQHA 4HKZB 1QRND 3T0EA 4PJEA 2W65A 1RZGB 3VGDA 1OP5H 3IGAA 4WWKA 5DJYA 5HGHA 2RCSH 2JB6B 1FO0B 4Y4KC 3GI9H 5LKNA 1NAMH 1MRDL 4FQCH 1UACH 1CR9L 2KZ1B 3A6CL 4JB9L 3QCVH 1I85A 5MEPA 3LKSB 4PBVC 1FFQA 3SE3C 2XKUA 4O9HL 3P4NA 4OCYL 4N5EC 5C7XH 3WJJA 1KJ2B 1SJEB 5INCB 1SMAA 3MRDB 4O00A 3V6OE 1RK1A 1QRNE 5EOCH 3BW9B 3UZQA 5FM5M 3W81A 2P7TB 1EZVY 3VH8A 4PJAE 1J1OH 4Y5VA 5B39B 5E5UB 2ZWLT 3B2VL 3O2VH 2VXTH 1QBLH 1BECA 3MLVL 1KOAA 2C5DC 3SJVB 1HILB 4O2CA 4Z5RB 3CPLA 2JJVA 4YHNB 3T3ME 1L9MA 2OSLB 5DK2B 1CL7L 4D3CL 5KSAB 2ZCHH 3OG4B 1YY9C 2F5AL 5ESVB 1J8HA 1U92A 4WY7H 4TUJA 1D3CA 4LLUB 5LAXA 4HS6B 3QJHB 1CD9B 2OI9B 5ACLA 2FZ3B 3U0PB 4R97C 5JPMB 2AK4A 5I2IB 4TRPH 4EN3A 1QQDB 1OD7A 4BELD 4GBXB 4N8CL 1DN0B 4Z7UB 1M05A 1O0VA 3GRWL 4PJ8A 2RHEA 3S36L 1MCEA 3T77B 1MH5B 3KJ4C 1KFAL 3J8F7 4HT1H 2OYPA 4YJZL 2E8ZA 4U1IB 1FFOA 1KB5B 1AIFA 4OFYA 1OL0A 5LBSH 2CXGA 4GKNA 3FONA 3CVIL 4TTDD 2DDQH 4O51B 1HIML 2OP4H 3BXNA 3L95A 2XTJC 1I9JH 2EE9A 1XF3B 1U95B 2BSTA 4WW2A 1RUPL 3SDCA 1NLBL 3UTZA 4IIQC 1A1OA 3FCTA 2AJYL 5ISZD 3U1SH 3BZ4A 5CBEB 2DQGH 1I1CA 1I8IB 4RNRA 2R4SL 3OTTA 1SBSH 1I3RB 2IG2H 3BH8B 4Y89A 3NABH 3SDYL 5IOPA 3RVWC 1ULVA 3M8OL 1EMTL 1ND0A 4MCYA 1U8OB 1EH9A 1Q72L 3TPUB 2CGRH 4E5XA 3EFFB 1AI1L 3O2DA 5D6CB 3T2NH 4M9PA 2AKRB 1U93A 3BGFB 3WN5C 2ZUQC 5ISZE 1A47A 4ZFFB 3BIAX 5L0QB 4YDJA 2VITA 1X3DA 1F97A 3NH7H 1T03H 1IAII 4ODHH 5IUSA 2Q76A 3DVNB 2XKSA 4MA7H 5C0BB 3W9DA 4J4PC 5TGBA 1EJOL 3B43A 4LHQB 2EXYC 4UBDC 1NUFA 4J3UA 4MQTB 1U8KA 3ABZA 2EKSA 3GRWA 5L2JB 4M48H 1HE7A 2ERJB 4PRDA 5D2LF 1GC1H 4PUBH 1UEMA 4R3SA 3C60D 1CFQB 4BSWA 1SJXA 2ZPKL 4KJQC 1QTYT 2CKBL 1P5UA 2VDQH 3CZJA 1NCNA 4FQXB 5EU4B 3S36X 1TJHH 1EERB 4J3XA 1BIIA 1DVFD 5CINL 1C7TA 1Z9LA 4YFDB 4NQXA 5I17A 1OTSC 5GGRA 4MDIA 5E6ZA 3RA7H 1ODAA 4PJBE 1PY4A 1FL6B 5IMOA 1MLBB 2FATL 1CGTA 5IQ9B 4G9FD 3K8MA 5BCAA 2CSPA 4N9GB 2YEZB 3QA3A 1GCFA 1X5IA 2IPUG 4YHOH 3UJIL 4XAKE 4M62L 2AXFB 4DJMA 4HGMA 1OAYH 1D5MB 3MRHA 2IADB 4OLEA 3HE6D 1KIQB 1A6PA 5FA3A 5K9OA 1GZPA 3C09B 3F58L 1KLUB 4ODUB 5H35A 2APWA 1N7ML 1WC7A 4G9FE 2XFXB 1I8MA 5DF0A 4QOKA 5TE4L 3HS0B 4CW1A 1UWEL 4BZ1L 1B3JA 3X11A 3E2HC 4KH2A 2NNAB 2HT4D 4N0UE 4JKPH 3ARBB 1HWGB 3RNQB 4ETYA 2M8XA 4QRRB 4KZEL 4XC3L 1I7RB 3MV7A 2AEWA 4LP5A 3VXMB 4UILL 1AR1D 3JTTA 5KSAC 1JI2A 3QAZC 4NYLA 1RJZA 4JJHA 2GSIB 3MRKB 2CKBA 3P2TA 4IMKC 2A6DA 4LQFL 1NCWL 2ED8A 1FORH 4WWID 3RJQB 2OI9C 1NAMB 3EFDL 3WKML 1MHHB 3VXNA 3TN0C 3R1GH 2ADFH 1ZTXH 4IDJH 1ZLWH 5HHXH 4R4BB 4X6CE 2VZVA 2FJFB 5T1DH 1AE6H 4GBXC 1RJYB 4QYOA 5E8PA 4M7KL 1FNFA 2VLRB 3ZYJA 2FO4B 1OTTD 2IANB 1DEEA 4WNQB 1KIRA 2VC2L 1D6VL 1LGVA 1T04B 3ARPA 3IJYB 1QYGL 3ZDZF 1CT8B 2GFBB 3ET9F 5CEXA 4RA3A 3QHFH 4EEEA 1SVCP 2FX7L 5CMAB 3G5ZB 3OGOE 3TO2B 5C2UB 3RUGE 5C0CE 4GRMB 2PUQT 1I1AD 5HHQA 3MLTB 1F42A 1JBJA 1NL0H 1YUHB 3S3PA 3RVVD 5F1KC 5FEBA 1GOGA 2C1PB 1M6OA 3SOBH 3WDJA 2NMSA 1KN4L 3OXRA 1LE5B 4QRPA 2V2TA 1NGZB 4JHWL 4FRWA 1UXSB 4LCCA 3SE9L 1AHWB 3V5DA 3QH3A 5I1DA 4MAUL 1MFEH 4WENB 4PJGB 5K9JL 5BRZD 1O5DT 2XXMB 2Q7YB 2X41A 2F9BT 3VFMA 4U31A 2YPVH 3WBDA 5GRUL 4PJ7A 3SGDI 5IFJB 1HDMA 4D8PB 5DWUH 3UTPD 1B0RA 5IGXL 4YXLH 1K3IA 4XX1G 2CIIA 5L0QC 3SY0B 1S7XA 1YJDL 1CGVA 4QTHB 1IQWL 5FKAA 3BQUA 2E6QA 5SX4H 4O58L 2FLBT 5BRZE 4WRLA 1H3PH 4G80A 4MDJB 2XA8H 2P8LB 4ZUSB 3HHRB 4MA8L 4ISVA 3UTPE 2FX9H 3RWEA 2ERJC 3ARGC 1AQKL 5I1AB 1JMZA 4MX7B 1KCUL 4NHUA 4WV1A 2BX5A 5FK9B 3RHWF 5EPMB 1FIGL 4ZD3H 4FQXC 5ESQB 2VR4A 1JPSL 3VXUA 3RVXD 3U7WH 3EYFB 5DUPL 5FGBA 3NCMA 2KH2B 1I9EA 2R56L 3CFKB 5TFSH 1LP9E 2OQJB 3VXQB 4DTGL 2IPUK 1QLEH 4X99A 3I6LD 3SGEI 5JHDD 2H2SD 1T21B 4M6ML 5E2UL 5B39G 1K85A 4NUJB 3HKFA 4NQUA 4JFXA 2ITDA 1YNTB 3ECBB 3CC5B 1CL7I 3LS4H 3LZFL 4MA3B 1NFDB 2OXHA 3ESUF 4M02A 3TCXA 1UB5A 5F9WB 3DIFA 5FYJL 3STLB 1P1ZB 4HWEH 1GGIL 5CIPH 4OLVL 5KTEL 2YSSB 5C07B 4FFZH 3D48R 4OLXH 1RZKC 3WFBH 3HCVA 3IFLL 5GJSH 4TOYH 5C0AA 3I6LE 3ES6A 5JHDE 3IDIA 3PIQB 1VEMA 3ZSTA 1S78D 4R4FH 1A0QH 5C71A 1A6AA 4AMKL 4FQLH 5MI0B 2ADIB 2Q1EA 3SQBA 3P4OB 5GJTL 5DJDB 4H1LA 1LO2L 2HVJA 3CLEL 4P4RB 4PJAF 3BPLC 2XPGB 4LSPL 2W9EH 4P5TA 3HC3L 4WW1A 3ARBC 2YD3A 3KPLB 3T3MF 2QQLH 4RAVB 2UY6A 4JQIL 5F6IB 5E03A 2DTSA 2GEEA 2NLJA 2OL3L 3QI9D 3FB7A 2AJ3A 3OAYH 1WWCA 1L0XA 4DKEH 4I1NB 5IMLB 1Z5LB 3TVMB 2NY0C 4TSBL 4DVRL 4Y4HD 3PGCA 1MCKA 2DLFH 1PAMA 3KGRA 4LU5L 5CJQH 4JPIB 4K71C 1F3JA 2EIEA 2CLVB 3L9RA 4PRPB 4HIHA 1T7VA 1EX0A 4LRNH 2QEJA 5DR5H 3ARDC 1RUQH 1YN7B 4FG6C 2ICEB 4H25B 4GW4A 4JY4A 3S88L 3K2UH 1SQ2N 1YEKL 4JHAL 4JDZA 4XCYA 4Z77B 3T09A 1CDBA 4PTTB 4R2GD 4LHUG 3JUYA 1S7WA 1Z0NA 5LCVH 5GS0D 3IFPB 3LQAC 4XNZC 1LVEA 1A6UH 4E41B 4X80L 5DMIL 1DR9A 1V8HA 3UJTH 4BH7B 5HPOA 5KS9A 1UA6H 4WVRA 3P11H 3BISA 3EYSH 1AC0A 4JFZH 4JCMA 4Y4KD 4X4YB 5HDQH 1XCTA 3H2WA 5HHMD 3RWGA 4F8QA 3HPJB 1AD9B 3VWKA 4XNXL 1A5FH 5AEAA 2V9TA 1U8LB 3QFJD 4JKMA 4U7SA 5I19H 2RR3A 3LOWA 2CLRA 1CE6A 3U9UA 4N5ED 5IB5A 3MV11 3VFGL 3EYOB 3OMZA 3O8XB 4OAWA 3IJHA 3SHSA 1X7QA 4I0PB 5DYOB 4NT6A 5F88B 2EO1A 2OR9L 4HW6A 4PJ9B 1KUMA 1XGYL 5KVGH 1RSFA 4PP2A 5D93C 5E8EA 3CX5J 1F8TL 4NKIL 5HHME 2A6JB 3L6FA 3HI6L 2R2HB 3QFJE 5JW4R 1KBGL 4NQCB 3P9LB 2X4OB 2RB8A 4BFIA 1YY9D 1S5HA 3KPSA 5AAMA 4NNXB 4Z18A 5GSRA 1QEWB 4UTBL 4K3EH 1INDH 2Z31B 1EAPA 1QSFD 4CL7A 3GSNH 4DKAA 5CJXC 3KDMB 4OCRL 4YBHA 1J1XH 4LBEA 3RI5F 1D7FA 1FZKA 1D5IL 4W4OC 4MHHI 1FG9C 1EGJA 2ZZUT 5E5RB 3QIUB 2FX8L 1VKXA 3HZMB 1DE4B 2IGFH 4PJBF 4XNMA 1D5XB 2XTJD 2PW1A 4WGVB 1U8NB 4XHQA 2VLJD 1MCDA 3LDBC 2VXUL 3X14B 3X3GL 1MCCA 1QSFE 3KPTA 4HS8H 4WIQA 1NCBL 5LQBH 3NCJH 5AUMB 4GFTB 1RUMH 4JQVA 3DARA 4U2ZA 5F9WC 5EBMA 1CGXA 2FB4L 3D5OF 1DUYB 1FYTD 3MBEA 5TJWK 4KY1L 5BO1L 1KCSL 1IILE 1MRCH 5BVPH 3S35L 1CFSA 3HZVB 2EXWC 2VDLL 3RVWD 2XTJE 4HUWB 1OM3L 3PHOA 1AGDB 2WLYA 1ZSDA 3B5TA 3MSPA 5J11C 2VLJE 1PBYA 5MI0C 2R1YB 4KVCL 2VDOL 5JW4M 4OZIB 2H26B 4XVSL 1M71A 4Z78B 1I7TB 5DRNB 5CZVL 4OIIL 1HYRC 5I16A 5SWSD 3RPIB 4F58H 4JKLA 4ZO8A 3IVKA 4ZS7H 3ZYZA 3WDHA 1FYTE 2FWOA 2EO9A 4XXCC 1IM9B 3A67L 1EFXB 5C2BH 5HHPA 4U1HB 4L29B 5D70H 1PKOA 2BVPA 5FUOH 3RWDA 5I1CL 4UBDD 3A0OA 4IOIB 4NGHH 4YHPA 5TDOA 4RFNB 3WFEH 3AXLB 4XP5H 2AXGB 5DGQA 1QR1B 5J3HC 4O5LL 5E1HB 5CIPB 3TVMC 7FABL 5J12B 5HY9A 3KYMB 3ARSA 4G8IB 4UZGA 1XGTA 3VFTB 5HXMA 1LK3H 5TE6H 4X6CF 2HTLD 5I30L 1OGAB 1XGRB 3ARED 5A16A 1MPAH 4WO4B 4DFIA 3CSPA 4KJQD 2V2WB 3LKPA 2VDRL 3IFOA 2GW5A 4LHJB 1VFMA 5I8EA 3SE8H 4DGIL 1UJ3B 2I9TB 4EJ1C 5I1HL 5SWZB 1JPTL 2PNDA 4OD2B 3EJYC 4R7NB 5ETUA 2V5MA 3RUGF 1JFQH 1MFAH 2GJ6B 1U36A 3NTCH 4TUOB 4P2RA 3VFOB 3RX7A 2YD1A 2DYPB 4NIKB 3KPRA 3I9GH 4PYGA 3WXVH 1UM5H 1FIEA 3EJZC 2R2BB 1KJMB 2VQ1B 1RJCA 2X5PA 5KW9L 3MUHL 4H88L 4QHMB 5I73B 5IVNA 3NZ8A 3LIZH 3Q5TA 3QQ3A 3GUTA 2AERT 1IGCL 3TBVA 1A6VH 4JDVB 3GSVA 1QFWM 1YMHA 2A9NH 2IH1A 1E4XH 1I3VA 2CUMA 4K3JH 4K7FA 4MCZB 5DQ9A 5D2LA 3TH4T 3EO0A 4I4WA 1CS6A 3REWA 3UTSA 3H9HA 2EDDA 4HFUL 4XMLH 2O5YH 5DK0A 4I0PC 4YBLB 3TNNB 3IU4L 4PRIB 1T5WA 1A8JH 2D9QB 4PJ9C 3F12A 5EBWA 1EAJA 4FQ1H 4IHOB 4XVJL 1OP3K 2V5SA 3P0VH 1CDGA 3L7FA 3DO3A 4M1DL 4XRCA 3SJVD 4G6FB 2VL4A 3ARZA 5IW3A 5TE7H 5FO9B 1C08A 2X10A 1FFNA 1GGCL 4LP4A 1T83A 1K3ZA 1G7JA 3ETBF 5KSAD 4YWGL 3GMQA 3L3KB 2ZUTA 4XH2B 2V7HA 1N64H 4JZJC 3L5XL 1RJLA 4OZFA 4P9HL 5D7IA 2ID5A 3DVGA 3SKUD 2Z31C 3FMGH 3L5WA 2GK2A 1MUJB 3SJVE 3MRCA 4NO3A 3MCKB 4GBXD 3AMKA 2QSQA 4ZFGL 1QNZH 4LSVH 5MP6L 3LB6C 2N7BA 4X5XA 3QSKB 4JLRA 5B8CA 3U4AA 4YHML 3NIFE 5C0GA 2E8YA 1HZHH 1LP9F 1PSKH 3OSKA 4PJHB 5DJAA 5IBUB 3MV01 1VFAB 5MEQB 1TQBB 1LD9A 2XWTA 5D1XA 2EICA 4M3KB 1HKLL 1I4FB 1JHLH 3BOVA 2PYFB 5C09E 4MXVF 5K33A 4MNGA 5LXGH 4UIKH 3FT2A 1JN6A 5LJYH 4Z7UE 5D7LD 4K3GA 3SN6N 3LKQA 5D7KD 2L7UA 4BZYA 3NA9H 5E4IA 1ZHLA 1CK0H 3S98A 4XBPB 4L3CA 5F89B 5FDYA 3TYGL 3H8NA 4Y2DB 1MF2L 4ODTH 2HWZH 1A7QL 2BRQA 1NCDL 5EOQH 4KROB 1K2DA 4YGVB 2Q87A 4CADB 3RTQB 1I3UA 3UYOD 1QBMH 4YDVA 3EBAA 4X7SH 4Y16A 3IS1X 2ADJA 4KKCC 3SBWA 5DMGC 1FC2D 5GZOD 3CZFA 3N1PC 5H94A 3FQWA 1N3NA 5F6HJ 2BSRB 5D7LE 4WFHE 5D7KE 2R23B 4J12A 5A2IH 1N59A 5EORL 4BFGA 3G5VB 1J0ZA 3RY5A 1YEFH 2AV7B 2YMXL 2ZKHL 2KDGA 4WUUA 4EUPG 3T0AA 1TCRA 2IEPA 3C5SA 2EH7H 5EA0L 2IPTH 3D69B 4O02L 3LQMA 4DUVA 1MJ7L 3VFVB 3RL1A 5SV4A 3BKJL 4JPVL 1RULH 3ARGD 2PW2A 3ELAT 1XIWA 5ERWA 1A1MB 1MFDL 4YE4H 1EO5A 3T08A 4GRLB 4FFWC 4DN3L 5HDOA 1RAMA 3O6MH 2RGSA 4LGPB 4R0LA 4WO4C 3TBYA 4JO1H 3IDMB 3L3JA 5ANMB 4YX2L 4FQXD 4I18C 3C9NB 3UAJC 1JRHI 4JO3H 5CJBA 1XF4B 2ZSWA 1C12B 1CDHA 2CUIA 3X13B 5L8JB 5FUZH 1YEEH 3WS6A 5C0NC 4XNUL 2HLAA 4PRNA 1I75A 3HMWL 4RZCA 1Y18A 4LVOC 1H3TA 1MHPH 4JJ5A 4GQ9H 1YMMB 3DO7A 5BV7H 3OX8B 3MRGA 3ARWA 3KPQB 2Q3AA 5DVKA 1N5AB 2Z4QA 2QSCL 3FOLB 4XZUA 3NN8B 2ESVB 4X4XB 3NFSL 4F3FA 1S7UA 4I3SH 3N9GL 1GVIA 5E8NB 2CRZA 2CDEA 4EI5B 5KSVA 1KIUA 1E6OH 4PV8B 2AK1L 4TQEH 4M8QA 5DC0A 1BQLL 1HXYB 1N26A 3MUY1 4YXHL 5KJRL 3BKML 3SO3B 5E56A 3MMEA 4YBLC 1P7KA 5D1ZB 1R3JA 3HA0A 3DJ9A 5FECB 2JK5B 4Q58C 3GBNL 3O6FC 1YC8A 4OJFH 3ARBD 3DUUB 5DQJB 1CLYH 4RDQF 1DDHB 5FB8A 2IQAA 2XY1A 4QRRD 5T3XH 4W70A 1G6VK 5F8QC 4XCNA 3VXMD 2KZWA 3KPOB 4P46B 3ZKXC 1MOEA 4K9EC 4UQ2A 1GOFA 1FE8H 2AJSH 4LLWB 4WFFD 4EVNB 3G04B 5IF0B 3VDCA 3FN9A 5B3JE 5KG9B 4KDTC 5FO8A 3WFZA 4I48A 4QRRE 1UEYA 1BPVA 5AG8A 3EGSA 3QZWG 2VLRD 5CWSB 2BZDA 1KCLA 3VXME 2IAND 3D3VB 4RMVA 5F1IB 4LSRL 1O7SA 1XGUA 3M1BB 1J10A 4HWNA 1P6AB 1S7SA 4OD3H 4I5BB 1A9BA 4FG6D 5D8JL 5GRVK 4WFFE 2DLHA 3KPMB 3BESR 5GISH 3GJFK 4HJ0C 3KLSA 2AJZA 4IRZH 4P0DA 1TQBC 2QQKL 3IKCA 4L8BB 4MVBC 1X4ZA 3V6OA 4LNRB 4UDUA 1QRNA 1CG9A 4GRWH 3OR7A 4RGOL 1UB6B 3MRRB 4JO2L 4PJAA 3BJLA 3C5ZB 1UWXH 2VLRE 3D39B 4WHYH 3ZTNH 1QD0A 2IANE 1AY1H 4NJAH 4QXGH 4X5LA 5IESL 3Q3GA 1CDUA 4HKBA 3MNWA 1EHXA 4GO6B 3MRJB 2Y5TB 3QXVA 1PEZA 1P84K 4KROC 3RTQC 5IB1A 2H2PC 2Q8AL 2B1HL 4KI5C 3C2AL 2KL6A 4OCMC 5L9DL 4BUGA 1OP3H 3FQUB 5GRZA 3L1OL 3WXWL 5F72S 3VA6A 4YBQC 3WO3B 2UWEF 4PB9L 1KB9K 3QHTC 2E27H 2W9DH 4OLUH 4MQSB 3FT3B 2RFXB 4PJGE 4AQOA 2GUOA 3LRSB 1N6QL 2PKDA 4RBPK 1WCQA 4OUUB 2Z91A 1NGYA 2OR7A 4D0BA 1JI1A 3TBSB 4S0TD 3QDMB 1XGQB 3MCG1 1JNLH 4HMDA 5I74B 1NDMA 5HHNA 2AGJH 4DCQB 4RCAA 1KTRL 2UZYB 2E7LA 1MFCH 3BDXA 5EG6C 1QFHA 1ADQH 1U8IA 4Q9QL 3D0VA 5IV2B 3UC0L 1H15B 2XTLA 4IMLB 3O6KL 4PRBB 5EUOF 3ULSA 1LEKA 3QR2A 4S1QH 3WFCH 3T8XB 4G9DB 4GS7C 5MHSD 1G7QB 4NNPL 4JDTH 5IR1A 1JK8A 5I1IH 5EWIH 4Q2ZA 4M61B 1CFTA 1T2QH 1KTKE 3QG6A 4HEPG 5D2NC 5ISZA 1ZANL 4EXKA 1YN6A 3QFDB 1ZLUH 1OARL 5MHSE 1HXMA 2LU4A 1JP5A 2HJKB 3GMRA 3G9AB 2W0FA 1Y0LB 3QHZH 4NHCH 4QY8B 1G7HB 4ODVL 4URTB 5DK3A 3IF1B 5HI4C 4GMSL 3V0VA 4MNHA 4GG8A 4LAQH 3U2SA 4U0QB 5C07D 5ADOL 4KKBC 3E0GA 4EI6B 4MJIB 2ZSVA 1Q9LA 2EXWD 2YD2A 3SKJL 2J88L 4TVPE 1NKRA 1R5VA 2EDYA 3RIFF 1MQKH 1DP0A 3PQYE 25C8H 3HZYA 4XP9H 1A3RH 2C9AA 2XNAA 3SO3C 4GAGH 3P9MB 3P3YA 5D1ZC 4ELMB 1ZGLB 4DW2L 1NFDE 1T3FB 1A7PH 4P3CH 1PDKA 3D18A 2V17H 3QUKA 2YD6A 4MAYC 3E3QC 3CU7A 4U1SB 5BV7B 4PGEA 5CBAB 5IBUG 5C07E 4WU5B 4DKFH 4HUNB 4MB5A 4RMTA 1B0GA 3NZHH 4KTDH 4P46C 3AY4A 4UT9H 5C70A 3WNKA 4HUVA 5CD3A 1X4XA 5ICZA 1IEBB 4I3RH 2AJXL 3OB0K 4PJBA 5EH1A 1J0IA 2O61B 4HS3A 3RWFA 3HMXH 2AI0H 5J3HD 3TVMD 3C60A 3DX8B 1W72H 4LF3B 1OW0C 4UQ3B 5JW5B 2MJWA 1MJJA 4OI7A 2NXZC 2X4SB 2J12B 2V6HA 3I3BA 4PRPD 4J8RB 1BAFH 1DVFA 5I75B 3PWUA 3QNXA 1TVBB 3NIFF 1PZ5A 1OT1A 3WD5H 3QIBB 2QHRL 3GMNB 5DD0L 4JO4L 1B6UA 1XZ0A 1HH9B 2VZ1A 4G9FA 4Z9KB 2VKXA 4U0RB 1V3KA 2GAZB 4LKXB 3RWCB 3EJYD 4RISH 5CHNA 5EO0B 4BYHA 1YEHH 1EBAA 3MRQB 4YPGB 3OHXB 3MJGX 2A73A 4E41D 3DV6B 4Z7UF 4PRPE 3C5ZC 2AV1A 1HHIB 2W9LA 4Y19B 5F7LB 4N0UA 5CGTA 2VLLA 5SX5K 4RRPA 2IAMB 5BS0B 3HE6A 1JTPA 1T89C 1LK2A 4FZ8L 4QRSA 2H1PL 2EECA 4PTUA 4JFEB 1A4KB 4PR5B 1II4E 3DUSB 5ALCH 3ZTJH 1P7HL 3UPRA 3P0YL 3PGFH 2BP3A 4V2BA 5CJOH 3HC0B 4E41E 4D0DA 5HYJB 2G60H 3O8XD 1VGEL 4X6CA 2CJUL 2D7PA 2A83A 4I0PD 1U58A 1NMAL 3QEUA 2Y23A 2VR5A 2X4PB 1QLFA 4PJ9D 5GGSA 1JZ8A 3DPBA 4Q97A 3LEXB 5TDNB 3WJLA 4XNYH 1AGFB 1OAZL 1NUNB 2AEQH 4JZNA 1IAKB 3V4PH 1I85C 4GRWB 5GGQH 3IDGB 3O41B 5B4MC 1LO4L 3GMLA 4AL8H 4LDEB 5IBLC 5IK3A 3WJJC 5I1JH 5I74C 3BZFB 3RUGA 3MNZA 4WJ5B 2OJEB 4X7CC 4D9LH 5CCKH 1U41A 1I8LC 5ITFA 2PO6B 5DD6A 5FGCB 2WIMA 3FZUC 1UH4A 1WZ1H 2Z31D 4WCYH 4YUEL 2PXYC 4ODBD 4KK8C 5EBGA 3BH9B 5DVMA 4X9GA 2AXHA 4DVBB 5HGBA 4PJ5B 1JWSB 3LB6D 4HWZB 4ZQKB 4XVTL 3BE1L 1FVEB 3JWOL 4OM1H 3BO8B 5L8LB 4YHLL 4G8FB 3OKMB 1PG7H 2B4CH 3CD4A 1I1AA 4HJJL 3ARRA 4MXQC 4X6BA 2D0HA 4HX1B 1S9YB 4QHUA 4HDIB 1INQA 3E6FA 4HXBL 2FEEL 4L1HA 2J4WH 5EC2B 4F9PA 5JOEA 3VI4F 2I5YL 3JV4B 5EU6B 4F7EB 2FLRT 5HVWA 5BRZA 3MR9A 5ADPH 1XCQA 4FQHA 4K94L 3UX9B 2VWEE 2P43B 5AZEL 3L5JA 4J1UB 3C5JA 5GHWL 1M7DA 1YY8A 2KUTA 2EIZB 3GSUB 5JO5B 1QVOA 3KYNB 1GGYA 5SWQA 4PJXB 3O0RL 2IBZY 4KKCD 3CXDH 3HI5H 3N1QC 2RBLA 5DMGD 1K5NB 1SYSB 5IVZA 5LGHH 4CU8A 2H41A 1YA5A 3PHQA 3TT1H 5IJKC 1H8SA 2YUXA 1WT5A 4HC1A 4TSCH 4AENA 4G6AC 1X5AA 1LDPH 5F3BA 3I85A 2Q20A 1IM9D 5BV7C 1A6WL 1KC5L 2FEDC 5SV3A 3P9WB 5EC1B 2ZOLB 4LSQH 5T1MA 3GMOA 1LP9A 2IQ9H 5K9KB 4CVZB 3BEVA 1JF1B 5FHBH 1FNLA 2DQUL 4HUKB 3QXAA 2FL5B 3TWCL 2X4QB 3TIEB 5J13B 1ZS8B 3Q0HA 4GUPB 5MENB 3WE6A 3P73A 1FZOB 1CICB 2IPKB 3CXHK 5KN5A 4M3JA 4W68A 3GM0A 5B3JF 5I1GL 2GIYA 5AYUH 1TZGL 1A14L 4FFWD 1OGAD 4XBEL 4CDHA 1UG9A 4TULL 3CMGA 4AIOA 1KXQE 4WO4D 1ZHNA 1CGUA 5FGSA 5I75C 4OKVB 2GT9B 4UU9A 2DLTA 4ZDHA 2CIKB 3UAJD 3EOBB 2XOTA 1KEGH 4X8JB 4KQ4H 3HNTH 3RQ3A 1T66C 4MWFB 5JHDA 3T1FA 2DQJH 4LLVA 3RJDA 1JRHH 1NPUA 1BQHG 4QWWD 1V7MH 2O5XL 5C0ND 4U0RC 5SWZD 4OSUH 5IHUL 4H26B 3P4MB 2GJ6D 3PABA 4PLOB 1OGAE 3MROB 4MD0A 2QKIB 2WINA 2DYPD 3MQIA 3V4VH 4OZ4A 1Y6KR 5GS3A 4RIRB 5GS0L 1N0XL 5F7WC 2APVA 1MI5B 1SEBA 1TZHA 3QBTB 4X7FC 3ARFB 1B88A 1HI6B 1WIUA 4GKOA 4J3VA 3T0DA 1P9MA 4DAGH 2EYTA 1W72B 4RX4D 5SWZE 4RFEA 4EDWH 4KZDH 4YZFE 3SE4A 2D7NA 2GJ6E 1EEZB 3WMSA 4XPAH 3MJ8A 3NPSB 2XZCH 1OAUL 3B3IA 4MD4B 3ZKQD 1OSPH 3G6JE 2NY1B 3QUXB 3TYFB 4QHNB 1H5BA 4H5SA 2OCFD 3ZKND 4YXKL 4Z8FH 5EIQA 4PRID 3VCLA 1B4JL 3O6FD 5DEGB 1DQQB 2B0SH 2DAVA 4EIGB 4G6FD 4PJGF 1NFIB 3QI9A 1F6LL 2G9HA 4KK5C 5KSUA 3UZEA 4XWGH 4KMTH 2IWGA 1PFCA 4Y4HA 3ARXA 3FOMA 2A1WL 1ZE3C 4HXAH 4EDXA 3H6JA 4PRIE 2PN5A 3G5YA 3NACH 4N8PA 3E6HB 3ROOA 4X98A 1FRGH 1KJVA 2YBRA 3NMEA 1RIVH 1NAKL 1CWVA 4PBWD 1HSAB 2X70A 1VACA 4LSUH 1KPVA 3I75B 4C59B 3MRLA 4JFDB 2GHWB 5BZWA 3OJ2C 5A3IC 4NKDA 1L9NA 5EOTA 3ARVA 1Q8MA 1YNKL 2XV6B 4M7LH 1KT2B 5L88H 2WUCH 5E1AA 2DTML 4HJ0D 4Z7VB 2VXVH 2Y9RT 1LO0H 4MVBD 1AGEA 4P2OB 2D2OA 4XPHH 2EDFA 2YA2A 4GXVH 1FH5H 4U6TA 1FL3A 3E1F1 4U1JA 3FB5A 4ZTOH 3DXAB 1D5ZA 4Y4KA 2FIKA 2DQFA 1QFWI 4NN7B 4N68A 2FSEA 3KLAA 3MRPA 3QFJA 4HIXH 2DF3A 4Y2DD 1P7QB 4HBCL 4PJHE 3SE3A 3PL6B 5EZIH 4LLMB 1R24A 2AQ1A 4KROD 2DQEL 5EUKA 3MNVA 1UZ8A 3RTQD 3RU8H 1BFVL 2IF7A 4LLDB 3IETB 2H2PD 4NKQB 3H42H 5FAAA 4KI5D 1JZ5A 5M95B 2GSGB 3OKLB 1JHTB 4C83B 5FYLH 5I9QB 3UYRL 1QA9A 1JWMB 4KC3B 1NFDF 4DN4H 1FG2B