4JS7A

Crystal structure of d78n mutant apo form of clavibacter michiganensis expansin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords cellulose binding protein
publication title Crystal structure of wild type and d78n mutant Clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
total genus 43
structure length 202
sequence length 202
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4js7A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4js7A02
4JJOA 4FG2A 5H4UA 3X2MA 3X2JA 4FFTA 2HCZX 2PI8A 5GLYA 1WHPA 1WC2A 1HD5A 3X2IA 1N10A 1OA9A 2PNWA 2ENGA 3FT9A 2BH0A 2PICA 3X2KA 4ENGA 2JNZA 3SUJA 3FT1A 3X2NA 5GLXA 3D30A 3X2LA 3SUKA 2KQAA 2G5DA 4JP7A 3CZBA 3ENGA 4FERA 4JS7A 3M3GA 1BW3A 3X2OA 1L8FA 2GAEA 5GM9A 2AE0X 4JCWA 1WHOA 3SULA 4FG4A 1BMWA 3X2GA 3SUMA 4AVRA 4L48A 3X2HA 4JP6A 2G6GA 2VXQA 1BW4A 1OA7A 2PJJA 4ZM7A 3X2PA
chains in the Genus database with same CATH superfamily
1EK3A 4FKHA 4JFDD 1N70A 3KXFD 3QQ7A 3SQOL 4M5YH 1GZQB 4PS8A 1OTUC 4LLMA 4M62H 1IC5L 1LXMA 4JFEB 2CAKA 4MNQA 2V9TA 4QRFA 4AVKA 1EJFA 4AL8H 4K8RH 2NQDA 4S1DD 3UTTE 5EZJA 5LQBH 1NIDA 1KCBA 1KJ2H 4U6HB 1SOSA 2L4OA 4XPBL 5E2WL 4KJPC 1JZHA 1D5ZB 2AK4B 2AQTA 5K9KA 2D4FA 1GOGA 5EA0L 2WWMD 4FYQA 4LIQL 4HAKA 1ZANL 3MSPA 4J3TA 1PQZA 5JOEA 3JV4A 5I17B 2X1XR 3FSAA 3T2PA 1ZLVK 2WTOA 2EXTA 3LSOB 4LL4A 2CLVA 4QHUA 3ZBMA 2WMPA 5F1NB 2X87A 1ZTXE 3C75A 1W2KT 3D30A 1CIUA 3ATEA 4AEEA 3KL0A 4NZFA 1GAFL 1HQRA 7FABL 1FHNA 1TO5A 1YPZB 3K6FA 1J9TA 1UKQA 4OM1L 4KQ3L 4ONGH 4BGLA 3PP4H 1F02I 3GEWB 2R0WL 2E74C 2EILB 3EYQC 4PJIB 4N8PA 3RWCA 2SEBA 4OY9A 4ZSOB 1QQDA 1AZBA 3QORA 3ZTEA 5GS0D 2VXQH 3TWCL 2HTLD 3EBHA 4FTVE 1I9IL 2GQHA 3O41A 2C3WA 4N68A 1QWNA 2XZCH 3VXPB 4B50A 4NO2A 2NYAA 2P8MA 4O9HH 3DV6B 5J6SA 1UASA 4KY2A 4HIPA 5K69A 5AVSB 5F7FA 3V0IA 1K4CA 5DR5L 4AGNA 1M7IA 1JHKH 3D8MA 5TE7H 2B63A 1HVXA 4OLXL 4MYPA 4YLQT 3S88L 3L1FA 5EZLA 3HUJE 4LHJB 1QUNB 4BINA 3V5DA 1S8DB 1AO7E 3RGVD 4C47A 2OMTB 3PHAA 4GQZA 1M57B 5GGSB 4X6FB 4ISVB 1F45A 1OTSC 4YR6A 5EC1B 4AEHH 3SDXA 2IVFC 2F58H 5KSBE 3IDUA 4UQAA 1D5MB 1JGUH 1KT2A 3HZKB 4N6RA 3DRQB 3T3MF 3O6FD 3FRPB 3DX6A 1NGQH 1WT5A 2IFFH 3KCPA 4AZDA 3BPLB 1E5ZA 1ONQA 5AALA 1UXLA 1YMMB 1HT6A 2WBJA 3DSFL 4UUJB 1DEEB 5TE4H 4BZ2L 4JG5A 2E6QA 2F53D 2O5XH 4M1GH 2ZOKB 2EEOB 3NH7H 3HR6A 3CVIH 5DXWA 2F08A 2XN9A 3QORC 1F4YL 5A7BA 4P4RA 3KVQA 3V52L 2ORBH 4OFVA 4XCNA 3GTMA 1BG9A 1FFNB 1RK1B 4J23A 4R96B 1MN4A 4XPTH 4E9YA 1ZEAH 1P4IH 1J1PL 2X6MA 1IAKA 3DTUB 3HJEA 2G9HA 5HD8D 4AJYV 5EZPA 5CEZH 1QFUH 2QQLH 4RFOH 1OPGL 4ZW7A 3SD2A 1KYFA 3EJYD 3MA9H 3ZKXB 1BMWA 3HMXA 3QZWG 3VGEA 5BQ7A 1JV5B 4JMNA 4ZM7A 4L29A 4MJJA 1OSZA 2A74A 3VXTA 3CQQA 2UWEA 2PETA 4A2MA 1QNZH 4BFJA 4ONFL 1WAEA 2A4ZA 3IGAB 4N1CA 3ESPA 2JQMA 3MQIA 3ZDZE 2QADB 4N0UE 1EWHA 3ALXA 5TD4A 2NNXA 5D2LB 1ZV9A 4XMXA 1WT5C 2CR0A 5C6TH 4H26A 3ZRCC 4HUKB 2L04A 4ZO9A 1QPKA 3DO4A 2JI1A 1T1YA 1TT6A 1Z3GH 5BS0D 3OZKA 3NDZE 5FLUA 3WCYA 4PV8A 2ZE0A 3D0VA 2WBJC 3AREB 5HI3C 3ZO9A 3ZE0F 1JZ5A 5F7YC 4Y5YA 3CG8A 1LWRA 1D3CA 2WTRA 1EHLH 3CBRA 5DWUL 2IWKA 2ZWNA 4PMEA 3MNMA 5EO1A 4KUCF 4BDVB 3LZFL 4FP8H 1HJBC 4JLRA 4AJWA 1G7JB 2GG1A 3I6KA 1J8HB 4Y1AD 3LXAA 2P8PB 4HK3N 1CDBA 5JLZB 3D69B 5AD0B 4XN8A 5DEFB 3CQFA 5IQ7L 1XSKA 3MNVB 5I75B 4AQAB 4V2BA 2R93A 1KGYE 2Z8RA 3T4AA 5J11B 5CP7B 1RHHA 1B9KA 2WN2A 3PXLA 4JP6A 3TZVD 4JFEE 2GBTA 2UZXA 2A74C 3FQWB 3CFJB 3BISA 4ELMF 3OQ3B 2C7UA 1H3PH 1WA0X 1NGYA 4QYAA 3LNIA 5KYNA 5DYOA 5I1HH 3L17A 1XF4A 4U1HA 4YWGL 2ZXAA 2NDGA 3IDXL 2F7QA 1WPCA 3WAJA 3REWA 1O75A 5HY9B 5E0QA 2VAAB 3WNJA 2CGRH 4AWJC 3MRIA 3IMUA 1FZJB 3NIGF 4P5TB 4AIZA 3LV3A 2C1PA 3ATBA 3GXFA 5IMMB 1NCBL 3C6EA 5IFJA 1UYWH 1EJOH 4RISL 5K9OB 4FZEH 3MLUL 1IBHA 3MLVH 5EO0A 2LE9A 1AOHA 5AG8A 1J9CT 3ARTA 1YPZE 5ICXA 5L8KB 3WFZA 1CFBA 3U4EA 4UQ3B 3BGMB 3HS9A 4PJIE 1DVXA 2KLTA 1M71B 1JYNA 2R0KH 4QXVA 4RGMB 4IKNA 3C5JB 4L8CB 4PW3A 3L3OB 1A21A 3FOLB 3T4AC 1FNGA 1DFXA 4NUQA 3WO4C 1ZSDA 1V3LA 5I8EB 4G6MH 3HMXH 2OMWA 1ZAGA 4PY8J 5LBSL 4UBDD 2E27H 2XY2A 3B9VA 3OV6A 4AIOA 5HYFA 3EJQA 4GKOA 4JRXB 3TA4D 1P0SE 3MCLL 1OV8A 3QRLA 3BESR 3R0MA 4CVWA 2GEEA 2X7LA 5DJ0B 2B9AA 1NJ9A 4WZ9A 4GUQA 3B7SA 2NCEA 5JW4Q 4B6ZA 1CFVH 4E5XA 5TQ0H 2XG4B 1VEMA 3K71B 1KLUB 4HJ1A 4DIXA 2JMRA 2CDFA 2EDMA 3VWJA 1XF3B 3ZGIA 3GSQB 4J4PA 4OLUH 3LN5B 1HAUA 4XNZC 2ISDA 3PGCB 5H4UA 1BJ1H 3B7RL 4P2RB 2Z9TA 2YD8A 5AZEL 5F9JA 1M7UA 2WXOA 5AYUH 4HJGB 4F7CB 2OP4H 1SUHA 4JHZA 2CJSA 1YMME 4ODUB 5EV7A 4LEOB 5DD6B 5MENB 3GSUA 5F88A 3MRKA 3OJDB 3UBXA 4WHYG 2EDDA 4JN2B 5TPWL 3S8WA 4DERA 2YO3A 2AVFA 2BXYA 2H2PC 3O3AA 2EKSA 4UV4H 5E2TH 4MCZB 2GFBB 1AIFA 2BHUA 3GMOA 1F11A 3GBML 4HV8B 5D7IB 1N8ZA 2JIXB 4TUJA 5E6UB 3U2JA 1TLMA 3MV7D 5A7EA 1H15A 4JPWH 1JYXA 5AVTB 3AMLA 4I48B 5GPRA 4NRZB 4YDZA 1N3NB 5DHEA 3OF6A 1VFOA 1ZDQA 4JFQA 1MLBA 4P2CG 4HXBL 3K6NA 2ZIDA 3P11H 3UXFA 2ZCHL 3SCMA 3MGOB 5EU4B 5F7AA 2Y4SA 1CLZL 2IMNA 1F42A 3O3BA 3FTWA 1A7PH 4H20L 3VWJC 5JPNA 4X5LA 3DX0A 5KS9A 2D31A 4J4PC 5A16B 5TJWK 1E43A 3D2UB 5D7JD 1OARL 3B83A 1BGXH 5HYSB 1NOFA 1WA1X 5D2LE 2FH6A 4HC1A 4N20A 3EBGA 5T1MA 5MHSE 3U0PB 4NFCA 4WK4B 2ENGA 4O2EA 5M94B 4TN9A 2FGWL 2YD2A 1JZFA 5I19L 5SX4I 3PHSA 4QHPA 2YEZA 3SBPA 1PIGA 5MEOB 1YPZF 5EUOB 4K7PY 3BZ4B 5ANMA 5EFIA 2ZYIA 3D39B 4PJIF 5AWNL 5C0BB 2WUCH 1B2YA 2HJLA 1KCVL 3U6RB 1JCVA 4LPVA 1HIML 5FO8B 5BUAA 3OX8B 4B0MB 1IC7H 4MBRA 4P0DA 4DFIA 1UQSB 1UACH 3P4MA 4TQEL 2IDTA 2WZAA 3CBKB 3LB6C 2NXZB 3O2WL 4KKAD 4LK4A 4RLDA 4A1RA 4DP2X 4E41D 5KVFL 2BINA 3NFPB 2VLLB 3BEWB 1GPOH 4W9KC 1QO3B 1MXDA 3SPGA 5I6XC 4MMZB 3QIBD 2XWZA 1JHTA 3SCMC 3L3HA 4Y5XB 1A0QH 1E4WH 5HDBB 5I6MA 1G1CA 1V3MA 2HJFA 2GJ6A 2Z3FA 4G8AC 4M8QA 5GS1B 2G5RA 5DA4A 5JPNC 3VI3B 3QQ8A 3MCKB 4OCRL 5TK4A 4D2NA 3MRDB 1LEKA 3CD4A 1JTTA 4AENB 2D0GA 3TO4D 1K2DA 4R97B 1G9EA 5DFTA 2R0LL 2AV7B 4IOIA 1AFVH 5EF1A 3RY4A 4FYRA 2A5UA 3B9EA 4MWFA 4F58H 2JQAA 3CNKA 1BPVA 2IDQA 4N2GA 5GGQH 1MNNA 3L4YA 2ZP8A 5FUCE 4NZTH 2WXMA 5DRWB 1XZWA 2FEEL 2H8PB 4KJQD 4MJ5B 5CILH 5TDNB 5GS0L 2CUAA 1NCWH 2BVPB 2FNBA 4G8FA 4MNHA 3VH8B 3I3EA 1OOAA 3T0AA 3W57A 5IJVA 5J9PB 3UYPA 3UTOA 3FBQA 2DJUA 1TJIH 4Y9FA 5GZOA 5T1KD 4PCSA 1UM4L 4LZKA 4NWTL 1RU9L 3ENGA 4WY7H 5IVZB 4HQQH 4QOKD 2OQJB 1SJEB 3NABL 4LDLB 3V4VL 1L0QA 1TCRA 3QZMA 4UM8B 3UTZB 5F7DB 1E28B 1KG0B 1OSPH 3CVCA 1CURA 2CLRA 2PYED 5E6ID 3UJTH 4HKZB 1D7DA 4ZXBB 1QX1A 3KE0A 1FJ1B 4JQVA 5FGCB 3CDZB 5T3ZH 3L13A 5DLMH 1SFDA 2Y5TA 3KYKH 1OQOA 3WD5H 1UXWA 4HC1H 4N8CL 2PN5A 3HB3C 3FF7A 1F8TH 4F27A 5D2LF 1AGDB 2DIAA 3KYOA 1G7QA 1BJ8A 5C6PB 2VZUA 4AC4A 2J88L 5E2UL 1JMZA 2C9XA 2F61A 1GOHA 4R7LA 1QR1B 2VDOB 4BHUI 5E8PB 3EYVB 5CMAB 5HPMA 2ATKA 5SWQA 4FFVC 3QJVB 5F7MC 4C4KO 3VD1A 1I4FB 2VNCA 4MA7L 1N0XH 4MD4A 4JM0A 4R4BB 4UV7H 1SZNA 1AW8B 1WFTA 1I7UA 4ODHL 2P44B 4L1TA 4YDIH 4DPRA 2YD4A 3N6YA 4O00A 5E00B 3FTZA 4DVBA 4YEFA 2LLNA 3SUJA 3QCVL 1QVOA 4NKDA 15C8H 4OF6A 5GZOC 3MNWB 1TFPA 3QUKA 3KWWB 5L8JB 1G6RA 3S34L 4EZKA 2VLKA 3QJXA 4HU8A 3EFFB 3QEUB 4BSVA 3AAZA 1X5KA 2NX5A 2DIEA 2QSQA 5EZOH 1N5YL 4W9EC 5IMLA 3UTTD 4WFGD 1XGPA 2EXWD 4UM9D 3ZHKA 3F04A 1D9KA 4K3DH 2FAUA 1QNIA 1XFPA 4ZNCD 3GRWA 4LFHD 4G6AD 1W0WB 3E6HB 4JQVC 1QYGH 4FNSA 1IAMA 2Y6SC 1R0AL 4CSZA 3HG1A 1S9XB 3QZNA 3UAJA 5ID1B 1J05A 2A0LC 5DJ8B 2CHDA 3TYFA 3FB8B 1LO0H 3ABGA 1ED3A 2EDOA 2R4SL 3OGCB 3QB7C 4KUZL 5GRVL 3FQ2A 3GO1H 2BP3A 4U0RB 2EE6A 2QFRA 5EO9B 1PPYA 3P4NB 4TPRH 3RGHA 3DYMA 2DQHL 3D0AA 4KUCD 4J3XA 5C1MB 3HI1B 2ED9A 4RWHA 1YC8A 4XR8C 2W07B 3PPEA 2V37A 1L9MA 3OZ9L 2BVTA 3FU5A 3TV3L 3W38A 4Z95H 3OBAA 3LZNA 4Y4KB 4P07A 5BO1H 1U95A 4FTVD 5DTFA 2V7HB 5FWRA 2FLBT 4OAWB 5IFAL 2K4WA 3KPRB 4G8IA 2A6IA 4FADA 1PX3A 3BIKA 4JG1L 3FTUA 1KY7A 3HZYA 5D1QB 4X5WB 3RAJL 2X0UA 3K1DA 4HEPA 3QIUA 4KK9C 1MWAB 4E42A 2LR4A 4IYKA 1IM9A 4GMTL 1D9KC 5AB2A 4MVBD 5SWZA 3CFCH 1AMXA 2F74A 5IJCC 2F7RA 3I75B 3OKMB 5F21B 4KGJA 4Z7UA 1HD5A 1XIWD 1YEEH 1UA6H 5LDSA 5KJRL 1AO7D 4DP8X 3C8DA 1G7PA 1ROCA 3UAJC 4GKZA 2M83A 3UG3A 4KQ0A 3IDGB 5KANG 5ALCL 3X2LA 1ZPLA 3WFHB 1U8HB 1NDMA 3ATFA 3GMMB 2AJSH 3HPJB 3Q13A 5E6SB 3WEOA 3EDFA 4DEPB 3ET9F 2X4SB 3GKWH 1DBJL 5IFHH 4ZYKA 5F6IC 5JMRA 3EFOB 3IDMA 1INEH 1ECYA 1AZUA 4HJTA 2K3HA 1EEYA 1NEPA 4JO2H 2I26N 1I7TB 1EAOA 2PNDA 3VFUB 2H9GB 4MZ2A 1BZQK 1TPXB 2EIZA 1FNHA 2W59A 3RBGA 5EF3A 3T0DA 2R8SL 4KJWD 4XE5B 1R3LA 4LCUA 2WB7A 2P5EE 1GGIL 5KYYA 2B9BA 4KU1A 1NOAA 1Z2KA 5CHNB 4F7EA 4G6KH 5T5ID 4G9FA 2YJQA 3VXSA 32C2B 4LVHB 1G6RH 3P0GB 5CSZB 5JOPD 1IBZA 1QWUA 3QISA 1R47A 4QXGH 1S7XB 2ICES 2CH8A 3MRNB 5IESL 4KK5C 1QSEA 5D7IF 1MJ8H 1SEBB 1CS6A 1IC4H 1ZXQA 3CFIC 3W82A 4HFWB 4PRNB 1IQDB 4FCHA 3GRWH 4NKIH 2LAGB 1H19A 1L7TL 1LK2B 3GTJA 1F4XL 1FNSL 3HZMB 2ICEB 5FYLL 3Q8CA 1UZ8B 2MTPA 1CICC 4XC1L 5D93B 4UB0L 1JPST 3OR7B 3OWEA 2ZPKH 4M6AA 4XNQB 4ZS6C 1MI5B 2IV8A 1FVEB 4NNYB 4KH9A 5INDB 2ZCLL 1PCXA 2BIQA 2ZP0T 3L3IA 4LHUG 4M7JH 1GTFA 3D4GA 4DGIH 4N22A 4TOYH 1F18A 3HU1A 3EOAB 3JV6A 3IFPA 5HDWA 4HCIA 2D0FA 4GPVA 4AVJA 3G9AB 2NY5C 1RP9A 2OR9H 4XN1A 2XUWA 4XXDA 1CIDA 1NEUA 1I31A 4HCFA 4ZOBA 5IMOA 2Z8WC 4NUPA 4PJ5A 5EU6E 1CG9A 2W5PA 3CVHB 3Q8AA 3DPBA 4Q0XH 1PDKA 3DTXB 1PZ5B 2OTWB 4ZPTA 5E94B 4PSRA 1J12A 2WVUA 3OMAB 1CE6A 1UXSA 5EUOF 3RDTA 5E5LA 5I0XA 1A7QL 1LO5A 5B38G 3ARVA 3ES6B 3V4UH 4BFBD 1V8HA 2FSEA 5I18H 4AK1A 1Q38A 1AXIB 1V55B 3BN3B 1U6AH 2ARJQ 1B3IA 3QJTB 4XB8A 3PGDA 4PCTA 4WV1B 4JFED 2J43A 3A67L 1PSKH 1NGXA 4OFYA 2VN7A 2VZOA 4BFOA 2IAMA 3D3VA 5FKPB 1NC4A 5IG7B 3MJ7B 1BIIA 5LN8A 3LZPA 2XXCB 2KLSA 5JO5A 1SYSB 4E9TA 2AK4D 5HHXH 4DETA 1B4RA 2K8QA 5HDBF 3HRZB 4EI5A 1SMAA 2J1WA 3UBFA 4D8PB 2C7FA 3CFDB 1JV2B 2BP5M 5IEKA 3BP6A 1DBKL 2X09A 4RGNC 3VFWB 2OTUB 1UM5H 4M48L 2JJTA 1KCRH 4PM1A 5DUMH 1KPUB 2BFGA 2NY5H 4Z7VA 2XWTA 4G6FB 3SE8L 3OKLB 2J8UA 4NQXA 4AZ8A 2WVVA 5KSAD 1V7NL 4LL9A 2XWBB 4AT6B 1FYTA 2Y69B 4PB9L 2H1PH 3RL1A 1JXDA 2NTFA 1HEHC 3MGTB 3SPCA 1NEZB 3EJPA 1M1XB 3RDTC 4B9CA 3DYOA 4WCYH 2OCCB 1X5XA 4L2LA 4U33A 3SYCA 5I5JA 1TO4A 1WAAA 3BRGC 1MJJB 4L1HA 3B3IB 5C0CB 2V2TA 1SJMA 1SJXA 1KIQB 2DN7A 4YHOH 2AJYL 2AXWA 3KPRE 3UPRA 3MBWA 4PJAA 1A6TA 2YPLA 43CAB 2IAMC 5IT2L 3IDJB 3W56A 1LO3L 5DUBA 2X6UA 3QXAB 2XG5A 1L6ZA 4JY4A 2BY0A 4P49A 4EI5C 5F0MB 2Q7NA 1LWHA 3DSNB 3TBBA 4JCWA 3FKIA 4XNMB 5LGHH 3MRMA 1E0OB 4UILL 3LQAL 1KIRB 4XMZA 4FMVA 4ANVA 4HS8H 2FATL 5GIRA 1AR2A 3B34A 1R5VA 3NA9L 3O8XA 3NT0A 4QEGA 4P57B 5CD5D 5C0RL 1KELL 5ESVB 1L5GA 2Y7QA 4FQJL 5BJTA 3H7BA 4KOBA 2ZUSA 1LD9B 4UIKH 5FYKE 4YO0A 1YMMD 3S8GB 3GJFA 1KTKE 5EBGA 1T5WB 3HFMH 2DMGA 2MHAB 1NCNA 4IMKA 1G87A 2BSSB 4P9MH 3WXVL 3WYRA 2YAFA 3EYOA 3AGWA 1HINL 2VUOA 3NIDB 4GBXB 1FV1A 3JWOL 4JO3H 3EKCA 1YEFL 2JK5B 1YECL 1E2WA 1B9ZA 2O1AA 3B5HA 1SGKA 1EGJA 3KW8A 3TNMB 3DBSA 4PP1D 2MKLC 1YUHA 2F7OA 2NZ9D 4DO5A 4H0IA 2WIIB 1G8KA 1JSYA 3AXIA 4TRPL 2Q7YB 4D9RE 4X42A 3SEPA 2UXGA 4PVNA 1TU2B 4Q58C 3WEXA 2EVHA 4GW4A 1Y18A 2PWDA 4LPTA 4QHMA 1YJDH 4XX1G 5DZAA 2E46A 5MEQA 4YNYB 4Z7WB 1JWSB 3LMJL 1CT8A 3ARDC 4A37A 3V2AR 4J6RL 5JHDB 3NZ8B 3WFCH 4JL1A 4XH2B 3EW3B 2BS8A 4JANB 1EPFA 3GMLA 3AXHA 4R26H 3O9WD 4AGOA 1MI5E 3Q2WA 2N4IA 4QTFA 3DO7A 3VGFA 2QADD 3O8XC 2WYZA 5DZJA 1AQDA 1ADWA 1KIUA 1D5IH 5MHSD 2KC0A 2OBGA 3U30B 1OHQA 4R4NC 5A2AA 4F15B 1KGWA 3TIEA 4DVRH 4BRVA 3HRPA 4IRZL 1IM3B 2EXYC 3RWGB 1FH5L 4NJAL 4AVHA 2X2UA 4NC1E 3I9PA 3DBXB 4R9HA 1L9RA 2G2RA 4IMKC 2VL5A 3FCUB 1ZE3C 3VTMA 3FZUC 3MRBA 1ZDSA 5I73B 1JPGB 3FBKA 3A24A 5EOQH 1SJHB 2FLMA 5J5EA 4YHNB 4RA3A 3N55A 4J8QA 4IBVA 3FCTB 1J8HD 4P3DB 1KJ2B 5EORL 2YD0A 3G6AA 3OVUB 3L3DB 5D72H 5IB2B 2CBMA 5K59E 4YSQA 3X11B 1N4XL 2EO1A 3DGGB 2E9WA 1KBKA 5GSVA 3QDGA 3BSZA 4TULL 1A14H 1XF5A 1YN6A 4XOAA 5C07A 2X12A 4DP0X 4LASL 2IWGA 4WFHE 4DP9X 1FE8H 3D05A 4JB9H 3EJZD 4ODVH 3NTCH 4P23C 4PTTA 4TLUA 1U8OA 1BX2B 5I1LB 3S36X 3BH8B 2C9AA 2VLRA 5CEZD 2OTPA 1YEDB 2TSAA 4DCQB 2HVKA 5DUPL 2Y06L 3VXUE 4OLVL 2C9RA 2FJHB 2X88A 2KH2B 3B2VL 5ERWA 3WMQA 1OAUL 4MJ2A 1BBJA 1EHNA 3GJFH 4P5TD 5GJTL 3G5ZB 3CZLA 4MS8D 3GXMA 2Z65C 5E8DH 2OJZL 1MLCA 5EBLA 1PD1A 1ZE3H 1VENA 4AGMA 2AP2A 3LEXB 5GS2H 4XMKL 4Y19A 4YDKH 1EGJH 1J8KA 1YA5A 2CK2A 5DA0B 1EEUA 3IU4H 4OM0L 1VFMA 3O3DB 1A3LH 2VH5H 2Y5EA 4W68A 4OIAA 3ZHFA 4OZIA 4JFWA 3RX7A 2P80D 3QEQA 5AW7B 3IF1B 3O2DA 4JZJB 3ME0B 2GCYB 3MA7B 1OCWL 1HOCA 3A23A 2V17L 3IPBA 4OF3A 5DMJB 3CC5A 1K5NB 1TJGL 5I6PA 4F33A 3BE1H 4UTAA 3WEAA 2DWTA 5DJAA 4O5LL 4JAMA 1J8SA 2HT3C 4JRXD 2J4WL 4PIRF 4X6DA 4ENEC 2G2NA 1O5DT 2A83A 4F24A 2Z7YA 2GTZA 2BS9A 4BKLB 4U1SA 5C6WH 3HHRB 5HHNB 4TLSA 3TT1L 1M6OA 5FM4A 1T89A 4MAUL 1IKFH 2YC1B 1PX4A 4H1LB 4MDIA 1BEYH 4O2CA 1Z9MA 4GO9A 3AQDA 2YQGA 4U0QB 4QY8A 4DKTA 2WPGA 5DJ6A 3BQVA 3RVVD 2A77H 3WEBA 3HVNA 3MLXH 4JFPA 3TEZA 4HJJL 1A25A 4P2RD 3U4KA 2HFEA 3WFBL 4FN0A 4LOEA 5JZ7D 1LJMA 1KB5B 1YEHL 3LYRA 2D7PA 1FZMB 5C0GB 4WSKA 1EXUA 1WBYA 1P4BH 4OJFL 5HGHB 4GQRA 1PZ2A 1UD4A 4P3CL 1WTLA 4PGEA 4HBCL 4NRYB 2BZ7A 2LABA 1YEIH 1HHJA 3WOVA 1JPFA 1J0ZA 5HJGA 2BVOA 3NIDE 2OW7A 3KWVA 1OAQL 1HWWA 1SFHA 2WHVA 1AJ7L 5HYJA 5IR1A 1PLAA 2JIXD 4J3OG 4OUUA 2K70A 4I0PA 5I8CA 1MHEA 3BSZH 3INOA 4JFYB 3EGDA 2CLVB 2VDQB 1RZFH 2WCSA 3FQ4A 4OCWH 3T5WA 1M05A 2F18A 3ZUNC 2LLGA 3FU6A 3VXME 4EI6A 2R92A 4Z7WE 3GUTA 2OX5B 1HSBA 3K4AA 3WS6A 3IRCA 2FBJH 3PHOA 4N2BA 5J3HC 3HC2A 1IGJA 1RKRA 5JHDE 1NKOA 1T89C 4PBDA 3QPQD 1XF1A 4F2EA 4JRYE 1TJMA 3AFLA 4DN3H 5I82A 3D6GA 4J2QA 4OCYH 2EEDA 4R7VA 2IPUK 3D2UD 5KVDH 2W0KA 5EG6C 2EE3A 1WC2A 3LS5H 4A7TA 1OAYL 3E2HB 2VWEE 4X83A 3SPVB 3UJJL 2MSPA 2QVTA 1A9BA 4XN5A 1SHWA 1USZA 3FFDA 2X6BA 2DM4A 2E0PA 4K94L 3KPQA 2YEVB 2YD7A 5D6CB 1T1WA 1GJUA 4QJ3B 2YRPA 4MGXA 1VFBB 3VMPA 4YBQC 1TSRA 4J27A 4PPTA 4OH2A 3MLZL 1DBML 3LZLA 1NQBA 2VQ1B 4DKAA 3K4DA 4AZUA 3MMEA 3O2DH 5C0BD 1JDAA 2YPVL 2N0MA 4CW1B 2XSKA 3CDGB 4XI5C 1FNEA 4L18A 4QRTB 4YDNA 1VB9A 1MFDL 4JZOB 2YUVA 5A43C 4UTAH 1PBYA 2PTTA 1U8KB 1LE9A 3FT9A 3WKPA 2FJFA 2LVCA 2NXZD 1ZWIA 3B2PA 3ZMNA 4F20A 2WGNB 4U1JA 1A4JA 2HTKC 1XH1A 2IDCA 4QRQA 3WS6C 5F7KC 1NBVL 5JORB 2IDSA 2PR9A 2H45A 4IDJH 2F19L 4KZ0A 4J3VA 3OG6B 3EJJX 2DYPA 3PIQA 1I9RH 1EV2E 1KN4H 4FL4B 1IGYB 3OAWA 2OK0L 2HN7A 4NHUA 1NC2A 1EO8L 1IRAY 2ITCA 5E8EA 4DHLA 5IB3A 1R3JA 2BFVH 1JWUB 4NQEB 2IO5A 3IXTA 1NANI 3B2MA 5D70H 5F7HA 1NAMA 2R0ZL 1TQCB 2PICA 4KI5F 3PCYA 3ZTNH 3GSOB 1ND0A 3LPPA 1IAKB 2HT4C 2ZUVA 3RTQA 4ZO8A 3CLFH 4HWZB 2AEPH 3HE6B 1X44A 1QSVA 2P5ED 2ERJB 2YUWA 3CQZA 4GKLA 1LEGB 2X05A 4LQFL 3VSTA 3L16A 4YHKH 4NAQA 1BG1A 1CZ8H 2UWEB 3NIDF 2DMKA 1DQDL 4MXWH 4Y4FB 4EDWH 1FIGL 3BVXA 4WW2B 2G4GA 2W80C 4B41A 5I6KA 2EIJB 4LAJH 2F5BH 2JFCA 4H26B 4AOFA 2J1YA 2HG5B 4BH8A 3SDAB 1OGTB 2A73B 3HZVA 4PGBB 3ZUCA 2BDNL 3ULUC 2I25N 2VM4A 4CDHA 5GGVL 3TN0A 4MLSA 4Z7WF 4I3RH 3MOBH 5I74C 3QCTH 4Y5YB 1M2VB 5EULV 4ABUA 4L2YA 3K7UA 2EDYA 2JA6A 1HHIB 4XBGA 3IETA 4MMXB 1I3VA 3MRPA 3TESA 2ZWKA 3KDMA 1VZHA 4ZXBD 2OSYA 4HXAL 1XGYH 5FV1L 3SODB 3VFMA 1DCEA 1I8MA 2RB8A 2CO6A 2FECI 3PGFH 5LNEA 1HQ4A 1GW6A 2EDBA 4Z3IA 1AXTL 4NQQA 1A7RL 1EUUA 4GRWB 3O4LB 4XPGH 3ETBJ 3GJEB 3ILDA 2Z1PA 3MV9B 2Z31B 3RTQC 3RFZB 4ZTOH 2P48B 4YFLF 5CF3A 5F9WC 1N5AA 4EN3A 1BYPA 1RQ5A 4PJGA 1UZ6E 3AU1A 4M7KL 4FHJA 3UJIH 1A64A 4MNQE 4OIFA 3DROA 2VXUL 4NQVB 4LSQH 3MRQA 4IS6B 4F7TA 1NA8A 3HFFA 3TVMB 1QPPA 4Z3FA 4Z7NE 2JA5A 4V33A 3TJPA 4IHOA 3ZW3A 3CXDL 1OALA 3AJ7A 5EU5A 3NA4A 1MFEL 3HC4H 5DYOB 4YMPA 3MUGB 4JHAH 4NO3B 5I1CH 3LN4A 3L9EA 2UUDK 1NANH 4WWNA 5IKCA 2QEJA 3QJZA 3MUJA 3J07A 4L4VB 3DVGA 3TN0C 3BGAA 3VG0L 3ULUH 4IBSA 2YXFA 5D4HA 1VGEL 5AVZB 5DK3A 1VJSA 4F57L 4DMRA 3VXQB 1S5IH 1C5BL 2CIKA 3SKJH 1MCJA 4NKOA 1ACZA 4PGDB 1FLRL 3PAVA 4LKCB 1S7UA 5EO0B 2PPCA 4B96A 4PYGA 2O26U 5ICXB 1CE1L 1LMIA 5EOTB 2A6ED 1NAMH 1PT1A 4H25B 2NY0C 4MA3A 5JW5A 4KKNA 1VA9A 5DD3L 2ZX8A 4LLWA 4EN3C 1I1AA 4HPYL 4KK8C 3NFSH 3SSGA 2X9ZA 5HHQA 4IOSD 4AONB 4EUPG 4XPHL 5DZ9A 5ETUA 4ZX3A 1J5OH 4KMTL 3GHPA 3BVNA 5B39G 5I9QC 4BK8A 3KYAA 4GW1A 4NBYB 4H0HB 1BVLB 2CDEA 5F7NC 3EOBB 1WGVA 3P9LB 1BWWA 3JWDH 2XWEA 3CDYA 4YX2L 4Y4KD 3D9AH 4FXKB 2EDKA 4DP7X 4NLHA 1BVNP 4HCGA 3KPRD 2UZIL 1C16B 1E8WA 3KWTA 1P7KA 5D1QD 3VA6A 5J6HB 4PI2A 3SDXE 3DUUA 5KBKA 3IGUA 1CGXA 3RLSA 3VWKC 3QS2A 3MOAL 2V4LA 2P24B 5AOKA 1R3KB 4Y16B 5K5YA 1CGWA 1S5HA 3C9NB 2G5BA 1DFBL 4XPFH 4AQ1A 4YQXH 2B2XH 4OR1A 1GY1A 5CGYD 1BZ9A 1U8QB 3LD8B 3ROLB 3BW9A 3GSUB 4OGAC 4HPOH 2WSKA 1WJ3A 2OMUB 5CZKA 3UBXB 1A6UH 1QBMH 4HH9A 4OCSL 5KTEH 5IWLA 2W0PA 2ZKMX 3H6JA 2XN9E 4OGQC 1I1AC 2HWZL 4ZTPH 4NQEE 1MAMH 4TUJB 1RJLB 5FYKD 4F8NA 2DQCH 3O6LH 4G8GB 1IGML 5GZND 4PJFA 1ZHLB 4X5XA 4KV5E 2ROYA 1RPKA 3WV0A 1BD2B 4XAWH 3QFJA 4JFQB 3ATDA 4K5LA 5E51A 2APVA 2IPKA 3SBWA 5IW6A 1KJMB 1QTYT 1S7RA 1AZNA 1WZ1L 4W9CC 1AQKH 2MPVA 4D9RD 2UWEE 2VXSH 2FT6A 3ECUA 1MCPH 1MRCH 1YEGH 2BZDA 2KUTA 1ZT7A 2D31B 1RP8A 5FCUH 3A3YB 3W39A 5JNYA 4RMVA 4P46B 2IDUA 1AKJA 3RZCB 1ZK5A 3IN2A 5CD3B 3EF4A 3M7OA 4U6VH 1F13A 4AEFA 1LDPL 3U83A 4AQ1C 4WAFA 4KQ4L 1Q4NX 2CU9A 3W0WB 1MCHA 4ZD3H 1GYAA 1ORQB 4AQEB 3RVTD 2AITA 4JVUA 5DQDL 1HHKB 1EUTA 1MI5D 2JKRM 4KZCA 5C0AB 4HIIB 3ZDXB 5CS7A 5IWLC 4A6YB 1Y7VA 1NINA 3MBEA 3N40F 3U1SL 5J56B 2AC0A 3B4NA 3WY2A 2XTLA 5FHBL 3G6JA 4P99A 3KHOA 3PPSA 4HBQA 4QTHB 3UZVB 5E08L 3IVKA 1BECA 1F3DH 1F4HA 1XGZA 4RH4A 2MNJB 2AJ3A 4ODXB 5C0IB 1K8IB 5JR1H 7PCYA 2PCPB 2OYLA 4C59B 2K4AA 1G1OA 3QWRD 3DMMD 2VE6A 1PEWA 3QA3A 1FGVL 3SBWC 2Q9OA 5BV7H 1R5WB 2RAMA 1XGRA 4HCRL 3IJHB 1AQ8A 5C0JA 1YSOA 1JHTB 4GRLA 4X6EA 3OZLA 3SULA 5JXAL 1CJYA 2HJFB 4LB8A 4WUUA 5HHPB 3VD2A 3HBQA 1RMFL 2F1EA 2EUVA 1G6VK 1WFJA 2ENJA 2EABA 3BZFA 2FQFA 1UCBL 3V6BR 1ASOA 3C5XA 3AQZA 5EHFA 4YIQB 2QQKL 1JDDA 3QO1A 3A6BH 1B4JL 4OVVA 2NR6D 3RB7A 1A4KA 4P2QB 3RNQB 2O61B 4PJXA 4WFHD 4MJIB 4MWFB 4HHAA 3CFUA 4FFZL 2KERA 3L7FA 4XCFL 1QBAA 2HVJA 2BO0A 4OKVA 4IK7A 1H6UA 4P2YA 1A9EB 1ZLDA 2NTSP 1RZ8A 4NGHH 4NQUA 3VXUD 3MRRA 2VITB 5A2CA 2AVGA 3OD3A 2XXMB 1ZGLA 4L05A 1FPTH 2X42A 2P52A 2IV9A 2BSBA 3KNBA 2XVGA 4O02A 2R1YB 3WLWC 3LRGA 3MR9A 3WBDA 4LGSB 4G6FD 4HIQA 5E5UB 4WU5B 1FN4A 3LIUA 1DLHB 1AC6A 3AWGA 4I18A 4N28A 3K2MC 5A2KH 3IFOA 4UDUB 1TCRB 3BHBB 1T2XA 4GRLC 4XBEH 2EUZA 3G5YA 4OI7A 3UO1H 1QI4A 3T8XA 2UWEF 4YSTA 3GPEA 2WNWA 5C0CD 4WW2F 4WNQB 4F7MB 4KNSA 4JN1L 3IMTA 1UXWB 3MJ9L 1RZ7H 1E4XI 4XMUA 1KZQA 4F93B 1G7IB 2ADIA 1SY6L 2AEOA 2QMJA 4BK4A 1GA2A 2AJXH 4EZJA 1E9OA 1L6XA 2V5YA 4FKEA 3T1FB 5HPMB 3V5KB 2ATKB 2FHCA 5SWQB 3WTVA 2NYYC 3Q1SH 5GISH 4ACTA 2V2WA 2CRZA 4OV5A 1ETB1 4MS6A 1WHPA 4LLVB 3W9DA 2C8NA 4R5TA 1TMCB 2E3VA 5IW1A 3A6CL 3L6FA 5CCKL 2WO2B 3NGBC 5EZIL 2BPBA 4TVUA 1CDGA 4ODWA 1WRFA 2MRYA 2V33A 4GRWF 5EOCL 5IHUL 1G6RB 4I18C 4CVUA 3PE9A 1PZUB 2VW6A 5F0LB 3VGAB 1S3KL 1AHWA 2OJEA 5ACZA 4G8EA 2QL1A 4LARH 1XGPB 2Y7SA 1OM3L 2VZ1A 3QAZB 1KZYA 2XQBL 5DJYA 2I9TB 4LEXH 3BAXA 1BD2E 4FNLH 2FEJA 1JF1B 1FZOA 3FQXA 4M7LT 4V1DB 4W9GC 4NDMA 1F3JA 3K8KA 5IUSA 4L1DA 5KYWB 1J05B 3QDJB 4NBZB 3TYFB 3KAAA 4DAGL 4PJBA 1DVTA 5KYUA 5HBBA 3CLEH 3FHAA 4NN5C 5KS9E 1NFKA 2JELL 1KXTA 2YSTA 3ULSA 3VXMD 5T3ZE 1W72A 3JUYA 5F6IB 3QUYA 2BSCA 4UT9L 1D5XA 1ZVSB 4PLJD 3QQDB 5DHMC 2XFXA 4M8VA 3DOSA 5JHDD 5CJ8A 3MJ6A 2LW3A 1OW0A 4BCYA 4HU2A 4ZFGL 5HJ3A 2ZD0A 2D3VA 3PDOB 1T22B 2AHIA 4B97A 1H0DA 1BMZA 2R51A 5I71B 1JUFA 1R4XA 2NZIA 4KDTC 5ANME 2VIRB 4OT1L 1MCCA 1E30A 4D7PA 4JP7A 4ES8A 4O02H 4NNPL 4MQ7A 5B7EA 4AYGA 1QEXA 2VDOL 1A3QA 3QIUB 1AHWC 3TH2T 4M43L 2H6UA 1ZLSL 3FSWA 3BKJH 1IM3D 4KHXL 3TPKA 3OAUL 5J06A 1SM3L 5ELIA 3PP3K 3GSWB 3LXUX 3PFUA 4KKLD 1PG7L 1DN0A 1ZLWH 3T0VA 1EEQA 3T77A 5AW2B 4Z78A 4K8RD 1LE5A 2KBGA 4NUGL 3NJLA 4DGVL 2FQGA 3KLSA 3ABKB 2GJ6E 4HOZA 1Q90A 4K7PL 4IRJA 1JZJA 4TQPA 3L1EA 4N5ED 1LK3H 4M9PA 4OUOA 4Z7QB 1GRWA 1PFCA 2ADJB 3M17B 2CJUL 1IL1A 1YNLH 2MWCA 5D2NB 3QUYC 3JTTA 4AEIL 3D48R 4NAMA 5D96B 2HKFH 3EDKA 4PJHA 3WS3A 2Z91A 5FHAL 3M1BA 1OW0C 1U41A 3H42L 1INDL 1QSFB 3L3KA 4MJIE 1E9PA 5BW7A 3FCSB 3L8QA 2R29A 3LKPA 5KG9A 2F8IA 4LU5H 1U3HA 3ARSA 2UV3A 3DC0A 4LCUB 4BEIA 2R2CA 1U8IA 3T4YA 2DLIA 3ZR5A 4F7EB 1RFDL 1TQTA 2J8HA 1AS8A 3WGVB 3ARFA 3U1PA 3ULVC 1LMKA 1P5VA 4A39A 4W9HC 3J8F7 5DI8A 5DZNA 4LCIL 2CHNA 4G83A 3MN8A 1YN7A 1O6SB 1ZRUA 4BFIA 5EEVA 4BFEA 4XN4A 1I3GH 2Y7NA 2H0EA 1OTUD 3RX8A 1JHLH 1JPSH 3VXRB 5E4EB 4PJ8A 4KZEH 5BUGA 5ENWA 5JW4M 1BFOA 5C0FA 3VQLA 3VDCA 1X5FA 5JHLL 2P7TB 1LQSR 4C4UA 3EH5B 3STZA 3LQMA 4LKXB 1HWGB 4ATWA 4FQLH 4KJPD 4IRJC 3CIAA 4MAZA 3L3IB 1YO4A 1FVDB 2A6JA 1MWAL 2P8LB 5FV2A 2WWNA 1E27A 2YIHA 3BT2H 2B1AH 1W72H 1YC7A 4EMZA 1DQML 1SXCA 5LWYL 4LLDA 3FT3A 4WWKA 5E8NB 4HKBB 5AVUB 4OLYL 3BP5B 1NCGA 1FZKA 3BP7A 1BXVA 5F0JB 3I85A 1PY9A 1L3NA 2DYRB 2J55A 2HLFD 3MCYA 1B0RB 4LOFA 4XXDB 1MVFA 4XBMA 2BOCB 4B7LA 2ZF8A 5BW7C 5IMOB 5K9QI 1U3HC 4I77H 2P5WA 1DANU 1IFRA 1CG9B 3C6LA 1NFDA 4M4RA 1YEJH 4NOHA 4DO6A 1QRKA 4IOFC 5CWSB 3ARFC 3LEVL 3EAKA 2VDNH 3P73A 3LH9A 4GO6B 3ZDXF 1CE6B 4POZD 2OMXB 4Z0BL 3L95B 3V0HA 3H1ZA 2BNUA 3EYQD 5F0PB 3S7GA 2A6KA 3FPYA 4RMRA 5FYKL 3K6OA 2XLLA 1JGLH 5T5FL 4EXKA 4PGZA 2EE2A 1MCQA 1Z0NA 3SYQA 2OW6A 1JF5A 3IDIA 3MTRA 1OSYA 4WU7B 3SQBA 5HVHB 1DZBA 2P4AB 2BWDA 4AH2B 3P9MA 2B1HL 4PJ8C 2VLKE 5MEPB 4AIEA 4Z6AT 1MCOL 1A6AA 4K23L 3WELA 2NX5E 2NY7L 1MDTA 2JI2A 4U1IA 2QHLA 2O30A 2ZNWA 2X28A 4WEEA 3B6SB 4HWEL 1BIIB 1JZIA 1CDUA 1T4KB 1FGNL 1J0IA 4LNVA 4HIXH 1H5NA 4O4YH 1EJ6A 1HEZA 5DJ2B 4ZI8A 3UBGA 1T7VA 4O58H 3HS0B 3QRFM 1S7QB 1F4AA 3APMA 1OTSD 3D7PA 2AJZA 2D03L 3FSOA 3LX9A 3SBQA 5GJSL 1EHAA 3SDDB 1OSEA 2L3BA 2OR8A 5K1JA 5T3XH 3GM8A 3S3DB 2WINB 1WGOA 3L5XL 4QD2E 1MKFA 3HE7A 2R29H 2HZHA 1DO6A 3C6LC 5C7ZA 2HMIC 4KZDH 4AZ8B 4HT1H 2AZUA 2Q1EA 5F2FA 4CBPA 5I1AB 4I3GA 4PBXA 3UPAA 5IM7A 5IV2A 2WUBH 2GHWB 3GXTA 2CJ3A 4ZUTB 4U3CA 1QLEB 2CPCA 1RZKC 4GQQA 3GK8L 4BH7B 5FAAA 4D0BB 4AV4A 3QGVA 4PREB 3X13B 1FDLH 3UDWA 1T21A 5G4OA 1ACYH 2A6DB 2AGJL 2AJVL 2DI9A 3FT2A 3KYNA 5HGAB 3K5SA 3RY6A 3VNZA 2FUQA 3WLBA 4ETYA 5KBLA 3I02A 4KKPA 2I85A 2NY4C 4PRIA 3HG2A 4X5QA 3QQ4A 5T8IA 3WTXA 3NSJA 3UIYA 1WD9A 2ZUXA 6FABH 4TTGA 3PQYB 1A6TB 3CVHL 2X2HA 4YE0A 3QZWB 2XWJB 3QDHA 3BQUC 4JFUA 5E5MA 5HDQH 3ELQA 3BUYA 4YHLH 2F68X 1U8NB 4MA1B 2NNFA 1J11A 1U9KA 4L8DA 3FQTB 3GS7A 3P0YH 4Z7UE 1YLEA 1F1AA 5GGUB 5I16A 3KEDA 4BQBA 5IQMA 2LU3A 1O9ZA 3DOHA 1XGQB 1HKLL 2GTWB 5GIRB 1EJ8A 1R5VB 2FHBA 2Q6WB 3V79C 3CAFA 1I3QA 3OPZH 3HE7C 5AZ2H 2DBJA 1DVFA 1MRDH 4OLEA 4PRHB 5D2NE 1OGAB 2HXAA 2HUHA 1SUJA 4XP4H 3DX8A 2WBJD 1OAKH 4FLRA 4ZDHB 4CBZA 4NYLB 1RZKH 4I5BA 4PUBL 5F6HI 3MYJA 3JTBA 3NACH 5FUOH 3UDWC 1IAIM 2XN9D 3IJSA 3UBHA 3SKNA 3WU1A 3WKNA 1BMGA 4NQED 1S78D 1OHZA 1VIWA 2J6WA 1N9PA 5DHYA 4Z3HA 5DFVC 2EVIA 4G9FE 4M5ZL 3E8VA 4AV0A 4E36A 1N7MH 3VXSE 1OCCB 3OKNB 2FX8H 3QJFA 2HFFA 5CZXD 1SMYD 2N56A 4DKFL 3NBNA 1ICTA 5T1DL 3V8OA 1N6UA 4ZOAA 4QHMB 3EDJA 4TKWA 4YBLB 1OGSA 1QSEE 2KZ1B 4LL1A 3HE6D 4F7PA 2D7QA 3BDXA 3DJZA 3G3LA 1Z32X 4PLNC 2YMXH 1MQKL 4YHMH 3DVNB 3KPSB 2W92A 2Z4QB 2ICWJ 5FO7B 1GC1C 2QHRL 5L8LB 5KVMC 2WP3T 5CCGE 4Y4FD 3SE3A 3CH1A 3FB6A 4V2CB 3FFCB 1VZGA 2A4CA 3ZKNC 1BFVH 4DKDC 1KIUB 1D2PA 3L1OH 4EOWL 1R33A 1DVFC 3BJ91 3L3GA 3U9WA 2E9JA 3V9FA 3SDAD 4R0LB 1UWEL 2DOCA 3VXNA 2H3NB 5CJQH 1A6WH 2NUPA 1EFXA 4KO8A 1CLYL 4RGNE 3R1GH 3SJVB 1PLGL 4J3BA 3MBXH 2G3MA 3D87B 1PJ9A 3VCLB 2VL5B 2F54A 3BP4B 2BOBB 3MRBB 3ZHLA 4ABWA 4E9XA 1MQ8A 1ROWA 4PJ5E 4Z1PA 3RIKA 4F9LA 3K74B 3P2BA 5IREA 2PCXA 4LF3A 3OKOB 1MHHB 3EJSA 3OSKA 2AI0H 4MQSB 1CFTA 3G04B 4KRPC 5I76A 2YR3A 1NGPL 5B4MC 5JOFA 4QYOA 3O4LD 1MWOA 1THAA 1BZ7A 3HI5H 1AC0A 1W0VA 3BPOC 4RAVB 1EFQA 3MV9D 4M1CD 2Z31D 3CZGA 3UEZA 4GUPB 3B56A 5EPMB 3TJEL 3MLPA 4F5CA 2YD5A 4XOEA 1HI6B 2YFNA 5CGTA 3KJ4C 5BRZB 2PMZA 5TH2A 3GHEH 4DOHB 2OL3A 3SKUD 3V7MA 1ET7A 2W94A 3D3VE 3KLKA 1N10A 2VLJB 2WYTA 4M00A 1KN2H 2DLFH 4XP6L 4YN3A 1BFTA 1JGEA 3TVMD 2B3IA 2EYRB 3THML 5IIEB 1JZ2A 3X14A 3WIHA 2XZQL 1MZYA 4GOSA 4XNYH 3FTSA 2NXYB 4N9GA 3EJUA 2WLIB 3LXBA 2OV0A 5I1KL 4N4YB 1ZSHA 4Z7QF 5ERWB 2OZ4A 1QTPA 4BCZA 3GTTA 4I89A 4HDIA 2BMKA 3GB7B 1QA9A 3REVA 4Z7VE 5LLIC 1G0XA 4Y9BA 5EBLB 1MCLA 4RFNB 4F9LC 4XWGH 3GMNA 2J8UE 3PABB 4HLZH 3JVGA 1KSRA 1QFPA 5AOLA 1FYTE 3I3DA 3LKOB 4AI7A 1C7TA 5FFLA 1KCSH 4F1SA 1K83A 1G1KA 2EINB 3EYFB 5CJOH 2XA8H 1WAAE 3FU7A 1I9JH 3GUFA 3C6SA 3TH4T 5HP5A 1XMEB 2ZKYA 2E7ZA 1HOCB 3GMRA 1WVZA 4M5YL 2KDYA 3TBWA 4L48A 1LQBC 1P4UA 3RWEA 4AMXA 3BWSA 4X6BB 2K7QA 1OA7A 4F33B 4GAGH 3JZ7A 4PJAE 2YPLE 5DJAB 4K71B 3TBSA 5HI4C 2Z35A 2H32A 4JAMB 1CU4L 4KY1H 1KJ2L 2A83B 4GXUN 4APXA 3MC0A 1HCVA 2CXGA 1H0HA 4U1SB 2ITFA 3FKUS 4BSJA 2V9QA 3WJMB 2NUTA 2PXYA 3GS4A 4UINL 5ESAA 4CVZB 1DQQA 3CSFA 2XCMC 4JFFA 1Z5YD 1KJVA 5J4MA 2GJZA 2LTQC 3L3JA 1XZ0A 3VFRB 3DJTA 2G60L 4QRUB 5IOPA 5MI0C 3FTVA 2HFEB 4OD1H 4URKA 1HH9A 1ITCA 2X1WL 2V8MA 1K4DA 3U4BL 5C7XH 4U6YA 2VO5A 4PRHE 1OGAE 1OAXH 1GMIA 2H1LM 2W0LA 3A4EA 2QQQA 4ONGL 4L1LA 5F8QC 4EZMA 4OCXH 4YDMA 1HWHB 4YZWA 1EMTH 1DQTA 3QHFH 3OC8A 3NSDA 1XO8A 3A47A 4PLOB 25C8L 2BVOB 3L7EB 5E1AB 3R19A 4H44C 5FA3B 4EBQH 2JIPA 3GBNL 2XKNB 1GKOA 5IR1B 1EAPA 4I0PB 4S10A 3ECBB 1DSFL 4Z18A 3EGDB 3QHTC 4WI0A 4JJ5B 1MOEA 3G08B 3LB6D 5EUKA 4HUXA 2OL3H 4NUJA 1BD2D 1NCDL 2OYMA 3HNTL 3GUTB 4H5SA 3CZFB 2JTYA 2IANB 2CM5A 3LQZB 5FYJL 4QIWA 2I27N 1NCHA 2IOIA 2XDHA 2PXYC 3WIHH 3ZQXA 1XHHA 3NSCA 3SCMD 3SIKA 1BF8A 1ZIBA 2R83A 2CK0L 5CZVH 1XT5A 3TYGL 1RVFL 2OZ4H 3DYPA 4BQ9A 1VKXA 4HW6A 2LFEA 2VJXA 5T3ZD 5ES4B 4J39A 1FNLA 4K5OA 3FFOA 5GGTA 4ANKA 4ODSH 3ARGA 4DGYL 4FQIL 1A9BB 5DVNA 1H5BA 4S1SH 3IAGC 2DH3A 3HNVH 4X7FC 1A7OH 3LKQB 1XCTB 4CJ0A 1MCRA 1EZVX 3Q0HA 3Q5OA 5C0AD 3MXVH 2O5XL 2HJKA 2BWQA 3KCWA 4NN6C 1EBAA 3CU1A 3MZGB 4XBPA 3CC1A 2NSMA 4MD5A 4XX5A 3SO5A 4UZSA 2EDWA 1KPVB 4Q89A 1AZRA 1PD6A 5I0DA 5HI5D 2OMVA 4K9EC 3AT8A 2EIEA 1S7VA 4JREC 3ZDYB 1KB5L 4YVUA 1ZEAL 1P4IL 4OLWH 2ZTBA 3F83A 5HGDB 3M8OH 4KOCA 1YDPA 3S4SG 3VFVA 4HK3J 3HCVA 3IJ8A 2RHEA 1UD2A 4LLYB 1MRFL 2H32H 5E9NA 4GQ9L 1MNUL 1AD9B 5C3LD 3WY3A 1AXSB 4Y2DA 2BC4B 3RX5A 4JG9A 4DF9A 4CN4A 1RV6X 2X4PB 2IF7A 3QDGE 4G7YL 1FSKC 2GY5A 4PWFA 1MVUB 1VAHA 4ZAKB 5DC0A 2UYLB 4DOHE 2GJ6D 5AW0B 2QSCH 3SE3C 4X7SH 1KQGA 4QCIA 2AQRA 3O6MH 3NZHH 2APTA 5FGSA 4B9YA 3NK3A 1Q94A 1ID2A 4XOCA 5DVKA 1D6EA 2VDQL 1RUPH 1WCBA 2JKXA 2V9RA 3QR2A 3ARGC 3PYCA 3STLA 2NYZA 4AKPA 2GTQA 1HDMB 1H5BC 2NY2B 1WFNA 4H88H 1ND0B 3FT1A 3SYAA 3T0EA 4YHPA 1U91A 1HILA 4MJID 3ASOB 5FB8B 2I7SA 4NN7C 2WLLB 4MX7A 4NCDA 5ILTL 5KVDE 5ADOH 3KPOB 2OXHB 4M3HA 3ZOAA 2B0SH 5DSCB 1KXVA 4PAZA 5LB1A 2FUTA 5GLYA 5DWPA 3VGBA 3HI6L 2ADGB 4Z77A 4ORZC 9CGTA 4K9EH 5ID0A 4QMEA 3IB4A 1TENA 1NFIA 1WF5A 4OZIE 3SDCB 3R06B 3QEQE 3TA3A 4RESB 4ELDA 3L4CA 1CXIA 3IDYC 3DV4A 1KF9B 3RNKB 4PV9B 4Y2DC 3TFBA 1S9VA 2UXFA 4N8VG 2MCMA 4CA4A 3WSQL 2C1OB 2WXPA 3RUGA 3UCRA 2WLMA 3II2A 3FMGH 4KBPA 5DURB 3CZJA 3UG5A 1MY5A 4XBGB 2EDEA 1XGUB 4BIKA 2AABL 1II4E 3L5JA 1EO7A 4O2FA 4LSPH 3ARXA 3WHXA 2WK2A 4QT5B 2F1AA 3SZKC 1SYVA 1GZPB 2FYYA 3ZKSD 5IMKB 1HZHL 1DANT 3IBEA 5GGTH 3CJJA 5CBEA 1SVCP 3GTKA 1B2WH 2FD6H 3QUZA 4GKSA 4MASA 4BZ1H 2OI9B 2WQUA 1RUKH 1P7QA 1IO4C 1T3FA 2CGRL 4Q9RL 1KEGH 5EBMA 1OWWA 5ICUA 4FQPA 4XMWA 3TH3T 3AU0A 3TT3H 2O6DA 2ARWA 1AI1H 1KXVC 4C56B 4FS0A 4N85A 1G9NL 3MLSL 4OZHA 4U3SA 5TDOA 3RIAK 2ATPA 2H6OA 2FL5A 1MIEL 1KGJA 3TP4A 3Q9QA 4QRAA 5FK9B 4LPUA 4GW5A 5H2BA 4AMKH 4IJTA 3R0NA 2DD8H 3TA3C 4BUHA 2YMTA 1L7IL 1SF5A 4X9YA 5L4MA 4X8GA 1N64L 3KD4A 4KK9D 1RPUA 2BSEA 3Q8FA 5IVXB 3GIVB 3NEEA 4YUEH 3TIDB 4HK0B 1FI8C 1QFWL 2VN5A 3NCEB 2CIKB 4IGBC 4JDEA 2XVKA 4NKOB 4PB0H 5F1IB 5G4NA 5HHVL 1NGZA 4XMVA 4YOKA 1E9QA 4V1DD 3VFTA 1AE6L 4OSUH 4RWYH 3F12B 1YYMH 4LAQL 1XEUA 1WH0A 1S7TB 2FCBA 3V0FA 3L45A 3A4FA 3IU3A 2QSTA 3QUZC 1BBDL 1U8JB 3DX3A 4YXHH 4YDLC 4HGWA 4IHBA 1WEJL 3IKCA 3N85L 1NMAL 2BOLA 5DJCB 4FHKA 5C97A 1L8FA 2ZUUA 1CB4A 4LLWB 4LCWB 5L2KB 3GSNA 1I1AB 3CF2A 4ZUSA 2PR4L 1X5ZA 4UNIA 3IR5A 1EHKB 1MCKA 1ZA6B 5KSVB 5KOMC 3NRQA 1BQLL 3P30H 4QRPB 3IR6A 1CDIA 3CUPB 1CGSL 3B9KB 2CDEB 2F1BA 1C5CH 5D1ZB 4HISA 4WWOA 4Z8FH 2Q0ZX 2VDRH 4N0FA 3ZR6A 5BV7B 3X1GA 2NQ3A 4LOUD 4GS7C 5IQLA 2VPZA 1CVSC 4N0YL 3H3PH 3NJVA 2A9ML 2XNAB 3Q43A 2B4CH 2VT0A 4UQDA 2QFPA 1TF4A 4AYEC 1J9SA 4NQCA 4NJ9L 2Z92A 1TXKA 4NPYA 3NJJA 1LO4H 3AWEA 4FNTA 1G7HA 5IOKA 3QIUD 3DUUB 3D09A 4R7NB 1HNFA 3ZDYE 4BKTC 2LQRA 1IE4A 3D12B 1IM9D 2G75B 2VDMB 4UDTB 3VO0A 4KK6D 1B4TA 1P84K 3TCLA 4OQTL 3FB5A 4AYFB 2E2IA 4ZBJA 3RHWK 1E4XL 3OMNB 4LLUA 1DE4A 3N0AA 4X4YB 2I07A 5IF0B 4LHUB 4RIRA 1BZ9B 5AVYB 5KVGH 1OM9A 3NQKA 4ENGA 2YBGA 1I7RB 5FO9A 1NTDA 4NHCL 4AYBA 3BWUC 4HH9B 2GJPA 1HYSC 1KPRB 1GYVA 1RUMH 3RGBA 1SHXA 5DVPA 4NWUH 2HKHH 4APQA 1BGXL 4TUKL 2Q8BL 5A6MA 3VMOA 1YYCA 2ZCZA 3ZRFC 1KBPA 4B3EA 4IJ3C 1E18A 1AGCA 6PCYA 3MRLB 3PY9A 3PRZA 3H9SB 4PJFB 5FA4A 2JB5H 1QSFD 3TBVA 3KDPB 1UB5B 3ECVA 4NQDA 4Y4HA 4ZMQA 2K8MA 1I1FB 5JA9A 3C8KA 1R27A 1OANA 5B38B 3MTXA 1NLBL 3UABA 3VB8A 4KX9A 3U46B 4PJ9B 1T1XA 3C2AL 1OF2A 4G9FD 3BXNA 2EDFA 1DBAH 3JTSA 3BKML 2FIKB 3RL2B 4KXBA 2AF2A 5JW4R 3BMWA 4PY8I 1KCUL 1L9PA 2FIRT 5IB4A 5JQIB 5KWYC 1JZ6A 2I7OA 4R90H 4HJ0C 5E0FA 5J1AA 1QSED 4NP9A 4YPGA 1MUJA 4OLZL 1HL4A 4AM0B 2UZPA 3WFDL 5G5DB 3NJMA 2HUEA 3S5LA 1UA3A 2MCPH 3VXRD 3RE0A 1GPOL 4A7QA 2JLPA 3BKYL 2HT2D 3FB7A 1J8RA 4DWHA 1C1EL 1FCCA 1X6NA 1A0QL 4WJKB 1MW2A 4CS0A 2ZAIA 2WZ6A 3S96B 3BGFB 4XXCA 3MBEB 1KGIA 2CHWA 1JWMA 3B37A 3SKMA 1TLKA 3G6JB 4ELKB 1GSKA 1QATA 4NNXB 5DDHA 4APQC 1KY6A 3I74A 5L4IA 3GSNH 4HETA 3FYIB 1Y4ZA 1Y0LB 3G5XA 2YWYA 4PJEB 4RGND 5AKSA 4PR5A 3WMSA 1ZCRA 4OGYH 4ZUVB 3US1A 4GA5A 1LP9B 1T7WA 2DQUL 4PJ5D 3LPFA 4PS4L 3A6OA 4ZFOB 2IALA 3N2JA 1TZGH 4U6XA 4L1SA 4NZTL 4PJGE 4FZ8H 3PF2A 1WS7A 5IBTL 4C56E 3IPFA 1WZAA 4TTDC 2WW8A 5I1IH 1DUZB 3RDTD 1J1OL 3ESUF 4F2MA 5CKAA 3IJYA 1DBBL 1MREL 1CVRA 2DQFB 4ONHA 4CNIA 3FQNA 5MERA 2J57A 4HUUB 5I1DB 3NRFA 4RGOH 4BZ2A 1YEKH 3X3FH 2YSSA 5J6GB 2ITDA 1JS4A 4ZMVA 1I8AA 3ZDYF 2PTUA 1I1RA 1TJIL 3T65B 4KGLA 3CSGA 4HZLB 4U1GB 2VSKB 4WY7L 3N9GL 2VUKA 1GHFL 2CDGB 1BQHG 2XC8A 4TUOB 4MHHI 5E56A 3SQOH 2B5IB 3EGSA 2ALAA 2IAMD 3D3VD 2BHFA 2WLHA 4IIQA 3TNNB 4NRXA 5IVOA 4G7SB 3SDYL 1KWKA 1WC7A 2QVFB 3HHSB 4NI6A 4PJ7A 4ZMAT 3BZEA 3D0LB 4XN2A 43C9B 2GABA 4D0DB 4BFFA 4JFDB 2E7CA 2R23A 2WZ5A 4XPBH 5E2WH 3WD5L 4JPIA 3WMPA 2YBRA 1C08A 4FQQA 1X9LA 2CRMA 4M93B 3SDDD 2GIYA 3HR5B 1UOVA 4OJCA 2JKIS 4FXGA 4H8UA 5EA0H 4CADA 4LIQH 2QMKA 1ZANH 2XICA 3VXOB 3C5ZB 3U7YL 3FH7A 3BFWA 3D5OF 3GMQB 2VLME 4FNRA 5L2KE 1IMHC 2PWGA 2A1WL 3SD5A 3X12A 1X9QA 3ZTDC 4XVJH 1MVYA 3MRHA 4DZBB 4A6YL 1FYTD 4GH7B 3I2CL 5DJXB 2ESVA 4YDJA 4XNBA 4HGKC 2EXSA 1N59B 3DIFB 4S0HA 1T5KA 1GAFH 3UGXA 3KLQA 7FABH 1PYWB 2Y72A 4NSKB 4B60A 3T8XB 4OM1H 4KQ3H 1JE6A 1SXSA 2R0WH 1PG7X 5IBLD 4S11A 4WNSA 3V5HB 4TYUA 1SN2A 5DK0A 5CUSL 2YPLD 3PWNB 1SNRA 4YFEA 3HC0B 5EEZA 5F96L 4CGUB 1I9IH 5HVWA 4IIQC 1PPIA 3TCXA 3EO0A 1UKTA 3QRGL 3F5WA 4ECNA 1GYWA 1G8JA 1QYGL 2C3VA 3MNZB 5DR5H 4WO4B 2MMXA 1T03H 3IS0X 2MQCA 1FG2B 5CXPA 2X4QA 4OLXH 3S88H 3DOIA 4QHNB 1BJ1J 1DO5A 1KTLA 3AM8A 5CZRA 5IW1B 4FXGC 1CZ4A 5CGBA 1OTTC 2BP0B 2X89A 5BCAA 3F6JA 4PJCB 4S2SA 4HMCA 4JGJA 1BEXA 4PRHD 1OGAD 2XKSA 2JQZA 3GI9L 1X4XA 2OZNA 2AEIT 1XXDC 4JPKL 3FTGA 4FI6A 2WQVA 5ACZB 3OKEB 4OD2A 5BPPA 2OULB 3H9SE 4PJFE 3VFGL 2XTJB 4JM4L 1PKOA 2WXQA 2GKIA 3FZUD 1BZEA 2BNQA 2K7PA 3QFJE 2RACA 3KJ6L 3DSFH 4M03A 4TLTA 1OB0A 4BZ2H 1P7HL 1F3JB 3ARUA 4JFXA 1T80A 3WIIL 4RQQB 5KN5B 1CFMA 3HN3A 4QHLA 4X99B 1FRGL 5J12C 1AS6A 2CBQA 4TUUA 1F4YH 4PJBB 2JCCA 3C09B 2V8LA 2J6EL 1J0KA 3V52H 3VX1A 5JPMA 2NVXA 2DQGL 2IH1A 4OZFG 4YSUA 3QS3A 1BLNB 1OP9A 4W6XB 2NCMA 5GQBA 4FJ6A 1H3VA 1J1PH 4YL9A 4WDIA 5IVXF 2XFXB 1J0HA 1G5GA 1SHSA 3DOSB 1IQWL 2YAQA 3H9HA 2MOQA 1OPGH 4LSRL 4JFHD 4XWOC 2H0PA 4HS6A 4J8RA 5CINL 3BVVA 4I7ZC 2XWRA 2O5ZL 3AM8C 2PP9A 4TSAL 5LBSA 2AFNA 3FFCD 4ONFH 4NT6A 3G6JE 4KXDA 4TQHA 1MELA 5DD1L 1FF5A 1RLBA 1NIBA 2JJVA 4ETQA 3RWJB 2HX7A 1TYJA 3IM1A 1INEL 2A7BA 3HLAA 2D7NA 5L6YH 1J9RA 2FBOJ 3MU3A 4PJEE 3SJVD 4G72B 4GO8A 4K4KA 2KHAA 2FWUA 1KQFA 3CDCA 1CDHA 2KLRA 2ZUQB 3BLBA 4HIEA 2X4TA 2YK1L 2WSPA 4UAHA 1XR9A 1OOWA 2AXHA 3EHBC 4GXFA 1WD8A 5ITFA 2CIIA 3ESVF 1FQ9C 4MMYA 2PP7A 3LRKA 4QXTA 5DWUH 4BK5A 3MFGB 1G6RL 4WUUE 3QI9A 1NCUA 3LZFH 5IHZB 3MACL 2NPLX 2FO4A 3P4OB 4JEGB 4K0OA 1IFHL 2CALA 4F3FA 3RWHA 3JTTB 2WKOF 4NZUL 4WI2A 1NM9A 3QDAA 5IQ7H 1UUNA 3DO3A 1JNLL 2J21A 3SGEH 3P2TA 2EEBA 5KJ7E 4WHTA 3VD5A 5EN2A 1UB6A 2V3FA 2Y24A 1H6TA 1LNUB 5IB5A 2HT3D 4ENED 3V0JA 3LHPL 4OTXL 5E5RB 4N2HA 4AITA 2NY1C 5E24E 1A2YA 2BE5D 5FYKU 1N12A 4R3SB 3DDFA 2COQA 1KMGA 4LBAA 4XNAA 1RJYB 5GM9A 2WY3B 5E9DA 2VPYA 5I0VA 3HN8A 4EQ2A 1DUYA 4CMHB 3TZVB 4PWEA 3OGOE 1AKPA 4YWGH 1U3YA 2X4NB 4X4ZA 2VRAA 3IDXH 3KL3A 3L2NA 3E3QC 2VDKB 3PHQB 2CG9X 2MQ0A 5IHBA 5D5MA 4PJFF 3ISRA 4X9HA 4MYWB 2ENQA 2Y6TE 4P2OA 3Q6FA 3QUXA 3FRUA 4KVCL 5FDYA 3ML8A 1A6VL 4BK5C 4XP5L 4G80B 2DQEL 3FU9A 1NCBH 3FCGA 4KDWA 4RISH 5B1BB 3QI9C 5IVNA 3OPUA 1WFIA 3MLUH 3RU8L 2A99A 2R2HB 5KW9L 1URLA 5I6LA 5ICZA 4WTWA 4PD4J 3T3PE 3VSVA 1A7NL 1TOXA 3FT3B 1QFHA 3X2PA 4WWKB 4F2FA 2DKSA 3QNYB 4M5SA 4AGLA 3FDWA 3LRLA 3KXFA 3VD4A 2MQGA 1ZT4A 1JNNL 3E80A 3OB0K 5LBSH 2Z8VC 3K2UL 4L23A 1JZEA 1MH5B 4G7RB 1IT9L 4KTYA 2V5TA 4O51B 2NNRA 3P73B 4WGKA 3IRZA 3MCLH 5EWIL 1NMCC 3QG6B 3BPNB 5ICYB 2J12B 2DF3A 1S7SB 1JXJA 1ZHNA 5CCHE 4A63A 3G6JF 3QDMA 1CXEA 4H0GA 4QPEA 2AXGA 4P5MB 1AAJA 1R46A 2Y7MA 5AOIA 3QWOA 4JKPL 2QR0A 4QF1A 3F7VA 2BP8B 1P5UB 4PJEF 4M7ZC 4P2OC 3WKQA 3FOMA 3QUXC 2G4EA 4U1IB 4WI3A 5ISZB 1H8SA 5AZEH 3EJTA 1KGUA 2DQMA 3AS0A 3NCXA 1UHDA 4U1NB 2XTJE 5CIPA 3QUMB 4FQ1L 1AD0A 2EAEA 4PRAA 3T0BA 2O6CA 3F8UB 3BVTA 1HE8A 2ZWLT 1RK0A 4TS6A 1VGKA 2ZAHA 4IEFA 4U7KA 2HAZA 4WW1B 4B9IA 5TPWH 1L6PA 1A1MA 4JG0L 2IH3A 4I0PD 4DZ8A 1A1OA 4PJBE 3QXDA 4FG0A 5F89B 3DXAA 3GBMH 4X6CB 4X5RA 2NY3B 4D0CA 2AQ3A 1JN6B 4EKXA 2F8XC 2HTKD 2IAND 5AOMA 5IM7B 4XN7A 3KM1A 4S1DC 2ZKHH 1H9VA 2AV1A 3AB0B 2Z1KA 4W6YB 4WI4A 4D3CL 3RHWF 2Q2LA 4ICXA 3IAPA 4A66A 4HXBH 4X0KB 3V4VA 4J2XA 3LAFA 2ZCHH 3VI4A 1NUDA 2DIBA 1Y6KR 4AKQA 2UY6B 3QNZA 2VL4A 2FEEI 3MV7B 5FKAA 2AW2A 4JM2A 4QDGA 1CLZH 3I02B 4YAQB 3ELAT 3QQ4B 3P54A 4H20H 2NT1A 4RFEB 3V0EA 4KKQA 1KB9K 3U79A 3GGWA 5BXFB 3O6FA 4IKLA 1OARH 1PKQA 1NBYB 2HT4D 2BHYA 4FMFA 4NO5A 3HFML 4KXZI 4Q6IB 3BO8B 2BLFA 4LSUL 1UG9A 1ZHBA 1KBVA 2PWHA 4CL7A 2FGWH 4HHWA 4P9ML 3PNWA 3O4OC 5DJZB 5B3JF 5I19H 2KDGA 4GSDH 1T1ZB 1JTPA 1RIUL 2VZVA 5D7JB 2F53A 1BYNA 5J13C 1RHFA 2ZYSA 4YHIA 4E5XG 1BOGB 1NBZA 2CHZA 3F2LA 1ZJBA 5GS0C 2P47B 3APDA 3RWIA 3VFPA 4GFTB 4QJ4B 2HTLC 1OP3H 1KCVH 5F3BB 1TEGA 1HU8A 2YN5A 1GYUA 1YJDL 1HIMH 1UOLA 2EVFA 4FLQA 4M61A 4EN2A 3HBPA 3LKRB 4TXVB 4TQEH 3GSRA 3OQRA 4IMLA 3QEHA 1UOKA 4J28A 1P7BA 4PJHE 2FYVA 3IGKA 5T3XE 5KVFH 1QBLL 4ZAKD 3ZT6A 4GIAA 1GCFA 1Z5LA 4QXWA 3KPLA 2WZ0A 2PYFB 3IJSB 3RGVC 1ZA3A 4G42A 3BYTA 4JM2C 3MREA 1AYRA 2AKRA 4E41B 1T0MB 1ACXA 1XB3A 4OCRH 4WGVB 2NY2D 3HBGA 4PJCF 3O6FC 4PTUA 2XJLA 4DVRL 1HHGA 2RJMA 3KH3A 1JRHI 1Z9OA 3QIBB 5CO1A 4UU9A 3RPKA 4AW4A 3JVFC 1JOIA 4A55A 1QLEL 2JV6A 2R0LH 3KPMB 5BS0A 3P1VA 4UYQA 1NSNL 4XHJC 5CIPH 1E42A 3FRPG 1TYEB 4S1QH 3WN5A 1MCEA 4ZFFB 4Q14A 1C7SA 3NCFB 4G9DA 4XCEA 3LEYL 4P05A 3TO4B 3DVIA 4X80L 2X4OB 4G1MB 4H13C 5GS0H 2JJWA 2XN1A 5F1SA 4BBWA 2R1XB 4L3EB 5TDPB 5T5NG 4PJBF 4RAUA 5C9JA 1BVOA 5I66A 5HD8C 1HHHB 4U49A 3VXNB 4ODBD 3ZO0A 2CQVA 4H2CA 4KXZH 4P5SA 1JD7A 3EJYC 4MRCA 1UM4H 4NWTH 1W8OA 2JB6A 3U1QA 3B7YA 3NABH 2FJGA 2CCWA 5EIIG 3K72A 3V4VH 2P5WE 1PF3A 5IK3A 1JGDB 2VYRE 5FTMA 4LF3B 4X5PA 2F8VA 4TSBL 1A3RL 4ORGB 1F1GA 1GMEA 5F9OH 3UZQA 4EUPB 4CRZA 1GGBL 2NY0D 4L9LA 2GT9B 4MQTB 1UGNA 4JGUA 1N2RB 3IMSA 5AOJA 3ZE2B 5B39B 1BQSA 1NMBH 3BIBX 4GAFB 4N8CH 4PGCA 5A2FA 5HYQA 4KK8D 3NPSC 3WN5C 4GSXA 5LAPA 4C56D 2J88H 5T1JA 5E2UH 2HH0L 5ISZE 4PRPA 2VABB 5CLXA 1U42A 4RSYA 3HKZA 1IX2A 2VB5A 4MA7H 4PCYA 3X14B 4OZGB 1M9SA 1RUAL 4QGYA 2DKMA 2VUYA 4ODHH 4N9GB 4NLAA 2OXGA 4PLKC 4XCCL 3QCVH 1WFMA 4AAYA 4HDIB 3MV8A 2WWKO 4AYMC 4FQCL 1EH9A 1QZ1A 2YHGA 2V45A 3AC0A 3S34H 3BCDA 2Y36L 3QO0A 4MCYA 2YRZA 2X40A 1N5YH 2APWA 1JK8A 3U0WL 4K3EL 2E47A 1Q8MA 3VD0A 3VE0B 1RZIA 2V3DA 3JUZA 4L5FE 4OCLC 2R9HD 2OSLA 4XVOA 5K39B 4JQIL 1CFSA 1WBXB 1AP2B 4AUUA 1V10A 1R5IA 1R0AH 3H0TB 4L9LC 2A68D 1DQIA 3AT9A 3EF7A 3S0PA 1OVZA 5L2KD 5I8KL 2VLMD 3KR3L 1I1AD 3TBWB 5CSGA 4FE9A 1SLWA 3ILPA 4MNGA 4KROB 4FABL 6PAZA 1R24B 2Y2YA 4NOBA 4QRPD 4XO9A 2R4SH 3KLAA 2MH4A 5FYJU 2YS4A 4KKBC 4GMSL 4KUZH 2ZSVB 4NKMB 2FX7H 3U2SA 1ZIAA 3ASNB 1DHKA 3PJLA 4OZ4A 4NO0B 4RZKA 4WKZB 1FVCB 1KYOK 1Q9WB 5DVMA 2XXGA 2DQHH 4GAYA 3IMVA 3B3BA 2VN4A 4DKEL 5KVEE 1EVUA 1BVKA 1FNAA 5AKRA 5DRNB 5ESAB 1DQQB 2PW1A 4J3OF 2RCSL 5CEYB 2ZCKL 1WHOA 4PJDA 4JFFB 1CD1A 2O5YL 2RFXB 1IGTA 4LVOB 5TK2A 1UWYA 5GSRA 5IFAH 2DLHA 6CGTA 3DX2A 4JG1H 3T6XA 1HH9B 3RAJH 5B8CA 2CBOA 2WXFA 2ED7A 3PWLB 4LRNL 2X70A 2GAZA 4JPSA 3N5AA 4PP2A 4UBDC 4GMTH 4YZFE 4LHUD 1HESA 4LEBA 4AX3A 1CMOA 3PJSB 1E4HA 4X4ME 4PGJA 3EFDL 2Q76B 2BVQB 4GAJL 5KJRH 5C3IA 1XF2A 3S97C 3BEVA 1CI3M 2DJ4A 3FQUA 4LDEB 4OCYL 5ALCH 3RWFA 3Q6GH 5M95B 4HGMA 1NOLA 4EKJA 3EUDA 2NW3B 5C0EA 3HUJB 1TG8A 1ETZB 2JCWA 3MO1A 1DBJH 1XIWB 1NFAA 2Z7WA 3S35L 1PLCA 2VQ4A 3H9SD 1AO7B 1OK0A 4IU3A 3WE6A 3GEFA 1TVBA 4DP4X 1GGCL 1U8PA 1X7TA 1MAJA 3PWPA 2JLLA 1KNOA 1FL3A 3QFJD 4H5SB 4HALA 5JHBA 5KSBB 2VZTA 4CILA 3CIQA 5DRXA 1XSJA 3QH3B 1OD9A 2R8SH 2WYIA 5EDXA 4YXKL 4YSDA 3WIFA 4X7TA 4Y5VB 3CFBB 3QR0A 1X9RA 3KPNA 4J1UA 1UJ3A 4FNPA 5FXCH 3HAEA 1GGIH 2DMRA 2XYBA 3KEHA 5DMGC 3F7LA 1GJWA 5DLLA 3BH9A 5I26A 3BPCB 3D06A 4PRDB 3MRFB 4G7VH 3WUWB 5B8CC 3QFGA 1XX9C 3DUSB 4L3EE 3T04D 3E8UL 3OKYA 3WNIA 5IESH 2Q86A 2ARJA 1USQA 1VFAA 3QC6X 4PHXA 1ZS8B 4X6CF 3ERXA 2RA1A 4A38A 2KZWA 1JXGA 2GK0B 1QRNA 1NDGA 3MX0A 1L7TH 5PAZA 3CPLA 1FNSH 1OB1B 2KPWA 2X4UB 2F54E 1ORSA 4XB7A 5FYLH 4XC1H 2WLKA 3MBED 4QAWA 4UB0H 4MD5B 3U0TA 4BSWA 4HX1A 2ZCLH 3DX7A 4XNXL 3MJ8A 4I87A 3UTQA 4DP6X 3CV5A 3HNSL 4OQ1A 1XR8A 5AYQA 5LGJA 4HEPG 3ZTNL 1KGCE 3KPPA 3V6FA 3VFVB 1TEYA 4CJ1A 1MFNA 1RZQA 4FI8A 3HCVB 4P5KB 1AGBA 2JXMB 3HC3L 5D9SB 5GHWL 3SB3A 1DJHA 1FORL 3LPOA 3ZE2E 1I3RA 1WCMA 3IJEA 2XPZA 4EVNB 1UGKA 4EDXA 4F5CE 3ZDZB 3MRCA 1UD3A 4CKVX 4MKTA 4GRLD 4QR7A 3L9BA 4HEMA 2QDVA 4WFFD 4AVIA 4Q7DA 4XB3A 4WUUD 3TBCA 2HRGA 1C5DB 4E68A 4ZQKB 5HDLA 3QJHA 1THCA 1I8IB 3MJGX 1TSHA 4U3XA 5SWSA 1XCQA 5DMYA 2GBVA 1JBJA 3VU1A 3DJ9A 1FAIL 4X9IA 5DHDA 1JK9B 1ANUA 4JFVA 3GMPB 4RAHA 3OXSA 1JZ8A 2VERA 1EA9C 1SRDA 1U91B 1UM6L 3T0EB 1TZAA 2MPAL 1CXLA 1WAPA 2EYTB 3PXJA 2N7BA 3RKDD 3N43B 2O72A 5T1KA 4AG4L 1I8KB 2XV6B 4LCCB 1JPTL 4QOKA 2JA7A 5CU9A 2CO2A 1RLWA 3QUGA 1H8LA 2IQAB 2L8AA 3LH2L 1F4WL 1HH6A 4YHYB 1TDQA 2PYEA 5E6IA 4MJ6B 3QC5X 4TM9A 4RRPA 4XGZB 1MHPL 1I3UA 3B5GA 2COVD 2CO3A 2QVMA 2DYSB 5DZVA 2BNRB 1ILSA 2B59A 3LQAC 2L7JA 3C5ZD 1E2VA 1DBKH 4M48H 2JJSA 1RJCA 5SX5H 1AR1B 2HRPL 1I1CA 2GEQA 4ODTL 3SE8H 1T0NA 3FO2B 3EG9A 3TONA 1V7NH 4ZW3A 2R7EB 3HAEH 3F7YB 4OIBA 4PB9H 5KYXA 2HPOA 4IRZA 3Q44A 1E60A 3HC4L 4KJQC 3TO2B 3ARBB 1O7SA 2ZUYA 4OZFA 2Y07L 3ESMA 3OB0H 3JWOC 3SKOA 1PEZA 4XCYB 1NGWA 1OK8A 4FQ2L 5E6ZA 3S3BB 3GXUB 4UAOC 4JFFE 5KSAB 4L4JA 4EEEA 3TTSA 5CBAA 2ZWYA 2CUHA 4M6OL 2DWDA 4QTIL 4UTBL 2AJYH 1NUNB 3F7PC 1WG3A 4CMMB 1G0YR 3VFNA 5BO0D 1W6LA 5MP6L 3VFOA 5C86A 3DI2B 4GYBA 3BVDB 4KC3B 3UTTA 2IQ9L 1LO3H 1S7WA 4JPQA 5TF1L 5IT2H 4JKWA 2UY7A 4WO4D 5EU7C 2NLJB 5E6IC 2FL5B 2DM7A 4Q9CA 1ECZA 5CGMA 4OFIA 5F97E 4R7DA 5C2BL 2YWZA 2A69D 1AY1L 1D6VL 1CBVL 4FQHB 4HD5A 1JZ3A 5A2IH 2F7IA 5E23A 4LE8A 1M7XA 2L0DA 4UILH 4I4WB 1PS3A 2FZ3A 3LQAH 3VG9C 1YHPA 5D1XA 2YD3A 3QWNA 3NFSL 2FATH 2JJSC 1KTDB 4Y9CA 3NN8A 3NA9H 3POCA 5I1EL 3SBRA 3ZE2F 2W0FA 1XVSA 5C0RH 1KELH 4YL4A 2GUOB 4FQJH 2WYHA 4ICWA 3G5VA 2NW2A 1AS7A 3LRSB 2XTJD 4GKNB 2ZXGA 4IM8A 2JNZA 1YZZA 4JDEB 1W80A 1O7VA 1S9YA 3JWDL 1EHXA 3D18A 3CXHK 4ZOCA 1ZVHA 1IEBA 2XIIA 5BNXD 1HINH 1E6OL 3OHXA 2GY7B 4OZGF 5IQ9A 3JWOH 2D0HA 4FTDA 3V0DA 1YEFH 4ZMTA 1V54B 2YA0A 1TVHA 2WP3O 3IKCB 4FTVA 1F0LA 4G3YL 5L9DL 3PG2A 1B3JA 1AA6A 1UCTA 2BXZA 2R56L 5JQ6L 2WLZA 3LY6A 1BVZA 3OKDA 3QUYD 3UZEA 3ZIYA 4B27A 4ZUUA 4XPFL 1DJYA 3ESNA 2EXWC 3MRGA 4UNUA 3LMJH 2ADYA 2E6JA 3H55A 1DYZA 4ELMA 4J6RH 1KTBA 1O5PA 1QLRA 1U8LA 1YNTB 2IMMA 4N0FB 3N1FC 3LPWA 1YUKB 1FAKT 2H26A 1KXQA 3LDBC 5DRZA 1J86A 1UH4A 3BKCL 2DEYX 3QK0A 5D1XC 2Z92B 4HWNA 1U8MB 4NPYB 4WO0A 4UTCA 5F7UA 4BFGA 1P6AB 1AH1A 2HLAA 3ZYJA 2APXA 3V6OA 1IVTA 4L3CA 1Z6JT 4QNPE 2BW4A 2X4RA 3PWVB 1YMHB 3O9WB 3QR1A 4GSUA 4DQOL 3V4PA 4KJYA 1IBBA 4IRZH 1FH5H 2CE6A 4NJAH 2CKBB 1EVTC 4HUWA 4YSAA 4OZFH 2NNAB 3OHXC 4LP5A 1AQKL 4MAYB 3INUL 2NDFA 2FWSA 2VXSL 3KGTA 3IDNB 4WI6A 1T04B 3EYSH 4QRRB 1Y6MR 4UYPA 1W9XA 5FGRA 4PRBA 3L4ZA 5EORH 4HJEA 4N2OA 2AMUA 4M6NL 3UZEC 5JXEA 4KKRA 2EE9A 2VJ0A 2XVBA 4FNUA 5KAQG 4PU2A 1ZHKA 1IZKA 4LCYA 2CNZA 3ZPDA 1WUZA 1N4XH 1P1ZB 2V7NB 3T0EE 1AGFB 3QIWB 2APFA 2MNWA 3ETBF 3TBVB 4ZG1A 4N24A 4Y4HB 3I3BA 2E4FA 1CFQA 1ZVNA 3NCWA 4TULH 2F5AL 5DQ9A 3SY0B 1Z7JA 4IOFD 4LASH 1GOFA 1DQJA 3NMEA 4X98B 1Q9LB 4ADIA 4JCMA 2GITA 1QABA 3NJGA 4N0UA 4E9LA 1B0IA 5IB4B 3QW9A 5DT1L 3UGEA 5KSUB 2VQUA 5FWQA 4XXWA 3V6OC 1QLFA 2BNRE 2J5LC 5DUPH 2D8KA 2Y06H 1TVDA 3HUJF 4OLVH 3B2VH 3SGKA 3VRJA<