4JSPC

Structure of mtordeltan-mlst8-atpgammas-mg complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jspC01
4L3HD 2CN2A 5I5JA 4J0WA 1XIPA 4JT5C 3SLED 1YFQA 2I0SA 5IJ8E 3F3PA 1U4CA 3EI4B 3JPXA 3SBPA 3EI3A 3JZGA 4GMBA 4ZN4A 4QQEA 2H6QA 4J0XA 5KDOB 5GMKn 1K8KC 2QC5A 4NSXA 3HFQA 3GREA 1MDAH 3OW8A 3JB9L 5H17A 2H13A 2CO0A 3SBRA 2H6KA 3V9FA 1OMWB 2I0TA 2IUVA 5GSAA 1XKSA 5AFU3 4E54A 4A2MA 1U2VC 5IT9g 4G56B 1SQJA 2IURA 2TRCB 3PE7A 3MMYA 4CY5A 4JT6C 2OK4A 3N0DA 4JD2C 3MZLA 5CXBA 3UVMA 1XHMA 2HKMA 3FGBA 3EI3B 4GM8A 4JSPC 4GM3A 4FA4D 4AEZA 1NEXB 4XYIA 4FA5D 3C9CA 3RMZD 4CY2A 4O45A 4ZOXA 3SJLD 2AGYA 3A0FA 4A09A 1GG2B 3I2NA 4E5ZB 4D6VA 3SVWD 2P9LC 5HQGA 4CZXA 3UVOA 1Q47A 3SBQA 2J57G 1PBYB 2OJYA 2H9PA 2HJ4A 5HE0B 3I89A 5CXBB 3AL8A 2I3SA 3OKYB 4K3JB 3EI2A 3E0CA 2P9NC 3OKWA 2P9PC 4LG9A 3RN1D 4ERQA 4PC0A 3AL9A 2P9UC 4ZOZA 2B5MA 2QXVA 4ZOVA 5EMKB 3DXMC 4U1EI 2H9NA 1B9YA 4ES0A 1ERJA 5FKSA 4A09B 3RN0D 3UVLA 3RSEC 4BL0A 2H68A 4D0KA 4LGNA 5EM2A 2YNPA 3DM0A 2CO0C 3J81g 2OIZA 2AGWA 3U4YA 5FKTA 5IGOA 2AGLA 3JZHA 2AGXA 2B5NA 3UKRC 3J80g 1NR0A 2IWFA 4O3TB 3AL8B 4A08A 5FXYA 1GP2B 2XL2A 3PXWD 5B4WA 1SHYB 3V7DB 5CYKB 3OTTA 2B4EA 3I8CA 3EMHA 2I0RA 4PNKB 3RFHA 3F3FA 1S4UX 4IA9A 4X60B 2OVPB 2UZYB 3B7FA 3I7PA 3ZWLB 1A0RB 3K26A 2GC4A 2Z2PA 2XL3A 4CZVA 4N14A 2HKRA 2PM6B 4Y7RA 4CI8A 3VA6A 3SMRA 5I5MA 1QNIA 5EM2B 4CY1A 3MKSB 4O9DA 4IMMA 4Y5RD 1FWXA 2PM7B 4QRJA 3W15A 4CI2A 5FA5B 4XEIC 1N6FA 3IJCA 3L4OD 5GXHA 4CI1A 2GNQA 1P22A 1MG3A 2PM9A 3VGZA 4FAND 3I7HA 2Z2OA 4J73A 3SN6B 3AFCA 5HE2B 4FB1D 3ODTA 2J56H 4R7AB 5EALA 2B5LA 4Z8LA 3EI1A 2YBAA 4GQ1A 3PXTD 4ERZA 2OVRB 1K32A 3MKQA 2YB8B 1L0QA 3C75H 3JRPA 4H5IA 4J77A 2BBKH 3FRXA 2YNOA 4A7JA 4BUJC 1JMXB 5TDHB 1VYHC 2YNNA 3MXXA 4J8GA 5EMJB 5FKQA 3EG6A 3ORVD 4JSVC 5HE3B 5TF2A 3OL2A 5K19A 2PBIB 4OWRA 4E54B 5K1CC 2PM9B 3DXKC 2H3XA 2CNXA 4H5JA 1R5MA 3JROA 4PXWA 2J55H 5CXCA 3MZKA 4J87A 2P9IC 3UR4A 5C9ZB 4OZUA 2OVQB 4GM9A 3EI1B 4FAVD 4QT8A 3I8EA 2IAAA 4L9OA 2Q7QA 2H6NA 1MG2A 4J86A 2YMUA 3I7NA 2P9SC 2CN3A 4I79A 2H9LA 2CE9A 2P9KC 2HXCA 2G9AA 5A2Qg 3OL2B 1GOTB 4XYHA 5FLXg 4JSXC 4X63B 1PEVA 4GGAA 4GQBB 4ESGA 4QL1A 3BWSA 4A0AA 2EBSA 4MK0B 2IUPA 3DSMA 4J84A 5H14A 4A11A 4J81A 2MTAH 3C99A 3SFZA 3EI2B 2HYEA 3PSLA 3NVNA 3IIWA 4KFMB 4UI9R 4CC9A 2GC7A 3I7LA 3DWLC 4BH6A 4GGCA 2CE8A 3I7OA 4A0BA 4TZ4A 4CZYA 3ULEC 4A2LA 4PSWB 2H9MA 3JZNA 3SCYA 1B9XA 1JJUB 3RFGA 3UKUC 3K27A 5IC7A 3UVNA 2G99A 4J82A 5AJAA 3I7KA 3V5WB 4EWRA 1N6EA 4A0AB 3BG1A 2Z2NA 3PSCB 5EMLB 2O9KA 5SXMA 5C2VB 3EWEA 4A11B 4A08B 1PI6A 2AH0A 2AGZA 3P4FA 3CFVA 3N0EA 2IUQA 3EU7A 1PGUA 3BG0A 5I5IA 3SWSD 2XYIA 1OLZA 3GFCA 4E5ZA 3KRXB 3L4MD 4A0BB 4YVDA 5EARA 4GZ8A 2UZXB 2OK6A 4FA9D 5IGQA 4AOWA 5EMMB 5EAPA 3CFSB 3VH0A 1N6DA 1SQ9A 3OKYA 2H14A 3OKTA 3RLMD 3IIYA 4GQ2P 4L3GD 5HE1B 5FQDA 2BCJB 5HYNB 4PBYA 3PXSD 5C2WB 3FM0A 1TBGA 3NVQA 3RRMC 4JXMA 4CY3A 5IJ7E 1RI6A 4FHLA 4ERYA 4X3EA 4FA1D 3UVKA 3SHFA 3AH8B 3NVXA 1TYQC 3C5MA 4K3ID 4ZOYA 4L1QD 4J8BA 5GXIA 3IJ0A 5AMSA 2AQ5A 2AH1A 5JWZA 5EAMA 5TEFA 3SXTD 5CYKA 4GGDA 2H47A 3EI4A 2IWKA 3CIKB 4X61B 2HESX 5CXCB 4HDJA 5THAA 4FWWA 4PBZA 5TEEA 4LG8A 1GXRA 3KRWB 3IJ1A 4O3UB 5FKRA 3JAMg 1JOFA 4U7AA 4PSXB 2I3TA 2XU7A 3PVWB 4JSNC 3F3GA 3IKOA 4J79A 1JMZB 4J78A 4O1QD 5H1MA 3PVUB 2HJBA 2W18A 4CI3A
chains in the Genus database with same CATH superfamily
4L3HD 4MMYA 2CN2A 5I5JA 4J0WA 1XIPA 4O02A 4QAMA 4JT5C 3SLED 3IJEA 1YFQA 2I0SA 5IJ8E 4MMXA 3F3PA 1U4CA 3V4PA 3EI4B 2VC2A 3NIFA 3JPXA 3SBPA 3EI3A 3JZGA 4GMBA 4ZN4A 4QQEA 2H6QA 4J0XA 4UM8A 5KDOB 5GMKn 1K8KC 1C9IA 2QC5A 4NSXA 3HFQA 3GREA 4DNVA 1MDAH 3OW8A 3JB9L 1H2WA 4AX4A 5H17A 2H13A 2CO0A 3SBRA 2H6KA 3V9FA 1OMWB 4IRZA 2I0TA 2EIBA 2IUVA 5GSAA 1XKSA 5AFU3 4E54A 4A2MA 1U2VC 4RE5A 5IT9g 4G56B 1SQJA 2IURA 2TRCB 3PE7A 3MMYA 4CY5A 3NIDA 4JT6C 4AN0A 2OK4A 3N0DA 4JD2C 3MZLA 5CXBA 3MVDK 3UVMA 1VE6A 1XHMA 2VDKA 2HKMA 3FGBA 3EI3B 1L5GA 4GM8A 4JSPC 4MMZA 3O4HA 4GM3A 3O4IA 4FA4D 1VE7A 4AEZA 1NEXB 4XYIA 4FA5D 3C9CA 3RMZD 4CY2A 4O45A 4ZOXA 4D9SA 3SJLD 2AGYA 3A0FA 4A09A 1GG2B 3I2NA 4E5ZB 4D6VA 3SVWD 2P9LC 5HQGA 4CZXA 2VDNA 3UVOA 1Q47A 3NIGA 3SBQA 2EICA 1UOQA 2J57G 1PBYB 3K72A 3IUQA 2OJYA 2H9PA 2HJ4A 5HE0B 3I89A 4NENA 5CXBB 5M5VA 3AL8A 2I3SA 3OKYB 4K3JB 3EI2A 3E0CA 2P9NC 2VDMA 3OKWA 3MUOA 3VI3A 2P9PC 4LG9A 3RN1D 4ERQA 4PC0A 3AL9A 2P9UC 4ZOZA 2B5MA 4AMZA 4BCBA 2QXVA 4ZOVA 3FCUA 5EMKB 3DXMC 4U1EI 2H9NA 1B9YA 4ES0A 1ERJA 5FKSA 4A09B 3RN0D 3UVLA 3RSEC 4BL0A 2H68A 4D0KA 4LGNA 5EM2A 2YNPA 4L1MA 3DM0A 2CO0C 3IUMA 5M61A 3J81g 5M5SA 2OIZA 2AGWA 4Z7NA 2JKXA 3DDUA 3U4YA 5FKTA 5IGOA 2AGLA 3JZHA 2AGXA 2B5NA 3UKRC 3J80g 1NR0A 2IWFA 4O3TB 1GOHA 3AL8B 4A08A 5FXYA 1GP2B 1E8NA 2XL2A 3PXWD 5B4WA 1H2YA 1SHYB 3V7DB 5CYKB 3OTTA 2B4EA 3I8CA 3EMHA 2I0RA 5C86A 4PNKB 3RFHA 3F3FA 1S4UX 4IA9A 4X60B 4Z7OA 2OVPB 2UZYB 1E8MA 3B7FA 3I7PA 3IVMA 3ZWLB 1A0RB 3K26A 1UOOA 4NAAA 2HU7A 2GC4A 2XE4A 2Z2PA 2XL3A 4CZVA 4N14A 2HKRA 2PM6B 4NBMA 4Y7RA 4WJKA 4CI8A 3VA6A 3OF7A 3SMRA 5I5MA 1QNIA 5EM2B 4CY1A 3MKSB 4O9DA 4JHNA 4IMMA 4Y5RD 3T3MA 1FWXA 2PM7B 4QRJA 3W15A 4CI2A 5FA5B 4XEIC 1N6FA 3IJCA 3L4OD 4WK4A 5GXHA 2EIDA 4CI1A 1VZ3A 2GNQA 1P22A 4NC4A 1MG3A 2PM9A 1M1XA 3VGZA 4FAND 3VI4A 3I7HA 2Z2OA 4J73A 3SN6B 3AFCA 5HE2B 4FB1D 3ODTA 2J56H 4R7AB 4DNWA 5EALA 2B5LA 4Z8LA 2WQ8A 2YBAA 3EI1A 4GQ1A 5FFGA 3PXTD 4ERZA 2OVRB 1K32A 1H2XA 3MKQA 2YB8B 1L0QA 3C75H 3JRPA 4H5IA 4J77A 2XZGA 5C92A 2BBKH 3FRXA 2YNOA 4A7JA 3EQ7A 4BUJC 1JMXB 5TDHB 1VYHC 2YNNA 1QFMA 3MXXA 4J8GA 5M5UA 4RE6A 5EMJB 3EG6A 3ORVD 4JSVC 5FKQA 5HE3B 5M5RA 5TF2A 3QI0A 2VZ3A 3OL2A 5K19A 2PBIB 4OWRA 2QR5A 4E54B 5E6RA 5K1CC 3GD1I 2PM9B 3DXKC 2H3XA 2CNXA 4H5JA 1R5MA 4WK0A 4BCCA 3JROA 4DNUA 4PXWA 2J55H 5CXCA 1GOGA 1E5TA 3MZKA 4J87A 2P9IC 3UR4A 5C9ZB 4OZUA 2OVQB 4GM9A 3EI1B 4FAVD 3FCSA 4QT8A 3I8EA 2IAAA 4L9OA 1I2MB 2H6NA 2Q7QA 2VDPA 1MG2A 4J86A 2YMUA 3I7NA 4O2WA 2P9SC 2CN3A 4I79A 2H9LA 2CE9A 3ZE2A 3O4GA 2P9KC 2HXCA 2G9AA 5A2Qg 3OL2B 1GOTB 4XYHA 5FLXg 4JSXC 4X63B 1PEVA 3IUNA 3IUJA 4GGAA 4GQBB 3ZE1A 1O6FA 4ESGA 4QL1A 2VDOA 3BWSA 4A0AA 2EBSA 2QZPA 4MK0B 2IUPA 3DSMA 4J84A 5H14A 4A11A 4J81A 2MTAH 3C99A 3SFZA 3EI2B 2HYEA 3K6SA 3PSLA 3NVNA 4G1EA 3IIWA 4KFMB 4UI9R 4CC9A 2VZ1A 2GC7A 3I7LA 3DWLC 5E6UA 4BH6A 4GGCA 4UM9A 2CE8A 3I7OA 3QHYB 4TZ4A 4CZYA 1C9LA 4A0BA 3ULEC 4G1MA 4A2LA 4PSWB 2H9MA 3JZNA 4G55A 4Z7QA 3SCYA 1BPOA 3KCIA 1B9XA 1JJUB 5HDBA 3RFGA 3UKUC 3K27A 2VDRA 5IC7A 3UVNA 2G99A 3ZDXA 4J82A 5AJAA 3I7KA 3V5WB 4EWRA 1N6EA 4A0AB 2VDQA 3BG1A 5E6SA 2Z2NA 3PSCB 5EMLB 2O9KA 5SXMA 3MUNA 2EIEA 5C2VB 3EWEA 5FFOA 4A11B 4AMYA 3O4JA 4A08B 1PI6A 2AH0A 2AGZA 3N0EA 3CFVA 3P4FA 2IUQA 3V4VA 1GOFA 3EU7A 1PGUA 3BG0A 5I5IA 3SWSD 2XYIA 3ZDZA 1O6GA 1UTCA 3EQ8A 1OLZA 3GFCA 4BCDA 4E5ZA 3KRXB 3L4MD 3ZDYA 4A0BB 4BP8A 4YVDA 3EQ9A 5EARA 4GZ8A 2UZXB 2OK6A 4FA9D 1UOPA 5IGQA 4AOWA 5EMMB 1K3IA 5EAPA 3CFSB 3VH0A 1N6DA 1SQ9A 3OKYA 2H14A 3OKTA 3RLMD 3IIYA 4GQ2P 4L3GD 5HE1B 5FQDA 2BCJB 5HYNB 2BKLA 4PBYA 3K71A 3PXSD 5C2WB 4BP9A 3FM0A 1TBGA 3NVQA 3RRMC 4JXMA 3T3PA 4CY3A 1YR2A 5IJ7E 5M5TA 1RI6A 4FHLA 4ERYA 4X3EA 1JTDB 3ZE0A 4FA1D 3IULA 1A12A 3UVKA 3SHFA 3AH8B 1QFSA 3NVXA 4AN1A 1TYQC 3C5MA 4K3ID 4ZOYA 2HU5A 4J8BA 4L1QD 3IURA 5GXIA 3IJ0A 1TYEA 2AQ5A 2AH1A 2VDLA 5AMSA 5JWZA 1H2ZA 1U8CA 5EAMA 5TEFA 1JV2A 3SXTD 5CYKA 4GGDA 3GC3B 4JHPC 2H47A 3EI4A 2IWKA 3CIKB 4X61B 2HESX 5CXCB 2HU8A 4HDJA 5THAA 4FWWA 4PBZA 4WK2A 5TEEA 4LG8A 1GXRA 2XDWA 3KRWB 3IJ1A 4O3UB 5FKRA 3JAMg 1JOFA 1T2XA 4U7AA 4PSXB 3F3GA 2I3TA 2XU7A 3PVWB 4JSNC 3IKOA 4J79A 1JMZB 4J78A 4O1QD 5H1MA 3PVUB 2HJBA 1VZ2A 2W18A 4CI3A
chains in the Genus database with same CATH topology
4L3HD 2CN2A 5I5JA 4J0WA 1XIPA 4JT5C 3SLED 1YFQA 2I0SA 5IJ8E 3F3PA 1U4CA 3EI4B 3JPXA 3SBPA 3EI3A 3JZGA 4GMBA 4ZN4A 4QQEA 2H6QA 4J0XA 5KDOB 5GMKn 1K8KC 2QC5A 4NSXA 3HFQA 3GREA 1MDAH 3OW8A 3JB9L 5H17A 2H13A 2CO0A 3SBRA 2H6KA 3V9FA 1OMWB 2I0TA 2IUVA 5GSAA 1XKSA 5AFU3 4E54A 4A2MA 1U2VC 5IT9g 4G56B 1SQJA 2IURA 2TRCB 3PE7A 3MMYA 4CY5A 4JT6C 2OK4A 3N0DA 4JD2C 3MZLA 5CXBA 3UVMA 1XHMA 2HKMA 3FGBA 3EI3B 4GM8A 4JSPC 4GM3A 4FA4D 4AEZA 1NEXB 4XYIA 4FA5D 3C9CA 3RMZD 4CY2A 4O45A 4ZOXA 3SJLD 2AGYA 3A0FA 4A09A 1GG2B 3I2NA 4E5ZB 4D6VA 3SVWD 2P9LC 5HQGA 4CZXA 3UVOA 1Q47A 3SBQA 2J57G 1PBYB 2OJYA 2H9PA 2HJ4A 5HE0B 3I89A 5CXBB 3AL8A 2I3SA 3OKYB 4K3JB 3EI2A 3E0CA 2P9NC 3OKWA 2P9PC 4LG9A 3RN1D 4ERQA 4PC0A 3AL9A 2P9UC 4ZOZA 2B5MA 2QXVA 4ZOVA 5EMKB 3DXMC 4U1EI 2H9NA 1B9YA 4ES0A 1ERJA 5FKSA 4A09B 3RN0D 3UVLA 3RSEC 4BL0A 2H68A 4D0KA 4LGNA 5EM2A 2YNPA 3DM0A 2CO0C 3J81g 2OIZA 2AGWA 3U4YA 5FKTA 5IGOA 2AGLA 3JZHA 2AGXA 2B5NA 3UKRC 3J80g 1NR0A 2IWFA 4O3TB 3AL8B 4A08A 5FXYA 1GP2B 2XL2A 3PXWD 5B4WA 1SHYB 3V7DB 5CYKB 3OTTA 2B4EA 3I8CA 3EMHA 2I0RA 4PNKB 3RFHA 3F3FA 1S4UX 4IA9A 4X60B 2OVPB 2UZYB 3B7FA 3I7PA 3ZWLB 1A0RB 3K26A 2GC4A 2Z2PA 2XL3A 4CZVA 4N14A 2HKRA 2PM6B 4Y7RA 4CI8A 3VA6A 3SMRA 5I5MA 1QNIA 5EM2B 4CY1A 3MKSB 4O9DA 4IMMA 4Y5RD 1FWXA 2PM7B 4QRJA 3W15A 4CI2A 5FA5B 4XEIC 1N6FA 3IJCA 3L4OD 5GXHA 4CI1A 2GNQA 1P22A 1MG3A 2PM9A 3VGZA 4FAND 3I7HA 2Z2OA 4J73A 3SN6B 3AFCA 5HE2B 4FB1D 3ODTA 2J56H 4R7AB 5EALA 2B5LA 4Z8LA 3EI1A 2YBAA 4GQ1A 3PXTD 4ERZA 2OVRB 1K32A 3MKQA 2YB8B 1L0QA 3C75H 3JRPA 4H5IA 4J77A 2BBKH 3FRXA 2YNOA 4A7JA 4BUJC 1JMXB 5TDHB 1VYHC 2YNNA 3MXXA 4J8GA 5EMJB 5FKQA 3EG6A 3ORVD 4JSVC 5HE3B 5TF2A 3OL2A 5K19A 2PBIB 4OWRA 4E54B 5K1CC 2PM9B 3DXKC 2H3XA 2CNXA 4H5JA 1R5MA 3JROA 4PXWA 2J55H 5CXCA 3MZKA 4J87A 2P9IC 3UR4A 5C9ZB 4OZUA 2OVQB 4GM9A 3EI1B 4FAVD 4QT8A 3I8EA 2IAAA 4L9OA 2Q7QA 2H6NA 1MG2A 4J86A 2YMUA 3I7NA 2P9SC 2CN3A 4I79A 2H9LA 2CE9A 2P9KC 2HXCA 2G9AA 5A2Qg 3OL2B 1GOTB 4XYHA 5FLXg 4JSXC 4X63B 1PEVA 4GGAA 4GQBB 4ESGA 4QL1A 3BWSA 4A0AA 2EBSA 4MK0B 2IUPA 3DSMA 4J84A 5H14A 4A11A 4J81A 2MTAH 3C99A 3SFZA 3EI2B 2HYEA 3PSLA 3NVNA 3IIWA 4KFMB 4UI9R 4CC9A 2GC7A 3I7LA 3DWLC 4BH6A 4GGCA 2CE8A 3I7OA 4A0BA 4TZ4A 4CZYA 3ULEC 4A2LA 4PSWB 2H9MA 3JZNA 3SCYA 1B9XA 1JJUB 3RFGA 3UKUC 3K27A 5IC7A 3UVNA 2G99A 4J82A 5AJAA 3I7KA 3V5WB 4EWRA 1N6EA 4A0AB 3BG1A 2Z2NA 3PSCB 5EMLB 2O9KA 5SXMA 5C2VB 3EWEA 4A11B 4A08B 1PI6A 2AH0A 2AGZA 3P4FA 3CFVA 3N0EA 2IUQA 3EU7A 1PGUA 3BG0A 5I5IA 3SWSD 2XYIA 1OLZA 3GFCA 4E5ZA 3KRXB 3L4MD 4A0BB 4YVDA 5EARA 4GZ8A 2UZXB 2OK6A 4FA9D 5IGQA 4AOWA 5EMMB 5EAPA 3CFSB 3VH0A 1N6DA 1SQ9A 3OKYA 2H14A 3OKTA 3RLMD 3IIYA 4GQ2P 4L3GD 5HE1B 5FQDA 2BCJB 5HYNB 4PBYA 3PXSD 5C2WB 3FM0A 1TBGA 3NVQA 3RRMC 4JXMA 4CY3A 5IJ7E 1RI6A 4FHLA 4ERYA 4X3EA 4FA1D 3UVKA 3SHFA 3AH8B 3NVXA 1TYQC 3C5MA 4K3ID 4ZOYA 4L1QD 4J8BA 5GXIA 3IJ0A 5AMSA 2AQ5A 2AH1A 5JWZA 5EAMA 5TEFA 3SXTD 5CYKA 4GGDA 2H47A 3EI4A 2IWKA 3CIKB 4X61B 2HESX 5CXCB 4HDJA 5THAA 4FWWA 4PBZA 5TEEA 4LG8A 1GXRA 3KRWB 3IJ1A 4O3UB 5FKRA 3JAMg 1JOFA 4U7AA 4PSXB 2I3TA 2XU7A 3PVWB 4JSNC 3F3GA 3IKOA 4J79A 1JMZB 4J78A 4O1QD 5H1MA 3PVUB 2HJBA 2W18A 4CI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3H D;  2CN2 A;  5I5J A;  4J0W A;  1XIP A;  4JT5 C;  3SLE D;  1YFQ A;  2I0S A;  5IJ8 E;  3F3P A;  1U4C A;  3EI4 B;  3JPX A;  3SBP A;  3EI3 A;  3JZG A;  4GMB A;  4ZN4 A;  4QQE A;  2H6Q A;  4J0X A;  5KDO B;  5GMK n;  1K8K C;  2QC5 A;  4NSX A;  3HFQ A;  3GRE A;  1MDA H;  3OW8 A;  3JB9 L;  5H17 A;  2H13 A;  2CO0 A;  3SBR A;  2H6K A;  3V9F A;  1OMW B;  2I0T A;  2IUV A;  5GSA A;  1XKS A;  5AFU 3;  4E54 A;  4A2M A;  1U2V C;  5IT9 g;  4G56 B;  1SQJ A;  2IUR A;  2TRC B;  3PE7 A;  3MMY A;  4CY5 A;  4JT6 C;  2OK4 A;  3N0D A;  4JD2 C;  3MZL A;  5CXB A;  3UVM A;  1XHM A;  2HKM A;  3FGB A;  3EI3 B;  4GM8 A;  4JSP C;  4GM3 A;  4FA4 D;  4AEZ A;  1NEX B;  4XYI A;  4FA5 D;  3C9C A;  3RMZ D;  4CY2 A;  4O45 A;  4ZOX A;  3SJL D;  2AGY A;  3A0F A;  4A09 A;  1GG2 B;  3I2N A;  4E5Z B;  4D6V A;  3SVW D;  2P9L C;  5HQG A;  4CZX A;  3UVO A;  1Q47 A;  3SBQ A;  2J57 G;  1PBY B;  2OJY A;  2H9P A;  2HJ4 A;  5HE0 B;  3I89 A;  5CXB B;  3AL8 A;  2I3S A;  3OKY B;  4K3J B;  3EI2 A;  3E0C A;  2P9N C;  3OKW A;  2P9P C;  4LG9 A;  3RN1 D;  4ERQ A;  4PC0 A;  3AL9 A;  2P9U C;  4ZOZ A;  2B5M A;  2QXV A;  4ZOV A;  5EMK B;  3DXM C;  4U1E I;  2H9N A;  1B9Y A;  4ES0 A;  1ERJ A;  5FKS A;  4A09 B;  3RN0 D;  3UVL A;  3RSE C;  4BL0 A;  2H68 A;  4D0K A;  4LGN A;  5EM2 A;  2YNP A;  3DM0 A;  2CO0 C;  3J81 g;  2OIZ A;  2AGW A;  3U4Y A;  5FKT A;  5IGO A;  2AGL A;  3JZH A;  2AGX A;  2B5N A;  3UKR C;  3J80 g;  1NR0 A;  2IWF A;  4O3T B;  3AL8 B;  4A08 A;  5FXY A;  1GP2 B;  2XL2 A;  3PXW D;  5B4W A;  1SHY B;  3V7D B;  5CYK B;  3OTT A;  2B4E A;  3I8C A;  3EMH A;  2I0R A;  4PNK B;  3RFH A;  3F3F A;  1S4U X;  4IA9 A;  4X60 B;  2OVP B;  2UZY B;  3B7F A;  3I7P A;  3ZWL B;  1A0R B;  3K26 A;  2GC4 A;  2Z2P A;  2XL3 A;  4CZV A;  4N14 A;  2HKR A;  2PM6 B;  4Y7R A;  4CI8 A;  3VA6 A;  3SMR A;  5I5M A;  1QNI A;  5EM2 B;  4CY1 A;  3MKS B;  4O9D A;  4IMM A;  4Y5R D;  1FWX A;  2PM7 B;  4QRJ A;  3W15 A;  4CI2 A;  5FA5 B;  4XEI C;  1N6F A;  3IJC A;  3L4O D;  5GXH A;  4CI1 A;  2GNQ A;  1P22 A;  1MG3 A;  2PM9 A;  3VGZ A;  4FAN D;  3I7H A;  2Z2O A;  4J73 A;  3SN6 B;  3AFC A;  5HE2 B;  4FB1 D;  3ODT A;  2J56 H;  4R7A B;  5EAL A;  2B5L A;  4Z8L A;  3EI1 A;  2YBA A;  4GQ1 A;  3PXT D;  4ERZ A;  2OVR B;  1K32 A;  3MKQ A;  2YB8 B;  1L0Q A;  3C75 H;  3JRP A;  4H5I A;  4J77 A;  2BBK H;  3FRX A;  2YNO A;  4A7J A;  4BUJ C;  1JMX B;  5TDH B;  1VYH C;  2YNN A;  3MXX A;  4J8G A;  5EMJ B;  5FKQ A;  3EG6 A;  3ORV D;  4JSV C;  5HE3 B;  5TF2 A;  3OL2 A;  5K19 A;  2PBI B;  4OWR A;  4E54 B;  5K1C C;  2PM9 B;  3DXK C;  2H3X A;  2CNX A;  4H5J A;  1R5M A;  3JRO A;  4PXW A;  2J55 H;  5CXC A;  3MZK A;  4J87 A;  2P9I C;  3UR4 A;  5C9Z B;  4OZU A;  2OVQ B;  4GM9 A;  3EI1 B;  4FAV D;  4QT8 A;  3I8E A;  2IAA A;  4L9O A;  2Q7Q A;  2H6N A;  1MG2 A;  4J86 A;  2YMU A;  3I7N A;  2P9S C;  2CN3 A;  4I79 A;  2H9L A;  2CE9 A;  2P9K C;  2HXC A;  2G9A A;  5A2Q g;  3OL2 B;  1GOT B;  4XYH A;  5FLX g;  4JSX C;  4X63 B;  1PEV A;  4GGA A;  4GQB B;  4ESG A;  4QL1 A;  3BWS A;  4A0A A;  2EBS A;  4MK0 B;  2IUP A;  3DSM A;  4J84 A;  5H14 A;  4A11 A;  4J81 A;  2MTA H;  3C99 A;  3SFZ A;  3EI2 B;  2HYE A;  3PSL A;  3NVN A;  3IIW A;  4KFM B;  4UI9 R;  4CC9 A;  2GC7 A;  3I7L A;  3DWL C;  4BH6 A;  4GGC A;  2CE8 A;  3I7O A;  4A0B A;  4TZ4 A;  4CZY A;  3ULE C;  4A2L A;  4PSW B;  2H9M A;  3JZN A;  3SCY A;  1B9X A;  1JJU B;  3RFG A;  3UKU C;  3K27 A;  5IC7 A;  3UVN A;  2G99 A;  4J82 A;  5AJA A;  3I7K A;  3V5W B;  4EWR A;  1N6E A;  4A0A B;  3BG1 A;  2Z2N A;  3PSC B;  5EML B;  2O9K A;  5SXM A;  5C2V B;  3EWE A;  4A11 B;  4A08 B;  1PI6 A;  2AH0 A;  2AGZ A;  3P4F A;  3CFV A;  3N0E A;  2IUQ A;  3EU7 A;  1PGU A;  3BG0 A;  5I5I A;  3SWS D;  2XYI A;  1OLZ A;  3GFC A;  4E5Z A;  3KRX B;  3L4M D;  4A0B B;  4YVD A;  5EAR A;  4GZ8 A;  2UZX B;  2OK6 A;  4FA9 D;  5IGQ A;  4AOW A;  5EMM B;  5EAP A;  3CFS B;  3VH0 A;  1N6D A;  1SQ9 A;  3OKY A;  2H14 A;  3OKT A;  3RLM D;  3IIY A;  4GQ2 P;  4L3G D;  5HE1 B;  5FQD A;  2BCJ B;  5HYN B;  4PBY A;  3PXS D;  5C2W B;  3FM0 A;  1TBG A;  3NVQ A;  3RRM C;  4JXM A;  4CY3 A;  5IJ7 E;  1RI6 A;  4FHL A;  4ERY A;  4X3E A;  4FA1 D;  3UVK A;  3SHF A;  3AH8 B;  3NVX A;  1TYQ C;  3C5M A;  4K3I D;  4ZOY A;  4L1Q D;  4J8B A;  5GXI A;  3IJ0 A;  5AMS A;  2AQ5 A;  2AH1 A;  5JWZ A;  5EAM A;  5TEF A;  3SXT D;  5CYK A;  4GGD A;  2H47 A;  3EI4 A;  2IWK A;  3CIK B;  4X61 B;  2HES X;  5CXC B;  4HDJ A;  5THA A;  4FWW A;  4PBZ A;  5TEE A;  4LG8 A;  1GXR A;  3KRW B;  3IJ1 A;  4O3U B;  5FKR A;  3JAM g;  1JOF A;  4U7A A;  4PSX B;  2I3T A;  2XU7 A;  3PVW B;  4JSN C;  3F3G A;  3IKO A;  4J79 A;  1JMZ B;  4J78 A;  4O1Q D;  5H1M A;  3PVU B;  2HJB A;  2W18 A;  4CI3 A; 
#chains in the Genus database with same CATH topology
 4L3H D;  4MMY A;  2CN2 A;  5I5J A;  4J0W A;  1XIP A;  4O02 A;  4QAM A;  4JT5 C;  3SLE D;  3IJE A;  1YFQ A;  2I0S A;  5IJ8 E;  4MMX A;  3F3P A;  1U4C A;  3V4P A;  3EI4 B;  2VC2 A;  3NIF A;  3JPX A;  3SBP A;  3EI3 A;  3JZG A;  4GMB A;  4ZN4 A;  4QQE A;  2H6Q A;  4J0X A;  4UM8 A;  5KDO B;  5GMK n;  1K8K C;  1C9I A;  2QC5 A;  4NSX A;  3HFQ A;  3GRE A;  4DNV A;  1MDA H;  3OW8 A;  3JB9 L;  1H2W A;  4AX4 A;  5H17 A;  2H13 A;  2CO0 A;  3SBR A;  2H6K A;  3V9F A;  1OMW B;  4IRZ A;  2I0T A;  2EIB A;  2IUV A;  5GSA A;  1XKS A;  5AFU 3;  4E54 A;  4A2M A;  1U2V C;  4RE5 A;  5IT9 g;  4G56 B;  1SQJ A;  2IUR A;  2TRC B;  3PE7 A;  3MMY A;  4CY5 A;  3NID A;  4JT6 C;  4AN0 A;  2OK4 A;  3N0D A;  4JD2 C;  3MZL A;  5CXB A;  3MVD K;  3UVM A;  1VE6 A;  1XHM A;  2VDK A;  2HKM A;  3FGB A;  3EI3 B;  1L5G A;  4GM8 A;  4JSP C;  4MMZ A;  3O4H A;  4GM3 A;  3O4I A;  4FA4 D;  1VE7 A;  4AEZ A;  1NEX B;  4XYI A;  4FA5 D;  3C9C A;  3RMZ D;  4CY2 A;  4O45 A;  4ZOX A;  4D9S A;  3SJL D;  2AGY A;  3A0F A;  4A09 A;  1GG2 B;  3I2N A;  4E5Z B;  4D6V A;  3SVW D;  2P9L C;  5HQG A;  4CZX A;  2VDN A;  3UVO A;  1Q47 A;  3NIG A;  3SBQ A;  2EIC A;  1UOQ A;  2J57 G;  1PBY B;  3K72 A;  3IUQ A;  2OJY A;  2H9P A;  2HJ4 A;  5HE0 B;  3I89 A;  4NEN A;  5CXB B;  5M5V A;  3AL8 A;  2I3S A;  3OKY B;  4K3J B;  3EI2 A;  3E0C A;  2P9N C;  2VDM A;  3OKW A;  3MUO A;  3VI3 A;  2P9P C;  4LG9 A;  3RN1 D;  4ERQ A;  4PC0 A;  3AL9 A;  2P9U C;  4ZOZ A;  2B5M A;  4AMZ A;  4BCB A;  2QXV A;  4ZOV A;  3FCU A;  5EMK B;  3DXM C;  4U1E I;  2H9N A;  1B9Y A;  4ES0 A;  1ERJ A;  5FKS A;  4A09 B;  3RN0 D;  3UVL A;  3RSE C;  4BL0 A;  2H68 A;  4D0K A;  4LGN A;  5EM2 A;  2YNP A;  4L1M A;  3DM0 A;  2CO0 C;  3IUM A;  5M61 A;  3J81 g;  5M5S A;  2OIZ A;  2AGW A;  4Z7N A;  2JKX A;  3DDU A;  3U4Y A;  5FKT A;  5IGO A;  2AGL A;  3JZH A;  2AGX A;  2B5N A;  3UKR C;  3J80 g;  1NR0 A;  2IWF A;  4O3T B;  1GOH A;  3AL8 B;  4A08 A;  5FXY A;  1GP2 B;  1E8N A;  2XL2 A;  3PXW D;  5B4W A;  1H2Y A;  1SHY B;  3V7D B;  5CYK B;  3OTT A;  2B4E A;  3I8C A;  3EMH A;  2I0R A;  5C86 A;  4PNK B;  3RFH A;  3F3F A;  1S4U X;  4IA9 A;  4X60 B;  4Z7O A;  2OVP B;  2UZY B;  1E8M A;  3B7F A;  3I7P A;  3IVM A;  3ZWL B;  1A0R B;  3K26 A;  1UOO A;  4NAA A;  2HU7 A;  2GC4 A;  2XE4 A;  2Z2P A;  2XL3 A;  4CZV A;  4N14 A;  2HKR A;  2PM6 B;  4NBM A;  4Y7R A;  4WJK A;  4CI8 A;  3VA6 A;  3OF7 A;  3SMR A;  5I5M A;  1QNI A;  5EM2 B;  4CY1 A;  3MKS B;  4O9D A;  4JHN A;  4IMM A;  4Y5R D;  3T3M A;  1FWX A;  2PM7 B;  4QRJ A;  3W15 A;  4CI2 A;  5FA5 B;  4XEI C;  1N6F A;  3IJC A;  3L4O D;  4WK4 A;  5GXH A;  2EID A;  4CI1 A;  1VZ3 A;  2GNQ A;  1P22 A;  4NC4 A;  1MG3 A;  2PM9 A;  1M1X A;  3VGZ A;  4FAN D;  3VI4 A;  3I7H A;  2Z2O A;  4J73 A;  3SN6 B;  3AFC A;  5HE2 B;  4FB1 D;  3ODT A;  2J56 H;  4R7A B;  4DNW A;  5EAL A;  2B5L A;  4Z8L A;  2WQ8 A;  2YBA A;  3EI1 A;  4GQ1 A;  5FFG A;  3PXT D;  4ERZ A;  2OVR B;  1K32 A;  1H2X A;  3MKQ A;  2YB8 B;  1L0Q A;  3C75 H;  3JRP A;  4H5I A;  4J77 A;  2XZG A;  5C92 A;  2BBK H;  3FRX A;  2YNO A;  4A7J A;  3EQ7 A;  4BUJ C;  1JMX B;  5TDH B;  1VYH C;  2YNN A;  1QFM A;  3MXX A;  4J8G A;  5M5U A;  4RE6 A;  5EMJ B;  3EG6 A;  3ORV D;  4JSV C;  5FKQ A;  5HE3 B;  5M5R A;  5TF2 A;  3QI0 A;  2VZ3 A;  3OL2 A;  5K19 A;  2PBI B;  4OWR A;  2QR5 A;  4E54 B;  5E6R A;  5K1C C;  3GD1 I;  2PM9 B;  3DXK C;  2H3X A;  2CNX A;  4H5J A;  1R5M A;  4WK0 A;  4BCC A;  3JRO A;  4DNU A;  4PXW A;  2J55 H;  5CXC A;  1GOG A;  1E5T A;  3MZK A;  4J87 A;  2P9I C;  3UR4 A;  5C9Z B;  4OZU A;  2OVQ B;  4GM9 A;  3EI1 B;  4FAV D;  3FCS A;  4QT8 A;  3I8E A;  2IAA A;  4L9O A;  1I2M B;  2H6N A;  2Q7Q A;  2VDP A;  1MG2 A;  4J86 A;  2YMU A;  3I7N A;  4O2W A;  2P9S C;  2CN3 A;  4I79 A;  2H9L A;  2CE9 A;  3ZE2 A;  3O4G A;  2P9K C;  2HXC A;  2G9A A;  5A2Q g;  3OL2 B;  1GOT B;  4XYH A;  5FLX g;  4JSX C;  4X63 B;  1PEV A;  3IUN A;  3IUJ A;  4GGA A;  4GQB B;  3ZE1 A;  1O6F A;  4ESG A;  4QL1 A;  2VDO A;  3BWS A;  4A0A A;  2EBS A;  2QZP A;  4MK0 B;  2IUP A;  3DSM A;  4J84 A;  5H14 A;  4A11 A;  4J81 A;  2MTA H;  3C99 A;  3SFZ A;  3EI2 B;  2HYE A;  3K6S A;  3PSL A;  3NVN A;  4G1E A;  3IIW A;  4KFM B;  4UI9 R;  4CC9 A;  2VZ1 A;  2GC7 A;  3I7L A;  3DWL C;  5E6U A;  4BH6 A;  4GGC A;  4UM9 A;  2CE8 A;  3I7O A;  3QHY B;  4TZ4 A;  4CZY A;  1C9L A;  4A0B A;  3ULE C;  4G1M A;  4A2L A;  4PSW B;  2H9M A;  3JZN A;  4G55 A;  4Z7Q A;  3SCY A;  1BPO A;  3KCI A;  1B9X A;  1JJU B;  5HDB A;  3RFG A;  3UKU C;  3K27 A;  2VDR A;  5IC7 A;  3UVN A;  2G99 A;  3ZDX A;  4J82 A;  5AJA A;  3I7K A;  3V5W B;  4EWR A;  1N6E A;  4A0A B;  2VDQ A;  3BG1 A;  5E6S A;  2Z2N A;  3PSC B;  5EML B;  2O9K A;  5SXM A;  3MUN A;  2EIE A;  5C2V B;  3EWE A;  5FFO A;  4A11 B;  4AMY A;  3O4J A;  4A08 B;  1PI6 A;  2AH0 A;  2AGZ A;  3N0E A;  3CFV A;  3P4F A;  2IUQ A;  3V4V A;  1GOF A;  3EU7 A;  1PGU A;  3BG0 A;  5I5I A;  3SWS D;  2XYI A;  3ZDZ A;  1O6G A;  1UTC A;  3EQ8 A;  1OLZ A;  3GFC A;  4BCD A;  4E5Z A;  3KRX B;  3L4M D;  3ZDY A;  4A0B B;  4BP8 A;  4YVD A;  3EQ9 A;  5EAR A;  4GZ8 A;  2UZX B;  2OK6 A;  4FA9 D;  1UOP A;  5IGQ A;  4AOW A;  5EMM B;  1K3I A;  5EAP A;  3CFS B;  3VH0 A;  1N6D A;  1SQ9 A;  3OKY A;  2H14 A;  3OKT A;  3RLM D;  3IIY A;  4GQ2 P;  4L3G D;  5HE1 B;  5FQD A;  2BCJ B;  5HYN B;  2BKL A;  4PBY A;  3K71 A;  3PXS D;  5C2W B;  4BP9 A;  3FM0 A;  1TBG A;  3NVQ A;  3RRM C;  4JXM A;  3T3P A;  4CY3 A;  1YR2 A;  5IJ7 E;  5M5T A;  1RI6 A;  4FHL A;  4ERY A;  4X3E A;  1JTD B;  3ZE0 A;  4FA1 D;  3IUL A;  1A12 A;  3UVK A;  3SHF A;  3AH8 B;  1QFS A;  3NVX A;  4AN1 A;  1TYQ C;  3C5M A;  4K3I D;  4ZOY A;  2HU5 A;  4J8B A;  4L1Q D;  3IUR A;  5GXI A;  3IJ0 A;  1TYE A;  2AQ5 A;  2AH1 A;  2VDL A;  5AMS A;  5JWZ A;  1H2Z A;  1U8C A;  5EAM A;  5TEF A;  1JV2 A;  3SXT D;  5CYK A;  4GGD A;  3GC3 B;  4JHP C;  2H47 A;  3EI4 A;  2IWK A;  3CIK B;  4X61 B;  2HES X;  5CXC B;  2HU8 A;  4HDJ A;  5THA A;  4FWW A;  4PBZ A;  4WK2 A;  5TEE A;  4LG8 A;  1GXR A;  2XDW A;  3KRW B;  3IJ1 A;  4O3U B;  5FKR A;  3JAM g;  1JOF A;  1T2X A;  4U7A A;  4PSX B;  3F3G A;  2I3T A;  2XU7 A;  3PVW B;  4JSN C;  3IKO A;  4J79 A;  1JMZ B;  4J78 A;  4O1Q D;  5H1M A;  3PVU B;  2HJB A;  1VZ2 A;  2W18 A;  4CI3 A; 
#chains in the Genus database with same CATH homology
 4L3H D;  2CN2 A;  5I5J A;  4J0W A;  1XIP A;  4JT5 C;  3SLE D;  1YFQ A;  2I0S A;  5IJ8 E;  3F3P A;  1U4C A;  3EI4 B;  3JPX A;  3SBP A;  3EI3 A;  3JZG A;  4GMB A;  4ZN4 A;  4QQE A;  2H6Q A;  4J0X A;  5KDO B;  5GMK n;  1K8K C;  2QC5 A;  4NSX A;  3HFQ A;  3GRE A;  1MDA H;  3OW8 A;  3JB9 L;  5H17 A;  2H13 A;  2CO0 A;  3SBR A;  2H6K A;  3V9F A;  1OMW B;  2I0T A;  2IUV A;  5GSA A;  1XKS A;  5AFU 3;  4E54 A;  4A2M A;  1U2V C;  5IT9 g;  4G56 B;  1SQJ A;  2IUR A;  2TRC B;  3PE7 A;  3MMY A;  4CY5 A;  4JT6 C;  2OK4 A;  3N0D A;  4JD2 C;  3MZL A;  5CXB A;  3UVM A;  1XHM A;  2HKM A;  3FGB A;  3EI3 B;  4GM8 A;  4JSP C;  4GM3 A;  4FA4 D;  4AEZ A;  1NEX B;  4XYI A;  4FA5 D;  3C9C A;  3RMZ D;  4CY2 A;  4O45 A;  4ZOX A;  3SJL D;  2AGY A;  3A0F A;  4A09 A;  1GG2 B;  3I2N A;  4E5Z B;  4D6V A;  3SVW D;  2P9L C;  5HQG A;  4CZX A;  3UVO A;  1Q47 A;  3SBQ A;  2J57 G;  1PBY B;  2OJY A;  2H9P A;  2HJ4 A;  5HE0 B;  3I89 A;  5CXB B;  3AL8 A;  2I3S A;  3OKY B;  4K3J B;  3EI2 A;  3E0C A;  2P9N C;  3OKW A;  2P9P C;  4LG9 A;  3RN1 D;  4ERQ A;  4PC0 A;  3AL9 A;  2P9U C;  4ZOZ A;  2B5M A;  2QXV A;  4ZOV A;  5EMK B;  3DXM C;  4U1E I;  2H9N A;  1B9Y A;  4ES0 A;  1ERJ A;  5FKS A;  4A09 B;  3RN0 D;  3UVL A;  3RSE C;  4BL0 A;  2H68 A;  4D0K A;  4LGN A;  5EM2 A;  2YNP A;  3DM0 A;  2CO0 C;  3J81 g;  2OIZ A;  2AGW A;  3U4Y A;  5FKT A;  5IGO A;  2AGL A;  3JZH A;  2AGX A;  2B5N A;  3UKR C;  3J80 g;  1NR0 A;  2IWF A;  4O3T B;  3AL8 B;  4A08 A;  5FXY A;  1GP2 B;  2XL2 A;  3PXW D;  5B4W A;  1SHY B;  3V7D B;  5CYK B;  3OTT A;  2B4E A;  3I8C A;  3EMH A;  2I0R A;  4PNK B;  3RFH A;  3F3F A;  1S4U X;  4IA9 A;  4X60 B;  2OVP B;  2UZY B;  3B7F A;  3I7P A;  3ZWL B;  1A0R B;  3K26 A;  2GC4 A;  2Z2P A;  2XL3 A;  4CZV A;  4N14 A;  2HKR A;  2PM6 B;  4Y7R A;  4CI8 A;  3VA6 A;  3SMR A;  5I5M A;  1QNI A;  5EM2 B;  4CY1 A;  3MKS B;  4O9D A;  4IMM A;  4Y5R D;  1FWX A;  2PM7 B;  4QRJ A;  3W15 A;  4CI2 A;  5FA5 B;  4XEI C;  1N6F A;  3IJC A;  3L4O D;  5GXH A;  4CI1 A;  2GNQ A;  1P22 A;  1MG3 A;  2PM9 A;  3VGZ A;  4FAN D;  3I7H A;  2Z2O A;  4J73 A;  3SN6 B;  3AFC A;  5HE2 B;  4FB1 D;  3ODT A;  2J56 H;  4R7A B;  5EAL A;  2B5L A;  4Z8L A;  3EI1 A;  2YBA A;  4GQ1 A;  3PXT D;  4ERZ A;  2OVR B;  1K32 A;  3MKQ A;  2YB8 B;  1L0Q A;  3C75 H;  3JRP A;  4H5I A;  4J77 A;  2BBK H;  3FRX A;  2YNO A;  4A7J A;  4BUJ C;  1JMX B;  5TDH B;  1VYH C;  2YNN A;  3MXX A;  4J8G A;  5EMJ B;  5FKQ A;  3EG6 A;  3ORV D;  4JSV C;  5HE3 B;  5TF2 A;  3OL2 A;  5K19 A;  2PBI B;  4OWR A;  4E54 B;  5K1C C;  2PM9 B;  3DXK C;  2H3X A;  2CNX A;  4H5J A;  1R5M A;  3JRO A;  4PXW A;  2J55 H;  5CXC A;  3MZK A;  4J87 A;  2P9I C;  3UR4 A;  5C9Z B;  4OZU A;  2OVQ B;  4GM9 A;  3EI1 B;  4FAV D;  4QT8 A;  3I8E A;  2IAA A;  4L9O A;  2Q7Q A;  2H6N A;  1MG2 A;  4J86 A;  2YMU A;  3I7N A;  2P9S C;  2CN3 A;  4I79 A;  2H9L A;  2CE9 A;  2P9K C;  2HXC A;  2G9A A;  5A2Q g;  3OL2 B;  1GOT B;  4XYH A;  5FLX g;  4JSX C;  4X63 B;  1PEV A;  4GGA A;  4GQB B;  4ESG A;  4QL1 A;  3BWS A;  4A0A A;  2EBS A;  4MK0 B;  2IUP A;  3DSM A;  4J84 A;  5H14 A;  4A11 A;  4J81 A;  2MTA H;  3C99 A;  3SFZ A;  3EI2 B;  2HYE A;  3PSL A;  3NVN A;  3IIW A;  4KFM B;  4UI9 R;  4CC9 A;  2GC7 A;  3I7L A;  3DWL C;  4BH6 A;  4GGC A;  2CE8 A;  3I7O A;  4A0B A;  4TZ4 A;  4CZY A;  3ULE C;  4A2L A;  4PSW B;  2H9M A;  3JZN A;  3SCY A;  1B9X A;  1JJU B;  3RFG A;  3UKU C;  3K27 A;  5IC7 A;  3UVN A;  2G99 A;  4J82 A;  5AJA A;  3I7K A;  3V5W B;  4EWR A;  1N6E A;  4A0A B;  3BG1 A;  2Z2N A;  3PSC B;  5EML B;  2O9K A;  5SXM A;  5C2V B;  3EWE A;  4A11 B;  4A08 B;  1PI6 A;  2AH0 A;  2AGZ A;  3P4F A;  3CFV A;  3N0E A;  2IUQ A;  3EU7 A;  1PGU A;  3BG0 A;  5I5I A;  3SWS D;  2XYI A;  1OLZ A;  3GFC A;  4E5Z A;  3KRX B;  3L4M D;  4A0B B;  4YVD A;  5EAR A;  4GZ8 A;  2UZX B;  2OK6 A;  4FA9 D;  5IGQ A;  4AOW A;  5EMM B;  5EAP A;  3CFS B;  3VH0 A;  1N6D A;  1SQ9 A;  3OKY A;  2H14 A;  3OKT A;  3RLM D;  3IIY A;  4GQ2 P;  4L3G D;  5HE1 B;  5FQD A;  2BCJ B;  5HYN B;  4PBY A;  3PXS D;  5C2W B;  3FM0 A;  1TBG A;  3NVQ A;  3RRM C;  4JXM A;  4CY3 A;  5IJ7 E;  1RI6 A;  4FHL A;  4ERY A;  4X3E A;  4FA1 D;  3UVK A;  3SHF A;  3AH8 B;  3NVX A;  1TYQ C;  3C5M A;  4K3I D;  4ZOY A;  4L1Q D;  4J8B A;  5GXI A;  3IJ0 A;  5AMS A;  2AQ5 A;  2AH1 A;  5JWZ A;  5EAM A;  5TEF A;  3SXT D;  5CYK A;  4GGD A;  2H47 A;  3EI4 A;  2IWK A;  3CIK B;  4X61 B;  2HES X;  5CXC B;  4HDJ A;  5THA A;  4FWW A;  4PBZ A;  5TEE A;  4LG8 A;  1GXR A;  3KRW B;  3IJ1 A;  4O3U B;  5FKR A;  3JAM g;  1JOF A;  4U7A A;  4PSX B;  2I3T A;  2XU7 A;  3PVW B;  4JSN C;  3F3G A;  3IKO A;  4J79 A;  1JMZ B;  4J78 A;  4O1Q D;  5H1M A;  3PVU B;  2HJB A;  2W18 A;  4CI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...