4JS7A

Crystal structure of d78n mutant apo form of clavibacter michiganensis expansin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
202
structure length
202
Chain Sequence
b'MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulose binding protein
molecule tags Sugar binding protein
source organism Clavibacter michiganensis subsp. michiganensis
publication title Crystal structure of wild type and d78n mutant Clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
total genus 43
structure length 202
sequence length 202
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4js7A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4js7A02
3X2KA 2G6GA 2GAEA 3X2MA 4ENGA 4JS7A 2BH0A 1OA7A 5GLYA 3X2PA 3X2HA 5H4UA 4ZM7A 3FT9A 3D30A 2HCZX 3SULA 4JP7A 5GM9A 1WC2A 5GLXA 3SUKA 2KQAA 3X2JA 1BW4A 2G5DA 1L8FA 3FT1A 4JJOA 2AE0X 4FFTA 4FG2A 4FERA 3SUJA 3X2LA 1WHOA 1WHPA 3M3GA 3X2IA 2PNWA 4L48A 2PJJA 2PI8A 3SUMA 1N10A 2PICA 3ENGA 1OA9A 2VXQA 4JCWA 2ENGA 3X2NA 4JP6A 1BW3A 4AVRA 4FG4A 1BMWA 2JNZA 3X2OA 1HD5A 3X2GA 3CZBA
chains in the Genus database with same CATH superfamily
2HT4D 1P69B 3TIDA 3CK0L 4LKXB 4RA0C 4WVRA 3AAZB 3O6MH 3FN0H 3MOBL 5BXFA 2VDRB 3QJHA 5JOPD 2C3HA 4MNQE 1ITBB 2W60B 1JPSL 3CX5J 4LSSL 1ZV9A 4NBXB 1DBBL 1S7VA 1UG9A 4Y2NA 3TOPA 5DJZB 2Q0ZX 2XVBA 3QJFA 4HKJB 3SQBA 4KDLA 4JG5A 4OB5H 1EWHA 5JOPE 1M05A 2WLLA 1KIQB 4MMZC 5B1KA 4NRXB 3UTTB 5KSBA 1T3FB 4BD4A 4HSCX 4AYSA 4Q9RH 2XXGA 1NFDE 2FT6A 3J27A 3TA3B 5GIRB 5IMOA 4BZ2A 4HJJL 5PAZA 2CMRL 5CGTA 5AZ2L 3ABMB 1M2OA 3RDJA 4LCWE 2DM3A 4TUOB 4Y5XA 5JO5A 3OL2A 2D3VA 5HYSA 4R4BA 1GKOA 3ULVC 3A5VA 1RZJC 1IC5H 4EZMA 3QWNA 3FB6B 1CVRA 4M6NH 1JF6A 1C1EH 3SDAD 3PGFL 2MCAA 1T89A 1SEQH 5DJ2B 3MLPA 2J8OA 4UV7H 1CXKA 1MREL 2MFNA 1UB6B 2G5UA 2VXSH 5D1XC 3FAXA 4L3CB 3OR6B 1Q9LB 1TVBB 1WIPA 4HFWA 5I5JA 4A04A 3H0GA 2KZBA 4OD3L 1W72H 5E9NA 4EN3B 1IL1B 5F96L 3OF6D 4KTGA 4PJCF 1KJ3H 5FYKL 2F08A 2V37A 4ISVA 1ZKAA 3O8XC 1TJMA 5CIPB 4APQC 3DWTA 2F8OA 3LB6D 4ODHH 5F7FA 2NY1D 4H8HA 2G60H 4BWUA 2FIRT 2ZSWB 3UZVA 3P54A 5TE7L 2IH3A 1GPOL 1I8KA 4BK5C 1U8JB 3QB7C 3DJRA 2X09A 4NO2B 4OJEH 2XSKA 4DVBB 2WUBH 2X70B 4J3VA 3VRLF 4MJ6A 5D6DA 4LCUB 2KZWA 4HBCL 5T3XD 1JBJA 3GJFK 3NTCL 4NZRL 2VZ1A 3UO1L 5GXBB 5C18A 4WY7L 4DUWA 1IGYB 3LQAL 2IWEA 1YUHA 2F9BT 3QRLA 1NCDL 4ORGB 3BWAB 1KYAA 1J0IA 2IH9A 3FULA 4LVNB 1PZSA 1CDUA 1ACYH 3H3PL 1CLYL 4HLEA 1P2CA 1TTRA 2CKBB 4FN0A 1F4XH 5GGVY 3IFNL 1U9KA 2OMBA 4WV1B 3H3BC 3U2JA 1MRDH 3GJEB 4NKDA 4P2RE 1WFTA 5EWIL 5HGBA 2P8LB 3HBZA 4PJXE 1E27A 4LRIC 2P48B 3IR5A 2YRBA 2CGYA 1JVLA 3H4FA 1A3LH 3QO1B 4UOJA 3TIEA 4HV8A 4I13B 1T0NA 4YDIL 1MZZA 2C3WA 4PV8A 4AWJC 3GO1L 3VMNA 5IREA 2CCWA 1FNLA 4LPWA 5K39B 1CXHA 5EORL 4GP5B 4S0HA 4X42A 4ZFOL 3OC8A 3HR5B 1JZ2A 4M1DL 4YDVA 3G6AA 4YDKH 1QFUL 1TENA 1I82A 4JG9A 1W6WA 4ICWA 4N5ED 3NFPB 1P4LA 2Y4SA 1PZCA 3OKOB 3QVAA 3TM7B 1G5GA 2DIJA 3GKWL 3N1PC 4K5NA 2E7ZA 3WUWA 4JFEB 2H1XA 1Q8MA 2AK4B 1CGYA 3FQRB 4PS3A 1BXVA 5A43C 1TWFA 2AVFA 2R0WL 2Y36H 5F1OB 4GG8B 2CRYA 2ZXWB 1I1AD 3HBGA 4HXAH 1IBGH 3SYAA 4ZX6A 4TV3A 4FFZH 3UP1A 2XQYA 1IFHL 4ZDHB 1JZJA 3X2IA 1JPTH 1Q72L 2BSSB 3N6YA 1T0OA 5CEZL 1ZT4B 3H2QA 3IMTA 4KO6A 1GS7A 3HEIB 4R8WL 4AVRA 2E9IA 2CO6A 4ABVA 3EOTH 3FTUA 3DYPA 5EU7E 2X41A 1GZQA 4KPHL 4Y8DC 3RP1A 3S7GA 1VB9A 2IAMD 2NRDA 4JNXA 4BFFA 3B9AA 4OLYH 3BPLC 3BPCB 1D5RA 1DANU 2UZXA 4IU2B 1L0YA 1DBKH 1NJ9A 4JK0D 4LKCB 5DVMA 2VSMB 1HWHB 1O7DE 2YD3A 3O11B 1F90L 2VW6A 4AEIH 3Q1EA 4PBVC 5GZOD 2DIBA 5GGSB 5E08L 3VJ6B 4NFBA 1OT1A 3C75A 4NJ9H 2HT3C 3U7AA 3MKKA 5C09B 3MVSA 1HU8A 2L04A 1R5WA 3PHOB 3SPVA 2AMGA 1HDMA 2XN9D 4IOIB 3CZEA 3FCGA 4UZGA 2IDTA 5F71A 1M05B 1PDKA 3P1VA 3MGOA 5HHXL 3ZU8A 4PSPA 5DUPL 1QLFB 2QQKH 2BCMA 4YBQC 1XGQB 5BO1L 3LV3B 1URIA 3NH7H 4UT6L 5L4IA 1WZKA 3IU3A 1NMAL 1NMCB 1J1XL 3Q6GL 3RL1B 1WHPA 5D9SA 3TIDB 2PYEE 1E6JL 3MV9E 1UQSA 1FVDA 1ZSDA 3DBSA 2DEXX 1BZOA 1GY1A 1ZEAH 5EZJA 4I9XA 3IN0A 2M2DA 3BCDA 4CJ1A 3RX5A 4K5OA 5EPMA 3UTSB 2KI6A 2IH8A 4M29A 1GJIA 4Q6IB 3I74A 3H3KA 1PNDA 4NNXA 3V6OE 1BQLL 2NZ9D 2DBLH 5EN2B 3S37H 3VB9A 1KJ2A 2ESVE 4XB8A 5FYLD 3ZLQC 2UWEE 4DETA 3K91A 5ANHA 3HMXA 2YAHA 4XP4H 4PG9A 3D30A 2YPLE 3HC3H 4Y16D 2VR7A 2BX5A 3DETD 1YNKH 2WVSA 3PF2A 4GXUM 3VGHA 4IBLT 4ELMA 4J1UA 4ZUSB 5IMOB 2CXGA 3QQ9C 1X7QA 3G5XB 3GMLB 2R4RH 3LHAA 4HK0B 4NUMA 4WI3A 3VA2C 1FDLH 3KL5A 1V27A 4JFTA 1FFQA 2MRYA 4H8WC 3QWRA 4QWWD 3OLGA 2JKWA 5LKNA 4PIRF 1J05B 3MRKA 2ZOKB 5GIRA 2K70A 5IUCA 1SYVA 1HL8A 2X7LB 4FQIL 4PWFA 1KYOJ 1M56B 4XPTL 4DJMA 4ZD3H 1YNTA 1UYWL 4XO4A 4EN3A 4I2XA 4E9RA 4MB4A 3I3EA 3DIFB 1PIFA 3ZTJG 4ODXB 1MI5D 4JM4L 1NCJA 4ISVB 1PYWB 2AZAA 1JVOA 2F58H 2P80A 3MCKB 1WC7A 1M7XA 2OBGA 5DD0L 2YR3A 1YAIA 5E0FA 1B3JA 4XAWL 4XN8A 2PPEA 5D70H 3T0ED 1LM8V 4B5ZA 2GJ6E 4DGYL 1OP3K 3ZW3A 4MQTB 2YWYA 2LU3A 4XH2B 5AW4B 4FG0A 4X5XA 2HVJA 3U83A 3GHBH 1JZ8A 3QIUD 1HL4A 1QTYT 4U2YA 5DC0A 4NWTL 3QRGH 4YH6A 2J6WA 4CUCA 4XVSH 1EV2E 1CDCA 1IGCL 2YPLD 5SX5K 3VMOA 1HSAA 5BRZA 1IT9H 1GL4B 4Z7WA 1HXMA 1SFHA 2ADGB 4AJWA 4NSKA 5IHZA 3RG1C 1DQQA 5JXAH 4N20A 4KTDL 2XXCB 2A6JA 4QNPF 5F9OH 3C08H 1HHJA 5F7KC 2CMRH 5AZ2H 3IMWA 5CSGA 1DBAH 1MHHA 2IDFA 3R4RA 2ILLA 4PPTA 2XXMB 2GPZA 5AUMA 2GUOA 3B7SA 3QHFL 4U1HB 1ZXKA 5GRWA 1NCGA 3IFPB 4LHUA 5C0CD 2VM4A 3FN0L 1EEQA 3FUMA 4M03A 1FNAA 4MDJA 2VZOA 3OG6B 4PCYA 2IPUG 3MRMA 1OTUD 2BE5D 4JRFA 3TTSA 1DJXA 1D5ZA 4WWKD 3DX9A 2WQXA 2XZCL 3CFDA 4R5TA 2DEYX 3L4VA 4LLUB 1DEEB 4LRNL 1TZAA 4YBLB 1XH0A 3PWLA 3E2HC 3ARGC 4AG4H 2QPEB 1TLKA 5FYJE 1ZC1A 3PABA 1XCWA 4Z76A 4KU1A 4UZUA 4QRQB 4YBLC 1H5NA 5E9DA 3NPSB 1U42A 3HNTH 5E00A 2IMNA 4OZHE 3DGDA 4QAMB 3MLSL 2AGJL 4YOKA 5F0JB 1OWRM 4M02A 5LCVL 2P8PB 1NFKA 3BZFB 2XZAL 1N19A 1RUQH 5HYEA 3QUMH 1NTDA 4M8QA 2NVXA 1T1ZB 1UCTA 2EIZA 2VQ1A 3TT3L 2HYMA 3H54A 4JRXD 4KO9A 1OW0C 4ATTA 2WBJA 5CIPA 5H94B 4L1BA 1I7RB 1MHEB 2JB5H 1RZ8A 4FQXB 3ML1A 3NFSL 4NPYB 4NO3B 4PIBA 2F7RA 5EBWA 2P5PA 3AGWA 1U8NA 4KJQD 2W9DH 4G1EB 1H15A 1F0LA 2N7SA 3SO3C 3ZSSA 4BFRA 1QO3B 4L8SC 3MRDB 2BVUA 2CDEB 2XV6B 3KPLB 2OJEA 1FFOB 1GCYA 5HI4C 4DQOL 2EE3A 3ULUC 1WYJA 5DQJA 1T0MB 1SY6A 5BW7A 3LZPA 1MFDH 2B5IB 3BC9A 4JRYE 4U1NB 1N2RB 4I2XE 4KUCF 3FQUB 3JWDH 4FEMA 3V5KB 5IBTH 1U8OB 1CYWA 3FTZA 3GXNA 5FUOL 4XBPB 4ZAKA 3QUKA 4IKNA 4KRPD 3TBVB 1UWYA 4OLWH 1R3JA 1NBYB 4M7ZB 1CICD 1CQKA 1W72B 4PVLA 5IB5B 5FHBL 3LZQA 5JYMA 1ZPUA 1BQ5A 3SDAC 4DN4H 2BVOB 4FYTA 3B9VA 4A2DA 1EZSA 4WEBH 4UTBH 2VUKA 4KXBA 3VYPA 5CJQL 3SGJA 3VGEA 1GXEA 4QIRA 5E8OA 4WWPA 1MAKA 1QABA 3MLUL 1NL0H 4MJ2A 1WDAA 4I7ZC 4NYLB 5KBLA 3MNZB 5E23A 4KVNL 4WKZA 2JJSA 4DGVL 1BFOA 2IV9A 3DX6A 4FTVB 5T5FA 4OM1H 1LDSA 2CA4A 4RNRA 3SE6A 5IB3B 2E2HA 1N26A 1CPUA 1I8AA 2K8QA 4DQOH 5F72S 4XP6H 4IDLA 1N8ZA 4Y4FD 1WCMA 4ZOCA 2EUWA 5LAPA 3SCMC 3Q2VA 1SXBA 2ITDB 3HE6D 5GGRA 2WKLA 3ARFD 3IJEB 4PRHB 1QW9A 3C87A 2KQNA 4EUPB 1IV8A 1NAMH 1KDIA 4GRMB 5BS0D 3SBRA 3UTSA 1U8PB 2VZUA 2HUHA 1SEBB 4MD5A 4ODHL 5GRYA 4ALAH 4YBHA 4L2YA 4J6RL 2BJMH 3SJVE 4F33A 2WLLB 4WHYG 1U3YA 4JKWA 4MB1A 1FYTD 3GBML 3SZ6A 3FUFA 5E6IC 2F68X 3SDDB 2WC7A 1MUJA 3ZE0E 3DVFA 4JHBA 2NDGA 3QAQA 1A9EA 5KBKA 4X99B 3DSNB 3LQZB 4BCZA 5L9DL 1OP5K 4WI0B 3HUJA 5FUZH 1JZ7A 2JWYA 4Q52A 3GIVB 2RGSA 3HVDA 1BF2A 4NDMA 3II2A 3DNKA 1R5WB 1HZHL 2J57A 5D7HA 3V5DA 5DD3L 1URZA 1H5BB 3DGGB 2YS4A 2QVTA 1JNLH 1USZA 1IC0A 3CFQA 1LEGA 3QEHB 1E6OL 2DPKA 3QXVA 4J3BA 1CZ4A 3CHOA 3RGHA 1JZ4A 1NGZA 4PJAF 1U92B 1ORQA 1BEYL 3F62A 3QZLA 4DN3H 4AENA 3VWKB 3W5MA 2LAAA 3PGCB 1WCQA 3NABL 3SDYL 2R29A 2CRZA 2VN6A 4JHAL 2EDLA 1CXEA 5HGAA 4H8QA 4DP6X 1EZLA 2IWGA 4NNYA 3LTVA 1TETH 2X05A 2WQSA 1JDDA 1P7KB 4LQFL 1TJIL 3VM7A 4WUKH 5CCKL 4RNRB 1NANI 2DWDB 1BVKB 2BOCA 5E5MA 5GHWH 3UERA 4RV0A 2D03H 1U8JA 2CBTA 5HHVL 2OCCB 3HKZA 1AD0A 1EBPA 4BRVA 3TF4A 3TONA 4PM1A 3ARGA 4M61B 1BV8A 3BMVA 1FORL 2OMZB 1YN7B 2Z3FA 2ZNXA 3FU9A 3MBXL 4LNRA 3F7QA 4PUBL 4KITB 3ZE2F 1R9FA 3BPNC 4O5LL 5DD5L 1AGDA 2X4SA 3OKKB 4EDWL 1KBGL 2OJEB 4F8LA 1FO0A 4M7KH 3H9YA 3QNXA 5DRWA 3ME0A 2PWFA 4N85A 1J0HA 2Q76A 1WBZA 2IMMA 4NQCA 2DQJH 1F4YH 4M6OL 2V9QA 5C08E 2VDRH 3V95A 4LCIL 1NBQA 1I3GH 3KPSA 3VYOA 2UZXB 3WI9A 2NY3C 1KJMB 4QD2E 1UB5A 3INUL 3VGBA 5IR1B 3E9TA 3Q8CA 5GZOC 4ZFQA 5I74C 4X7TB 1Y6NR 1AR2A 2PF6A 1D9KB 4PJXA 5DRNA 4MJIE 5C0BD 5IROD 5CCKH 4JG0H 2EDRA 2QADD 1SGKA 3LN4A 4PGCB 4X9YA 3PL6B 1LNUB 5F0MB 1LK3H 1SVBA 3U7WL 1SQ2N 2RB8A 1A7NL 4JFDB 4Q0XH 5HJ3A 5A6IA 1IRAY 1ZLDA 1IFHH 3QUXD 3BYTA 2ADIA 4HJIA 1B0RA 4UOW1 1QW8A 4FLOA 4U4IA 5F0LB 3PRZA 2XV3A 4OZGA 2J8HA 1AO7E 2V3DA 2HTLC 5DD3H 5FGSA 1ODUA 1QHQA 3CHSA 1QBML 5HVFB 4OZ4B 5SX4I 2DV6A 3ESUF 4ZXBD 3FSAA 2IBGA 4FQPA 4P2AA 2DBLL 4CMHC 3FHAA 5D93B 2NZ9C 2IOIA 4JDEA 1AOZA 4APQB 4JM2A 1X5ZA 1KEGH 3VFPA 1JZFA 5CIPH 3ARWA 3FUEA 2V3EA 4NZJA 4OCNC 2DICA 4HIHA 3WBDA 4ZPTA 5DJ8A 3LEYH 3AY2A 3DC0A 4HETA 3WNNA 4BFIA 5I9QB 2WKGA 1U58A 5IHZB 4JR9L 2CHNA 2WXQA 4CVZA 1Z2KA 4PREA 3EF7A 5AVUB 1MFBH 5CF3A 2AEWA 1E4WH 4L1SA 1ZT1B 4N2IA 1J9RA 2H0JA 2YQGA 2JA7A 4H4NA 5ADPL 1OM9A 2UY7B 3O8XA 4PRIE 3EXLA 1UZ6E 3FHQA 3QEUA 3MGAA 4LBAA 3QZWB 1A6VH 2V6HA 4QUOA 5CSZA 4UZSA 4BYHA 1E7VA 3MRFA 2A3TA 2ETWA 2ODHA 5KN5A 3BIKB 2GHWB 3IFNH 4X80H 5E7FA 1Q1JH 1S8DB 4JFQB 2E7LC 2PXYA 4WW2A 2HLFC 5F2FA 4FQCH 4HEPG 3T2QA 3LDBB 5CN2A 1QASA 4H25B 2EEDA 3Q5TA 5GHWL 2YXFA 3MFGB 2NY4D 2VMDA 5CJOH 3B7UX 3QH3B 1K5NB 4U1KB 1A14H 4MS6A 5CMAB 2WLHA 5A16A 1G1KA 3QJSB 5DYGA 4PVBA 2OAAA 4NQCE 4BSWA 4ZZFA 3D5OF 2HLAA 3WKMH 2DKUA 4BKSC 4DN4L 2AJVH 2Q7NA 2YPKA 4JFEE 3KLQA 4U05A 1EAQA 5FAAA 5DC9B 1NOAA 1CU4L 3DSFH 3WFCL 3ZMEA 1AZRA 4P5TA 5GGTL 3MGTA 5EU4A 2XPGA 1FIEA 4LIQE 5C08A 4BFOA 1CI3M 3K4DA 4Y5VC 2NW3A 3TO4C 2VDOL 1E2WA 4AV5A 3MMEA 2FGZA 3HHMA 2CUMA 2NCMA 2HFTA 1YEEL 2OL3L 4AENB 1UZ8A 2WXKA 5D8JH 3AROA 5I8KH 4Q0XL 3ULVL 2VJXA 1FAIL 4O02A 4LCCB 3ROLA 1NC2B 1AC0A 4YXHH 3HS9A 4W6YB 3PGFH 2GCYA 3QG6B 3BT2L 2GTZB 3OKNA 5D93C 2OXGB 4MMYA 4HPHA 4QRRD 2NX5D 4XN2A 3GBNL 2R93A 3MRGA 2R69L 4AZ8A 1P84K 1AQKH 4Z7UF 4RFNB 5B3NA 3B2PA 5I0VA 2ARWA 2GBTA 2X2IA 1JZDC 3OC5A 4P2OA 4OJCA 3X12A 5CZVL 3NCCB 4LSRH 1HTYA 4Y4HC 3TBYA 4BUGA 5H2BA 4KQ0A 3F65A 1VCBC 3S4SG 3CFEA 5EBLB 2IGFH 4D3CH 1I1RA 4XMLL 4TOYL 4HYTB 3F6IA 3LKNB 4QHKI 4Z5RA 1JSYA 3SQBB 4MD4B 3FQ2A 4KTEL 4RMUA 2NLJA 2CLRA 2JIXD 4XNAA 2ADJB 2R56L 3AJ7A 4O2CB 2XWBB 4H0LC 5DC4B 4G8AC 2O1AA 4K8RH 5C0DA 4D0CB 4PV1C 5IEHA 2Y7SA 5JOEA 3W2DL 4ONOA 1X5GA 1S7RB 2APSA 3O3DA 4ZX3A 4TRPL 1PLCA 3WMSA 7FABH 3MRJA 1HCFX 1T7XA 5T1LB 4PCKA 1I9IL 4X7EC 4YSOA 1BCIA 2G4GA 1SFDA 2CCLA 3BD5A 2XWEA 2FX7L 3IK2A 3MNZA 4L3EE 1Z9SB 4MAYC 2RH0A 1QG3A 2D3JA 2ZCLH 3VXTA 2YJQA 1K85A 4PY7B 4R90L 1P4IL 1X5IA 3FTYA 1AGDB 2X4SB 3K6IA 5E8DL 2WN3A 3MCLH 4Q58C 1DQLL 1FVEA 1PD6A 2AEQL 1DFBH 4J3OC 4URTB 5TE4H 4M3KB 3WEMA 2NXZD 3DA0A 2Z7YA 5C0AB 2J3SA 3BVTA 4E41D 4G70B 1UHVA 1A3LL 1FL5B 1A9BB 3G7TA 3IDMA 3BESR 3F7RA 4Q6YA 4S0TD 2R7EB 1PQZA 4S11A 5HHMB 3EUDA 4Z7VA 2F5AL 5DK2B 3ZBMA 3WIHA 4ZBJA 4LLYA 3S3BB 2D7OA 2VJ8A 2ZYIA 4Y1AB 5EFIB 1JPGB 5EC1B 2O5ZL 4WTWA 3ARRA 2FJHA 1TKWB 2E8ZA 1NBZB 3GTTA 5L2KD 1CICC 2DLGA 1CLYH 1AD9A 4HJGA 4XVSL 1N8OE 4U49A 3RUGA 1UHDA 2A6ED 3TO2A 1H19A 2PMZA 4APQA 1V8HA 2WZ6A 1LEGB 3QEHA 2EDXA 3WNKA 1J5OH 1AI1H 3RWEA 3BIBX 3HFFA 4PRDA 1RUMH 5ECGA 2ZUQB 1X5KA 1NGYB 2WUBL 5BVPL 2J8UF 1S8DA 4JFQA 4AUUA 3BVWA 3ZDXF 2E7LA 4E42B 3B9KB 4YGAB 4P23B 1I3QA 1L6XA 2OI9C 3ZTNH 2VWEC 1E4KC 2E46A 3P02A 2PYED 2BSBA 4KROB 3O6KL 2HJLB 5J11B 4LF3A 3I50L 4NM4L 4NN7C 4CN6A 4U3SA 2W38A 1IGMH 5HP5A 2AGJH 2XVKA 2Y06H 3VRIB 2EEBA 3HE6C 3L9BA 1WUNT 5F7DA 1JUFA 4ODWB 1OHZA 3VI3A 3HC0A 5CGYD 2EKSA 4KVNH 1TZGL 1D5MB 5KBPA 2YD7A 4H13C 4RGNB 1BMGA 5ABDE 3WEXB 1F56A 1YNJD 2FLMA 1N7ML 5EO9B 1QPXA 5F6HJ 1OOWA 5IMMB 5E6ID 2ZUVA 2KLTA 4M1CD 5JW4N 3K8MA 3EYFB 1QFWI 5B3JE 1Y1UA 1F4AA 4UT9L 4LPTA 1FFPA 3IAGC 3L6FA 1XCXA 3ZZ1A 1I1FA 3M1CA 3BLBA 3BT0A 3B3IB 1PT0A 1EEZA 5DURB 1DVFD 1BQRA 3FQTA 2BRQA 1JRHH 4YLBA 1QFHA 4XPBH 5DD1L 3EGDB 4CKQA 1SFOA 4P23D 1E8YA 2HWZH 4BINA 4PJ9D 3W39B 5E7BA 1N0XL 2A9NL 1GY2A 3NDYE 3LD8B 1A02N 1S6NA 1BXXA 3S2CA 3TYFB 2R2BA 2DL2A 5E9DD 1RJCA 2D7TH 4K7PH 3O2WH 4E9WA 1M2VA 1B4TA 3L9EA 4WRLA 3Q8BA 2RACA 4XXDB 1KMGA 1ZV2A 5DJ2A 2Y1ZA 3G3LA 2OW6A 5TDOA 4XMPH 2P26A 3HZYA 5CGMA 4YHKH 5A2JH 4XNUL 2CUIA 2IBBA 5KS9E 4IU2A 1KIUB 3VSUA 1CD0A 3DJTA 4Z95H 3WFCH 4N22A 2TSBA 1OP5H 8PAZA 5CMAA 4NKMB 3RTQB 3GWJA 4QMEA 1WFOA 2HTKC 2O6FA 4Z0XB 3PIQB 2H1PL 3VG0L 1PMYA 4ZD3L 3O2VH 2Z65C 2EDOA 1F3JB 4FNTA 1ZVSB 1H8OA 4GW5B 4FYRA 3HG3A 1DQMH 2X4QB 4AYMC 5E4OA 4M8UA 4YXHL 1Q9KB 1Z9LA 3HHSB 4HLJA 3RWJA 2NDFA 1ET7A 3D9AL 3GUFA 2R15A 2VYRE 3QW9A 2B3RA 4FD0A 2F74A 3IKCA 4YHOL 4Y4KB 1QLEL 3MRJB 5T1LA 1BF5A 2RMNA 3VW3H 2DM7A 2J2ZB 3P3UA 4Z7NB 2C3GA 3KYOA 4HPOH 5GQBA 4CMMB 1FBIL 2JFCA 1FHNA 5DHEA 1N64L 3HU1A 1CICA 3IXTB 4H40A 3WEBA 1TVDA 3J7HA 3BAKA 4NLHA 3HRZA 4OGQC 3G5ZB 5C97A 1L7IH 4NUJB 1NINA 3JTBA 3AADB 1KGUA 1XR8B 4JL2A 4DEPB 3BP4A 3N43F 3M17A 4XZUB 4AQ8A 2BIOA 1TJGL 3QFDB 1F1AA 1K8DB 2AJ3B 2RHEA 3FB5B 4I3RL 4NUPA 5BOPA 5K59E 2ZICA 4OZFH 2WYIA 3GJFH 3R0NA 2B1AL 4HIPA 4YSSA 1U41A 5GGSA 2XFXB 5IESH 3RZCD 2MSPA 4XODA 4D8PB 2K7QA 4HSAC 2QEJA 3KWWB 3ZZQA 4HALA 2VDML 4YLCA 1OEZW 5IQNA 4XC1L 1MW3A 4BE6A 1E50A 2CO4A 5EF1A 4JY6A 5JHLH 3UTQB 3BFQG 5K1JA 1SVCP 1QMUA 2B20A 3CZKA 3X13B 4QRRB 4PCSA 1FAKT 3MACL 3PHQA 4ZO6A 3NT0A 5EG6C 5CWSB 3FKUS 3SY6A 2E9GA 3MMEB 1T7VA 1O6VA 1KCSL 4W6XB 4G6ML 2A83A 2N56A 3FT9A 4PRHE 5EIIA 3O2DH 3PU7A 1KYFA 2ADGA 2OK0H 1E9PA 4H88H 1G7IA 1MFBL 1OSPH 2XWJB 3GSNH 4NJAH 5C6TL 1QLEH 1DUYB 1FZOB 4PW4A 1DBJH 4GUCA 1AKJB 4XPAL 3QYCA 1U2HA 1ROWA 2A77L 1X3DA 4H26A 4XPGL 1VFAA 1BVNP 3W37A 4YPGB 1I3RA 1QLRB 5DQDH 1VGEL 4KHTH 4YDZA 2BHFA 3FTSA 4KKCC 5EBMB 3VXMB 3GK8L 3G08B 4OIBA 3S97C 4W4OA 1EXUA 4UTAH 2E76C 5I8KL 1G5AA 2NY4B 1T5XB 3BKYH 3NYKA 1K4CA 1QBMH 4PBXA 5AB1A 2EE0A 4QRBA 3V8CA 3WIAA 4N3UA 2X4NA 1DJYA 4B7LA 4PGCA 3L3DB 9CGTA 1BW8A 2E6JA 5ESAA 4Z6AT 3ZN6A 4PV8B 2NW2B 4YHKL 2Z7WA 3U79A 3P0YH 1SYVB 3K80A 5K9JL 2NY4C 4I3SH 5FM5M 4PRDB 3L3KA 1QPPA 2BSSA 4HUWB 4KVCL 5CZXC 5EOCJ 3D69B 4OFPA 1C5BL 1QYGH 3G6JB 5F6HI 3K1DA 1CGSH 4AMXA 2A69D 1G4MA 5IB4A 2Q7YA 3FO2A 4F8OA 1UWGH 4GRWH 5KSAA 3F6JA 4X8JB 1IC5L 3AQYA 2FYYA 2GKIA 2VLKA 3VFVB 3HE6A 1GGIL 4K2UL 2WXIA 3WE6B 4R0LA 2FJUB 3CLFH 4RCAA 4XWOD 1UM6H 3TO4D 3WUZA 3VFGL 1WLHA 1NCHA 3IJ9A 1INEH 4LAJH 1IC1A 1PQZB 1LGVA 5BO0D 2BWQA 5M7QA 3DX2A 3TCLB 2DDQL 1RURL 9PCYA 2J88H 3PP4H 1BFSA 4IM8A 3GXIA 1UWXK 3IWUA 3P0YL 4P5TC 4ZXBB 5JHLA 2WQRA 4E9TA 1HESA 3IDIA 1ZY9A 3NIGE 4XXWA 4K8RD 3RURA 3MKGA 1J05A 2HXAA 3MRKB 2UY7A 3N1GC 4XVJL 3MOAH 1HH9B 1D7BA 4LPVA 3RFZB 4FQJH 1ECZA 2C9XA 1RIHH 4Y4HD 1N6QH 1GIGL 1ID2A 1UYWH 2JI2A 5FS5A 1E43A 2CBOA 2Q8BH 3SJVD 4BKLA 5L2JA 3TBYB 1NPNA 1B4JL 2I7SA 4OFQA 2AJXH 4EMZA 1GSMA 4NM4H 2YAPA 1RIVL 4KNSA 1X5LA 1D6VH 3NGBB 4MCMA 4GAFB 2BFGA 3P9LB 1HKLL 3SN6N 5CBEB 1A25A 4NQXB 1B9ZA 3CDCA 2E7HA 3MV9B 3ARXA 3U1SH 3FT4A 1NAML 1VFUA 1U95A 4ORZC 4TVPD 4HCGA 4GMSH 3SGJC 3S0PA 1A4CA 3BVDB 5I6NA 4P3WA 2BMKA 4WFHD 4NCC1 2ED6A 4LB8A 1JHTB 2I5YH 4GSDH 4RRPM 3HS0C 1OSPL 3JZ7A 5DUBA 1LO2L 4PJ8B 3WV0A 2G75B 2ZOKA 1L9RA 3HHSA 3RWJB 1W0WB 2YA0A 3MRRB 4IIQC 3IJEA 1X9LA 3GLEA 1LO0L 2HKHL 2J73A 1O0VA 2AITA 2B08A 4OF3A 2R1YA 5B1JC 1E4XH 2GJZA 4MD5B 1IBBA 3G5WA 2H45A 2L7JA 4XTRC 1TFPA 5CHNA 4JKPH 1LWHA 3F01A 5D1QE 4QHUB 1HEZB 1JWMA 3B1TA 5IB3A 1Q4NX 3HC4H 4OLUH 5KVGL 5I9QC 3ZE2E 3MCLL 1ZT7B 1RP8A 5CEXB 1MW2A 3N0PB 1NJ9B 3Q3GA 3VFNA 4G9FD 4LU5L 5IQLA 2BNQA 3T8MA 2OTPA 4PD4J 1J9CT 1TJGH 3VDCA 3CMOH 1IFGA 5D7KD 4TPRL 4LLDB 1BMZA 1NOFA 3FCSA 3V5HB 1M2VB 4DZBB 5GRUL 1PU0A 4AQ8C 2PXYD 2XQYK 5DS2A 4XVUC 3SKOB 3L3DA 4LFHD 5C0FB 1G9EA 4F91B 1JGLH 4QTHB 3WTXA 2B1HH 4WI4A 2ZG3A 3GS4A 3QI9A 3KLLA 2GHZA 3L4WA 1XF1A 5ELIA 3U1SL 4QJ3B 1HH6A 4HGWA 4GLRI 1X9RA 3BP7B 2XDHA 3MLUH 1AO7A 4HPOL 1MPAH 1OWWA 1KIUA 3FCBA 3L3HB 4ZNEE 4UCFA 2LAGB 3M6DA 4P2QB 4YDLB 3T0AA 2YUWA 1E9OB 3FT4B 4D9QD 5D5ME 4P5SA 5C9JB 2EIZB 2HAZA 5KSBE 1A6WL 5IT2L 4OGYH 2YOCA 2NXYB 3FU7A 4AGPA 3VE0B 2R0KL 4WV1A 1FFTB 4QRFA 4HWZA 4FS0A 5GRJL 1MFUA 4FG4A 3TH2T 3S96B 3FTXA 4DPAX 1F42A 1KACB 3HI1B 3PWNA 4M1GL 1WRFA 3IJSA 3IJYB 1DN0B 32C2B 4K07A 2H2PC 4QHNA 1QO3A 2WTRA 3M1BB 4GG6B 3ULUH 5LNDA 1G7LB 3VI3E 3FUDA 1U21A 1A0QL 1IW7D 4MHHG 1HZHH 4LAQL 3EYSH 1RHHA 1MHPL 3W1ZA 1RZ8B 4FQXA 4HFUL 2VISA 2HJKB 4PR5A 3GSNB 5L4JA 5IG7B 2OMNA 3QUZA 5GS3A 2CLZB 3MO1A 1FL6A 4GH7B 1JXFA 1MWAB 2JIMA 2LE9A 4N87A 5LGKA 1U33A 3FO2B 2Q7YB 4AGMA 1C8PA 3ILQC 1RK7A 4HK3J 2CJSA 4NO5A 1TQBB 4KQ3H 1TOXA 2HWZL 1EFQA 3QCTL 4OBRA 4U7SA 2D8KA 4ZT1A 4OI8A 2VAJA 4TNVK 2ZUYA 3CC5A 4N2KA 4Y19B 2YKKA 1MUJB 3X2QB 3D4YA 4IMKA 5C0NC 3VUAA 4W9GC 2Q2LA 4TQIA 2JCCA 4PI2A 1NGPH 4EI0A 4EXPX 1S9YB 1FNGB 2X9XA 5BMFH 3LNHA 4F24A 3U46B 5BOJA 1P4BL 4LLDA 3EW3B 5BUAA 4NB7A 5DVPA 3SYCA 4G8FA 1T04B 3FT3A 4WTXA 3QEGH 1TVHB 1M7DA 3GBEA 3NOIA 3O4OB 5HTSA 1P6FA 1ETB1 1CDIA 5HPMB 1NMBH 3G04B 3KPQA 3Q9PA 4GAGL 3NJXA 5D1ZD 1LO4L 2YBRA 4KRPB 1S9KC 3BUYB 3TA3A 1VJSA 4EIBA 2CIIB 4AKOA 1ZHKB 4Q6IC 4L3EB 4ONHB 2WWMC 2ZSWA 3OUGA 3OAYK 2NY0B 1YG9A 3HS0A 3VXRB 3MV7D 2EO1A 2Z91B 1IJNA 2P42B 3BQUB 2G75A 3I50H 1ET5A 4KO5A 5GRUH 4L0PB 4LSUH 2DQCH 3HC4L 2Y6SC 2DQFA 2XETA 2Y06L 3CFTA 4L4VD 5B8CA 5T33L 3MX0B 5I1LA 4JQVC 1ZAGA 2A38A 1YN7A 3FH5A 1XB6A 1MRFH 4RZCB 1F97A 2CLZA 2EDWA 1G6RL 2MWCA 2VXQL 4RISL 1T1YA 1LO5A 5HVGB 4M7LL 4Q74A 4NZDA 5AALA 1FH5H 3D25A 3QNZB 1SBSH 4M00A 5JORB 5EU5A 2PLTA 3GIZL 1BHGA 3P4MB 3HB3B 2J55A 3LZFH 2QV2A 2GVYA 1IGCH 3EADA 3FFDA 4NC0B 2FUTA 4QOKD 1TU2A 2PCFA 1T2JA 3STLA 2Y7LA 1L0XA 3WFZA 1EHXA 4MFHA 3BZ5A 2MIZA 3E6FB 4MJ6B 3Q05A 2BO0A 4I0PB 4MB3A 1FNEA 5AAWA 3GUTA 2WHVA 3SDXA 2OI9B 2VR8A 3FBQA 5DMJB 4NPKA 1S9WA 1PVHA 2PWEA 1WJ3A 2OMVA 3BLPX 5I76B 3GIVA 5JDSB 4KI5E 3HAEB 1YYML 4OTXL 5FKAA 4XRCA 3GJFB 3TVMB 4MA1B 1XZ0B 1UD8A 2FQDA 3M46A 4EZJA 5MENB 1P53A 1Y1DA 2XY1A 3KJ6H 5C07E 2VAAA 1S9VB 2YC1B 3LZOA 4WWKB 2WLMA 3G6DL 7CGTA 2BZDA 4YHLL 2ICWB 1IM9A 3LEVL 2HPTA 5E5MB 1PLGL 1X5JA 2XV0A 3SKUD 3VGDA 1IBFA 2EXTA 3TVMC 4GFXA 2IF7A 2QSVA 4WKXA 4RISH 3EH3B 3SKJL 1J87A 1TWGA 1NCOA 5F3FA 3EIFA 4MXVE 5C07D 5JW5A 5K69A 2IIJA 2XPYA 2WZ0A 5D7LB 2IANA 3BJ91 3PWPB 2JIRA 3E6HA 4Z1PA 4AC4A 4E9YA 4MS8D 1T21B 2WAQA 2J8UB 4HT1H 4ODSL 1KXQE 4S0SD 3NJFA 1MDTA 4JGNA 3TJEL 4HG4J 2LLGA 5IW6A 1PTZA 4LDEB 3MRLA 3QUHA 1GTFA 3FMGH 3LYRA 3GZOA 2ENSA 3JZYA 4C57C 5L2KE 1S5IH 1YZZA 3LRHA 5F7LB 5TFSL 4DEPC 4Z3IA 4KZCA 1XGYH 1AQ8A 4TOYH 2LLLA 2DAVA 3FF8A 3CZFA 3SDCC 5DO8A 2V2XA 1IGTA 3BVNA 4TULL 1XAKA 2CK2A 4FCHA 4B41A 4CU6A 5H4ZA 3BO8A 1PF3A 2WYTA 1ZPLA 4G6KL 2J6EH 2VMJA 4PTTB 2G9HA 2DF3A 2PW2B 4HUNB 4NQSA 4GG6E 5JQIB 2YRPA 1QRNA 4UQIM 3UJIH 1CFVL 1J1XH 4PJBA 3MNWA 3GRWA 4L3CA 3L2LA 3OLIA 3BPOB 1OP9A 3VA6A 1UD6A 2EEOB 1AR1B 1HHHA 2QQKL 3UAAA 3DHMA 1G7QA 2Y72A 3PG2A 5DGRA 3ZDYF 4CSZA 3AU1B 4NSKB 1L9SA 2ZXQA 1CF8L 2BVPA 4HS6B 4OZIE 5EZOH 3ZE1E 3CLEL 2IGTA 2GITA 1E4JA 1MVFA 4L5FL 4C4KO 3KPRE 1KC5L 1PSKL 4KWUA 4JJOA 3CZGA 3EYVB 4F5CE 4AONB 3LZNA 4ZUVB 2F8IA 3ZSTA 5L88H 4N5EC 2XX0A 4Z7AA 1SJXA 3X1GA 4FJYA 1T03L 2CRMA 2VPZA 5FGRA 1O9VA 5ITBH 5F7NC 3PWPA 2WLNA 2YEQA 3IS0X 3WEAA 4PHZA 4LEXL 3AB0B 1LD9A 3LIZL 2EUVA 2NY7L 2K1MA 5K9OB 4XPTH 3KYAA 4H20H 4AQ1B 4LSQL 4PRPE 1NIEA 4PLJD 1P84J 4PJ8A 4DKFL 2V9UA 1NDMA 4P59L 4PWKA 3ECUA 1I1AC 1JZ5A 1T22B 1KGCE 3UAJD 4KXZI 2UX7A 1WT5A 4JO2L 1KN4H 2VN3A 2XRAH 2YRLA 4P9HC 1RHHB 2CM6A 4ZDHA 1P5UC 3LV3A 4PS7A 4LLQA 5BUGA 1W6LA 1H8SA 3C2AH 3MJ9A 2EILB 1RXLA 1DVFA 1EDQA 3P69A 4N6RB 5ITFB 3NIGF 5B7EA 4ZMWA 5I75B 3MYJB 5AYUH 3OJDA 4PJ9A 1T7ZA 4DTGH 3HW7A 4X80L 4FNPA 5ADPH 3SHSA 2Q9OA 4E36A 3S37L 4H88L 4HG4K 4HC1H 2XN9B 3ALXA 4Y16A 5KSVB 1A4JA 3BGMB 3HN3A 3IU4H 3TA4D 5IJKC 1JZEA 3E0GA 3UTPE 5D7IE 4Z76B 1ZEAL 4CRYG 2H0FA 2HT3D 5CN1A 2V7NA 2I7OA 3RB5A 2GTWB 4HUWA 4J3OF 1MIEL 3CZBA 1QSFD 1BG9A 3MUHL 3NTCH 3T1FA 1N5AA 2DS4A 3O9WA 1T4KA 3VXNA 1W8NA 3PQYE 2BSRA 1V3MA 4WEBL 1FO0L 3QWOA 4LL1A 4MAUL 4YO0B 3L3HA 3QUYA 4PMEA 1XR9B 3KW8A 4Z7QB 4ZUUB 3JV4B 3ARDB 3C6LD 5JXED 1HXYB 4FQLH 2XN1A 1E27B 4KX8A 5KYXA 2LLNA 4UQCA 1SF5A 2V2TB 4H20L 2YSSB 2Q8AL 3U4KA 1UD4A 3EFFA 2IOMA 3GF8A 1MI5A 5C2UB 3BISA 1T89C 1UUSA 3BVXA 4FXKC 4X9HA 1BZDA 1GOHA 2H8PA 2C9UA 2BP0A 3OXRB 2WTPA 3QJTB 3C5XA 5E70A 2GJZB 5TQ0H 5FK9B 2GC4C 1NAKL 2WLZA 3U30C 2L3BA 1CD1B 4G8GD 3ARVA 4P5MB 4HISA 3IKCB 2D7NA 3DOSA 4M4RA 4EDXB 3DV6B 3DX3A 2F7OA 4AV4A 1OAYH 3DETC 3E1F1 4M6NL 4N0YL 1H3XA 3A3YB 4LKCA 3GI9H 4Z7VB 3F85A 2AJSH 4P2CG 5F7UA 3OJVC 2YPLA 3DK0A 2GTQA 3VXSD 1I4FB 1I75A 5EU6D 2EQDA 3AS0A 3TTYA 2FJHB 1SLVA 1JS4A 1RERA 3RGVD 4AYGA 2IWKA 1GIGH 2ZCHH 4YNYB 3DK2A 4XVUD 3W82A 4DMRA 3BSGA 3Q6FA 1RPKA 3FPYA 4N2EA 4P8QA 2BS71 1OM3H 4LGPB 2X0UA 5EC2A 5I2IB 1BQUA 5E51A 1EJ6A 1V3JA 4FZ8H 5E2VH 1I1CA 1A4KB 4PRAA 4NT6A 2J25A 1WFMA 4NQDA 5MERB 4YLQT 3D07A 3FAWA 4DH2A 3K6SB 4FFYL 3T4AC 1ZA6A 4WI9A 1SEQL 5J6HA 3P4OB 3TGXA 1OKEA 1UVQB 4G80B 2YQ2A 1PLAA 2MEJB 3EFDH 3P4LA 1GGBH 3MCG1 4GW1A 4HJSA 1W91A 5EO1A 3UGUA 4Z7NF 5L4MA 1EK3A 2PR9A 3D33A 5HGGS 5GGUB 5TD4A 2V7HA 1CIDA 2V2TA 3A0OA 1F2QA 4AI7A 1UH3A 5FO8B 4ZMNA 4ZO8A 4HJJH 4N1HB 1B6UA 1P1VA 4K9EL 1CFTB 4NQVB 2W5PA 4OFYD 3II3A 3NEOA 2QKIC 4RQQA 1SHMA 4HBQA 3TZVC 4WF7A 2IQAB 4UQ2A 4O51B 4JDZA 4UAOB 3FB8A 5FTMA 3E8UH 4HIIB 3DMMB 1U8IB 2G0LA 3QEQE 4PGZA 3C6SB 4XO5A 1MW1A 4J3OH 2EVGA 1ZLEA 1E5UI 3QG6A 5LDUA 3FSWA 2XWTA 3CBRA 4NS0A 4IQHA 2WBJD 1MZYA 3N44B 4LGSB 4N2OA 1QBBA 4ZTOL 1NGXA 3H53A 2P8LA 1MHCB 3GSOB 2C3VA 4YQXL 1DVZA 2DOCA 1PEZA 3IGLA 4Q2ZA 2GSMB 1UASA 1OTUC 2ENYA 5F7EL 5JOFB 2NCEA 2VABB 3WN5A 1TZGH 4PEEA 4GW5A 4PJ7F 1U2YA 4IJ3B 2WSPA 2ZXEB 4MXQC 4HJTA 3D18B 3N40P 2JIOA 3OB0H 4NNXB 1CWVA 2ZQKA 3GM0A 3TIWA 2VO8A 1ADQH 4ELKA 1C8QA 1YN6A 5FO9A 1F86A 1FIGL 2YBRB 3F7YA 4GKOA 1OHQA 4ENZA 3CF2A 1FZMB 3GBMH 1RMFL 3U9WA 1C9SA 4XBPA 3BYYA 2Y1AA 2Z31C 4ACPA 2YC1A 1ZA3B 3S5LB 1HJCA 2B4CC 2J20A 2XCMC 2IBZX 1QHOA 5DK3A 2LR4A 4FQ2L 2NQDA 3ARBD 4EKJA 5JPNA 4YL4A 2C34A 2R2HB 3NZHL 1MREH 2XX1A 3H7LA 3TO2B 4HXBH 2AABL 4PJ7E 3BEVA 1TQCB 5K1NA 4BFJA 1K3ZA 1SLUA 3LCYA 2PR4L 4Z0XA 4R7XA 4XP6L 2XTJB 3CUPB 3EDDA 4O00A 4R97B 4KJQC 2HG5B 1FZOA 4MSWB 1NFDB 4LLYB 4OM1L 1ZXQA 4D8OA 4ZTOH 3ULUD 3TCXA 3TEUA 3D25B 3MFFB 1CDGA 4YPGA 3N44F 4RFEB 1BEXA 1OPGL 1N6VA 4P07A 2K7PA 4GAGH 2DLHA 3A6BL 3KGUA 4LVNC 4UV4L 5CU5A 1AANA 4KKPA 3KLSA 4Y4HA 4XPHL 4PB9H 4RIRA 1TZIB 3MJ7A 4XGZB 5FGCE 4KRPC 1DEDA 5AVXB 3VRIA 4NEHB 2I5YL 3BUDA 2PCXA 1CJYA 1PW3A 3O6ML 4BH7B 5BQDA 2P7TA 3UL4A 1TTUA 3CN3A 4W81A 1PIGA 2VL5B 4GT7A 1N5YH 3CPLA 1J5DA 3QQXA 5AVZB 4JO4H 3VXNB 1AO7D 3QARA 3CLEH 1FZJB 2NTFB 2AI0H 3ML8A 5E8EB 1I3RB 1QLRA 4KOBA 3TVMD 25C8H 4P9HL 4JFFB 3AVEA 4TVPH 4LDLB 3NA9L 5AW6B 1KPVB 3E2HB 4J8RA 4H44C 1UATA 4DKFH 4IYKA 4X5WA 4MDJB 2Y1YA 2PO6C 4MBRA 3UJTL 3EJPA 4IOFD 4NKDB 5CUSH 3SGKC 1MFEL 1NDGA 2AV1B 4MS8C 2H47C 2VDQH 3QC8A 4A2EA 1A8JH 4M9PA 3VI3B 1F6AB 3D4GA 2ZXCA 5SWQA 3PAVA 1BVLA 5D2LF 4M6OH 1ZS8B 3EBHA 5HXMA 4IRJB 2R8SH 2LV4A 2ITDA 4TTGA 1DMSA 3MJ6A 4G43A 5D1QB 4X7SL 1PBYA 2ZOOA 2AMUA 2N7BA 4PJ5E 4XO9A 3ES6B 4DAGL 2MPAH 2NNCA 3K5RA 4ONGL 4QOKB 5DC2A 5F3HB 1BIIA 4Y2OB 1C12B 4GA5A 1O75A 2X12A 1JI2A 3B2VH 4Y1SA 3NQIA 4E41E 4EIZC 4TNVF 4C83A 4K94L 4LCVA 5FIEA 1KEML 4M3HA 2GJPA 3P73A 2AI0L 4AGOA 5EDSA 1VIWA 3EOAB 4RAVA 4JO4L 3KPSB 2VQUA 3C12A 3JVGA 3V0WL 5CR1A 4HWBA 4PRNB 5D8JL 3ULVH 4O9HL 3X17A 2VTFA 3TV8A 4HF5L 1R3IH 4E5XG 2IV2X 3MLVL 1TQUA 4YC2B 3KHQA 4FRWA 2HFFB 2IPUK 5D2LA 1T66C 1CDHA 1OF0A 4EN2A 2FCBA 5CM1A 4PRID 2X6VA 1RSYA 1JGDB 2NY6C 2HVBA 2YA2A 3B9DA 4HX1A 5ADOH 2EYRA 1QEWA 4RMBA 2VAAB 3KJ6L 4QXUL 1L8FA 3BH9B 4HLZH 3MODL 5KSBB 1A7RL 4IU3A 2GQHA 1XMWA 4Y4KA 3BJLA 2N1TE 5GSRB 2Z34A 1BD2B 3I9AA 1II4E 3VXUA 4OLZL 4HEMA 4S1RL 3ULAB 2ZPKH 1UT2A 2WO2B 5ACZA 4YSEA 1QEXA 3PAYA 3RQ3A 3GHBL 1BOGA 4NNYB 1FUNA 4APXB 3HUJF 5DUBB 5D2NC 3DX7A 4C56E 4DPBX 5DMKB 5J1TC 2VLME 1JGLL 1WBYB 4L2LA 2R1WB 3F84A 4HEPA 3BSHA 5E99L 1AXTL 4XNXL 3T6QC 3PHQB 1KENH 3QS2A 4KKBD 1DQIA 5KYXB 3QUXA 2B2XL 1Z5HA 3MLZH 1E4WL 4TVUA 4O02L 4XBGB 5T5NF 3VVWA 4RWYL 1L5GA 2DJ4A 2ZKYA 1J8HB 4YHIA 3ZMNA 3CSYB 1LP9A 5INDB 4JKLA 3ZZSA 3MV9A 3LEVH 4MXWL 4X6DF 1WFUA 4OSUH 2RD0A 3VH8B 4UYQA 4JZJA 3PHSA 1NCCL 4AQAB 4NGHL 1XAUA 4KMTH 3IDYC 3RA7H 3RBGA 3UBGA 1HEZA 1JWMB 2MOGA 2ZF8A 5B7MA 2H2SC 3MLTB 5D7JB 4QNPE 1BF8A 1XGQA 4BQ6A 3VFWA 3B6SA 1EFXB 5EOTA 2B0SH 1TIUA 3UC0L 3DGCR 1DANT 1XGRB 2NY3D 3RWIB 3FS9A 3W39A 2XN9A 4N0RA 1HH9A 1P5UA 4OGAD 2B3IA 5GGQH 5H2BB 4RESB 4WJKB 1J7VR 4IBTA 3FW6A 3R7QA 3ZVVA 1PYQA 5LUMA 1AQDA 2GFBA 3ZO0A 1E5YA 1V3LA 1OO2A 2LU7A 3OAWA 4BK4A 3RVVD 1OP4A 2G9KA 1YQ2A 5DEGB 2KQMA 4J39A 2QT6A 4X0NA 3GTMA 1UFGA 2GBVA 5IB4B 2WNKA 2BDNH 4A6YH 3QO0A 2P4AB 1R24B 3C5JA 2A73B 5LNEA 3ZKNC 2MCMA 1KTRL 4JKMA 5IGXH 4GO6B 1IQDB 3V4UL 1YJDL 4GMSL 4UTBA 2W0LA 4L8BA 5I6PA 3UBXA 1GGUA 4L9LC 4QPEA 2DTSA 5LGYA 2KYIA 4P2QD 4GSQA 1NGQH 1KGCD 4X4KA 5KEZA 1MJJB 4M5ZL 1J8KA 1WE5A 4O9HH 4K23H 1AD9B 1RHFA 2A9AA 3CLWA 4QGTA 5GRZA 1CE6B 1X44A 2P7TB 3EYQC 1CCZA 2CPUA 2GJRA 3MBEC 4U7MA 4ZS6C 5FYKD 4O4YH 4DPCX 1CTOA 2D31A 5D71L 1G1CA 2Q8BL 3KL3A 3GC3A 1XL6A 2OCJA 3ABKB 4IJ3C 1PKQB 5I1IH 2P5WE 5DUJA 4U1SB 2QSTA 3INUH 5C3IA 4WSGA 3V0WH 3N3EA 3MBEB 3MO1B 4X7CC 5F1IA 2BFVH 4P3CL 5A16B 1MHPH 3N42B 1OGAD 4PS8A 1FO0B 5EC1A 5I17B 1XMEB 3NIDF 3JWNH 3KAAA 2B4CL 5I1AA 3REVB 5HI5C 3DVIA 4ZAKB 4XMLH 4OLXH 1PGRB 2H1PH 3DO3A 5I0DA 1XIWA 2EC9T 4YHPA 3X14A 1CLVA 3Q1SH 4M7KL 4LK4A 1T5XA 3FMGL 1S7UA 1M7UA 1YECH 3CXDL 1KTDB 1CLCA 1YPZE 2A6KB 3TJPA 1XGTA 2IEPA 2VPWA 1PEWA 2JLLA 3FK3A 5KJRL 5C86A 4R8WH 5FO9B 4JFEA 3EJQA 4JPVH 2NLJB 1A21A 4JUTA 3T3PB 3KPRB 3L45A 1E42A 3GBNH 3MXVH 1R0AH 3D18A 6FABH 4G3YH 1D2OA 3O0RL 5MI0B 3QIUA 1P5VB 4KJPD 1S7RA 2WWOA 1L7TH 4ZRGA 2GUOB 1E30A 2HN7A 1SLXA 1ORSA 2DH3A 5D4JA 5GJSH 5BRZD 2HJFB 4AZDA 3CMOL 3QXAB 3PV7A 3WFEL 2WINA 1EHNA 1OSEA 2ID5A 3MRCB 4N28A 2J8UE 3U46A 1IU1A 2VOTA 4AW4A 4OLEA 4OCXH 3BWAA 4F8PA 4R7NA 2BZ7A 3CIAA 5HJBA 2EO9A 5DZNA 32C2A 1KZYA 5KBMA 3W5NA 1DUZB 5A3ID 2KPWA 1U8IA 5C0CA 4PJGA 3O3DB 4FULA 4N2AA 1JK8A 5FKPB 5F3BA 4UQDA 5JIQA 3L1OL 5I66A 4CSPA 1BM3H 4WU7A 1WIUA 1AACA 3MTXA 1AY1H 4L29B 5F1NA 3VSVA 2PPCA 3DSNA 3ILDA 3LQZA 1P2CB 4W68A 5DD6B 5B21A 1Y18B 1IAIM 1Q1JL 2DYPD 4V1DE 1G6RH 2VXQH 1PFCA 5DVKA 4JFXA 4NERA 4QRAA 3DDGA 3QIBA 3MREB 2PNWA 2XG4B 3BHBA 2IDUA 5C0AE 5IVXA 3OBAA 3TNMA 5IW3A 4ZMVA 1BZ8A 2LT9A 5GS0D 4QYAA 3VXSE 2C9QA 2F8VA 2X70A 3RHWF 5CJBA 2KT6A 3WY3A 3AREA 3ETBJ 2XVGA 1KGIA 4HKBA 3S9DB 4KBPA 4JG1L 4MMXA 3GEWB 3A6OA 4UDTA 4UT7H 5TDPA 1X5XA 4AQAA 4JKKA 5EFIA 4OR1A 4BSWB 2CHWA 2A6DA 1U8LB 4KDWA 1QZ1A 3QPQD 4ANXA 3HU2A 5J6HB 3NP3A 1HH6B 1P7KA 3GYRA 1VCAA 3PP3K 5D7IA 4U1GB 3FCTB 3ZMRA 1XF2A 4YE4L 4J3UA 4Y9BA 3WS3B 5DUMH 3SE8H 4Z7QE 3C6LA 3L1OH 1MLCA 1G87A 3PWJA 2BIQA 4NFDA 1GPOH 1DFXA 4M6MH 5DU7A 5C1MB 2NW3B 4JDTL 4YR6A 3RZWA 3CFKB 2ADFL 2I9LB 5IHWA 5DJ6A 4G8IA 1GW6A 4ZZKA 4FLRA 1W0WA 4UINL 1QSEA 1ADWA 3KR3H 5IVZB 3FQWB 1XGPB 5KZCD 1P6WA 1TYEB 2W60A 5L4FA 4F8QA 1BX2B 1H6EA 1DZ0A 1U91A 4KH9A 3T77A 3I9IA 1P0SE 2QZ5A 3GTJA 2FQGA 4AW7A 1F1DA 3WFEH 4GKZB 5I71B 1BGXL 1PSKH 3JVFC 5G4MA 2NY5L 5LDSA 4YFEA 2BVYA 4P4RB 2ENQA 4MAYA 1UD3A 4WEEA 3RFZC 1JPFA 3M8OH 3TBWB 3VXSA 3T5WA 3ZE0F 3BRGC 3VGAC 3U7WH 4WCYH 4M56A 5PCYA 5TF0A 5DMYA 4JFXB 3E6HB 1MVYA 2P8MB 4UI2A 4UV7L 1FE8H 1T04A 3B9KC 3FT3B 4JM0A 3W56A 1XQ4A 2EDMA 2FEDC 4Z7IA 3MUZ1 4CC4C 5I6LA 2XA8L 1AH1A 1MF2L 3STLB 4GLRH 3VXOA 1OTTC 1G8JA 2D0HA 2R39A 2WIIA 3MLRH 4IGBA 1PG7L 4OKVA 5F9JA 3T4AA 3WNMA 3PFUA 5HJ3B 4AMKL 4EQ2A 2Z9TA 2MKLC 3LD8C 2IALA 3RBSA 3SO5A 3O9WD 3ZR6A 4UM9B 1H3WM 4LQ1A 4O02B 3PXJA 4P5KB 4QY8A 5E6RB 3CZJA 4HAFA 1ZGLB 1HINL 1FVDB 4L9LA 2HCZX 4IOFC 1WEJH 3AXHA 2PP7A 1IAIH 2H3KA 5E08H 5DMKA 3EHBC 2JKXA 3L4YA 3NSCA 8FABA 5TF1H 5HYJD 1BJMA 1LXMA 3K72B 2JV6A 3MBXH 5F7HA 1PG7W 2YN3A 1U3JA 2FSEB 3C60C 4QRQA 5IMLA 1ZJAA 5ERWA 4HWBL 3WLBA 1YNND 2ARJB 3WMQA 3ISRA 4F7CB 5DD1H 3KLAA 3N55A 2BP0B 3OXRA 5HDBE 4YHLH 2Z1KA 2YK1L 3EGXA 1VGKB 4X6DE 5HDLA 5C6TH 5KVMC 3DV6A 5FDWA 1IEAA 3SCMB 2X38A 2BP8A 1G9MC 2PNDA 1O6SB 5CP3H 4TVSa 5L7XL 1H0DA 1GHFL 1G7PA 3RTQD 3REVA 2DWDA 3CCHB 3MRFB 1FNGA 4QTFA 3SE3C 2HKHH 2P47B 4CU8A 1M3JA 1BXAA 4MDRA 4AIXA 2VKWA 1S7WB 2YKLL 3IVKA 4HUUB 2AXFA 2CO7A 1UXLA 4M43L 5I1CL 1GYUA 1I7RA 1MHEA 2OR7A 1YY8A 1HHIA 2RFXA 3CVIH 3KPQB 2VDLL 4O2EB 4YHNA 1PY9A 3O3UN 3QORB 5J9PB 2R7EA 1BAFL 4XR8C 3AUWB 2BRRL 2Z92A 5IK3A 4N9GB 1DBJL 3JUYA 3T1FB 1FV1A 3G6JF 4CADB 5CAYB 3T6ZA 2F5AH 2X1PA 4W70A 1MH5A 3OJDB 4PJ9B 4G83A 2P8PA 5DJCA 5F6IC 1KENL 4LLUA 4JZOB 1NUNB 5I24A 4BQBA 2APXA 2WNGA 2V4LA 4KUZL 4PJ7B 4W9DC 4X98B 2ZKMX 2FAUA 4R26H 1WAAE 5I16B 2HTKD 2JJUA 3IETA 4HAKA 5KUMA 5LG6A 3PQYD 1QFPA 4E5XA 4N24A 3U6RA 3HZ3A 1ND0B 1M4KA 4KC3B 3BZ4A 2ZX7A 2ZCKH 4ZODA 4OJYA 1QTSA 1SEBA 1TQTA 4JZJB 2QPFA 1Z3GL 1XB3A 4GBXD 7PCYA 1VC3B 3RIKA 2GTZA 3OKNB 4J7RA 3UTQA 5C70A 1RKRA 1JP5A 1IE4A 5GGSY 2R4RL 2XQBL 5FGBA 5JPNC 4NO5B 2QGDA 4Y5XC 1FC1A 2X1OA 1OCOB 2WP3O 2HX9A 3DYMA 4IBVA 1EFXA 5DR5L 4KK8C 3WFHB 5KJ7E 4WFGD 4GIAA 5AWNL 4OGAC 3VFUB 1RURH 2WOBA 4HF5H 5FHAH 3RWFA 3FQXA 2Q7AA 4TSAH 2JKIS 2D3LA 2OMTA 1BMWA 4OKDA 1F6LL 1NGPL 4KROD 2GITB 4JPWL 5KVFE 4FX5A 1T83C 2PYEB 4TVPE 2IG2H 4IBZA 4PGJA 4RBPK 4J6IA 3W9EA 3VXME 5F1SA 5JHAA 3CFUA 1E5AA 3BP5A 1LP9E 4LPCA 1R17A 4P57B 2VXSL 3PUUA 3X2JA 1MFMA 3QE5A 4JFYB 3RZCC 5IOPA 4OM0H 2XFXA 3DJZA 2X1WL 4U1HA 4GSXA 2FWUA 4MYWB 1KC5H 4AYEC 1XH3B 5DJXA 5TQ2H 1CURA 3SUMA 2VSKB 1FLTX 1MAJA 4YDMA 2I07A 1AZCA 1OT4A 3UX9B 5L2KB 1P1ZA 3MNWB 5J13B 2IGFL 4WK2B 4BCYA 1N8ZB 4K9EC 2NUPB 3D85D 1MCWM 4OGXH 4TQHA 4XNQB 4B95C 3PIQA 3V5HA 1CE1L 4PS4H 4D9LH 5GRJH 4J4PC 2WK2A 3CDYA 4NT6B 1U8KA 3Q13A 3P2TA 2ZCZA 3K2UL 4OLXL 1J88A 2DWTA 3Q5YA 4E41B 1B88A 5HVWA 2DQUL 1B0IA 1XTLA 2NXZB 1OSYA 1KNOB 4LSDA 4PSRA 3HR5A 3MREA 4K7PL 1C7SA 2YXVA 3ARDC 4HXAL 3UOAB 4DOHE 8FABB 2RQEA 4NKOB 3U36B 1U8QA 5C7XL 1TCMA 4XPFL 3O41A 4J4PA 1BYOA 4N0FA 3HA0A 4PVMA 3WGVB 1XVSA 2BXZA 4HIJA 5JDJA 1WAAF 2XWXA 1YYLH 3LY6A 4QXGH 2D03L 2AK1H 4MASA 3PXLA 2RQ8A 1CC3A 3O3AA 5HJDA 1KLFA 4N90E 4IMLB 1UKQA 1W72A 3Q7JA 4JPKL 2VLRA 3K8KA 3FTWA 4ZSOA 3TIEB 1QKZL 5K9KB 3MLWH 4R3SA 1FZKB 5J5EA 4WGVB 2HH0H 4M5ZH 3ECVA 4PJ5A 2JIXB 1KXHA 4XN9A 4LKXA 4ZNEA 1HFUA 2DEWX 1IVTA 5EUOA 5E0QA 1ML0A 5BVPH 4P46D 3Q06A 2L8AA 1NUFA 3PDGA 5CZXD 3S8WA 2V5SA 1GGCL 3EG9A 3EFFB 4NP4H 4AVIA 3TFKD 4JZOA 1T2QH 1H3PH 3PWNB 1M6UA 1R27A 5EO1B 4JPIA 2W0PA 2VXUL 4TKWA 2EIBA 1OGAE 1H9VA 2F53D 3GSQB 4XCCH 4EKXA 4UILL 4KXZH 2NNRA 2PTUA 4OUOA 4Q14A 1RLBA 1L9OA 1NC2D 4QRSB 3V8OA 3CZLA 3I75A 3I6GA 3FQWA 2P5EE 3Q5OA 2O5YH 2BK8A 4F2MB 3ZTNL 3RILA 3U2SA 2YN5A 4ODTH 1JHKL 4GRLA 4O58H 4RMWA 5DFTA 3DPBA 3KWWA 4LHUB 4QJ4B 1LNUA 5FX3A 7PAZA 2UY6A 1N0LB 4NOBA 2YOAA 3I84A 2AEQH 5TE4L 4ELME 4WWNA 3C5ZB 1VGKA 2IXQB 1YYCA 4W9FC 2YGQA 2ZP9A 4F8NA 4G7YH 4QRUA 4B0MM 1OAXH 2VH5L 3OD3A 1S7XB 1J1OH 1KTDA 2A6KA 4M61A 3B1UA 3UIYA 5AZUA 2AVGA 2UYLA 5F7MC 1E61A 2K0RA 1SOSA 1IFRA 2NTSP 1KTCA 3QORA 3EF4A 2ROYA 1R3KA 4GKLA 1PX3A 4XVTH 4YGVA 1UKSA 3H9ZA 3D69A 1JN6B 1M1XB 3ZYOA 1OCZB 2A9ML 2OMYA 3QPQC 5JHDB 3LHPL 1TF4A 2XTSA 4K0OA 2XLLA 5J3HD 3TEXA 3E8UL 1B0WA 2NYAA 3KYKH 5KSBF 5A7EA 3OKLB 3BUBA 4YIQB 1L3WA 1KCVL 2XJLA 2J88L 3LMJH 4X4ME 3H9HB 5AAPA 2NR6D 4FLSA 4AMKH 4F92B 4YR6B 4UNUA 2E7CA 2VW4A 4E9LA 3ULVD 4HJ0C 3ILPA 5A7BA 3OF6A 4WO4D 1AJ7L 1BVKA 3QK0A 2ZUWA 3GXPA 1CB4A 3HIZA 3S3DB 3ULSB 1UB6A 1FFNB 1EDHA 5BMFL 2J5WA 1Z7JA 1DUZA 1ITCA 2N3JA 4K9EH 2VQTA 4RVBA 5D1XD 4B9JA 3LEXA 2XWTB 4CKVX 1WTLA 2PICA 2ERJC 1LP9B 4HV8B 4TUJB 1JFQH 3PV6A 1RIUL 3RVXD 4HULB 3CSTA 3QQ4A 1KTKE 4LCIH 1X4YA 5DHVA 1U6AH 3SDYH 4I3SL 3HFMH 4QRPA 1A1OB 1BQHA 3TEWA 1DSFL 5K33A 3WSQL 4APQD 4F58L 3VU1A 1OAZL 3PJSA 5DTFA 4ONGH 3VFMA 2DQEL 5MEOA 4NRXA 3UTTA 2P8MA 4XCFH 3SKMA 3LNGA 1P1ZB 4EDWH 3LXAA 5DEJA 3VNYA 3UTTE 2DMBA 2JCCB 3M1OA 2X6BA 2BY3A 1H8NA 4XVTL 3F7VB 2R0KH 1AQHA 3W9EB 1SZNA 4DK5A 3HMXH 4OLYL 1NBVL 3V0EA 1U3HC 4MNGE 3LPWA 1IBYA 2ADFH 2VLRB 3S5ZA 4BH8B 4XRCB 4PJIA 2FLRT 2E86A 3FRUB 5F0PB 2X28A 3BAYA 4IOSD 4B9CA 4KPHH 3O3EB 1RU9L 4WKZB 3RNQB 3EOTL 5GZNC 3RVWD 4H8VA 1R7RA 4Y7OC 3K6DA 2YEVB 3GSUA 3MV8D 4JREB 1QSZA 2CHZA 2H3NB 4G42A 5DJAB 4ZMOA 5IB1B 3MV01 2IQ9H 1CXFA 1TT6A 1WCBA 1BPLB 5D7LA 2E6PA 2EADA 4NP9A 2PPFA 1RJZB 1DP0A 5JA9A 2AQQA 3QI9C 5G5DB 1KBVA 5E2JA 4AZ8B 3ULSA 3LZRA 4HX1B 5CHNB 2VDMB 4NO2A 5KANG 3I02A 2JKRM 3O6FA 5J1AB 2DQFB 5FO2A 4MB5A 2Y6TE 2EDBA 2XN2A 4C4KT 1JCVA 3HI6H 1AHWA 3IDYB 1AXSA 3V6FB 4CJ0A 3VQ1C 4P5MA 5GGTA 2ATAA 3BKCL 3BQUC 5L9DH 3GXFA 2OZ4H 2JKJA 4HAGA 4LRIA 4CAGA 4WENB 4WV1C 4XXDA 4DFIA 4R9HA 4M8VA 3RNKA 4UIMB 1XIWD 1ZSHA 3KJ4B 3UBHA 3CZUB 2W0FB 3L4CA 4UB0H 1A66A 2XUWA 1I8MB 3VFMB 1DL7H 1QWHA 2RR3A 5B1CA 4K23L 2OJZH 3BQUA 5FW6A 2JCCF 4NIYE 1XZWA 4JUSA 1O7VA 4KJYB 4R2GD 1BQSA 1BJ1H 2OCFD 3MAWA 4WZ9A 5T1MA 1EQWA 1LO2H 4NCC2 5D72L 2OMTB 5AW1B 5I6OA 3OB0K 5C6PB 3U1PA 4P3DA 2OMYB 1D7FA 5TGBB 4DTGL 4JJ5B 4YXLH 2A74B 2H6UA 3ZKMC 2EJ1A 4XPFH 1HQ4A 3TPUA 3LQAH 5EHFA 3S35L 5IFAH 1QFWM 5EOTB 4U7KA 4AUYA 3RY6A 5ANME 5F88A 5DJAA 3D3VE 5IB1A 1F2XK 5AW8B 2QVFB 3STZA 1A22B 2AF2A 4TQEH 4A6YB 1HIMH 2FBJH 4QRTA 3T3ME 4N2HA 3ZIYA 5MENE 2HPOA 1KB5A 5IEKA 5FA4A 4BV1A 3NN8A 4GSRA 1XD1A 1QAWA 1IAKA 2FB4L 4MRCA 1JFHA 3UMNA 2EH7H 2DQ6A 2P44B 1F4YL 3TV3L 1OSZA 4FQJL 2MMXA 3IWVA 5AKTA 2NQ3A 4DP1X 5EO9A 1X6NA 4PJHF 3H42H 3FFCD 1CL7L 4TM9A 3L48A 1KY7A 4XMPL 3ZT7A 1MFCH 5EUKA 2XJKA 3QUZB 1A47A 4N0UB 3SDDD 5I17A 2VDPB 3B9KA 2VZVA 4K4KA 4M43H 4NWUL 2AXGB 2OL3A 4JO3H 1DQJB 4AK2A 1BM7A 1TFHA 2FBOJ 2OMUB 4J2QA 5T1DL 3RU8L 2XICA 1AOHA 3B2MA 3VE0A 3VXQB 5F7DB 1XSIA 5KG9A 1JNNL 4BBWA 4POYA 4GSUA 4YUEL 5DQ9B 1YEEH 2OL3H 3HR6A 4Z7WB 1A6ZB 3KWUA 5ISZE 4IGBD 2EYRB 1JV5A 3OX8B 1QP1A 5EZLA 3MBEA 5DZPA 2QGBA 4Y4FB 4DWHA 1ES0A 3F5WB 2PP9A 3MZTA 4TLKA 5IHBA 3TNNA 5B7FA 1WZ1H 2CKBA 4FTDA 2CBQA 1ULVA 3OJMB 3V4UH 4NZUL 3LS4H 1HILA 2KS0A 4HJEA 2J1YA 2B16A 4R7DB 4ZPVA 3LZLA 4YHYB 5FR3A 4OF8A 2A73A 2KL6A 4BQCA 2FLBT 5FGCB 4AQEA 2Y1VA 1PPYA 2HB0A 1FVEB 4FNUA 2DBJA 3NSYA 4A7QA 1V54B 1BWWA 1Q9WB 3ZRCC 4NUQA 1AFVL 43CAB 2AQ3A 5I73B 2ZOLB 5T1DH 2X9YA 5ACZB 4RFOH 1K4CB 5LQBL 2C7UB 4WTZG 4KNUA 4G59C 4R96B 4BXVA 1NAMB 1TJIH 8CGTA 3DX9B 1EO8H 2DJUA 2JI1A 5HDBB 2ICES 4P5RA 1XF3A 2NZIA 2D31B 4WUUE 3GMNA 1GKEA 1QEWB 4MNQD 1AMXA 1QI4A 3L3KB 1ERNA 1N3NA 2A4CA 1FGVH 4X50A 1KTLA 4QRUB 1F5WA 2Z35A 5JZ7D 1DVQA 1KOAA 4Y1AA 5ISZD 2WVVA 3C2SA 1XGUB 4JHWL 3ULUE 1J5OL 2C45A 1BLIA 2W0KA 2GBUA 2P24A 5ILTL 3MLTA 3MUGB 4DKEH 1VFOA 3OMIB 4HHAA 5EPMB 1IAOB 4WGWB 5AVSB 1IM3D 2XQ0A 5J1AA 3NACH 1E5ZA 2EDYA 3RIAF 1RZKH 5EZLB 2O6PA 1IM9B 3E38A 3V4PA 3EYUL 4IRJD 2ICEA 4MGXA 2CUAA 2YU9A 5KSAD 2CNYA 1DVXA 1NCUA 3GQFA 2FT8A 3LPOA 3UJJL 1KCKA 3CDGA 4AUJA 1YMMA 1ED3B 1YNKL 5LO7A 1PYWA 4I3GA 3TFKC 4BUHA 1U3ZA 1VEMA 1VDGA 1YMHB 4M7LH 4X7FC 4GG6F 4DQAA 1IO4C 2DYSB 1A7NH 5DWPA 1TNMA 3ZTJH 2XPGB 5LB1A 4OCWL 5B38B 1CFBA 3D39D 5IBLC 2ZX8A 5B3JF 5E6SB 4GRLC 4PV9B 1NDTA 4S1DD 1E3FA 4XHJC 2DI7A 2FGWL 1E8ZA 4R96A 3U9PH 1A6TB 3K81A 3C5SB 4M5YL 4EVNB 2JKLA 1RZPA 1F4XL 1QFWH 4PLJC 4H1LG 2ZKXA 4YE0A 4EF3A 3OB8A 3WUWG 3AUVA 5FA3B 1EGJL 3GZKA 4F33B 3GZQA 2BOBA 2WJ7A 4LOVA 4F2EA 5JXEA 2VN4A 5C0CB 4FNSA 1TTCA 2WXJA 3MUY1 3ECQA 3VFRB 3IDJB 3RTQA 1GZHA 1V10A 2YHGA 3V55A 4IBQA 3C9NB 5GGRB 4F7PA 5JUEL 2R8SL 3MSPA 3T6WA 2X89D 1KT2A 3FUNA 5C0IB 3QC6X 2CO2A 1ZGLP 1OB1B 1S7WA 2IC2A 3AU0A 4GO8A 3ZGIA 3GTQA 1MCOL 2IV8A 4EI5A 1IKOP 1TUPA 1D5XA 1Q1PA 4RX4A 3WDHA 1JGDA 1RUPH 1T03H 1OZUA 1MJUH 3FU6A 2CK0L 1AYOA 5J3HC 5L8LB 3UMTA 3H2PA 2HG5A 2NUTB 3HE7A 2XIDA 3TF7C 2CBPA 2YPVL 1C7TA 4KK9D 1YDPB 3RGVA 1KPRA 3V6ZA 5IZ7A 1PS3A 1HZLA 4PTUA 5F6IB 1EEZB 4IRZL 4QTIH 5LNGA 2J1XA 4RMTA 1RQ5A 2DIAA 2R9HC 1JRHL 5J4MA 1IBGL 5DFWH 3QZWA 4L8CA 2UXGA 4ZJ9A 1XXDC 5B3SB 1GVIA 4TSAL 3V0DA 2CA3A 1U6AL 2IQAA 4XCNB 3UJIL 2WO4A 4GBXA 1EU1A 2AP2A 4LMQI 2HP4A 5GSVA 5HVHB 3ECWA 2R4SH 3I3DA 1OB0A 2AHIA 1HNGA 2KDYA 4ES8A 1DBBH 4GINA 3NJHA 3GHPA 4L4TB 3HNTL 2J21A 1H6TA 4I89A 5KVFH 3QQ7A 1QWNA 5GGUA 3LXBA 1U92A 3CK0H 1A6ZA 3UTSD 1UJTA 2AKRB 5IWLA 3MC0A 1L9PA 3D7PA 4OFYA 2YQ3A 3RFZA 1C5DB 1TZIA 3FU3A 1MCEA 2A83B 2VC2B 3H0TA 3L1EA 2DLTA 4JLRB 2VDNH 4K3EL 1Y18A 1MWOA 1DQJA 1L6ZA 3LMJL 3SDXF 2DQIH 3IDGA 4KK6D 4OCSL 4DVBA 4YSPA 3NCYP 4Z7QF 3V4PH 1Z9MA 1AGBA 2AABH 3EJSA 4P2QE 4PJIB 2N4IA 4Y9FA 2GT9A 3KW7A 3OGCA 4H26B 2V8LA 3M17B 3GKWH 4DKAA 1J5HA 2OJZL 3K2IA 1DLHA 1EBAA 1ETZB 3ULVE 4N2DA 2WUCH 1H6FA 3HE7B 2NUTA 1JFQL 3PAUA 3SDCA 3LKOB 1PLGH 2R83A 4JR9H 4NO0B 4S2SA 1AY1L 4LO9A 4QRTB 2MHAA 1MH5B 3V6ZB 3VGGA 1YMHA 3MRCA 5IQ9B 2HT2D 4KMLB 4EI6A 1WBXA 3SE9L 3AXIA 3UABA 3CFDB 5C09D 4D0DA 5GLFA 2BNRD 1VADB 2AJSL 3LN5A 5DT1L 1RULL 4FOMA 2I9LA 3CDZA 3DXAD 5DHYA 3VDBA 3CUPA 5TPWH 3IGAA 1DN2A 3T3PE 3ECBA 3WAJA 2NYKA 2F53E 3MRNB 4HC1A 4PW3A 5E6YA 4A1RA 2ZX9A 1E2ZA 2BOBB 4Z78B 1NC4B 1YEFL 3ZTEA 5LGJB 2O5ZH 2EXYD 2QFRA 5EEXA 3IT8D 1N9PA 4ZUTA 4HOZA 4WHTB 3B2UD 4L1HA 5LBSL 4J8QA 4U6YA 1AXIB 1QX1A 4B50A 5CEYB 3D0VB 4F9PA 3K3QA 4PJBB 1JYVA 1MHCA 3GSOA 1I4FA 4KKQA 4PH8A 4ZUWB 3D05A 3D50A 3T65B 3I9GL 1K2DA 4E9VA 4BH8A 2A4ZA 4OD1L 3SE9H 3VD9A 5IJKA 1E8WA 3FTGB 2LU5A 2AK4D 4YX2L 3EZJB 1YMMB 4MAZA 4PBWD 3V7MA 2QHRL 4OJFL 1CD1A 4KI5D 2P46B 5BOZG 2XKNB 4H5SA 1GW0A 2YMXL 3QIBC 3MXWH 4YN3A 4AITA 3FU0A 2EDHA 4B9YA 1Y6MR 3DJ9A 1SN2A 2E75C 1S2EA 4NQDB 1MCIA 3AW5A 4ACTA 4JFDE 5KUKA 4BKLB 5L2JB 4Z0BH 1YPZF 4L48A 1MVUA 5IBUB 4BZ1H 1YCSA 1OGPA 1F4HA 1E8XA 4XOBA 4HQQL 4R7VA 3CXHJ 1UD2A 2EABA 1WZAA 1IC4H 1VADA 4B3VA 1F02I 2WVUA 5C2BH 5E1AA 3BGFC 5CZVH 4BHUA 3NH7L 4X9IA 2R51A 4JFFE 3DHJA 2X4UA 3ZQ9A 1KN2H 1K6QH 3ZUNC 1RVFL 4JO2H 3U6RB 5AOLA 4MZRA 1X5MA 3B4NA 1AGFB 1GAFL 4PG2A 3BZDA 3ARZA 4WW1B 3NFNB 2ISDA 3MLWL 5DHDA 2CJTA 5B1AB 4DN3L 3S36H 4OY9A 2HRHA 1BA9A 4OCXL 4P4KC 1YPZA 1FAIH 3TFBA 4A66A 4Y5YB 3SKNA 4A6YL 2VM3A 2H6PB 5B39A 1UOKA 3CD4A 1IIIA 2DM4A 3VH8G 2P5WA 3PE9A 5D4QA 4MNGA 4OIIH 3ATBA 3OKOA 3UTOA 1ZHNB 1JXDA 4QRRE 2UX6A 1JIBA 2VDKH 3SY0A 5FECB 1MW0A 1RZFL 1FJ1B 5AW5B 2QPSA 5JHDE 5J57B 3GZPA 1CBVL 5AVQB 4A7UA 5FW8A 3TCLA 4EN3D 3B2VL 4BH7A 3VD7A 2GCYB 1ZLWH 2OYPA 3V4VH 5JPMA 3ME0B 4J6RH 5C07A 2B0SL 4AYBA 4GW4A 3X11A 1VZIA 4OZHF 1BW3A 2EDQA 2BSRB 4IJTA 2X4PA 3FONA 2NR6A 3HZVA 3QDMB 2ADIB 1A3ZA 4M6AA 5CSZB 1PZ5A 3JXAA 3KHOA 4Z9KB 3T0EA 1CGTA 3H0TB 2QQLH 1FV1B 4JMXA 2XN0A 5FHAL 4XMZA 2VDLB 5MEPB 3U4BH 1KTBA 1EPFA 2ZUTA 3FH7A 4IRSC 4DO4A 2NY2B 3QC5X 1XBDA 1F11A 4U0RB 4Z7OE 2HLFD 4R4ND 3VWJC 3CVHL 4UDUB 2WXOA 1BFVL 3W11C 5LGHL 2OTWB 3BWUC 1PT1A 1RLWA 5I1KH 2AANA 2WMPB 1U8HA 2QQNH 3DOIA 2O30A 4NO0A 4S2SB 4ORGA 3LRSA 3MCKA 3GBLA 4RMVA 4IHBA 3UTTD 1O6SA 1Z9SA 1EHLH 2OMUA 2Z0UA 2B15A 1ZA3A 5SV4A 4TQPA 2OMWA 4UANA 1LE9B 4C59B 1JTPA 4IKIA 1F3RB 1A4BA 3MA7A 1AGBB 4MX7B 2PPDA 2VQ1B 4BIKA 4N86A 5CP7B 1D5XB 1IB5A 1HOCB 5AVTB 3UPRA 1DFBL 5DZAA 5TTRA 4X6CE 3TASA 1P7QD 3EHBB 3OX8A 2HJKA 1AS7A 4JLRA 4NO3A 3HNVL 3F7LA 4L3AA 3IDXL 2QTVA 2IO5A 1ORQB 4C56A 1R6VA 3K1KC 5I6XB 2EH8L 2OULB 1OLLA 1Z1WA 4X6DB 3GMLA 2K6ZA 5AYUL 4G7SB 1U58B 2VN5A 4OZHB 2X3BA 3VD3A 3HI6L 1LWJA 1A6AB 3CX5K 5LGHH 1YEGH 4X8CA 4XN7A 1TU2B 2PCFB 3PWPD 1V7NL 4K8RL 1SJEB 3W9DB 2Y2TA 5D7LD 1BYNA 3Q2NA 3NRFA 3SSGA 3PPSA 4DSYA 4WI6A 2EIMB 1JDCA 4TQ8A 5E2TL 5EH1A 4FA6A 1T1XB 3OLEA 2YUJA 2B77A 2XPZA 4KUZH 4X7SH 3NBNA 1D6VL 4I88A 2K3HA 4JFZH 1BFVH 4OV6F 3H4HA 4YHMH 3P2DA 3X2HA 2WLKA 2X9WA 4YSDA 4LSRL 3DRQB 3I2CH 2ZIDA 4N2LA 4QTHA 4JJHA 2QELA 1WPCA 2AQPA 2HFEB 2XWBA 3PPEA 5C0DB 1XF4A 5MEND 3KMDA 4OCRH 4AE0A 1DVTA 5I0XA 1UWFA 4FABH 4X6EB 4H5SB 1HCYA 4TXVB 1L5GB 3V52L 1NGYA 1BPVA 3P3SA 3KBFA 3US0A 2FD6H 1INDL 4WTZA 3CFMA 5G55A 4E41A 4Z7OF 2B7DT 3FT2A 2JTDA 3ROOB 2VDNL 5HHNA 2BSED 2ROXA 3POHA 4PJFE 4WUKL 1DQDH 3D0VA 2VPYA 3B5TA 2NXZC 2XZCH 3O11A 4QHPA 4WQOA 1BAWA 3L54A 5DJ0A 3PV6B 2OSWA 1Q16A 1CU4H 1ZDQA 3DSFL 4GQPH 2R7ZA 1EHKB 2F54D 2FWLB 3Q01A 5DK2A 5JHMA 2N0MA 1KCWA 4G8FB 4L4VB 2X0VA 5I75C 4P49A 4ENGA 4RBPH 4WNQB 1U3HA 2CW0D 5FPIA 3OKYA 4OZHA 5DVLA 2VDOB 3QNFA 2X2YA 1JHTA 2PW2A 2V45A 3ESMA 4H0GA 3BP6A 4JY5L 2DJSA 1DBML 2AQRA 1ZE3C 4JDVB 4XBEH 3RWCA 1PQEA 3ENEA 3WO3B 5I1EH 3LN5B 3QUKB 4P2RB 4U6HB 5ALCL 2EXSA 2TRYA 2WWNA 5JIKA 3QYNA 3M8OL 3NSDA 4G8GA 4EI6B 5D1ZB 4ZFOB 5AEAA 4CU7A 3U9UB 1WEJL 3DRQA 2BIPA 2YEZA 1S9XA 3MRQB 3RKDD 2ED7A 4DOHB 3B2XA 4V2CB 3FFCA 4CC4A 2YGPA 3G5YA 3ZPDA 4I0KA 5FUZL 5AW7B 1YEHL 3ULUF 1INDH 5A6LA 1ONQB 4U6YB 4EQ3A 4KZEL 3HPJB 4U1NA 3KJ4C 3WCYA 4AAYA 5HHOD 4WJ5B 5SX4H 4FXKA 1KJ2L 1KB5L 3ZL4H 3VG9B 3I9GH 4I0PA 1EVTC 3P4OA 3ZE0B 3HKFA 5CINH 4O2FA 5HI5D 1JUFB 3AWGA 3WIHL 4F15B 5T33H 4TLSA 4EBQL 1UQSB 1ZSDB 5HHPA 1KYUA 2VXVL 2ITEA 4NBZB 1NUGA 1LE5A 1HT6A 3IXAA 3UIZA 3X1EA 1H9DA 1M7IB 1J0ZA 5C6WH 4ZW5A 1KCSH 5C0JA 4ERSL 4FXLA 1UM4L 5HPOA 4JHZA 4TQEL 3SE4A 1V7NH 1WWBX 4UT9A 3NDZE 1E7UA 4MJHA 1ES0B 3FONB 3HZVB 5D6DC 4HLZG 3M7FB 2A74A 4ZK8A 4R4FL 2JK5A 3HC3L 4S1SL 4AYFA 2AFNA 2HX8A 3ARFA 4RDQG 1T6WA 1G9HA 3UZEC 1JJUA 4Q4IA 2X9ZA 4HD9A 4H2CA 2FL5B 4U6XB 2HT2C 3FSZA 3QZNA 4IK6A 3CVDA 4WI2A 3RYMA 1ESOA 2JH2A 3V9EA 2R29H 3ARQA 4LLQB