4JS7A

Crystal structure of d78n mutant apo form of clavibacter michiganensis expansin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
202
structure length
202
Chain Sequence
b'MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulose binding protein
publication title Crystal structure of wild type and d78n mutant Clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
molecule tags Sugar binding protein
total genus 43
structure length 202
sequence length 202
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4js7A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4js7A02
2PI8A 2JNZA 5GM9A 3X2KA 2BH0A 4FFTA 1L8FA 4ZM7A 1N10A 2GAEA 3FT1A 3X2IA 3M3GA 1HD5A 3SUJA 2PJJA 3FT9A 2ENGA 2G5DA 1OA7A 3X2LA 4FG2A 1BMWA 2AE0X 4JP6A 5GLYA 3CZBA 1WHOA 5H4UA 1OA9A 3X2NA 4JCWA 3X2OA 3D30A 4JS7A 3ENGA 3X2GA 5GLXA 3X2MA 1BW4A 2KQAA 4AVRA 2G6GA 4JP7A 1BW3A 2VXQA 2PICA 4ENGA 3SUMA 2HCZX 3SUKA 3X2PA 3X2JA 4L48A 4FERA 3X2HA 4JJOA 1WC2A 2PNWA 4FG4A 3SULA 1WHPA
chains in the Genus database with same CATH superfamily
5ACMA 2GCYB 3WTXA 4N26A 2B1AH 5IVXF 2MKLC 4OU3A 3BP6B 1HINL 5J3HC 1HHGB 5M7QA 1OARH 2AQ1A 1XCQA 1JV2A 4V1DE 5BCAA 5D7KD 4G3YL 4ACTA 3L9RB 4IM8A 5DJZB 5I1IL 4NHCL 4F7TB 5I5IA 5KW9H 3PHQA 1AY1H 1V3MA 3PHSA 3WFEH 3V0WL 1OCWH 2AK1L 3VCLA 3Q5TA 3BVWA 5A40E 2QEJA 4QWWD 4H0IA 4AJYV 1OAKH 2WCGA 3ISRA 4NP4H 5DJYA 3SQOL 4U3XA 3ZY7A 3T1FA 4FFYH 4HOXA 5BUPA 4NQED 4XBMA 1RFDL 1TPXB 5JIIA 1U3HC 4XBEH 2VLRB 2GI0A 2J6EH 1QSFE 3DDFA 1FGVH 3LZNA 1BQUA 4XOCA 4ZO9A 2ADGB 2VKXA 3MBXH 2XPGB 4Y8AA 5EZOH 3GS7A 2EEFA 5KYWA 2DY2A 4Q14A 2DN7A 4HJ0C 3D39A 4MJ5B 2WCSA 4KRNA 4LMQE 1CDJA 4A68A 1X9LA 3E80A 4LAJH 5JQ6L 5EDSA 4EN3C 2KDGA 4YUEH 3TVMB 2ZCKH 3ZSSA 1CE1H 2PYFA 1XH3A 1YJDC 1J9SA 3VGEA 4W4OC 5ITFA 3L3IB 4PRPA 5E2VH 2Q8BL 5DZPA 4B0MM 3TASA 1UKSA 4G80A 1NQBA 5BOJA 5HYJD 4X4YA 1FI8C 2BVUA 2VZ3A 4PJCE 4BFBD 3NABL 4R9HA 3TOPA 4OAWB 5FPIA 4UMSA 1MWAB 2ZT9C 1IM9D 3GSXB 2ZX7A 1I1AC 1JMXA 2OULB 3DYMA 4OLXH 2HP4A 4M1GH 3GSWA 2Z4QA 4GQ9H 4UM9D 4KTDL 5CJOH 3A4AA 2H3KA 3HC0B 1L0XA 1PLGL 3HUJF 5I17B 1BZQK 3QO0B 5SV4A 3LV3B 2COVD 2GEEA 3PV7A 3ELAT 4XAKD 5D1XE 3VXQB 1YN6B 2YXFA 4WW1A 2O5XL 4Y4HC 2OYMA 4Z7QB 1HS6A 1JDAA 1WFMA 3LH2L 4OGXH 3STBA 1QP1A 2C9UA 3ESOA 3IK2A 4AIOA 3JVGC 5HJDA 5KUMA 4R4BB 3FSZA 3T0EE 1YHPA 4ZFOA 5IMLA 4FZ8H 1F1GA 5H4YA 3X2IA 4DP4X 1EJOH 2JIXB 5EIVA 2YKKA 1Q94A 2J88H 4IKNA 4FS0A 2GBUA 4OR1A 3D0VB 4A7GF 4MAYA 4X5WA 3IYLW 4YZFF 1CLYL 3SDCC 3W2DH 5INCB 5FGBC 3LZOA 2LR4A 2V2WB 3CX5J 1UYWL 1FZJB 1XEUA 4RZCA 3U2SB 3QWNA 4LMQI 1CN4A 1KIQA 2H32A 3IJSA 4ABWA 3RUGE 5C0AB 1AVAA 4LRIC 4QGTA 2HTKC 2YLKA 5ES4B 4PJFB 3MLUL 3ARDD 2X2HA 3GWJA 4X9YA 3SY0B 1M2VA 4ZX5A 1FORL 1I1CA 1OB0A 2QSCH 2H26B 1A0QH 1CMOA 5KSBB 4TNVF 4J8QA 1IAIL 1MHCB 1TFHA 4Z7VB 4K3JL 4LL9A 2XKSA 4XN2A 4ZNEE 1WP6A 3DMMA 5AZEL 5JOEA 1G84A 3L3GA 3AUWB 2PW2A 4ZXBB 1JAEA 2A6JB 2WKOA 4P9MH 4XP6H 5I74B 4GAGH 5DHEA 4AL8L 2BWQA 3ZPDA 2PXYA 3VACA 3ZR6A 3DVFA 4ZFFA 4K3HA 1E6JL 1TYRA 4C47A 5C0JA 1TLMA 2QKSA 4NAQA 3BYYA 3CSFA 3OAZK 2ZOLA 2B5IB 1NKGA 1RK7A 3CZUB 4IEFB 3KS0H 2E7HA 4DJMA 5DQDH 2J5WA 1JHTB 4KX8A 4OZIE 4WU7A 3QRLA 4GLRH 4TV3A 3LQAC 1NCAL 2DM7A 4MAUH 4RWHA 3UEQA 1YEDA 1I82A 4Y8DC 4N2EA 3IJHA 4ZOCA 1AO7D 1TDQA 2CLRB 1Q9WB 2FL5B 2YC1A 4PYHA 5FUCC 3CN0A 5EC2B 3W11D 4YHMH 4PJGE 3RHWK 3D4CA 4GRLD 4NLHA 5ADPL 3SPGA 5JPMA 2OL3B 1PJ9A 3BE1H 1S7XB 2JLLA 5AALA 2WTRA 3QWRD 5IB1A 1JZ8A 4NRZB 5KEZA 2B0SL 3EJZD 2F8IA 5CN1A 1W15A 12E8L 1D6EA 1BBJA 3BMWA 1X44A 1LP9B 1ZHBB 4MASA 1NCUA 1KTRL 3C2AH 4XC3L 5ISZB 4Y5XB 5DHVB 3VRLF 2NUPB 1TQSA 4U2YA 3SJVE 2DKUA 2CJSA 2MPAL 4PYGA 3QC8A 1N5YL 3F00A 2WM0A 2XX0A 3O2WH 4XX5A 2ESVA 3REWB 4UANA 2IANA 3GEFA 3DX3A 3BVNB 5ILTH 3ZQXA 1EAOA 2KS0A 4HS6A 2PPAA 4MDJB 3VU2A 1O7VA 4NKMA 1DJYA 1TKWA 1B9ZA 4M7JL 3AT0A 4QRQA 2VH5H 1XF5A 3WFZA 5CU9A 4XMLL 4BEIA 2WV3A 3A6CL 2ZP9A 3ZKNC 4ELMB 4PBDA 3N6YA 1OKEA 1HIMH 1OAJA 4WI8A 2VWEC 3QNFA 1RZ8B 2ENGA 2DWEB 4CVXB 2DWYA 4U3HA 4M6NH 4XP5L 2WOYA 3HN5A 2GTWB 3BT0A 3WJJC 4QMEA 1EFXB 1U33A 4FL4C 4LB8A 2XWBA 2CKBL 3RDTD 4YGVB 5J11C 4UILL 4L48A 1EGJH 2YD5A 4ZQKA 5BV7H 3NUKA 5EEUA 4LL4A 2M1KA 5AVVB 2P26A 4B3VA 1IGJB 1NMAH 1XTMA 3FC8A 1ZXQA 2EDDA 3PAVA 3TIEA 5EZPA 5T33H 1JZ4A 2Y7MA 4HPOL 4A39A 2D4DA 2EDLA 1KJ2B 1MCDA 1DL7H 5GS0L 4OLEA 2NAPA 3ESPA 1VC3B 1KUMA 2X6MA 3MCLH 3T0WA 4D9QD 3N04A 3OR7B 4HD5A 3UX9B 1PZ5B 3LY6A 4M61A 2DWTA 2HMID 1WZMA 1JGLH 2VDRL 2M26A 3U79A 1JF5A 3MA7B 5I71B 4U1JB 3PL6A 3O6FD 4XO9A 3ZK0A 4D8OA 2VXTL 3SDXA 1Y6MR 5KANG 4LSUH 1YLBB 3QHZH 1LEIA 5JXAL 4LQFH 5K1JA 4MJID 4ZMVA 3P30H 4XPTH 2Y69B 4G9FA 4XNQA 3KWXA 5INDA 5IHWA 1G7MA 4XN7A 2BIQA 3SE9H 1J0KA 1N6UA 4P5RA 4UTCA 4JHUA 5C9KA 3O3BA 3LS4H 1T4KA 2NX5B 1LDPH 3RKDD 1II4E 4KKRA 1HXMB 5F9WC 4FQHB 1IL1A 2AQSA 2IOMA 3FT0A 1G9HA 3FQ1A 4FLQA 5C09D 3KGRA 2NY5L 3FU0A 3BPOC 2X44D 4AENB 3L8QA 2YWYA 5ALCL 5I16B 3CDGB 5TDOA 4DERA 1E27B 2FX9L 3UJIH 1S8DA 4HLZH 4P57B 4WI3A 2WMPB 3MKKA 4LCUB 2NZ9C 3O45B 3GMQB 3QJHA 3VMOA 5G2NA 5JW5B 1IMHC 4U1HB 1UENA 1B0RA 2HT4D 2WO3B 2PPCA 3QQ3B 3QNXB 5DEJA 1NPJA 2V2TB 3QJUB 3QUKB 4TSCH 3JXAA 4TNFA 1Q9OB 5FO7B 3GMNA 1W8NA 2OR9L 4BZ1H 5BMFL 4JO4L 2VXVH 2AZUA 1VFAB 3MLPA 2ZPKH 3QEQB 1IC7H 4ODWB 5IVXA 1UJ3A 4L5FH 4N2CA 3GZPA 4M7KH 3S35X 4WO4D 2VO5A 4AYMC 5FF6A 3UPRA 1MJUL 2CKNA 2V8MA 3OPZL 2LT9A 2NXYD 4MJJA 3OKDB 3W5MA 3A6BH 1I7RA 3NH7L 3MJ8A 2EJ1A 4R7XA 4X7TA 1E2WA 3SE3A 3SOBL 2WBWB 1D2OA 4JL2A 2K7PA 1X7QB 2QQLL 3Q3GA 3U9UB 1Z3RA 4AE1A 2VLKD 1YYLL 3VH8B 4ZTOL 3UACA 1GJWA 4HIJA 1HD5A 4OVUA 3TA3A 3WFCH 4X5XA 2G3NA 5EZLA 1KCLA 1JF6A 5AEAA 1KTCA 1FV1B 2DRUA 2F5BH 3JV4A 1QUNA 4R7LA 3VM7A 3W9DB 1B90A 3GTLA 4J39A 2EDRA 3TESA 5J89A 2ZSVB 2CMRH 4HGWA 2X4OB 4UMGA 4UV7H 3IDXL 1A02N 2L3BA 4EDXB 1KYDA 2HXAA 3VMPA 3VUAA 1U3NA 3ENEA 5BVPH 4CS0A 2X0UA 3BVDB 5F96L 3RURA 1I8KB 3JWNG 1MW2A 2Y7OA 1F3DJ 2CKBA 2K4WA 2YRBA 4PS4H 3ZE2B 4F20A 2F61A 1NOAA 2KI8A 1AXTL 3FQRA 4ZPVA 3VA6A 5JOPE 2UZYA 1CBVH 1OF0A 1A5FH 1IILE 1DJHA 2YLHA 4KZEH 4QTHA 4JFHD 3TBWB 3TJHD 5T1LD 3F7KA 1YEEH 4IRSA 5I26A 4LKCB 3SGEI 4ZMNA 3LNHA 2H47C 5LN4A 1KPVA 4MRCA 1MFDL 4A66A 3VFRA 1NBCA 1YEGL 1CU4H 2ESVE 1N8ZB 3CHQA 4JFZH 1FIEA 2XQ0A 4WEMB 1MDAA 1QEWB 2IANE 1HCYA 2XYCA 3ROLB 4PJDF 4UT6H 4DPBX 1TTRA 3DDGA 2W9DL 5FS5A 4XMZA 4CDHA 4YEEA 1T21B 3FCGA 3T3ME 2EE0A 1KBBA 2VRKA 1HEZB 3HUJA 4EUPA 5GXBB 2D73A 2I9LB 3UH8A 1N59B 3P2TA 2IGFL 2I9TA 5EBWA 3OKEA 4YXKH 2IG2H 1BX2A 3QIBC 1HE7A 3D34A 2JK5B 4M4RA 1DVZA 4A63A 2YEZA 3WS3A 3MR9A 2PTVA 3GTMA 4Z95H 4HUUB 5CFAA 3EYQD 4B7IA 1EXHA 1H0DA 2H6UA 3VXMB 1CO1A 1ZJBA 2HX7A 4HD9A 2W65B 4U0QB 2ZAGA 1HSBB 2FBOJ 2VDML 5DVNA 5HHNA 1OHZA 4HJGB 4V1DD 1RP9A 1UC6A 1FZOA 4A7GA 1REIA 4XMPH 2ENPA 4HJTA 3AU1B 2VPYA 3KH4A 2CBQA 2V3EA 3T3PB 1WZAA 3ARVA 3KJ6H 2BVQA 3V0EA 4TULH 2DIJA 4YDIL 4HZ1A 1I8MB 2WQXA 1NJ9A 1EEYB 4Y16B 5DJ0B 3TN0A 4CVZB 1FRGL 1HWHB 4PMEA 2AK4D 4XNMB 4H13C 4ALAH 4ENZA 5EOCL 3VU1A 4QRUA 3ZW3A 2X6CA 2VDOB 4YDKH 1XGRB 1QSFD 4JGUA 4MDIA 4P48A 1HQRA 5ICXB 4ZX4A 2VW6A 3SDXE 1COBA 3QXVA 4HLJA 3W3BA 3KWTA 2NY4D 5DZOA 3PWJB 1X6LA 1FFNA 1RMFH 2X9YA 1DLFL 2LVEA 1KCUL 1HXYB 1M56B 4HDIA 4QRAA 1BPLB 3GO1H 4Z0XA 5AZ2H 3CN3A 2AVFA 2EE6A 4Y5VB 2JQMA 2R4SL 1W0VA 4G9FE 2F7PA 4WJ5B 1O7DC 4GKOA 4MCMA 1LE9B 3WMQA 4BCZA 5E8NA 4D0BA 4KJPD 3VSVA 4GW1B 2OLDA 2NY6B 4AKOA 2BERA 2FQFA 3ZDZF 1CFSB 4NQDD 1J0HA 2W8CA 4EAEA 3S8FB 3X2OA 1L9TA 1JXGA 3V4PH 5DC0A 1RUKH 4K8RL 2XJLA 5F9JB 1T4WA 4KXDA 3TIDA 1PQZA 2H7WA 2OMVA 1D5IH 2ZG3A 2V7NA 5DJ8B 2D7TL 3IXAA 2N1TE 4KH9A 3W81A 4TXVB 1AP2B 3G6JA 4WI9A 2XN9B 2IADB 2VDQL 5EU6E 5L88L 1QATA 1J48A 2KBGA 3V0GA 3UO1L 2X6VA 4ABUA 3UBXG 3EO1B 4OF7A 4HCFA 4F24A 1EANA 5DI8A 3F05A 3QULB 3TA4D 2ZOKA 5EH1A 3MLZH 5D1XD 1KXTA 1DCEA 1F2XK 1BZDA 1P5UB 3RZCD 4GG6F 4KKCD 4RZKA 2HJKB 4NHUA 4A04A 2G9HA 3BGMA 4OZHF 4MZ2A 5IVXE 3MODL 2Y2TA 2JA5A 4MJHA 5FV2A 3VO0A 1TENA 4XXCA 2LU3A 3QORA 1S9XB 1JFQL 1C16B 3N1MC 1CBJA 3BXNA 4UOW1 3VXRA 1KELH 4NENB 3T0ED 5KZCD 1A9BA 4KTGA 2CUIA 3H3PH 2UXVA 3T9WA 2IQAB 1ORSB 2XIBA 1KTDA 3PP3K 2FLBT 3FN0H 1HZHL 3DIFA 2MH4A 3OAZH 4QO1A 4QRSA 4X5LA 4L2YA 4FQ1L 4JKPH 1IAII 3HE7B 4LCVA 4FQ2L 4OD3H 2Q20A 4PWKA 3QW9A 4H8WH 2C8NA 5IMKA 5AKVA 3BWAB 3C6LD 4J3XA 5KAQF 1P4LB 2GJJA 3O4LB 4Z3HA 3N9GL 4AITA 4ZMYA 4OUUB 1TWHA 1BMZA 3ULAB 4DK5A 4LVNB 2DB8A 1OGAB 1CZ8L 2ODHA 1K6QL 3GMOA 3IDIA 4O2FA 3RGBA 1SJHA 2YD7A 3P9WB 2XY1A 1BVKB 1WZLA 3KR3L 3ARFB 3QE5A 5E6IA 3UP6A 2DICA 5D6CA 1UZ6F 5AKSA 4N5EC 5GISH 2ZJSH 3Q2CA 4WENB 2MNUA 2UZXA 5HYEA 5MERB 4K7FB 2CBOA 3G04A 2VLME 1PPIA 1IQDB 2IH9A 2EADA 4JFVA 2WBJB 5IGXH 1JXDA 3EJYC 4IHOA 5DK2B 3U36B 4YHYC 4DN3L 3C5JB 1TJHH 4EN2A 4AMWA 5I9QB 1IVLA 2O5NA 2GHZA 1HILB 2DPKA 1BD2D 2A6IA 3BQUB 1SF3A 4ZYKB 4JFFE 1QFWI 4FHJA 3P3TA 1UJTA 1JZ5A 1JI2A 3HUJE 3RFZA 2HJLB 3O2DL 1PF3A 3ZHNA 2C3VB 4PG2C 1SRDA 1UD4A 1I7UB 1YEHL 2R2CA 5B8CA 1CGSL 4PTTB 1RSYA 5DHXB 5EC1B 3BT2L 3ALWA 3GKZA 3DX2A 1QPPA 2XUWA 3RBGA 4KQ3H 3PABA 1PTZA 1XMEB 3ZMNA 4CKQA 2J6WA 1IBHA 1KYOK 3ILPB 2I7SA 4UUJB 4X6BA 5E7FA 5F1OB 4EO5A 4HH8A 3KNBA 3ECBB 4HKZA 2ZKYA 3UZQB 1YEIH 2V8LA 4N20A 2JH2A 3FH7A 5DQ9A 2BLFA 2DYPB 4WI5A 4XAWL 4P5MA 3GMLA 5GRZA 4BD4A 4YZFE 3TXAA 4NEHB 1T3FB 1VFBA 2E7ZA 2W92A 5EA0H 5DD3H 5DURB 4GEJA 3PV6B 5FYKD 3VTMA 2B15A 4QXGH 3AU0A 1FDOA 1BEYL 1NMCC 3BPCB 3RZWA 4X8CA 4BWWA 5JLZA 4RFEA 4GSDH 1X5AA 3GBLA 1SLWA 3PGFL 4KROB 4DZ8A 1I3RB 3FCUB 5F3BA 1QWUA 2G9KA 1FL3B 2X4SA 3GB7B 3K0YA 1OAXH 3Q0HA 3V9EA 2M8XA 1WTGT 3U4BH 4F7KA 1WFOA 1B4RA 1SJVA 4GBXD 1ADWA 4XB7A 2HSIA 1U36A 4QT5B 3WTVA 4PCKA 2BW5A 3T4YA 1OP4A 3KPLB 1UA3A 5BJTB 43CAB 2VRAA 3D39D 4KJWC 3ZHDA 1RUQL 4WFHD 4DEPC 4KUZL 5I73B 1YDPB 5DJXA 2DBLH 1HI6B 4K94C 1OO2A 5F9OL 5AAMC 1ZTXL 3V52H 3G5XA 4DK3A 1VGEL 4P46A 2CO6B 2ZOOA 1ZD6A 4MQSB 2V17L 4GAYA 1UCTA 4U33A 4IK6A 3DXAB 3LXAA 1MF2H 4MNHB 1R3KB 2VC2L 3Q8FA 2ZKMX 3D3VB 5I0ZA 1DDHA 4HHAB 4PRPD 2WY3B 5CBAB 3OMAB 3PWVB 2FECL 1WCMA 3OLGA 2WLHA 2DQFA 3BZDA 4M93B 4X9IA 3QPQD 3QYCA 2X1XR 3FQTB 4JDZA 5FA3A 1PQEA 4APQA 4MX7B 4Y9GA 3PWPB 3VD7A 1R17A 2BFGA 1A4JB 3DO7B 5J1AB 2VW4A 3CZLA 1QI4A 3M17B 2GJPA 3ZUCA 4YPGB 4F37F 3FT3B 4AQAB 4Q89A 3LD8C 2R69L 1JK8A 3JT2A 5D70H 1RULL 3S3JA 3A24A 1CICA 4FQIH 4R6UA 2DLEA 2FK9A 3UGXA 1UZ8A 2IF7A 3LSOB 5T8IA 5L2JB 1EAPA 3D33A 3ZTJG 4W9KC 1NGXA 5K1VA 2YQBA 4HWBL 4HIEA 4TM9A 3MYJA 4IGBB 4EI6A 3IRCA 4XMUA 3TBYB 3LZPA 4LK4A 4OLUL 3FCSB 3VSTA 3S35L 4OKVA 2FYYB 1D5BA 3PIQB 5DT1L 3VXRE 1U4EA 3NG5A 4IRJC 3DGDA 2CBTA 3QHTC 3VRLE 3DVGB 1RK0B 1I31A 3EH4B 1LWRA 4OZ4B 4X5RA 4EZLA 1YNLH 3KPNA 1DVFA 3OJ2C 5IW6A 5DD6B 2L4OA 4OB5L 5A16A 1UFUA 4PJDA 3P3UA 4MAYD 3UBXA 4AZDA 2E56A 4P5KA 3PY9A 5IW1A 3O2DA 2HAZA 5CLWA 2D9CA 5J6GB 1AAJA 1JVOA 2OTUA 3DSFL 3T0BA 3BH4A 5DHDA 1HHIA 4I3SH 1MCRA 2VJ0A 1YYMH 4FNLL 3RFRA 1KENL 3RWCB 1UT1A 3R06B 1DJGA 5DMJB 3N85H 2WTPA 3HU2A 3TNNA 3M88A 4D9RE 3QJSB 4JM2C 3W0WA 3TH4T 2VSMB 1GPOL 2YFOA 1G7JB 3MJ7B 2VDPH 2VPZA 1PIFA 5ERWA 3WSQH 4LLYB 4DKTA 3SUJA 2ORBH 3O0RL 4KO6A 4W81A 1CURA 3BVXA 1P84J 3ZO9A 3DMMD 3FU7B 2Q7AA 1BZ9A 5FW8A 3UG5A 5IOPB 1QBLH 4HH9A 2CXGA 3LN4B 4NNPL 5DC2A 3ZL4H 2WVVB 4U1NB 5GS1B 2E2IA 4FA6A 5DU7A 4LSRH 1QZNA 1E50A 3NBNA 1JUFB 4YBHA 5ESQB 5H35A 1NGPH 2J8UB 1N2RB 3IEAA 4XWOC 4I18C 3OSKA 2PXYD 4G6FB 4JE4B 4BGDA 1XB6A 3IVKA 2IAMC 1BQKA 1TSHA 3C8DA 3PG2A 4OFQA 2FQGA 4WGVB 2A6KA 1OTTC 3GIZL 3GI9L 5C0CB 2BP0B 4A7TA 1DVUA 3MLTB 2UXTA 1FZMB 1FVDB 4NPKA 2PW1A 5IQ7H 2MCPH 4M02A 3QC5X 4Y4KA 3ULVF 4M1DL 1LMKA 3RX5A 1H5BA 3FCBA 3TTYA 4Q9RH 3KLQA 4O5LL 3VWJA 4IBVA 5LVEA 2ZSWA 4E9WA 4BCXA 2YBRB 1X9UA 3MRNB 3OKOB 4X80H 3ZDYB 1NFDB 3BQVA 2R9HC 3EYVA 3QNZA 3T4AA 2OJ1A 2WBKA 3MO1A 3RBSA 3K1DA 3U0TB 5FX3A 1SEQL 5JOPD 4FKEA 4MQ7A 3BD5A 2CDFB 3QFDB 5JDSA 5MEPB 3TM6A 1U8MA 5IBTL 5KJ7E 5JW4M 2X12A 4G6JH 1ZT4B 3IN2A 3OKYA 4ISVB 4N0YH 5CZXC 3B2VL 3AS0A 2BCKB 3F6JA 4HCRH 5A6MA 2AKRB 1UB5B 1PSKL 1L5GB 3K3QA 3VD3A 1R3LB 1RY7B 1CYWA 2DV6A 5BV7B 4IU2B 2H8PA 4O2CA 4XCFH 1T7ZA 2VN5A 2ESVD 3EDKA 1A22B 2IAND 3JZ7A 4IU3B 4CDGC 3HEIB 4HBCH 4I9WE 5KN5A 2FGWH 2R69A 4DPRA 4QKTA 2YAPA 4YC2B 4N6RB 2QLYA 4FXGA 1D7CA 1I53A 3MOBL 5F8QC 4E5XB 5I66A 4EJ1C 1QBML 4JHAH 1R3IH 4OIFA 2VN6A 1AHWC 4HWBA 4E41B 3D69B 4M5TA 5LAPA 4GI9A 4GG6A 1FVCB 1N5AA 1PZBA 5C07E 3GSUB 2DZEA 1KGCE 4H25B 2VM9A 2XWDA 4OD1H 4OZHA 5B3JF 1UOKA 1I8IB 1TU2B 3ZQ9A 4LPXA 4QHKI 4XVJH 3ZT6A 1WGVA 4HKBA 3W56A 3CN1A 3V95A 2Y4SA 1KCKA 5GS3A 1YNKH 4O4YH 4V11A 4QY8B 4J3WA 1N19A 1PZDA 3FTWA 5FLVA 4MA8L 3AMLA 1LYQA 1UWXK 3QUXA 2EYTB 5E8DL 3ZZQA 4HXAH 4TUJB 2C9QA 2Z7UA 4HIXH 3IDGB 1GSKA 2YRPA 1OM3H 4FHBD 5J1SC 3HVNA 1E4KA 1RZJL 2MRYA 4GQZA 1QFHA 2R29L 2WLLB 1AD0A 4QRTA 3VI4B 3WHXA 4BWUA 4WWID 4NM4H 4XB8A 3OGCB 1TZGH 4EZJA 3DROB 2DWDA 1YG9A 4PJ5B 5JA8B 1M6OA 4B9IA 3UC2A 1N3NA 3S98A 1BVNT 3IDUA 3PL6D 4ZO8A 2VR8A 2W95A 5I0VA 5F3HA 4LPUA 3FT2A 3B3IA 4P4KA 2XBZA 3O2VH 4NJ9H 4K9EH 2VDKH 2RFXA 5D4QA 4NZRL 4YXHL 4Q6IB 1H8OA 2VZVA 4LLWA 4QXUH 4MA3A 2YMXH 3FB6B 1T1XA 4MD0A 5CO1A 5D7IB 3FQ4A 1TZAA 4GAFB 5TDPA 4MZRA 1CFMA 4G9FD 2OMTB 1U92A 4HUXB 5C0GA 1XR8B 4DVBA 2I60H 4UT9L 3JTTB 4GKZA 1MUJA 1WA1X 1A66A 5F7YC 4KPHH 4K3EL 4DKFH 1HHKA 1YECH 1JTPA 1J9RA 1PDKB 5KSAB 3BSZL 1Q0YH 1X5MA 3HG1B 3PP3H 5CSZA 4AVJA 3L3JB 4LRNL 4PJDE 4ENGA 5HHPB 3RVTC 5JW3H 3GTGA 1HH6A 3GC3A 1D2PA 1CIUA 4DMRA 3D9AL 3CFUA 2ITEA 2QMKA 5IKCB 4K23H 7PCYA 3CVBA 2H0EA 4NKDA 5JIQA 1TQUA 1QKZL 1ZIBA 2DTMH 1AZCA 1LQBC 4FNPA 4B0MB 1QABA 3QBTB 3X3GH 2VR7A 3TO2B 1UZGA 4LU5H 1UWGL 2GABA 3W0WE 5I8OL 5EZJB 3ESUF 3WNPA 1URLA 3PWLB 5AOKA 3ISWA 1MLBA 2AV1B 2CCVA 3K72A 1QYGL 5DJCA 1JPTH 1MFBL 4G9DB 1A6UH 5E0FA 3FQYA 3P0GB 4MTMA 2ZXEB 4DCQA 1G1YA 5IWLC 3VXNB 5FTLA 1DSFL 1RZ7H 5G4OA 1OK8A 3WGVB 2AAVA 3OZ9L 4QHLA 4FXKB 2HH0L 2K6ZA 3BVTA 3U4EB 1X5XA 2WLMA 5AWNH 4XPBH 4M48L 1KTKE 4F58H 2V0AA 4X8XA 2ATAA 1P7QA 1I7TA 3VTAA 2AJUH 2UVEA 3TL5A 4OCYL 5IB5B 3CZFA 1ZEAL 3QQ9D 1FDLL 4M00A 4PP2B 1SN2A 4PM1A 6FABH 2IDFA 3RWJA 4QLWA 4UNIA 2VQUA 5HI5C 3HR5B 1NUDA 3E1F1 3MBWA 3PUUA 3F7VA 4PJIF 3TA3D 5D6DC 5GRJH 4DP9X 3HC3L 3FQUA 4TPRL 4ZXBC 4NCC2 5F7WC 4ELDA 1E6OH 1U2YA 2HFEA 5CZVH 5JUEH 2Y5TA 4L4TB 1M7DA 3KLDA 3QDGB 3ZDWA 4BM7A 4JM4H 3QUZA 3ZKMC 4FOMA 3QRGL 3JWDH 4TUKH 5EUKA 4CMMB 3O3AA 2XKUA 3WFDL 4Z7NF 1Z5LA 5CINH 2WPGA 1GS8A 1ZTXE 3ULVL 4UQ2A 3DX4A 5FO8B 1QR1B 3T0AA 1BVLB 2BNRA 3G5YB 3CN4A 2XG5A 2UYLB 2EO1A 2VXQH 4JDVB 3TTSA 3TC9A 2B5IC 1OANA 4D0CB 1I9JL 4RIRB 5CEXB 3UBXI 4DN4L 3GS0A 4AYSA 3B4NA 4LPWA 3BH9B 3L6FA 3CIAA 4LGPB 3FRPG 3ZDZE 4OVVA 4ZSOB 1LWHA 2VLMD 4IRSD 3FTYA 1BZOA 1KB5H 2ZD0A 1Y18A 3EJRA 5GS0D 5HDQL 4HF5H 3IJYA 3GSQB 1ZDQA 2R29A 3KHQA 1NLDL 1N9PA 2OMZB 2LE9A 2W9EH 1JK9B 5J13B 1AR1B 1ZHLB 2E6QA 4UIKH 3CX5K 4F5CA 4RAUA 1TYEB 2A9NL 1EDYA 2EZ0C 2N7AA 4JNXA 2FEJA 1XZWA 3QPXH 5ABDE 1VFMA 5C3LD 2BVYA 4Y5XC 3HNTL 5SWZB 4GG6E 3FUNA 4UZUA 5IVZA 4RBPK 2EC9U 5DLML 4OZHE 5FDYA 2OX5B 3L3HA 4M6AA 4AMXA 4P2QB 4UT9A 1P4IL 1VERA 3K4AA 3L9YA 3DRTB 5K9OA 1LEGB 2YPKA 1UFGA 1YUHA 5CD3A 3GMPA 3MNMA 2X2UA 3OXSB 4PY8I 2A9MH 3D85B 2J44A 1LXMA 4PJ7B 3BSZA 5MI0B 2DEWX 3W9EB 3FTUA 5IG7A 2JQAA 1QSEB 2COQA 2HRPL 1MLCB 4W93A 3VFNB 2ZTBA 3KPPA 3NRFA 1W9XA 4K5LA 1YRKA 4P4RB 1L9QA 5LWYL 1JTTA 3DOSA 1A4BA 5FTMA 3BAJA 2H5UA 3IKCA 5CEZE 4P3WA 4LOVA 1AQDB 1HXKA 3ZO0A 3PQYB 1WIPA 3Q43A 4DO5A 4NGHL 3V4PB 4ABVA 3MROA 1XZ0B 1U6AL 4ZMQA 4NS0A 5IV2B 2F8OA 3V4VH 5FUZL 2X42A 3X11B 3WFBL 1A8ZA 2PYEB 3BP5A 4PIBA 2J8OA 4ZUUB 2H0PA 2VN4A 2H1LM 3JV6B 1JPFA 3NCMA 2FECI 4R0LA 2DQIH 2H1PH 3FKUS 1UD2A 1UZ6E 3RY5A 3CH1A 4OF5A 2BK8A 1IC5L 3CSPA 3ULUC 4WTQA 5KYYB 1AS8A 1HESA 2GT9A 3K2KA 3EGXB 4BK5C 2IPKB 2G0KA 2WB7A 4MQXD 1ORQA 1CC3A 2DQUL 5C3TA 3QQDB 1J1XH 1I3GH 4PG9B 1JPSL 3ARUA 1HNFA 2JFCA 4LCIH 4ZMPA 2HKHL 3BUTA 4WLCA 4JMNA 1JNHA 2C1OB 3I74A 4Z23A 1DBBH 4LNVA 4L0ZA 1IRAY 2BRRL 3IM1A 4G1EA 3UP1A 1EJ8A 1NFIB 3DPBB 2F53E 3DV4A 4PRNA 5D7SH 3JWOC 3OX8A 2CA4A 1OM9A 1IVTA 3H9HA 1F4HA 2VB5A 3AGWA 2KYIA 4KKZA 4GXUM 4C8XA 2W0KA 3IU4H 4OCWL 4U6HB 1J0IA 4JPWL 3SN6N 2ZNXA 2EXTA 5TQ2H 4R90L 5DDHA 1J5CA 3CWGA 5D7HA 4BUHA 1OV8A 2XG4B 4FLSA 4FG4A 2P80D 1N26A 2FEEL 4RVBA 4OQTH 4ATTA 1RZKH 2WLJA 4PRBA 2X9XA 2HKFL 2CBPA 1WAAF 1DLHA 4JFPB 1XGPB 4I5BA 1SYSA 4NQEB 1NGQH 1A6AA 1ZLVK 2O5ZL 3MV9E 1IAIM 3QYMA 1MAML 4ZOBA 1CK0L 2Z92B 1OAZH 3NFNA 4X7SH 4YHLH 5D2NA 3QORD 2RQEA 1LE5B 1V7MH 4RGOL 4BSJA 1C08A 1MW0A 2F7OA 4FX5A 1RV6X 5E03A 5GGQL 5GGVY 3VXRD 1I9RL 4APXA 4AC2A 1BIIB 2QQKH 2OW7A 2F8XC 1H15B 5T1DL 1A2YB 3CZSA 3SE8H 2FWOB 3NK3A 4FA8A 2WGXA 4X6FA 4FG2A 2HN7A 5JORB 3E8VA 5E2UL 2JB6A 2GITB 1F6FB 1AHKA 2JKRM 4YDZA 4KZ0A 2J5LC 4NDMA 2V33A 1U8CA 2PTTA 1GZHA 1PCXA 4R3SB 3VI3B 2ZXQA 4I0CC 3WLWD 3UTQB 2NYZA 3WJMA 3CJJA 4G82A 4ONGL 2E86A 3WNJA 3VJ6B 3VW3H 2JB5H 4KXZI 1AD9A 2VMEA 2FR4B 4HOZA 4KUCF 3L13A 5HYJB 1CFQA 2ZYRA 1MCOH 2J43A 5EU4A 4Z6AT 1VZHA 4BFOA 5HHQB 2BNRE 2A2QT 2JV6A 4PCTA 4WHYH 2J2ZB 2NY2D 5E6ID 1IM9B 5L0QC 2V3FA 3BUYA 5CIPA 3IU3B 1BREA 5DFVD 4LP4A 4UM9B 3JQOB 4JHZA 5JOFB 4LLQB 1QFWM 5I8CB 5JTWA 4MMXB 2OSWA 5CBEB 1JIBA 3FFCE 1R5WB 1XIWC 5FYLE 2A9AA 1U3HA 2K3HA 5E8PB 4H88H 4PWEA 5DUJA 4ZJ9A 4MS8D 3EGDA 1F3JB 1E9PA 1NCBH 1SHXA 1F86A 1U42A 2BDNH 1OWWA 3LQAL 3VFGH 1FFPA 4F5CE 4ZFGH 3CZJA 4GMTL 4OM0L 1PD6A 3FUJA 4KVNL 3SSGA 5IIEA 2QV4A 4BWTA 5ESAB 2W91A 4MWFA 4MZ3A 3FQ2A 1BW3A 3C60C 2Q8AH 1GZPB 5I0DA 1IEHA 1E40A 3LH9A 3CVCA 4YX2L 5IFJB 3F5WB 2GVYA 4I3GA 3STZB 1YPZB 1FNHA 4W4OA 1PKQA 1ETZB 3FRPA 2OBGA 1IO4C 4NBXB 3EOTL 3I75B 4DGWC 1F18A 2VMCA 4WNQB 4Y1AA 3VXUA 4Y5YB 2JKJA 3BDBA 4DAGH 3CE1A 5DFTA 4BH8A 5HYSG 4KQ4H 4R7DA 4IOIB 1HQ4B 1TO4A 1K72A 1CDUA 5FYJL 2J20A 3RWGA 3LZFH 1TFPA 3KW8A 2BIMA 3FZUD 1I1AA 2MOGA 2OJEA 1KEGL 2Q7YB 1G5GA 3M46A 1MH5B 1IAOA 2OR7A 3ARDB 3VFPA 1ZS2A 3IDNB 1ZLUK 3NA9H 4BCYA 5IR1A 4K8RD 1UWXH 4U6VL 1ADQL 2W07B 4F33B 2AS5M 5B22A 3IMBA 1M3IA 2ICEA 2QBWA 5F7BA 2GSGA 4YSOA 4J3UA 3MRQA 5DTFA 4P2AA 1MQKH 3O41B 4Y2LA 4PH8A 4Y4HA 1YA5A 3NPSC 2MOQA 3GBNH 2JCCE 3KEDA 5I1HL 4PPTA 1T7YA 2BC4A 1W80A 5D93C 5AVWB 4I9WD 1B0WA 2EYRA 3GZKA 4GUCA 4J3BA 3U1PA 3JVGA 1MFVA 4E0RA 4KJQC 4U1KB 1IEBA 2C9SA 1ZGLM 4DO6A 3OJDA 5GSVA 5MEOB 3O6LH 3FBKA 3CDZB 5AVSB 3OB8A 2BNQA 2UXGA 4M5ZL 3ZTEA 3STLB 1YQVL 3KXFA 4GY4A 5BO1L 3LKNB 4WJG3 1UOLA 2H32H 2CRZA 1P7KB 2A0LC 2B39A 4HXBH 1IKFL 3W1ZA 1MRDL 4IBYA 1JZ3A 4JO2L 2HYMA 4TNGA 3QR2A 4UF7C 4NFDA 4Y16C 4AM0B 2XY2A 4MXVF 1DQDH 1NCHA 5EMYA 3GMMB 1LO5B 1LO4H 3EF7A 2O4EA 4P46D 3I2CH 4M5YH 4X4ZA 4E9VA 4GYBA 1SBSH 3GTOA 5EF2A 1AO7B 1NH6A 5JIHA 1ZAGA 5HI4D 2MNWA 2IWGA 3VG0L 1TEGA 4LRIA 3LN5A 1OTSD 4YHPA 1MCQA 3B83A 1CJYA 1HINH 3DPDA 1RP8A 1KC5L 1CZ5A 5D4IA 1ED3B 4GRLB 4B27A 5I15L 4IKKA 4G3YH 3VVWA 3S88L 4NCDA 5C6PB 1JNNL 4JN2A 3L5WA 3AMKA 5DJ2A 3R7QA 5I1IH 4NHCH 5KVDE 5IBUB 4W9ZA 3IMVA 4PJIA 4Y5VC 3TPUB 4APQD 4FN0A 5TDNA 3NGBB 5J7CC 3AT9A 4M62L 3V0WH 5KS9F 2AK1H 2IMMA 2NNXA 3B9KC 3LB6D 3MNVB 4KXBA 4XB3A 3ME0A 5FIEA 2IDQA 4W9HC 5J5EA 1RERA 3IFNL 4Z9KB 5KSUA 3SQOH 3L7EA 4LOFA 3ULVE 2NY6C 2PP7A 1EEZB 3KPMA 3VE0B 5IHZB 5B7FA 3CK0L 4KKPA 5KBLA 3UTTA 2O61B 2CCWA 3MCG1 2DQCL 2VLLA 1HCZA 4AEEA 1CICD 3CFCL 5F9AC 3EJTA 1TVBA 2WIIB 3CBKB 2X9WA 3EBHA 2ZWSA 5T1KA 4RRPG 4Y19A 3L4CA 3GSRA 2AVGA 3MRHB 1INQA 5E8OB 1MFCL 5E95B 2EKSB 1KCSL 5F7EL 1IGIL 2VDPB 3OAYK 5D2NE 2WINB 2N0MA 5F6HJ 3MRFA 3T6ZA 4HOMA 3FB7B 5JQ6H 5BZWA 5KYXB 4J28A 2J25A 4UDTA 2NR6C 3FUHA 5SWQB 5IUSA 2MCMA 3SQBA 3I6SA 5ID0B 3QS3A 2PP8A 4PWHA 2Q2LA 1QLEL 3QZOA 4JRYD 3EYFA 4KK6C 4AH2A 1DVFD 1HWGB 4AM0Q 4OUOA 1F58L 5SX5K 4F57L 2J8HA 1P5UC 2Q8BH 5ACZA 3K71A 4HYTB 2EUWA 1K3ZA 2WZ5A 4JREC 1KT2B 5DLLA 1J5IA 5DJ6A 1MCLA 4EI0A 5DEFB 1VADA 3FSAA 5K9JL 5HHME 2BSEA 3NABH 5G4MA 4OV6F 2QTEA 2DQDH 3RDTB 4POZC 4V2CB 3LKRA 5CGMA 1ZK5A 5HXMA 3WE6B 3UXFA 4NQXB 5HDBB 4KTDH 5CILL 4HIPA 3HMWL 3QXDA 3W0WD 5B3JE 2GUOA 4LDOB 2R27A 4G8GE 1BJ8A 2GJ6A 2PF6A 4BFNA 2HA1A 3HE7C 1EU1A 4WKZA 1SXZA 3WCYA 2H3NB 1X4XA 5HVFB 3LH2H 4AONB 2WXQA 4KH2A 4QJ3B 4HETA 1FNAA 1OCCB 2B2XL 4PRAB 3WL9A 3C09C 2DBJA 3QXAB 2HZHA 5K39B 5B38G 1PNCA 1ADQA 3O6FB 2D8KA 4R26L 1WF5A 4IK7A 3PHOB 4LVNC 4JKKA 2IH1A 4R2GD 1U4FA 4JRXA 1FNGB 4XVUD 1G7IB 3ARFC 3BAKA 4MJIB 5FFOA 1ZV2A 2VCOA 2A77L 3S8GB 1SHSA 3WOVA 1E8YA 3H4FA 4YR6A 4YS4A 1CLYH 4B41A 5L7XL 2C3HA 3FO9B 1ZV9A 3WFEL 4R7NB 2GAEA 3IFOB 4H20L 1UYWH 2AITA 2WBJC 4R4NC 3FN9A 3BO8A 3V0IA 4AZ8A 1PKQE 1KPUB 2H6PB 2OZNA 3F3HA 4KMLB 4KO9A 4N1EA 4P8QA 4RBPH 3S3PA 1DSYA 1NCWL 5C09B 4B96A 2ID5A 1NC4A 4CRZA 2JI3A 3US0A 1MHEB 3OB0K 4QF1A 4Y1AE 5CEYA 1AQMA 3VWJD 1G7LB 4D3CL 1JGVH 2BOCA 3BAXA 3MLUH 5C8JA 3BQUC 2XA8L 3IPEA 4WUUA 3HNSL 5AD0A 2APTA 1NFKA 3O6ML 1PLAA 4N3UA 5AW4B 1IAIH 2A73A 3ASOB 4K3JH 2DIBA 1OSZB 5AAWA 5DUBA 2Z65C 5AZEH 4F7MA 2JJSC 3UYRL 2IDTA 4NSKB 4U1LA 4EI5A 4FQQA 4MCZA 3BZEA 4FQLL 3V9FA 1SXNA 3BCDA 4IIZA 4LF3B 5J56B 3REVA 3L1EA 1GR7A 1EEQA 4AL8H 4BFKA 3ZZ1A 4LLUB 1KPRA 1UT9A 1W0YT 1TTUA 3GI8L 1NM9A 2PPEA 1E6JH 3FFDB 3JUYA 4NQVB 4UAHA 4WO4B 4J3SA 3GM0A 4HS8L 2WCPA 4QXWA 1SY6L 4PHZA 2NXYB 4GP8B 4ONFL 3V6FB 5HYSA 4N25A 3LRSB 4GKSA 2UY6A 2BNQE 1R4XA 1C8PA 1XGUA 2O5YL 3O8XA 1WAAA 2NY0D 1NGWA 2CWRA 4LOEA 2ETWA 1UURA 2ITCB 3CC5A 1NCAH 3I6GA 3AZUA 2VLKB 2K9FB 1U8JA 4PBXA 3HFML 4GKNB 2A69D 5E94B 3RWEA 1VGKA 2ADIB 4J27A 4E42B 3FCTA 5FDWA 4KROC 4NQUA 2C7UA 3RB5A 2VSDA 1K5NB 5ICZA 5ADPH 2VDKB 3QJFB 2E76C 2OTPA 4AW4A 2V6HA 1MCJA 1NA8A 4LOUD 2JVUA 3EO0B 4ILDA 3NJXA 4TTDD 1AZNA 1XGZA 4C2MA 4MYWB 2B0SH 4PVLA 4YLQT 3CFEB 2YPLA 4XGZA 12E8H 3MDJA 3TNMB 4MXQC 3QUXD 3U4AA 1XF2A 3UBGA 4XC3H 3O4OC 4PJIE 4FZEL 4R96B 1N5YH 2IXQA 2MPAH 1F56A 3U7WL 2IAAC 2ZOUA 4XCYB 1NCDL 2MSPA 4PB9L 2AXGA 1YEFL 5T1MA 4FTVA 3E6FA 4N9GA 5T1LB 5IOKA 1THCA 1U93B 4ZUSA 1YY8B 1JYVA 4Z7NE 4WI6A 4F9LC 3VDAA 2DMRA 4XTRD 3NSDA 1NCTA 3PDOB 4BFJA 1AOZA 1LO0H 1X9RA 2I69A 3HAEB 4M7JH 3BGFB 2OW6A 4P4KD 2GJZA 4XMLH 1ZLVH 4Y19E 5A2LH 3A6CH 1HZLA 3C5ZC 5EU5B 5TFSL 1OF2A 5E1QA 3S96B 4CGTA 4FQXA 2Z35B 3GSOB 5G55A 3L2MA 4UQEA 5K93A 4RNRB 3TEZA 1ZRUA 3RB7A 3GRGA 2CKBH 1KNOB 2JI2A 2QR0B 2WXRA 1VEOA 1M42A 1MXDA 2YUZA 3OF6A 3TCLB 4G70B 4X6CF 4LLAA 1KTBA 4K2UL 5FUCE 5HYQB 2HWZL 3KPSD 5A2JH 1FFOB 1MW1A 4HC1L 4IGBC 4L9LA 3SKNA 1I8LC 1VENA 4A7QA 4HPOH 2PCFA 2R2EA 1CT8B 2HT2D 3FT4B 3GEWB 3GUTB 4HFUL 5GS0H 4Z1PA 5LBGA 4MMYA 3P4MB 1PZCA 2JLPA 3VSUA 1AACA 3QZNA 4V1DB 3X12A 4ZS7L 1D9KA 5BZZA 3KYOA 4NKIL 3ILQC 2VDRH 4CRYG 5EHFA 4AJ0A 5IMMB 3D0LA 1JN6A 3U82B 1WC7A 3HPLA 1OWRM 3PREA 3WU1A 2GJ6E 4EUPH 3HPJB 2R4RL 1KJVB 2VXTH 1FHGA 1XBDA 1SEBA 3WJLA 4GSXA 4LLMB 2AK4B 3K2UL 1S7VB 2DMCA 3T6VA 4JY6B 1N0LA 3ILEA 4D0DB 5JXAH 2QPSA 1UUNA 4WWNA 2D7MA 1QSFB 1FLRL 3CDCA 2ZF8A 3L3OB 3QJZA 4G8EA 4PJHE 1DBKL 4JGMA 4XCEB 4LLDB 5KG9A 1G9ML 2Q86A 2NY4B 3DJZA 1PU0A 3X2KA 5B7MA 5JHLL 3KD4A 1C8QA 4LVOC 1B4LA 3BZFB 3Q2NA 2IFFL 3TYFA 3KYMB 3MCKA 1KB5B 1N12A 1X5KA 2NW3B 3MTXA 2F58L 4JM2F 3NZHL 3SPHA 1D6VL 1SY6A 5ITBL 4E9YA 2V7HA 2NY5H 3QEUA 4Z7UA 1HC1A 4W9DC 1MCEA 3GTVA 1N0XL 2KDYA 2AMGA 3NQIA 4PI2A 5GS1C 5ALCH 1RVFL 3P2BA 3OAUL 4NQDB 2FX9H 2CJUL 4JDEB 3L2NA 3Q7JA 3OHXA 3QUZD 2WYTA 2X7LA 2Q6WB 1AXSB 5IQOA 3EXLA 5E70A 3WIFA 4HPHA 3NFPA 3PAYA 2P8PA 15C8L 1A25A 1U8QB 5GSRA 5B38A 1N64L 3PAUA 4G6AD 3NVQA 1PL3A 4AIZB 2B3RA 2WXFA 3DURB 5C0BA 4NCC1 2BNRD 4XBGB 3CHXA 3T2PA 4WUUE 2XWTB 5DO2D 1MG3C 4HLZG 2WSDA 3TWCL 1BOGA 3Q6GL 3VFMB 4XH2A 3SPVB 5BMFH 3TFKC 4JO4H 3X13B 2PLTA 3A22A 1ZLUH 4YHOH 2G5BB 2C45A 3QP3A 1QO3A 5KUKA 1WC2A 1NDGB 3QCVL 4ZI8A 5D1XB 3ZE0B 2YXVA 1KBKA 2B63A 4GH7B 1ET8A 3WTYA 3RZCB 1MJUH 3FO2B 1QX1A 4ANWA 1UH2A 2C4FU 3OPZH 4PGCA 5I30L 4HUWA 4E9SA 1MIEL 5D7JA 5CMAB 3PWNA 2OXHB 3CX2A 4JAMA 3NH7H 4KODA 2YBGA 3LHAA 3EJCA 4HU2A 3SOBH 4IBLT 4YBQD 3QAZB 4OCXL 4P2OC 5DQJA 2QQLH 3NJNA 4HJ1A 1DO6A 1YYLH 4U6YA 4ZTOH 1CL7I 5I76A 1GGCL 1DL7L 3T0EB 1KCRL 4CL7A 5KZCB 4FMVA 3G6DL 1AGBB 3V4VB 1KN4L 1F0LA 1WAAE 5CCGE 1H3PL 2GEQA 3TM7B 4UZGA 1UXSB 3LDBC 3WTTA 4QOKA 4AWJC 5BV7C 2BH0A 2XT1B 3FQNB 3BN9C 5HTSA 4B5EA 1LHZA 1SJEB 1YMHB 3LKSB 3IDXH 1DSWA 3JV5A 4U1SA 1EZUA 2I32A 4K15A 2EICA 1A3QA 4GRMA 3C6LB 3ETSA 3JTSA 3SKOA 1P2CB 2V3DA 4YC2C 4CW1B 1XH2A 5CM1A 3FTGA 5IEKA 1WBYA 3LKPA 1TQBB 1D3CA 2QVFB 4HC1A 4W68A 2H6OA 2QGEA 3BGAA 3KPTA 3MX0A 2WWMD 2HFGL 3HN8A 4IQHA 2JKXA 4BUQA 1MFDH 1BQHG 3QUGA 2CPUA 1KBVA 1YEGH 4QKXB 3PDDA 4Y2OB 3BDYL 1Z5YD 3Q13A 5EFIA 4PJXB 2OCJA 2OPCA 4FTVE 5SV3A 3D2UA 4LDCA 2VOTA 3HLAB 4S1DD 4NI6A 4NIYE 3RVUC 4KDVA 1USQA 2W9DH 1S9WB 4L37B 5F7DA 3SE4A 1P1VA 1IT9L 2QSTA 4P05A 5MEQA 4BHUA 5AW7B 2ZUQC 4E9LA 2ZUVA 3BKYL 3VGFA 3A47A 1WAPA 2VABB 3P9MB 1XX9C 1L3WA 2EDFA 2IGFH 3VFUB 4AOKB 5F1KC 3G5WA 3RWHB 1NIAA 3X3FL 3K6SA 3Q1SL 3OAYH 1BF5A 1DJSA 3CVHL 2RJMA 4NQCA 3U1SL 4Y9FA 4OLYL 4OZIB 3GMRA 4G11A 4QHUA 3MGOB 5JHLA 4JN1L 5C7XL 4I4WB 1CCZA 4JFXA 2AXHA 3WHE1 1H19A 1G9NL 2K8QA 2FZ3A 2VL5A 4XN8A 5D4JA 4F91B 4YHNB 2GAZB 5SX5H 3OSVA 4NC1C 1E4XL 1L3NA 4PVNA 5HPMA 2K6YA 2VDMH 1ITBB 4PJGB 3V5HB 1HNYA 1U0QA 4KVCL 4MD5A 4FFVD 5AKRA 3VXPA 1UWEL 5EBLA 5A2CA 2E2HA 1NTDA 1U3YA 5D5MA 4N2GA 4ANUA 3NJGA 4ONHA 4YDIH 2AQPA 4M9PA 1XCQB 5FKAA 1JV2B 1MEXL 3BJLA 3VNYA 4KHXL 1FRGH 1FN4A 3QRBA 1BW4A 2ZWKA 3ULVD 5T5FL 3P77A 3WUWG 3F7PC 3WFCL 5KSAC 3PHQB 5EOCH 4ICXA 2KUTA 3VCLB 5F0MB 1OPGL 3JWNH 4IKLA 5DJYB 1GC1C 3HZVA 3DJTA 3T1FB 4YVUA 3SB3A 1CYXA 3F7QA 1DLFH 1UOVA 1KCUH 2YRZA 1A3ZA 1G8KA 4IKIA 4LVEA 2R4SH 2NYYD 4GBXB 2QVTA 4ZTPL 1T5KA 1NWPA 5KYWB 1IB5A 4PG2A 4NZFA 1BLNA 3B7TA 5JW4R 3D39B 3S3BB 3E1ZA 3EGSA 3CFIC 3AAZA 4AJWA 5LBSA 5BQ7A 1RUPL 1H3WM 5I1LA 3D07A 3GHPA 4P2YA 3ARBA 4NQSA 4PW4A 1U8PA 2J1YA 4K8RH 3I9AA 1TSRA 2PYFB 1XH3B 3SYQA 5HHMD 1XGQA 2R51A 1L9PA 5ITFB 1OAUH 4XNZB 4JCMA 5DRNA 3SQRA 2KPWA 2ZXWB 4FMFA 4PRPB 1CDGA 4JPQA 4XNUL 2EDYA 4IIQA 3AY4C 3N40F 4U1MA 4F1SA 1KFGA 4G80B 1PYWA 5FA4A 2VDQH 2FB4L 3OB0H 4X4YB 5L88H 1OQOA 2FBRA 3ZDXF 3UO1H 1RZQA 1LLAA 3PXHA 2NNRA 2WOBA 4MXVE 4PJFF 3IGAA 5FOBA 4XPFL 3FONA 4NPYA 3N06B 3GSWB 2Z4QB 2R1WA 1O6SA 1LMIA 4XVTL 4NO5B 2LW3A 3NIFF 2EABA 1ET7A 2P5WA 3GKWL 3MODH 2FJFA 4Z7VF 2V9QA 1LK3L 4N8CL 3ZKQD 2Q0ZX 4WW1B 1JFQH 1U3HD 4KFMA 2IV2X 4WWKC 4YL4A 1Q72L 3AC0A 3H6AA 4LSSL 1JNLL 1TTAA 4WCYL 1OE2A 4AUYA 3DX7A 5KS9E 2WXJA 8FABA 1FF5A 1M57B 5AUMA 4XMPL 1HZHH 2J21A 1MJJA 2ZUUA 1OIOA 4FQ1H 1F1DA 2VR6A 3GBML 4FQ2H 4Y0GA 4ZFOB 1GYAA 1O7DE 5AAMA 5IMLB 3EFOA 1AGFA 2CBMA 5T3ZL 3UYPA 3WKPA 2F68X 2MCAA 1V55B 3Q8EA 1P4BL 2R7EA 4Q56A 1Q94B 4QOKE 3F04A 5B1JA 4MAYB 1IIIA 3N9GH 4X5WB 1PY0A 4MMZA 1ZCRA 3CVHA 4L29A 5EDXA 3O6KL 1EH9A 1CZ8H 1TEYA 1K6QH 4Y1AD 3VXUD 5J13C 1AR1C 3O11A 4RZCB 1CD1A 1MVYA 3KR3H 1KIQB 1B2YA 1NC2A 2H32B 4H5SA 4MXWL 3IJSB 5E5MA 1SOXA 3QEGL 1SXCA 3GXDA 4AV5A 1KCWA 2APWA 4KI5C 3LIZL 4OSUL 4LVHC 3KWVA 1I1AD 1KQGA 1SOKA 5AL0A 5JIPA 5E5UB 5KOVC 3LPOA 4FEMA 1M2VB 1RZIB 4WGWB 4X6CA 1GMEA 5E6ZA 1GOFA 1F41A 3LS5L 3V5DA 4Z8FL 4DN3H 2AABL 4PFEA 3VGHA 3HZKA 4Y4HD 3DMMB 3K6IA 4I9XA 3L3GB 1DZ0A 5T5FA 1QNZL 2I24N 1U8IA 2ZG2A 1KXHA 1I7ZA 2A68D 2PXYB 4AGOA 4PS7A 3O2DH 4AV0A 4ZFFB 5AOMA 4HV8A 2BNQD 3EG9A 4IRJA 1E4JA 4PJ9A 3KXFD 5C0JB 1YEHH 3QRFM 1CGSH 2E7BA 2ZOLB 3X12B 5IJCC 3NJKA 3BT2H 2WYZA 3MRKA 4ELMF 3CXHJ 4NQCE 3L2LA 2NXZC 3D25A 4I2XE 4XN4A 2J12B 4WU7B 1CI3M 1BQHA 1BQRA 4YDJA 4EDWL 3N1GC 4MLIA 5L8JB 1YEDB 4RGNE 3IT8D 1QWNA 3IJHB 1OT2A 1VEMA 4MVBD 5DF0A 3TLRA 5KJRL 1ZA3A 2ED6A 2YC1B 3DRQA 4CVUA 4PGDA 3GBDA 1ND0A 1PMYA 1UADC 2HTKD 3BI9X 5DZJA 3P54A 3EH3B 4XAWH 4X7CC 3DC0A 5JPMB 3BP7B 4JG1L 4JZNA 5I23A 2YPVL 1SYVA 2WTRB 2DJSA 1H3XA 3H3PL 4Q4IA 5IB1B 2ADFL 1F4XH 5DK3A 3ULUF 2JXMA 1BEYH 3FAXA 1QSVA 3FN0L 1M05A 4M5SA 2GY7B 1BBJB 2P5PA 1SOSA 3D4ZA 3NFSL 1T04A 2XLLA 3HBPA 2P45B 4GXUN 3I6LD 3UTTD 2E46A 4M1CC 1L7IL 3ZYOA 4ERSL 2JSFA 3UTOA 3H7BA 2YA1A 4TNWF 2ESVB 1VEPA 3E0GA 3GJEA 2IANB 3MREA 4I18A 4TSBL 1T80A 3EO9L 5T1KD 4QXTA 3MV8A 1LJMA 4H4NA 4W6YB 4Y19D 3RDJA 3S8WA 4HS6B 1UD3A 4NKMB 3T3MB 1TT6A 4KUZH 3UTZA 1Z0MA 3OAWA 4QRQB 5F9OH 5C08A 1ZTXH 4H8WC 1XF5B 2L7JA 4WTWA 5GISL 4J5VA 5E8OA 4ANXA 2Y7LA 1VGEH 4L3CA 4XXDA 4N8PA 4ODTL 3ZR5A 1S7TA 2V17H 3SCMA 3F58L 5F44A 2A6DA 2D2CC 4F2ME 2BY2A 4L8BA 1SOQA 4N4YB 4QWWC 3UBHA 2XIIA 1X5ZA 4NUMA 3WUWA 3B5GA 4M7ZB 3RNQA 1CD9B 5IT2L 1OK0A 2P8MA 4GQQA 4HJSA 1VB9A 2DLHA 1TWCA 2KHAA 2KQMA 2GPZA 2TRHA 5FC9A 4U3SA 5BUAA 2BSED 3T71A 2F7IA 1ZT7A 1XWVA 3FB8A 4CNIA 4GOSA 1X5HA 4O02L 4ZQKB 3RIAK 1YZZA 4LLVA 4Q9CA 4BUGA 2QADC 4K5PA 5C71A 1N68A 4GMSL 3TIEB 3WS6C 1NAMB 4E9TA 5DJAB 4ZO6A 1RULH 2EVHA 2G5UA 3RI5K 3I9PA 5FYJD 3LIZA 2GJ6D 4M61B 2YD1A 4K7PL 4BA0A 4BZ2L 5IJVA 1FNEA 3P02A 2OMXA 4HWBH 3MFFA 3X14A 1U8NA 3H85A 3NRPA 3OLDA 2VISA 5FWRA 2P5WE 1KYAA 1W16A 2Q3XA 2NNCA 2VZ1A 3CVDA 1O5PA 3S5LG 2XETA 3PL6B 4FFWD 3ZIYA 2IQ9L 4NC2B 4XZ4A 4OLUH 4ODXA 3SDXB 5T3XL 3S35H 5DT1H 4F2EA 2F15A 2BOBA 3L5IA 4JRXD 3RX7A 4PY7A 1LEIB 4DSYA 1TJIL 4JFWA 3DTDA 3L9RA 1AHWA 4P3CL 2G0LA 5CSGA 5GJSL 1TOXA 2DQJH 5F89A 1O9WA 1B0GA 4G9FB 4OB5H 1ZE3H 1G7MB 2E7DA 4XNQB 4CGUB 5INDB 2BIPA 1CVRA 1PFOA 5BS0A 4KMTL 4MMXC 4S1QL 1UD6A 4A6YL 1T4KB 4RQQA 3AG4B 2BWDA 2WLNA 5GRXG 1QMUA 1IL1B 2EIMB 2QGCA 1Q0XL 4FNLH 4JPSA 1KENH 2EVJA 1NC4D 2XPGA 3OKNA 3P69A 5E1HB 1WD9A 1HJCA 4PJEA 3SY6A 5TDOB 1GPOH 1JZJA 2DJUA 3LVEA 1PZSA 5A2BA 4WUUD 1J18A 3KLKA 1EWHA 2PICA 2CXKA 5CP7A 4HLEA 1KJMA 5CGYC 2KLTA 3O0RH 3AGVA 3QJHB 1D7BA 4KFZC 2O6EA 3TFBA 3QI9A 4UOQA 3OKMA 1DVSA 2B20A 3RWDA 1B0RB 4M8VA 3U6XS 1KIRA 1VLXA 3A4FA 4X6CE 4EI5D 4NNPH 3L5HA 4P5TD 5C0IA 2YPVA 4HX1A 1GYVA 3H0GA 3GMNB 3KBHE 4KXZH 4Y5YC 5LN8A 1BJ1H 1WH0A 3CLEL 5IVXB 4X98A 1UJ3B 3FMGL 1AG6A 4ZUTA 5EEXA 4KNSA 4GA6A 5DEGA 5FF6B 2Z34A 4M4PA 1AGCA 3GTTA 1FBIL 3ARDC 3GIZH 2D2OA 3GI9H 2E6PA 2ATKA 2VE6A 1I7RB 1AR2A 3MJ8B 3HC0A 3IRPX 2Z7WA 1DANU 4X7TB 1MRFL 3TIWA 3O8XD 5ESVA 4HAKA 5IHUL 3Q3GB 1OY3B 1I4FA 3NIGB 4MYPA 4M1DH 3ZTJH 2OYPA 4LAQL 3V6OC 3WKNA 1GAFL 2ROXA 4PW9A 3TA3B 4O5LH 4X5XB 5EZLB 3BWUC 5T5NF 5HHOA 1EXGA 1AG0A 2HPTA 3JV4B 1QUNB 1BG1A 4J4PA 4EOWL 1CUOA 4XXWC 5AL8A 4HGWB 3LPFA 4KBPA 3DVIA 4X9BA 3QFGA 3SULA 2YPLD 2NZ9D 5DD5L 5IBTH 1JZIA 2YGOA 1OSPL 3ZYIA 2VXSL 3B2VH 3T0DA 3RPKA 3DOHA 3S5YA 3A21A 4OZFG 1MCKA 1U58A 4R8WL 5E08L 2CKBB 1PSKH 1X3DA 3H8NA 5FK9A 4KX7A 3FQRB 4ZPVB 2QELA 4O02A 2UZYB 3CFQA 1EZVX 4QTHB 3EJPA 2AQ3A 4GI6A 4FTVD 1FNFA 4IRSB 2K9UA 3N50A 1KPVB 3RX8A 2O26U 2CJ3A 1S78D 3VFRB 1EFQA 3W11C 4HUVA 2PWDA 1E4XI 5C6TL 3AS1A 3MOBH 4I3SL 3WGUB 4GRLC 1QBMH 1YYML 1HKLL 2A9BA 2VDRB 4BZ2A 1AQKL 2N7BA 3MV8E 4FABL 4GG8A 3NGBC 1BF2A 4PJ8A 4NOFA 3EJZC 4Z7WA 3UROR 1K83A 3HUJB 5JZ7C 3RX9A 3ZKSD 4GINA 4FQXD 4RFOL 5C08E 4Z7VA 4IBWA 2LU5A 4JQVA 1T7VA 3JWOL 2EO7A 2I9TB 2FUQA 4NN5C 5EBWB 3OKEB 2EE2A 1BX2B 3N44F 4KK5D 4F7PA 4M4RB 2C5DC 3OF6D 1H3TA 3MUJA 4LSRL 4TLUA 3WS3B 5CKGA 4MA8H 1IQWL 5E8DH 4A6YA 2YD2A 5HDWA 1SN5A 1CB4A 4HUNB 4PWJA 5JHDA 1H0DB 4P04A 2DF3A 3MVSA 4EKXA 3WNNA 1RZJH 2R29H 1JHTA 1MCCA 2Z9TA 5HHNB 4LHUA 1D9KD 1KYFA 5FUOL 1FZOB 2Z8VC 2OS7A 3BPLB 3FU9A 3UZEC 1WCBA 2BVQB 4KRPC 3OVUB 5H4ZA 4MHHG 1MI5A 2F18A 4PSRA 1NJ9B 3SOTA 2CUMA 1WWCA 4F7EA 2X70A 4Z7IA 4NNXA 3RDTC 1JZFA 4NZRH 4YXHH 2CHZA 4RDQF 1S7XA 4K4KA 2C9VA 2Y2WA 3ATDA 4N2FA 4QRUB 4QTIL 4TQEL 1LK2B 4L3EA 1O7SA 1HQRB 2FO8A 2YAMA 3B2UC 3QNYA 3CSYA 5I1DA 1FFNB 3A67L 1ASOA 3CCHA 4HDIB 3TT3L 2VR5A 3BH8A 1QR4A 4K3EH 3U2JA 4JHBA 3BDXA 4FCHA 3BSZH 4DVRL 5CCJA 1W0VB 3QT2A 1HHJA 4LRNH 1BQ5A 2QQNL 4PREA 3DX6A 3FN3A 3QK0A 5E8NB 4D0BB 2YKLL 1XL4A 2D7PA 3D9AH 5D71L 5E1AB 2OXGA 3HHSA 4NOHA 1FCGA 3MMEA 3QCUL 2XZAL 4N2BA 5JIMA 2VLRE 1DN0A 1QKZH 1HX0A 4WHTA 3F7LA 2XZQL 2HVKA 3EIFA 3SKMA 1T6VN 4ZZFA 2DQHL 5DA4A 4ZS6C 4NO3A 5AB0A 4PJCF 1KWKA 2IPUG 4UQAA 2JJTC 3S5LA 1UWGH 2MMXA 3ATFA 3EYOA 3TIDB 5I8OH 4Q58C 5C0BD 1PQZB 2OMVB 1R3IL 1BZEA 4A7SA 3F8UB 2V7NB 3E2HB 3BAYA 1QYGH 1ZWIB 4AK1A 3IXAB 1AKJA 3FTZA 4ZUVB 1MFBH 2XNAA 3G6JB 3WXWL 4KO5A 4GW5A 4XNDA 4JLRA 3ATAA 4AQEA 1CQKA 3EYUL 2BSRA 1TTBA 2XWJA 1JVLA 5IQLA 1OSEA 2YJLA 1RU9L 3KJ4C 1DSFH 2XXCB 1VAHA 1OLZA 3OZ9H 1DBJL 2ZOKB 2Y06L 3KLHD 1KXTB 2HH0H 3VNZA 1GZQA 5GGRA 1VSCA 4M48H 4NHUB 1O5DT 2G9HB 2OI9B 4XP9L 1KB9K 5LNGA 5D7JD 4G2AA 3HKZA 2FWSA 1E2ZA 1SQ2N 4M3HA 2G2PA 4OCYH 4PVMA 5CLTA 2AEQL 1ZEAH 5HHVL 1FDLH 5FECA 3QDJA 3QORB 1SNRA 4YOKA 2PTUA 1P1ZA 3RP1A 3U9WA 3BXNB 4JVUA 3VXRB 2EDXA 4S0HA 2NT0A 4B9ZA 1A9BB 1IGYA 2HT4C 2O6DA 3HC3H 2JCWA 4MBOA 1EZVY 4TPRH 3ESVF 3MJ6A 4JM0A 1BCIA 4QHNA 1GXEA 2EEOB 1I3VA 1KTDB 3TGXA 3UO8B 4QRSB 3DIFB 4QO1B 5FGRA 5K9QG 4QOKD 3QRGH 2NY3D 4ETQA 3FF8A 3WFDH 2XWZA 3BAWA 7TAAA 3MUUA 3ULVH 1XF4A 3IGKA 5IMKB 1EPFA 1JZ2A 3H9SA 1K2DA 1OP5H 3VD9A 5IMOA 3GSVA 2A7BA 5I24A 5IB2A 5L8LB 2F8VA 4NJAL 4XWGL 2MNJB 3U7YL 1I9JH 2NXYC 2VUOA 4DN4H 3KPQA 4F3FA 4O2FB 3KYNA 3QQ4B 2QL1A 3GMOB 2P52A 1SJHB 1S7QA 1TQCB 2NY2B 5E6IB 4RDQG 5D6CB 4YSAA 1R3JB 1HXMA 3ABGA 1HDMA 3UJTL 2Z0UA 3P4OA 5HDQH 3DIVA 4JKNA 3PJLA 1I1RA 1NLDH 1F2QA 1Q0YL 1A3RL 2UZXB 2VDMB 4LZKA 1C1EL 2E74C 4HOWA 2X38A 5IB3A 3G04B 3D2UD 1I85A 2BVOA 1WLHA 1MG2C 2P7TA 3GSNL 3VYPA 3OG4B 2DM4A 2A9NH 2MOVA 4IHOB 3EH5B 2CJTA 5LGYA 3EZ8A 3ZDXE 1KCBA 4LPYA 1AZRA 3CUPA 4PJFE 1JZDC 1KBGH 3O0LA 4W9FC 3FOMA 3ABZA 2A6IB 3HNTH 4MFHA 3H0TA 3LVTA 3QQ3A 4H8HA 5KVGE 4OGYL 1ECZA 1MCHA 5DLMH 3FQXB 3RFZB 2VN3A 3TJHC 3NIFE 1MVFA 4NQCD 5T3XE 4OZFA 4Z7VE 5E2TH 4ZM7A 1P4IH 1ZT1A 1NCGA 4DQAA 2E47A 1J0JA 4GT0A 5B8CB 1EHAA 4RGND 5CIPH 4HBQA 1QNIA 1WK0A 4TQIA 3UIYA 2HRPH 2TSAA 1HSAA 1J8HA 4R7VA 3UEZA 4BXSV 2X4UA 3PABB 3TYGL 5LWYH 2XQBL 3U46A 4OV5A 4X6BB 2FDBP 4YFDB 1AYOA 3KNBB 5JHDE 3PU7A 4HKZB 2XRAL 3L16A 3Q5YA 4UQCA 4PV8A 1TLKA 5D1QA 3QG7L 1AE6L 4J3OG 3DI2B 4N5ED 4NGHH 1U6AH 5DQ9B 3VQ1C 4P5MB 5FUZH 2UZIL 3KPOA 2XTJD 3WFBH 1F00I 1OE1A 1U95A 1ZVSA 1VFBB 3CPUA 1XIWA 1E6OL 4G8IA 3X2GA 1MI5E 2YIHA 5F2FA 1XVSA 5A6IA 1OT1A 1UACL 5JLZB 4F15C 5JIKA 3SD5A 4RFEB 4AUUA 3DYPA 2HCZX 2HG5A 2VDQB 4DZ8B 1NAKL 3IFPA 5F3BB 3QFJA 4IBSA 1IC5H 2W9LA 1YJDH 4IHBA 3UAAA 1GS6X 1HAUA 2IJ0C 2KZ1B 3CFJA 5LDUA 5IHLB 4L3EE 2JWYA 2BVEA 2XA3A 4RMQA 4X6DA 5EIIG 3GXUB 1BZ8A 1RXLA 2DQUH 3C60A 3W82A 1E3XA 5D72L 4BBWA 3GYRA 3T4YB 5CLYA 4TQ8A 2DQTL 5E4AA 1JPSH 4RMBA 5ISZE 1PX3A 5TQ0L 2HKHH 3JWDC 1WZ1L 5DJXB 1GCFA 3LMJH 4ZBJA 1QHOA 2BRRH 4YXLL 4FG0A 3G5XB 3T2NL 1PNDA 3ARBD 4JFQA 1FDIA 3PPSA 3GHBL 5D1ZC 4P46B 3K7UA 3O81A 3F65A 4RAHA 2P49B 2VDLL 3L3KA 2B1OA 2R56L 4GAYB 1KLUA 2X09A 4L1DA 2YZ1A 4OCWH 4PJBA 4JPWH 1DDHB 1S4IA 1HEZA 2C9RA 1J1PL 2YAHA 4R90H 2DQFB 4ODUA 1A47A 4LARL 3QDAA 2VR4A 5D8JL 4X8JA 4JDZB 5FA3B 4APQB 5DK0A 4ELME 2BRQA 4N2HA 5L8KB 3BESR 1WCQA 4LSTL 1UHDA 5FR3A 3LKOA 1BDYA 2HKFH 3B5HA 4KJPC 5I5MA 3HMXL 5EWIL 5AW9B 3MLRL 2VXUL 4ABQA 1R5IA 2O5ZH 4L2LA 1WD8A 2EIZA 4ONOA 1MAMH 5EULV 1JK8B 4XE5B 3U2IA 3VGAB 2ZQKA 1UXMA 4UINL 2P5WD 3N1QC 1CICB 1CK0H 3SGKC 1UZ8B 4LCCA 3CBJB 3P0YL 3P3YA 2JJVA 2BJML 2X2IA 1AMXA 4PCYA 2R0LL 4RGOH 1EAPB 3BAEL 1NGXB 1I9RH 3EOAA 5H4UA 2F1AA 1E28A 3MYJB 4HIEB 5KBKA 1GTNA 3CXFA 4DFIA 4EI6B 2DLTA 2FYVA 3ULUE 4UV4L 5T1DH 1MY7A 3EHBD 3IBOA 4OJDH 2P4AB 3GSNA 3QDJE 1J5HA 1IKNC 3X2JA 4ZFZA 2Y72A 4DNLA 5E56A 3TJEL 3WE1A 5DS8A 5B39G 1WT5C 5E2UH 1N4XL 4NERA 2AJ3A 1TVHA 1J10A 2LLGA 4I0PA 1E7VA 3ZZLA 1A7NL 3TF4A 5E7BA 1EO8L 2YAFA 3KPNB 1DVFB 5IW6B 4N6QA 3RZCC 5A16B 4KKCC 2G5DA 3MLVL 4OCLC 4ONGH 4PJDB 3K8KA 3UBXB 1IC1A 5IW1B 4P5KB 3IAPA 35C8L 4PLJD 1R3HA 2AJXL 3IBEA 5F70A 5HDLA 2OTUB 1HOCA 3H9SE 1Z9MA 3OJMB 3A4DA 3IDYB 1A65A 1HHIB 4Y7OC 1NC2D 1NZRA 5CCKL 1W6LA 5F1SA 3MRMA 2WQAA 5C0RL 3MRBA 4OF8A 3B9KA 4Z7OF 3TNNB 1HOEA 5EOQL 3W0WB 4M7LH 1ZHNB 2DDQL 3MUGA 2NX5E 3ECUA 5ERWB 4JFYA 1F02I 1GGTA 4HJJL 4LCIL 3VD4A 3RPIA 2AF2A 2NW2A 4HUCA 1BZ9B 5DMIL 4HH9B 3LQAH 4ENEC 1P9MA 2Z7YA 4GMTH 4NN7C 4ECNA 4OM0H 2RAMA 1RZFH 4KVNH 5H35B 4BH7A 2YWZA 4J6RL 3UBFA 3M1CA 1SXBA 4G42A 4R2GB 5H37G 4G71B 2NR6A 2H3XC 3IVKB 3ARGC 4IRJD 4MJ6A 4YX2H 4JE0A 4DPAX 4PJ9D 3C75A 3IMTA 3WLBA 4ZMOA 5JNYA 3DMRA 2A6KB 2X1PA 1PT0A 4D9LL 3EOTH 1AI1L 2XFXA 3FTSA 4EKJA 4PV1C 1FA4A 3DIDA 3QEQE 5HGGS 1MZYA 4UWQB 1I9IL 4Y4KB 5FYJH 2NCEA 1EBAA 5L4MA 4KRMB 1H5BB 4WFGE 4DPCX 4YH6A 1Y6NR 1RIHL 4MB5A 1KEGH 3VD1A 3VWJB 4G43A 5K9KA 2K45A 1A1MA 1FNSL 1J8HE 2ZSWB 2YGPA 3EUUA 3T4AB 3EYVB 3QNZB 1F8TL 4U6VH 4PJAF 1ADQH 3MO1B 2LTQB 2VC2B 4P2CG 1CLCA 3UG3A 3VXOA 2AANA 5JDSB 5EIQA 3PDGA 3HU1A 3BVVA 3UMTA 3ZDZB 2VQ1A 1U8MB 4F7CA 2X89A 5I6XB 4W9IC 5KTEL 2P47B 5I1HH 2BZDA 1IGML 3NCJL 4CSPA 1RAMA 4HJUA 4QNPF 4XZUA 5EU3A 5B1AB 5C3IA 4PJCA 2BSDA 3NSCA 3PS6A 4S1RL 4H8PA 2H8PB 4O2CB 4OUUA 3R19A 2JTYA 2Z93A 1OZUA 2VGLM 1BW8A 2GBTA 3FT1A 3HMXA 4XWOD 1T7WA 3ARZA 4M5ZH 1T03L 3Q1EA 1FQ9C 1YQVH 1G43A 3QFJE 4LSDA 1QZ1A 5EN2A 5BO1H 5KN5B 1IM3A 3MBEC 4HCIA 2W38A 1DQQA 5BVJA 1IKFH 1CXIA 1MRDH 4OF3A 4JO2H 3ZE2E 2VMFA 4FXGB 3GD1C 3ML9A 5I66B 1OTTD 4OZGF 4JMXA 5C08D 3H9ZA 1P69B 2NY0B 2G3XA 4OI9A 2C34A 2EIBA 1V05A 3QZWG 4GG6B 1YMMA 5AAPA 1N5AB 3VGGA 3SCMD 2NRDA 4O00A 4OQ1A 3VG0H 4JJHA 4GB9A 4MA7L 1KC5H 4K5OA 3SBWC 4KKBD 1PG7L 5I15H 3S88H 1T0NA 1JNNH 5T3ZD 1FSKB 1HILA 3UJJL 4HKBB 3NZ8A 3DETD 1NPUA 3BW9A 4PGBA 1PYUB 5EG6C 4GBXC 4NT6A 4AQ1A 4M62H 1KFAH 4G6ML 5BRZA 4M8QA 3G6AA 3N5AA 3IFNH 4ODVL 3QUXB 3L3DA 4QAWA 4KLNA 3MQIA 1BVOA 2JJSA 1TJGL 3CK0H 3UC0L 5EIIA 5LGHL 2ZE0A 4JRLA 4DGIL 1M7UA 3CFCH 1AW8B 4QRTB 1AD0B 3QO1A 3WHXB 2LGNA 3ARPA 3RUGA 1V10A 1QWHA 2ZKHL 4Z5RA 3Q2LA 3NJIA 5GZOC 1ZANL 3L9BA 4NUJA 3SDDC 1R9TA 4AEIL 2DWDB 4QRFA 1PBYA 4XNZC 1M6OB 1ONQA 1N3NB 1ASQA 1QASA 4LSQL 1MFCH 4KXCA 4ZO7A 1KCSH 2HB0A 1VFUA 5F7EH 1IGIH 3QIUA 5KVMC 1O6VA 1W6WA 2UX6A 3UZQA 4FF9A 1MAKA 3FOLA 1PY9A 1WTLA 5F3HB 3QPQC 5LXVA 3FT2B 3B3IB 4P4KB 2EDJA 1G0DA 4A55A 2EECA 4JGJA 2ZXGA 3PQYD 4MCYA 4LLWB 4KK8C 1QLEH 4MA3B 4MD0B 1CVSC 1T1XB 4N0RA 4ZNEA 4UOZA 4JZJA 5TDPB 1F58H 3HS8A 4CC4A 1U92B 4DVBB 4F57H 4M8RA 5C0GB 2JJWA 2OTWB 1NL0L 5BS0D 1BBDH 1MUJB 1A7RL 3KDMA 5K9JH 3LZRA 1HHKB 3BSHA 2DQMA 3W5NA 3JSSA 5CSZB 2L7QA 4FMKA 4XNYL 4GA5A 3BHBA 1HH6B 3KPSB 2CGRL 5D9SA 1J05B 2J57A 5CILH 2X6AA 3HMWH 5MENA 1M7IA 2QJDA 4NKDB 3H3BC 2XXFA 3MFGB 4MNQA 1UOWA 1XR9A 1V3KA 4AY0A 5I6OA 1TQVA 4MHHI 1A64A 3QI9D 4GEIA 1NCCL 1NICA 4BE6A 4HWEL 4HG4J 5B39A 1DUZA 1MLBB 1THAA 2B2XH 1OTUD 4QLRA 3K72B 4OGZA 3U48A 4XOAA 4MAYC 4F9LA 1R3KA 1QHQA 1XQ4A 1HL8A 4HS3A 4R26H 3TONA 2CR3A 5FYKU 2PNWA 3PWVA 3S4SG 4P5SA 1EAQA 2DL9A 4DCQB 4XP4L 4Y88A 1ES0A 2YMTA 4XVSL 4QHLB 2A77H 3C5ZA 3LRLA 1NEPA 3RVWD 4RMUA 4N2DA 1EAJA 1KBWA 3V5KA 3DO7A 2EXWD 43C9A 3DBXA 5L7XH 2XN9E 4D7ZB 1GW6A 4GXVL 4XHJC 3SJVA 3B1UA 5E00A 1I7TB 3FO1A 4H20H 5FW7A 4C58B 3MNDA 2WN2A 3CZFB 4NNYA 2N4IA 3ATBA 3UGUA 1NCWH 3OKKA 3RWJB 3V6ZA 2PWGA 4WJKB 4OF0A 3MBWB 1S3SA 3F7VB 3UZVB 3FQUB 4AYBA 1Q9LA 4GSQA 4D3CH 1SDYA 1T66D 5HHOD 4IGBA 2HFEB 4XT1C 1I8LA 1B3JA 1CLZL 1XB3A 2Y5TB 3ESNA 4NQQA 4U0RB 1M7DB 2XA8H 5DZVA 1CTNA 4J4PD 3RIKA 1NINA 3HNSH 3QUZB 4BDVA 1SMYD 2NLJA 1TCMA 1QFUL 3O3AB 3WY4A 1X5FA 2BY0A 1Z5LB 2XCMC 3O6MH 2IH8A 3NAAL 1Q4NX 2NNFA 3IMUA 2P3YA 4UQ2B 1V54B 2BNRB 4MSWA 2XG5B 1KTJA 2CO7A 3UYRH 5F0JB 4M56A 3B2DC 2AAAA 5H37A 1I1FA 2HRLA 1IARB 2CCLA 4FQLH 1PCSA 4AIEA 1MNUL 2JIPA 3F84A 2VIRA 2W80C 4KO7A 2AJSL 2CO2A 3L6FB 1PY4A 1CDHA 1MJ8L 3WAJA 3EDFA 3VFSA 3C9NA 5IJBC 2YD8A 3GI8H 3MRIA 4P2RA 4RISH 2BS9A 3O4LE 1Y18B 2OK0L 4HS8H 1SY6H 2DQDL 3IJYB 4ONFH 4X7DC 2V9TA 5E9DA 2B59A 1FZKA 1OGAE 3SUKA 3D12B 2EDWA 3KCPB 2O5YH 1YCSA 4RAUB 2FX8L 3J2PA 3RA7H 4PJ8D 3HFMH 1WE5A 4YBLC 3CTTA 3N43F 4JKMA 1ESOA 3L4WA 5KSVA 5K9QI 2VYRE 2F1EA 5T3XD 3HR6A 3IGFA 3DWTA 3N0AA 4DT2A 1L9MA 1HKFA 2HX8A 4MDRA 6PCYA 5IVZB 1YMME 4U1NA 1SLXA 2A99A 2BM3A 3F83A 4YSRA 5D96C 3GXPA 2IH3A 3K4DA 4OBRA 3DVNA 2OR8A 3L3HB 4HWUA 4TSAL 2KC0A 1IJ9A 3SYCA 1JRHL 5K9OB 2IEPA 2YPKB 1YUHB 2HPOA 3GMPB 3QISA 4JVWA 3V0VB 3MA9L 1DFXA 3AG1B 4FZEH 5IG7B 4XC1L 4CC0A 3U7WH 3MXVL 5BRZE 1NCDH 3CH8A 3KPPB 3U30B 5BW7A 5J12B 1AZZC 4PB9H 1GC1L 1YEFH 2QT6A 2X28A 2P43B 1Y1WA 1CTOA 3DOSB 2EDEA 3QJOA 4LHUD 3IN0A 1MOEA 4GIPD 3IKCB 1UEMA 4GFXA 3TJPA 5DRWA 4M7ZC 1QI5A 1NCOA 2IPTL 3CMGA 3P3SA 3MROB 3B9EA 4JX0A 3DX8A 3QZWA 4PQXA 5AW5B 3N42F 3QDMA 3CXHK 2YBRA 4PLKC 1TF4A 3BP5B 3WXVL 1CGUA 5IB4A 1VPOL 5LDSA 3D08A 5TFSH 1JGVL 2YU9A 4P2OA 1JPFB 4L3ED 2RR3A 3KGTA 4MB3A 4WU5A 1UQSA 2CDFA 2EZ0D 3CH1B 4Y1SA 4ELKA 5JPNA 1Y6KR 4OJCA 5CR8A 5LB1A 3D05A 1I1YA 2GT9B 1BMGA 3H7LA 5MHSE 2WXIA 1EA9C 3CQPA 1CF1A 1X4ZA 1HL5A 5KBDA 3TCXA 1ORQB 4K2UH 1W8EA 1QFOA 2EEAA 2HWZH 5AW0B 4LQ1A 4HC1H 4LO9A 1Q8MA 1B6UA 4Z77A 4HFUH 3PL6C 1JNHB 3FT9A 3MGAA 3GLEA 2FLMA 4G1EB 4A7UA 1XGTA 1IAKA 3CC1A 2VR3A 3DV4B 3CHPA 3LPWA 4KDTC 4A38A 4ZS7H 3OX8B 1QW8A 4NKIH 3M6DA 4OLWH 3H9HB 4BQ9A 2FATL 1QCSA 3B5TA 3D52A 3HTLX 5MENE 1U8KA 1FVCA 1Z9LA 3LQZA 4N0CC 4R4FL 2A74C 1AGDA 5TD4A 3VSQA 1AKJD 4JFEA 2R4RH 4HK3J 4MNQE 5DDHB 2YJQA 2F6AA 4BQ6A 4X0KA 3NRQA 3K2UH 3TBTB 1H6FA 1FE8L 4LBEA 1VIWA 1SIWA 4YE4L 4PRBB 4EUPG 1FLRH 1T20A 3N55A 3D3VE 1DBKH 4QY8A 1F5WA 4O2EA 1J86A 1DLHB 1G9MH 4I5BB 1SYSB 5JHLH 4PJAA 1A6AB 1QFWL 4G8FA 2DKMA 2ZP8A 4DFHA 1MELA 2NTSP 2CR6A 4TUJA 3Q9QA 2IFFH 1H6EA 1ZXKA 3HZMA 3VXSA 2EDNA 3NFNB 3PWPE 4YIQA 5D2NB 3ZE1F 1PFCA 3QDJD 3R4DA 1XEDA 2F58H 2XN0A 3NZHH 1E9OA 1D6VH 4L8SA 4XCNA 5ITBH 5JXEC 1C08B 2WO4A 3I3DA 5EV7A 1DBML 4APXB 5E4OA 2W5PA