4JS7A

Crystal structure of d78n mutant apo form of clavibacter michiganensis expansin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of wild type and d78n mutant Clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
molecule tags Sugar binding protein
molecule keywords cellulose binding protein
total genus 43
structure length 202
sequence length 202
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4js7A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4js7A02
4JP7A 4JCWA 5GM9A 3SUJA 3SULA 3X2KA 4ZM7A 3X2OA 3X2JA 2HCZX 1BW3A 4FG4A 1N10A 2GAEA 3FT1A 3ENGA 1L8FA 3X2MA 1HD5A 2PI8A 2G6GA 2AE0X 2BH0A 2PNWA 3X2PA 1BW4A 2ENGA 4FG2A 4ENGA 1WHOA 4FERA 3X2IA 3CZBA 4JP6A 2KQAA 2JNZA 3FT9A 2G5DA 4AVRA 3D30A 4L48A 1OA9A 3X2HA 2VXQA 1BMWA 4JJOA 5GLXA 2PICA 5H4UA 3X2GA 2PJJA 3SUMA 3M3GA 3X2LA 1OA7A 4FFTA 5GLYA 1WC2A 3X2NA 3SUKA 4JS7A 1WHPA
chains in the Genus database with same CATH superfamily
2AJXH 3AWGA 5F1IA 5HHVL 5CGYD 4A7UA 1XXDC 2W0KA 4K55A 4KRPD 3O41A 1JYNA 5I0WA 1QLEH 4HIXL 5J1TC 4TQ8A 4XP4H 2EE3A 4XX1E 3QZWA 2O5ZH 2VMEA 4OF7A 2DM3A 1CR9H 3C8DA 2BRRH 4WWNA 4NXSA 2B59A 1AQDB 2N7BA 3P9WB 2G5UA 1TMCB 3MFGB 2ZX5A 5D7KD 2H0FA 1P4IH 3FB5A 5B1CA 3DI3B 4HLJA 1CCZA 4MJIE 2R2BB 1JE6A 3Q9PA 5AW6B 4FQCH 2EDKA 1EXUA 2F58H 3KPQB 2DQCL 1NC2A 2VUMA 2PNWA 4IBUA 1GYAA 2B20A 1UASA 4HMCA 4NN6B 1KT2B 2W38A 1DUYA 5C0NC 4GMTH 5HDLA 1RD6A 2CCWA 2P9RA 1ZY9A 2QQLL 1MEXL 1PZ2A 1A1NB 3V4VH 1BZ8A 5C92A 2IDUA 1AIFB 5CEZE 3EDJA 3FQYA 3PYCA 5FOJA 5L2KD 2EIBA 2BNUA 4KRLB 3PWUB 1GHFL 1UT1A 4PWEA 4DN3L 1S9WB 3CVHA 2XA8H 4H25B 5FA4A 3CXHK 5CR8A 1UH4A 1WP6A 3T0AA 1G9MH 2LLLA 5FFLA 3LN9A 3INUL 1H6EA 3AB0B 1JNHB 4H8UA 3KDMA 1W2KT 4X6BA 2JK5A 1R47A 2X4UA 3SQRA 3ZDXE 3WIHH 4LBEB 5I8EB 2PCXA 1CFTB 3BD4A 4MLIA 1FLRL 2X40A 3HB3C 4LCWA 1P1ZA 4J6RL 1EGJA 4BH8A 1E28B 3O3UN 2WLLA 1Q1PA 5TQ2L 4NO3B 5DRXA 3CSYB 2YHGA 1BWMA 4KKZA 4OFIA 2UV3A 2FD6H 4JUTA 3TEZA 2XG5A 4F1SA 4GSDH 3PP4H 4I0PD 4D9RE 1AGFA 1HL9A 4DO5A 2IDQA 2O26U 3O2WH 3T09A 2JJSC 3B2VH 5IBUB 1T1YA 1BZ9B 4OJEH 4QY8B 1RU9H 2PJHB 3LS4H 1KY7A 4PY7A 1D5ZB 3BWUC 1INEL 3QWRD 4FYQA 3QFJE 4PV8B 1G6RH 1J1XH 3BESR 5EWIL 4A2MA 1TZ8A 2EH7H 2VJ8A 1HX0A 1B0GB 4WJKB 1KEGH 3CPLA 5C71A 4NUPA 1VLXA 5AW2B 4OF6A 5I15L 3PIQB 5D93B 2WNGA 1VADB 2PR9A 4MNQE 3H9SE 4G5AA 4AKQA 4M6NH 4M7LH 4HKJA 5ICXB 2UUDH 1OOWA 3L13A 4DUWA 4P2RE 4PRID 1DEEB 5I18H 1M53A 3V10A 3MA7A 2ZCHL 3CVIL 4GT0A 4UNVA 3AT8A 3QEQD 4WI3A 4PW3A 3WO4B 1A25A 3GJEA 3MOAH 1QLFA 1T5XB 1L9PA 3D85A 5JUEL 3MJ6A 1R3HB 3MR9B 4UZSA 3V9CA 1EA9C 1VJSA 5T33L 2X4RB 3CFNA 2O5JD 3TJPA 4RFNB 3HC0A 2P42B 2VLMD 3ABKB 4WEMB 4ABWA 5B3JF 4ZSOB 2WVSA 1OCZB 1MNUL 3S5LB 3BEVA 3L17A 4WUUA 3L5XH 4AM0Q 4JZOB 3SZKC 2BLFA 1X4XA 4NLHA 3CH1A 2HZHA 3C9NA 1XZWA 3TO2A 3G5XB 4ZX4A 1JCVA 3MTXA 1FNSL 3PNWB 2OW7A 1QBBA 2QQQA 2Z65C 5JPMB 2XQYG 1A6WH 2JVUA 3V6BR 1YCSA 4LHUA 4PJXF 1QFHA 2EC9T 4ZS7L 3VD7A 5AD0A 4X6DA 2VAJA 1NIAA 4NX0A 4Z7OE 4P5SA 3OQ3B 1IGJA 4FE9A 4Q9QH 3SJVD 2BVTA 5IMMA 1AANA 4ZSOA 4WF7A 4IK7A 3UACA 4OZIE 2Q7YA 5FHAL 2G5DA 3BAWA 4NQTA 5AOLA 4F8QA 4P5MA 1I9IL 4JFFB 4BFJA 2V5RA 4AQ1B 4BM7A 1F3RB 1RK1B 1J1PL 4EXKA 4B60A 1OALA 5KVFL 1WH0A 3GSXA 3NESA 3OTTA 1XD0A 2IFFH 3LTVA 2A83B 2G3MA 1NKOA 1ILUA 2Y36L 3B5TA 4OVVA 3QORC 3THML 1UT9A 3H2QA 3H53A 3RTQB 5C18A 4F5CA 4YSQA 5K1JA 5ID1B 2KLRA 1HEZB 2J8UB 4XWOC 5HD8D 1X7QB 4P9MH 5MENE 2ZAIA 1QQDA 4R97B 3LN4B 4PWIA 1U8CA 5JXEA 4NQQA 1PJWA 5INDA 3D39B 2CJUL 3KLQA 4FNUA 1XEDA 1W0VB 2QQKL 3TM6A 5H94A 1A02N 1LM8V 3AQZA 5A3ID 3F7VB 1MRDH 1GC1H 2KC0A 5FO8B 3RGVC 1CD9B 4GI8A 4EUPH 4PRBA 1F4XL 1LO2H 3FO0H 5HYJB 3I50L 3QUXC 3MRJA 5DJ8B 4F8OA 3DX2A 5GRYA 5KVFE 4AEHH 1JYVA 4LVEA 4PLJD 3B43A 4OJCA 4U33A 3VFGL 1G0XA 5FHBH 4HJUA 3VI4F 2X6BA 3DI2B 3FRPG 1BQLL 2HMIC 2Y6SC 1A4BA 4DWHA 4MVBD 5EZLA 2QPDB 3MNVB 4AYEC 1PLCA 5HD8C 1NMAH 3JQOB 1RZ8A 2IH1B 3FB7A 3L48A 3NSCA 4O5LL 1DLHB 4FHJA 4I18B 2A9MH 2XX1A 3PGDA 2VAAA 4IBQA 5DUML 3QJFB 1YECL 4M8VA 5HYJA 3F6LA 2YMOA 5LG1A 1AJ7L 1ET7A 1U3HD 4YH6A 2B39A 2E7MA 2DYPD 5HVWA 1VENA 3K71A 5DHYB 4Z5RA 3HE7C 3HG5A 1TYRA 2VDNB 4LASH 4L1HA 2WVVB 1Y1DA 4NFDA 4OB5L 2IH1A 1ZDQA 4HF5H 4HULB 2D3NA 3SE8L 4IRSA 1NMCB 2VM3A 3DIDA 1HL8A 3JTBA 3BVXA 3QIBC 3QIBD 3F58H 4GI6A 4LPXA 3B7TA 4C56A 3F5WA 4OLXL 4HWUA 4OVUA 3X14B 4F91B 3DYOA 4K2UL 5TK4A 3LMJL 5HI5C 4YIQB 3WUWG 2D8KA 2R9HD 2K9UA 4LHUD 1THAA 5HGAB 3ZOAA 2E76C 5HVHC 3OXRB 1JGEB 4AYGA 2PUQT 2D3VA 1MVYA 2BFVL 2D0GA 4EN3D 4H88L 3QC5X 3KCWA 3NIGB 1TOXA 3IR5A 3THMH 2Z7ZA 5SWSA 2ICWI 1AGBB 2IFFL 4LLYA 5H2BA 2PWEA 2VDMB 1GMEA 2JIOA 4FQ1L 3QXWA 4XMKL 5E24E 3AZUA 2OYPA 1TEYA 1J8HE 4FNRA 4PI2A 5E5MA 4DGIH 4ODUA 3LNDA 5EU7E 2VRQA 1X5HA 3LIZL 4QUOA 2ZSVB 4M1DL 2YR3A 2DIBA 2CPUA 25C8H 3AXHA 2VISB 5AOMA 5HHOB 1W72H 2PYED 4Q0XL 4HV8A 4IU2A 4JRWA 1Y07A 5T1LD 4CW1A 3ARED 3QHZL 4DEPB 3WDIA 1NM4A 3CHQA 4FFYL 5EEYA 3HVDA 1G94A 1KACB 5BVJA 1OF2A 1TSRA 1EU1A 1F58H 4PWHA 4KPHL 1AHWC 4EZKA 1R33A 3AM8C 4HQQL 5DEZA 4ZTOL 3RFZA 3C6EA 1TUPA 3OJ2C 5CN3A 1BYNA 1NGWB 2AEOA 2NY6D 1JV2B 3T2LA 3SULA 3X2KA 1CFVH 5KYYA 1FBIL 1I7ZA 5FO7B 1AZUA 1JVKA 1PEZA 3SY0A 4HIEA 4S1RH 1IRAY 4FYSA 2NSMA 1MRFL 5AVUB 5AVSB 2OL3L 1PZAA 4JKPL 4DP0X 4M93C 4K8RD 1HNFA 3C5ZD 1MJ8L 4MWFA 3UZQB 5D96B 3UROR 1BLNA 2ZP8A 4ZTEA 5F3BA 1OT4A 4B3EA 1MFNA 4FXGC 2NXYB 4HKXB 1PY9A 3OKMA 5ACZA 5ADPH 2K6ZA 1FL5B 1U92A 2F53B 4XPAH 3U36B 3VXTA 4UT7L 4WW2C 3IGUA 1SLUA 1MPAH 3IFLH 3CZSA 5LQBL 1JG9A 4OQTH 4IIZA 5HHXL 5T5FA 2R8SL 2XTJC 1CD1B 3UTSE 4XVOA 3UTPE 5KZCD 4LKXA 1FZOA 4ADGA 4URKA 4W6WB 4PEEA 2GSMB 4LFHD 4L3EB 4TF4A 5DCCA 3NCJH 3NT0A 1SLXA 5E9DE 1I9EA 2P5WB 4UQBA 2P43B 1OE1A 3BQUD 1J1XL 1NCOA 2XZCL 3HE6A 2QKIB 4GW1B 5FWQA 4ONFL 2V2WA 5DT1H 1CGSH 4PJFA 1WIUA 5IMOB 1LE5A 4HUXB 3SUKA 3U79A 4TQPA 2CCVA 2H2PC 3BXNB 3UAJC 3IF1B 1WFIA 2ZWZA 5E99H 5IFHL 1DVQA 4R90L 1Q1JH 4N2AA 1G4RA 2D9QB 2E7BA 3KPMA 2NXZC 1GTFA 5KSVB 1JNNL 5DFTA 1QP1A 1N64L 3UMNA 1BQ5A 2OA9A 2B4CH 1CBVL 4P48A 4LSDA 1I75A 4MCYB 3U46A 4XZ4A 2XN9D 1H5NA 2WP3T 1UB6A 1V55B 3CMOH 4PJHB 2G3XA 5BJTB 5IMOA 2JXMB 5AG9A 3TA3C 5I8KL 4KTEH 4M7LT 3Q6GL 1FLRH 1KLUB 4FQIH 2R23B 4TVSa 4XHJC 3V0HA 5JIDA 4EAEA 4F33A 2VSCA 1WV7T 3MCYA 1EO5A 3QBTB 4QIRA 3G7TA 1NEUA 1JNHA 4HU8A 4DKEL 2YEVB 4N0UE 3RRQA 5EEUA 5CSGA 4JQIL 4NO0B 2KI6A 1KIRA 2XRAH 4POYA 4UQ3B 3E2HC 2C4FU 4OW6A 1KJ2H 2YAMA 4AWJC 1NAMH 2OMYB 4Q6IC 1Q90A 4Z76B 2F15A 5JDSA 4F3FA 3FFDA 1GHFH 4G8AC 4QRFA 4BSJA 3C2SA 1CDUA 2P8LA 4CSZA 3WLWC 2DTMH 3PV6A 2UXVA 4WDIB 4HOXA 1KFAL 2ADGB 1EAJA 3N1FC 2Y2YA 1JGDB 4Y5XC 4GG8B 1BF8A 2D7PA 4JKLA 2HJFA 2ENSA 3EYUH 3GZQA 4QXWA 4XX1G 4Z77A 1NICA 2YSSB 4DEUA 5GRUH 4B53A 2AJUL 2X9WA 1IBYA 2AXFB 4RV0A 3AQDA 3FHEA 4JFEE 2OQJA 4P4KD 5F89A 4YWGH 2O5NA 4XXCC 2JJTC 3GMPB 3GTGA 2APTA 4XRCA 2G9KA 1S7QA 4UBDC 4F7TB 3BZFA 4UTCA 1PSKH 2W8CA 3WENA 1JWMA 4PCYA 1CG9B 4MS8D 2JKWA 3D07A 4X6EA 4MDRA 2HPOA 4WUKH 1OIOA 2WGXA 1U8PA 1VACB 1NBZA 4K3EL 2YFNA 1YMMD 3QZWG 1UYWL 3QRGH 5AW1B 5D4HA 3O81A 4WWKB 2H1PL 4P46D 5DWPA 4IBYA 1ZHNB 1K85A 3C5XA 1QTPA 4DP8X 1ASQA 6TAAA 2VLRE 4ATWA 1HU8A 1N5YH 4DOHB 1KTLB 3K80A 2NY3C 1IUZA 2ZX9A 1NDTA 3M3GA 5LGHL 3W5NA 5KJRL 3RGVD 1TQCB 4HU2A 3MU3A 3VWKB 4YUEH 1UWXH 2I60L 2VLJE 4EI5C 4IOSA 5GISL 5D55A 3ARQA 4XCCL 4XBGB 3UBXB 4JFFA 4E9RA 3MAWA 1EFXA 3KPOA 3WL9A 4AIXA 4BZ1H 5D1ZD 1OAUL 1GOGA 1VF5C 1EHXA 2A4CA 5ABZA 1TQWA 3OG6B 4J4PA 4NWTH 1I1AC 1WD8A 1ZVNA 3BD5A 1B6UA 3TM7B 4HX1A 4PR5B 4L23A 3WE1A 4B3VA 5HI3C 2HYMA 3A5VA 3CFIC 4YR6A 5H4ZA 3JWOC 4WEBH 5AW9B 5ES4B 3VQMA 2NX5D 1NSNH 1V10A 2OMVB 2Z92B 5JHMA 4WENB 9CGTA 1ZHKB 3S3PA 4F15B 1AP2A 2CJ3A 2CR0A 2OCFD 3G04A 4NP9A 2X7LB 4NCDA 4PCSA 1MCSA 5LB1A 3N85L 2WXQA 1KBVA 3J07A 5I8OL 4OY9A 4F37K 1T6BX 3ZBMA 1XL6A 3HS8A 3QS3A 4UYQA 3CZFA 1SN0A 3GGWB 2EDRA 1AHWA 1FG2B 1JIBA 3AS1A 5IOKA 3FXIC 4M4RA 1UVQA 2JCCF 1ROCA 4X5LA 1YEWA 5HI4C 3W2DL 2FQDA 3VU1A 1GGYA 1KCVH 4M6OH 1MN4A 2YD6A 1DQIA 2DQEL 4AEIH 3LEVL 3FSWA 4K7FA 4DCQB 2IAND 2V3VA 1ZC1A 1ZA3A 2B4CC 4IRJD 4QRBA 4ISVA 1J9TA 2JFCA 5EH1A 3WEOA 1NCDL 2BSTA 2P5EA 4HJJH 5I1DA 1HQRB 2FO1A 5DQDL 4F5CE 4M6AA 4UT7H 1A6PA 3S5LG 5ICYA 2OM5A 5LDSA 2K3HA 3MQIA 4Y19A 4AJWA 1ZT1B 3BH9A 2WXHA 3EIFA 3PABA 1N9PA 2ZX7A 3WS6A 3PGFH 2NY5C 4NSKA 1YRKA 4NO0A 1BXXA 1DQJB 3GLEA 1NBVL 3ECWA 5G4OA 4F9PA 3M45A 2X2HA 3WBDA 4KK5D 2YUJA 1OGTB 1J5IA 3CVDA 5DJ6B 4FTDA 4FLRA 1YYML 4QJ3B 5EZLB 3S3CB 1PQHA 3DOSB 4PJIF 2QQNH 3TNMA 2FYYB 4Y4KA 5IB4A 1ILSA 1JI2A 4PWFA 4ANVA 3OMZA 2Z91B 2LTQB 4A38A 3BIBX 2H9GA 3Q2WA 3MJ8B 4JZJC 2YA2A 3DX7B 3AUVA 1WJ3A 4AGQA 2O4EA 4TVPL 3C5ZA 4KV5F 5AB1A 1JGVL 5EOTA 2YQGA 1RP9A 3LRKA 1MFMA 4HEPG 1UD6A 2FL5A 3L3KB 4Q4IA 4XBPB 4OFYA 3TVMB 4NUQA 4Y5VB 1DEEA 3FQ1A 3BWZA 4FQ2H 2CCLA 3QR1A 2VCOA 5ISZD 3HU2A 1CR9L 2WY3B 1Q9KB 3OR6B 4NQDE 3K2UH 2CH8A 1VCAA 3QXUA 4LSSH 1T21A 5C2BH 1JK9B 2OXGA 2J5LB 2BHUA 5DQJA 1MRCL 3EOAB 3B1UA 5BZDA 4L8BB 4NJAH 3BUIA 3TV3L 2NNFA 4ES8A 1MOEA 4HKBB 4YHLL 4DK6A 3JVFC 2J8UE 3DURA 4N5ED 4NP4L 3H3KA 4O02B 3NCMA 4XWGH 3CUPB 1DL7H 2NY7H 5CKAA 1ANUA 2PCYA 5I1EL 2J6EL 5D70H 3E0GA 3ISWA 4GH7B 2R27A 4X98A 1IGIH 2EINB 1TTBA 4HC1H 2VDML 3OC8A 4MMXC 4KKCC 1CICC 4PJGE 1XQ4A 2I60H 4C54A 3ZMRA 2A99A 5CFHA 5E1AB 5HJGA 5BZWB 2YBGA 5C7ZA 3L3JA 4P2QB 3UZVA 4BWWA 4Z3HA 5I17A 4L4VE 2HT4C 2W9DL 2EEAA 4XMPL 3MLSL 3OAZK 4HS8H 3W56A 5C0DA 1OGAE 5JIQA 4GW4A 3SCMB 3RDTC 4J3TA 1YNKL 3IJ9A 5IBLC 2J44A 4K3EH 2JMRA 1FL5A 1U92B 3CFTA 3W3BA 3HRZC 4JP6A 4DGWC 3QIUA 1YQ2A 4JQIA 4P9HH 2GJRA 4UIMA 2A9ML 2AQQA 1URLA 2ODHA 2ZOKA 4OTXH 4JDEB 4JO3H 1CZ8H 3SODB 3HUJE 1HHKB 4X7EC 4ZPTA 2JKSA 4MNHB 1DZBA 5EF0A 1IBDA 3L4XA 4JPVL 4KODA 1JD7A 2YD1A 3HFML 2DQGH 2H2PD 4BFRA 1JXGA 3B9KD 4K94H 1U95A 5BV7H 1G6RB 5KOMC 3BN9C 2XN9E 3RAJH 1OB1A 1AD0B 1SEBA 5EF3A 2HKHH 3DYPA 3AADB 5HPMB 4CRZA 2R4RL 3LNGA 2JTYA 1T04B 4LRNL 1UOVA 2BP0B 2CR3A 3WFZA 4N2KA 5G5DB 3SB3A 2NQDA 4MJJA 4P05A 4NZ8A 4EVNA 3X2QB 4AM0A 3MLUL 2FYVA 4P2RB 1I9JL 4HKXA 4X4ZA 3KAAA 3GRBA 5EZOL 4X80L 4PJIA 3ML1A 4ZOCA 4Y4HA 2Y1YA 4O2CB 1J1OL 4MNQB 5F2FA 1F6AB 1E30A 1B0RA 4N2NA 1KBKA 5C0GB 3IS1X 1YJDL 2DKMA 4J6IA 3N1PC 3VB8A 5CGBA 4IBSA 4WCYH 1MCOH 3T4AC 2NQCA 4WK0B 2DLHA 2NY1D 3E8VA 4DP6X 4AM0B 4FNSA 3SE4C 2DMKA 3BZ4A 4WUUD 3PLXB 2DMCA 3EOTH 3B9KA 4WLCA 3QUYB 4GG6E 2HKFH 1RAMA 1EEZB 1DVXA 4OI9A 1S46A 4NUMA 4C4KO 5KVDE 4X5RA 2VXSH 3UPCA 4JFXB 3V6ZA 1GA2A 4JCMA 2NY5H 5CCKL 2CRMA 3N1GC 5TD4A 5DJ0B 4JFHD 2HVJA 5D5MA 1RJZA 3S35H 4HZLB 4JFSA 4QXTB 4QTHB 1HD5A 2IPUK 3MCG1 3OX8A 1J0KA 4HWEH 3HLKA 1A3RH 1ACYL 3CDZB 4ZMWA 2Q3AA 4EN3C 2I9LB 1TIUA 4K3DL 4KK8D 4KAQH 3A4EA 5CZVL 3EYSL 2ISDA 1GXEA 1XCTB 2HLFD 1FC2D 1MFUA 3BMVA 3AQXA 1DANT 2JWYA 1YEKH 4K23H 3L2NA 5E5UB 1PX3A 5BQ7A 3P4OB 3HBPA 5IHZB 1KZYA 4PJAE 3L95B 3ZQWA 4NO2B 1NGZB 2VO5A 1BAFL 5GSRA 1TTAA 2W07B 1DSYA 4QRRE 4W9IC 4OBRA 2VDOH 1BP3B 3TCLB 4Q89A 5K9KA 4D9LL 1QLFB 1RI8A 3O2DA 3D0LB 3UJJL 1PDKA 3FB6B 4N86A 4B27A 3EJTA 1O9ZA 4HH9A 1JPFB 3DWTA 3T8XB 4A6YA 5DGRA 3D39E 3VE0A 3EH2A 3QEUB 3TEWA 4K5OA 4ZNEA 2HKAA 4PD4K 1HIML 1HFUA 1JAEA 2BNQE 2MSPA 4PJ8C 5MENB 4C83A 2A73A 4X7FC 1VDGA 2Z3FA 5B38B 1FZKA 2PTUA 3MLTA 4MS8C 5EU3B 3HI5H 3LKQB 4JM4H 3BRGC 2Y1VA 2OI9B 4H7VA 3ARSA 2PYFB 5CJOL 3PFUA 2NW2B 3ZTCC 5KW9H 1OKEA 4HWEL 1DBKH 3OMAB 3L3GA 2PF6A 5DEGA 2IDSA 5T3ZH 1Z9SB 4F2EA 4YXHL 2VZOA 5H35B 4LVHB 3EYSH 4KRMB 1TEFA 3F7PC 4F7EA 4B9PA 4HIHA 3LV3B 3B9EA 4HDIA 5CSBA 4DGYH 3P9LB 1YSOA 1U4EA 3EOTL 4HSAC 1R5WA 4U1MB 4NZTL 1TTUA 1ITBB 4PJEB 5I5RA 4LVOC 4YC2B 3GYRA 1FVCB 4ZBJA 5GLFA 2EADA 4P3DA 5CEYB 2YA0A 4CSPA 2VZVA 4PJXB 4NQCD 3NH7H 4AITA 2KKQA 2DZEA 2O6FA 2ODIA 2WQAA 3O4LB 4P5TD 2X0WA 5CZKA 1C5CH 1KCUH 2Y69B 3BC9A 4G1EA 1SFOA 5I2IA 3GXTA 1GJIA 1HCYA 1U8NB 4ZT1A 1H0DB 2WD0A 1JP5A 1NFDB 3GZKA 1YN6A 3B34A 4FNLH 3V8CA 3HU3A 2MKWA 4GKOA 3BUBA 1AXSA 4J4PC 3OKOA 4PJGB 4I8DA 2JSFA 2BFVH 4JQXA 4XBEL 3ROOA 1R34A 2BSRB 1BJMA 5CIPB 4YHYC 1A6AA 3RDJA 4U1GB 2XSKA 2DY2A 4RH4A 3WE6A 2VMDA 3RTQC 1AI1L 1H8LA 2ZXBA 4Y4HB 1P1VA 1MJUH 1FRGL 3BZ5A 3KVQA 1LEGA 3UIYA 7CGTA 4K8RH 3SDXA 3FU5A 2DMHA 2G5BA 2NYYD 3TWYA 3IXAB 3KPPB 4G1EB 2J8UF 2HX8A 1OSPH 3IJSB 4NAMA 5EC1B 5I16A 1AKPA 2JB5L 3D3VB 4JS7A 4LLUA 3MJGX 3NEOA 4FX5A 1XGQA 1ZT1A 2WK2A 3A67L 5AW4B 1Q9OB 2CRIA 1NL0L 1FZMB 5HJBA 4BZ2H 4GJTB 4JAMB 5GZNA 3OQRA 4QHLB 1GSMA 2P26A 3HG2A 1KJ3L 4AX3A 3ULVC 3HFMH 3EHBC 2FT6A 3QPXL 4HGWA 5E6ID 3L5IA 3UTQA 1H5BC 5F97E 4Y5YA 3EH3B 4LSTH 3FW6A 4HFWB 1EX0A 4LOUD 4QRTB 2HRPL 1UZ6F 2JTDA 1I9JH 3WEAA 4ZMTA 4TRPH 4N5UA 4PGBB 4BQ6A 1SOXA 2BCKA 1XL4A 5FB8B 5IBLD 3MV8B 5D1XB 2R4RH 2BP8B 4QHLA 4OCWL 1T22B 4FG6C 2C1PA 1CFSB 1GZQB 2O61B 1GCYA 3MLRL 1T1ZA 3V4PB 4UOQA 1C12B 2A74A 3PQYB 1JGDA 4Z3EA 1D6VL 1MRDL 1I8AA 2E0PA 3MOBH 4FDWA 5FO9A 3S34H 3VNYA 3WXWL 1WCBA 3O9WC 4PS7A 1TZHB 2E4TA 5C09D 2P5EE 3TN0A 5E8PB 3RJQB 2NY2B 1L9TA 4OV5B 5JTWA 1UJ3C 3UTZB 1DL7L 3D0LA 1NCIA 4ODVH 1KYDA 2ID5A 3WIIL 1FIGL 1YEFL 3IJ7A 3EAKA 2GTZA 1ZS2A 4NT6A 3EFOB 1R3LB 1EVTC 1DBMH 4PWKA 5GRXG 5A2LH 1M71A 5SWZA 2ZOTA 1MCHA 1OE3A 1P1ZB 4KKCD 3EGDB 2MCG1 1EZUA 5JIIA 4R26L 4G6JH 4WNSA 2DMGA 4JPSA 2KLSA 1RSFA 2FQGA 3C09C 3GSNL 2VQTA 3WJJC 3A6BH 3FTGB 3NIDF 4OF0A 2ZG1A 1NC4B 2CBPA 4TVPD 2Z93A 4RGMC 3IJEA 3WFDH 2V3EA 1KV7A 1DVFC 4H0GA 4U6YB 3NSXA 1IGCL 3AS0A 1AMXA 1DBAH 2BIPA 3D6GA 3O2DL 4U3XA 2H41A 4L4TB 4KI5C 5L8KB 1TEGA 4WUUB 4YLQT 1SJHA 4KVCL 1ZJAA 1ZT4B 2YD2A 4U7KA 4DEPC 3MROA 4MD0B 3GT6A 4NBZB 5SWZD 3V0WL 3H6JA 1PZCA 1CICD 5DJXA 4KMTL 1QPPA 2BIMA 4DP9X 5GZOA 3MXWH 4A37A 4OLVH 4F1ZA 5TF0A 3FHQA 4J3OG 5C0BD 1P7KA 3MACH 7FABL 3ZDYF 1CE6A 5IV2B 5T1DL 2CBQA 2FX8H 3QORA 4N8VA 3DBXA 3HA0A 4XN4A 4AXWA 5ICXA 5E2UL 2FWOB 2V8MA 2B3RA 1ZA6A 2PCPB 2VUOA 4U31A 2EVIA 4OD1L 4TVPH 3WNNA 2DWYA 2SODB 5H4UA 3NACL 3US9A 1EJOL 3KHOA 4M93B 1TCMA 2YN5A 2X3BA 3N3EA 4G8GB 4YFLF 1KJ2B 2C5DC 4B6ZA 1NAMB 3U9UA 3NMEA 3QZWB 2R0KL 1LD9A 4XE5B 5I6KA 4NIKB 3AITA 3NPSC 3UMTA 4CJ1A 3GMOB 4YBQC 3FO2B 1YQVH 3OHMB 1NCDH 4PJ5A 3WNKA 4L05A 4WW2B 3VXUD 5GS0C 4Y9FA 3X2IA 4GA5A 2NLJA 1GJUA 4QNPE 5DHXB 1EIBA 3LAFA 4KTYA 1AH1A 5J3HC 2E86A 4CSTA 4MNHA 4XXWA 4FTVD 1HSBB 1R0AL 1KCVL 4I0CC 4KX9A 5C08D 1E9QA 5JQ6H 1XAKA 3IJHB 3CVHL 1AFVL 4HJ0C 2IIJA 2ZE0A 5C1BA 2FBRA 4R7XA 1I53A 4WO4C 4HXBH 3D4GA 3VFPB 4HXAH 3JVGC 3VH8B 3PCYA 1T1XA 1A1NA 3SE3C 4WU7A 5HI3D 3IDUA 3POHA 5FGCE 3X1NA 3DJRA 2EEDA 1ZSDB 3M88A 3RU8L 2XQ0A 2NXZB 4GAJH 4HZLA 5FGBC 2WIIB 4U1KB 2ERJB 3IDYC 4R5TA 4JR9H 1I1RA 1LYQA 1WUZA 3CV5A 3IJHA 4YHOH 5J3HD 2BVEA 3MBEB 3FL7A 4XNDA 4GQZA 1KXTA 4DIXA 3ALPA 5E2TH 4MCMA 2WLJA 1LK2B 2GVYA 4NJ9H 5CZXD 4OJYA 3PHOA 4GAAA 2PI8A 1VFAB 2J12B 1R3JA 5EPPA 3GI8L 3VG0L 3IMUA 3JWDH 3L1OH 1QBLH 4MKMA 2I5YL 1CGTA 1G9ML 1NGXB 2BY1A 3PWNA 4OCWH 5BUAA 1UYWH 2YQBA 5HJ3B 4NQEB 4E0RA 4ZPVA 2AJSL 5LGHH 4BYHA 4MB1A 5H37H 3O8XB 5F6HJ 1ACZA 3TT3L 2D4FA 2PETA 4FI7A 1YMHA 4L4VD 1RZQA 3IVKA 3X13B 4PRAA 2R29L 1RJLB 3NIGF 3TBTB 4MHHI 1MI5B 2AJYH 4KDLA 2X05A 4EOWH 3QB7C 3T8MA 3PG2A 4TQHA 2DQCH 3VXRB 3DJ9A 2BSDA 4ORZC 4X0KA 4Z18A 5BMFL 1JF1B 1LNUA 1W15A 2NTSP 3NSYA 2L7JA 1A6UL 1XTLA 2BP5M 2MOVA 3A67H 1HK6A 4G9FA 2H0JA 4KI5E 5TGBA 4YBHA 4RGOL 1K5NB 3DURB 3M8OH 5TTRA 1NFIA 1W6LA 1RHHB 2WCGA 1UM6L 3OL2A 3OPUA 3QJFA 1KFAH 5IUCA 4AKPA 5FGRA 2Y9RT 2FWLB 4K73A 3EJRA 1N5YL 1RZPA 2WZPD 4GYBA 1ACXA 5GRUL 2ZIDA 1G4MA 3ILQC 5DLMH 5DC0A 4P06A 3RFZC 4UNTA 1FVDB 2TRYA 3CLEH 3N5AA 1SLVA 4F93B 2CWRA 2JQZA 1IC5L 3ABLB 1V7NH 4GMSL 1IBGH 1U6AL 1J0JA 4G42B 4XBEH 1MCFA 4ZFFA 4JQIH 3H0TA 3SN6N 3JWDL 3ABGA 4NOBA 4P2QA 1F2QA 1R17A 4FQXC 1K2DB 3HMXA 5E4EC 4HD5A 2DPKA 5GS2H 1MIEL 3CWGA 4TUJA 4XB3A 2CJTA 2H3KA 1HAWA 4DAGL 1KN2H 4NPYB 5LBGA 3I6LD 1AQKL 5INCA 4ILDA 3NJLA 4XPGL 3ZKXB 3ZMNA 1B4RA 4JO4H 2OP4H 1U8MB 2NW3B 3RZWA 4GAJL 5AW7B 3ZYIA 2OR9H 4A2DA 2X88A 2CHNA 4X9IA 2IAMB 4KJPC 4ZUTA 3SKOA 1XVSA 4X4MA 1K2DA 4QGTA 1I1AB 4XZUA 1KGCD 3R7QA 4V33A 2V2TA 3NCCB 1Q1JL 1BX2A 2YPLD 4HXBL 1Y1WA 3VFNA 3BEWA 2FX7L 3JV5A 2DBLL 3LQMA 4TSAH 5GRJH 5T1KB 3FUFA 5F6IB 3DJTA 2R7EA 5LN4A 3O4OC 4LMQI 1VSCA 4NQED 4JFQB 1IAKA 3ZTNL 5JXED 3FT1A 4R9HA 4BFEA 1JS4A 1WC7A 3PWLA 2ARWA 2W1NA 1SQ2N 2ZP9A 5GS0D 1EHKB 2YAEA 1TZAA 5DR5L 3MRCB 1U8HB 1LILA 2AEPH 3CCHB 4FXTA 3IDGB 4V1DA 4QYOB 1R24A 1VPOL 4FRWA 5DZNA 4IRZL 3T3PE 1HIMH 3PP3K 1D9KD 2JJWA 4I77H 4JVUA 1VZIA 1IBBA 2HLAB 3NSDA 3TBVB 4HPYL 3D9AH 3NCWA 2F0CA 3UAFA 5IHWA 1WDAA 1GIGH 4Y16D 3GMRB 2Q3XA 4Y5YB 4KTGA 2IANE 4QT5B 4WV1B 3U30B 3V52L 4M02A 2YKLH 3W81A 4W6XB 3RKDD 3KH4A 4V2CB 3MGAA 1P5UA 3WUWB 1X9UA 5GGVY 3Q5TA 1U8HA 5FDWB 1UM4L 4Q9CA 2ZXWB 5IESL 3BQUC 3RI5F 5T5NF 2WO4A 4ICXA 3QG7H 1ZLVK 3MODL 5A2FA 5K9OB 3FUIA 2WINA 3BH8A 3DHUA 2Y23A 8FABB 3QUXA 1L5GA 2A6KA 3ZDWA 4Z7AA 5AZ2H 1MCWW 5FTKA 3MUUA 2R4SH 5FUCC 1MH5A 4YHZL 3A23A 3B8SA 5LN8A 2WWKO 3ZL1A 4XMVA 3UTTB 4KI5D 5C70A 4EJ1C 3DTDA 3O2DH 5K39B 3AXLB 3KLHD 4L8CA 4OGYH 4DSYA 5KBNC 2ZF8A 3EOBB 1UOWA 3IDMB 3OKEB 3V6OC 1WICA 3HMWL 4P4KB 4UANA 1I31A 1PS3A 4DFHA 1O5DT 3AVEA 2WYTA 5FYKE 5LBSA 2E4FA 3DK2A 3B2UD 3VGBA 1RFDL 3N9GL 1BIHA 5L4FA 5D7JA 1SHSA 3ET9F 5EU4B 1LE9A 3QJHA 2HRHA 1LNUB 4G6JL 2MQ0A 4X7TB 1MCOL 3VQ2C 3GTKA 4BKTC 2VDOB 4TNGA 1TR7A 1MF2L 4JJ5B 3IFNH 3QI9A 3ZE2E 5T1DH 4PJDB 3WV0A 1N2RB 2G75A 3M17B 2JJTA 3W57A 5KYWB 3IDIB 1WCMA 1TJIL 1WS7A 2MEJB 2GW5A 1FIGH 2DWSA 5B39B 4KK9C 3V0EA 3CVCA 3E6FA 1I8UA 2FGWH 1M05B 5DRXB 2CHDA 3GS0A 4R8WL 1RZGB 3MLUH 1IQWL 4ODWB 5L4IA 2V17H 5GGTH 4BUHA 1CLYH 3KNBA 1X3DA 3OAUH 2FATH 4MA8L 4NO5B 1I7UA 5LAPA 3MCKB 3WFDL 4PRIB 4XVUD 4F7EB 4NPYA 4J5VA 1P7KB 3P2DA 3U0PA 1J0HA 1U8OA 4HA1A 2K8MA 4S0SD 3KS0H 1R5WB 1CQYA 3GS7A 4H1LB 4FHKA 1Z5HA 4U1MA 5HGHA 2YAHA 3SDAA 2FO4B 3UZEC 3SGJA 3EO1A 1U8QA 1IFHL 1NCBL 3D85D 1BOGB 1SBBA 3GTVA 4JO3L 4L0ZA 4J3WA 3G5YB 3SBRA 4F9LC 4OD3L 3V0AC 2MNUA 1F18A 3GHBH 4ADJA 4CAGA 1C5DA 4ZUVA 3WD5H 3D08A 3CN2A 5C09B 2A9AA 3VI4A 3GZPA 1DQDL 1Z2KA 4L29B 3R8QA 3RWDA 5FS5A 1QI4A 1VAHA 5DVOA 3T77B 3ZTJH 1Q9LA 1AKJD 5F3HB 2QHLA 3GJFA 4N3TA 3DRTA 2WMPA 4HYTB 2VJXA 1IILE 4KX7A 2HJKB 2R7EB 1QWUA 3FT0A 4NQVA 3SCMC 1NFAA 3WMQA 2C26A 3FCBA 3K5SA 1B0WA 2FLRT 2DEYX 2FO4A 3HRZB 2NRDA 2DIAA 1NMBL 1D5BA 4O2EA 4G8IB 4HP5A 1G7PB 2HAZA 3CDGB 3QZOA 3WG7B 3L4UA 2R59A 1F56A 5ALCL 1G0YR 2F7QA 1DBJH 4XBMA 3HC0B 2A4EA 4WNQB 3GJFB 4L2LA 2XVBA 1FQ9C 4ELMA 3H3PL 5E6IB 4EXPX 3QFJD 4ZMOA 2VL5B 2HFGL 2QQKH 3ERXA 3VXTB 3BE1L 2D0HA 5H94B 4BUQA 2CBTA 3SE6A 1F4HA 5TDPB 1YNTA 4JM0A 1ZTMA 4U6VH 5A7EA 4GS7B 4HPOL 3B9AA 2AQ3A 2OULB 2HG5A 4LKXB 2IDFA 1IBGL 1U6AH 5D5MF 2C3XA 1PD1A 3MNDA 2R1YB 4BSWB 5KVFH 2P4AB 43CAB 3FTXA 1JPTL 3QPKA 5E9DA 4OFQA 3WFEH 5J11C 2W81C 2UXFA 5E00A 2WWKT 3KPSD 1TDQA 4PYGA 5F21B 4BFBD 5DFVC 5D4IA 4JFXA 4KNQA 1N68A 1IM9B 2BNUB 1CT8A 3KYOA 1LK2A 4BD4A 3PDOB 3GKWH 3OC5A 1HCVA 3O2VL 2UWEB 1JGVH 1X5LA 3MV8A 3FTUA 5D1XA 3WNMA 1UKSA 5DZAA 3QDJD 4XMTA 4KVNH 1EDYA 3B8YA 2HLEB 1SYVA 2PTTB 4DO6A 3GTQA 4I9WE 4MSWA 5GGTA 1KYAA 4BFNA 4ZAKB 4HETA 5DEJA 1MELA 4IBTA 1CFTA 1JGLL 2R0WL 3SIKA 3KPRA 2WXNA 3QQ3B 3K4ZA 3DX9B 4PRAB 1N4XL 2N0KA 2EDOA 2J1WA 1ZLWH 3VX0A 2HA1A 5C0AB 4QRUB 4I18C 5GIRA 4FNLL 5CCGE 1KCWA 2OYMA 5I1AB 1SYVB 1FO0A 1OD9A 2JI1A 3GMMA 4K9EL 2I85A 5DJYA 1HNGA 2Z8WC 3C5ZC 1MZYA 4D0BB 4NI3A 3BP7A 3FCSB 5AW3B 1M6UA 2I5YH 4KC3B 3ZZQA 3QCTH 5IVOA 3VYPA 3QWZA 4F7CB 1KEML 1L0QA 5C09E 1BM3H 3EYFB 4YSOA 2X9ZA 4KRNA 4XPBL 1BIIA 2V4LA 4ONHA 1JERA 4GIAA 3QHTC 4F8PA 4A1RA 3BD3A 5F7WC 5IEKA 1NMCC 2WJ7A 4YAQB 5BOPA 3GXPA 4C83B 2EUVA 1NDMB 3VH8G 5BPPA 2BMKA 5CLYA 4XNZB 2ADGA 4UBDD 3CHRA 4GNKB 5BZDB 3H2WA 3WN5A 4L3CA 3FSVA 3D9AL 1SY6L 4MA3A 5GLYA 2XA3A 3LIZA 5GGUB 1SJVA 3D4ZA 1CICA 3BYYA 5HHPA 3RGHA 4HJGB 1F6FB 2XACC 3FT3B 2W94A 2Q87A 4OCSH 2WYZA 1U8LA 2IFGA 4NYLB 2JKRM 3SDYL 5DR5H 2FUTA 3FCGA 4K5PA 2ENGA 4UQEA 3CE1A 1Q72H 2YK1L 3L5WA 3LY6A 4IKLA 5IB4B 4I4WA 3FQUB 1H3PH 2AZAA 1I8KB 3DSNA 4RMUA 3MN8A 3NJJA 3LRLA 4PS4H 3DXAA 5C09A 4LLWB 3STZB 1OPGH 4UYPA 1GIGL 3QCUH 4YPGA 1SUHA 4FC3E 2JCCE 5EC2A 2NQ3A 3I74A 4PJDE 3O8XD 4N6RB 2ARJB 5HDRA 2HJKA 1WA1X 4P57B 4NOHA 4YFEA 3WFHB 3ENEA 2VDQH 3WMSA 3U9PL 4Y9CA 5DD1H 1Q9KA 3GZOA 3L9YA 4YZFE 5T5FH 2NNCA 4E9XA 1Q0XL 3IU3B 4MJ6A 1FNEA 3U9UB 4FLSA 1URZA 2NT1A 4YC2C 4X5QA 3AY4A 3U7WH 3QQ4A 3RB7A 4OIAA 4LCCC 3G6AB 3L1GA 4E41D 4A7QA 3C6LD 4TL4A 2EEBA 4TQEH 1MFDL 5EU6D 5JO5B 1CDGA 4LDOB 1FL6A 1LEGB 3QUMH 5I8CA 4FFVC 5HHOA 3LEYH 5GGRY 4BSVB 1UATA 3B3IB 4Y2DB 5I5IA 2JJUA 3B2VL 4OZFA 4XMZA 4DHLA 4FI6A 2G6GA 2H1PH 2HRLA 5FIEA 3F7RA 1EZSA 4U1IA 2XV2A 4YGVA 2QADB 3ARYA 5D96C 1CF8L 3GMRA 4Z3GA 3DRQA 3V2AR 4XNQB 3ETSA 5E4IA 3KPSA 5IFAL 1E4WH 4JFOA 1HI6B 2ZSWB 1MEXH 2ZWNA 1ECYA 2QHRL 4YDMA 2PO6C 2XKSA 2DWDB 2OCJA 2HVKB 1S9VB 5DD3H 3O6LH 4JHVA 1F4YL 4M4RB 1JN6B 4YXLH 3ZTDC 1L4IA 2LE9A 4WHTB 1FN4B 2CA4A 4WCYL 2F5AL 2YWYA 2ESVD 1BJ8A 3QUXB 2F54E 3G6JE 5IB2B 4YDZA 2QKIC 1B4TA 3ZK0A 5CEZH 3IE9A 3HE6D 5GRVK 3WTWA 1A7RL 1LDSA 1U2CA 2FWUA 3BSZL 2DYRB 5DD0H 2X70B 1XF5B 4XO3A 4W9HC 4XP1L 1PLBA 4JBSA 3F7YB 3BAJA 1OZTG 1TWCA 3EOBA 4HLZG 1DYZA 3AU1A 5HJ3A 3SYAA 1TVHB 3NCXA 3FB8A 2M83A 4DZBA 2CNYA 4KHTH 3EDEA 1KIRB 4ODVL 1V05A 4OCMC 1FDLH 1GYWA 2HVBA 3GLAA 3IRPX 4OZ4A 2VR3A 1OA9A 2XKNA 1DQJA 4DPAX 3HE6B 3ULUH 1X7QA 2FH6A 3BH8B 1GGBH 1ETA1 2Z35A 3U1QA 2W9EL 3GXIA 5HJDA 5SWZB 5F70A 1FG9C 3VI3F 1B0RB 5C0RH 2O5ZL 4NQCA 2ZUTA 4BFIA 2AQNA 2W07A 3KYKL 3RVWD 1H8SA 1B2YA 1HWGB 1IEBB 5FO8A 1R5VB 4YSSA 3WTSA 4L8SB 2G3ZA 1A9VA 5C0IA 1JPSH 1KULA 2GIMA 2XNAB 3NQKA 3UJTL 4S1SH 4XNXL 4R7NA 3LHPL 1MLBA 4GY4A 2YPLE 1K3IA 2FR4A 2P24B 1AFVH 2AV7A 2DQFA 5H37G 1IBHA 2HWZH 3QEQE 2Q7AA 4OIBA 2YQ3A 2BZ7A 5E51A 2VLKA 2GKIA 3C60A 2BOCB 1RJCA 2WVTA 1X6NA 4Z1PA 2YD8A 1L7IL 4QTIL 4JANB 4HBCH 4W81A 5DFAA 5FUOH 3DVFA 1ND0A 4PWJA 3O6MH 5E56A 3TV3H 1GYCA 4F7PB 2R7ZA 4LEXL 4X0NA 1U91B 1DVFA 1FRGH 3ZE0E 1HHGA 3O3BB 1U41A 4Z8FH 1DUZA 5LAXA 4NRXA 4I0PC 2YLHA 2PCPA 1T5KA 5EN3A 1XH1A 3FN0H 4PMEA 4EF3A 4OI7A 2YSSA 3HW7A 2ZJSL 3MCKA 3P1VA 4MQ7B 3GMLA 3ARFB 3T04D 3CLFH 5DEFB 2NCEA 3TO4B 3P69A 3TVMD 3WHXA 1UACL 4QRQB 4AYFB 1BSIA 5IHUL 4PH8A 4ZXBD 3QUZC 4C55A 2VQ4A 4EI5B 3MXWL 3QDGA 4KROB 5SV4A 3VE0B 5HYSB 4Z7QE 1QLEB 2FDBP 3QQDB 4NZRH 1JWMB 4PB9L 1CDJA 4RCAA 1P0SE 4J8RA 4KPHH 4AYSA 4FOMA 2I27N 3SQOH 4OKDA 2L7EA 1EEQA 3IR6A 1XGYH 3P4NB 1OAXL 2WXJA 4MJID 2GJJA 3FRPB 1HSBA 4NGHL 5DS8B 2PCFA 4B5ZA 2AJZB 1OAYL 1IGJB 4N4YB 3STLA 1JBJA 1XIWA 4HUVB 2VO8A 5B38G 3VH8A 1G7IB 1OK8A 1RUKL 1HKFA 2W9LA 3A6BL 1KWKA 1T2QH 2DWXA 3FB5B 5D7LB 5I8OH 1DBKL 1H3PL 2RR3A 3PRZA 3QGVA 4JM2A 3APDA 5E8OB 1OAJA 2XPGB 3CQZA 3HPLA 4KWUA 1Q72L 2YK1H 2AXHA 3QNXA 4R84A 3ZW3A 4CRPA 1GC1C 1DO6A 2KL6A 4XNYL 3B7RL 2NSQA 4UI2A 5TDNB 1AC0A 1MCPL 4A2LA 4J2XA 3ZPDA 3WIIH 2HJLA 3LKNB 1G1KA 2DQUH 4A2FA 4N25A 1BVOA 4NWTL 5AVVB 2BIHA 3BXNA 1SY6H 2NYYC 4W9GC 5JOFB 2A6KB 3AG4B 4UAHA 3LEVH 2H6UA 4ZS6D 4WFED 4G7RB 5FA4B 4HIPA 4AMKL 3KLKA 3ZRSA 3RZCC 3TA3B 2XI9A 1DLFH 1KCRL 4LASL 3VGGA 1B3IA 1CFSA 3HE7A 1LO3L 2WUCH 3V0IA 1IM9A 5ACZB 4X6BB 1UJ3A 4AONB 3SDYH 2HJLB 1D7DA 3LKNA 4NRZA 4Z7VF 4JKMA 5ENWA 3TIDA 5C08E 4EEEA 5CBAA 1CS6A 1INQA 2ZWLT 1AYOA 4C8XA 2G5BB 2E7DA 1GZPA 1LDPH 2NPLX 3SSGA 5IF0A 5KYNA 1CFQB 2FHCA 4J3OH 1ZGLB 5SWQA 3HMXH 1JGUL 5FOBB 1S9XA 1A4JA 1DR9A 2D7MA 1NCHA 1ZLSL 4DESA 2V2WB 1TMOA 3MBWA 4YDVB 3QPXH 1QBML 1AGFB 3RVTC 4FA8A 1DJYA 3OR6A 1IQDB 2FR4B 3SGJC 5ITFA 1IFRA 4W1TA 5DURB 2G9HA 1NBQA 1HHHA 3V6OE 4Y4FA 4P23D 4K71B 2N59A 5JPNB 2BOLA 1GW0A 4KJQC 1QWNA 4LZKA 3P4OA 4HAFA 4KHTL 5DQJB 3LH2H 3WKML 2X1QA 3IGAA 2HJFB 1MJ7L 1W0WB 2GT9A 2L0DA 4A7TA 1SXNA 1DSFH 4NBYB 3CSBA 3RWCB 3E1F1 5CXPA 5A16A 5EA0H 2IG2H 4Z78B 2EKSB 5DF0A 4QKTA 2FEEL 3X2PA 3W9DA 1SPDA 1J1OH 2J21A 4YE4L 3V4PA 1BVLB 4FMKA 1SM3L 3KGRA 1BOGA 1CB4A 1MW2A 1SLWA 3OPZL 4P2QD 3IMSA 1ADQL 5HDBB 3VXUE 3IJYA 1ZVSA 3BGFC 5EO1A 5E8PA 3GBNL 5LNDA 4LIQH 2DQIH 1G8KA 2WQRA 3TEYA 5IK3B 3G5ZA 2IMNA 2QHRH 2OXHB 1OM3L 3DMMD 3FAXA 3CBKB 5F44A 3RL2B 5DI8A 3UADA 4QIWA 3BAEL 4K9EC 4M7ZB 5E8NB 3TS8A 2ZWSA 4TV3A 3KL5A 2GBVA 4ODXA 3EYUL 4A7GF 3CFDB 2A69D 1M2VA 1MCDA 4Z0XA 3RWGB 3BVDB 5IQOA 2X89D 2R2BA 3ZHNA 3B3IA 5JXAL 2B8OT 5ESQA 4DGYL 5I76A 4ZPTB 4PCKA 1HWWA 1TKWA 2E56A 3PNWA 4KK8C 1WBXA 3DUUB 3DO4A 3MRMA 1TJGH 3RX5A 5AEAA 3MLZL 1KMGA 4QCIA 1R24B 2VW7A 4M61B 1CGSL 5EN2A 4FNPA 1IC1A 3E9TA 1AS6A 2ZSWA 2GBUA 5LGKA 2BY2A 5CJOH 4HS8L 2BE5D 1SBSL 5C0AE 2D7TL 3NCJL 4E9QA 2R83A 1O0VA 3BLKA 3D50A 1DBJL 3HI5L 3MJ7B 1YNND 2P5ED 4PREA 3GEFA 2GK2A 2XPGA 1KJMA 3SE3A 1XB6A 3RX9A 1TQTA 2A6DA 2O5YH 3QXAB 1T0MB 2YUZA 4Z7UF 5HTSA 4MRBA 4Q2ZB 1NEZA 3N2JA 2EVJA 1A22B 1RIVL 4LDLB 4HC1L 1FVEB 4AH2B 5FLVA 5KBMA 4AQ1C 2YD3A 5ICZA 2YMXH 2FQFA 1B9ZA 1TYJA 1HT6A 5DHVB 3HAEB 1K4DA 1RZKH 5EORH 2I9TB 3OAUL 3ZDXF 4NNXA 3D06A 3VO0A 4YEEA 2I69A 4TOYH 3C2AH 4ZMVA 5DMGC 3GHEL 5L7XL 1O6VA 3ECVA 4P04A 2R39A 5ERWA 4MXQC 2EC8A 5I15H 3IU4L 1AY1H 2Z7UA 4AC2A 5FCUL 3B9KB 5DC2A 2O30A 4MA7L 3IFPA 3ZZLA 1OTTC 3DNKA 4XN2A 1QUPA 5ICZB 1YEKL 4K23L 5D2LB 1XF4B 4GKSA 4Y9BA 3BKJL 3VNZA 3MSPA 5D7LD 4V11A 3UTTA 1T2QL 3BUTA 3BQUB 3QULB 2MCMA 4YHPB 3U7YL 2Q86A 2MMXA 1RV6X 3JV0A 5J5EA 1YY9D 3UDWA 1QCSA 4KDIA 4UDUB 1LO3H 2R56H 4HEPA 2NXYD 2BIIA 1QNZL 2L04A 4R4ND 4Y8DC 4J3OF 3TTYA 4CNIB 2UZPA 2R1XA 4EZLA 1S5IH 2XY1A 3KE0A 5CU5A 3L3OB 1E61A 1DQML 5EU4A 1PLGH 3ARVA 3N43B 4HT1L 4J3OC 4JFPA 3S35X 3P0VH 4XPAL 5JZ7C 1SF5A 3U46B 1B3JA 4ADIA 1CR5A 3PGDB 3VGFA 1XR9B 2YJQA 3LKPB 1U8CB 4KDTC 5KSAC 3KYNA 1KFGA 4ALAC 5MEND 2C9PA 3QO0A 4ZXBB 1SXZA 4XVSL 3GXDA 1RULH 5F9OH 2AEQL 4UTAA 2JKNA 1A0QH 2B2XH 3L8QA 4MX7A 4WKZA 4M7JH 4JFTA 1MRFH 3MKKA 1FNHA 2ADIB 4DKAA 1DFBL 2IO5A 4UB0H 1URIA 3N1QC 3RYMA 1XGTB 4KJWD 1PDKB 3FUKA 1NFDF 3S37X 1W0WA 2IV9A 5D7SL 3T0XA 3ULSA 3QG7L 1MG3C 4TN9A 3FT3A 2XA8L 1EFXD 3Q43A 3LKPA 5T1LB 3CLWA 3P3YA 3DXAD 3JT2A 2MQ3A 5I1IH 3IGKA 2VXTH 3GC3A 1CXHA 2CUMA 3QS2A 3MZTA 1AHKA 5DQ9A 4HAKA 5J12C 2J5LC 4ORGB 3EJYD 1KB9K 3P30H 2XC8A 4WQOA 4Y8AA 1JWSA 5F9WB 4RNRA 3VTTA 2PMZA 4GG8A 4B9CA 5JHLA 1TNMA 2YKLL 3CQQA 3P11H 4TLTA 2G0LA 5T1KD 3TT1L 2PPCA 3PHQA 1W72L 5E1IA 5LGYA 3MKGA 3MRHA 2DD8L 2CKBB 3UYRL 3LEXA 1Z0MA 5TJWK 2ZKXA 3O8XA 1P7QA 3WFHA 1UA7A 5ADOH 4H0IA 4PJ8B 1AJ7H 2DWEB 3KWWA 1BD2D 4AQAB 3MA7B 3ARFA 3RVVC 4R4BA 4XCEA 3VRIB 5C86A 3X13A 3BKML 1OQXA 2OAAA 4KKAD 4RSYA 2WB7A 3DO3A 1FI8C 2PWFA 2FNBA 1C9SA 4Z7UA 3OZLA 3MR9A 1XEUA 4OZHF 4LSUL 4LPCA 3FSOA 1D2PA 2ORBL 4X6CA 2ZYRA 1AGEA 4GT7A 3DDGA 4LSVH 2N1KA 4Z8FL 1YVLA 4S10A 2R69L 4AVHA 1BFOA 1Q38A 3T8XA 4A6YB 5HHVH 2OZNA 5JPMC 1OTSC 1NFIB 4KMQA 2F7PA 4M1CD 4YHML 1BOYA 1NA8A 3G5XA 1G7HB 5F96L 1P6FA 1NCTA 2O5YL 2VC2H 2E6JA 2Y06H 4MNQD 3WJMA 5MP6L 1G7IA 2AAVA 1B0IA 1AGBA 2L3BA 4LLYB 4A7SA 1KTJA 2NMSA 3SPIA 3WTVA 3AG3B 3I9AA 1YNTB 2VDKB 1S7UA 4S11A 5HHMB 3TH4T 5BQDA 2FJGB 5IVXB 3KPSB 1WWWX 4X6CB 4ODUB 3OMNB 4KOCA 1LK3H 2FRGP 1XCQB 4MRCA 4NC1C 4TNWF 4XCCH 5E8OA 4NP4H 3M46A 1E5AA 5F7KC 4FABL 2FLBT 1WAPA 2DEXX 2APWA 3D2UA 3LXBA 4O9HH 5C6PB 4M8RA 5GJTL 1S7RA 2OMZA 3V5DA 4S1DC 4LVNC 3VD1A 1P84J 2FWSA 3KR3L 4ZS6C 1F3DH 2FSDA 1CYGA 1JI1A 4NQXB 4JUSA 5AZEL 5EBMA 3WSQL 2QPFA 4YFDB 3PJNA 3ZE1B 3GBDA 1Z9MA 5FV1L 2CHZA 1MCRA 3FH8A 3RJDA 4OJFL 4GKZB 5CSZA 3AGVA 5E9DD 4P9HC 3ZYZA 3D39D 3N50A 1E2WA 2A38A 3LZOA 4PJXA 4CC1A 3WHE1 3VGDA 1I82A 5M7QA 3EYVA 1MHHA 2NR6C 2WBJA 4BHUI 5F7NC 2AV1B 2D31A 1A14L 1M1XA 1UXMA 1UXWA 5BZZA 2FEDC 2WKOF 4J3UA 2VDLL 4Z5RB 5E6UB 4BH7A 3IXTA 5GIRB 2VMFA 4UUJB 4ZZKA 3I85A 4BBWA 5F3BB 1N19A 3N91A 1CF8H 1SEQH 2OTWB 1BBJA 1CGVA 2TRHA 1DANU 2EDHA 3QYNA 2ZWYA 3MRRA 1WHOA 2VDLB 1BVZA 3IGLA 3MLPA 4WFHD 5CMAA 1CN4A 1WFTA 1J5OH 3NJKA 1N0XL 2EVHA 5CEZD 4KKPA 3QFDA 3ECUA 1BAWA 3I9PA 1YDPB 3LKOB 4JHAL 3SO5A 4AEEA 1P6AB 5C0BE 4TQEL 2WN3A 4PV9A 1NAML 5F7HA 5KANI 5SV3A 4JRFA 1FL3A 4LO9A 4RX4D 6PCYA 1WVZA 4Y88A 1HH9B 4WEEA 1DEDA 1EEUA 5BMFH 1F5WA 1CTNA 2E5EA 4OGYL 3ZUNC 5KYUB 1IL1A 3F05A 3BUYB 2UVEA 4B96A 3ZU8A 2J5WA 1AHMA 1M3IA 4PP2A 4D8PB 2VLJB 1VKXB 1XSOA 4POUB 5E6YA 2OR8A 1SXAA 4QRPD 3DA0A 3KS0J 2XZAH 4I9XA 3QIWA 2VLKB 2QSCH 1A2YA 5GSVA 1NGZA 1RZGA 2P80D 2VLRB 1ZLUH 3F5WB 4YDKH 3FTGA 1HH9A 2ZWKA 3BDXA 5HVHB 1R5IA 5GS0H 4G8FB 5IVNA 4JDVB 3MODH 1QKZH 4ABVA 2YXMA 4C56E 4H8WL 1DVYA 1BVNP 3CHSA 1QBLL 4EN3A 1ET8A 1CGUA 4HXAL 4B9YA 1T6VN 3LEYL 4F7PA 1F41A 4CVWA 3TZVA 3AREA 1CTMA 3CZBA 3AXLA 1USQA 3VRIA 4L8CB 4KH9A 1CU4H 4GRLA 3OJVC 3OJMB 4L9DA 2Y5EA 5JQ6L 1DDHA 5F7EH 1CVSC 4ZFGH 3SKNB 2BZCA 4BQBA 3SPHA 5KYYB 4Z7UB 5E2JA 1OLZA 3TBWA 3X3FH 2EZ0C 3MMEA 4YHOL 2PWDA 1BGXL 5GPRA 3OLEA 4FZ8H 3VWJC 4IGBA 3X3FL 1CE6B 1K8IB 2DQ6A 2VUYA 2EEFA 7PAZA 5MEOA 4S0HA 1VACA 5J9PA 3S97C 4O51A 3FYIB 1C08A 4LEOB 3TZVB 2ZONA 4OGXL 1KENL 4ENGA 4ZNEE 3TIEA 4Y2LA 3ZR6A 3OGOE 2AAAA 1EJOH 4WWKC 4N0FA 2B15A 5AYTA 1OF2B 3U2SA 2C45A 1F02I 1JV5B 4AEFA 4I2XB 4GEIA 3GO1H 2A9NH 1TCRA 2OQJB 3FRUA 2HX9A 5F89B 3UFIA 4ODWA 2XQBH 1M56B 3KVPA 2NY3B 2WQSA 1JWUB 3MRNB 3V7MA 2O6CA 3WIHA 5B3JE 3IETB 6PAZA 5EU6E 4WW2A 4D0CB 7FABH 3RY6C 4UTAL 3SY0B 4XVJL 1QKZL 4J3OD 4NERA 4RFEA 3R1GH 3ZKNC 1SVZA 4YFLI 4EQ2A 1MI5D 3KPLA 2DWDA 1ULVA 5K9JH 2FJFB 1QI5A 1MHCA 3FCUB 4HIJB 4PM1A 1G7JB 1OSZA 1YN6B 4FXGB 4X5WA 8CGTA 2XWBA 1KPUB 1T7VA 5DVKA 2CHXA 3FRUB 1DMSA 5DYGA 1DSWA 3NACH 4Y4HC 3AW5A 3DHJA 3DETC 2G30A 1X5KA 2FX9L 4OGQC 1FNGA 1NFKA 1U3NA 1XSKA 1ZD6A 3LOWA 4FFYH 1JRHL 4XWOD 5F1NB 2YAOA 1WZ1L 4F15C 3BZEB 3CLFL 3IDGA 1TZGH 2UZIL 1XF5A 3MI6A 3L4VA 3V9EA 1G6RA 4M1DH 1Y0LB 3TBVA 1QFWL 5FKAA 5DMGD 3K8MA 2VPYA 5CS7A 1UCTA 2OMXB 3PQYD 3X1EA 1J8HA 1JHTA 3CLEL 3O3DA 5HY9B 4FG0A 1SMAA 3VRJA 4LNVA 3GMNA 5DLML 2P28B 1P5VB 1X5XA 4WO4B 1J5OL 4AL8L 1ZT7A 2Q8AL 4YR6B 1ZPLA 4Z7VE 1P2CA 4E41E 5GGSY 1QFWI 4FMFA 5FA3A 5A2KH 3S8FB 1L7IH 2A5UA 4XHQA 1AZNA 1JFQL 4WY7H 1K6QL 1J8KA 2UX6A 3L9RA 1IMHC 3L4ZA 4YEFA 5ICYB 4DKEH 1M7IB 2W0PA 3EHBD 4JO2H 4WGWB 4HC1A 5J89A 4JLRA 1A4JB 4Y16A 3GSNH 1JCKA 5CIPA 3U0WL 3DROB 5IMKB 3BGAA 4AE1A 4KRPB 3FUMA 5CZRA 5DZ9A 1LVEA 1JVOA 1LQBC 3ETTA 3GSOA 4JE0A 3ZYJA 5B6CA 2WXLA 4OM1L 4PQXA 1TTFA 5DJ2A 1OZUA 1OAZH 3PE9A 4KK6D 3RIFF 3FQRB 2BOBB 1U9KA 1CBVH 4GINA 5IEKB 3VXSA 4DTGL 1YYLL 4FMVA 4LGPB 3GPEA 1GGUA 3FU7B 1PD6A 2GTWB 3DPDA 2J1ZA 1FSKB 2QVTA 2X9YA 3PWPB 5KVMC 3D12B 1JXFA 5I1DB 2GB2A 5GGSB 3V6OA 1D6EA 3FU9A 1F1AA 3N06B 1E40A 5GS1C 4APXA 1R3HA 5KSAA 3QQ9D 4I7ZC 1OP3K 3TZVD 5MP6H 3S9DB 3RHWF 4HJGA 3QO0B 1Q8MA 2G75B 3Q5OA 3S98A 4MMYA 5ECJE 2W91A 2VR7A 1FDLL 2N1TE 4QXGL 3VXPB 3LDBC 4XXCA 2OL3B 1JOIA 1OAQH 2IBZY 1LO2L 3FO0L 2WXMA 4HUWA 4WUUE 4OQTL 1U21A 3CAFA 4L4TE 2H0PA 3Q2CA 3TCLA 5KS9A 2NZ1A 4YHMH 1OSPL 1A3LL 5I1AA 1K8IA 2IH9A 3GMPA 3ULVE 5DI8B 1JRHI 1X5ZA 2VLKD 2ZYHA 4WW1A 3T0BA 3BSZH 5DD0L 1IM3D 3DV6A 3FCSA 5JIHA 3B7YA 5BVPL 5C6TL 1A7RH 3VFOA 1HQ4B 3TF4A 1H8OA 3P3SA 1RK0A 3GSUA 4IU2B 3ZE1F 3LSOB 1UKTA 4MCZA 3A47A 3RWIB 3FSAA 1JV5A 2I24N 3GSVA 4PVBA 1M9WA 4NBXB 4R7VA 4UT9H 3VI3E 2HP4A 3W39B 1X5FA 5C1MB 2WZ5A 3VWKC 2DJUA 1DO5A 4LCCA 2Q2LA 3L3GB 2IGFL 3LKSB 3PL6B 4QRAA 3ARFC 4HJSA 3NH7L 3BJ91 4K07A 1N6QH 5IW6A 2ICWJ 3NA4A 4XC3L 3JV4A 5CM1A 2H3NA 4RFNC 3L1EA 3P11L 4NYLA 2FATL 3QDJE 2V7NB 4GRLC 3T3PF 5CBEA 8PAZA 2C4FT 5KYXA 2C9QA 2J20A 5A6IA 5BUGA 2QSQA 1U3HC 2Q3ZA 2E7ZA 1ICTA 5D7SH 3QZLA 5DGQA 3AUWB 3HZ3A 4JY6A 4NQXA 4QAMB 4V1DB 1EAOA 1ZIAA 1UXSB 4IOIA 4KXCA 2C3GA 5HDBF 1BMWA 1E8YA 5C0CA 5B1JA 2WLIB 2ITCB 1WEJH 2YXVA 1AQMA 3TYGL 1AAJA 5FFOA 3UC2A 4RMBA 3L5XL 1KB5L 4QHUA 2HVKA 1TJIH 3DETD 4XMKH 1RZFH 4Q52A 1WHPA 4U3SA 4QRPA 2WCPA 3VVWA 2K3TA 2F53D 4UB0L 2GK0A 2WWMC 4ZQTA 4JFDB 2B77A 3OGCB 4DMRA 1E6JL 2H47C 1HEJC 1UXWB 2XZQL 3MBXH 1JXJA 1FYTB 1QABA 4NNYA 3MNWB 5JUEH 2XQYK 3HU1A 1CWVA 4OZGA 5EIVA 4Z7VA 2VDQL 2OYLA 1PJ9A 3HZVA 3SHSA 3PLYA 3LB6D 2WHVA 3FBKA 2H32H 5F7YC 3VFNB 5E9DB 1GGTA 1TO5A 3QJZA 4PS4L 2ZCLH 2WV3A 2I26N 4OIIL 1QLRB 4FL4C 3BKJH 3QC6X 2Y7QB 1U58A 3MPCA 4NNYB 2FGZA 4YHZH 2XTJD 1PEWA 1ACCA 2MRYA 1UH3A 3HG0A 1CDCA 3HS0B 5CGYC 3FKUS 4ETQB 2JKLA 2YUVA 5CJ8A 4JG5A 3F3HA 1FWXA 3ATBA 4JVPA 1JUFA 2C9SA 1BQHB 1YEFH 1G6RL 2OX5B 2AV1A 3NG5A 5AQ0A 4ZO9A 5KAQG 2A6JA 2KQNA 5FYJH 1AD0A 1SEBB 3T4AB 5E2WH 1AZZC 1TJGL 2Z35B 1Z0NA 5F0LB 5IW3A 1NFDE 4H1LH 5KVEH 2BP0A 2P8MA 3I02A 1J0YA 4KKBC 4WZ9A 3C6LC 1OTUD 1JTTA 3I3DA 4GSDL 4QAWA 4NWUL 3H4FA 3RTLA 2AXGB 3IDJB 3Q44A 4OB5H 1H8NA 4APXB 1C8PA 1KQGA 1M9SA 1JUFB 5E0QA 2GFBA 4KX8A 1G1CA 5F0MB 3VFPA 3US0A 2BIQA 5KVGH 1RSYA 1SBSH 2DQJL 4GUCA 4DKFL 5L4MA 3NJXA 2VOTA 1KTDA 4B0MB 4EN3B 2ZSVA 4FCAA 4LK4A 4WI9A 5JHDD 5K33A 2VR8A 4JEGB 4NLAA 3WIHL 2F8IA 3MJ8A 4QRSA 4FXKA 4UV7H 4ZO7A 1XWVA 4PJ7B 1Y1VA 4FQJH 4O00A 5AAWC 3V4LA 2VXVH 3OPZH 5A6LA 1OEZW 2NY0B 3KYMB 1O6SB 4AQOA 3ZKND 5F7LB 2QVFB 1QNIA 2FL5B 1ZEAL 3L3KA 3MHZA 4XBPA 2AZUA 2VKWA 4KO8A 1J87A 2AQ2A 5F7DA 4OCXH 3QIBB 3WLBA 3B37A 4FTVE 4PP2B 4Q6IA 4D8PA 1DBBH 4EDWL 2LOEA 2ENPA 5D93C 3RFZB 1GVIA 2HVJB 5D5MB 5C0BA 3RL2A 4YHNA 5B8CC 1T7WA 4YSEA 4M62H 3GSUB 3HBGA 1KPVB 2XWJA 2LR4A 3EO1B 1QACA 1IAOB 3NBNA 1MUJA 1W8OA 4ZPVB 4RGOH 4AKOA 1KJVA 3GDCA 3O2VH 3TF7C 1AGCB 1AD9A 5E4EB 1E5YA 1V27A 3SGDI 3U4EA 3QCVH 3Q2NA 3W39A 4DERA 1GL4B 1XHHA 1SDDB 1YN7A 1NCCL 2E75C 4WJG3 4O02A 1QPKA 4WWKA 5C6WH 4PLNC 4UNIA 1DQQB 4QRRB 1MLCB 5EULV 4LIQL 2Y7NA 4A6YH 5I0VA 1W72B 1KG0B 1P4IL 5JQIB 1ZAGA 1Y7VA 1N70A 4M1GH 1JGUH 2KH2B 3ARFD 4LCUA 4PJAB 3UAEA 3RBGA 4Z3JA 5I6LA 3NZ8A 2YAQA 4OTXL 3W9EB 3NZHL 4HW6A 1RZJH 4QKXB 5G4MA 1A4CA 1BQHG 3LVTA 3WTYA 5IB1A 4G71B 1Y18B 2DJMA 3I2CH 5EBWA 3VCLB 1T7ZA 1TVBB 5HGBB 1QFWH 2Q20A 4GO9A 4ZQKA 3WDJA 2IG2L 4GW4B 3LCYA 4I13B 1EEYB 3S0PA 5BV7L 2Y1ZA 5E4AA 3QJSB 2YLKA 1KCRH 4B9IA 3D0AA 4QRPB 5E7FA 4NWUH 3S48A 3UC0H 4NM8L 4AMKH 1YPZF 1TENA 3TA4D 2CA3A 3SPCA 5KJ4A 4DUVA 5HGHB 5F93C 4ZS7H 2OYKA 5FUCE 3O6KL 2UUDK 3NP4A 4JR9L 3T6ZA 1E3ZA 2VGLM 2B59B 5CCHE 5I30L 3KLLA 1NAMA 2XT1B 2XVKA 1Z9SA 3H56A 2ZZUT 2OMWA 3Q8AA 4ZQKB 4YDLC 5EOCJ 5EU7C 4RFEB 2EDJA 5JHDA 4BJLA 5HYJE 1OANA 3MRBA 5I73C 3A3YB 3WD5L 4JG0L 4BKLB 1SRDA 3NFSH 4PPTA 5AB9A 5T33H 2Y7QA 4R97C 4M5ZH 3Q2VA 1FO0H 5JYLA 1O9WA 2AJSH 3L3OA 5C07A 1AR1C 3F7KA 4YZFF 1IU1A 3CDGA 3GSXB 2WLKA 4ISVB 1A7OH 1T7XA 4HG4J 1WA2X 1A1OB 3BN9D 4PRHA 3D4YA 3QIWC 3VG0H 2PWGA 4N28A 1DQKA 4AGNA 1M3JA 3KPRB 2JKIS 1LO5B 1NPJA 3O6FA 4KNSA 3I6SA 3DX1A 4H25A 4UOW1 5M95B 1WS8A 2NDGA 4OZGE 5DMIH 3V9FA 1JZ3A 3R06B 4FTVB 2ZUQC 4QLWA 3VJ6B 3G08A 4GBXA 5B1AB 3TONA 4N2BA 4GO6B 2A68D 3X11B 1WC7B 4JMXA 2H8PB 3ARGC 3AMKA 4FZ8L 3LYRA 1QZNA 1WWAX 4GEJA 1C16A 3KEDA 4UAOC 4W70A 4X8JB 5HGDB 4FD0A 3RWFB 43C9A 4IEFB 5FM4A 2IEPA 3N43F 2FHBA 3QRLA 2HCZX 3H8NA 3IXAA 3K6NA 3KPPA 3QXVA 4FGMA 3FO1A 3K6IA 1LO5A 3O6FB 5DS1A 2LVCA 1CGXA 5KSAB 2Y0SA 5EF1A 1RUAL 1KGJA 3VWJA 2Y5TA 5JOEA 5CINH 1M7IA 1E60A 2DM2A 4G6FB 1HYSC 5J57B 4JRLA 3CVHH 3AJ7A 5K59F 3D1MC 1YMME 1ZHBB 3K7UA 5KN5B 5D7JB 2IWFA 1CK0H 4KMTH 5GGUA 4B9GA 1I1YB 4N22A 2YEZA 4PRNA 4X6EB 1CE1H 3DX7A 4NQCE 1BLIA 4ZUSB 3ZQ9A 2K78A 5DYIA 4PB0H 5FK9A 4DGVL 1F0LA 3KXFE 4JHWH 5DJ2B 3V79C 1PNCA 3PJSA 4HD9A 4M1CC 3RA7L 5DZLA 1YQVL 2FEJA 5GGQH 4YOKA 5FUOL 2BHZA 1PKQE 1UJ3B 3SCMD 1CD0A 4O2FA 2HUHA 3VFMA 3CFKA 1T21B 5EOQL 5F71A 1FFTB 3LZFH 4R2GC 4DVRH 1F3JB 2QPEB 2Y24A 4N68A 4X7SL 3APMA 1NC4D 1RK0B 4QTFA 4Z77B 1NLBL 1G8JA 5F72S 3GMMB 5J9PB 1PY0A 1A4AA 2WTPA 2B1OA 5J6HB 5EEVA 2VRAA 3W2DH 4WWID 3BRFA 2EDYA 3X17A 3RL1A 2H3XC 3RIAK 5TE6L 2CM5A 3MRGA 3WNIA 1MAML 3C60C 4CVZB 1I7ZB 1S7QB 3BPCA 1ID5I 1JPSL 3O6ML 3KWVA 4CC0A 2F19L 4GAGH 3IBEA 2X6MA 3DMMA 5J6SA 2FJSA 3G04B 3RVVD 3C8KB 3L7FB 3JWNC 2MFNA 4LEXH 3WN5B 1WBXB 3U0TA 4XE0A 4MKTA 2OSYA 2GT9B 1RUMH 3KL0A 3S36X 1U3HA 1HSAB 4JZOA 5E8DL 3ZDZE 3D7PA 3QJRB 3ULUL 3OD3A 1IGCH 4CMHC 1H3UA 2OSLB 3CFUA 3O5AA 2YJLA 2ZP0T 4NQVB 2EE6A 2EH8H 2ZOLB 3HNTH 2L7QA 4GG6F 5BRQA 3NPZB 4MMXA 4OJFH 5D2NA 2HFEB 3EH5B 5KSBB 1EFXB 3KPOB 2AERT 3ARUA 3WL9B 2NY4C 4DETA 1ORSA 5AKRA 3KYKH 4Y1TA 1G43A 3FU8A 1FO0L 4FLOA 5KVGE 5IW1A 4IOFC 1E50A 3F2LA 5IVXF 4A63A 4AC4A 1AIFA 5FM5O 5FYJU 3NFSL 1BG1A 1H15B 4F2ME 4S1SL 4MZRA 2B63A 2X12A 5E6RB 4QHMA 4HJ1A 2FB4L 2P46B 2JF1A 3V5HB 4KFMA 5D7JD 3FZUC 1FGNL 1MFBH 2BVOB 2X41A 5KSBA 5FW8A 1MVUA 2E3VA 5ID0B 3GHPA 4IOIB 4F80A 4RMSA 5GZNC 4NPKA 3SGDH 4JFYA 2E74C 2AS5M 1B4JL 4WI5A 1JFQH 4PJHF 3ZE0B 5IW1B 4U6TA 2EYTB 3VGAC 4HGMA 1GGBL 1P2CB 2A1WL 5FB8A 2FHFA 4PJCF 5TE4H 2EUXA 4KQ4H 4MWFB 4L3FA 2EP6A 1S3KH 2JQMA 3GF8A 3H9SD 4NM8H 4OFVA 5EUKB 2CLRB 4Y1AD 4MAYD 5ITBH 1F11B 4GBXB 3NJNA 2FYYA 5C0GA 4ANWA 2OSXA 4NN7B 1J8HD 1BHGA 2EDBA 3P4MA 5DS2A 1ZSDA 4L1BA 1FH2A 3T6XA 2BVQB 2YUWA 3R0MA 5ANMA 4NUJA 3AROA 5KANG 1AOHA 5IBUG 3MRIA 2Z8RA 2F5AH 3S7GA 3B6SB 3TLRA 2K6YA 1TMQA 4ZRGA 3FO2A 4EZJA 3EO9L 5FR3A 4AW4A 5I75B 4NQSB 1WAAE 3SO3C 3S3JA 2D9CA 3SDCB 1CUOA 2VM4A 4QMEA 5K9OA 2CLVA 3ZUCA 1FFNB 2WUBH 1RURL 5CD5C 1W16A 1MW3A 3FQWB 5T3ZD 1SJEA 2VLKE 4X7SH 4CADB 3D8MA 4Y9GA 5L8JB 1A2YB 2ED7A 3NA9L 1WBZA 3QI9C 3RVUD 3O6LL 1OCWH 1NOFA 3LRSA 4LCIL 3S96B 3CN4A 4GAYB 2WGNB 3Q48A 4HS3B 4OGAC 2NY2C 2PR4H 3IJEB 2IH3A 3QZMA 1ZTXH 4B9ZA 1UB6B 3QUML 4U49A 3N41B 2E27H 1WFJA 2ZKMX 3ZE2F 3SQBB 5FTLA 3VFMB 3VD4A 3O8XC 1E90A 2A9NL 2B7DT 2VQ1A 4G6ML 3SDAC 2VN3A 2XRAL 4JL1A 5BO0D 4ZOBA 5JQHC 4XCNB 4HZ1A 3VXNA 4P23C 5ISZB 1T5WA 4FQHA 2FBJL 3LXCA 1DJIA 4X9HA 4LKCA 4EI6B 5L2KE 1OT2A 4ESKA 3FUHA 4LLQA 4C4BA 4RLDA 4J8QA 1JGEA 1HQ4A 3WELA 2DM4A 4X7DC 1Z5YD 1JFHA 3TU6A 3WJJA 4CVZA 1IW7D 3VXMD 4EI0A 1S7SA 3ESPA 1JVLA 1D5ZA 1NUNB 1X7TA 1IGML 2MPAH 3CD4A 4D9QE 4Y5VC 4A55A 4DN4H 1SHWA 4JVWA 4EMZA 4BIKA 2DTSA 4UIMB 3C60D 2XIBA 4MFHA 1ADQA 3DSNB 1MHEA 4Y5XA 4JQVC 5F7EL 4OZFG 1BQKA 4WIQA 4KZCA 1BPLB 1UURA 5LKNA 4OT1H 1Y6MR 1ZANL 1WRFA 3NIGE 1CZ5A 2ZKHL 3MLXL 4W4NA 2KLTA 1G5AA 4M9OA 2OXHA 2VR9A 4YL4A 1ZT4A 1ODAA 2E9BA 5IT2H 1RPKA 4ZZFA 4NRYB 3HC3L 1WISA 1MJ8H 2YS4A 5EB9A 4KTDH 3WJMB 3DOIA 4XTRD 3EG9B 5IR1A 1HDMA 1TXKA 3ZZ1A 4WEUD 1BZDA 1W91A 4NQDD 1OSZB 3GSNB 5FC9A 3WLWD 3H85A 3KBEA 1WWCA 4PTUB 1T5XA 3D85B 3L6FB 2H2SC 3EH1A 2OJEB 5I6XB 1KGUA 2J8UA 4LCWD 1UCBL 3KBHE 5LNEA 2DYSB 4FA6A 3UJIL 1A6TA 3L3HB 3UGUA 3LNIA 4Z7QB 5LBSL 4BFOA 4OJAA 1I1FA 4N0UB 4X5PA 3C6SB 1AO7A 1BEXA 1UADC 1KXQA 1U91A 3FK3A 1S7TA 5IBTH 3QCTL 4UWQB 1RZJC 1XF3B 2DICA 3CHXA 3OMIB 3UCQA 2JIXD 2C9AA 1LEKA 2EDLA 1CPUA 4YK4B 3MGTB 1OF0A 4Y4KD 1WLFA 1I4FA 5F6IC 3T08A 2WQWA 1E3XA 2R1WB 2IPUG 4ZW5A 1N4XH 4JB9H 2DDQH 2Y6SD 5AWNL 2HMID 1KTBA 3D34A 3Q3GB 4F8NA 1KYFA 1JGLH 3X2HA 4LCWE 5FA3B 1P4LB 2RIKA 1S9VA 4RGNB 3HS9A 4M4PA 1WITA 1KC5H 3TEXA 5EC1A 3FB7B 3VMNA 3WFCH 4AUUA 5DD5L 2VRKA 3AABA 3HG1D 5ERWB 3BE1H 4U6HA 1UG9A 5LO7A 1SYSA 4KVNL 4RAHA 1ZXKA 3RVXC 3BYTA 5IEHA 5L2JB 4GI9A 4UM9B 1QASA 3IGFA 2BCMA 4CBPA 1HOCB 4XCFH 5EU6A 2QGBA 4JG1H 4WV1C 3ZSSA 2X4SB 4YWGL 2Z8VC 4L3EE 4AK2A 1IKNA 1CF1A 4JRXB 4MNGB 4WFFE 3POCA 4ALAL 3D30A 2BWQA 1GY2A 2Q86B 2VN4A 4FQXD 3ZVVA 2WINB 5F9AC 1V3MA 3FB8B 4HF5L 1JZ5A 2BVYA 1FGVL 4RQQA 2BCKB 1NGYB 1ADQH 4IRJC 2VIRB 4KXBA 2YXWA 2WLZA 4KHXL 5EEXA 3D09A 1RXLA 1SM3H 4KRPC 2WIMA 5DJ8A 2HFGH 1Z5LA 4JFFE 4XI5C 1DN0A 5TGBB 4FADA 3HB3B 4M7KL 2J88L 4PLKC 5CAYB 4Y2OA 4XN7A 3SQBA 3DVGB 5D1QE 1G7LA 3IWVA 1MHPH 5T5ID 1BG9A 4FI8A 4FA7B 3KYMA 1QSEE 1DSFL 4H8QA 1TZHA 1NMAL 3RWCA 3HHMA 1OCOB 1S9KC 3KHQA 3B2DC 4JP7A 4JFHE 4QNPF 3GB7B 5GS1B 5EF2A 4IKJA 4N8CH 1I8IB 2P8LB 1TITA 4H8VA 5AG8A 2WNXA 3DDFA 1G7QA 5I9QC 5I6NA 3TVMC 1D9KB 1HYRC 4CU6A 5I1HH 4U05A 4Q58C 1RLWA 3RVWC 4DVBA 1NMBH 2WC7A 2WW8A 1R75A 3L4WA 4KXAA 2V17L 1YDPA 2F8XC 4PW4A 2FIKA 5AYUL 5TE7H 3S3DB 1TPXB 3EGSA 2AXFA 4KKAC 3UEZA 4DKTA 4IGBC 4XVTL 3V4PL 1JPGB 3VQ1C 4LF3B 4UM8B 2VR5A 4YDVA 1YYLH 3LEXB 1EBPA 1XSIA 3QEUA 5DK3A 3ZTJG 3IAQA 3KLHC 4OD3H 4HIEB 2R2CA 1PGRB 4WHYH 4OQTA 4EKJA 4BZ2L 1VKXA 1NCWH 1MQKH 4KJYB 4LMQE 5B38A 1H0DA 3ATAA 2IALB 1ZVHA 3QWOB 4POZC 4IU3B 1T89C 5CD5D 1I9IH 2O1AA 3BPOB 2VDMH 4N6QA 2ROXA 4RMTA 3TPKA 2JIQA 4GKLA 4JO2L 3WNOA 4ALAH 4MZ2A 3WS3A 4MAUH 1ZV9A 3R18A 1ROWA 2NT0A 3ARBC 1H6UA 2FZ3A 4UTBA 4MA8H 1I85C 5HDOA 5DVLA 2H26A 4KK6C 3MZGB 4LLAA 4U1SB 3NJIA 1CJYA 5B7MA 5JMOC 2R29A 1OB1B 2RMNA 1JYWA 4CW1B 3T3MB 2K0RA 3K6SA 3FMGH 4H8PA 3GRWH 1XF3A 4GRLB 5DD5H 5DSCA 3SPGA 4RZKA 3KPSE 1H3TA 4ENZA 1OCRB 4F7MA 3OWRA 1FGVH 4GSUA 1DTUA 1I4FB 1HHIA 4PY8J 1FZMA 3O4OB 4U1JA 1UT2A 2QKIA 3NJVA 4G7QB 5B4MD 5KVDH 3L16A 4YMPA 5CP7B 4BQ8A 4MYWB 3G5ZB 4B9JA 3U7AA 4H8HA 1XCQA 4PJIB 2V5YA 1NKGA 2EYTA 4MQXC 4HUVA 4EDXB 1MF2H 2G2RB 3U6XS 2O5XH 2ZOLA 5E5LA 5IKCB 2WLYA 4PLJC 4ZG1A 1E7VA 5B1JC 2AE0X 1RPUA 2UZXB 4WK2B 2Z1KA 4XO8A 4QXUH 1PLGL 4HT1H 5AVQB 1ORSB 5LNGA 4M8UA 4PBDA 4MVBC 4NGHH 1J05B 4XC1L 5BS0D 2EAEA 4FKEA 2ZCHH 1A6WL 2EXYD 1A1OA 1GCFA 2WQVA 5BRZE 2CIIB 3BQUA 1L9MA 4FLQA 1Q0YL 2WMPB 1AYRA 4NKDA 5T3ZL 1E27B 4JRYD 3ZX1A 2DQEH 3H2PA 3ZKQD 3BKCL 4F7KA 3QDGB 4ZW3A 2EYSA 3BVUA 1UH2A 5DWUH 4JRYE 3RZCD 5J13B 4LARH 1BW8A 1WAAA 2EE0A 1T2JA 4PY8I 4PG2C 1I8LC 2RB8A 1RHFA 1FZJA 2YRZA 4R7DB 4D7BA 4NS0A 4Q6KA 5T8IA 4L0PB 5IIEA 3RZCB 3KW7A 4YGAB 5AOIA 3FN0L 3H42L 1HQRA 3PGFL 2JIXA 2XWTB 4UQ9A 3HC3H 3F65A 4HUNB 1PU0A 2ZCKL 1BYPA 2XYBA 2Y2TA 1RL1A 4TSAL 3V52H 4LP5A 5C97A 1UTDA 4JY5H 4WO4D 3MA9L 3WHE0 1E4KA 2CMRL 4Y19E 4ZAKA