4JS7A

Crystal structure of d78n mutant apo form of clavibacter michiganensis expansin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of wild type and d78n mutant Clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
molecule tags Sugar binding protein
molecule keywords cellulose binding protein
total genus 43
structure length 202
sequence length 202
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4js7A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4js7A02
5GLYA 2AE0X 3X2KA 2HCZX 3M3GA 3X2NA 3X2GA 2VXQA 3D30A 4FG2A 3SULA 2PICA 2KQAA 4AVRA 3FT9A 3ENGA 5H4UA 2GAEA 2PJJA 3SUKA 1HD5A 5GLXA 2BH0A 3X2MA 1WHOA 2G5DA 1N10A 3X2OA 4FFTA 4JCWA 1WHPA 1L8FA 3CZBA 2G6GA 3FT1A 3X2IA 3SUMA 1BW3A 4ZM7A 2JNZA 3X2JA 4JS7A 4JP6A 1OA9A 2ENGA 4FERA 1BMWA 3X2LA 3X2PA 5GM9A 1WC2A 4L48A 4FG4A 2PNWA 1BW4A 2PI8A 1OA7A 4JJOA 4ENGA 3X2HA 3SUJA 4JP7A
chains in the Genus database with same CATH superfamily
5D2LA 4HC1A 4Q14A 4B60A 2BIQA 2Y7NA 1Q9WA 2A9DA 2QL1A 1B0RA 2E2IA 3EH1A 3D52A 3F5WB 2G4GA 1FH2A 3LDBC 5E2VL 1S9WA 1CICD 1F42A 3SDAA 3V7AG 3SYPA 4R0LC 1FAIL 3QJFB 2GT9A 3C9NB 3VXSB 3QAZC 5TK2A 5C0FB 3STBA 1C12A 1HI6A 2Q2LA 4NN7B 4P4KC 1J48A 3NCEB 4IRZL 4WWKD 1HHIB 3WJMB 5MEQA 2ZSWB 1KLUB 3ARFD 4OQTH 4KITB 3P73A 4IKJA 4XNUL 2VLRB 3PWVB 3ZUNC 5JIIA 1INDL 3QDGB 3L6FA 3WO4B 4XH2B 5T1JA 3WI9A 3LZNA 1QHOA 4KLNA 2FGZA 2JSFA 3TBYA 5E2JA 1JPFB 4B97A 4FXGB 1JCKA 3VD9A 5DRXA 2ZWSA 4HUUB 3UABA 1UFGA 3N44B 5JORA 3HI5H 3R0MA 4M5ZH 2O5XL 4KO6A 2ICES 2W0PA 3WNOA 3HR5B 3BO8B 4BINA 2NY4B 3MXVH 4Y16C 1IE4A 2CDGB 2Z64C 2E6QA 2BXYA 4ZTPH 3ILPB 4M43L 3UTZA 1TYRA 5EU6B 1I31A 4XX1G 2WZPD 3RUGA 1AW8B 2DQDH 5PAZA 4LCWB 4PRDA 1TFPA 4JFUA 4F8QA 2J6WA 1HL4A 1Q94B 1I9EA 4HIXH 4GP4B 3ZSTA 3KW8A 3MNMA 1P53A 1JWMB 5IF0A 4CSSA 5I5RA 1Z9LA 5K5YA 2YXFA 4JCLA 3NCBB 1JG9A 1CFSA 4LLUA 2ADFH 1UB6A 4ZS7H 3TONA 1BECA 5AZUA 4WJ5A 3LHPH 2VZ1A 4TRPL 1DBKL 1MREH 1EJ8A 1PZSA 2G4EA 4IW4C 1F4HA 3AB0C 3L95B 1XF4B 1KTCA 2ZCHH 3QFJE 2VMFA 1U30A 3SYQA 3V7MA 3SGJA 2YAPA 1DVFA 4E36A 1QO3B 4QWWC 3QHTC 8CGTA 4PJ7E 4GP8B 1V55B 4LGSB 1T03H 4KTEH 5KAQG 1LE5A 2Y6TE 1NEZG 3P4MA 3MFFA 2X38A 1SY6H 4FXGA 5DRXB 3PQYA 2PP9A 4N28A 5J3HC 3VFRA 2R29H 3I9PA 4FI8A 3MRKB 3NFSH 4PEEA 1KB5A 3IU4L 2R29L 2NOYA 4MS8C 2V3VA 1TLMA 4P9HC 1G9EA 4ETYA 1B0GB 5DK2A 2VXUL 3ZRSA 4OJEH 2XQBH 4H8HA 3DPDA 3BJLA 2ESVB 3GSNA 2VLKE 3C60A 3IPBA 5MEOB 1XAUA 1U41A 3HNVH 1UOLA 3V4LA 1KC5H 2VDNL 3IDMA 1YMMA 3RNQA 2YBGA 3FCBA 4G72B 2XJKA 5FGBA 4LARH 4ZFOA 5I1AA 3WG7B 3IF1A 5K1NA 2X6AA 1YAIA 2LW3A 5FF6B 3HVDA 5AOLA 5I17A 1ZXQA 1J18A 4HIJA 4JHVA 1EJOL 2NY1C 4ODHL 1WD9A 3BFWA 1C9SA 3S4SG 1N5AA 1J87A 2WXPA 3PNRB 2VERN 4ZXBB 2DYPA 4GO9A 4A68A 4G11A 4MASA 3ROOA 5CXPA 5T3XE 1H3VA 3CIQA 4OFPA 5TFSH 1E9QA 4YLBA 1RK1A 2CNZA 4ESKA 5AOMA 3I75A 4GRLD 5GGSB 4TL5A 5CHNA 1TZ8A 1FE8H 4FQXA 5KW9L 2ITCB 1JSYA 2E9BA 4ODVL 2J55A 4K23L 5I8KL 1BOGB 2PNWA 4YSQA 2FHCA 3DC0A 4FFYH 1MW3A 2O72A 4D94A 3I9IA 4AYEC 1H5NA 3D25A 3I50H 2VE6B 4G9DA 2IADA 2IWGA 4M6ML 1DJSA 1JVKA 2B7DT 1IB5A 4MCZB 2R1XB 5FUCE 4HJ0D 3V55A 1G1YA 3W39B 3EXJA 1B0GA 4AY0A 1C16B 3BGAA 4UDTA 4U1JA 1NMCB 2EABA 5B39A 2EYSB 1AZNA 2HX9A 1A9EA 1S7VA 2LU5A 3OPUA 5J9PB 4DKEL 3CCHB 4XNUH 3IBOA 3MRMB 4ZFOB 3B9AA 4O4YL 5GRYA 3HE7D 3PWPE 5EU7E 2VERA 4X5WB 5DZJA 5KYNA 2WP3O 3AQXA 2WN3A 4FP8H 3DSFH 1TQSA 5DLML 1UJ3B 3MRCB 1D3CA 2NLJB 4QXWA 3AXHA 1N4XL 4XNZB 4BKLB 1TR7A 4BE6A 1ADQA 4LRIA 1KEMH 1KFGA 1T89C 3N0AA 1F3JB 2JCCE 2QV2A 2ZAHA 4DZ8B 4EE2A 2I69A 1ROCA 3NP4A 1DE4B 4PJHB 1TVHB 4JW3A 2A68D 4Y5XA 1JYXA 3HBGA 5BO1H 4UOW1 4G7YH 1PZCA 3WDHA 2PICA 4FA6A 3TA3C 3TWCL 4EI6A 2WGXA 1A9BA 1J9CT 2A6ED 1SFDA 5E5MA 5T3ZE 3A4FA 5CEXB 3OAZH 2BSED 1KYOJ 4WI3A 3HJEA 3MX0A 4R90H 4JRYE 3OGOE 1CTOA 4BA0A 3NEOA 2RIKA 5J6HA 4PD4K 3AUVA 3HC3L 1KTDB 3CBKB 3MUZ1 3FO9A 3RGVB 4DVBA 5I5IA 1A02N 1QPXA 3ZHKA 1OAKH 3SIKA 4JHUA 2V2XB 2EVHA 1KN4H 1DUZB 1S3KH 5DYOB 4X4YB 4N6RA 2VDOB 1HCFX 4OIBA 1NGQH 2A74C 1X6NA 1KCVH 2BNRA 4U6YB 5DD3H 2X4PB 4NBXB 3LPWA 4J3WA 4NRXA 4Z3GA 1RD6A 2BK8A 2P5EB 4PV1C 4DZBB 4ANWA 2GHWB 4FTVE 4U6VL 1XXFC 5E8NA 5HHVH 3QUZB 1IAKA 1QW8A 2Y7SA 4ANKA 3C5ZD 1OP5K 4GRWB 1FN4A 1NFKA 4BRJA 3VMOA 4YHMH 3PWPD 2VDMH 3GK8H 3SDYH 5ILTL 1NKRA 4OT1H 5JHDD 2KMWA 3SKMB 5KYYB 1R27A 2CA3A 3PRZA 4J39A 4HXAL 4P2OC 3QNZA 3V0EA 3SYAA 4DP4X 4L4TD 4EZLA 4F9PA 3HOGA 4LPVA 2EVIA 2AXFA 4R97B 4ATWA 5BZWB 2BDNL 4N8CL 5I74B 3UGXA 5BRZB 3FSZA 3NCJL 4N8PA 4XHJC 2QPEB 5I1HH 5IV2B 4KJPC 1JJUA 4G5ZL 1XF5B 5BS0B 1G8KA 3DHMA 3HG1A 3W9DB 4IBSA 4IMKA 4BWUA 2HZHA 1GTFA 3HS8A 4XBGA 3LRLA 2E5EA 2Z3FA 3MV8D 4I88A 4AL8C 4GO6B 2G6GA 4QHNA 4YK4C 1K8IA 3T0EA 1WA2X 4H1LH 4GKOA 3VFGL 3NJLA 1FNGA 4TSAH 2BIOA 1JZIA 2DTSA 4WV1C 5GGTL 4B9YA 3KJ6H 1T6VN 3P77A 4AIOA 5JQHC 3ZYOA 4J6RL 4RGMB 1BW4A 3PGFL 4A2MA 3VGBA 3NFPB 3KYOA 3T08A 2X9XA 1IC4H 2BPBA 3D9AH 3CSTA 2Z9TA 5DFVD 2VLJE 2XN1A 3OZKA 4E9WA 3FOLB 4KFZC 2ED9A 1CXLA 2XFXB 2GC4C 2NY6C 1BQUA 3N5AA 3ZQXA 1TJHL 2EEOB 3HHRB 3U2SB 3BPLB 1AFVL 1HAWA 1RU9L 3NACH 1CLOL 3BQUA 4WI0A 4G6KL 3ZQWA 3JWOH 3A67L 3MJ8A 4KH2A 43C9A 5TQ2L 1D2OA 5KYYA 5H35B 5CGTA 1BD2D 4UAOC 4ZMZA 4XO8A 4YBLC 2IPKA 4PG9A 2ZAGA 1E5BA 2AXFB 4NDMA 1IAIM 1UJTA 4Z7WA 5J1SC 4F2EA 3O3BB 2VOTA 3WIFA 1KY6A 1OTSD 1V8HA 2DPKA 4KUCF 3GI8H 5ANHA 2WTRA 1A6PA 4W9CC 5AOJA 3QP3A 3GGWB 3MLTA 2ZCLH 4PJIA 5I1CH 1KMGA 1UM6H 2B1AL 3WFEL 5CKAA 1KXVA 4OIIH 5SV4A 4AZDA 1AP2A 3TO4C 3KLLA 3SCMB 1G8JA 1U2HA 1ZS8A 3W57A 4B9GA 5C6WH 1MFCH 1A1MA 4O2FA 2FX9H 3T0EB 3MV7E 4KROB 4KU1A 2BX5A 3FH7A 4D0DB 3AB0B 3MO1A 4BWTA 4PGZA 3U1QA 4LCUB 4PHZA 3WDIA 3TFKD 2NZ1A 4YDIH 5FM8A 3KYOB 3BW9A 4KY2A 4N24A 3Q01A 3RIFK 4ZW8A 3V52H 4FNPA 4X6CA 1E3XA 1JZFA 3FOLA 1KIPB 3G5YB 1MFBL 3CFKB 1M3IA 2FJFA 3QG7L 4TUKL 3L54A 3D69A 5KSUB 4KXBA 1A22B 4PY7B 4GI8A 1M7XA 4NUJB 3QWRA 3W1ZA 4GUCA 2D4DA 1J11A 2F61A 4P59L 4KDTA 3SBWC 4B50A 3D9AL 4PRPD 1PD1A 3MJ8B 1NGZA 1QYGH 3Q2WA 3T04D 3ZTNL 3HPJA 4KJPD 2PI8A 1FI8C 5E2UH 2R0ZH 3KLDA 1KCRL 2K4WA 4QXGL 1P84K 5GGTA 1P7HL 3M46A 3U7YH 1RZPA 1J8HB 1GJWA 4HWNA 3FFCE 4AYFA 5J7CC 2AJXH 1PKQB 1QKZL 2E7DA 3CU1A 1JXJA 1N59B 3GBDA 2BVUA 1HHKA 3RX8A 4NM8H 3D3VD 1TSHA 5BPPA 1FIEA 1PNCA 3MUJA 5HGDA 5KYXB 1AG0A 3EO1A 1O7DE 5HYSB 4P2RD 1CGSH 2QT6A 2ADGB 3QUXB 3HB3D 4K5LA 4TTDD 4S1RL 5HHXL 5C6TL 5KBLA 5I8EA 3C6SB 4OLYH 4A7QA 4J27A 3SGJC 3BSGA 4G6FB 2KI8A 5E7BA 5DMIH 3OKMB 3O2DL 4D0DA 2EILB 4Q9RL 1N68A 4XN9A 5DEJA 1R3JB 5CGMA 2NYYC 4FZEL 5INCB 3B6SA 5DJAA 2DQHH 3X3FH 5FK9B 1UATA 2ZWZA 1NC4B 3MAWA 5KVEL 1KSRA 4IJ3B 2Q5BA 4PV8A 4GG6F 2BERA 2I9TB 3CFKA 5SWZA 2P4AB 1S7RB 3SBRA 2XN9E 3QJZA 3VH8A 3VG0H 2YUZA 3LKSA 4NUJA 2KBGA 1ITBB 4Y4FC 3B7YA 4MFHA 2IQ9L 1WWCA 2CKBA 5H37A 2CBMA 3K81A 3L7EA 3OQRA 4K71B 4CVZB 3ATAA 3WJJA 1HD5A 1A3QA 2BNQD 3H2WA 2YPLB 5E6IB 4YWGL 5J1AA 4HIHA 2P28B 2VDPL 4IU3A 4CAGA 4G8IA 1N59A 4PJIE 3BESR 1N6UA 1XD1A 4APQB 2E6JA 3O6FD 4GRLB 3WMPA 3ULUL 3UJJL 4AJWA 1KB9J 1DSFH 4Z7WF 2XIBA 2Q2EB 5ERWA 1I9JH 2AJYL 4IGBD 3QWNA 4U4IA 4L05A 3MQIA 4R4BB 5FYKL 1ZV5A 3CQFA 1EAPB 3H3BC 5IMOA 4FQLL 4ZXBD 2IV9A 1B2YA 2D03H 3IT8D 4DEPC 4XBEL 5FCUH 4GBXD 4IRSB 2CGYA 2CGRL 1U4FA 4BSVB 2VPYA 2XFGB 4DEUA 3TEUA 4TNWF 1KCLA 1U93B 1A1OA 3RWFB 4JGJA 4HJ1A 3QFJA 5ADOL 3OR6B 1X44A 4Z1PA 1FFQA 2FWLB 2I32A 4Q52A 2NY2C 2QKSA 4A2DA 3EJQA 4EIBA 2XV6B 2WVVB 4M48H 4RGOL 3IVKA 2VPXA 5GS0L 1L0YA 4ACTA 3UG3A 1DQMH 4MA3B 3ZTCC 5D2NC 3IMRA 5E95B 4TPRH 1GA2A 2NXZD 2H32H 5AZ2H 3FQUB 3LSOB 4P06A 4IU2B 1LO3H 3ULVF 5D7JA 1IVTA 1KTBA 2Z35B 5FKPA 4HFWB 3UP6A 5BJTA 2D4FA 2X1PA 4WK4B 3UXFA 4Q58C 3D3VA 4PY8I 5J3HD 3MLUH 3DXAA 1H3PL 2RALA 1RUAL 1ZWIA 3FU7B 4ALAC 3S6CA 3X1GA 3TO2B 4J3BA 1JDDA 4PGJA 3G6DL 2A6IA 1SMYD 1CN4A 3IRZA 5MEPB 5I1GL 4MA7L 2DB8A 1Q9OA 1A6UL 3HI1B 5D7SL 1RY7B 1L0PA 4IBWA 4U1GB 2Z7WA 1BYPA 2JCCB 1JYWA 1T89A 3EGSA 1QTSA 1KGYE 4G42A 4JM4H 3GTQA 3HZYA 5CCHE 4WGVB 3LIZL 1UKQA 2FX8H 2GC7C 3SDDD 5ABAA 2WTOA 3O45A 1AYRA 1OGAA 4NUQA 4NWUL 5DRZA 1XX9C 3DVIA 4A39A 2NY1D 3VFTA 2X44D 3NCYP 4LLWA 3OR6A 2VB5A 3BEWB 3KXFE 4R3SA 4XNZC 3TA3A 2X4NB 4JR9H 1BFSA 3T09A 1MZZA 3BIAX 2W07A 5I1DA 4FLSA 1MLBA 1U0QA 2GIYA 3QUZD 4U6TA 5FDWB 3SKOB 4M7LT 4ES8A 4M5TA 1WICA 3BLPX 4R8WL 3D5OF 4MNGE 4AQAB 1ASOA 2OR9H 5K9KB 4ECNA 3T3MF 3VYOA 3HMWH 1ZHBB 4U1MB 4XI5D 4JN1H 1HZKA 1GKEA 5JR1L 3WO3B 2P5EE 4S1DC 3LD8B 2B1HH 3V0VB 1IAII 4I13B 2R8SH 2YARA 3TEZA 1YEDB 1KCUH 3FQWB 3LRKA 1ZHNB 1BFOB 4HYTB 2AQ3A 3LIZA 4QHKI 2ENJA 3HR6A 1HSBA 1M7DB 4WUUD 1HS6A 1U8KB 1SHXA 1N5YH 5LXGH 1JD7A 4Y5XC 5JHDB 4KJQD 3L1OH 3ZE1F 1A66A 4AEIL 1K9TA 3A6BH 4YHZH 3LNGA 1HKFA 3LKPB 2P80A 4DKAA 3X2IA 5F3FA 1FVCA 4JE0A 3DUHA 3QNXA 1E42A 2WQUA 2AITA 2UWEA 4Y7OC 4U2ZA 3S3CB 3QRFM 5I1LB 1ROWA 2BS8A 4X6DF 2HTLC 1UHVA 1RMFH 1F3RB 1NPNA 1AQ8A 4NN5B 4WEBL 3VTMA 4WW2C 3U0PA 4RLDA 3F5WA 1EPFA 4FQXC 5CF3A 1IGIL 1JXGA 4FADA 4CVWA 1EVUA 1RJLB 1GPOH 2BSTB 3KPPA 1OAUL 3VDBA 3ELQA 1KFAH 5KS9E 2LR4A 4NQED 1ZYRD 4EIZC 1MCQA 3A6CH 5AKSA 2CUHA 3C6LD 4GQPH 4F33B 5MEQB 2VCOA 1P0SE 2V2TA 2DIAA 3EYSH 3ATEA 3IDNA 1ECYA 3HG2A 3P73B 4YO0B 5AW9B 1MCWM 4NKMB 5B3SB 2NZIA 1C5DB 1PY0A 3WSQH 2Z31B 2KQNA 4LHJB 1J8HE 4ZS6C 1TCRB 3BP6A 2J8UA 2SODB 3O4LD 4P3CL 2IGLA 2AS5M 3WMSA 1CGWA 5KVDL 1OP3K 1FG2B 2F9BT 4P46C 2EIEA 2UX7A 2WXJA 5JORB 3BYYA 4K8RH 3JUYA 2X7LA 5HVHC 2D0HA 3ENEA 4LCCC 2B3RA 3QNXB 3KMDA 5HY9A 1N2RA 1WISA 3WS3A 3RUGB 1JK9B 3QAQA 3EJZD 1NCAH 3ESNA 1NPUA 3KWWA 5FYKU 4DUXA 3BCFA 4NKDA 2QSTA 3O2DA 1Q94A 4JQXC 2CH8A 2KLSA 1TTBA 3A47A 3ARFC 1GCFA 3IFOA 3VFVB 3WFEH 4D8PB 4Q0XH 3FZUC 1NEZB 3IEAA 1WD8A 3CN4A 1O6VA 3BWSA 3MJ7A 1PD0A 4XMWA 1FJ1A 2Z92A 3B9KC 5TDOA 2EDTA 3C8HA 4HKJB 3HRPA 3T2PA 4JFYB 3ZKMD 4B5ZA 4H88H 1OB1B 1AKJD 4JFVA 5C0CB 4BCYA 1S5IL 5D1ZB 3HZVA 4HOMA 3QQ4A 1QO3A 4C58B 4CRZA 1YY8B 3E0GA 3ECVA 4GINA 4P23B 4G9FA 4MB5A 2R2EA 2JKJA 3NACL 2BMKB 4G6AD 2ZNWA 3N04A 3QA3B 1A4JA 3WLWD 3MFFB 1KTKE 4PCSA 1UA3A 5IKCA 4PJFB 4XZ4A 3H3PL 2V8LA 3VFRB 5I15H 3IFLL 3INOA 1FL5A 4NCC1 4P4RB 2HUEA 1Q38A 1XAKA 1AZBA 2NY0D 1WT5C 1U8LB 2HLAB 2DH3A 3MTXA 5HY9B 1DVSA 4E9YA 1CFQA 2YWZA 1SQMA 3TVMB 4AYMC 3F6JA 4RISL 3S35X 4G6ML 3BD3A 4R4NC 3RLSA 1FDOA 5FXCH 3SDAB 4NQCE 3QZLA 2F8VA 4S1QH 5LVEA 3CUPB 4B9FA 4M61B 1FJ1B 1X3DA 5J0BA 4FMVA 4WEEA 2R15A 1XGYL 5DFAA 3RHWF 4ZXBA 4KKNA 3QORA 2X5PA 4EF3A 4JPSA 1EERB 3O3UN 3ROOB 3Q5TA 4AT6A 4JFFD 2W94A 1DJHA 1S7SA 3BZ4A 4RFEA 4W68A 2AVGA 5I2IA 4FXLA 5D1QE 3CN2A 4N0YH 4H8UA 1RIHH 4AGQA 3O81A 3Q6FB 3P3TA 4GNKB 5CZXC 4Z0BH 1CE6B 2IH9A 5LBSL 3E3QC 3PIQA 5B7MA 2DWDB 1YYLH 5IKCB 2VDNB 3D1MC 2KDGA 3K7UA 1J12A 2H1LM 3TNMB 4Z78A 3FT3B 3HFFA 2A73B 1WZLA 5E51A 1E3ZA 1WFIA 1ZC1A 3OC8A 5FLUA 4P5SA 4AEFA 3WUWG 5EU6A 3VRLE 4HD5A 1GW6A 3TVMD 1TETL 4LQFH 4WWKB 5IVOA 4R90L 3AS1A 2RJMA 1KQFA 1RURL 1WYJA 3ISYA 4M93B 3ZKMC 1UH4A 5HI5D 1OKEA 5D2LE 4JREB 2BJML 1WZKA 2R39A 1VERA 4HH9B 5LN8A 2W0KA 3M7FB 3CUPA 4GRLC 1RVFL 2QJDA 4MA8L 3MRPB 1H8LA 5ICYA 1FO0L 5LWYH 3X3GH 3HUJA 1PZ3A 1NICA 4YC2C 1TJIH 5A2CA 3U4EB 1L9NA 3RWJB 3ULVH 3ARGC 4L29B 3NH7L 3JWNH 4LSPH 1WIOA 4ODXA 1CDJA 2BHYA 2FBRA 3HN8A 3LRMA 4BK8A 1LVEA 2G5UA 4QJ5B 5DXWA 1Q16A 1A3LH 3BAEH 1QPPA 2VUMA 5JO5A 5LGJB 1U33A 3HHMA 3PAVA 1NBVL 5JIKA 1BAFH 2X70B 5C8JA 2J1YA 2V5MA 1OL0A 5AUMA 3A67H 2VN3A 1RZFL 1JZJA 3D0LA 4KRPC 3MV9D 4NOFA 1MAMH 4KV5E 3DTXA 3LRHA 4PJXF 3FS9A 5AOIA 4QR7A 1F58H 3ARTA 2X2JA 4JFQA 3UAJC 1K4DA 2GG1A 4KTDH 2P8MB 1CO1A 2KLTA 4XBMA 3V0DA 3S96B 1B2WH 4PGEA 2O61B 2ESVA 4YHIB 4ORGA 2ERJB 2GFBA 4CVUA 3QXDB 5DHEA 3KPSD 3EOAA 5I76A 4XPBH 3KJ6L 4K5PA 4JRXE 2I26N 2R59A 4YDVB 5EO0B 2P5EA 3I2CH 1OA7A 4AIZA 2PR4L 2XY2A 4AKPA 2CE6A 4AITA 5KSBF 1A3LL 2NY5C 1QLRB 1YN7B 5CU5A 1CBJA 3I6KB 1QQDA 3G6DH 5DJZA 3U4BH 1MDTA 4EI5D 4W4OA 5F7LB 1RUAH 3VAEA 4ONGL 1NCWL 3GB7A 4JNXA 3Q9QA 5D1QA 4QD2E 4AVKA 2XWRA 5EDSA 2JJTC 1U8IA 2R1YA 2X9ZA 3C2SA 3DX3A 3RZCA 1KG0A 3FB5B 1RK1B 5D2LF 4BXSV 2RD0A 3KNBA 3PNWA 3VYNA 1I75A 5IV2A 2PO6D 2O6EA 3A4EA 3ARFA 1WBZA 3JWDH 4LHUD 4TPRL 5DVNA 5ECJE 5AZ2L 4I8DA 2OI9B 3OZLA 3PWJB 1NKOA 4FQ2L 3CLFL 3F58H 1MW2A 3NFNA 5IB1B 4ZAKA 5PCYA 4Z7QE 4BDVA 1JNHA 1ZA6A 2VMJA 5C0BA 1K4DB 1FNGB 4DPCX 4U3SA 3QYMA 2HX7A 25C8L 2BP8A 3DKHA 3Q8CA 3S96A 3INUH 4U0RC 2ZCZA 3C08L 3CHQA 3DIDA 2R92A 2DBLL 3NFPA 3DXAE 3L3DA 5HBBA 3AWGA 1X9LA 2ZG1A 4EN3A 2Q20A 4X5WA 4YAQA 4N0YL 1EU1A 3OJVC 3VTTA 3CFCH 1GY2A 2D0GA 4YXKL 3IJ7A 1QLRA 1WG3A 4O5LH 1OGSA 5I8CB 2F68X 4N0UE 1RL1A 2AXHA 5SWSE 4FNSA 1U8JB 1SXBA 2VIRA 3BAYA 5H35A 1UHEA 2YN3A 5CD5D 3C5JB 5L7XH 2F18A 2ZX9A 1L5GA 4JFHD 4UCFA 3UTPD 4XN1A 1X7TA 2NCMA 3QNYB 1F45A 1HX0A 3QZBA 5HVHB 2R2BB 1DE4A 1F4YL 1YMHA 3P9MA 4MHHG 2WLJA 3G6JF 3WTWA 3SGEH 3ULVC 3GGWA 5E8DL 3ARFB 4O9HL 4YPGA 1XCXA 1FPTL 1MY7A 3LEXA 4PJ7A 1ASPA 4JFDE 4PWHA 5HHMD 4XMKL 1TVBA 1KGXA 3REWA 4FP8L 5FW6A 4F37F 3QYNA 1I85A 2W91A 2E9IA 4I2XE 1TYEB 1JFQL 4FYSA 3VQ2C 3MO1B 4AG4H 1B4JH 1FDIA 1YZZA 3CC5B 4PJ9A 5T33H 5FA3B 2YK1L 4DFHA 1UXWA 1KJ2A 1IC5L 1Y7VA 2EUVA 2ICWI 2JI3A 4GXFA 3FRUA 3N3EA 5DEZA 3C5XA 5DJXA 5IIEA 4N6RB 2ZKYA 4I9WE 1AG6A 3DSNA 1FL6B 1ZS2A 3W5MA 3MV8E 1DJIA 4RAUB 2QKIC 1KYOK 3QJTB 4G2AA 5L4IA 1S9VB 4KKZA 5EZOH 4W9FC 1INQA 1QX1A 3C8DA 4QF1B 1ZEAH 3DMRA 4B3EA 3F7QA 3TPUB 4WO4A 3CJJA 2EH7L 4G9FE 4ELDA 1Y1VA 3ARBB 4EKXA 3UAJA 2VIRB 2XJLA 1W80A 3NZHH 2YXMA 3CSFA 3GSNL 3CMOL 3SO3C 5D7JD 4APQC 1LYQA 5FCSH 1UG9A 5D1XE 2B15A 5EZIL 5D7IF 1USQA 4PJCF 3P4NA 5AKTA 2FATL 3E9UA 3ML9A 5BZWA 1L9OA 2I7OA 2I85A 4BZ2L 3BDBA 4GG6B 4G8GB 3FL7A 4A67A 1PX4A 3M86A 2F53B 3VI3E 5E4OA 5HGDB 3OF6A 2L04A 1A47A 1V7MH 2GY7B 1PLBA 1AH1A 1A4BA 2ZXBA 3U9WA 4TF4A 1AR1B 4QRPA 3CWGA 3GKWH 3VH8G 2AJ3A 1UXLA 4PJEF 3ZDXF 1JZ8A 3N41F 1NOFA 1EXGA 4L18A 4DK3A 3JWDC 1AXIB 3N41B 2AGJH 5BVJA 3FT0A 3UAEA 3DVFA 2IWFA 2HKAA 32C2A 2HCZX 2EJ1A 1KT2A 2AMGA 3PE9A 5DJYA 1GOFA 4Y8AA 1CFVL 4YSCA 1R9FA 4GG8A 3L5WA 3TWYA 3NZUA 3ENGA 5KVDH 2E9JA 2DQFB 2FJHB 4FF9A 4S1SL 2H5UA 2UX6A 5F1NA 3B2XA 5CD5C 3FULA 2I9TA 1URIA 1JI1A 4GI9A 5DS2A 5JMOC 4AYBA 3OZ9L 4P3DA 1KXQE 2X10A 3VH8B 3P2DA 1E6OL 2JJSC 5BS0E 2XVKA 2WBJC 1YY9D 3GMMB 3HMXH 4WI2A 1X5AA 3NJXA 4B9IA 4P5KA 3ARBA 1LK3H 5E6SB 3L7EB 1DQML 1V7ML 4YSSA 2YMXL 1NCUA 1ZE3C 4P46D 1FE8L 2VL5A 3AITA 4AW7A 2CCWA 4I5BB 4Y1AA 4JFXA 2VR4A 3HBQA 2CQVA 3SO3B 4MSWB 3PWLB 4OD2B 4YGVB 4OCSH 3Q2NA 2Y6SC 2FYVA 1DDTA 5GZNA 2GJRA 1WZMA 3IXAB 1YLEA 2R69A 4Y5YA 4F80A 2YAMA 4N2EA 4OZIA 4H25B 4D9QD 1I7ZB 3EIFA 1W72B 3RPIA 5EUKA 1HQRA 1Z5YD 3ECBB 3UZVB 2UZYA 2HJFB 3TYFA 2MTAA 2ZG3A 1T21B 4FKEA 3QIUA 2FYYB 1KNOB 2AJSL 3FN3A 4BSWB 4TXVB 5DJ8B 1SXSA 2XPZA 3HB3C 1UXSA 1N10A 4GH7B 5IWLC 1T2JA 4XGZA 2EIZA 1BM7A 2AJVH 4PRHE 4MVBC 4LCWD 5JIMA 3VD4A 4Q9QH 4Y2DA 3STZB 3ZKND 4OF0A 2X6BA 2DQEH 4KWUA 2JCCF 3TH4T 1JZ4A 3S98A 1KXHA 1A4KB 4G1MB 3QJUB 4N2IA 2NR6A 3ZHNA 1NAMB 2NZ9C 3MODH 5EN2B 4W9LC 4JANA 3WY2A 3CSYA 3JV4B 1L7TH 4AZ8B 1INEL 3TBWA 1UD2A 4ZQTA 1TZIA 2DV6A 1KCBA 1AS8A 4F58H 1EHNA 4LCVA 5H4YA 5C1MB 3ARDB 4MMYA 1NL0L 1AYOA 4P57A 4CBZA 1NFIA 3GXPA 5TF0A 4F2MA 5DO2C 3VFWB 1ILSA 2GI0A 4JZJB 4PYGA 3SPCA 3UG5A 3GK8L 2Q8AH 1Q9OB 3GLDA 4A7VA 1RUML 1MCCA 3R19A 3UTTE 1MI5A 5IQ9B 1R1CA 1Q1JL 3X1EA 1XF3B 2ITFA 1R3HB 1KEML 1PYQA 3WLBA 1NM4A 2NNCA 3MREB 3O41A 3P0VH 1LD9B 4GQ9L 3O11A 5D70H 3ABGA 4XC1L 2D7QA 5E9DD 2WQAA 3CVDA 1QBLH 3NCFB 1C08B 1IT9L 4LBAA 1G9NH 4HUWB 5CLYA 2X4NA 2IOIA 2XLLA 3LKOB 4M43H 4MLIA 1U8MA 4XE5B 3B1UA 2Q86B 3QIUD 4FEMA 1R5VB 2F7IA 2VDQH 3RL1A 4GW4A 3CPLA 4K94L 1YHPA 4NZJA 2K3HA 3RWIA 5JQ6L 1AC6A 3RY5A 1MUJA 5IOKA 2VAJA 1MHHB 3IE4A 4V1DD 1I7RB 5J56B 4AC4A 4QHUB 3ULUC 2JVUA 4GSDL 4LSQH 3EYVA 4AZ8A 1D6EA 4U1MA 4R5XA 5T5ID 2K1MA 2BOCB 3M1BA 4JRXB 4L9LC 4YDKH 4TTGA 1XGQA 5E1HB 5GZND 1CT8B 2ARJQ 1F6LL 3V0VA 3DBSA 5SWSB 1WFUA 4P5RA 3BVXA 5B22A 3BVNA 2AEWA 2J6EH 2XY1A 1T4KA 4H4NA 4IBZA 2IG2H 3TT1L 1MAML 3AZUA 3U9PH 4ZSOA 1YMME 2JH2A 4OCRL 5TGBA 3KLHD 4Z7NF 4R7LA 1JZEA 1KBPA 4X7DC 1ACCA 5D7EA 3MXWH 4XOCA 5CINL 3QR1A 4WSGA 4EI5A 2XN9B 5D4QA 1IBGL 3WLBB 2RGSA 3NSJA 4U7SA 5IHWA 3H7BA 1JWUA 2PR4H 3QDJE 1E61A 3MDJA 2NQCA 3OB0K 3L7FB 5DD6B 4HGWB 3RI5K 2MFNA 1G7LA 1MWAL 1X4ZA 1KZYA 1YUHB 1G0XA 5FYLL 1VFUA 5AVXB 3X14B 4ZMQA 4HU2A 5CBEB 3RX5A 1I4FA 3BPLC 3D4ZA 3MRRB 3PXHA 4F8TA 4DVRL 1Q8MA 2IDQA 15C8L 1HH6A 2ZD0A 2E86A 3Q8AA 3RPBA 1EAQA 1RJLA 4GW4B 2GHZA 5IREA 5KSAA 3F7KA 4JPVL 3RDTA 2ZOUA 1E6JL 1MHHA 1NLBL 4Z5RA 1A6TA 5I30H 4KMTL 4G6KH 4H8WH 1EMTL 5HI4D 2NX5A 4DK5A 1XGQB 5G2NA 1EV2E 1W0VA 4HKXA 1CBVL 3GMLA 3RUGF 3D3VB 4YO0A 5FUZH 1E5ZA 5C7ZA 4OIAA 1AGFB 3T8MA 1I1AB 3EYUL 4NKMA 4FHJA 2AQ2A 1ZWIB 3FU7A 5I1JH 1T4KB 3U1SL 5IESH 3FO1B 3WU1A 2A6IB 1MNNA 2BNRD 2FWOB 3K2KA 1X5KA 1FG2A 4YL4A 1P4BH 1ACYH 5GS1B 1QD0A 2EACA 4I48B 3X13B 4EI5B 4CNIA 2RCSH 3EGSB 4V11A 3VO0A 4LARL 2Q7YB 3O2DH 5L4FA 2IANE 4Y9BA 5DFTA 4Z6AT 5DRZB 4HS8L 2ADFL 4XNAA 5FECB 1LNUA 4UQDA 4NAJA 3SOTA 1FV1B 3Q8EA 1G7LB 4JJOA 1H6FA 2WJ5A 2BIHA 1G1KA 1AQDA 1I4FB 3MRRA 3Q7JA 4ETQA 2XACC 3DJSA 3NGBC 3H85A 4A37A 1S9WB 1HH6B 1XEDA 4GQQA 3D07A 4PJFF 4TQPA 1AA6A 1H3UA 4PCKA 3RDTB 4HEME 1L7TL 5B3JF 3QJFA 3VXSA 3N42F 1RFDL 5JXED 4R7NA 4BUGA 2XV3A 3NABL 1HHIA 4XNBA 2Q8BH 4YHPA 5HYJD 1G7IA 4X4ME 4YSAA 3IU3B 3V5KB 3OC5A 4F9LA 3Q2LA 2Q87A 4RX4A 1AGFA 5LCVA 3ZZSA 1ZHNA 1O0VA 2DYSB 5T3ZL 1DQQB 4G70B 4L3EE 5E08H 1MFNA 2CO7B 2ZWYA 5T3XD 1EO5A 3L08A 5SX5H 3C6LC 1E9OA 2NVYA 2IJ0C 3MLVH 3QBTB 4AQ1A 3L5HA 5I1IL 5IK3B 3OAUH 4CNIB 5KTEL 1NCCL 2QQLH 3BVDB 3BO8A 3NSYA 3HIZA 5F7EH 4IHBA 4LLDB 4PY8J 3O2WH 3SEPA 2AJXL 4AYID 2CDGA 4OGAD 5JZ7D 3E6HB 4Y7MA 5FHBL 4JFPB 3WELA 4NHCH 3ILPA 3UTZB 1NCIA 1XH3A 3LS5H 1NEPA 3AG2B 3EGDA 5F7DA 4C59B 1LO4H 4G8AC 1U8PA 3L17A 4KJYB 4WCYL 3IKKA 1PTZA 5DHMC 2C7UA 1SYSA 4G6FD 5IB2A 1BVLB 4XMPL 4Y19B 3D2TA 4X5PA 4DKTA 3FUIA 4OIFA 1L6XA 4N5ED 5C0BD 2OV0A 3BUYB 2BSTA 3KPPB 1B2WL 1U3HA 4HPYL 3ABLB 4DKFL 1CGYA 4KTDL 4IBQA 2PR9A 5D6DC 4L1SA 1NMCC 3EYFA 1IQWL 2OMVB 3BHBB 1NLDH 2C1PA 3KLAA 4G7SB 1I9IH 2CCLA 2VRAA 3EYOB 1LEGA 3NSFA 4X9YA 3P54A 5FW7A 1FZOB 2FX9L 2UUDK 2YIHA 3B9KD 1GGCL 8PAZA 5ISZD 2BSSB 5MHSD 3D2UB 2WPGA 1BF2A 1RXLA 2VH5H 3L3HB 3QIBB 1YC8A 1PKOA 2GUOA 1RZGA 2OS7A 1WAPA 3N43B 4KRPB 4XX1E 5IQ7H 4KHXH 1KV3A 4JZOA 1N6QL 1RZ8B 1BQHG 3MRKA 4YSTA 3AFLA 2EXWD 3P3YA 4HHAB 3FCGA 5KN5A 2X7LB 2VABB 1T7WA 3ZPDA 2CRYA 1AIFB 3V6OC 5FO9A 5F70A 3REVA 2WKLA 3EYSL 2WUBL 5DUMH 1K5NA 1D7BA 1VFAA 5CBAB 1E0OB 1KJ3H 1CZ8L 1M2OA 2WQXA 3AREC 3GSRA 2ESVD 1O9ZA 3ERXA 3BXNA 1VFBA 4DGUA 4G5AA 2HRPL 2ALAA 3EG9A 4Y4FB 3EDFA 3TU6A 1BWWA 3WN5A 2P45B 3WFBL 1AFVH 1RU9H 3VGGA 2C4XA 2CO1A 3HG3A 1P7KB 3ZDYE 1PZDA 4J2QA 4WAFA 1KB3A 4HIJB 1Y1DA 4JZJC 4L8DB 3T0EE 3GFUA 4S1QL 1DJGA 1ERNA 2X4QB 3B34A 2FJGA 4YSPA 4G8GD 1FUNA 4GXVL 5ANME 2UY6A 5CLTA 4QDGA 2YA1A 2OQJB 4I4WA 2W5PA 1CFMA 3Q06A 4O2CA 1KYFA 1U95A 4IMLB 4W93A 3UACA 1CU4L 3WIAA 2Z8WC 3E8VA 4ZYKA 3D8MA 3DNKA 4Y4KD 2AJVL 3RFRA 5FTJA 3PAYA 2RACA 5E2WL 2Y06H 4BIKA 3OXRB 3O0RH 5J13B 2GCYB 5BVPL 1CUOA 4GW5B 2DJSA 2EIJB 3N0PB 3BD5A 4KZCA 4L8SA 4OJDH 1S9XB 3GBLA 2KT6A 1PKQE 2W95A 4H0GA 2Y7QB 1W0WB 5DURD 1QEXA 2EDEA 2XWJB 1ZLSH 3V5DB 3U4AA 2W60B 1YNJD 4ONFH 3FB7B 5J11B 3TVMA 4UTAH 2WB1A 1NC2B 1S7XA 2RB8A 1H5BA 4XN5A 3ARGD 2AEQL 2NY6B 3DMMD 4KOBA 4R2GC 5JOFA 1G7PA 3GMPB 4P46A 2YPVH 1N64L 1CIDA 2IAMD 3T3PE 1J88A 3W5NA 5FLVA 4YX2L 4TM9A 1LDPL 4L8DA 1SXAA 4E0RB 3OM3B 3VYPA 5BZZA 3LNHA 3FT9A 3LKQA 3NIGF 4ZK8A 4YIQB 1W91A 3IFLH 4GAAA 4K94C 5F72S 5D1QB 1WCMA 3PL6A 4HAKA 3VSUA 4N0CC 3ZE0B 3LYRA 4W6WB 1KG0B 3C5ZC 3VM5A 1MHPH 4AV0A 3M6DA 3OR7A 5F1IA 3RG1C 1JXFA 1I1RA 2GJ6E 4HDIB 4TLKA 2V5TA 3IAQA 3PV7A 2VXQH 5L88H 3RY4A 5HHOB 4AUYA 2J1WA 4HCRA 3QCVL 2EH7H 3S88H 3E1ZA 4K8RL 4PG2A 1NCBL 4M6NH 4NZRH 1IAIH 5CLXA 2QQNH 2AQ1A 2UXFA 3VFPB 4BDVB 4PJEA 4N22A 4R97C 3VQLA 1NCJA 3FPXA 1MJUL 3EO0A 4U3SB 3HG1E 1EUUA 5C08B 3SY0B 4L1DA 4PJCB 1J9SA 3EBHA 4WFGD 2KHAA 4NPYB 5DA4A 5BNXD 4CW1B 1I7UA 4EI5C 2H2PD 3MGTB 3T1FB 4KQ3L 3QW9A 4NENA 1Z66A 5CILL 1WITA 3QXAB 1AHWA 4JG0H 4RX4D 1BEYH 1WUNT 3ARED 2HJLB 3K4AA 4AVJA 1IC0A 1O9VA 5G4MA 2BY3A 2O4EA 1IM9D 4JO1L 4JAMA 4HCRL 3JTTB 2R9HD 3OB8A 4ODXB 4P0DA 5DQDL 4LOVA 3IMVA 3VXSD 4XPBL 4G9FD 2O1AA 1A1NA 3SDCA 4NQDA 4ONHA 2A6JA 1YMHB 2J57A 5GRWA 3H9HA 1QSFA 4PVLA 3MROA 2GSMB 2OMBA 2FTAA 3WAKA 1WJ3A 2ZYHA 4Z7AA 1G1OA 4PJ9D 3ZGHA 1Z0NA 2YUVA 2ZAIA 3A21A 2BO0A 2LFEA 2NY1B 4EQ3A 4XCFH 2PJJA 3DTXB 1DFBH 1FZKB 1NEUA 1T2QH 3D09A 4PW4A 4WI8A 2JQZA 3WKYA 1K8IB 1A6VL 2F7QA 4WI6A 4G3YH 3HA0A 3U7WH 3ARPA 1UEMA 1TOXA 4N5UA 2O61A 2HB0A 1RIUL 4OD3H 1TDQA 5DJ2A 1EBPA 4PJCA 5IJDC 1D5BA 4L2LA 2XPYA 4EUPH 1UZGA 2GJPA 1I7UB 1QZ1A 2WAQA 5A2BA 2A7BA 4GMSL 4YDVA 4QMEA 5DK0A 2XFXA 4JO3L 5G5DB 4EBQL 4Z23A 5BUGA 1G4MA 4KQ0A 4QOKB 2JKLA 3S3JA 1YRKA 3TFKC 2NT0A 4GBXA 1MWAB 4HOWA 2EYRB 3FSOA 4GPVA 3AREB 4TNFA 5DD5H 3GBNL 3ULVD 2H6OA 2J8UE 3DOSB 4BQBA 3AU0A 3WCYA 2YA2A 4HU8A 2FH8A 5LJYH 3BE1L 2G3MA 2E7LA 5AG9A 2EUZA 4O5LL 4F7TA 1NKGA 1BXAA 1H8OA 1X6LA 3FB5A 5IFHL 3GXFA 3DIVA 1BX2A 2OKMA 1SZNA 3RNKB 3JT0A 2LVCA 2Z65C 5IHZB 3MROB 1SF5A 1ZA3B 3DV6B 3RHWK 4I2XB 1EVTC 1KGUA 4PS7A 3QQ7A 1A2YA 5C2BH 4IBLT 1BZDA 3FFCA 4NQEA 2YR3A 3K6OA 4I9XA 1BQKA 1FA4A 3POHA 5JW4M 5SX4H 5LXVA 2CGZA 1A6UH 1UD8A 2WCSA 2CCVA 5EORL 4PJ6A 1FVEA 5B3JE 2A6HD 2YFOA 1RLWA 3R8QA 3B43A 3ML8A 4FQ2H 3RGVD 2A9NH 2HT3C 4G82A 2KPNA 4ZO7A 3BAIA 2DWTA 1HJCA 3I3DA 1CFNB 1BM3L 4KRNA 1NGWB 4KOCA 1JN6B 3X2QB 4X6BB 2EDQA 1L6ZA 2WIIB 3T6ZA 2G5DA 5ICZA 1C5BL 3QG7H 1SVBA 3T3MB 3BZEB 3U1PA 3AC0A 1NJ9B 4MCYA 4N2HA 2DKUA 4W9KC 4ERSH 43CAB 1ND0B 1NGZB 5IBTH 2EO9A 4FD0A 3M17A 3X1FA 2F74A 5EEWA 1EHXA 2B4CC 2ARJB 1ZT1B 3BAEL 1RIVH 5DVKA 3U2IA 3BRDA 1IBDA 2YC1A 4AMKL 1UCBL 1YEEL 1ETA1 3B2VH 3FBQA 4P07A 4H0HB 2FL5B 3CHXA 1ZA3A 3DV6A 2N4IA 3WEMA 4EOWH 1GS6X 1SDYA 1UB5A 1CYWA 1OLLA 3I6GB 4FNRA 4XXWA 2EEBA 2LU4A 3OBAA 4XXDB 4XP9H 4XO4A 1LWRA 1M53A 1D5RA 4FQHA 5E9DA 2J6EL 4U3HA 3UTTA 4A2EA 2ZP0T 3ECBA 4FJZA 5AKRA 1EDYA 1NFDF 4MXWL 3UZVA 3QWRD 3I9AA 3MRDB 4WDIA 3NIFF 3BZFA 5EEVA 4YDKL 3EJPA 2K70A 4LHUB 5FK9A 3BN9D 4KBPA 4XGZB 4LB8A 1FFNA 3DJ9A 3KYNA 2XOTA 4UTAA 4AI7A 2CDEA 5FM5M 1CFNA 2WCPA 5HHOE 4KQ4H 3EDJA 1OGAD 1EEZB 3U82B 1S7RA 5IJCC 3AAZA 4LU5L 5FR3A 4ZOBA 1S9YA 3ARVA 5TE6H 1E2WA 2X9WA 3GT6A 4HF5L 1NIFA 4JL2A 2PJHB 3X3GL 4KV5F 3CDFA 3M17B 4YH6A 4NRYB 3F65A 5IUCA 2DMGA 1G9HA 1R75A 3ARDA 3DECA 4HF5H 5FYKH 2PTVA 1N8ZB 3GHEL 5EOQH 3TT3H 1W72L 2WMPB 4BZ1L 5C0CD 3SGDI 2BHZA 1NFIB 4OLUH 5GJSH 4N6QA 4HHWA 2V0AA 2CA4A 2WZ5A 4DP1X 2DQMA 4WQOA 1WBXB 4Y2DD 4IIQB 1CB4A 5KBNC 4N1HB 2BY1A 1M7IA 4XCCH 3H54A 3LN4B 3T71A 1QRND 4I0PD 4HCFA 3I6GA 4HOXA 3W37A 1RUPH 4M4RB 1MI5B 3IR5A 2LQRA 3E1F1 3GSQA 2AJ3B 3IWVA 1XCQB 4K3JL 3UIZA 4H20H 4TNWK 5MENA 1UYWH 5BZDA 3L5IA 1JGLL 1IKFL 3HFML 4IRSA 4RMUA 3U25A 1NSNH 5KYUB 4XP5H 1PIGA 4HWEH 1XR8B 2WK2A 2P9RA 1EFQA 3TLRA 3MLWL 1SRDA 1KT2B 2GTQA 3ZL4L 5IJVB 4R7VA 2X4SA 3V4PL 3O3DB 3T65A 3KYNB 1DBJH 1AQKH 1PT0A 2JKNA 3MOAL 4KVCH 4XI5C 3V6OE 1AE6H 3QZPA 4Z7OE 2B77A 5F1NB 3GRGA 4I1RA 4Z7NB 1IVLA 5E2WH 3RWEB 2EDJA 2OSWA 3OG4B 3VD2A 2IOOA 4DVRH 1L9PA 5EIIB 4HH8A 4JFDD 4OZIF 2VLME 2X53A 5DO2D 3GZPA 2J6EA 4FAAB 4AQEB 2X9YA 4GT0A 1GHFH 4YFLI 5GLYA 5LDSA 2AEPH 4QHLA 3VRJA 4JPKL 3D2UD 3EH2A 3AQDA 2M26A 1CT8A 4IOFC 1OK0A 4XVOA 5SWSA 3QHZL 3PGCB 5BW7C 4JN1L 2VXSL 2O93L 2D7OA 3BVNB 4PJ8A 3S8WA 4FC3E 4K5OA 4UQAA 2PCFB 1U58A 5TF1H 3PYCA 1CDBA 5J1AB 1HYRC 3UGUA 3TCTA 3ZOAA 1MFCL 1G9NC 2B4CH 5C0EB 1SFOA 5FGCE 4M4RA 5L6YL 1BXXA 4Q6YA 3V4PB 3GSQB 3HKFA 2I5YL 1I7ZA 2XN9A 2FSEB 4B6ZA 4F91B 1XCQA 2EO1A 1I1YB 4G8FB 4ZOCA 1OB0A 1J8SA 4OD1H 1IBYA 2PPAA 3QUKA 3H7BB 1BQ5A 5SWZD 2JLPA 5K69A 1XR8A 4WV1B 4AM0A 4N2MA 4UF7C 4HGWA 2WNKA 1H6UA 4RIRB 4NCDA 4TYUA 5D7IB 5DJ8A 1N4XH 4XPTH 3I9GH 5DUPL 4EDXA 1WGVA 1UXSB 4R3SB 2BP3A 3FFOA 1YYMH 5EFIA 1D5XB 4H20L 2LV4A 3GIZL 4HX1B 4NC0B 5B38A 4NERA 3STZA 1KWGA 3UMNA 1HJBC 3RWEA 5GGRA 5BQDA 2XQYK 1RSFA 2Y2YA 5D8JL 5C08E 4HULB 5KSAB 3M3GA 3DJTA 7FABL 1UQSB 4JANB 2HTLD 2EYTA 3ZR6A 1MEXL 2KQAA 4U1HB 4AQEA 4MX7A 2VN4A 2BW5A 1KB9K 1AIZA 1IKOP 4GO8A 1WCBA 3AQYA 1HWGB 2DLTA 1U91A 3R1GL 1GRWA 1MHCB 1WFTA 4MMYB 1YEDA 3FQWA 3NJKA 1GJUA 1U8NB 3VD1A 4GFTB 2AABL 3WV0A 1OZTG 2DQCL 4DO6A 4JCMA 5EBWB 4ZX6A 2W9DL 4M1CC 1HSBB 4UQEA 2FWOA 1WPCA 3SE9H 1QA9B 1VACA 3WN5C 4ZBJA 4ACPA 1AGCA 3C2AH 3HE6B 5LBSA 3SGEI 3TGXA 5MENE 5IQ9A 4I48A 3X13A 3QHFL 1BEYL 4MQXD 2A6KA 4QRAA 1HKLH 4XMLL 3ECQA 3OMAB 3SODB 3FTZA 4RGND 4Y89A 5BV7H 1SEBB 4KK5C 4DPBX 1AACA 3BKYH 1QSEE 1ZPLA 2WQVA 5CJBA 4EDXB 4GXUM 1NGYB 3E8UH 1UVQA 2D03L 3MGOB 3U46A 4FNUA 3LKOA 3FHAA 4IQHA 4ETQB 1U8MB 2Q86A 3D12B 4X42A 4BFEA 1BYNA 1MPAH 5F9DC 1S7TB 5DVOA 3D3VE 1A7BA 1UUNA 1KIUB 2PW1A 4JY5L 4U1HA 5AALA 2X2YA 3PUCA 1U8QA 1XGZA 4FQJH 3M1BB 5GJTL 2GIXA 1E5AA 1YPZF 2WINA 4BFIA 4PJEE 3ZDXE 3NP3A 4M48L 1HZHH 3BYTA 4JO4L 4LPTA 3MNVB 4OQTA 5GGUB 4NKOA 1HSAA 1ONQB 2HMID 5IM7B 4P2YA 4KY1L 1TJIL 3BAXA 4O58H 1OF0A 1RZ7H 1T6BX 3BEVA 4EN3D 5FO8A 2EO7A 3D39A 2OW6A 3PDGA 5EIQA 3GMOB 5LQBH 4HK3N 4WFEE 3D6GA 3SBQA 4L4JA 5D6DA 3MUHL 3RKDD 3CQZA 3MNZB 3QZWB 1CL7L 2YBRA 5DYIA 1Z3RA 5I16B 4Z8FH 3BKCL 4OV5A 3SPIA 1VADB 4J8RB 5I6XB 4X7EC 3MRFB 4MB1A 3AU1B 4NHUB 5AVYB 1QLEL 1MH5B 3BFOA 2ZOWA 1QTPA 4OLWL 2ERJC 4XPHL 5JIQA 4ZPTA 2D3NA 3D39D 3QC8A 4URTB 4NQXB 2EE9A 4Z3FA 5CP3H 4KJYA 4MWFB 1P4IH 4JZNA 4ZPVA 4XC3H 4DSYA 3TBSA 4AH2A 4UZGA 2DRUA 4FQQA 4OGQC 5C2BL 5CJ5A 2C9QA 3MBWA 1PD6A 3RZCD 1A21A 1KYDA 3MJ7B 5CNHA 3RWHB 5I6OA 3MRGB 4X6CF 4Y9EA 2YD4A 5TDOB 3N1PC 4NI6A 4NLAA 4I1NB 4Z77A 4D7BA 2WWMC 4NC1C 5HJ3A 4LCIL 4GAYA 3WHXA 2K9FB 2DL9A 3GMLB 4NJ9L 1QP1A 3BUTA 4OGXH 3VACA 4D9RD 4Y4KA 3ULUF 1PZ2A 1Y1WA 4KMTH 3W56A 4IOSD 2VAAB 1ZIAA 3A5VA 3H9SD 2XIIA 2H41A 4LNRA 5DMIL 3QQ3B 2CLRB 5L9DL 3MKKA 2FQFA 4JZOB 3MLXL 3MRLA 1BDYA 1FO0A 1KPRB 3MC0A 1M1XA 4MKMA 3RJQB 3RFZB 4OV5B 1MCLA 5BXFB 4K3DH 3CV5A 4XP4H 4OI9A 2ICWA 3SGKC 3MVSA 1MI5E 3WFBH 4X9FA 2IGTA 4Q2ZA 5L2KB 1TT6A 2C9AA 2X41A 3L4XA 2YEZB 4NB7A 4APXA 3SJVA 5D7SH 3GSRB 1MJJA 3DUUB 4MCMA 5CSGA 3RJOA 3QDJA 1T66D 3CN1A 1UZ8B 1HOEA 5GGQL 3RA7L 3H6AA 4HFUH 1WHOA 3BVVA 1IZJA 1IARB 1L7IH 1MSPA 2BVOB 1YQ2A 3ZDZB 5JHLH 2X2UA 1P7KA 5DT1L 5DFWH 4AE1A 1X7SA 4NO2A 4FQ1H 4A1RA 1TITA 4M61A 1TJXA 2OL3H 1IQDA 4KKBD 3ARDC 3EHBD 4MNGB 1DN0B 5E99H 1H3GA 4F37K 3CSPA 4UQ9A 5HJ3B 3BQUC 1MFBH 4TUKH 3KBFA 1QHQA 3CX5K 5DZPA 4G83A 3DBXA 4V2CB 2CHWA 3D30A 4ZFZB 4PMFA 4NGHL 5ISZA 5M94B 5H4UA 5EF3A 1OSZB 3RPKA 5D96C 2V2WA 3GD1C 1T1WB 1ZHKB 5EC1A 1Z32X 3Q6FA 1D6VL 3G5ZB 5I9QB 4J7RA 1OHQA 1MHPL 3E9TA 2J7LA 1ZLUH 3VXTB 5IK3A 5EU6D 3E38A 4I87A 1LXMA 2KERA 4N8UA 3ZE2E 1G9NL 2KC0A 2IPTH 2EIMB 2ICWB 4MHHI 5E1IA 2H8PA 1HEZB 4XBEH 1T3FB 4UM9B 4OF7A 1S9XA 5I1KL 4XC1H 5DHDA 4BKSC 2Y7QA 3IDJB 3VFUB 1T80A 4YE4L 1FO0H 3VWJC 4DW2L 4LU5H 2ZOLB 1D5IL 1PFOA 1M05A 1NBZA 1UZ8A 5IB2B 2AW2A 2AP2A 4I1PA 3KLSA 2QKIB 4HSQA 1ZTMA 3O2WL 4TRPH 4P46B 3BISA 5TH2B 1J05A 1IAOB 1T5XA 2J3SA 2VKWA 4YUEL 4NO2B 3HPLB 2NSMA 2XQBL 1FFTB 1R3LB 5IVNA 2R7EB 3G5VB 3LMJL 2XG4A 3QORD 5T5NF 3EYFB 3LKQB 3OF6D 1ITCA 1IGJB 1NA8A 4LFHG 4Q56A 3MCKB 2G30A 1D2PA 2WWKO 3NIGE 3U4EA 2OMTB 2W0LA 2JELH 3K91A 4XPFH 2C1PB 3PL6B 2CR3A 2RBLA 3DBXB 4CRPA 1MCEA 3ATBA 2AANA 4N0UB 2HFFB 4P5MB 3AWFA 3X12B 4L5FL 2J25A 2XETA 2CZNA 1AE6L 4H2CA 5CEZH 2R4SH 4MQTB 4FRWA 3G5ZA 5E8EB 1HWWA 4X4XA 2LLNA 1LHZA 4L1BA 2K6WA 4NEHB 4PJDA 4O02H 3TS8A 3PF2A 4HWEL 4IRSD 1ADWA 5T1LD 3MJ6A 4PJEB 3ZDXB 4KX8A 3CBRA 3IETA 1E8ZA 2MNJB 2YEQA 3GHPA 2IF7A 3LS4H 4MXVE 4R2GD 1UGNA 2WVUA 4N2GA 1L3WA 3GXIA 1QRNA 2OTWA 3CFEA 2G3NA 4I0PA 1ID2A 1YNTA 1BLNA 5FOBA 2B39A 3NG5A 3RUGE 2ZOLA 5T1MA 4QAMB 2Z34A 1L9QA 2EKSB 2VJ0A 4GG6E 5JDSB 1L9TA 1UWXH 3G6JA 3QXAA 1QEWA 1E32A 2F1BA 2NNAA 3BKML 3TV3L 2QPUA 3HPLA 3ZX1A 4LZKA 5CSZA 3K8LA 2VQ4A 2BIMA 2NCEA 2R7EA 3G5VA 1PFCA 2XBTA 4MZIA 3HLAA 3CXDL 2PCYA 2DEWX 2QV4A 2A9CA 4HIQA 1K8DB 3QUYA 2Z31C 3C09C 2GBUA 1Y6MR 4L8CA 4TL4A 2OQJA 1SF3A 1F18A 1W16A 2OP4H 2C7FA 2AERT 3T5WA 4L0YA 1LK3L 1U95B 4IMLA 5AOZA 1SUJA 2C9XA 2OZ4L 4ZYKB 5KBDA 1YC7A 1NBYB 4K8RD 3Q8FA 3D18B 3DETC 3C8KB 1WBZB 5IW1B 3PWPB 1RUPL 3JUZA 5HDLA 5FM4A 3D7PA 2AXGA 4Y5VA 2XV0A 1QABA 1YEHL 2ENQA 4N90E 2ID5A 4PJDB 1RZJL 3S5LB 2VXTL 5AD0B 3FUMA 4UI2A 2FNWA 5F21B 3ZYZA 2DWEB 4DKEH 3VXRA 2LTQC 5F6HJ 2I27N 3QUMB 3V6ZA 2Z8RA 1MCOL 2F6AA 2XVLA 1OP4A 2EEFA 1GZQA 1FAIH 1CGVA 1XH0A 5FYLD 1J5DA 5GZOD 3NIDE 4YLCA 3FC8A 3BP4B 4OZFG 3T0AA 4PIBA 2GBVA 1UWEL 1ADQL 1BAGA 1BVNP 1HNGA 3H9ZA 4KZEH 2K7PA 2DY2A 4QNPF 4XNYL 1NDMB 1HCYA 4C83A 4FEIA 2GJJA 2VDKL 3ATFA 2CK2A 5KJ4A 1B4RA 4K5NA 4XMXA 1PQZA 1GGIH 3MJWA 3DIFB 4F7CB 3ULVE 2OYMA 2H47C 1SOQA 2NRDA 2NUTA 1ZHLA 2VUYA 3NJIA 4HUMB 1I9IL 2J5WA 1RZJH 4IGBB 2P8PB 2XBZA 4NX0A 4M7KH 1Q9LA 1S7QA 1FNSH 3ZTDC 2DH2A 4XOAA 5IEHA 3CVBA 4X6DB 3EAKA 1LM8V 4I77L 2R2BA 4ZDHB 4EUPB 1QSVA 3WNIA 2BP0A 5IJBC 6TAAA 2FQDA 3B2MA 3GSWB 4XCNB 2CKNA 1PYWB 4PW9A 5IHUL 2VPZA 1N0XL 5BO0D 1QNZH 2P8LA 4WIQA 3VXQB 4Y0GA 4N8VB 3N44F 5JQ6H 1R6VA 4KKLC 3LKNA 4PLKC 4XZUB 2SEBA 4FI7A 3VXRB 1CICA 1AR2A 3ARGB 2G3XA 3V4UH 1HQ4A 1KYUA 4Y8DC 5DD3L 2C3GA 4F8PA 2PCPA 2AV7B 4NHCL 4DEPB 1XT5A 1S3KL 3P2TA 4D9RE 1AD9A 4QTHB 2PCXA 5E00B 5EBLB 1YAZA 3R7QA 1IBZA 3IGAA 5LB1A 1T04A 3H53A 1A0QL 2FT7A 3DOIA 3MBEA 4WUUA 4DKDC 3GTLA 4POZC 1EEYB 1FZJB 2OMXA 3SE4A 4WHTA 5GIRA 2V7NA 3B83A 2PMZA 1LMKA 4L4TA 1XH1A 4D0CB 3OKDA 4R84A 5T1LB 1T03L 2AJUH 1LEIA 3DV4B 3P1VA 2QHRL 3SYOA 1O5PA 1JE6A 1T7ZA 4JRYB 1G9MH 4MXQC 2DI8A 2JLLA 3MV7D 1RUMH 3HB3B 4UDUB 5AENA 4G6JL 1DBAH 1QLEH 2B14A 3K6IA 3R4RA 2EDLA 1HIML 4MQXC 2BOBA 3D85B 4N9OB 5HYEA 1ES0B 1V3KA 4UB0L 1KELL 4KZ0A 4CSZA 1WFJA 1F4WH 2Y5QA 5ICXA 5IB3B 4OCXL 3IKCA 2VXUH 1DL7L 1OD9A 5D1ZI 3QDMD 2IAND 1ZMYA 1C1EL 1PLCA 2A9AA 4GXUN 1H6EA 1Q9WB 4UV7H 2EZ0C 1QVOA 4AGMA 1A0QH 4OLEA 5BVPH 1A9VA 1I8KA 5GGRY 5HTSA 2SEBB 3BUBA 4UQBA 1R47A 3ALPA 2A74B 3C6EA 5BOZG 5F0MB 4XPAL 2WYZA 4ZMLA 1P4IL 5L0QB 2J20A 5F71A 5AW4B 1IM3D 2Z7UA 3ES6A 1AD9B 2LLLA 3GXTA 1WFOA 1QSZA 5BRZE 1GY1A 5CJOH 3WJMA 3ASNB 3DHUA 4TLUA 2AEQH 4YSDA 1D5IH 4QOKE 5B1KA 1KB5H 4ZOAA 3DX8B 4WHTB 5GIRB 1SXCA 3NA9H 4M6MH 4JPQA 5I0XA 3PWVA 1T5WB 1RULL 1YPZA 3MNWB 3UOAB 4ZMTA 5T1LA 1WZ1H 4O00A 3QDAA 4GYBA 3QDGA 3OXSA 4JHBA 3BCDA 2WLHA 2DMKA 4MD0B 3AREA 3SPGA 3FU6A 1TMOA 5AWNL 1JPFA 3CFTA 4JO8A 5HDWA 5IR1A 4A7GA 2VLMD 1KY7A 2R0LH 1NFDA 2PYFB 3OKYA 3U7YL 2HKFH 3KCPB 4IRZH 3B7UX 4J4PA 4ONOA 4BHUA 3ZK0A 4YDJB 2YO3A 3O3EA 3WTTA 2DMCA 1V10A 2P5WE 2PWEA 3BP7B 2CKBL 1LEKA 3IKCB 3IXAA 3KWVA 4NO3A 4HJUA 1IL1B 4FL4B 1WLHA 5DVLA 5BRQA 3EHBB 1UWGH 1S3SA 4BBWA 4OZIB 2J1ZA 4N3UA 1GYUA 4P9MH 4ZQKA 1QVOB 4J12A 4ZX3A 5C2UB 3IYLW 4OLZL 3LV3A 4AV4A 4PLNC 4GRWE 3LQZB 3UPRA 3LNDA 1RJZA 1S7WB 2EECA 4TQ8A 1KNOA 1AS7A 4P9ML 5KEZA 3KW7A 4LLUB 2HAZA 2IH3A 4Z18A 3ASOB 1L0QA 3POCA 3ULUD 1DBBL 5C0BE 4AQ8C 4N2NA 2XZQH 4WFFD 2B5IC 2D31A 4PSRA 4ZTEA 3TCLB 4KDTC 1XF4A 3SBWA 1A7NH 1O6SA 4JRFA 1CVSC 3KYKL 2VITB 2X1WL 4JG0L 1R5IB 2HKFL 2XQYG 1YO4A 4LEEA 1J5OL 5EIIA 3U6RA 4XMLH 1A4KA 4G1MA 1BQSA 3G6AA 3SKNB 1P6FA 3CSYB 1A7QL 3JV4A 3DO4A 4KRLB 4NO0B 3WXWH 43CAA 4ZFGL 3IPFA 4MD0A 3RWDB 3QDGD 5I5MA 2ZE0A 4A6YH 1I53A 3BT2H 2XWXA 4AMXA 3GTNA 3NK4A 1I1AC 1VJSA 4P57B 5IB5A 2JKWA 4JHAH 1EFXB 4PJ8B 2R2HA 1KTLB 2QTEA 4YSOA 3KVDD 4JZJA 2BNUA 3L2NA 5ESVB 4TVPD 4NZRL 2VDRB 1S5HB 2F2HA 2MPVA 1X9QA 3BPNC 1ECZA 3C60B 4WW1B 3QCVH 4KJQC 4WLCA 1AZRA 3DVNB 4KXZI 4UYPA 1A4AA 5DVMA 2BSDA 2OXGB 3EJCA 1WBYB 3S4SA 3V4VL 5ID0B 4UOW0 1WRFA 3QQXA 4N9GA 1FGNL 4JB9H 4PB9L 4K7PX 5I73C 4CMMB 1KOAA 4KODA 1NQBA 4WDIB 3VUAA 4O2EA 3ZT5A 3NFSL 2CJUL 4GKSA 4BE5A 3V10A 2BFVH 4RIRA 3VI3F 3ZXAC 2NUPA 1JK8B 1AKPA 4JGMA 4K15A 1XR9A 4HUWA 3JBG7 3BIKB 4LL4A 5I6NA 2DYPB 3NIDF 1NZRA 4L3EB 1HHHB 4NO5A 2CDEB 2ZYRA 1GTNA 4H13C 1QSED 1NWOA 2VITA 4IOFD 4BZ2H 1OK8A 2WO2B 3G04B 2H0PA 1AKJB 2Y1YA 1ET8A 2EC9U 2Q76A 2ZP8A 1P5VB 3QRGL 2B63A 3UGEA 4JPIB 5D1XD 5A2AA 4HUVB 4QHUA 3AMLA 2FEEL 4FE9A 1N3NA 3EYVB 3VFSA 3DX4A 3H9SA 3RP1A 3GSUB 4XXCA 4E42B 2W9EH 4MD4A 4PRPA 2GIMA 4B9KC 3B9KB 5DLLA 3L1FA 3RDTD 3QJVB 4ZW7A 3WTYA 2CO2A 1WA1X 2HT4C 3FDWA 3PV6B 1CDCA 3FU9A 4QI3A 1Z9SA 2H4EA 1CG9A 2QVKA 1UT2A 4X7TB 1BWMA 3GRWH 1BFTA 3EOTL 3EXLA 5K9JL 1JZ7A 2EXYC 2XYCA 3VDAA 2A0LC 3BH8A 1SM3H 2UUDH 4FJ6A 5MENB 4HT1L 3CH1B 1ZSHA 1E27A 1JPTH 3GMRA 1XSJA 3NTCH 1KBGL 5CFAA 3QCUL 2MOVA 4J1UA 5L8LB 1N6QH 1PZ5A 3OHXB 1JPSL 3TN0A 4F57H 2Q9OA 4HJGB 2B16A 2W0FA 1IV8A 3A24A 5CFHA 5IP4A 3FBKA 3FQRB 4XB3A 1XGRB 3QORC 4NQSB 1HCZA 3KPSB 3U4KA 2GQHA 4FN0A 4OZHA 5CKGA 1TENA 3H3PH 1B9KA 4F8NA 2X1XR 2X4TB 2P80D 2X3AA 5K1JA 2OSLA 4HWUA 3RTQA 5ETUB 2XKUA 3OVUB 5SWZE 2UXVA 1T0OA 4NQDE 2YSSB 1H0HA 1J1OH 2CPCA 2BVQB 5T5FA 1UD5A 3V0GA 1C8PA 2WLIB 3PAUA 1N0LB 4JKPH 3B56A 2XHNA 3BX7C 3DYMA 5EC2A 1MCFA 2O30A 3TP4A 4JCWA 4DHLA 2P26A 2PO6A 4IRSC 1SBSH 2VQ1A 3S5YA 3PV6A 3V5HA 3FKIA 2CPUA 4DTGH 1MWOA 3QO0A 2VYRE 2QPFA 5C09A 4JM4L 1KTRL 1U8CA 2DLHA 2BC4B 2CDFA 3HCVA 3MMEA 5DHYB 1JZ2A 4L23A 5GS1A 4E5XG 1K5WA 1OSPL 4PTUA 4WW2F 2BRRH 3B7SA 3SULA 4QGTA 5EZIH 1BQRA 4OZFH 3VXRD 5C3IA 12E8L 3VMNA 3V2AR 2EDXA 4NYLA 2DQ6A 5I0ZA 4F3FB 2OA9A 3VW3H 2YGNA 3U6XS 3GMRB 2WJ7A 3UJTH 3QUZA 2IFFL 2PW2A 1FORL 4JM2D 3DRQB 3Q3GB 1NANI 4PLJD 4LOEA 5E94B 2Q1EA 2ZXGA 5L2JA 3OKNA 3CLFH 3F58L 5EZOL 1IQWH 2DQJL 2Y36H 4PJAA 4Z7UB 4HWZA 1E4HA 1LO0H 4MWFA 3T2QA 4DT2A 3KPSA 3NCMA 1ZTXH 3TEXA 3KBPA 5ETUA 3MBWB 2CO6B 3EOYG 2W59A 4BH8A 2NMSA 1N26A 2ZSVA 1GOGA 2BVPB 2ICEB 5CJXA 4AG4L 2EH8H 3LQAC 3RVXC 2Y9RT 5JHLL 3HG1B 4HGMA 5JXEA 4Z3HA 1E9PA 3ZE0F 3RU8H 1Z6JT 3WKQA 3QJOA 1TTUA 4NNXB 3U9UB 5DYGA 4MJIE 4JDTH 3V5HB 1Z9PA 4M1DL 5DWUH 4ES9A 2Q7AA 2YGVA 1QBLL 2BCKA 3BPCB 2VWEE 1KENH 1IGCH 4X8XA 1QA9A 5I0VA 2P5PA 1I85C 4FXKC 4JY6B 4MNQE 3PJSB 4ODWB 1PZUB 5KS9B 2QSCH 4N8CH 3T0DA 4P5TD 3K46A 1TZOA 4QJ3B 3VWJB 1P6WA 5KS9F 2H9GA 4W9DC 3GTGA 2BSEA 1ED3A 1SJEB 2A4ZA 3DRQA 3Q3GA 2YSTA 2QEJA 3DI2B 5GS2D 4DP5X 4C4BA 1XH3B 3RKDC 3QFDA 5L2JB 3GPEA 5D7LD 3JV0A 1MJJB 4HWZB 4R0LB 1MG2C 1LE9A 2D7PA 4LVOC 1Q72H 4XAWH 1CL7H 3AY4A 1Z2KA 1SLXA 3SDXE 5A3IC 3CDCA 3MPCA 5CS7A 5H37G 3WIFB 4FQIH 1TQCC 1K85A 3FN0L 2KZKA 2D7TH 2NX5D 2YD9A 3LPPA 1DQIA 3MLTB 3LZLA 2Y5TB 4WFHD 1HNFA 1YG9A 2H26B 1EZUA 1S3RA 4B0MB 1RI8A 4HT1H 3ZVVA 4A38A 3MNVA 3EYOA 4XO5A 4NNXA 4O2FB 4NKOB 3IMWA 3WFCL 1UWXK 2OMZB 2B20A 1OSZA 4NIKB 4DGYL 4M3KB 2OR9L 1QSEB 1RPUA 4BQ8A 2F58L 5C0RL 1ZHKA 1OGPA 1IUZA 4PLOB 4Q7DA 2Y2WA 3QUMH 1R33A 1QLEB 3D2UA 2R27A 4BUHA 2GUOB 3KE0A 3MRNB 4LPUA 5J8OA 4JY6A 4Z7OF 2K8QA 2YAFA 3QZWA 4FULA 5CM1A 1TTGA 1F11B 4M02A 2YPVA 4ONGH 1ET7A 1I7TB 3D69B 5FYJL 5CP3A 3OL2A 5I74C 5D72L 4PY7A 3AU1A 4NHUA 4NPKA 1UH2A 3ZE2B 1VFAB 1GSMA 4U49A 5CBAA 3IDJA 4B5EA 5I6MA 4R0LA 4ZUWB 3BXNB 2O5XH 4D7ZB 3RY6C 1NLBH 3AY2A 3WN5B 5D7LE 1NUNB 1PKQA 4ELME 3KPRA 5DQJA 3HS9A 1YEKH 2CSPA 3MRGA 3OAZK 4LKCB 2Y5TA 3VRIB 1MCBA 4BHUI 3ETBJ 1JTTA 3DJZA 4H8VA 1MWAH 1SEQH 1CLVA 4KO5A 2MQ0A 2UY6B 1BIIB 4Q6IC 4Y2OB 3WYRA 4FQ1L 1AQHA 3ZTJH 2CO4A 5AQ0A 1TWFA 5TDNB 3I74A 3QDJD 5C0ND 5GGVY 3FPYA 1Q4NX 2HFEB 3B3IB 3ARDD 3EHBC 2OMNA 2ZUVA 4U1IA 3RVWC 5F9OH 3MLSH 4IS6A 3VSQA 5DJAB 1OSPH 4BFBD 2Z1PA 4ZFFB 1CWVA 2R4RH 3C60D 3JTBA 4HW6A 4N87A 3I2CL 4MQ7A 4FNLL 5T1KB 3RX9A 4KZEL 4WVRA 1M1XB 3PXJA 2N01B 5DRNB 3I9GL 5DUPH 5CILH 4FG4A 3P69A 4HQQH 2M8XA 3ELAT 4LVHB 4A2GA 5L9DH 1EO8H 2YEZA 1HHGB 1T22B 2FH6A 2WVTA 3QUGA 1JTOA 5IVXE 1HINL 4IOSA 2IANA 3WNNA 4DPRA 5F3BB 1U8OA 1MRFH 1K3IA 3SDXA 4M7KL 3EJSA 1FH5H 1HFUA 1K2DA 4HMDA 3U79A 2XV2A 3ABZA 1QEWB 3CNKA 4NKQB 4Z76A 3D4YA 5C3LD 5JOPD 3GLZA 7FABH 1XZWA 3RX7A 4LGRB 3AXIA 4P2RB 2NAPA 1DQTA 3WFDH 2VDLB 1M9WA 2G2RB 3II3A 3JT2A 4RNRB 3HKZA 3OMIB 3WE6B 4C4KO 2Z4QB 2XT1B 1S78D 3OLIA 3ZYIA 1N18A 3P0VL 4LO9A 4P4KB 2DM2A 2GABA 3NK3A 4EIGB 3X2OA 1HHJA 3DTUB 2HFEA 4HS3B 4RFOL 4AV5A 5DGQA 4MA8H 5AYTA 1WHPA 4PJGB 4L3FA 4AQZA 4PGCB 2Z93A 2DDQH 4Y4FD 3BUPA 1DQJB 5AVVB 4UQIM 1F6FB 4Q74A 4E5XA 1MY5A 5C07B 5ALCL 1MVUA 1OAUH 2DWEA 3F6LA 4UILH 2W9LA 5CU9A 2FR4B 3BAJA 3CFIC 1B4TA 4MJ6A 1J0YA 1TZAA 3FW6A 4R7DA 1NUDA 1OT2A 3B2PA 4LSSH 1BVKB 2BS9A 4HC1L 2EP6A 3ML1A 5DA0B 5D2NA 4AK1A 4O02L 4PJBE 3KZ8A 1TMQA 3J27A 3NUKA 4FXKA 4NOBA 2FEDD 1RHHB 1K3ZA 4JHWH 4XCCL 4WGKA 3SN6N 4HJTA 5T5FL 2YD6A 3DETD 2OYLA 3UTSE 1Q90A 1ZHLB 2DDQL 4AJ0A 2XQ0A 3BGMB 4NOHA 2BH0A 3P0YL 3H7LA 3LQAL 1AQKL 4N26A 4DN4H 3ABMB 3P4OA 4HMCA 1KJMB 1L9RA 3IR6A 4WNQB 4ZUUB 4EEEA 3FONA 4TUJB 2ZP9A 3HG5A 5FW8A 3H9HB 4HS3A 5E4EB 3MLWH 1BQHA 3C5SA 2BP0B 4ISVA 5CJXC 4X6DE 1I9RL 2BNRE 3S36L 3K72A 3OB0H 1GSKA 4NJAH 3E6FA 1DYZA 2GBTA 2MQCA 3NZ8A 2ZJSH 4R83A 1U8HA 1P1ZB 1HH9B 3GRBA 4QEGA 4XZUA 4P49A 4K8RC 2YGQA 4H44C 4CVXA 3ZKNC 3NJFA 4KKRA 4YHZL 4HLZG 2GT9B 4DKFH 1H8SA 1IGFL 2ZUUA 1OCRB 3WTVA 5F2FA 1TTCA 4L1LA 3WUWA 1FCGA 3V9EA 2EC8A 5E00A 5EBLA 5LDUA 3UG4A 5C0JA 2A9ML 5FTKA 2YAEA 3HU1A 1KLUA 3GINA 3K6DA 3FUEA 5I9QC 5IMMA 8FABB 3ISWA 4J3TA 4MA1B 4WTQA 5BW7A 4QTIL 4HSAC 5E5UB 1JGVH 4HALA 1YEEH 2JCWA 4WNJA 1E5CA 3DV4A 5C6PB 3INUL 2CJTA 2RH0A 4U33A 4KNSA 1RQ5A 4O4YH 1CTMA 2XZQL 2ZCKL 3O3AB 4JRYA 1EZSA 4PB0H 4WY7L 3QDGE 5ESQB 5JR1H 1T0PB 1EZLA 3BGMA 2A1WL 3OSKA 4XOBA 4WUKL 4XMZA 5IGXH 1IBFA 2AGJL 3LKPA 4PB0L 4FFVD 4FERA 7PCYA 2YXVA 1NCNA 3V0IA 1FVCB 1RZIA 2OL3L 1GCYA 3P0GB 5I1LA 4FYRA 3CFNA 1A2YB 4PRDB 4DN4L 4Y9GA 1TTFA 4KVPA 4DO5A 2XN2A 4ABWA 1SMDA 5LG6A 4KXAA 4PI0A 2R93A 3G7TA 3VI3A 5F8RC 3PPSA 1Y6KR 3EZ8A 4ZMYA 1QBML 3NRQA 1D6VH 5J6SA 3NABH 4WJ5B 2XKNB 2YA0A 3BP4A 2JIXD 2EC9T 3DRTA 3CZSA 2N3JA 5KANG 2XZCH 4MXQD 1OTUD 4OFYD 4PJHF 3LEYH 1JRHL 3H42L 2RFXB 3IDNB 1Z5LA 2WIIA 1DQDL 4C83B 1BCIA 4J3SA 4B9CA 4YS4A 1SJMA 4JFFA 4JREC 4ERSL 1SN5A 1DQVA 4P4KD 3VGAC 4BK5A 2X2IA 2HJKA 4E9RA 1ND0A 2NUTB 2XCMC 1O6TA 3WTSA 1J5CA 1JERA 5IR1B 3CZEA 4IGBA 1OAZH 3FCTB 4HXAH 3V6FB 4LNVA 2F8IA 3AADB 4J3OH 5GGQH 3KCPA 4RBPK 2FLRT 1XGPA 4X6DA 4YDJA 2A6DB 1Q0YH 2VDPH 2JFCA 4KI5E 1GAFH 4X4KA 4LLMB 1OALA 1HXMA 4P2OB 4MLSA 3NAAH 4X80L 5KZCB 3RB7A 3SQOH 2Q8BL 3GSWA 1EIBA 4KKPA 3ZBMA 3VXMA 5EEUA 3KWWB 2QDWA 4OUUB 2V37A 1ACXA 2P8LB 1JHKH 1UASA 3IDXH 4ZQKB 2NY2B 2YQBA 4N8VA 4M7LL 4YE0A 5JMRA 1HVXA 3ZO9A 2PYEA 1Q1PA 1NEZA 2IDSA 3ARGA 4ZZKA 1ZVSA 4DF9A 4F7PB 4W9HC 5E5RB 3C9NA 5IJKA 1YMMD 2AV7A 4Z7WE 4B27A 1AZZC 4RSVA 1BVZA 2XKNA 4KO9A 3HZKB 4LHUA 5GLXA 1IC7H 4ZMOA 1T04B 4PWFA 3Q8BA 2ZSWA 3O6LL 5C0CA 1E65A 5AVTB 1UURA 2GK2A 1FGVH 5BOPA 1G84A 4X7FC 4UT9H 4NFCA 4L4VB 4Y16A 3GHEH 1T20B 4D0CA 4DP6X 5AYQA 3U6RB 1S9YB 3N43F 4JFFB 5F9WB 5CEZE 4UOJA 4NWUH 1OANA 1TO4A 1M2VB 4ZI8A 2VJ8A 3JV5A 4DP2X 1WVZA 3TBYB 2ZX6A 2XXFA 5F7NC 4DH2A 1EHKB 1P7QB 1WWBX 3AABA 3E2HC 1HTYA 1THAA 4HZ1A 1RZKL 1TYJA 1N8ZA 5HDOA 4JDTL 3SQBA 2HWZH 3HLKA 3PWUA 3L4ZA 2NXZB 3OKKB 2CR0A 3BRFA 2NY4C 5HGGS 1H0DA 4LCWE 2R4SL 3LN4A 2AXWA 4KUCD 3QZNA 3OD3A 4ZD3H 1RIHL 1UKSA 2R0ZL 3EW3B 4KUZL 3SJVD 3ZL1A 5EV7A 3LAFA 7CGTA 1DSWA 1VSCA 3CHOA 2C3XA 1MFAL 4MS8D 5GRZA 3KH3A 5F97E 2VLLB 4UOZA 2FECL 4LLVA 4OCMC 5K93A 2JELL 3NDZE 3D0AA 4PJXB 2RTTA 3F7PC 5BZDB 2AJUL 5AFAA 1E5VA 1UZ6E 4GRMA 4JVWA 3MR9B 2QMJA 3IR7A 3IMUA 3L3OB 1AAJA 3KH4A 4ODSH 4DWHA 1RJYB 1YEKL 1EGJL 1UB6B 4D3CL 4FG2A 2DQTL 2R56H 3VFMB 5CLZA 1NPJA 2RQ8A 2XXMB 4EOWL 4XB7A 3HC2A 3U4BL 1BOYA 3HHSB 3L95A 2F5BL 2DF3A 2OCJA 2CUMA 1JUFB 4Z7VA 4XCEB 3QAZB 4ZUVA 4A7SA 2OXHB 1H8NA 4ODVH 2ED8A 2HWZL 2LFGA 3ATDA 3LKRB 3O9WA 4L2YA 4PJ5B 5E6ZA 3MNWA 3VGFA 1PU0A 3HS0A 4YGAB 4JQXA 4GMTL 1LMIA 2QMKA 1PEWA 2G0LA 3C6LA 3TJHC 1I8IA 4UINL 5H2BB 1OVZA 1WWWX 1E30A 5BZXA 2CALA 3B9KA 2GJ6B 4GQZA 1AOHA 3WS6A 4GIPD 5CWSA 3S37X 4KNQA 1K4CA 4KDVA 4HLJA 3TIDB 2X09A 4F24A 4NBZB 2JKTM 3LRSA 1DTUA 2X4UA 3BKYL 3KPMA 1CGUA 3WENA 4WWKA 2IWEA 4PRBA 1UOKA 4BZ1A 4Q97A 1YNLH 3MUGA 4GW1A 3KPLA 1MCKA 1CQKA 5F7AA 1JZ3A 2VR9A 1T6WA 5I1AB 2TSBA 5L2KD 5IEKA 2WWKT 1RV6X 1CD1B 3PHQB 4BFOA 4BFJA 4MMXC 5D4JA 5FF6A 3ZSSA 4IKNA 4OTXL 3C2AL 5E8NB 1X4YA 1UD4A 3KXFD 4KO7A 3PAZA 4I9WD 2Q10A 5CP7A 3G6JE 1FN4B 3OHXC 1RJYA 2DQUH 3MOBL 2AAAA 3VXMD 1TFHA 4BQCA 3DPBB 1ILUA 4R9HA 1WGOA 1YYLL 2QVFB 2DQIH 2ETWA 4TQEL 2GUYA 5F1KC 2ADJB 1L7IL 2YMOA 3ZE1E 1OLZA 2Y4SA 1OEZW 2E4FA 4RBPH 4XCEA 2GK0A 3O9WB 5ELIA 2E2HA 4KK5D 1F8TL 2D3LA 3HE6C 4PP2A 3FT4A 2YSSA 5C8JB 3RVVC 5KJ7E 1BYOA 4PRNA 3GO1L 3IFNL 4MX7B 3TF4A 1WEJL 4IRJA 5AW1B 2QGCA 5CGYD 5EG6C 2XPGA 2Z8SA 2ZYSA 3EUUA 3VJ6B 2GJ6A 1MAJA 1BXUA 1XMWA 3NCJH 3JWOC 3TJEL 4Z9KB 2V45A 5D1XC 5E4AA 4EZKA 2P8MA 1M71B 5AW3B 2F0CA 3VG9C 1TEYA 5ESVA 3GMQA 3K6SA 4QOKD 2X4UB 4PGEB 4RDQG 4HETA 5JHDE 4ORGB 4PRBB 1DMSA 4Z7IA 5IMLA 3MUGB 4GW1B 2FJSA 2DJMA 3CE1A 2HRPH 3HZ3A 4KAQL 2WXQA 3BDYH 4XWOD 4KI5F 5EO0A 1TEFA 4AIZB 4TSAL 3VXOB 1OTTD 2HLFD 3P02A 2NYAA 4CRYG 4Y4HB 4FFYA 2VN6A 2XNAA 3C75A 3CZJA 5EO1A 4BZYA 3QQDB 4AK2A 3MRCA 1SEBA 5ISZE 3I6KA 5I0YA 1JK8A 4L9LB 2YGOA 4BKTC 4XAKE 5LAXA 3W2DH 1F1AA 3FTSA 1AR1D 4JQIH 2NDFA 4NM4L 3WS6C 1NAKL 2IPKB 1Z3GH 4PG9B 4LLYB 4Z7WB 3U0TA 3RZCB 5D5ME 1AKJA 4U0QB 4MZ3A 1VKXA 1FL3A 3FU8A 3KNBB 1GGCH 4HUVA 4AX3A 4WWKC 1U8QB 4TULL 2VW4A 4YVNA 4IRJB 4KK9C 1ACZA 1GYCA 5DD0L 2GTWA 4LEBA 5EIIG