4JS7A

Crystal structure of d78n mutant apo form of clavibacter michiganensis expansin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulose binding protein
publication title Crystal structure of wild type and d78n mutant Clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
molecule tags Sugar binding protein
total genus 43
structure length 202
sequence length 202
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4js7A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4js7A02
2AE0X 5H4UA 4FG4A 4JP7A 2ENGA 4L48A 3FT1A 2G6GA 1OA7A 1BW4A 5GM9A 3X2LA 1WC2A 1N10A 2VXQA 5GLYA 2PICA 3X2KA 1BMWA 2BH0A 3SUKA 3X2NA 3X2JA 3X2HA 1BW3A 3M3GA 2PJJA 2JNZA 3SUMA 4AVRA 3X2OA 3X2PA 4FERA 1L8FA 5GLXA 3X2GA 3SULA 1WHPA 4ZM7A 3X2IA 4JCWA 4JJOA 3FT9A 3D30A 4JP6A 2HCZX 3X2MA 4FFTA 1HD5A 2KQAA 3SUJA 2PNWA 1OA9A 1WHOA 3ENGA 2G5DA 4JS7A 2GAEA 3CZBA 4FG2A 2PI8A 4ENGA
chains in the Genus database with same CATH superfamily
1OOWA 4PJ8B 2WIMA 4XNYL 1EPFA 3H2PA 2ARJB 1P4UA 4ZPVB 5C6TL 2RFXB 2HFFA 4M7LT 4F7KA 2OL3A 1INEL 1EFXA 2FSEA 1HHIA 1MFVA 3LEYH 4WSGA 3P9WB 2AXJA 1KB9J 3C2AH 4OCWL 3PGCB 4PMEA 4IM8A 5AD0B 4DO4A 3DURA 3TWYA 2PXYD 4HZAA 1YMMD 4KO9A 1FDOA 2OMVA 4ZX5A 5I17A 3HU2A 1MLBA 4ZTOH 2VDQL 3WD5H 4P59L 1X7QB 4W9GC 4XCYB 4ALAC 3QZNA 3BWAA 2DKSA 2FQDA 5J3HC 3FQTB 5GJTH 2GPZA 1CK0L 4BUQA 4K5PA 4A2HA 3ZT7A 1J10A 3G6JF 4PRPE 2R4SH 1WISA 5KG9B 3TIEA 2AFNA 3MCKA 5AZEH 2A9ML 3T1WA 4QXVA 1C5CH 4KMQA 3C5JA 4BFEA 2XNAA 3WS6C 4IKKA 4OI8A 2QHRH 5DJDA 1HKFA 1EXHA 2BIOA 43CAB 3QA3B 3HG0A 4P9HC 1BQLH 3SQBA 5CLXA 1W2KT 3UJTH 3TFBA 2JJSA 1ACXA 2H0EA 4WY7L 5D7SL 2F53A 1MEXL 4GSRA 1UJ3C 3GSVA 3O3DA 4IIQA 1CURA 4MNHA 3OKNB 3CFNA 2AEIT 2WVVA 1CR9L 4HKXA 2XUWA 1S7VA 1YDPB 4GQZA 4ETQB 4NJAH 4L4VD 5FGRA 5C09D 1KLUB 1MFEL 1QZNA 4GA5A 4L8DA 2CGZA 3PUCA 5EIIG 5TE4L 3FCBA 5IQNA 4ZPTA 5BVPL 5LXGL 2VWEE 3VXSA 4JY6A 1YNTF 1JZJA 4PY7B 4TNFA 4G71B 1ED3B 4F5CA 3OXSA 1AJ7L 4HPOH 1NBCA 1H3VA 3FTSA 1AC0A 4D8PA 3HKZA 1AI1L 1OAYL 2NY4C 2XVKA 4PWJA 2HLAA 3HMXH 4F7TB 3DVIA 3PPEA 4ODVL 2DM2A 1ZV2A 3RIFF 4KX9A 3HG1A 1MG2C 3QEQA 1ORSB 2AXWA 3B4NA 4JFPA 4JKMA 2K9UA 1SVBA 5EOQH 4ONFL 2DEXX 2CRIA 5B6CA 4PYGA 2IAAC 1WWAX 3G7TA 4YXKH 4A7GF 4LSDA 2BIHA 4PJIA 3FFDB 2WXMA 3AMKA 4JKNA 3QHFL 1MVYA 5D93C 5I16A 4XHJD 2YBGA 2OXHA 4J6IA 1GL4B 4N9GB 4UT9H 5FO2A 3SOBL 4S2SB 3WIHL 4TTDD 4W4NA 4PRPD 3QZWA 4QDGA 1K4CA 4UV7L 2LU4A 4CSTA 3ARED 3ROOB 3GTPA 3DGCR 1DBJL 3S5LB 5KSBA 2OQJB 4Z7VF 1O6TA 3EH3B 4CS0A 4OFKA 1ZPLA 1EA9C 3MMEA 3OZKA 5B38G 5E51A 1PQEA 1EO8H 3KYOB 3CZEA 3CDCA 5DEJA 2FWUA 1T4KA 3GBML 1AD9A 5DEFA 2KZWA 2D7MA 3OX8A 2NY1B 5LDSA 1QSFB 3TV8A 2NDFA 5IHBA 4ODXB 2Z3FA 4UM9D 2QPFA 1UEYA 3Q2NA 4LPCA 2DYPD 2QJDA 3UDWA 4K15A 4FQXD 1RZIA 3BIAX 1NBYA 2FGWL 4X6DF 2HRGA 5E2UH 4B3EA 3JT0A 1P69B 3ARBA 1G7JA 4HUXB 3ARGB 5LB1A 3UP1A 3ZGIA 3D30A 5MP6H 4PCTA 2VTFA 4UANA 1GZHC 3ZTNL 5E1QA 1AR1D 2CBTA 2AJ3B 3ZRCC 4JO3L 3CN1A 2GT9A 4U1IB 2EIMB 5A16B 1PYQA 4PJXA 5F0PB 2I24N 5HSFA 1UB5A 1I9RL 1KWGA 1M1XB 2FT7A 2XZAH 3FT4A 2ATKA 1L0PA 3VD7A 1IC5L 1N9PA 3KPPB 3MBXH 5BS0E 3LH9A 2EC8A 4ZTPH 2ICCA 4MQXD 4GMTH 4KXZI 1YEKH 1IEAA 2VSMB 2WBXA 3O2VH 3F7KA 4PGEA 4F57L 2WN2A 4YHOH 3IGLA 1FNGB 3B1UA 4DKEL 1GMEA 3GTVA 4PJGB 2MJWA 3QFDA 3KVQA 1YJDH 3SKNA 3LKNB 1NCBH 2BNRD 2HTLD 2BC4B 2IPUG 3HS9A 2FJFB 4OD3L 4WV1B 4QEGA 3S96B 4F3FA 5AOLA 1UZ6E 2B2XH 2DIBA 2PETA 2VW7A 4FMFA 1AKJB 4W9EC 2G2RA 2X53A 4AVKA 1KEGL 4ELKB 4R97C 3WTSA 4Q9RH 3HIZA 1ND0A 1VC3B 1RSYA 3IJEB 1MF2H 1OAQL 4NKOB 1G7MA 3MREB 1UKSA 3CHRA 3T6VA 1YUKB 5J1SC 3PABB 1UZGA 2B39A 5B1CA 3A6CL 3LZNA 3RWJA 5GS0C 2BS8A 1HX0A 3Q3GB 2VZUA 5CIPB 4M7JH 3V4VH 1YN6B 3WCYA 4Y4KD 3V0DA 2H32H 5GRJL 4PJ7B 2P5WE 1GY2A 2IQAA 4M5SA 4XC3H 2OMTB 2VOTA 4J3XA 3MOQA 5E9NA 3OBAA 2B20A 3GMNB 4J4PD 1FNSL 3GBNL 2NY5H 4XNUH 1M2OA 4KC3B 4DGVL 1Q1PA 1NGQH 1IC4H 1YEEH 2H0PA 4KH2A 3OKMB 4M56A 5E8EA 1KMGA 1J9QA 3T2LA 1LK3H 5I19L 2NY2C 5CAYB 2XWZA 3X2PA 4P05A 1LEKA 7FABH 1A3LH 4IOFD 3MRFB 5FHBL 4X7SL 2X9YA 3TOPA 2ZOKB 5FF6B 3QXDA 1FAIL 1XB6A 2VDOB 4LSRH 2PWFA 1FSKB 4J3OH 3S37L 4AY0A 1T03H 4OY9A 4FJYA 1T6BX 1UVQA 4GRWF 5INDA 4JRLA 4YL9A 4Z7WB 1PKQB 3BQUD 2CG9X 1TZIB 4OR1A 2W38A 4F24A 1QSED 3T3PF 1CFVL 5CN3A 4G6JL 2FUQA 1ROCA 3ZDYE 3OQRA 4MMYA 5EORH 5BS0D 2WQVA 4X83A 1T04A 3L3GA 1PFCA 1NMCC 2AABH 5HI3D 3U1QA 4HQQL 4ZFFB 4H13C 5CWSA 1KIUA 2R4RH 3MLVH 3EJRA 4TTGA 4YHNA 5JHBA 1X5XA 1ITCA 3B7TA 4PRIA 5BOJA 3U36A 1KJVA 4MHHI 5FK9B 2OK0L 5DWUL 4EI5D 4FQQA 5HDOA 2WXHA 4KJPC 4Y16A 1I8MB 4NP4H 3LRSB 1GYVA 3F7VB 1QO3A 1WRFA 1VERA 4MD0B 4HIXL 3G6DH 2FR4A 1AH1A 3BZDA 1A3RH 1P6AB 1Z3RA 3L5WA 3JVFC 4JFFE 5C1MB 3BT2L 2O6DA 5D7IA 4ONHB 1EDQA 5FB8B 3QH3B 4Z3TA 2W5PA 2J2ZA 3JV6A 4BE6A 4FCHA 5MEQA 1FL3A 1WS7A 1VB9A 4HU2A 2IWGA 3E3QC 1E9PB 1TPXC 5L6YH 4NRXA 3S5YA 5ALBH 2P5WD 3BGAA 2ENPA 3MLSH 3QB7C 4G5ZL 4H8VA 1KN4H 4HHAB 3ILEA 5DFVD 4F7MA 1X6LA 1HE8A 3PWJB 4TSBH 4ZRGA 2AQRA 3EYUH 4K71B 2BVQB 5B22A 4F2MB 3O9WC 5C0EB 4X6CB 1H9DA 4AWJC 3VD2A 1IGYA 4RFNC 1U91B 4ZNCD 2O4EA 3CN4A 3RB5A 1WGVA 2J55A 3UTOA 3C8KA 3I6GA 1P9MC 3M8OH 1SIWA 3Q1SH 1XF5A 5B1JA 2QQLL 2D73A 3HZKA 4FQ1H 4RCAA 4W6XB 3ZXAC 1CT8A 1KIQA 3GEWB 1KIRA 2JJTA 4LOUC 2DQIL 3ZE0B 4RETB 1CXIA 4H8UA 2EIZB 1CFTB 2WLLB 5HDLA 1RAMA 4GRLC 3W9DA 2FH6A 12E8H 1QFPA 5LNEA 3E8UH 2ZUSA 2XQYK 3APDA 4GB9A 43C9A 5E08H 5DUBA 2AK4B 1BZ7A 4AQZA 3VRLE 4ZX3A 5KW9L 3GS7A 3HB3D 3QUYD 3RUGB 3IJ8A 3N6YA 3RU8H 1CLVA 3SDDC 5KVFH 1Z66A 5CGYD 1TU2A 3TM7B 5AVXB 2MNJB 4AK1A 3M1BA 4M93B 4X8JA 4LCCB 5CEXA 3AMLA 4PW9A 4L8SB 3BUDA 5LG1A 2XWCA 2CR6A 5DLMH 2Z6FA 1JHLL 5EEYA 1NSNH 3EDFA 4BQ9A 5EU4A 3CDFA 2P43B 4JFFD 1B2WL 3KPQA 3W37A 1O6SB 3DRTA 3IJHA 4HXBL 2DQFB 4FFZH 3OKLB 1ONQA 4WO4A 5MEOB 1EJFA 4XPBL 1HSAB 1HXMA 3S34L 4C2MA 1X44A 1P84K 1DDHA 4ZUUB 1GGTA 5KVMC 3EOBA 3HE6C 1CFNA 1MRFL 4X4YB 3ECUA 2BNQE 1WBYA 3ATBA 3F7PC 1VZGA 1BYOA 2ZWSA 3FMGH 1Y6MR 2WLKA 1TYJA 1ASOA 1YQ2A 1RUMH 2P5EB 3BQVA 1UG9A 3UJJH 3S8WA 1Y6NR 2RALA 4ODWB 1T22A 5T3XH 4EDWH 3EUUA 3H3PH 5IESH 5MERA 3W0WB 2ZOWA 3NJNA 4MBRA 2H45A 3L5JA 4OFVA 3GUFA 5AAWA 2GEQA 3FSWA 5EFIB 5EZJB 4RDQF 4P4KD 1AO7E 1JXKA 3VDAA 1IM9D 3JBG7 3MRGB 1INQB 3Q13A 1OW0C 5I5IA 3L95A 2QGEA 2XG4A 4H5SA 4R4FH 4KDLA 5L88H 4PW4A 3ULVC 3D7PA 3VXMB 3IJ7A 5DQ9B 3QFJB 2G9HB 1G6RL 2WBKA 4MASA 3ZDXF 2CLZB 5HHMB 3GXIA 2ROXA 4QYOB 2DKUA 1TVDA 3W39B 5AOJA 5JDJA 4PWKA 5I75B 3MRKA 4HFUL 2JXMA 1P4IL 3FONB 3RIAF 3QIUA 1A7NL 3SE3A 4NDMB 3VXTB 3RI5K 1XF3B 4OZGB 5J7CC 3WHE1 3B2MA 5EIVA 1QACA 5I6NA 3WNIA 5IQ7H 4WCYL 1HHKB 4LZKA 3T6XA 2GSGA 4UINL 3KLHD 5GS1B 5C0JB 4NLAA 4MNQE 1LO0L 5L8JB 4M5ZL 5E7FA 5LN4A 4FP8H 3ISWA 3NCWA 4XMVA 2LLGA 4HKBA 4F9LC 3WEXB 1AQDA 1BQHB 2I60H 4ES8A 3HMXA 3MLUL 5EZLB 4R5VA 1E0OB 1IVTA 1JGUL 5B21A 2CGYA 3LH2L 3DLQR 2Y69B 3L4YA 3QDAA 5I1LA 4AEEA 4FI7A 5L2KB 2OMYA 3FO1B 2BNQD 4XP5L 3P11H 1XCQB 4M6OL 2VDPB 5FO8B 4UT9A 3QUZC 2JIMA 4LPTA 2Y07H 3EYOA 4OFYA 2YK1L 2GJ6A 2ZKXA 2VLLB 5KUMA 5LCVL 2WNGA 3SDXE 4OZHB 5KVGH 5EG6C 1BHGA 3NSJA 4HCGA 1MW3A 1A6AA 5JTWA 1HEZB 5LBSL 4YBLB 5E5RB 1BVNT 4GIAA 4LDOB 4LP4A 4JFYA 5C0GA 1AO7D 2BP0A 1LP9B 1LLAA 1KF9B 2WZ6A 3PY9A 4IU3B 1YNKH 1R3IH 3TWCH 2NTFA 3FQRA 4YC2B 2F19L 1DVUA 3BFOA 3PGDA 1FE8H 1AP2B 2PXYB 3N1QC 1YMMB 1HILA 4WWKC 4ODHL 2WP3O 1JD7A 3GMMA 3QUML 4LF3B 1RZPA 5CINL 4Q4EA 5B3NA 3UXFA 1YQVH 3B34A 3S4SA 3ZKSD 1YEDA 3OR7A 5EU6A 4Y2DB 1R3LB 1DVYA 2OCCB 3HPLB 1GCFA 1CDGA 4N1HB 3NRPA 1KJMB 5I24A 2B1HL 2PCPA 4IRJA 3AS3A 5DD5L 5MEPB 1IILE 1FWXA 1DVFB 4PWFA 1UZ8A 3FQXA 2PP9A 5BV7H 4LQFL 2HT2D 3MV9E 3BZFB 1HXYA 1JWSB 4WU7A 5E6IA 1KXVA 5CFAA 2BVEA 1A2YA 5EUOF 4Y9BA 4MNQD 3TPUA 4JM2D 4M03A 3P2DA 2R1XA 2MHAB 4ILDA 3WN5C 1FVCA 1UOKA 1IFRA 2CGRH 4NZ8A 3ZTJH 4FTVA 2DJ4A 3UADA 5CCKH 4DZ8B 3FF8A 3FRPG 2AXGA 2UXTA 4WUKL 1NFKA 5KZCD 1O9WA 3OB8A 3WMQA 1A1MA 4LLWA 1NFDA 2A9CA 4PJ9A 5C09B 4PJ8C 3UZVB 3WXWH 3CHPA 2JJWA 4WK2B 5FO9A 5TPWH 5IOKA 3MAWA 5T3ZE 5FA3B 4RAUB 5KN5A 2VO5A 3L4UA 2YAQA 3VH8G 5HVGB 1R3KB 3SDYL 3QIBA 1CCZA 3WTUA 1KULA 5DRWB 3OSKA 5FYJH 5DJXA 2DF3A 4CGTA 2GTWB 4EN3C 2AJYH 3QJVB 3FB8A 3V4VA 4DKFL 1F6AA 4ALAL 3D3VA 2H32A 4XMZA 3M45A 4KROB 3REWA 3B9KA 3MRNA 4FEIA 3FS9A 3GMLB 4B95C 4MZ2A 4XWGL 1VFBB 3D4YA 1JRHI 3D0LA 3QDJA 4HS3B 4UMGA 3UTTA 2OV0A 1U8NB 3ALWA 3VFMA 3NFNB 4HLZG 5FXCH 3U4KA 4EN2A 4J6RH 3CDGA 3K2KA 2BHUA 2ORBH 4PWIA 5CSZA 1ECYA 4Y4HB 5ICXB 3UABA 4DP2X 3NBNA 2XXGA 1JZHA 2Y6TE 3AREB 3H56A 4HDIB 1Z9PA 4P9HL 1P4LA 1MQ8A 5JNYB 2AQNA 2VRAA 3VFPB 2PNWA 3DK0A 3QSKB 4QCIB 3NTCH 3N44B 4S1QL 3DX6B 4WW2F 2Q5BA 4BK5A 5DZJA 5E5MB 5IWLC 5JIQA 1MVUA 2IPUK 4EUPB 5HVHB 1G87A 3GNML 1GGIH 3GC3A 2WZ5A 2KH2B 5EEVA 2QHLA 3G08A 4UTBL 2KLRA 3LZPA 4RGOH 4TSCH 3W3BA 3GSOB 3O2DH 5KBKA 1RUKL 2RQEA 5DFTA 1PDKB 2YD4A 5DJZA 4BIKA 1OD9A 4D3CL 5AVRB 1CU4L 5EULV 5GRUL 5EU3A 1BLNA 4BCZA 2BERA 4WI8A 2VC2H 3NCMA 5DSCB 5T3ZD 2BRRL 1NLBH 1UWXK 4YUEH 2FAUA 3JZ7A 3PWNA 4L9LB 1URIA 5C0BE 5T5FL 1UACH 5I66B 2C5DC 3IWVA 1IZKA 3LKPA 4E42A 2GW5A 2PPAA 1M2VA 2WKLA 1JFQL 4Z7OE 2HWZL 1EWHA 1T7VA 2AQTA 3TTYA 4LBEB 3FBKA 1I1FB 3ESOA 3FCGA 1LEIA 3FHAA 4XXWA 4NOFA 4TQHA 2DLFH 3EGXB 3BH8A 5C92A 4WSJA 3V8OA 4JS7A 3HN3A 1NDMB 3BFQG 4WUUE 5CILH 4XBPB 3DI3B 2Y72A 1NJ9A 3TBSB 3GJEB 3P3UA 1MFMA 3KPOB 2X4NB 3X2KA 4JN1H 3KDMB 5TFSH 5DRXA 3SPCA 2RD0A 4OCXH 5E9DE 1AGBB 4U31A 4K3HA 1YEIL 3MRLB 5IVZB 2AK1H 2QR0A 3BYTA 1QAWA 4JO2L 1ZLEA 2GY5A 1KZYA 2Y25A 4WKZA 3CU1A 1QNIA 2JCCE 1MY7A 1U8OB 4HJIA 1RJYA 5CM1A 2NY1C 2VLKA 5FUZL 3CVIL 4B9FA 4R84A 2E6QA 4KJYB 5EBWB 2VDLH 3MRPB 4Y4KB 1UC6A 4DVRH 3MLTA 1NAMH 1TJGL 5F1KC 4F8OA 3EYFA 5I2IA 1X9LA 1GOGA 3D4CA 5GGRA 3C9NB 4BK8A 4OJFL 3DXAE 2BP5M 2EKSB 5AB9A 3ARGC 1KCKA 1W9XA 3KLLA 4K7FA 1HZHL 1X4ZA 3KXFB 2HJFB 3TBTA 5ANMA 3WFHA 4Q7DA 1TWFA 2DQEH 2KQAA 3S98A 2IDQA 1PIGA 4YMPA 2RHEA 3TIDA 1SYSA 2EH8L 5EOCL 3VD5A 1T2XA 3PWLA 1EANA 5M7QA 5C0BD 1KC5L 3QUXD 3HZVB 1ES0A 3WNJA 4O4YL 4OGQC 3ZDZF 1I8LA 5IROD 3WL9A 3BQUB 2Z64C 1BFSA 5EWIL 1Z9SA 4FFZA 4FYQA 5CJ8A 3AWEA 1KEMH 5IB1A 1S3RA 1G7PB 5BS0B 1U8LB 1JI2A 5CS7A 1TEYA 3CBRA 3NA4A 2CIIB 2UZIL 1IO4C 3FU9A 4M8QA 1MFAH 3MRDA 1NGPH 1S9WA 2DQDH 4HGKC 3VXRA 5A7BA 4WV1C 4WUUD 1TLMA 1CGVA 3X11B 3LPFA 4ZQKB 2O5XL 4HOMA 1KTDA 4QKTA 3U7AA 5ERWB 5GPRA 5FFGA 1MAKA 3BJLA 1RLWA 1UT9A 2JK5A 3SQOL 5DYOA 3NFPB 2BSTB 4KJWC 4XZ4A 4OAWB 3ESNA 5E9DD 4BZ2H 1FFOB 3ESPA 5FKAA 5D5MA 3LQMA 1E42A 3CAFA 1VHPA 5GS0L 4I1RA 1VEMA 4R7XA 3OTTA 1CVRA 1RERA 2B1AL 1CL7H 3CFJA 1BYPA 2WZPD 3UC0H 4E9LA 1UUSA 4KUCF 5BQ7B 4XP9L 3WLWC 1M6OB 3SGDH 4RMWA 4S1RH 1OP9A 1DHKA 1QYGL 4KK6C 4NYLB 3TJHD 2E2IA 3ILDA 4FQCL 2P5WB 4YDKL 4U1NB 1XGQB 4JFZH 2CUAA 2Q8AH 4PBVC 4DJMA 1SFDA 2KZKA 2A77H 4KWUA 4UT6L 1KLGB 3DXAD 4NAJA 5GGVH 3E1ZA 3L9BA 3CDZB 3QZWG 3QQDB 4QO1B 1OTUC 5D4QA 3QCVH 5DA0B 5HD8D 4GBXA 3CZGA 4ZMNA 2WSKA 4UYQA 5FCUL 4NQQA 3LS5L 1ZIBA 1MJUL 4F7PB 3LV3A 1FSKC 2G60H 4HS6A 4AEIL 1XF2B 5FTNA 4X7CC 3MCLH 1MSPA 3FO9B 2A6IA 4P4RB 3OM3B 2EXSA 5E7BA 4QRPB 3WNPA 4X6FB 3IJSB 4U6TA 2KS0A 3GXFA 3KJ6L 4QRRA 1MI5B 2H47C 5EPMB 3MYJB 4IOIB 1QLFA 4XVTH 3OLDA 4WTXA 5I0YA 4KDVA 4W9JC 4PRBB 4K5OA 2GABA 2GY7B 2X3CA 4HIHA 3VO0A 1RV6X 3ZDYB 4PVMA 1CLZH 5FLUA 2XTJE 1UHVA 1E61A 2YPKB 5IMLA 2OMZB 1KGCE 3QCTL 5ISZE 1N64L 1M9SA 3HB3B 2VNCA 4QYAA 4ZMTA 3CUPA 1U8JB 1GMIA 4RA0C 4YZWA 4CMMB 4XNDA 1T2JA 2OZNA 3WTWA 3X17A 5D2NE 1PD1A 4FRWA 3SJVA 2FHCA 3T09A 3VGBA 1GGCH 1S9KC 3BJ91 3H7BB 3CPLA 1BM3L 1OANA 2UZPA 3VCLA 1H0DA 1OK8A 5BRPA 2HJLB 3F6IA 3ZR5A 3KEDA 3O41B 3P4MA 1BCIA 2EH7L 1FL6A 1V3JA 1F4WH 3GMOA 3HC4H 5HYSG 4JFFB 5AAPA 1ODAA 4M8UA 1E4JA 4URKA 3MA9L 1NBVL 2XXFA 3ZTEA 3HHRB 4R5TA 5DUML 4EI6A 2Z34A 4AGPA 3TCLA 2GAEA 3JWNC 4K71C 2WLYA 4JJ5B 1IBGH 4D9QE 4LKCA 1AAJA 3TO4D 3O6ML 2AI0L 5ADPH 3W11C 3C5ZD 2D03L 3F8UB 2XA8L 4Y5YA 3P4LA 1W72B 5IGXL 2WO4A 4LKXA 4TF4A 3DV6B 4AC4A 1TTAA 4B97A 3BSZH 3VFNA 1HS6A 1PD0A 2BVUA 1OP4A 3E1F1 1BBDH 3WUWG 3SGJA 2VITA 4N8CL 1FH5H 3JWDH 2RGSA 1IM9B 1BFVL 4LLUA 1FGVL 3FN0H 5SV3A 4ODTL 4JANA 4DP4X 2DQJL 1KPVB 1YG9A 3QGVA 4UQ3B 4DFHA 1FFQA 5CU9A 2NSXA 2V8MA 3RVTC 2EEBA 2FX9L 4MJHA 5E6SB 1K4DA 5IMOB 4QY8B 2OI9C 4AZ8A 3V5KB 2XTJD 3ZQWA 4OV5A 2CLVB 1FI8C 1BECA 2C9QA 2GG1A 2UWEA 1KGCD 5CBAA 5ISZD 2N0MA 5K39B 4M93C 2MRYA 4YDLC 3TO2A 4LCCC 4XPHH 5LQBL 2ENYA 3BP4B 2EZ0C 3LSOA 4Y2OA 5E8DL 2GUOA 3KWWB 4PTUB 4FNLH 1C12B 4AGOA 1AHWA 5I1EH 5F6HI 2VZ3A 2AGJL 2WUCH 1CTOA 5CZVH 4DP7X 2D8KA 5CCJA 1KB3A 2JKJA 4G7YL 2K6YA 3SEPA 4JFEE 4CRPA 3BC9A 3LS4H 4E9XA 3MUUA 3N04A 3CGTA 5KYYB 3UBXA 4WI5A 2FO4B 2BSSB 1YLBB 3WDJA 2GJRA 3RZCD 2ADJB 4ELME 1MNUH 3FO2B 4MQ7B 5FYKL 4CMHB 3L4CA 3O2WH 4PB0L 4KO6A 2G3MA 2YPLD 1ZLSL 3CZBA 4OCYL 1XBRA 4B41A 2BNQB 4JQVC 2X2IA 2V2WA 1HYSD 2NYYC 2Q20A 3WFEH 3QXAA 5DVKA 2VZ1A 4WFHD 3UBHA 1XAUA 1SY6H 4FQJH 2YRLA 5LGJB 1SHSA 1ZS8B 4Z7UA 3US1A 4X9IA 3ULVL 4YSAA 4Z3EA 5IOPB 3L16A 5FV1L 4RMQA 3MJ8A 2PPFA 3P0YL 3L3KA 1MCDA 4FG2A 1M7DA 1JK9B 2DQHL 1JSYA 4IRZH 4ZTEA 5IJVA 1NOAA 3QNZA 3RJQB 2ZCZA 3IDGB 1PY0A 4POYA 3CSTA 1ZTXE 2ZUVA 1Y1DA 2PW2A 3HLKA 5FDWA 1GHFL 5I75C 5I8CB 2BY3A 5DTFA 3ZL4L 1QVOB 1UQSA 5AB0A 1JZ2A 2GAZB 3O2DA 3EO1A 4W1TA 4ZO9A 1JNLL 4MJ5A 1NPNA 2D0FA 2EDJA 3KPSA 5CD5D 3RVUD 4NWUL 5I1CL 3FFOA 4JHBA 4OZIA 5B39B 1PX8A 2C9UA 2QKSA 5BRZE 1NMAH 2FLMA 3MUZ1 4XH2A 3TA3D 2DRUA 5GS1C 4U3HA 1KENH 2E6PA 3F7YB 3QDMA 1FO0H 1JVKA 3LMJH 4NQDA 4YWGH 1JPGA 1M05A 4NT6A 5GZND 3WOVA 1OE2A 2LU7A 4H1LG 1ZVHA 3VX1A 1BGXL 4MNQB 4CN1A 2B4CH 5CFHA 4JM2B 4HUMB 5LN8A 4I85A 4JFED 2X28A 3QZPA 3WJMA 2E7LC 1E28B 5L9DL 3K4AA 1J1OL 3SE6A 4CVXA 2DW5A 5AYQA 2EADA 5FO7B 1EAQA 2Z4TA 1Q90A 1AG6A 1WUNT 3GTLA 3FCTA 3PWPE 4PJHE 3HVNA 3SZ6A 1U8MB 4WKXA 1ZT7A 2WWMD 5E4OA 3CC1A 4Y19E 4IBUA 4G11A 2CR3A 3DDFA 2BFGA 1VCBC 1C5DA 5ESQA 2CO7B 2G5DA 3SD2A 2D3JA 1VRSA 4EZMA 2K6WA 3D25B 4LRNH 4CVZA 4PJAA 2IPTH 4XNYH 3V0FA 3RX5A 1WA1X 2B15A 3NAAL 2O5YH 2DWXA 2Q9OA 1D5XA 1U2HA 3HNVH 1JN6A 4YBLC 1QWNA 1INEH 2F5BL 4K8RC 5D2LE 5D70L 3SDXB 3CH1A 3D69A 3QXWA 3U0TB 4NRYA 4R4ND 4OU3A 2R0LH 2DIEA 2OMWA 3GHBH 1TFPA 1I3RA 2JE8A 4KTGA 1EZVY 3OLGA 4JFXB 4YC2C 2UXGA 2EUXA 2P44B 3CFIC 3CFBA 1EZLA 2PXYC 2Y36L 2JQZA 1KZQA 5KEZA 4YZFE 4P59H 3TF7C 2H8PB 4G9FE 5HI4D 5CLWA 2RR3A 3K6DA 4JRFA 1RULL 1G0YR 1OGAA 3MV8E 1JV5A 1NAMA 1BIIB 3VMOA 4PRHA 4AGQA 1N59A 4JY5L 2JB6A 4YDVB 3T2PA 2ZUXA 4PBWD 4B0MM 4E9VA 2IO5A 3LPOA 1DVFC 5I15H 2NX5E 3VD1A 3Q0HA 3EYSL 3FQUA 3TL5A 5BRZD 2OSLB 3A22A 4X7EC 3PXLA 1T4WA 4B9CA 1NIAA 4NKDB 5LNDA 2R8SL 3MV9B 5F89A 4PJDA 3ZW3A 3II1A 1X9UA 1GJIA 2JIPA 1UTDA 2BVYA 4FCAA 5CJXC 5IV2A 5C0NC 3ECBB 1IC0A 3LCYA 5HYQA 3ZKMD 4NQEA 1LE9B 1A8ZA 1CG9B 4TM9A 4HA1A 2VIRA 3VI3F 3E6FB 1CR9H 3V6FB 5LUMA 1V8HA 4OFIA 3HPJB 5JW4Q 4WK0B 1N19A 3SPVA 1IKNA 1R5VB 3PWPD 4GFXA 2I26N 3DRQB 3VNYA 4WNSA 3EJJX 3KHQA 4DP8X 1BEYH 9CGTA 1TWCA 3B9DA 4GRWH 2WNXA 3KPRA 3C60A 3P9MB 5IEKB 2W81C 4NQCA 4ODSL 1RPQA 1NDTA 5F7BA 4C59B 3L5XH 5TQ0H 4GFTB 3EO9H 2GSIA 5B38B 4N0RA 1B6DA 3QJZA 3WIAA 4BZ2A 4U7SA 1OAYH 2VXQH 3IE9A 3L4WA 4ODVH 1DBMH 1S9XA 4N2CA 2C1OB 1ZDSA 4JZOB 4N6RA 1D6VH 4R26H 4W9ZA 2YEVB 3FB6A 3RNKA 4KROC 3TBYA 3VA6A 2YMOA 2O61A 3ZYZA 3HTLX 4O2FB 4HIPA 4ZFOB 4WI6A 2A74B 4BH8A 4K9EH 2H9GA 1XEUA 5EZOH 1AIFA 4M6NH 3DUSA 1R24B 5KBLA 2IPKB 1AQKH 1RFDH 2JKLA 4RX4D 1OQOA 5J6HA 2O5NA 3RFZA 3OJDB 2V7NA 5FUCE 4G80B 4DN3H 2IDCA 5D6DC 5E99L 2CK0L 4LNRB 4TTDC 2HKFL 4JHVA 1A6UL 2G2NA 3GRWL 2XZCH 4Y4HC 1ET7A 1YN7A 4I2XA 3MLXH 1DJYA 3AREC 1A14H 2NX5D 1F90H 1NGWB 2D31A 1PAMA 4MDJA 3RAJL 3MLYH 1F2QA 3LN5B 2F53E 2R9HD 2VXUH 1LQSR 5D1XB 4OLWH 1FZKB 5DJ8A 3TJPA 2AQQA 4P5TB 1MCOH 5HVHC 4FLRA 4LEXL 2X5PA 3PV6B 3UL4A 4WGWB 4TXVB 2JMRA 1E2VA 1KIPB 3VUAA 1G9MC 3QO1B 1WGOA 4KVPA 4FA6A 3UGXA 3S4SG 1TTUA 3OKOA 1HH9B 3D2TA 2GHWB 4ZFZB 4XNZB 1Z32X 5F1NA 3VXSE 2A9NL 1SJXA 1DQDL 3ZX1A 2XYBA 4Z95L 3DHUA 5EIQA 1J8HA 3BW9B 3NEOA 4F5CE 2V17H 1IAKA 2Z8SA 3ZBMA 3WKQA 5T1KD 2F8OA 4L9LC 2VWEC 5I6LA 3ILPA 4JDVA 2XXMB 3A6BL 4OTXH 3C08H 3DA0A 3RGVA 3FPXA 3HG1E 3QEQE 3X2LA 1HSBB 4KHXH 4HKJB 1MW0A 4WI7A 3QUXB 3DK2A 5BZDA 1ZHBB 4QHPA 4PJIE 3GLEA 4FLOA 1OWWA 3CHSA 1UWGH 4MQXC 5HJDA 4Z7OB 4AYBA 1IAMA 3SBWA 2ZT9C 4JFQA 5T5NF 3GS0A 1XL4A 5E03A 5C7XL 2I7SA 3LRMA 1RZJC 5KSBE 4NM8L 4XN9A 2CHXA 3L3HA 3R7RA 1A6ZB 4WUUB 5GSRA 1M6UA 4DCQA 4JHAH 1UA3A 2WVTA 2YAPA 1DO6A 4HJGB 3TEZA 3U4EB 2UY6A 1RP9A 3BSZA 5C3LD 1E4XL 5B1AB 2EDMA 1IGML 4C4KT 4OLXL 4DPAX 3CIAA 3EO0A 4K23L 1C7SA 1J86A 1GYUA 2F53D 3RP1A 3V55A 2R23B 4M6ML 4BSWB 1JPSH 3VXQA 4OJEH 4Y4KC 2JCCB 1S7RA 1DQQA 2XN2A 2WVUA 3QWOA 1BZQK 2M26A 4MRCA 4GP4B 2MCAA 5JMRA 1J5IA 5I5JA 4P5MA 1FRGL 2GCYA 1SJMA 3QHZL 4DZBA 4J4PC 4HZ1A 3B2XA 3QIWA 3AQYA 4WU5B 2YR3A 2GQHA 3DX9A 1ZEAL 4MX7B 3LZLA 3WJJA 1KCBA 5AWNH 5AG9A 1EHNA 3L3DB 3VXSD 1JGVL 2AITA 5K9KA 3DXAB 4PV8B 3MX0B 3ATAA 2FBJH 2JQMA 2ZXGA 5FYKU 3HR6A 4X7SH 2FATH 4PJXE 3X2IA 4IOFC 1JPFA 1X3DA 1GKOA 1N2RA 4ZMQA 5KSAA 4J3OG 2VN3A 5C9JA 1DQTA 1JWUB 1U8IA 5F9JA 3ZMEA 1N7MH 2R2HB 1MW1A 2WUBL 3IDIB 2R56L 1CFVH 3BQUC 3DYMA 1TNNA 2AQ3A 5AVZB 2E9WA 3BAKA 3M46A 3IFOB 4NKIL 4Z6AT 3S88L 1J8KA 1OKEA 2XG5B 2FJGB 5E6UB 5I1DA 4W93A 1VGEL 3ARSA 1MCPL 1K2DA 2WGNB 3WFCH 1U8PA 4FMVA 2BWIA 2R39A 3FT3A 1PLCA 1MRCL 4ERSH 3X2GA 1LO2H 3CX2A 2FT8A 3DIFB 3MR9B 1YNTA 3IR6A 4G7VH 1SGKA 1CBVH 3RKDC 3LQAC 1HL5A 5JLZA 3FT2A 2W91A 4DGIL 1JYWA 3WNMA 2DOCA 3V7MA 3UPCA 4PS3A 3NZ8B 1OLZA 3O4OB 3VXNB 2NOYA 4NO5A 4YVNA 4CJ0A 3G04A 1SY6A 5K9OB 2NY7L 4DOHB 1YECL 2HFEB 4R0LB 1KGJA 5SWSA 4L0ZA 2BSBA 3TBWB 1NC4D 5CR8A 1A47A 2XWBA 2GVYA 2OAAA 4XVSH 4Z76B 2DICA 4FEMA 3V7AE 2VQ1B 4N6QA 5DRZA 4FFVC 1QEXA 4NUGL 4U3SA 2IDFA 1AS7A 2HPOA 4IRZA 3HRZB 3S2CA 5DFVC 3RTQA 2AMUA 3UZEC 3ARBD 4HKZA 4P5RA 5I0VA 3AQZA 4FHBD 4Z7VA 1VF5C 3U6RB 3APNA 4ZG1A 4L1DA 1TMOA 3TO4B 4GY4A 2YXVA 5LKNA 2VDOL 4JZJB 1UD2A 4FXTA 3A67H 3BUQA 1UH4A 3HC2A 5GGSB 5GRXG 4P9MH 4AJ0A 4YGVB 1SJEA 3RPIA 4C57C 1FO0A 2HFGH 1B0RB 1XSJA 3G5VA 3QO0A 3CFDA 4QXTB 1CGSL 3PS6A 2QKIA 1T83C 2VDRB 3NIFE 4K7PX 2BP8A 2NY0B 2X44D 5FW6A 3RWGA 4APQA 4XXCC 2UVEA 2DH3A 1G4RA 2ZWLT 3B3IA 1ZA3B 3NIGF 3HRPA 4U1SB 3X3FL 2WZAA 4X6DA 5KYUB 4YSUA 2WZ0A 4KUZL 5TF0A 2YMTA 1F8TH 2VO8A 4JFOB 2EDWA 3B2VH 4BH7A 2A73B 1OSPL 5A2AA 2X70A 3GZKA 4I0PA 4MJ2A 2C9SA 2C9RA 4MLIA 4N2AA 1MCIA 1TVBA 5C08A 5TDPA 5J12B 3MBWA 3CSPA 4NZTH 3JV4B 4LBAA 1AFVH 3HB3C 2XTJB 1OK0A 3QUYC 5DD6A 1FG2A 4LB8A 3K6SB 4UQIM 5CGYC 3EAKA 1V7ML 4N3TA 5ISZB 4E5XG 3GMQA 3MNZA 2FVNA 5D7IE 1XEDA 4X6EA 5DHVB 1IGJB 1JZ8A 1MOEA 5E94B 2J1WA 4LAQL 5D2NB 1ODUA 4LCYA 4Y5XB 3VFGL 4X5PA 1ZLWH 3OAZH 2VDNB 4MXWH 3SKOA 1R6VA 1VAHA 1XR8B 2J6EH 4B5ZA 4TLSA 1II4E 3R8QA 1PQZA 2IV8A 3UO1L 3VW3H 1Q0EA 5IQ9B 3B3BA 4P3CL 1OAUL 1JMXA 3W5NA 3BRFA 3I3DA 3LXBA 4TVUA 4AOKB 4UQAA 2ADIA 2A3TA 2VZTA 2ICWA 4FABH 4QAMB 2AJXH 5DZOA 1FBIL 3LIZL 4FNRA 1CI3M 2PI8A 4OM1H 1T5WB 3HJ0A 1DSYA 2Z7ZA 1YEHL 4AIZA 3KYMB 4KTEH 3EDKA 3FU5A 4M62H 1X7SA 2Q7AA 3D2UB 1VFOA 3HFMH 2PYEA 5DO8A 4L37B 3FKIA 1V55B 1AXIB 2FL5B 2Y5TB 3JTSA 2ITFA 3DIVA 3NFSH 3X13B 1JXDA 4Y7MA 4D9RD 1WCMA 1IAIH 1U36A 3TH2T 5I23A 5AVTB 3F04A 4Q9QL 2FD6L 2IMMA 4FXKB 4X98B 4P8QA 3SCMA 3KZ8A 1G6RH 3OJMB 1WT5A 1FFNA 1KJ2A 4P2CG 4JVWA 4PRID 2BOBA 2ZNWA 4OBSA 1BMGA 2MFNA 1I7ZB 2QVTA 4MA8H 3H55A 2XHNA 4Y16D 1A7NH 3IRPX 4IEFA 4DVBB 1ZSDB 4E9TA 1I82A 3MROA 2WO2B 3VXOB 3T1FA 1OM9A 4FA8A 3K80A 2NZ9D 3L9YA 2X7LA 5E4AA 3H0TB 3SY0A 4A2EA 4OF8A 4FZ8H 2B14A 1CICA 1WHOA 1TQSA 2WXOA 3A0OA 3GMPA 1MHCB 1Q4NX 2ADGA 3V5DB 3KLHC 1RIUH 4TNVK 1XX9C 4A55A 1I7RB 2VXQA 2ZCLH 4HJ0D 5KJRL 2HVJB 3O6FA 3GRBA 4OVVA 5B7MA 3S36X 1LE5B 1FZMA 1BQUA 1W8EA 3ULSB 5DD3L 1NCDL 5AB1A 2VUMA 3QRGL 3ZE1E 4NFCA 4JFEB 5FCSH 5I1KL 4CMHC 2JKIS 2KKQA 4HUKB 1NDGB 4PJ7F 1KNOB 1WHPA 4XP5H 4YSEA 4ELMB 3U0PA 3PJLA 1N18A 2PW1A 4A6YB 2PLTA 1CZ4A 4LSSL 1MIEL 1QLEB 2BY1A 3C8HA 2DTML 2X42A 3TN0D 3ZRSA 3GSNH 5IVNA 2XQ0A 4EXPX 3SE8H 3VRJB 2P24A 2WTPA 4H44C 4UDTA 4HMDA 3L5HA 4M4RA 4D0CB 5F70A 2J21A 3PNWB 5GJSL 1YRKA 4ZUTB 1A1NA 4MAYA 3H9SB 2DEWX 4PGBB 3IVKA 2ITCB 1QBLH 5DQJB 4B9JA 4UB0L 3H3KA 2Z1PA 4MXVE 4BFGA 5CKGA 4AEHL 2F19H 2QLVB 3FYIB 4C83B 4Z7WF 2MOGA 4WFGE 5FM5M 1KUMA 3IFPA 1T20A 2VM9A 1TCRA 3GK8H 5AW1B 1DLHA 2IH3B 3FCSB 4NCC2 2GB2A 5J06A 1I1AA 1M71A 4LVHB 1QLRA 1CDYA 3GXNA 4HD9A 2X4PB 4POUB 1X5ZA 3TV3H 2QTVA 3THMH 5GHWL 1E6JH 3QJHA 3LPWA 3AU1B 3GPSA 4BXSV 2WQXA 1ZXKA 5CF3A 1VFAA 3BCFA 3N06B 1M7IA 3R0MA 2G3ZA 3PNRB 1FFRA 3NMEA 1B4RA 3ELQA 3ZO0A 4M4PA 1G7HA 1RURH 1VZHA 1MNNA 3OAUL 4HULB 4WO4D 2J7LA 1J12A 3FYEB 3R06A 4JM2C 4G9DA 3S35H 3ZTDC 2V0AA 3BXNB 2EDHA 4HIJA 4HJTA 3BUPA 1OL0A 1URZA 5JR1L 3JTBA 2E3VA 3OKKA 1G8KA 4JDTL 5DMIL 2NT0A 3ZTJG 3O11A 2CAKA 3F7RA 4PS4H 5JQ6H 5DDHA 2VDPL 4IDJH 4N0CD 1DFXA 3N85L 3VACA 1L6PA 4I9WE 4DPCX 4V1DB 1EMTL 3PWPB 4PJHB 1NGXB 2XCMC 5EHFA 4AYSA 3RX8A 4Y19B 1ZT1B 1S7WB 1DVXA 3UYOD 1OGSA 5TGBB 4RNRB 4K8RL 2WLMA 2EE2A 4PUBH 1TQCC 1HKLL 1F3JB 4TPRL 4DW2L 1A7OH 2YZ1A 3D39A 4OIIL 1EEYA 3O8XA 3QULB 5L4MA 1NEZA 1KB5H 3MRBA 5FR3A 3PRZA 4X5QA 5CLZA 1HZLA 3ZZ1A 3MCYA 4HUUB 1XSKA 1E67A 1UOLA 5EOTB 1JGDB 3BEVB 2FYYA 4F15C 3ZE0F 4YDIH 3T4YB 3UBXG 2BSRA 2J8HA 1FJ1B 4HK3J 2IEPA 4WFGD 4AT6A 5EU6E 3HNTL 5BRQA 5TDNA 1MWAH 3U2SA 4KY2A 2X0VA 3QIUD 1I7TA 2O6CA 3IKCA 4LIQH 4WZ9A 2R0KL 1D5MA 4G9FB 4IW4C 3ECQA 4OQTL 1DBBH 1WBXA 3MV8B 4FFWD 4I18B 5CP7B 3MFFA 4H26A 5HGDA 3LN4B 3S3JA 4MJ4A 2W0FA 3KYKL 1R9FA 4WF7A 3NCFB 1KBGL 1ZVNA 1CO1A 2PN5A 2WLZA 1X9RA 4M9OA 4CSPA 2ZX6A 3ZQ9A 1CYGA 2VN7A 2H26B 4QT5B 5TK2A 3FOLA 5IIEA 4DESA 1AKPA 3V5HB 4U1JA 2A4CA 1JHTB 4FTVE 2CK2A 3MJ9H 1OM3L 3ETBJ 4NAMA 4RV0A 4XX1E 3P1VA 4DT2A 2HTKD 2CHDA 4GP8B 1NFDE 1FGNH 4NNXB 1D5IH 3S9DB 1KCVL 4URTB 2AC0A 2CLRB 2ZAIA 1KTJA 3GXDA 4OFYD 4WAFA 2GJ6D 1ZE3H 2DQ6A 4I9WD 2LQRA 5GRUH 3INUH 4NXSA 4OLEA 4QRSA 3SPIA 3HI1B 1XL6A 3HMWL 1Y4ZA 2BJML 4K3EL 2EDEA 2HFFB 2F1EA 1S46A 2MCPL 4WQOA 4F9PA 2OL3B 2GC4C 4LSUH 1EFXB 1M7UA 1TQBB 1HHIB 2XETA 3SGKC 2ILLA 4A2DA 4BELD 4LGPB 3CK0L 2PR4H 3WG7B 3L6FA 1NKGA 3K0WA 3DOIA 3WHE0 3D3VE 5G55A 4XBGA 3S3PA 1H3GA 5T1DL 4R7DB 4WTZG 1NFIB 2GIXA 4XPTH 1RHHB 2M1KA 3FQ2A 5I17B 3HI6H 2FBOJ 3WGVB 1BZEA 2A74C 3KCWA 5EC2A 3QDJE 4FL4B 3BWAB 3QPXL 2K45A 5EU6D 1X4YA 4X5LA 3UTTE 4OGAD 1I3QA 4FAAB 1UGKA 2DBLH 4IOSA 2Z65C 4NM4H 3A21A 4IRJD 2X4UA 2LHAA 2Y7NA 3ISRA 4XNXH 4XP6H 3EADA 1C1EL 4F33B 1MWOA 1T7XA 3MCKB 4LLVA 5IK3A 3RY6C 1MELA 2J8UE 4GXVH 1MPAH 3L4XA 5E6ID 5GRWA 4DGYH 4X6BA 1BMWA 4HPYL 1DQVA 5F6HJ 5DJDB 2OZ4L 2ISDA 3K74B 4JO2H 2H5UA 4BGDA 1OXYA 1ZV9A 3QW9A 5KYXA 2E86A 1DUYA 4XTRD 2BIMA 3SQBB 3AABA 4RQQA 2JFCA 4DQOL 5D1XC 5E00A 3CLFL 2JKXA 1Z5LA 3QAQA 2F53B 2YWZA 4FTVD 4ZFGH 1G9ML 4X80H 1AXTH 3JUZA 3O3DB 4IIQB 2EQDA 4MNHB 4YE0A 1S8DA 3LHPL 1YAZA 3VMPA 2WJ7A 4GSDH 3U1SL 1AGCA 1MQKH 4BINA 5IHHA 3VYNA 4XNZC 4OJFH 4PJ9D 5E2TL 3F5WB 4N0FB 4L8DB 5D7LA 3GDBA 5IG7A 1AE6L 1D5ZA 3P3YA 1DFBL 3SQRA 3ZKND 1OCOB 5DGRA 2V2XA 3DI2B 4KI5E 1RD6A 4MWFA 4ZPTB 4I4WA 2LV4A 1SJHA 1HHJA 2GK0B 4PD4K 5EUOA 5E2JA 3QIBD 4JY6B 5D71L 3VXSB 5I1JH 1Z0NA 3EF4A 3T0EE 2X3BA 3WHXA 5A6LA 1MFBL 2R1YA 1ZANH 1QEWB 4MMXA 3OXSB 4PCKA 4MD4A 2BY0A 4D8PB 1FIGL 3L81A 2QT6A 3BKCL 4KK9C 2HLAB 3F58H 1DN0A 3QUXC 4O4YH 4WJG3 4OCMC 3B9AA 3BAWA 3D3VD 2E7MA 3FUMA 3FJTA 3ZK0A 1LP9F 2J6EA 3B9KD 3HG1B 4DQAA 1HEHC 1B4JL 1NC2D 3QEQB 2Z31A 4XMWA 1A7QL 3W56A 1TYRA 4N5EC 3N9GH 4LU5H 1IAOB 4O58H 2YAFA 3QDJD 2A68D 3L54A 3UTTD 1EBAA 1WE5A 3HC3L 3MLWH 4S0SD 4TVPD 3KEHA 1RZJL 4J3BA 2NMSA 2OXHB 5F7AA 3Q6FA 1IM3A 5F9DC 5JHLL 1KCRL 4K4KA 3D09A 1NCCL 2JJVA 4UCFA 2AERT 4KTDL 3VD9A 3FT0A 4ZAKB 3SYQA 2ZX7A 1YNJD 3E8VA 1DSFH 5J1AA 5ACZA 2PWGA 4G3YL 1S9VA 1CE1H 3MMEB 2ERJC 4J3OD 3EG9A 4UOW1 3TZVA 3EOYG 4QRUA 5BUAA 2X3AA 3SYOA 5JIPA 2VLKE 5IT2H 4PJBA 4FZEL 3RWHA 1J9TA 2EDLA 3EOTH 4JR9H 1BJ1J 2Q7YA 1AD9B 5DEFB 5CBEB 4JN2B 4RZCA 5T1LA 1BAWA 1OY3B 2XWJA 5BVJA 1YC7A 2XY1A 5IEHB 1G6RA 4FQCH 2K6ZA 4OSUH 3STZB 4UBDD 2XZZA 3SE9H 5AW5B 1RZIB 1JS4A 5ANME 1IBBA 5KVFE 2YD0A 1J9SA 4ZO6A 5FAAA 1DEEA 3QWRA 3S8FB 2ZYRA 1IQWH 2GJPA 1QFWH 5I6OA 3U4BH 5HHPA 1N3NB 5HD8C 4KI5D 1AGDA 5HGAA 1C7TA 3OAWA 5AL8A 2EIJB 5A43C 2DQTL 2YUJA 4WW2A 3B7RL 3LRHA 3UPAA 2XICA 4C56A 4AONB 2GT9B 2XXCB 2Q0ZX 2Y2WA 4DPRA 4PJXB 3IWUA 2YN5A 1D7BA 1UB5B 3TVMA 2WXFA 2OYPA 3MLRH 2ATKB 3DOSA 5IQLA 2DM3A 2C26A 4NN6B 1ZT4B 3DGGB 2AAAA 5BZWB 3VXRE 2RCSL 3O5AA 5ITBH 4P46B 1B88A 1RUQH 1P7QA 2E4FA 5D1ZI 3JSSA 4MD5A 2J12B 5F72S 4HEPA 2CJ3A 5DJ6A 3SKNB 1OAKH 3LQAL 4HP5A 4NBZB 5EO1B 3QCTH 5T3XE 1CIDA 1QTYT 2XX1A 3RX9A 4F3FB 2EYRB 1IV8A 2VXSL 2ZSVA 3LZQA 4NLHA 2NW2A 25C8L 3HLAA 5D4HA 4MRBA 1WZMA 2G2RB 4JO8A 3GSNA 5D5ME 3O4OC 2FB4L 1ND0B 4J1UA 5E0FA 1G7MB 3C75A 1TSRA 1LILA 1IEBA 4R0LC 2VLKD 4IQHA 5DJ0A 4OLYH 4FN0A 3U25A 4LMQI 4HHWA 1F6FB 4XVOA 4DTGH 2LAGB 4PN6A 1KN2L 4QUOA 3QRBA 4DK3A 1TTCA 1EO7A 2IQAB 1NBVH 3HRZC 1FPTL 4JPWL 3AY4A 2F1AA 3P3SA 4HLJA 2EDKA 3ZHFA 1J5OL 5FUOL 4XO5A 1DUZB 1UB6A 2ZPKL 3Q1EA 2AI0H 2NR6C 3MUGA 3TO4C 3JQOB 1LEKB 1S7UA 1HI6B 5G4OA 5ID1B 1UJTA 1I9JH 2O26U 1QASA 15C8L 3C5ZC 3OKDA 4JZJC 2H1PL 4PWGA 1MJ8H 5HJ3A 3QXDB 4QRRE 4PREA 4RA3A 4S1DD 2JKNA 1ZXQA 1DBAH 3TT3H 1KYOK 3WGUB 3IGKA 1UD3A 1MFCL 5F9WC 4PU2A 4EZJA 4R90H 3PAUA 2NY0C 4JP6A 2M83A 4Y1SA 5EU7E 4G8FA 2GK2A 2F5AH 4NUQA 2OTUB 5CUSL 4MMYB 3GHPA 3MRRA 3WSQH 2EIEA 3NIFB 4HIIA 3PHSA 1WEJH 3MRHA 4JPKH 4QI3A 4ANVA 3ARDD 5F8RC 2O93L 1NCHA 4HCRL 1XB8A 3VXRD 1EDHA 1OTTD 1KIUB 2ZJSH 5CWSB 5J12C 1IGIH 3ZKXB 4X9YA 4PGJA 4IBLT 1ZC1A 4RFOH 1EH9A 2AXFA 2DQUH 4UILH 5C07A 1KJVB 2XTJC 1H3PL 3U36B 4LLDA 3SJVE 5KVGE 5T3XD 5DJAB 3DO4A 3KLAA 4Y16B 5ACMA 5JA9A 5M95B 4GMSL 4PTTA 1GGYA 5F9WB 3RLSA 1EZSA 4H88L 1KXTA 1TJHH 4UM9A 3ZZQA 3VFSB 2Q3ZA 4KAQL 4XO8A 5DHEA 2FR4B 3GSWA 4YBQC 3X1BA 4FQXA 2NSQA 4X8GA 5D2NC 4Y5XC 3NZSA 3L5WB 1F97A 2W60A 1OCRB 5JUEL 3WXVH 5CR1A 5L4IA 4E9RA 2R15A 3WTVA 1J5HA 3JV6B 1KB5A 1WWBX 2NYKA 5MEQB 1BD2A 1YY8A 2C9VA 4XN1A 4G6FB 3ZL2A 4IBWA 5J5EA 2JKSA 3QNXB 1F42A 1DYZA 5AYUH 5DS1A 1TQVA 3UTSB 4EVNB 4F7MB 1BFOA 1MWAA 3N41F 1EXUB 1MCSA 5DC4B 1HHGA 4PB0H 2HVKA 2V5RA 4NQVA 3OAYK 4I7ZC 3LKQB 4CAGA 5EUKB 4J8QA 1W72L 5F88A 1CD0A 1IGYB 5H35A 4X8XA 3C8KB 3I6GB 1HYSC 1UCBH 3N40P 2RQ8A 3NQKA 5CEZH 5HDQL 4RISL 1XF5B 3HZKB 3FO0L 1NFAA 1CT8B 1KIQB 2ZAGA 3FU3A 2BNRA 1FDIA 1PZSA 2SEBB 4BKLA 2Y3NA 3SD5A 4E2OA 4FXKC 1A0QH 3A24A 3BVVA 4JDZA 1IT9L 3W9DB 3MJ9A 1PTZA 1QRKA 2JA6A 1P5UA 3OHXA 1QCSA 4JO4H 3O3AA 1GHFH 5T33L 5DUBB 1TIUA 3HG3A 5KUKA 5H4YA 4YHZL 2AF2A 1UM4H 2IDUA 1TUPA 5HHXH 4A68A 1HT6A 2AEQL 1JZ7A 4XR8C 4O2CA 5SWZA 1TU2B 3SJVD 4O2EB 1E8XA 2AEOA 3ETTA 3K1KC 4N8VG 3M1BB 3RVUC 1QX1A 5CD5C 2Q86B 5CEXB 3BDXA 5AW0B 2WLIB 2ZYIA 4Z3HA 4IK6A 4NUJA 4S0TD 2TSAA 4GAJL 4OM0H 5FYJE 4UQDA 4KPHL 4DK5A 2O5ZL 3T71A 1F45A 1L7TH 3BD3A 4N20A 4ZW3A 3EFDL 3MRQA 4OLUH 3T04D 5AVSB 4ENGA 3KPQB 1OF2B 4OT1L 5GZNC 2YLKA 3DRTB 1BGXH 1HCVA 5ICZB 1PY9A 3BMVA 1ONQB 4WO4B 4MCMA 5AUMA 2MOQA 3ET9F 1HXMB 2AJZA 2YMXL 4NXKA 2VE6B 2VW4A 3SUKA 2CMRL 4UQ2B 3QDGA 5CP3H 1DDHB 5DHDA 5HDRA 5IJDC 1MCQA 3HZYA 4YO0B 5AOIA 3VMNA 4L5FH 4HWEH 2HMIC 1LD9A 1CFNB 4LDEB 4OVUA 5G4MA 1QBAA 5I1IL 3TJEH 1MHHB 2VJ0A 5B8CA 4OI7A 5FW7A 2WYHA 3GD1C 1B3IA 2WWMC 3WLBA 2WCPA 1TFHA 2ITDA 2X2YA 3QZMA 2NVYA 3NESA 4CADB 2BVTA 1T22B 4QRFA 4UT7L 4GKNB 1L9TA 3ASOB 4Z7UE 5MERB 2VXTL 3T08A 4UV4L 4ZW5A 1N8ZA 3M1CA 4ICXA 3MGOA 5E2WH 1FORH 2Z0UA 5FKPA 5I76A 5EEUA 3FN3A 1FAKT 2E6JA 1C5BL 1MIMH 3BZ5A 4R4NC 2AKRA 4IJTA 4RDBA 1FZJA 2XG4B 5B3SB 4H5SB 3B7YA 4Z77A 2Y36H 3MBEB 5K1VA 3WENA 4F2FA 5IKCA 8FABB 4JHUA 4KDTA 3M88A 3T0XA 1MFNA 1DBKH 4HGWA 4LVHC 3KG5A 4XC1H 4U1KA 1IBFA 3BUYA 2R0WH 5HI4C 5E24E 3KPSE 3IU4L 4JY5H 5GS2H 3MRKB 4Z9KB 5F3HA 4I3GA 1QNZL 1S7QA 2HB0A 2JXMB 4MB1A 3ZDYF 1XQ4A 3QIUB 4JFDA 4OZIE 1A4CA 4EMZA 3EOAA 4B9KC 2YAEA 1Y07A 4AUUA 3EF7A 3N42F 2Q8BL 4U1HA 3QCUH 1MXDA 3QWNA 3S3DB 4NQDE 1PQFA 2GSGB 5GRZA 1CF1A 5FYJD 1NCTA 3P73A 4U3XA 4ENED 3EIFA 1LO3H 4TSAL 2W9EH 4BZ1H 2OR9L 4FDWA 2I07A 4HCIA 4HKBB 4U6VL 2W9DL 1E50A 5IJKC 5ADOL 3BI9X 1SXNA 3KW8A 3CBJB 1U8KA 1CGTA 3ZT6A 5IF0B 3ZKMC 1DJHA 2K4WA 5I1LB 5GRVL 4G8GA 3AAZA 1PSKH 2OMYB 5JMOC 1RPKA 1K8DA 4PJAE 2NYZA 5AOKA 1EVTC 1PZ5A 5DVMA 2R2EA 4I0KA 5TQ2H 3CHXA 2XLLA 3EYOB 1U9KA 3E2HB 5I9QB 1OA9A 1U6AL 4NS0A 4ODSH 3ARZA 1N6UA 3MV11 2VLRA 3IMSA 1A9BA 2E9IA 4BFKA 1DJIA 4PLJC 4TNVF 3GI8H 3LTVA 2J1ZA 1S7XA 3GJFB 1MUJA 4JFYB 2BP0B 2COQA 4GG6F 2Y7OA 1W0WA 2BDNL 2XKNB 4Z3JA 3FQRB 5D7JD 2BIPA 1OGAE 2ZCHH 3PGDB 3MNDA 3WE1A 1HILB 1BZ8A 5I30H 3GMMB 4DMRA 4RAHA 4L4TA 3GI9H 3LXUX 4D94A 3H42L 3S4SB 5C0CD 2K78A 2QDVA 1OAZH 3ARXA 3OR7B 1UWXH 1L5GB 3EXLA 3KPSD 4I18C 2ZSWA 5LVEA 1TF4A 2X2JA 2G2PA 2YEZA 4GRMA 5DUJA 4R96A 2JIQA 5H94B 3BWUC 1UZ8B 5EN2B 3FQXB 3Q5OA 2IBBA 3LKSA 3QDMD 4JBSA 4AL8C 4PJDE 2NPLX 1RVFL 4NQDD 4HYTB 1AOZA 1Q8MA 3DV4A 4N2MA 5E6IB 1B0GA 4YXLL 1A2YB 2HT4D 2V37A 3OGCA 4QIRA 2O6FA 2VH5L 5EO0A 4B7IA 1ZLUK 4N68A 3BESR 1CD1A 2IH1A 4NQEE 1T89C 2WAQA 3IU3A 5BMFL 3MOBL 4X7DC 2R9HC 1REIA 4KXCA 2FWOA 2AEWA 1FVCB 3NJJA 4RMVA 3W82A 1C08A 2Y3AA 4FTVB 3QWZA 1JNNL 1F4YL 1UXWA 2CJTA 1ILUA 4M9PA 2M2DA 4OF7A 4WGVB 1UA6H 2CKNA 3QI9B 1H8SA 1PL3A 4WFFE 3DJSA 3JXAA 3Q8EA 3KPRE 1NFDB 4YLQT 1XGUA 4NQCE 4RMRA 4W9KC 4PJ9B 3IFNH 4Z95H 3D6GA 3K2UL 1SOXA 3EBIA 5FO9B 32C2A 4Y1AB 3W9EA 3SYCA 3ZE2B 1UGNA 5T3ZL 5J6GA 5KN5B 2P4AB 3F85A 4YH6A 2A83A 5EBMB 1AW8B 2W9LA 1N6QL 4G83A 1SHXA 2XBTA 5DJXB 3RNQA 3MYZA 4LDCA 3SKJL 3ULUE 2XQYA 5CZKA 2Y2TA 4AGNA 3VXUA 4N28A 2A5UA 1QRNA 2HSIA 1QG3A 4X42A 4AMKL 1B2YA 3CG8A 3FB8B 2AQSA 4MA7L 3V4VB 4ZFOL 1F6AB 4K94H 1YO4A 2H32B 1OGAD 4ZX4A 4FL4C 3REWB 2DQMA 3SUMA 3B9KB 3MRNB 4PRHD 4DO6A 4XP1L 4U2YA 1ZLDA 3QC8A 3BN9D 1N5AB 3IJ9A 3I9GH 4FQIL 3D0LB 1L3NA 3QDJB 1XF1A 3UTTB 3N2JA 1X5IA 1T7YA 5E8OA 4LLMA 3DJTA 3MRJA 4LPXA 2EECA 4XXDA 5I0ZA 4CDGC 1HIML 5FUCC 1VACA 3CDGB 1NAKH 1TJXA 3HI5L 3BH9A 2XBZA 1P9MA 3OKYA 1PZ3A 3K6NA 5KTEH 3BIKA 4LGSB 4CRZA 2J8UB 3ETBF 1NOFA 1P4LB 5ETUB 1NEZG 4CNIA 4BFBD 1X5AA 1AXSA 2NY3D 3O0RH 2ZNXA 1GGBL 1NCGA 2JJSC 4QXUL 3T4AA 4NQED 2XRAL 3PIQB 4IIQC 4L9DA 1ZD6A 2FNWA 4KXBA 4MS8D 4JKPL 3MJGX 2CE6A 5H2BA 1WIPA 2A1WL 4XE5B 4UQBA 1SBSL 1FFPB 1CDHA 1CDUA 2R69H 4IDLA 3ZL1A 3QARA 2GITA 4K3GA 1P5VA 3FTWA 3D48R 3SKMB 1J8HE 4IKLA 3CZUB 5DJZB 2CRMA 4WFFD 4NQXA 3KPRD 5DZPA 1TETL 3C60D 4J8RA 3U6XA 5JPMA 4NQCD 2I32A 4RDQG 5I6XC 2A9DA 4QD2E 2GYSA 3GLDA 4HF5L 2PPDA 5JOFB 3GT6A 1A1OA 2OCJA 4BWUA 4OLZL 3FUFA 3PWNB 4BHUI 3TH4T 4N0YH 1HCYA 1QUNA 3T0EB 1QI5A 1FL5A 5DURD 1YYLL 4E42B 2J44A 4PG2A 4MBOA 1YNND 3NSYA 3V6ZA 3VI3A 3S88H 3FQ1A 3QJRB 3KVPA 1DJGA 3OGOE 3FH8A 1XF4A 2IXQA 3NT0A 5I8KH 1MCPH 1RZFH 2UXVA 4LEBA 3HE6A 2EIDA 4G59C 3MSPA 1GS8A 3BH8B 3DTDA 7TAAA 2VRKA 3WKMH 1DO5A 4FQLL 1ZCRA 2CPUA 4FF9A 2EXTA 4PP2B 4YE4H 4ZAKC 1ZSHA 4KH9A 1TJIH 3VM7A 1KLFB 3VFUA 2ZUQB 4NO3B 4TRPL 5IFHL 1SHWA 1JJUA 5DRXB 1FV1A 1FLTX 1DQLL 2X41A 1A22B 1S5HA 4YHMH 2QR0B 2VMEA 2VERN 4KKCD 2Y23A 5CIPH 2NTSP 3TYGH 1LO4H 4WKZB 4YIQA 2VDKL 3WNLA 2OM5A 4E9YA 4UIMA 1BZ9B 4PRNA 3HG2A 4E41D 4CVUA 1RJYB 3BDYL 3U7WL 3E38A 1EUUA 5KYWA 2BIQA 3HNSH 3RDTA 4KKBD 5HI5D 1PYUB 3RG1C 4DN4L 1JGIA 1OT1A 1Z1WA 3MLTB 4A2GA 1NM9A 1F0LA 4MAUL 2G0KA 3F12B 3UDWC 5I2IB 2IWFA 3DTXA 4UU9A 5GGRB 2JB5L 5KBPA 3TGXA 1J8HD 5LGHH 3KWTA 4K7FB 4DHLA 4QTFA 3TEXA 3TBTB 5ANMB 4GSUA 2OP4H 3WFHB 4ADIA 2BH0A 3R0NA 4KZEH 2HXAA 4RZKA 1YEJH 1F18A 3OR6A 4NJ9H 3RHWK 3QJOA 5K1NA 3TIDB 4ZDHA 1SYSB 3RGVD 4JDEB 1RZGB 2GFBA 3PWLB 1E2ZA 3ZYIA 5EIIA 4KJQD 4FTDA 2XIBA 1SVZA 2K8QA 4LGRB 1QWHA 1ZGLM 1Q9OA 5C6PB 3RVVC 5JO5A 1LHZA 3QG6A 1RJLA 5DYIA 1BXUA 3BE1H 5FYLL 3AWFA 1CUOA 4CU8A 5CP3A 2CO6B 4LCWA 4P57A 3PHOA 4WNQA 4P46C 3OHMB 4QJ5B 4C47A 1OSPH 4BQCA 1XB3A 4M8QB 5F2FA 3MRDB 3CZLA 1S9WB 3EXJA 4XNQB 3VXRB 1XT5A 3RIFK 1TTFA 1QBBA 2AJSH 3SSGA 4EKXA 4Z0BH 3NCEB 5CU5A 2C3VB 1LJMA 3RWEA 1KTDB 4NZUL 4L4JA 1RIVH 2P28B 4XRCA 2JLLA 1J1PL 3A3YB 4PHXA 1JL8A 4HSQA 4RVBA 5DYOB 3H4FA 3O6KL 1ZHNA 5B1KA 3U0WH 1SFHA 2DBJA 5SWSE 1FNHA 5D5MB 1E5CA 1IEHA 3IDMA 2O30A 1F11A 3ZLQC 4JB9L 4HW6A 4P2AA 2ZUUA 1XTMA 4KNSA 1GPOH 3ZUNC 4OZFG 1KPUB 2DD8L 2I85A 5LXVA 1T1XA 3TT1H 2ATPA 5EZIL 3PWVA 5JORA 1E5UI 2NY6D 3HS0A 3QIWD 3JWNH 5KAQF 3IT8D 4S1SH 4N26A 4Z7VE 1EEZB 3LZOA 5DZNA 4H0HB 1WICA 4X99B 2ZUYA 5GGTH 2CKBH 1WITA 2H2PC 4GBXB 1MHEA 3KE0A 1O7SA 4HZLA 1UXSA 2C1PB 4LSVL 5KSAD 4EBQL 4ZJ9A 2GBUA 2BINA 2YD2A 3LV3B 4QTHA 4ZS7H 3ATEA 3MFGB 4HS6B 3PGFH 4ZMYA 2ZOLA 1Z3GH 2A6IB 4NC0B 2VDRL 4W9DC 5E5UB 3N1FC 2PTUA 5E1AA 4EIGB 3IR7A 1T6VN 4QRRB 1OD7A 4BZ1A 5T1MA 4X6DE 1MREH 4L2YA 1QLFB 2XWRA 4WRLA 4YHLL 2VCOA 3FL7A 5FHAL 3V9CA 5KW9H 4M7KH 1RUAH 1IGCL 2X4TA 4HIHB 5C08E 4B3VA 1QQDA 2HG5A 2EEDA 1ETZA 2X0WA 1JTOA 5JXAL 1AGEA 3ZKXC 3NJGA 3ES6A 1UWYA 2WXKA 2KL6A 4G7SB 4XN2A 3MV7A 3KWUA 1VKXA 3STLB 2MCG1 4G42A 4A04A 1V3LA 4QTIH 4PJ8A 4Y16C 5A3ID 3D06A 4KQ4L 2FE0A 2ARJA 4ZPVA 2EXYD 4KK5D 2C3GA 1HQRA 2NZ9C 3K71A 1L9PA 3FTGB 1JV2B 2ICEA 3Q01A 3VG0L 2IBZY 2EP6A 5D55A 2ADYA 1H0DB 5SWSD 2VDNL 5IJBC 4XOBA 3PGCA 5FIEA 3SYPA 4LLAA 4XCCL 1FL6B 4X5WA 1U2CA 3GMOB 1FVDA 2MNUA 4HJ0C 5DA4A 3E9TA 3IETA 1CLOL 1X7QA 4HWBL 3RTQD 4ZK8A 3FQTA 2OTWA 5EMYA 1LWJA 2JCCF 3V52H 3DHPA 1I9IH 4AZUA 4ZX6A 4KV5F 1ETA1 2QVIA 4HEPG 5HVFB 4XN7A 1LDPH 4LKCB 2GBVA 1E9OA 1H19A 5KG9A 2GEEA 2N1KA 2ZP8A 1TZGH 5L2JA 4YSSA 4K3JL 2E5EA 1CTNA 1AY1H 5IBLD 1QFWI 2NW3A 3V0HA 3NCCB 3TNMB 4LKXB 3ZIYA 1MHPH 5B1JC 3VFNB 4FYSA 4G6ML 5BV7B 4P07A 3WU1A 5C0DA 1EGJH 1MJJA 2JJTC 4APQD 3ZVVA 3V0VA 1J0ZA 2VITB 2OXGB 4O02L 2R92A 1TVHA 3L7EB 4LLUB 2F68X 1Q1JL 3AGVA 3ARRA 3FU0A 3MLZL 5DLLA 5I8EA 5CSBA 5DFWH 4I0PD 4XPGH 3WIFB 5HHVL 5C08D 5DZ9A 4R7NB 2EILB 1K4DB 1TTGA 3B8YA 3MXVL 1ESOA 4ETQA 3DPBA 4F37F 2ID5A 4AZ8B 2J57A 3X12A 1KTRL 2YHGA 4GRWE 5FFOA 4GP5B 5CBAB 3SDAA 4LOVA 3X2HA 3TO2B 6CGTA 3RL2A 1OTSC 3T3PE 2FEEL 3LSOB 5CN1A 3U82B 1J05A 4NZRL 5GSVA 4U33A 4OGYL 1EIBA 4TN9A 1MDAA 1AG0A 4P2OA 2QQKH 1AHWB 2E9JA 1GAFL 2EINB 1BQ5A 1J5CA 1IJ9A 4F7TA 4L3CA 1HINL 3Q6GL 4J7RA 4ISVA 4WO4C 1WLHA 2RTTA 1CDIA 2BCKA 1KOAA 3UBXB 5DMIH 4K0OA 3FFDA 3F64A 4ADGA 1XGYH 2MKLC 3QZBA 4A6YL 4N9GA 3DSFH 4HBCL 4KNTA 2XFGB 1QLEL 2PO6A 4Q89A 4N0CC 4XCFL 4MVBD 1UD8A 3QJUB 5FV2A 5MHSE 2PYED 5E2VL 2DLEA 1D5BA 5TD4A 5IVXF 3ROOA 3MRIB 4PP1D 3HUJE 4HUCA 4A7TA 3QXAB 4K8RH 1EQWA 4YX2L 5AAWC 1IBYA 3BWZA 1OA7A 3EHBB 4L3AA 1BX2A 4Z7UB 1HNFA 3GSQB 3QUKB 3AVEA 2H6PA 1FYHB 3MBEC 3SCMD 4M61A 3SE4A 6FABL 3MJ8B 3GM0A 4G8EA 3A5VA 1M7DB 5IJVB 4J3WA 4FJ6A 3QNZB 4FE9A 4CL7A 4LPVA 2I7OA 3A4FA 3OUGA 3P9LB 2PW2B 5FDWB 4B5EA 4F93B 5EA0H 1AZNA 1OP3H 1ZTXL 1YEGH 2R69A 1VGKA 2JKRM 5DTFB 5IHUL 1UQSB 3QIUC 3EO1B 4K07A 5F0JB 4LO9A 4MJ5B 3KBFA 3KPSB 1CICD 1G5AA 4OZIB 1L7IH 4AG4L 4CC1A 2VC2B 3DUUA 3RVXD 3L1OH 1H0HA 1FFTB 2IG2H 2IOOA 2ZF8A 1CWVA 2N7BA 1JPGB 1M05B 2P9RA 4NT6B 3KBHE 3O6FD 1ZK9A 1XMWA 4WK4B 3B7UX 3WIIL 5CLYA 2XVGA 3VWJA 3T77B 3KPPA 1H9VA 4N2IA 3VD0A 2EXWD 1VJSA 3IEAA 3HEIB 3PG2A 4ETYA 1HDMB 1QP1A 4F1SA 1LGVA 1R75A 1U3JA 4PG9A 5D7KE 3WJMB 3AT8A 1ORQA 4R7VA 5IW3A 4CVXB 5DQDL 3BVWA 2HTKC 1O9ZA 2MNWA 5JXEA 5DK0B 1ZT7B 2DWEB 1S9YB 2BC4A 2XN9B 1I3GH 2FJFA 4WV1A 5HGHA 5BZZA 1JZ3A 1ZDQA 5MENA 2W65A 5ESQB 3L5IA 3VSVA 3JWOL 5I9QC 1RZ7H 4UWQB 3QZLA 1JZDC 4PJAB 1F02I 1T1WA 3D39E 3KS0J 2OYMA 1UXLA 3IJEA 4FFYH 3KLSA 3IMRA 1D5XB 2NSMA 1COBA 4MAYD 3MRCB 4NSKA 3D69B 3TX4A 3B5GA 4NRYB 1SYVB 2HRPL 2OMWB 3EGDA 2PJHB 3OXRA 3Q3GA 2D9QB 4MCYB 5CIPA 3OF6A 1YN6A 2X4OA 1JHKL 3BKJL 2BSEA 1HYRC 1MCKA 3CFBB 4HJUA 4PJ7A 5GJTL 1I1AD 5L8LB 2WO3B 5GXBB 1RMFL 2VDLB 1SOSA 2VSKB 2WQWA 1JZFA 1OGAB 2VKXA 1JV5B 1NAMB 3WJLC 3PP3H 1WZ1H 5DZVA 4OGAC 2F6AA 2JB6B 1Q9LA 2Y1YA 3KCPA 2EE6A 1C1EH 4IRJC 4OLVL 1N12A 2ZD0A 1ZJBA 1Q16A 1CFBA 4JO1H 1W8OA 2V9UA 2F58H 3KR3L 4ZZFA 2C3WA 2WD0A 3RZCA 4AL8L 2Y06L 2Q6WA 2ZOKA 5ALCH 1OCWL 3CFCL 3V4UL 5E6IC 1K5WA 1KXVC 3CXHJ 4PI2A 4EZLA 2IDTA 1BQSA 3RIAK 2YPLA 3I2CH 4G8AC 1RI8A 2IH9A 4A7VA 1EHLH 2ZKHL 5F89B 5I73B 2YQBA 1OE3A 4WI2A 1SLVA 4EUPH 2NY3B 3CLFH 1OCCB 1J48A 1LDSA 2W94A 2NRDA 1XZWA 5HYQB 1BXXA 3WFBH 4NQEB 3RTLA 1Z9LA 1NCWH 3OMZA 4JQIL 3UJIL 3LHPH 1U41A 2VIRB 4NENB 4ZFFA 3MJWA 1EXGA 4FG4A 2AV7A 4KHTL 3U1SH 5B4MD 5I6XB 1IKFL 2DQGL 3SPVB 1XDTT 4JPQA 2NXYD 4PJ9C 3APFA 1YEWA 1DFBH 4PJFB 4AAYA 4N2BA 2CPCA 3ZKNC 3KPRB 4YXHH 3C60B 1P6FA 2OL3L 1AZCA 1BVKB 4NQCB 3U7YH 3D39D 1MZYA 4MD0A 1HU8A 4FADA 4PVLA 2GSIB 2JELL 1H15A 2JLPA 4HIEA 4OB5L 5DT1H 2FECI 5ILTL 3TNNA 5K9JL 2D3NA 3V0AC 1CZ8H 2MQGA 1NPJA 4QNPF 1FIGH 1R3JB 1ETJA 5HDBE 2MTPA 1HVXA 3NZHL 1QWUA 4Z7QF 1GA2A 5DJ2B 2Y9RT 5FOBA 2NNFA 5CEYB 1HESA 1BAFH 1S9XB 5DURB 5DRNB 4JY4B 3FUHA 4N6RB 4YHIB 3RNKB 3FB6B 3TBYB 1R19A 3B9KC 4BH8B 1IX2A 5IHZB 2H9GB 1JK8A 3PWJA 1AIFB 2NY5C 2VR4A 3DUSB 3NEEA 4YGAB 1ASPA 4K7PL 4F2MA 5C0EA 1QFUL 2P3YA 2V33A 4KKLD 4FLSA 2NNAA 5B7EA 1KCRH 5DD0L 3C09C 5GGTA 3QQ3B 2CKBA 3CSYA 4I3RL 3N40F 1NCIA 1F4AA 2H3NB 1SJVA 4PYHA 1XGTA 3WE6B 1GTNA 2UX7A 4RWYH 3MACH 4FKEA 4YSPA 2D31B 4J3OC 3NABL 1IC7L 4YFLI 2VXVL 4FZEH 1JXGA 5LBGA 4OJCA 1HNYA 1OB0A 2YKLH 4ONOA 3G5ZB 4Y7OC 2EIZA 5D72L 2P52A 3W2DH 2WLLA 4BK5C 1MCHA 4K5NA 2VLJD 4ONGH 1FYTA 1P6WA 4N2LA 4JKWA 4KITB 1UH3A 5FC9A 2F54A 1EAPA 3P0VH 2CJUH 3GTJA 4HWNA 4ZO8A 5D7LE 1R0AL 4NAQA 3OKOB 4QXGH 2IC2A 2OULB 2XJLA 3D87B 5EUOE 5F1NB 1XWVA 2BP3A 4XI5C 5BXFA 1NL0H 3TBVB 1ZS2A 4B7LA 2AJUH 1J8HB 4Q58C 1ZLWK 3OAZK 1JRHH 1IAKB 1MH5B 3FRPA 4L8SA 4MB3A 4ABWA 5BO1H 1SBBA 3O3EA 1V7NL 4KI5C 3P30L 4PJHF 2OMUB 1IJNA 2BW5A 3GIZL 1P4BH 2R0ZH 2LTQB 4JDVB 4YSCA 3T0EC 1TQTA 2H7WA 4JVUA 1URLA 3K6FA 4AYID 4AQEA 5DR5L 4PLNC 5BZDB 4LOEA 1OGPA 3VH8A 4ZUUA 4LSPH 1F4XH 2XIDA 5TH2A 1JUFA 3T8XB 3VXPA 2Q3AA 1A7PH 3BD5A 3D9AH 4IOSD 4X4YA 1V5JA 1NEUA 3FTYA 3LZRA 3I50H 4JFQB 3UG5A 1RZKH 5D1QE 4ACTA 3GPEA 2F15A 3IE4A 1KGWA 3KVDD 4ODWA 4WHYH 3QJQB 5JW4M 1HJBC 2CBMA 1QPXA 3D4ZA 2RMNA 4JQVA 5BJTB 2ZUQC 1E9QB 4Q6IA 5JDSB 1TZ8A 4JO5A 1UASA 1UM5H 4X7TA 3LYRA 5I8OL 5DGQA 4PJBE 4H25B 2GTQA 4EOWH 2FZ3B 5EFIA 3BPLB 2V5SA 3BWUF 3CN2A 1INQA 5C2BH 1EGJA 5DXWA 1ZOXA 2EAEA 5IB4A 2WMPA 4PLKC 3IK2A 3VXMA 5K5YA 5A6MA 3VXQB 5TE7H 2Z93A 2G9HA 1EAOA 5F9OL 2CLZA 1WG3A 4OCSH 2ZZUT 4YDZA 1SRDA 4QYOA 4P5MB 3CFQA 2J73A 4BZYA 4DZBB 5D7LD 1SQMA 5TE6H 4K2UL 5AAMA 3AJ7A 5FUOH 3T2NL 2XU9A 1OGYA 3DX9B 3GO1H 3NN8B 4GINA 2G4EA 4NDMA 3VXTA 5PCYA 3S36L 2ROYA 1K6QH 4BCXA 1MFDL 1HJCA 2J88L 4WDIB 4RESB 5K9KB 1KELH 1T66D 1UOVA 3NSCA 4C56E 3CCHB 4AE0A 4DH2A 3AS1A 5IBTH 4NERA 5J6SA 1JPFB 2P80D 1IRAY 1N2RB 2AEPH 4OCLC 5DD1H 2AJVH 3DKHA 4IKNA 1MFCH 2MPAH 3DETC 3UPRA 1U8IB 3TYFB 1KB9K 1I8LC 3B5HA 4BSVA 3WEXA 1BQHA 4NEHB 2BOLA 1N26A 3RQ3A 3UO8B 2WM0A 4JGNA 3K1DA 1CLYL 7PAZA 3M07A 1A4KA 4HC1H 4XVJL 3L1GA 1CB4A 3TLRA 5I1DB 2E7LA 3R1GH 1MZZA 1PG7H 1GGUA 4M3JA 3B2DC 5E5LA 3NCJL 4O9HL 1BZDA 1K2DB 4H1LH 4TLTA 4HT1L 3FO1A 4GKSA 5E8NA 3FT3B 3UFIA 1IM3D 4DUXA 1AACA 2ATAA 1XCQA 3MZGB 2FX8H 3WN5B 3NCBB 3MNWA 2E47A 5IJCC 4IHOA 1KACB 3QJTB 5JLZB 3FT2B 3HG5A 1D6EA 3I74A 1IFHL 3GTOA 3TZVD 1T6WA 1KCUL 2BFVL 3D51A 5GISH 4LARL 1T7ZA 3FUIA 5F96L 5F6IB 4RRPA 4NO5B 3O4LA 3U79A 3G04B 2AZAA 4EDXA 1LP9A 4XAKD 2JWYA 1E4XI 1KG0A 3UH8A 4AQ1A 3OWEA 3Q8BA 4FMKA 5F7KC 5SWSB 5T1LD 1I31A 4I0CC 4YQXL 3BP7A 1NINA 1UH2A 2XWBB 2N7AA 4GW5A 4HH9B 1NMBL 3WFDL 5T1KA 5DRZB 4LF3A 4U3SB 3FUJA 2EDRA 3ARVA 5CZXD 1U8QA 2Y5EA 3RTQB 4EN3B 1KTBA 4HKZB 1R3LA 2DN7A 4Y2DA 3HPLA 3QWRD 2WVSA 1WZAA 4Z7VB 4GBXC 3I6SA 1DJWA 1MLCB 4LASL 1W72H 1DVFA 3JVGA 1CD8A 3U48A 3BZFA 4C56D 5DMKA 1PX4A 4AQAB 3FSZA 2ODHA 4KBPA 4M5YH 1KYFA 4YLCA 3VGGA 3TVMD 3FO0H 1CBJA 1OV8A 4XMKH 3OG4B 3RPIB 1QW9A 2B7DT 3QEGL 3G5VB 4F27A 3QO0B 4KMTL 4OGXH 2YQGA 2QKIB 4APQB 3LQZA 3RWGB 3B3IB 4PBDA 5CJOH 2XN0A 4EF3A 2ESVA 3PDGA 5EU7C 1NLDL 3ALXA 2GUYA 4X6DB 5JIDA 3TCXA 1P7QD 4IMKA 1DJSA 4K3DL 5C07E 4HJJL 3W1ZA 3LEVL 3IGAA 2CDGA 4I0PB 4LPWA 3GHEL 4RGNE 1TVBB 4CU7A 4HOXA 4YHZH 3MBWB 2FJHB 5CJ5A 2XPGB 4HV8A 5KVEH 1FG2B 2YJLA 4S11A 2YKKA 3HBGA 1RP8A 3RHWF 4JM4L 1FLRL 4LRIC 2AS5M 1EZVX 2AV1B 4FFYA 4X6EB 1NKOA 2HRLA 3QT2A 3C2SA 4IBYA 1Q0YL 1BD2E 4BKSC 5IBUG 5JW3H 4LCYB 1UA7A 3NRQA 2CBQA 1T7WA 5D9SA 2DI7A 4XMLH 4OFQA 2W59A 3SKOB 1I9EA 1RY7B 3WUZA 4ZT1A 2CMRH 4TQ8A 5GGUB 1U21A 2IFFL 3GMLA 2W95A 4LIQE 2ADIB 4QHNA 2ICWB 3BP6B 4WEBH 5JYMA 4HS3A 2ENQA 3I6KA 1Z0MA 3MLPA 1FNEA 2DI8A 2I9TA 5CO1A 1TTRA 5DO2D 4JCWA 4Z8FL 3A4AA 5GGQL 2WHVA 1INDH 4GAGH 4Y5YC 5E4IA 4ZUWA 1MVFA 5AW4B 2IANB 4LCVA 3T0AA 4Y4HA 1E90A 4Z7NF 2BNRE 2V45A 4HDIA 2OMXA 5BV7C 3JTSB 2ADFH 4WI4A 1SQ2N 2VMFA 3SGJC 4Y4FB 2ZXEB 2IQ9L 4KXAA 1OCZB 5F71A 1D3CA 2I9LB 1A4JA 4IRSA 1DZ0A 1J1XH 3TESA 4PJXF 4ZXBA 4F58H 5T5NG 1Y18A 4EUPA 1GY1A 3GS4A 3VX0A 3SCMB 3N1PC 1FFNB 1KJ2B 2DWDA 5C6WH 2RH0A 2HLEB 2Q2LA 2FSDA 2BOBB 4U2ZA 2HN7A 2VRQA 1RZQA 4FNSA 4R3SA 4HEME 1TYEB 4OZ4B 5C07D 1UYWL 5SWZE 2QZQA 4RMBA 4PWHA 2BHZA 4N3UA 4RGND 3UMNA 1ITBB 3VE0A 1NC4A 2A0LD 2A6DB 3QQ4A 1UURA 3FFCA 3MXWH 2DMCA 3MROB 5DC2A 2CRYA 2H6UA 2X7LB 2WV3A 2DEYX 4GRWB 5KVDH 4TLUA 5H8DA 5KS9B 4LOFA 1PVHA 1KJ3H 3MRMA 1CICB 1TR7A 2NT1A 2CA3A 4UAHA 1VLXA 1AHWC 3LEYL 5I66A 4FQ2L 3GMPB 5BUGA 4HETA 5A2FA 4ENEC