4JS7A

Crystal structure of d78n mutant apo form of clavibacter michiganensis expansin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of wild type and d78n mutant Clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
molecule tags Sugar binding protein
molecule keywords cellulose binding protein
total genus 43
structure length 202
sequence length 202
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4js7A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4js7A02
3M3GA 1BMWA 2ENGA 3D30A 1OA7A 3X2MA 5GM9A 4JP6A 4JS7A 5GLXA 3X2IA 1WC2A 2G5DA 1BW3A 4JCWA 4JJOA 4ZM7A 2JNZA 2GAEA 5H4UA 1WHOA 3SULA 3CZBA 3FT1A 2PI8A 3X2GA 3X2NA 2G6GA 4FG2A 3FT9A 3ENGA 1WHPA 1HD5A 4AVRA 2BH0A 1OA9A 3X2OA 2VXQA 3SUJA 4FFTA 3SUKA 3X2PA 1N10A 4FERA 1BW4A 4ENGA 4JP7A 4FG4A 2PNWA 3X2KA 2KQAA 5GLYA 4L48A 3X2LA 3SUMA 2AE0X 2PICA 3X2JA 1L8FA 2PJJA 2HCZX 3X2HA
chains in the Genus database with same CATH superfamily
1CFQA 3MGOB 5CD5C 5EORL 1S78D 5MHSE 4HUCA 4L2LA 3K3QA 4MNQD 1HHGB 4UTBH 3WUZA 4N8PA 2R69H 2VZ1A 3NA9H 5TD4A 4C4KO 3CZBA 1NJ9B 1N6UA 2LVEA 1RUML 1H5BC 1P4IH 1V3MA 1JWUA 3CDZB 5IHWA 3IT8D 3ECVA 2ZCLL 3BH8B 5GRVL 1SYVB 3MKGA 2P49B 1TIUA 4FG4A 1V55B 3NSXA 1IM9A 2WM0A 3EJZD 5FGSA 4ZMAT 4NQCE 3UZVB 5ISZE 4ANWA 2BINA 4KUCD 2Y07H 4K5LA 1HL4A 4GUCA 1LDSA 3FOMB 4E5XB 3VFOB 5GRXG 5DJ2A 1YSOA 1QSEE 4YGVB 3DUUB 5FYJH 1TVBA 1GGYA 2AQPA 2ZKMX 3KYMB 5KYUB 1T3FA 4OB5L 3MODH 1NBZB 3QA3A 1KB9J 3ARUA 1D5MB 2VR6A 5GGUA 5C86A 2CLZA 2LT9A 3D3VE 3MRQA 3GMQA 1GMEA 3FOLA 2ZAGA 5IEHA 2Z91A 1QFHA 1U58B 5T1JA 4OV6F 3GMRB 1JI2A 1PGRB 4XP1L 25C8H 1JWSA 3WS3A 1KN2L 2VN4A 3DSNB 5IUCA 1H6TA 4F57H 3OGCB 5KYWA 3K2KA 1M56B 2FHCA 4NQEE 1HESA 1KJ2L 1Q38A 2QGDA 5F21B 2Q8AL 1DE4A 5T33H 5HYSA 4KO5A 1CDGA 3K1DA 1KEGH 3IVKB 4OVVA 3WY4A 3CNKA 1NGZA 5J12B 4DZBA 1CLYH 3IMSA 1SF3A 2BVOA 4FQ1H 2PPAA 5GS1C 2PR4L 2PYEB 2W0PA 3CDFA 4DEPB 3MRJA 5EIIA 3MRGA 3GTTA 3DX2A 4S0HA 5A16B 4ANUA 3TVMD 5DFVC 1OCZB 2CRMA 1JPFA 4JK0D 2WYZA 3GSQB 4KHXL 1GGBH 1WAAE 1J1XH 5AL0A 4B9FA 3CBKB 1WEJL 1XF5A 4XXCA 4IBYA 1YEDB 2MCMA 2H32A 1HQRA 3L9YA 1QVOA 1ZT4A 3BJ91 1VFAA 1NIEA 3D07A 4AONB 1MREL 4N1HB 1TNMA 1AGCA 2GTWA 3T0WA 4IOIB 1BM7A 1F13A 5B7FA 4OCWH 5F8QC 4I9XA 4OQTL 3B3IA 5JXAH 1H8NA 1A4KB 4QNPE 4O51B 4A38A 1RMFH 3K91A 1IAOA 4HS3A 5GS0D 3SUMA 4TLUA 3F6LA 4N0CD 1QZ1A 4J3OF 3T4YA 1RY7B 2GB2A 5LAXB 2X44D 5FYKE 1NCNA 3QWOB 4UOQA 2DQHH 3X2MA 4MS6A 3VG9B 4CGUB 1F3JA 1CYXA 1I8MA 5IVXA 4PRPE 1KGWA 4ZMYA 3WELA 1Z9PA 3WY1A 4B3EA 3GTLA 2XN2A 3TBWA 3QUXA 3RWDA 3P0GB 1Z0MA 2YHGA 4FADA 4MJIE 5GS2D 4G6AD 2FX7L 3UZEA 1EXGA 4Z7WE 1I53A 4S1RH 3RY6C 2AF2A 4K3EH 4L4TD 4HOZA 3D39B 3QJFA 2JJUA 2HJKB 3FB8B 3FQTA 2VC2B 3IU3B 2IFFL 1PYWA 2Y07L 1ZT7A 4P23D 2DI7A 3PREA 5JXAL 4QJ5B 4NO2B 4ADGA 1NMAH 4HGWA 5LQBH 2FEEI 4KGJA 5TQ2H 3OKEB 1KBBA 3OMZA 2CO3A 1LO0L 3CFEA 3NCFB 2H41A 1SFHA 3KH4A 1VGEH 4V1DD 5FO9A 4OV5B 4Q9RL 1WH0A 1HHIB 5JIHA 3NJHA 4LEBA 4G6KL 2GJ6B 3F5WB 4FABL 3GSNB 4Z7NF 3KPRA 1ZGLP 1NGZB 3EF7A 3TF7C 4GQQA 4GKSA 1URLA 2AJVH 4DVRH 5T3ZE 5DQJB 3FQYA 1KTCA 1AIFA 1A64A 3OM3B 4XP9H 1A3RH 1G7PB 3VI3E 2WWKT 1LO4H 4J3WA 3WIHH 5I74C 2HMID 3HE6C 5LNDA 5ADOH 4W6XB 1HEHC 4OZFG 1RP9A 1XCTB 1A7QL 2QBWA 4V1DB 4DCQB 1L9PA 3RAJL 5JIMA 3WIHL 3ZTCC 1E6OH 3FFCB 2HKHL 4UNVA 3H6AA 4ZO7A 4M7JL 4IRJC 4WNQA 1DMRA 2A6DB 4BELD 4F8NA 1IO4C 1T4KA 2XZQH 3RGBA 4IS6B 3OQ3B 2FATH 3I50L 1PZCA 4XN2A 5H35B 4AENB 1EDQA 4GP8B 3EW3B 4IKNA 4PR5B 3MJ9H 4QRPA 1FZKA 3GTNA 3O3AB 5TF0A 1OP5K 1SOSA 1U8NA 4WNJA 3DLQR 3LNEA 3SY0A 1KCWA 1P69B 1Q0XH 4WWKA 4XMKL 3MOBH 1NSNL 4PJFB 4YWGL 4N6QA 3QDJA 1PFOA 4MD5B 1GTNA 4P5TB 3KJ6H 1YNTB 4HUVB 1P4BH 2RHEA 1IAIL 1OVZA 1U42A 1YEWA 4XMKH 2Q1EA 4NN6C 3C6LD 5MI0B 3KWWA 5ESAB 4ODUA 1TF4A 3QRGL 1BOGB 4ZQKB 1MAML 2EYSB 3NRFA 2D03H 2DPKA 4MVBC 3VU1A 2AXGB 4PJBB 2WCGA 2J8UB 5EMYA 1NCDL 3ZE1B 5HGHB 3AY2A 5CNHA 2B5IC 2XFXA 2TRHA 3IPEA 3BD3A 3H3KA 1HC1A 2QADC 2YD3A 1HI6B 1T0PB 4YHIB 3TVMB 1CLZH 1BFVL 4M1DH 4XODA 4HULB 1ROCA 2P5WB 3KJ4C 4C56B 4KZDH 3BRFA 5F7EH 3OSKA 1NIBA 1OPOA 3B37A 3LHPL 3LIZL 3N3EA 4LLUB 4NCDA 4NXKA 1CR9H 4W1TA 1QBLL 1QBAA 2IOIA 4P4RB 5FS5A 3GBNH 3V6ZB 3M17A 4FXLA 3REVA 3AC0A 4GRLB 2AQTA 4X9FA 4IGBD 1S4IA 4FTVA 2HSIA 1F6AA 3I75B 4JM2A 3WO4B 2I5YH 2VLRD 4N2IA 2R0WL 5C9KA 4YSEA 3LNHA 1PZAA 1OSPL 2BJMH 3JWNC 3STZB 1XZ0A 2YQ3A 3QHZL 4ONGL 2NY3D 4DOHE 4JMNA 3GK8H 4NZUH 1RK1A 2C3GA 1JPGB 1WA2X 1ZLDA 4PS3A 4NKIH 1EANA 3BPCB 4OCYH 4OZGA 2XC8A 2IGTA 3K6OA 4GB9A 1FL3B 4PJXB 2XN9A 1B0RA 4XPGL 5LWYH 1OAUL 1Q9KA 5D7JC 1KCLA 4JPQA 1HAUA 3SOTA 1ZHKA 4X9GA 2ZAIA 4UB0H 2BHUA 1VJSA 1BFOA 4PBWD 3G5ZB 4ZMNA 2WLYA 4Q6YA 3NBNA 2MCG1 4PRBB 2GSGA 4GXVL 2IWEA 4U7SA 1W2KT 3REWB 1FH2A 3M46A 4YIQB 1C5CL 1N68A 1OHZA 3H3PH 5KAQF 5AZEH 2UXFA 1MF2L 1KJMA 4FNUA 3ROLA 3V4LA 4CRYG 4AE0A 3IETB 3ZZ1A 2LU5A 1WAPA 2WHVA 3PFUA 1LP9B 4PWFA 4MNQB 1UKQA 1OO2A 2CAKA 3CHXA 3FT1A 5INDA 2HAZA 2FH8A 2X4RB 2WC7A 2ADIB 2IV8A 4RAUA 3ENGA 3CDYA 3HI5L 3B2VH 4J3UA 3C8KA 3UTQA 1HHHA 2QLVB 1IL1A 4LPWA 2XG4B 3RHWK 1AR1C 2Z6FA 2DLFL 3QDGE 5DJZB 3BZ4B 3VW3L 4OQTA 4X99B 2WY3B 5AW7B 5HGBA 3C60C 2UWEB 1MFVA 3K72A 4PTTA 1FVCA 3DIFA 3LEVH 5D7KD 1JNLL 3X13B 1YHPA 4FXKC 5DWUH 3U9UA 1L6XA 1HQRB 1HU8A 2OMNA 3SIKA 3LJ3A 4QHMA 2GK2A 1A9BB 4LCCC 5IOPA 1CZ8H 1JNLH 4K73A 2FE0A 4JG0H 1JZ8A 5CCKL 1MHCA 4C56D 4FA6A 1S7VA 1AJ7L 1M05A 5D1ZI 4GSXA 4OF7A 5FO2A 1ID2A 3ZO9A 3D3VA 3VXRD 2QVIA 2EJ1A 1S7UB 1DSWA 3QORA 5K9JH 4KQ0A 2LU3A 3LSOA 1CIDA 3FN0H 3IVKA 1KLGB 2Y2TA 4I2XE 5AAWA 2PTVA 3ZYIA 3VW3H 4DK6A 4ZUUA 2WCSA 3AT9A 1D9KD 4NRYA 1ACYH 3L54A 2C9QA 3SUJA 1JNHB 3CVHL 4OM1H 2VXQH 1R7RA 2CO7A 1ZVNA 4HOWA 4IMKC 2Q7YA 5DUJA 1D5BA 1KFAH 3HLAB 2BSSB 2J1ZA 3OF6A 3SPIA 4Y9FA 1AHWA 1CZ8L 2HFEB 1NMCC 3N40F 1OA7A 3B6SA 4KUZL 4JFHD 4ZDHB 5D96B 2BOBA 4CADA 1DJWA 3MRDA 4IJ3C 2MOGA 2R2CA 3RKPA 1KUMA 2HG0A 5FDWB 8FABA 1MCFA 4HMEA 1U8IB 4X0KB 5FM8A 3GO1H 3JYCA 5CZKA 2XG4A 4RVBA 1ZA6B 3TJHD 3OC5A 3RILA 2X4TA 4U1SA 1N0XL 4JZOB 1CXEA 4HS6B 4I9WD 4KTDH 3B3BA 4M43L 3H42H 3BAEH 3PABB 4WFFE 1E40A 4PCTA 4ODTL 4ENZA 5I1DA 1YCSA 1JGVH 2KYIA 5E6UB 3RWCA 3L3DA 4E9QA 4IIQA 1WCBA 5C0JB 5KSBF 2R0LL 4Y5VA 4KK8C 3MJ8A 1GAFH 4LRIC 3PQYA 4QMEA 1J8RA 2PO6D 4GA5A 1XIWA 2ZYSA 3EYQC 4FS0A 4BZ2L 5F44A 2OMWB 1MFDL 3VI3A 5BZDA 2AP2A 2MQGA 1RURL 1UOKA 3CVHA 3EFDH 5CIPH 4ZS6C 5D7JB 5IP4A 4D9QD 4PJ8A 2EIEA 3UBXB 2YEQA 1SEBB 4N0YL 4X7TB 7PCYA 4WO4C 3TFKD 3FFOA 3FT3B 2PUQT 1RHHA 5EZPA 1EZSA 3WNMA 5L2KB 1CN4A 5EF3A 2FNWA 4BK8A 5IVZA 3BHBB 3QDGA 4B0MM 3QDJD 1R47A 4WK4B 5LBVA 3TLRA 5E4EC 4ZYKA 4D0BB 2WCPA 4I13B 1I8MB 1AI1L 2WWOA 2NY6D 2AQ3A 2ORBH 3A23A 1BVZA 4Y4FC 5GRZA 4J7RA 4LSUH 5CILL 2PP7A 1U8KA 4H8WL 2L7EA 4MDJA 2H2SC 1GZQB 4RMWA 5KVDH 1AR2A 2R0LH 2PPEA 5J1TC 1G84A 4KGLA 3PWJA 2WYIA 2GG1A 4MSWB 1W0VB 4NJ9H 1MIMH 2FD6H 4HSCX 4FZ8H 4NQDD 4R3SB 5DK0A 1SXZA 5E7FA 4PJAB 4HG4J 4QI3A 3SDCB 4TVUA 2BOLA 1JGDB 2ZE0A 2AXFA 2ZOKA 3BVUA 4YSDA 1RL1A 2F74B 4KBPA 5C09D 4U7MA 5HP5A 5MENB 4LESA 2ED6A 2GBUA 4YXLH 3DV4A 4O00A 3QPQC 1WUNT 2CJTA 4JFEE 4L8BA 4NHUB 4PU2A 1WLFA 1G7LB 4XNYH 5JLZA 5K59E 3TIDB 4Y16B 5D7IB 1OQOA 1FUNA 1KCRL 4XMPL 4JMXA 5GGSY 4YFLI 1H15A 2GUYA 5AOZA 2DQDL 2FWSA 3X1EA 3F7LA 43C9B 1HZKA 2BHZA 3DX7A 1RIHH 4FQQB 5FTLA 4JUTA 4OZIA 2D31B 2EVFA 1V5JA 2NNFA 3UTOA 5I0VA 4EBQH 2EC8A 2ZUYA 4L8DA 5IFHL 12E8L 3MRJB 1YEFH 4X4KA 4HIXH 5HDWA 4APQD 1ECZA 4YGAB 4FXGC 1VHPA 5HYSG 3AM8A 5AVQB 3J8F7 3ET9F 4MNHA 1QLFA 5HI3C 2AK4A 2C1OA 4GIOA 3RZCC 3HS9A 3HS0C 3OGOE 3KE0A 5K1JA 1X5FA 2CO6A 1MI5B 3VCLA 5KUKA 1T0MB 3WHXA 1U3HC 3PGDB 4LHUD 3CU7A 5K1VA 5EIQA 4TS6A 4FL4C 4NKOB 2ZWZA 4KFMA 2IWFA 4P5TA 5DYOA 3CVCA 5DS8B 1FG2A 1KTDA 4PRHB 5C9JA 4FN0A 5DD5L 3JTTA 1UWYA 1FNHA 3CZGA 1AZCA 4NQDE 4OLWL 1Z9SB 2VMDA 3BAEL 1EXUB 1J9RA 3PL6C 4F27A 2TAAA 5HVHC 4NPYB 3AU1A 2OP4L 3FT3A 1AGFA 5BXFA 5I6XC 4TSAL 4F3FB 3ARFC 1LJMA 3O0RH 1J1PH 1N4XL 5E6IB 3AZUA 4OIIH 2NZ9D 4E5XA 2NRDA 5AVUB 1XHHA 1OGPA 2B5IB 2MH4A 3OL2A 4RIRA 4HUNB 4KPHL 3S96B 1MVUA 5IJBC 1SM3H 2N1TE 3PPEA 3QIWA 2XT1B 4UQ3B 5HPMA 3KPNB 3GSVA 4Z3TA 1BF2A 3A4FA 1P1VA 3DDFA 3ZSTA 4Z5RA 3HE6B 3RPBA 4OCMC 5D1QB 5IJVB 1KTKE 1UB5A 4HCGA 2JE8A 3ZHKA 5EV7A 4QO1A 3FN9A 1DLHB 4MAYA 3X2KA 5LGKA 3EJPA 1FO0L 4TL5A 4Y9CA 4F7CB 4GAJL 3AY4A 3QEGL 4KAQH 3SHSA 3EDKA 2XPGB 4NM4H 2C8NA 1BJ8A 3EDFA 5IF0B 3TJEL 4B50A 2PLTA 2AZUA 1GXEA 1DL7H 4YHNA 1QI3A 1QR4A 4EJ1C 5FYKL 2GT9B 1TZOA 4QRUA 2P8MA 1F58L 1P2CB 1R4XA 1WE5A 3QO1A 3SGJC 5DWPA 5D70L 5J06A 2B2XH 2HLEB 3C09B 1FC1A 3ARDA 5EEZA 1J8HB 1AS8A 2GYSA 5D70H 4OLYH 4LU5H 1RJYA 1EEYB 5HGAA 1MEXH 5FPIA 1CF8L 1ERNA 2XWDA 1IC1A 2VDOB 4Q7DA 2HTKC 2BO0A 2ENQA 2BP5M 5LNGA 4UILL 1QLFB 5I16A 4GI9A 2JSFA 3MODL 3UXFA 4LLVA 3VYOA 1D6VL 4H1LH 2OMTA 4PRBA 2QSCL 4GG6E 3I6SA 1A9BA 5IOPB 2PYEE 3OKOB 1VADA 3JTSB 2DYSB 3H4HA 3NESA 1Y1VA 3BAIA 5I6KA 4PWIA 5I76B 4FDWA 4FHBD 3RDTA 3JV5A 2J6EA 5EIVA 5B38G 5I24A 1SQ2N 4JB9L 3EXLA 1KACB 4LMQI 4TQEL 4DN3L 1KB5L 3FU7A 4FNTA 3BISA 3CWGA 4X5LA 2X89A 3DDGA 3IMRA 1LE5B 3EO1A 5BS0E 1J0JA 2DZEA 4N85A 4XHQA 3T0EB 4WF7A 1OK8A 1CDUA 1XB3A 2NY0B 4LU5L 2XICA 1I8AA 2V2XA 4LSVH 1BX2B 4FQJL 4E9TA 3OPZL 5TTRA 3U6XA 1WFNA 2DF3A 3V0EA 1YEGH 4D9RE 2BFVL 1IRAY 1KFGA 3UTPD 1WZLA 2C9VA 4J3BA 4FKHA 2B1HL 1V3KA 1IKFL 1OD7A 2RR3A 3FB6A 3RJQB 1G7JA 3H2WA 5AG8A 4KK5D 3PJNA 3BRGC 1X7SA 3CFQA 5D8JL 1BD2D 3UBFA 1UJ3C 5T1DL 2FECI 3K71B 4KI5D 2J1XA 4YDLC 4OZ4B 5TDNA 1E9OB 4Z7VF 5INDB 1MHPL 1NUNB 1BP3B 4Z7UB 3SDAD 2H5UA 4N2CA 1P7KA 2EO1A 4LPUA 4BK4A 1I3QA 2KL6A 4MAUH 2P5WA 4HEMA 1QPPA 4C54A 3LPWA 1MJUL 4N0CC 4XNZB 4FF9A 1ZAGA 2IBZX 2NVYA 2E3VA 1S3KL 2R51A 4ZOBA 3HZKA 4HWEH 3CQZA 1YYCA 5EDSA 1I8UA 3ZL4L 4DP1X 4DP8X 2R1XA 4HHWA 1DDHA 1XL6A 2YS4A 4J39A 5LKNA 1FCCA 1XH2A 2ICEC 2BFGA 3PV6A 3D51A 5GIRB 1MWOA 1S3KH 2NQ3A 1EA9C 3BWAA 4U1SB 4IYKA 3EIFA 3TO4D 1BZOA 1WUZA 1CMOA 4UUJB 5JIIA 1KCBA 4AT6A 5I6MA 3BUDA 5I73C 2G6GA 5SWSE 1MG2C 3VG0H 3AADB 5DGRA 4AJYV 4UOZA 5IQNA 1T2QL 5BZWA 3LXCA 3VXNB 4OZFB 5DA4A 1JG9A 3STLB 3VJ6B 3CJJA 1R34A 5HI4D 4P4KB 4M7JH 4AIXA 4L9LA 3DOSA 4U1KB 2BPBA 5IVZB 5D1ZD 5I17B 4S1SL 1NCAL 3LNFA 3LV3A 5C7XH 1MN4A 1T1YA 2VJXA 1CF8H 5CJQL 3O5AA 2CKBH 4NUGH 4R97C 4XMLL 2XRAH 2W9DL 4RA0C 3GMMB 3CN4A 3BDYL 2XKNA 2H1PL 1RULH 3RE0A 5FO7B 3HR5A 3VH8A 5TE4H 4YHYB 5AALA 2ZCZA 4PJ6A 3VXMA 4JFVA 3V0VA 4HIEA 1KPVA 5BUPA 4XVSH 5C3LD 3P4OB 4JY5L 1WEJH 2E7HA 4P3CL 4QAWA 5DK2B 5C0DB 3IR6A 3GM8A 3BN9C 3DX8A 2C1PA 1E28B 3WIIH 1W8NA 2PICA 3MNVB 2A77L 3ZRCC 3QI9D 4GBXA 2D2OA 5DYFA 4WU7A 1MLCA 4A2HA 3RJOA 3UO1L 3SY6A 3ZTJG 3FTZA 2O6FA 2NYYD 2ETWA 3QZOA 2Q76B 3ABLB 4WV1C 5E2JA 5ITFA 1LNUB 1CLYL 4NWTH 4QXGH 4LLYA 4JCMA 5A6IA 5EF2A 3AS1A 5B7EA 5IHHA 4IDJH 1NCBH 5T3ZD 5CMAB 2PJHB 4NENB 1CR5A 5I5MA 2YRZA 1HSBB 2ARJA 4BQ6A 4D0CA 5C2BL 2I7OA 4KDTC 4WW1B 5CEYB 4DKDC 1JPSH 3ML8A 3VDCA 5FO9B 3W9DB 2ZSVA 3GMOA 2PJJA 4YH6A 3B5HA 3FAXA 4LXFA 2YUWA 3IGFA 4CU8A 3VXTB 5AW5B 4H40A 3FUFA 4ODXB 4KNQA 1VLXA 2X53A 2K6YA 1UXSA 1FZMB 2RB8A 1A6WH 4I89A 1HYRC 3M1BA 4HHAB 1BW8A 5FHAL 1TQSA 2ZNWA 3N91A 1BJ1H 1I8LA 2P44B 2VR4A 1KWGA 1P0SE 5TQ0L 1OSZA 5BRZD 5F7KC 4PRIA 3HG4A 1FNSH 2ITCB 3F8UB 2F74A 1A7RL 5I8KL 3V0JA 2KBGA 4HQQH 4JFDE 2GHWB 3OAYK 2R0WH 5BZXA 3DX9B 3WY3A 1YZZA 4PJ5E 3VXSA 1J9TA 3NTCH 1KQFA 1BPLB 1SXNA 2VLJA 3CPUA 2OSYA 2CR3A 4FEIA 4HAGA 3BQUB 4EAEA 2JJWA 2AJSH 2EO9A 3ISRA 5CGTA 3NJIA 3CFNA 1EQWA 2OJEA 5BW7C 1OOAA 3G6DH 4N8VA 1KGIA 4M7ZB 1HD5A 3ZE1F 5CD5D 2BK8A 5I9QC 2UY7B 2OX5B 1WFOA 4R90H 3A6BH 3FZUD 1KWKA 3GSWA 1QDNA 3H7BB 3IWUA 1M7DA 3GMPA 1CTMA 1R3LB 4KNUA 1NMAL 1XH1A 5ADOL 2DQJL 4LP8A 3O45A 5DC0A 4JY4A 2PPFA 4PS8A 2XNAA 3GXPA 3MFFB 4AJWA 4LT7A 2HKHH 3Q8AA 4XVJH 2HJKA 4F2FA 1L9OA 3MA9H 5MERB 2JKLA 4J28A 4MA7L 3GTGA 2F7PA 1MOEA 5GISL 4ZMXA 4MYWB 5E70A 2K1MA 1XGYH 2G4EA 4KKAC 4G3YH 1YEHL 3MUGB 3QUYB 4XOAA 4FCAA 5B7MA 1GVIA 4HUMB 2EH8H 4KH9A 3KPSB 1KIRA 1VFBB 2DWYA 3ARDB 2YC1A 4OIFA 4E5XG 2VDLL 4E0RB 3ZYJA 2CKBB 4EUPA 5E4OA 2P8MB 3V7MA 2VDRB 5D2NA 1GKOA 2FO8A 1T83A 2GW5A 3O6MH 2VDLH 4AZ8A 4FG0A 2CK0H 1Q8MA 2GJRA 2AJUL 3UBXA 1XGUB 3SPVB 4XPAL 1PJ9A 5F3HB 1CFNB 3NZ8B 1HIML 2A4ZA 4JDZB 1UD5A 2YKLH 4K71C 3QS2A 4HSQA 3RBSA 5BRPA 3LZNA 2J88H 2A5UA 4H0GA 1KV3A 1E43A 3P4LA 5MEND 1BPVA 3BC9A 1T6VN 3SDDD 1TSHA 3STZA 4M5SA 3NGBC 2I24N 1SMOA 3CVHB 3IDNA 1SDDA 3K6SB 1L4IA 3QCVL 1P9MA 3KPMA 1KENL 4K3JH 2WWMD 4N2KA 3P2BA 3T0VA 3V4PB 5C08B 3L4WA 5T3XD 3RX8A 3L3KA 5F6HI 2FO1A 3UIYA 1LO5A 3PGCA 5EORH 2WYTA 2A73B 1ZV2A 5F7UA 2AJYH 2NX5A 4WWKB 5D6CA 2CK0L 5I1AB 2D0FA 2ZUSA 1JXJA 2DYRB 2E46A 1JYVA 1R5WA 1WITA 3QEGH 5E03A 4HIQA 1NGQL 4KVCH 2NUPA 3LQAL 4M5ZL 1U6AH 2QEJA 3DSFL 5FDWA 1JGEA 4GQZA 7PAZA 3A5VA 3ABZA 2R0KH 3IKCB 3BP6B 4QRUB 4PB9H 3D12B 4KK6C 2NY7H 4LLWB 1YLEA 1TWFA 1O6VA 2ICWB 3N85L 2XWRA 2E9JA 4M48H 4ZODA 2EUZA 2AK4E 5TE7L 1CGTA 1MH5A 4LOEA 2BP0A 4NI6A 5DFAA 3E38A 4X8JB 2Q8AH 1TMCB 3E0GA 3H2QA 4FLHA 4P46D 1G87A 1BBJB 2CBQA 5GSRB 4UMSA 4AEHH 4DTGH 1RCYA 3PL6A 2EDJA 3GSUA 5D7SL 4MCMA 1D7FA 4FOMA 3R8BB 4L05A 2I32A 2D3VA 1OAKH 1QUNB 2EDDA 2FQFA 2XV2A 3APCA 4JREB 5FCUH 4UILH 3ZQXA 4CMMA 1CXLA 4S1QH 4DTGL 5A7BA 1DEDA 3HN8A 3ZKMC 5D1XB 1Z1WA 3APNA 5CLTA 4YZFF 4UIKH 3QZWA 4JREC 1QOKA 5D2NE 1IBZA 1TQCC 2UZIH 2V5TA 4NZUL 4QRPD 1NGQH 2WOYA 4Z3HA 1DCLA 2WIMA 4ZPTA 1WA0X 1GGCH 1W0YT 3T6QC 5L8KB 2WBWB 3CVBA 3HS0A 3LN4A 5DVNA 3V6FB 1IILE 1HL5A 3AU0A 4JHVA 4P2OB 5IM7B 3IDNB 3QQNA 1HHKB 1ANUA 2R0KL 5C0EB 4HBQA 4P5KA 5PCYA 3QI9B 5F88A 1RPKA 1YUHB 5KSAA 3C5ZB 4MJ6A 3EYVA 4NPKA 4ZZKA 4ELKB 3DIVA 3IXAA 3DUHA 3I2CL 1WGOA 1UC6A 1UGNA 3RX7A 3SDAC 3CPLB 3MBWB 1H8SA 3NIGB 1FNEA 2ROYA 2JIMA 3H9SB 3QUKA 4OZHA 4G5ZH 4AMXA 4UQDA 2JF1A 3LRMA 3MV11 5FCUL 1B6UA 4Q9BA 2RFXB 2J88L 4OUOA 4YK4B 1I9IL 1KC5H 4R96A 4OT1H 3PDOB 5AFAA 3H9SE 2JA6A 5SWZB 4BINA 1X9UA 3OJMB 4XZUB 4KRMB 4KJWD 1NFKA 2OR7A 4MMYB 3U2JA 3FO9B 4Z7NE 4M6NL 3MA7A 4K3JL 3IFOB 4Z7QB 2HT3C 4Q9CA 2AK1H 2Y69B 2XXCB 4MZIA 4G43A 2GJZA 2HN7B 1O6SA 1UEYA 2Y6SC 3SQBB 4ALAC 1DZ0A 5AVXB 2CLVA 1BLNB 2I07B 4MB1A 1RKRA 4X6BA 5IWLC 5F3FA 4OD1H 4Z7QE 3BSZL 3LY6A 1ACZA 4FNPA 2X1WL 3VFPA 4A2FA 4NO0B 3LVEA 4MCZA 3GTQA 1G9ML 3FU5A 3LQAH 3IR7A 3MBXH 4M5ZH 4NP9A 4LLVB 2AXJA 4K3DL 5C0JA 5J9PB 4PGCA 1M3JA 3DROA 3EJTA 3S5ZA 1U93B 2B39A 5E9DA 3GEWB 1QUNA 5HPOA 1KTLA 2A83A 5DC9B 2YZ1A 3WG7B 1UD6A 5A7EA 2I27N 4P8QA 1RJYB 5HGAB 5C71A 2I9TB 5F1IA 4K55A 5F8RC 5IMKB 1KGCD 4ZTPH 4D9RD 4PV9B 3HZMA 4Y5VC 1TYRA 3BWUF 2NY5L 3Q2NA 1A7QH 1ET8A 2G2NA 3NP4A 4G70B 3VA2C 1PZDA 5JXEA 1GGIL 2R27A 3X2IA 5AW0B 4YDMA 2XA8H 3DMMD 4E9YA 4XPBH 3B6SB 4R26H 5F9OH 4TV3A 2VUKA 3NEOA 2JQAA 4N68A 1BD2A 3TNMA 1GGIH 4LPCA 1M57B 4OLVH 2PP9A 1A7PL 2LGNA 5D1QE 5SX4H 3CFIC 5AYUL 4WWKD 1BVNP 5HVFB 3ZL1A 5LVEA 3WNPA 5C18A 3HG5A 3VWKB 3LOWA 3T71A 3L2MA 5J0BA 3BYYA 4P5MB 3ASNB 1E4HA 1FFOA 2A99A 5JMOC 2A6HD 2FCBA 4TVSa 4IIQB 3OC8A 5FYJD 3RTLA 1T6WA 3X14A 5KVGL 4ZM7A 2UZYB 4M3KB 4WJKB 4LDLB 4NLHA 3K4AA 1HS6A 3PWPA 4YHYC 1QWHA 3SGKA 2N1KA 3QHFL 4PJAF 4DO6A 1WTGT 1ZIAA 3D6GA 3DUSA 3OAYH 1UENA 2ICCA 4NO5A 4Y19B 4AH2B 2IH1A 1S46A 3DK0A 4NZTH 1GMIA 3K2UL 3BKMH 4IOFD 1BXXA 3V6OE 1B4RA 1KYOJ 4XOBA 3IDGB 3JTBA 4U0RC 4JJ5B 3WFZA 4GUOA 1MLBA 4XNUH 3LKRA 3KPLB 1DN0A 3I9IA 1H3XA 3DROB 5ERWA 5E1AA 5AVYB 1MCLA 1NIFA 3SKOA 5HGBB 4DP7X 2QR0A 4UQ9A 1HN1A 1PW3A 1F4WH 2AABH 2WQSA 4NO0A 3NFNB 1UM4H 1A6AB 4Y1TA 4BQ8A 2K6ZA 1DBBH 3US1A 1J05A 2O4EA 3I3BA 2EDQA 3FB8A 3T3MF 3GC3A 3QWZA 2XG5B 5LHDA 4A04A 2Y36L 3TV3H 2IDSA 3GXNA 4G8GD 4CC0A 3TESA 3P40A 3CZFB 3L95A 4LSUL 1EO5A 3DX1A 3WNNA 2X10A 4P48A 4L4TE 1VSCA 2NY6B 4M4RB 3HFMH 3FUIA 2H45A 4UM8B 3JWOL 4OFIA 3TJPA 2ZOTA 2MQCA 4F3FA 3DTUB 1ETZA 5B3NA 3VJ6A 2VB5A 3CCHB 2GJ6A 3VD5A 3GUTB 3CV5A 2R7EB 4I77L 4XO4A 4D7ZB 1N5AA 1DQIA 2XQYK 4NRZA 5EO0A 1F11A 3ALXA 4M62L 1MQKL 3II2A 4PYHA 1EHAA 3OWRA 1FYTE 5I1EH 3UCQA 2ENYA 2PNWA 1U8PB 1E4KA 3CN2A 3P3TA 4J3TA 4WZ9A 4XBPB 4ZFOL 2NNCA 4YX2L 4LSRH 3WEXB 2A1WH 4U2YA 1MEXL 1ZT7B 5K33A 1IT9H 4BFRA 1A6TA 5K39B 1KIQB 5L2JB 3MRCB 1KXQA 3LIZA 2C26A 3FHEA 5JA8B 3QAZB 1I7ZB 1S9YA 2BS71 4HV8B 2AJ3B 3V0IA 4AEEA 3AAZA 3SDAA 5E24E 1FF5A 4PRHD 3Q8CA 3ZTDC 3O6FA 1UOLA 1ZLVK 2ATKB 2UVEA 4RQQA 4JO1L 3A4EA 3KW7A 2V3EA 1XFPA 4YBLC 4RWYL 4LARL 4Z7IA 3DX6B 2DJMA 2JKWA 4P07A 4P46B 1B4LA 4LLYB 2E4TA 2WQUA 4LCWA 1RK7A 2R92A 3GLZA 5CU5A 1RZPA 3U7YL 1A1OB 2O6DA 1EAOA 1D5ZA 3OB8A 4Z7UE 4JM2C 2YZ8A 1FDLH 3ZR6A 2WOBA 1J5DA 4QXVA 2VDKH 5CBEA 1XIWB 3SKOB 3N2JA 4IU3A 4X7SH 2EDWA 1Q16A 4NBYB 2A9NL 2GKIA 4WU5A 3KWWB 2P8LA 3H55A 5HJ3A 4RV0A 1IKFH 2H8PA 3P1VA 3GJFB 4X4ZA 3RIFF 1N0LA 5IW1A 1RZ7H 2GIXA 2AXGA 3EYSH 1CWVA 3BQUA 4XNZC 4AV5A 4OUUA 2NW2A 3IKCA 1TNNA 4AIZA 4JM2B 1A7OH 1A6PA 1W91A 4PVLA 3QCVH 2G60L 4PQXA 4NUGL 2MNWA 4EKXA 4NT6B 4P9HC 1OCOB 4CNIB 3NIDB 4PRDB 2WUCL 3JV4A 1SY6L 1I82A 3I74A 4OKVA 3A3YB 1TPXB 3UDWA 3CU1A 1MRDH 3LPPA 4L8SA 4ES8A 2FYVA 4B53A 1OAJA 5BVJB 3TURA 4PJ9A 3ARGA 1GS7A 3GKZA 2GFBB 2NQCA 3O6KL 3R19A 2B20A 4HZLA 2BZ7A 5EC2A 3U6RB 4PR5A 5DWUL 4NO3A 2BWQA 3VFNB 3IN2A 1LP9F 4WFFD 2ADGB 1P6FA 1S9WB 4ZW7A 2A9NH 1Y4ZA 3MCKA 1DQMH 3D2UA 2XFXB 4CVWA 4NQTA 3CZEA 2JKTM 3PHOB 3MLVL 4JN1L 3MGTB 4RRPA 4IDJL 2WZPD 4D0CB 4TQEH 1RJLB 2ZX8A 4YO0B 4YDJA 4B3VA 4GJTB 5ESVA 5E9DD 3ARFB 3FN0L 2DY2A 4ZXBA 4ZQKA 4U3HA 4JDEB 3S34H 4PV8A 3HFFA 3O41A 2O30A 4RFOL 4G6AC 5EU5B 5HHXL 4C56E 3NQIA 1ZJAA 2VZSA 2Q3AA 2NSXA 3QXAA 4AZ8B 3MRRB 3RB5A 3A6OA 4NZJA 3GXIA 3SD5A 1JGVL 1MI5A 3I9PA 4GKSB 4ZX4A 2FX9H 3DO3A 1TTCA 1NH6A 3NFSL 2YKKA 3MUY1 4OCRL 4ELDA 5HHMD 1G7HB 2IALA 1AS7A 4MLSA 1U8OB 4A6YH 3D25A 3KNBB 3GSXA 2V2XB 3CXFA 2FGZA 1OOWA 4AMKL 5CBEB 4TL4A 2ZICA 1IMHC 1M71B 2EXSA 3GF8A 3AXHA 3F65A 4PIRF 4O5LL 1E9PA 1H3PH 3HZKB 4JFTA 3V0HA 3HU2A 1QRNE 2DIAA 1UB6A 3PWNA 4M1GL 1NAMH 3BKCH 4UOJA 3V9FA 4EUPH 3EYVB 3BIAX 3AU1B 2OCCB 3KBFA 3T65A 1G4MA 1GY1A 5EZLB 1HXMA 3HI1B 3VXUD 4AC4A 2I25N 4A7QA 4YHPA 2GJZB 5B39B 1OGAA 2WQ8A 5C1BA 4I18B 1UATA 3P9LB 4HIPA 1QKZL 4PJXE 4XH2A 3UZQB 2QKSA 1X5JA 4D7PA 4G6ML 4HS8L 1NWPA 2KZWA 4L37B 2YK1H 2DIBA 3VSUA 3KYOA 2PPCA 4PJ7E 3SO3C 2QKIA 4JFEA 4I88A 1IEAA 3KM2A 1CICC 4NQDA 4PHXA 4PEEA 4LIQH 3D52A 4IRZL 5DGQA 2HLFD 1ITBB 4PJBF 2ZX5A 5IBLD 1OPGH 4MJHA 4Y4HB 1ADQH 4TOYL 4EI5C 3MQIA 2FL5A 1EBAA 1NKGA 1XV8A 4C57C 2IFFH 4JS7A 2Z92A 1PU0A 3W3BA 4B5EA 2Z8RA 4ZW3A 4FKKA 3CZLA 1TITA 1F4XH 2YGNA 3LKPB 3O6FC 4MAUL 1L0PA 3FSAA 5HHPB 3ZVVA 5KS9A 1EJ8A 32C2B 1ETB1 1MJUH 3G5VA 1H3PL 5JMRA 5JHLL 2RD0A 3PNWA 4M6NH 4R4BB 4CU6A 3WIFA 3RB7A 1G7IA 5HJGA 5B3JF 1AO7B 4FC3E 4MNQE 2YOCA 2OQJB 4TLSA 3FYIB 1AS6A 3G9VA 3BDBA 3KXFE 1E5CA 4LEOB 1JNNH 4WI9A 4R7NB 4YBLB 4XC3H 1G8JA 3LNDA 4MMZA 1XF4B 1JFQL 4HXBH 1IKOP 4C2MA 1FAIL 3CFDA 4GY4A 4X9BA 4LF3B 4JO8A 3S88L 1LO4L 1TQBC 2DWSA 3KNBA 1D6EA 3NK4A 4TNVF 4Y9BA 4PP1C 5T1KB 3CH1B 1ZHNB 3ATEA 4AL8L 4FFTA 4TF4A 2VDPL 4PJ5A 1J05B 3SDXB 2O5YH 2JIOA 1NCIA 3QCTL 3P30H 3Q5TA 3HG0A 3KPSE 2J4WH 4G42B 3UP1A 1JTTA 3IDIA 3MXWL 4AV0A 2Z91B 4FXGB 2QR0B 1OQXA 4S2SB 1UM5H 3WNLA 5CJXC 2XQBH 1BZQK 3QXTA 2QADD 4KJQD 5K9JL 1R3IL 4FP8H 4BE6A 2E2IA 5B39A 4IBVA 3GXUB 2Z34A 2A4CA 4I2XA 4NAQA 3BVXA 4N25A 2N0KA 2SODB 4QRFA 1BD2B 4WI8A 2J1YA 4MKTA 3UAFA 1HZHL 3VFRA 1GIGL 4YGVA 4UF7C 3SYPA 2CUAA 3MCLL 2OTPA 1D7DA 2XZAH 2X6CA 4OLUL 2BRQA 3Q5OA 4DAGH 3RZWA 2ZKWA 1NCJA 1NEZB 1J1OH 4JFYA 1TWCA 2KERA 3ZX1A 3DHUA 3N43F 5DQDL 4DUWA 2XZAL 1DVUA 3W38A 1QYGL 1BV8A 4I1RA 1JZ3A 1CLOL 5IB3B 2BNRE 5KVGE 3WGUB 3QZMA 3EH3B 4ZUUB 4XZ4A 5KVEL 2OXGA 3L3OC 1KZYA 4KNTA 2O5ZL 3AT0A 1SN2A 1I8IA 2AJUH 3QDMB 3PPSA 2NDFA 4WHCA 2Y7QB 2DQGH 3NTCL 2BIQA 2C9XA 3QHFH 4QPEA 4ZX5A 3VXRA 3BSHA 5DJAA 3CFJB 3DXAA 4MHHI 2PR9A 4ZPVA 5C0BD 3N1MC 1IFRA 1XAUA 4ODTH 1LDPH 3TIEA 5FW7A 2BDNH 2R2BA 1OD9A 1OF2A 2VXUH 5KSVB 4J3OH 1GPOH 2K9FB 2Q5BA 3MCLH 4JFFE 4M6ML 4OLUH 5CZXC 4DGWC 4OZIF 1OCWL 3ERXA 4LMQE 3NJVA 5IB2A 2J6EH 4BXVA 5L0QC 4EI6A 4M61A 3HNSL 1MFDH 3BWAB 2O61A 1QYGH 5DRNB 3ZTJH 4A37A 5D2NB 3SPHA 5JDJA 1S7QA 3NK3A 3O2WH 1SOXA 1PT0A 1BQHG 2DKMA 2B3RA 2AK4B 5I1JH 3EO0A 1GZHA 2V4LA 2XCMC 3KPQA 3MR9A 4BFIA 2ICEA 1WLHA 2YAHA 5AUMB 3ZE0F 3L5JA 1PIGA 5I75C 1OAZL 4L4VD 1U3JA 3EFOA 3RWGB 3RBGA 3H0GA 5FYJU 1E4XL 2OMZA 2RJMA 4A1RA 4NKIL 1MJ7L 2XTJB 1UKTA 2F18A 2BVPB 1A8ZA 4OCYL 4JHWL 4L8DB 5DJ6B 2EDFA 3VXSB 1M05B 2CHXA 2WXPA 5HDOA 2CO4A 3S88H 4XOCA 1EXUA 1MCOL 4OI8A 5L2KA 1E18A 4PRPA 1B2WL 1C08B 4G5ZL 4Z7OB 1N8ZB 2DD8L 1YMHB 1VKXB 3ULVL 4NKMA 1DLFL 3QUYC 4Q6IA 2OR9L 3IKKA 1VPOH 2I7SA 2HCZX 2GQHA 1GOGA 4A7GF 4HJEA 2C9RA 3MI6A 3KVPA 1JF5A 1MCEA 3SCMD 5BPPA 4M9OA 2YPLA 5DMYA 3Q2CA 3GXDA 4WFHE 5KJ7E 4JCWA 1G6VK 1TO4A 1T89A 1MRCH 1H6FA 1GZQA 5JHBA 1P5VB 3QEUA 1CXFA 2QT6A 5IB4B 3DVGB 1UFUA 5JQHC 1RIHL 1L7IH 3NIFE 1IAMA 3AROA 3UTQB 4YZWA 1A14L 3EHBB 4BEIA 1GIGH 4C55A 4EZMA 2BVUA 3QXDA 1I1AB 4R2GC 4X6FA 4JHWH 3JVGA 4PRID 3BEWB 5ETUA 3V4VH 3L5XH 1B4TA 2BERA 1DSFL 3GFUA 2DLFH 5I19H 2KQNA 3T1WA 3UYRL 5GS0C 1FNAA 1ZJBA 2FWOB 2YOAA 2GTZA 3BGFB 1Q72L 5E1HB 4ANVA 4HWZA 4FI7A 5DJYA 3RYMA 5A1AA 1RUMH 4PGBB 1Y5IA 3EYUL 1T0NB 5F89B 1REIA 3HE7A 2CU9A 4AX3A 4YE0A 4CBZA 3RVUC 4KVCL 1MFMA 4Y5VB 2K6WA 2WZ0A 1QEXA 4NN7B 4PMEA 3X11B 1V7ML 4RFEA 4GQPH 1NUFA 1THAA 1R3JA 2VLLB 4RNRB 4HGMA 5ICUA 1V10A 2AI0L 3QWRD 1KBWA 3MYJA 2VR7A 3NDYE 4ZS7L 4ZNCD 2H0JA 1U91A 4XGZB 3GSUB 3LSOB 5C0FB 3O9WB 2XXFA 4M29A 3RWGA 4F7PB 1JZIA 1SJHA 4P23B 2J1KA 2QADB 4QUOA 5DHVH 1ZDQA 3HMWL 3VVWA 2AGJL 1TZIA 1MPAL 5IHBA 4M8VA 5ELIA 2EUXA 1VEOA 3LKQA 5AOMA 5AW2B 4NQXB 3CMGA 3L5WB 1I3GL 3W11C 1ZS8A 4LLWA 4F2MA 2VAAA 1UD3A 4KKLD 4MAYD 4KK9D 4WWPA 1JGLL 1RVFH 4HCRA 4GKZA 2BSSA 2R56H 3AG4B 2YXVA 3D69A 1CT8A 3M3GA 2VDML 4UV7L 1CDIA 2XTJD 4Y0GA 4YS4A 4P57A 2PCFA 2RH0A 1LVEA 2HRPL 1T3FB 4Y5XB 2X3BA 3N85H 4JFPA 4WV1B 5E1GA 4C56A 5IROC 5JW5A 3RA7H 1WHPA 1Z0NA 3MV7A 1YY8B 2NUPB 4AYFA 4AQEB 5KVFH 4RGNC 4AZUA 4X6EA 4YHLL 4XPFL 1U3NA 3G6JB 4FHJA 2A74B 3TTSA 3POCA 3BD4A 4OGAC 3WMQA 3X2JA 2VDLB 2PCYA 4IRSB 2ADFL 3NJKA 1E8ZA 4ZFZA 4APXB 3CSGA 4BZYA 2C4XA 4YHLH 2FWUA 5TE4L 4FQXA 1HWHB 1JUFB 1Q9WA 2R29L 2UXVA 1QFOA 4LL1A 5EOCH 4ZAKD 3FQNA 3CVIL 3FT9A 4BQ9A 2AHIA 1YEIH 1NBYB 1QHQA 4F7KA 3LQAC 4MNHB 4PGCB 1VB9A 2X1XR 1VZIA 5F0PB 1XGUA 2FIKA 2QVFB 5F0JB 3SPVA 5IMLA 2W8CA 5I1GH 2VERA 2OL3B 1NC4D 1W80A 2UVFA 2QQLH 2GIMA 4GMTL 5KS9F 4GG6B 2V8LA 1KJ2H 4W9GC 4GUQA 3CC5A 2NX5D 4Y2DD 4HIHB 3TEYA 1CCZA 1BZ9B 2OZNA 1C5DA 3ALPA 1R3KB 3UROR 5A3ID 2YPVH 4N0FB 1TTFA 2FIRT 4JFHE 3NQKA 5EOTA 3HE7C 4TSBH 1EMTL 4DGIL 3H9SD 4BH8A 3IS1X 2O5JD 3EOAA 5GS3A 1KGUA 3VTAA 2ESVE 4LFHG 5F3BA 5IMKA 2R29H 3SDCA 5GS2H 3OHXC 1TEFA 5MENA 3KR3H 3EJZC 5DK3A 3GS7A 3WFCL 4G1EA 1MFAL 1CR9L 5K39A 1F56A 5E94A 1L9QA 3ESUF 4TRPH 2XVLA 1G43A 3W1ZA 2F61A 2Q86A 2VLRA 3DWTA 1UCBH 5E00A 4XNAA 1S9VB 4FHKA 3BVNA 5BS0D 7FABL 4N0UB 4H8PA 3WE1A 3O3EA 2KI8A 1E4KC 5KYYA 1IC5L 3U4BH 4I0CC 4HIIB 1IC4L 3D50A 1A21A 5DVLA 3NH7L 3T6VA 1H19A 1INDH 3JWNG 4JM4L 2WK2A 4N0UE 5DMJB 4LSTH 5GISH 3D0LB 3WOVA 3LPGA 1OE1A 5C70A 5F9DC 4FZEL 4NNYA 4Q0XL 1NBYA 1JV5B 4XCEA 3MV8D 1IM3A 2EABA 1BEYH 1VAHA 3ARBD 4WDIB 5JUEL 1G7HA 2IALB 1IBHA 4D7BA 1JUFA 2H3NB 2VSCA 4QHLB 1FNFA 2Q3XA 2LW3A 2EE2A 5D1XA 4JFFA 1MFEH 3GGWB 2DQUL 4GPVA 3UTZA 2IDCA 4K71B 2VDQH 4PJIE 3WKYA 3M1BB 1CUOA 1U8JA 4MMXC 3KXFD 1DVYA 1L5GB 2Q9OA 1U2CA 4R2GD 3QJZA 5ICZA 4MXWL 3ARZA 4BGLA 2FBJL 5J4MA 4NZDA 4ZOAA 4WHTB 5DZVA 3C2AL 4MJ6B 1XZWA 4EUPG 2IPKB 3FO1A 5L9DH 1I1FB 1OE3A 3DOIA 2ILLA 4Z78A 4F7TA 3HEIB 3VI4F 2YRLA 3MJ9L 4L48A 3X2LA 3QW9A 5IEHB 3B5GA 1YPZB 4PWJA 5DC4B 2BIHA 3Q9QA 3LKOB 4R0LB 3FU9A 3BPNC 4NNXB 1E2VA 1I9RL 3I3EA 3DNKA 3IGUA 3WFDH 4FFWD 3HU1A 3VRIA 1N67A 1PNCA 2X4QA 3U2IA 3HG1E 3LEVL 1GYAA 3SY0B 1DANT 4JQVA 5DJ2B 1IBFA 4AGMA 3FU0A 2CDFA 4ZJ9A 2CWRA 2VMFA 4HBCL 3ZTNL 1BIHA 3MLZL 1HEZA 5B21A 3EJJX 3X2QB 4NJAH 4LLMA 3AWFA 3NG5A 1B0GB 4L9DA 4J23A 3SBWC 2XKSA 2VJ0A 3KR3L 3VM7A 3WL9B 2CJUH 4ETQA 3MLRL 3W11D 4CMHB 2EYSA 5JPMC 2PP8A 4M1CD 2G4GA 3PWPE 4N2GA 2MTPA 2ZXWB 1YC8A 4L8CB 1X4ZA 2DN7A 3IJEA 4LLQA 1MNUL 3UG5A 4PVNA 3HZ3A 2OTUA 3POHA 4AVKA 3E8UL 2XWBA 5HHQB 3WSQH 1OSPH 2BJML 5DD6A 3BIBX 1UG9A 3U25A 4C4BA 3F84A 1OZTG 4F9PA 3K81A 3DV6B 5KG9A 2XWXA 2WLNA 1QP1A 1O7DE 5LXGL 5E08H 5ICZB 1QUPA 1JAEA 3UG4A 1G6RA 3HCVA 3Q13A 3KEHA 3KYKL 2C4FU 1F18A 4YSTA 2BOCA 3G6AB 5J12C 2F19H 4NFDA 1YEEL 4WFGE 1T2XA 2VDKB 4HC1L 2HMIC 1YYLH 4L1BA 4RFEB 5TE7H 1IAOB 2D7TH 2VLKA 2C7UA 1JK9A 1TZAA 3D39D 4R90L 5B39G 1RU9H 4JO5A 1Z9SA 3VXPB 5FGBC 3QH3B 3QJOA 4JFED 2X05A 2BNQD 3PQYD 4BFBD 4BWTA 3OKKA 1ZEAH 4LIQL 2LU4A 4YZFE 3LRSB 5JZ7C 3OLEA 5DO8A 3FCTA 2I60L 5GSVA 2GJ6E 2FRGP 3VD4A 4YR6B 3NACL 4BCXA 1FVEB 3GSQA 3ZKSD 3HBPA 1UADC 2QQKL 4J12A 3OR6A 4XO9A 4ZAKB 1CBJA 3GSRB 4U6VL 4K94C 4LARH 3ESOA 4X7DC 4UQBA 5CEZD 4B96A 3ISYA 3TCLB 2IDQA 3SDCC 4JCLA 2E86A 5D55A 3U0WL 3B2MA 3L4TA 3U2SB 3ZN6A 3QEHA 4ISVB 1KNOB 2YPKB 1NAML 3QVAA 3X1NA 3T3PB 1CICA 4LP5A 4HW6A 4Y4KB 5JOPD 2EUWA 3Q2VA 2D2CC 2WQXA 4JO4L 2AS5M 1I75A 4ZBJA 4GW5A 2GUOA 2VO5A 3B2UD 4L3EE 2O61B 1BHGA 3HUJF 4YDKL 2B63A 3KL5A 3T3PE 3QEQA 2PCPA 4YDVA 4BWWA 4LCYA 2LV4A 4UDUA 3Q06A 2WVTA 1ROWA 5FAAA 3VRLF 1B9KA 5BOPA 1NPUA 4PJAA 3RIFK 4N2NA 2F8XC 3N50A 2VN5A 4KLNA 3RL1A 4KK9C 1DJSA 3GHPA 2ATPA 2G60H 4DHLA 1SPDA 5JOFB 3SDCD 3RPIB 4BQBA 1UM5L 3KHOA 1QAWA 5I73B 4O9HL 5D1QA 2Y1ZA 3U1QA 3S36X 3AUWB 3ARSA 4TYUA 4KKNA 1BD2E 4FQXC 1UVQA 4PM1A 2ICEB 1XF2A 3KVDD 5AUMA 4IW4C 1ZLWH 3V5DB 1QNIA 2YO3A 5EZIL 1IEHA 4TXVB 1AMXA 4PGZA 4Z7VE 4XN1A 3SDXE 3CZUB 2JXMA 1P2CA 4HX1A 5FM5M 5JPMB 2YLHA 3MRNA 2H7WA 2L0DA 2AJYL 4KQ3H 3V4PH 4V11A 5D6DC 4HIJA 4IRSD 1E5AA 1ZANH 1K5NB 3B9KC 4LDEB 4DESA 5AYUH 1RI8A 4H2AA 5BV7C 1Z6JT 2NZIA 5IROA 3TO2A 2JK5B 4JY6A 4F58H 1HT6A 4TSCH 4JG0L 3F7QA 3PLYA 1XXFC 3O9WC 1QLEL 3CUPA 5D7JD 5DXWA 2GPZA 3VGAC 3PWVB 3V5HA 1MJJA 5CLZA 1HI6A 4YHIA 3IDUA 4EQ2A 2EDYA 1JK8A 3V7AG 2MWCA 3K6FA 1H3VA 2PTUA 2VITA 1G7QA 2DI8A 5KJRH 5FYJE 4A68A 3MXWH 2WXKA 1F8TL 3TWYA 4X8XA 3T6XA 3K2MC 3Q9PA 5C3IA 2WVVA 5H37G 4IMLB 4JP6A 2X87A 3LMJL 3OXSA 1BZ7B 3GSNH 5T1LB 2YD4A 3VFGL 1FAKT 1S8DB 5LGHH 4U2ZA 3TONA 1UACH 3VFTB 4AUYA 2HH0H 4PW9A 2W07B 5IR1B 2GBAA 3PU7A 2XUWA 3NYKA 4C83B 4B95C 2EDRA 3WEOA 4N0YH 3QR0A 1IAKA 2MHAA 4JRFA 4D3CH 3F62A 2ZUQC 5HYIA 1ODUA 2J7LA 2OMVA 2WWKO 3GM0A 2H4EA 1J1OL 2JB5L 1RZIB 2ZCHH 4Z1PA 3UPRB 1OARH 3DVNA 4HZAA 5D1XE 4MCZB 1EWHA 3FF7A 3PS6A 5HYJB 5ALBL 1U91B 3FRPB 1K8DB 1R3HA 2F5BH 4HWUA 3G9AB 3MCG1 3N44B 5D1QC 2IH9A 4JO4H 4UT9H 4UZUA 5D2NC 4JNXA 5KVDL 4L3CB 3H42L 4DGIH 4UNIA 5EPMA 2YIHA 4AVRA 5CN1A 1I8KA 2CW0D 1ZMYA 3FUNA 5CWSA 5EU7E 2Q2EB 5ABAA 4KKCD 1WIUA 4APQB 2Z8VC 5L6YL 3U9WA 2PYFB 3MKKA 1OP3K 5DHVB 5HD8D 2E6QA 2M83A 3RWEA 1SEQH 4OZ4A 2W0FB 5TDNB 2BDNL 5AD0A 4L8SB 3ULVH 1JZEA 4DKEL 2EDXA 1JCKA 1JV5A 3GI8L 4XCEB 5T5FA 2QKIB 2GY5A 4B9JA 5E2WL 3N42B 1C5BH 3R1GL 2CJSA 4QTIL 3W5MA 5HDBB 2J4WL 4OZIE 5D96C 3WV0A 5CIPB 1J9QA 4P5SA 4UT6L 2QV2A 2QMKA 5GGVH 4E68A 4H8VA 4HZ1A 1XH3B 3TZVC 1Q9KB 1V05A 1U3HB 3NCXA 4MSWA 1FSKB 3QUXC 3QDGD 4X4ME 4G43B 3WD5H 3GTVA 4JQIH 1SBSH 4H8UA 5C07B 2JIXD 1JDDA 1X7QB 2V0AA 3BKYH 2W65A 3ECWA 3MROB 4P2QA 3E2HC 5BRZE 4WEBH 3S5LG 1BG9A 4LKXA 1PKQE 1YNLH 2AV1A 4PGEB 3QXVA 5I19L 1T1WB 1MJ7H 3LNGA 5C07E 5BW7A 1Y6KR 2X4OA 3FONA 4HLJA 4FZEH 5ANHA 4X6DB 1E27A 4WW2A 1YDPB 3QFDA 4NFBA 3P2TA 2Y7MA 4M3JA 5CFAA 2WZPA 4X83A 3VGGA 3VXQB 5KYNA 1PKQB 5E2UH 2ERJB 1XT5A 1F97A 5IUSA 4GRMB 1SN5A 2V5RA 3CMOL 3KPOA 5E4AA 4Z77A 3EJYC 3V0FA 3JZ7A 1KJ3H 5DLMH 1ORQA 4UT6H 2YPVA 1FLRL 4JO2H 1RQ5A 4L4VB 3RKDC 2APTA 3NFPA 3WTXA 1KZQA 4ODHL 1HK6A 4LCCB 1A6AA 4EN3C 2P42B 5DJCA 1FL6B 4WO4A 3VXMB 2VZ3A 3ME0B 4N0FA 5CKGA 2FX8L 1WFJA 1DBKH 1MFCH 1OIOA 1LDPL 3HS0B 3LN4B 5ENWB 3HMWH 1UJTA 3CZJA 1NANH 2BVTA 2WBXA 2FJHB 1DBKL 4LRIA 2XQYG 2FAUA 2F54B 1CLOH 4RGNE 4BKLA 1AP2A 2VERN 1QFWL 2XYBA 3DC0A 1LD9A 4EO5A 5ERWB 5CD3A 1VZHA 2P52A 2JKNA 4G1EB 2NSMA 2OTWB 1R5WB 3SJVE 1Q72H 1JHKL 1WAEA 4BUHA 5KSVA 4L29B 3QS3A 2F54E 4RGNB 3ZKXC 1HSBA 1J5OL 3L3OA 4IJ3B 5FTKA 4UTBL 4LGPB 4FI6A 4AT6B 4U6XA 1F4YL 2QJDA 4M7LT 1OM9A 5FV2A 1UB5B 2FJFA 5KSUA 1E65A 3BZFB 2HT4C 3FUMA 2DMKA 3MRHB 4ODHH 3SBWA 3SJVB 4HUUA 4OFDA 1PD1A 4P5MA 1I8IB 4N6RB 3WFEL 1CGVA 4IBUA 2J43A 1I9JH 3Q1EA 1PG7X 5I82A 3B8YA 4FQHA 1QTYT 4WWID 4DIXA 1BQUA 4OD3L 3MLVH 4JN1H 4LHUG 3CFBA 4GT7A 2WXOA 3RWJA 3TGXA 1NDMA 1LE9A 4DCQA 3TEXA 5I8EA 4W9HC 3BPLB 5KANG 1GKEA 1DVFD 1PLCA 4GRWF 5D2LF 3ZKXB 4CVXB 5FO7A 3R0NA 4OCXL 1J1XL 4BA8A 2V2WB 3O6FD 2NYYC 1H0HA 4GYBA 4L23A 4Z77B 5CJXA 4TM9A 5F96H 3QQ8A 2OK0H 1ZVSB 4L9LC 2DTSA 1SUHA 2YD9A 3MJ7B 5AZ2L 3SGEI 3ZDXF 1FJ1B 4Y4HD 1NEUA 4APQC 4CVZB 4F37F 3TBWB 5GZNC 4E2OA 4W9EC 1U93A 5GLXA 2YEZA 4PLJC 3Q6FB 3TJHC 2ZXCA 1ZKAA 2J8OA 1WBXA 5A40E 3MYJB 3PXHA 2IQAA 1VA9A 4F57L 4M7LL 3APMA 4F7EB 5C0FA 1R0AL 3QEUB 1LEIB 1YY9C 2LAGB 4ELMB 3UYRH 3IJYA 2QPUA 2B8OT 4BFFA 2CBTA 4DN4L 3MLYH 1A65A 3VRJB 4QRBA 5KUMA 4WHYG 3TA3C 3SO3B 2UYLA 2PMZA 1BJ1J 4XB3A 2ZUQB 4GXFA 4OLZH 4DN4H 3B7RL 3NCWA 2BY1A 1I9IH 1KC5L 3BSZA 1WDAA 4HS8H 1RK0A 1R3LA 4ZW8A 4Z23A 1N5AB 1YNND 1QPKA 1WHOA 1WSST 4N5ED 4X9HA 2A6IB 1I7TB 4N90E 4PJDE 3VH8G 4QXTB 4RISL 3V4VA 5EWIL 3S35L 1S9XA 4FQXD 5AB9A 4PLJD 4EI5A 1MFUA 2VPYA 1BGXH 3R18A 4UZSA 3RDTD 5T1DH 4RQQB 4I4WA 4WJ5A 3BKCL 2V9TA 5C0AE 1XXDC 5E6RB 1HJBC 5ICYB 1OSEA 2PYED 2EECA 5LDUA 1AO7D 1J0IA 4FQCH 3EBHA 4OBSA 4QF1A 4WAFA 4M8QB 1L3WA 5JO5B 3BVWA 1RFDH 3U9PL 2Y7LA 1MCBA 2XWJB 4GQ9L 1HNGA 3FTVA 3OKEA 4XN9A 4ZSOB 5T5FH 3WYRA 5J9PA 1XTLA 4UV4L 3CK0H 4HOXA 1A4KA 1WGVA 3W37A 4BRVA 4XVOA 1OP3H 2AANA 1F2XK 3ORJA 3M07A 1T21B 1KB5A 5J6GA 4KNSA 3MLWL 3PGFH 2F7QA 4F33B 3AWEA 5HJBA 3OMAB 1E3XA 1II4E 4L3AA 3T77A 4NC2B 1N6QH 4AQ8A 1OB0A 1JPGA 2PN5A 5GGTA 2VLKD 4PJIB 2HFGL 4DSYA 3VFTA 1KDJA 2R83A 1PG7L 3WJMA 2YR3A 4MRCA 2F0CA 3ULVD 4Z95H 4HPOL 5DO2D 3VAEA 1NICA 1RSFA 1MNNA 4PJEE 3SCMA 2BIIA 3CXHK 4OZGF 2EXWD 2WB7A 2HRLA 2X70A 4YN3A 1TQBB 3Q6FA 3FQXA 3QZWB 1Q1PA 2ENSA 3VSTA 2K0RA 4PY8I 3I84A 4MX7A 4U3XA 2DV6A 4UIMA 1F5WA 4HS3B 3RZCD 3L1EA 4FABH 1TWAA 1G9NC 4X4XB 4KKAD 4JPWH 2J8UA 1TPXC 3UAJC 3LRSA 4YSSA 1QLRA 1DUZB 5SV4A 1OGAB 4CRZA 1NGXA 1GA2A 1NGWB 1E5UI 1A8JH 2GK0B 3D08A 4PP1D 1MG3C 1YQVL 2YQGA 2WLJA 3L5HA 3Q01A 1G0YR 1XSKA 4TVPE 1J8HE 4UOW0 2X4UA 4Y19A 1BIIA 4U6YB 1YQVH 3ARFD 3E80A 3IS0X 1NC2A 3MACL 4N3UA 2BZCA 5I8CB 2RAMA 3SJVD 1GW6A 2BC4B 3FDWA 1RZ8A 5IK3B 3KLLA 1NEZG 1X5YA 1ZY9A 1SDAB 3OLIA 1OM3H 4GG8B 1R75A 4U6TA 2Q76A 5ITFB 1A6WL 4AENA 4NQED 2VR9A 3NN8B 4U7KA 2X4SA 2CCLA 4LPTA 5HHNA 3STBA 1P4UA 3QEQE 1AGFB 3QCUH 4PSRA 2A9ML 2P28B 5GJSL 2EIZA 5DZ9A 1KY7A 4LL9A 2FVNA 3NCJH 3UAJA 4UDUB 4JGMA 4W9CC 4FFWC 2X2IA 4P2RB 3EOTH 5LLIC 3TWCL 3A6CL 4LSPH 3FFCD 5GXBB 5MI0C 5CJOL 3QNXB 3RGVA 2X4OB 1X5LA 6PAZA 1U30A 1NL0H 4Z7VA 3P73B 4NQVA 1F86A 2EYTA 2D8KA 2F6AA 3CHSA 2QPEB 3QZLA 4P5TC 3WFDL 3H9ZA 5D93B 1PMYA 1R33A 3QC8A 3ESMA 3MNDA 1D5IH 2DBJA 2AQSA 4BFJA 5E7BA 1P1ZA 4AUJA 3Q05A 5E8EB 1OAXH 3GXTA 2WTOA 3OKLB 1T83C 5F9JA 2J5LB 3DX4A 3NSFA 2YAQA 3SKNB 5IHUH 5JOFA 2ZKYA 3X3FH 1D5XB 3QFJB 3CXDH 4ZUWA 4NSKA 3T4YB 4DVBB 5DZNA 2HRHA 4KDWA 1Z5YD 5GS1B 3UBXI 2B3IA 4M3HA 5TGBA 3TVMC 3N55A 4IOSA 5DI8B 1UCBL 4CDHA 2BZDA 3JV4B 3FCTB 1D6EB 4NM8L 5I8OL 3B4NA 3GJFH 1NCCH 4R4FH 5EUOB 2N3JA 3CPLA 3MBWA 4YXHH 1YNKL 2VDQL 3MRMA 3MDJA 2J71A 1NL0L 3OUGA 2QSQA 3O6FB 3QSKB 3SGDH 1E90A 1IC0A 4X99A 1OTUC 2EDKA 4G8GA 4XPGH 2RQEA 3GMPB 1WCBB 5KN5B 2ADYA 5EUOE 2LLGA 4IM8A 4ORGA 1TZ8A 3IFOA 5KSAD 5HHMB 2F58L 3O81A 3KL3A 4TVPL 4Z3GA 5HVWA 1HQ4B 1UM6H 1IGFL 3LEYL 3QQ4B 3VXOB 4FMFA 1QO3B 4HA1A 2XPYA 3DJ9A 3ATBA 3EH4B 3BYTA 3V2AR 2NAPA 3OJVC 2R2HB 1G7JB 3FKUS 1FAIH 1UWGL 3LXUX 4I18C 4XX1E 4NZ8A 1TUPA 3O4OC 5EZJA 3GIZL 4G8EB 1OE2A 1BOYA 3X2GA 1MQ8A 5ALCH 4L0YA 2DQUH 2AEQL 1Z9NA 3LKNA 3WUWA 3EO9L 3TA3A 1IFGA 4Q6IC 2HP4A 3WMSA 1JVLA 3HB3B 3DXAD 3KPSA 3P73A 4NQVB 2OTUB 2YGVA 5EBMA 4RX4A 1BAFH 3T0EA 4TTDC 3MJ7A 1S8DA 4WQOA 1XF4A 3VFSB 4XI5D 5J3HC 3NPZB 2EKSA 2XPZA 1ZHKB 4K23L 3DX3A 4K5MA 2ADJB 3QZNA 1A1MB 3IXTA 1MFCL 4TUOB 4XVUD 5E8DH 4D0DA 5KZCB 4U1GB 5DJAB 2BOCB 5I15L 2ED7A 1UB6B 5DHDA 1DQQA 3DI2B 4RFNB 4FLSA 1X5KA 4KHTL 1I1CA 5A2KH 3EOTL 4IBQA 5DD1H 2JCCB 4IKJA 5HI3D 1AGBA 4WI7A 5CAYB 1F1DA 4AW4A 3PWLB 4XT1C 1N12A 5F6IB 5KTEL 4N28A 3MUUA 4P06A 3TF4A 3L08A 4L0PB 1JWSB 4L29A 1QSVA 5ESQB 5J7CC 5LO7A 4JZOA 5DRNA 1N19A 2JCCE 3ARWA 5E2TH 1ETZB 5ICXA 3RRQA 3S36H 5KTEH 5CZVL 2JIQA 3FO2A 4JRWA 4L8CA 2YAOA 3BAKA 2MCPH 2DH3A 4PJFA 3U7WH 1U8MA 3KLQA 1HHGA 2BX5A 2CO7B 3DRTB 1CJYA 2G30A 2HG5A 3MNVA 4HJSA 4CVZA 3S3JA 2CGRL 4P2YA 4IMKA 3C8DA 1XSIA 3IMWA 4NC1E 3MXVL 3DXAE 4OZHF 1JZ4A 1RJCA 4HC1H 1ZHLB 4R4NC 3APDA 4W93A 3KLAA 4XX5A 4JANA 4RETB 4F8OA 5EO9A 3AMKA 2B59A 2ZJSH 3NZHL 3PHSA 4RDQG 4QKTA 3IFPA 4QRQA 2FNBA 1GPOL 3ZYOA 1O9WA 4NQQA 3HLKA 2OSLB 4O2CB 4U6HA 3V0GA 2AQ2A 3O6LH 4HHAA 4KVPA 1XX9C 2BP3A 1ZHBB 1T1YB 3L3HB 5KOVC 5DHMC 5I1IH 3QORC 4HJJL 2PWDA 3DUUA 2G2PA 2FX9L 4V1DA 2JIXB 4H26B 3MTRA 3ZO0A 3CVHH 4IKIA 4OM1L 1UYWL 3TCTA 3IMTA 3DTXA 5CHNA 5IGXH 3BUPA 1MXDA 5FTNA 2IF7A 2DMBA 1E27B 4WW2B 3GSOA 2IPUK 1CD1A 1NFAA 1JF1B 4GXUN 4I5BA 5J6GB 1G1KA 1GGCL 2WP3T 4FXKA 3HN3A 3ROOA 1TVHA 3QARA 1B2YA 3S3BB 4EN3A 1LILA 2XN9D 1O5PA 3V79C 4U1NB 3LH9A 3GSRA 5L2KD 3U36A 3IXTB 1JVKA 4TUOA 1N0XH 3MLYL 5T5NF 4DZ8B 3OHMB 4KV5F 1A6VH 1PPIA 3L3GB 2RTTA 3VE0B 2EDTA 5JW4R 1MIEL 5AAMC 2Z8SA 5J56B 1H6UA 2ROXA 3IFNH 2Z92B 5ENWA 2E56A 3G04B 2DQTL 1WCMA 1G5GA 1VACB 1VEPA 3S35X 1ULVA 1MRCL 2WBJB 1AZZC 4GO6B 1A1OA 4MMZC 3CQFA 3LXBA 3A67L 3GJEB 4YL9A 4DGVL 4OFQA 5FHBL 2B9BA 3X2OA 4AYBA 1WWAX 3ZHDA 1AKJA 2NNAA 4GAAA 2QQLL 4GMTH 3RWDB 2RFXA 2HWZH 3DKHA 3BEWA 1J12A 4P2RD 4ZO9A 1OGSA 5ETUB 3ZIYA 3AAZB 4A2MA 1XDTT 4EBQL 2ISDA 3RFZA 1WFIA 4PWKA 3L3IA 1IVLA 1CDCA 3DETC 5MERA 2WLLB 4PI2A 1I7RB 4JPIA 4Y16A 1EJOL 1S5IH 3HZVA 5IB4A 4QD2E 1TVDA 3UTTA 2GC4C 2RGSA 1OANA 1MW0A 5E9NA 4KXZH 4J8RB 2JFCA 3GYRA 4KKBC 1IIIA 1AW8B 4AVJA 2R0ZL 1AJ7H 4WUKL 3INUH 4PRAA 4TQIA 2GEQA 4LLQB 1GTFA 1YO4A 2JJSC 1U8PA 1IAKB 2MHAB 4Q8BA 4N8VB 5AVWB 1HVXA 3CMOH 1S5HA 1R46A 3BJLA 4PJGB 3FU7B 2Y2YA 3ROOB 3HVDA 1C16B 4JKMA 4XPBL 5L4FA 1WWCA 3AJ7A 2IQ9H 5IV2A 5ITBH 5JPNB 2BNQA 1DMSA 1BQLH 2DQCL 3P4NB 1IV8A 1FSKC 2Q20A 3QUXB 4OI9A 4PJGF 4AGQA 1HOEA 4G6JH 4P3DB 1MW3A 3WTWA 4G2AA 3CFKA 1SJEA 1Q9LB 5INCA 1ACYL 2NW3A 1KYOK 4PG2C 2IV9A 4YQXL 4KQ3L 4JRLA 2IPTL 1LEKB 1FFPA 1I3UA 4M5YH 2E7ZA 4FYQA 4HWBA 1U95A 1LXMA 1KFAL 4JQXC 3F6IA 2FBJH 2KI6A 4W4NA 4ERSH 1UACL 1G7MB 1EFQA 2VITB 1E4JA 4JX0A 4HXAH 3MCKB 3RY4A 1XGPB 1R9TA 3VYPA 4D8OA 4DZ8A 2ZYRA 5C09B 1DBML 3FSWA 4MJIA 5DC2A 3UC0H 3VE0A 3L6FB 3MV9B 4HJUA 3IJYB 4FAAB 1BM3H 5I6OA 3UTSE 2Q2LA 3DMMB 4L5FE 4XMUA 4RESB 1N8ZA 5KVEH 5DR5H 4CSTA 4HEPA 3RAJH 3LS4H 1F90L 1JNHA 4ZFQA 1SMYD 3N40P 4AW7A 3L4XA 1X7TA 3PE9A 2CA4A 3FTSA 1SM3L 5D1ZC 1F02I 3CFJA 4XPFH 2A74C 3UTSB 2V9QA 4JO2L 1RZIA 3UPRA 2JI2A 3U1SH 1JHTA 3GBDA 1LO5B 5H37H 2A7BA 2H2SD 5D1ZB 4ZDHA 3VWKC 2UZYA 4BZ2H 4OD3H 5E6YA 1HH6B 4FD0A 4R6UA 3RWHB 4CKVX 4Y5XC 3MV7B 5EUOF 3QIWB 4AE1A 2LFGA 1KIPA 1XF3B 2BMKB 1W6WA 4I8DA 5LGJB 1B6DA 4URTB 5IMOA 1TG8A 2G3ZA 3ILPB 5IJVA 1ZK5A 3QDMD 4PJ9C 5JZ7D 1R24B 1FFTB 1UCTA 4G80A 4I3RH 2X2UA 1YAIA 1PY0A 4NBZB 1T4KB 2D7OA 2GFBA 4NNYB 1O7VA 5CJOH 1QBMH 3TIWA 4C59B 4Z7WF 2A6DA 1T0NA 3RUGF 2FJUB 2HT4D 3KPOB 1Y6NR 4PS7A 2Y06H 2JIPA 5GQBA 2RMNA 1MSPA 1EEZB 4JFXB 5D4QA 2KKQA 3KYMA 5KYUA 3GLAA 3LKNB 1XR8B 3MV7D 1JZ6A 1JYWA 3N1GC 1J10A 2CLRB 1YYML 3CSFA 5DRWB 4HPYH 5CBAB 2X9WA 1CLZL 4M1DL 4MAZA 5K9QI 1Y0LB 3PRZA 4NERA 4GAYA 1G7IB 1OALA 1U8JB 3P02A 5J5EA 3JQOB 3H2PA 4FNQA 2WW8A 5JW3L 4HUXA 4AIEA 3ZDYF 4I9WE 4JGJA 4YXLL 5F1NB 4UTAA 3O2DA 2JXMB 4HX1B 2K8QA 2P43B 1HNFA 4UQIM 3GB7B 4A7TA 3PHQB 3GIVA 4Q4IA 5KBMA 2ESVB 5SWQA 2AV1B 1B9ZA 1N7ML 3IJSB 3QUKB 4OZHB 4XR8C 5D7IE 3MRMB 1OGTA 1S7TB 2OMUB 3BGFC 2X2YA 3DJZA 3RJDA 1JYNA 2ZX9A 4OIBA 3QNFA 2R4RL 3AG2B 3WO3B 3EGSB 4UAHA 5JOEA 1VFUA 2YU9A 1JNJA 3G5YB 3LD8B 4NZRL 3NACH 4L3FA 2JWYA 1UD2A 4ZK8A 3RDTB 3NCYP 2F58H 3PIQA 1QFWI 1AO7A 5JLZB 1CE6B 4M8QA 1AACA 2K4AA 2Z31A 1HH9B 1PG7W 4K8RC 5DD0H 5LDSA 2G9HB 1V8HA 3OKDB 3QUZB 5EBWB 3V5KB 1WRFA 1TZGH 1YY9D 3PP4H 2AJ3A 3QNYA 2VDKL 3ZYZA 1RU9L 3P9MA 2EH7H 2KDGA 3M86A 4AMWA 1BQKA 1A2YB 1SUJA 4GUPB 1ZT1A 5HBBA 2FUTA 2JTDA 4KI5F 5FGBA 1QHPA 2QSTA 4XCNA 4O4YH 4PD4J 3X12B 4NQDB 5CN3A 3TN0C 3I6LE 4EF3A 4QLRA 2QGBA 2CR6A 3G5XA 4GRWE 4FI8A 3RVTD 2WLZA 5AOKA 1OCCB 2XXGA 3E9TA 4ZYKB 2D7NA 4EIZC 3BPCA 4OZGB 1MY7A 4WU5B 5L7XL 3O4OB 1SLXA 2ZP8A 1L9MA 2PTTB 4PJ8C 2IV2X 4JRXB 2PPDA 5E6SB 2J6WA 4XXCC 2EZ0D 3W0WB 3IF1A 3IRCA 4XMVA 2YSSB 1JVOA 3S8GB 4FMKA 43CAA 3ZDZF 3EYSL 4CS0A 2P24B 4G6KH 1VADB 1FWXA 3JTSA 2W0LA 1VZGA 4F7EA 4GIAA 4PJEF 3GEFA 2JA7A 5IJDC 1T5WB 1J0ZA 4K8RH 5EEUA 2EVHA 2B1AH 2KQAA 3KWVA 3EUDA 2ESVA 1ZLUK 3KLKA 2A2QT 1MHEA 3QDHA 4ODSH 3JUZA 1KXVA 3MBEA 3IEAA 5FK9A 2PKDA 1JPTL 1X4XA 4F15B 2KPNA 4RGOL 3BFQG 3TYGL 5HGGS 2X88A 3OZKA 2MIZA 4HPYL 5IT2L 2CPCA 3MNWB 5EU4B 4HBCH 3ZTNH 2DJ4A 1A9EB 3VFUB 3LQZA 4P4KC 1SFDA 3MGOA 5KVFL 2XZCH 2XX0A 4NWUH 3E3QE 5E2VL 3ZDZE 1KMGA 3RVWC 4Y2DB 1CO1A 3OAZH 4LVOC 4QJ4B 5CSZA 2H9GA 5H2BB 1K2DB 5G4OA 4C47A 3OKMA 4TLTA 1DEEB 3FCSB 4YSPA 5FO8A 1ITCA 1ML0A 2LU7A 3DUSB 3NCYS 4WI5A 2QTEA 1HCYA 2GABA 4ADIA 2OKMA 2FQDA 3VWJD 1HEZB 3ZHFA 4MA3B 4Z0BH 4NC1C 3GKWL 4HALA 3V0VB 3CVIH 3BP7A 3W56A 1QRNA 3MRIA 2JIXA 4H26A 3WE6B 2PETA 1ETA1 5HXMA 3EH1A 4J27A 4L4TB 2ZSVB 2VSDA 4GEIA 1A2YA 5KSBE 2D0GA 3HPJB 2D3NA 3B5TA 5SWZD 1P84J 5HGDA 4N9OB 5J89A 1OAYH 1CIUA 1YEJL 3CZNA 4P4KD 4BJLA 4JKLA 1BDYA 3MRFA 2AXHA 4WEUD 5CMAA 1FYTD 1KELL 3E6FB 3O9WD 3QEQB 3QR2A 4S0SD 4KZCA 43CAB 1MWAH 2G2RA 1LWJA 1YEJH 1CGWA 1PL3A 1UJ3B 4PWHA 1KCKA 1S7SA 3KGSA 3SBPA 2OULB 5HDLA 4CDGC 3GRWL 5JHAA 3MFFA 2JB6B 4ZD3L 1EH9A 3WNJA 1RUQL 2XXMB 5D9SA 1JZDC 4S1RL 3GKWH 4K7PX 4UIMB 3C09C 5F7FA 3D9AH 4A55A 4Z7WB 2K7QA 5JO5A 2X28A 2IDFA 3HW7A 4LAJH 2DQFB 4PLKC 5SX5K 2H3XC 3MBEC 3JWOC 1B90A 5I2IB 2JCCA 2C9UA 3PF2A 3ETTA 2VDPB 2FSDA 2DQHL 3T5WA 2D4DA 2W60B 2WMPB 4PVMA 3FS9A 3F01A 2HUHA 3GUTA 3A6CH 4LSPL 4W9DC 1N9PA 1MCIA 3O2DL 4S10A 1EO7A 3L48A 5IJKA 5HHME 2ZXQA 3DX9A 4LGRB 3REWA 2X41A 4HYTB 4PJIA 3QXDB 3HC0A 1XEDA 5LBSL 1JDAA 5EHFA 1S5IL 1TU2B 3FT4B 4G8FA 1QKZH 2NQDA 4KTEL 3QUML 1JPTH 4MB3A 5DTFA 1P5UA 4N2MA 2YBGA 3V9EA 1M9WA 1KIQA 3WJLA 3QJFB 2DJSA 1D7BA 1J88A 1QACA 4F1ZA 5CJ5A 1FGNH 1V27A 1KT2B 2DWEB 4IRZH 1SJVA 1PG7H 2X6VA 1DUYA 2P80D 3O3BA 1CICB 3H7BA 5F7DB 5AVVB 4YHZL 5DJDA 4HDIA 3QC5X 1HL8A 1MFEL 2OL3L 3QULB 3R1GH 3QK0A 2P5EE 2ZKHH 1LO0H 2DH2A 4Y1SA 3ZLQC 4AM0A 2ZD0A 4XNYL 4DNLA 3NIDE 3C12A 1TEYA 5I8OH 4FJZA 3DYMA 3B83A 2COQA 1SXAA 3DRQB 5HHQA 4N2OA 5I1CH 2ZOOA 2X6UA 2WN3A 4XVJL 2A6JB 3S5LA 1RJZA 5A2CA 3HNVL 3DBXA 1ZD6A 2Z7YA 3DV6A 1KPUA 5KG9B 2E6PA 3UTSA 3D06A 4XHJD 2YPLE 4HWBH 4LLDB 5DRXB 2Z9TA 1QABA 4M9PA 5FUOH 2VNCA 1TCRA 1JMXA 1YNLL 4JBSA 3TPUB 3FXIC 1RIVH 5AOJA 1G8KA 4B7LA 1JGEB 1GJWA 1F4AA 1V7NL 3LEYH 3IBEA 2AAVA 2C9AA 2N56A 4FGMA 4GW4B 4R8WH 1P4BL 1BW3A 1NLDH 1XD0A 2ADGA 4XVTH 4YE4L 3IRPX 5D9SB 2KS0A 4RMVA 5TGBB 2XETA 1CT8B 1MWAL 2WPGA 3QJTB 3LN5A 3CLEL 2APWA 1PJWA 4JFFD 3ATDA 3EYUH 3QRGH 4JVUA 1E50A 4WGWB 3QIBA 2VRKA 1OT2A 3PGCB 3SKNA 2WLIA 1R19A 3CLEH 2EAEA 1H8OA 2N7BA 3SZ6A 2J8UE 4JPKL 2OZ4H 1O9VA 5GRUL 3SE3C 5DMIL 5E0FA 1WO2A 1U8CB 5GJTH 4H1LB 3KPSD 2FLMA 1ZIBA 3EZJB 2CJUL 4LASL 2AMUA 2OYLA 1AXSA 1DN2A 1MCWW 2EYTB 5FA3A 2SEBA 3QJVB 2NPLX 1UT9A 3P3YA 1DO6A 2BP8B 1NMBL 4G7YL 6FABH 5F1KC 2N0MA 1ZCRA 4AYFB 5ISZD 4P9MH 1A6ZA 1OAKL 4B97A 3CHOA 3HBZA 1T03L 3A4DA 2R69L 5E6IC 4U05A 4UMGA 5J6HB 3R4DA 4IRSC 5E8OB 3T1FA 3FFCA 1NGYB 2X3AA 5DVPA 2JLPA 1BYOA 4IRJA 2Q7AA 4RBPK 3UFIA 1O5DT 1N18A 3CGTA 3RDJA 3QB7C 4U4BA 2ESVD 2NY5C 2Y3AA 4JHAH 4LHQB 3W39B 8PAZA 4OIAA 2PTTA 3HKZA 1MRFL 2OSWA 4XRCA 2JMRA 3HC4H 5LN8A 1PPYA 5FFLA 8CGTA 3MCYA 3WKPA 5IF0A 3LH8A 1T22A 1QTPA 4HT1L 1RZJL 5GGSB 1IAII 3DBXB 5DURD 2Y7SA 2HTLD 2KQMA 1IVTA 4EEEA 5EBMB 1JGIA 4ZMQA 4DFIA 2NXZD 2ZXAA 1G9MC 3FO0L 3N06B 4OB5H 3X14B 4IKKA 5JW4Q 4P59H 2Y1VA 1BMWA 4NAJA 1HTYA 4WW2F 3L6FA 3GI8H 4L2YA 3V5DA 3G04A 1Z66A 2HXAA 3PWLA 1A4JA 4MA7H 1PQFA 3IFNL 3TYFA 2VXSL 4O02A 3UC2A 4YR6A 4KHXH 3HPLB 2F54A 2R2HA 4BKLB 3NT0A 4YXKH 5EEXA 3KYOB 4JHBA 3GBLA 4XWGL 1GW0A 4HKJA 3SDDC 3GSWB 2W94A 2G5UA 3ULVC 5BO0D 1Z5LA 5IIEA 2NZ9C 3L2NA 2H6PA 3FUJA 3IPFA 4JKWA 1DJYA 5A2FA 4OM0L 3IXAB 4NQSB 4WO4B 2WO3B 4BXSV 1ZTXH 3M6DA 1UWGH 1NINA 4G8GB 4LBEA 2WLKA 4GH7B 4MCYB 2YMXL 5CKAA 2HTLC 1RMFL 3QG7L 2HFFB 2HX7A 2NY2D 1TOXA 2H3NA 1ZC1A 1E9PB 3CN1A 3ZXAC 5JR1H 2GUOB 2NY0C 5C2UB 1ZV9A 3MMEB 2DD8H 2WP3O 2GSGB 2XKUA 3AG3B 2QHRL 5IVXE 3HTLX 1MF2H 1CFTA 5F9WC 3ZE2B 1G9MH 1RUAL 3MBXL 4IGBB 2CMRH 4KOBA 3VI3F 1MHHB 5F7LB 4Y2NA 4QCIB 3TA3D 5B38B 3GQFA 4LKXB 1F3RB 1EAQA 3HRPA 3S4SB 3FUDA 3VFWB 1BCIA 3RVWD 2NY4B 2KLSA 2ZUUA 1ED3A 3FRUB 4JLRB 4XNQB 1B0WA 3O11B 1AGCB 2GTWB 2LFEA 4QRQB 4OJCA 4MYPA 1HHJA 5FB8A 1NA8A 3EO1B 1RK1B 1BGXL 3WN5C 2B0SL 4IOSD 1BQLL 2DQCH 3BAWA 5EF0A 4O51A 2IBGA 4NKDB 3IBOA 2XA8L 1BZEA 4FXKB