4JSPC

Structure of mtordeltan-mlst8-atpgammas-mg complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jspC01
1U4CA 1NR0A 2GC7A 3UVMA 4IMMA 3I7HA 1GP2B 3PSCB 4BUJC 1NEXB 3EI3A 4PSWB 3V5WB 1PBYB 4BH6A 4Y7RA 3UVNA 4E5ZA 1OMWB 2B5NA 1SQJA 3FRXA 5IC7A 3OW8A 5EMLB 3I7KA 2PM9A 1S4UX 3DM0A 2QXVA 4X61B 2YBAA 4GGAA 3KRXB 4E54A 3OL2B 2IUVA 2PBIB 3SN6B 3OKTA 4PNKB 2UZYB 4A08A 4ERYA 4ERZA 3I7NA 3F3FA 4QQEA 4NSXA 3MZKA 4JSXC 4CY1A 1XKSA 2I0SA 3MXXA 4PXWA 4ERQA 4FWWA 5THAA 5FQDA 4EWRA 3SXTD 4Y5RD 5C2VB 2H9LA 2PM6B 3RFHA 4GM9A 3A0FA 3PSLA 3UVLA 3MKQA 3SBPA 4L3HD 4FA5D 2CO0C 4CI2A 4O3TB 4TZ4A 2OVPB 4K3JB 2J55H 5GXIA 4J81A 3I7OA 4A2MA 1L0QA 5FLXg 3JZHA 4FAVD 2I3TA 2AH1A 2OVQB 4CI3A 2CN2A 2QC5A 4GM3A 3PXWD 5CXCA 3W15A 3UKUC 4A0BB 3IIYA 1QNIA 2XL2A 1R5MA 4U7AA 2HXCA 4JXMA 4A2LA 2YNPA 5CXBA 3K26A 5EMJB 5A2Qg 2OVRB 2GNQA 3MKSB 5EM2B 3EU7A 5EAMA 3PXTD 5K1CC 3C99A 1SHYB 4X3EA 4HDJA 4YVDA 4ESGA 4A09A 3JPXA 2H9PA 4N14A 5IJ7E 4QL1A 3OKYB 5TDHB 2J56H 3AFCA 5GSAA 4AOWA 3DXKC 5HE3B 1K32A 2Z2NA 1MDAH 4ZOYA 3JZGA 4K3ID 4CZYA 2CE9A 1B9XA 4Z8LA 4J87A 3PVUB 4X60B 3EI4B 3ZWLB 2AGWA 2YMUA 3IJ0A 1PI6A 3CIKB 3MMYA 2H13A 3NVQA 4GQBB 2B4EA 4A7JA 4J82A 2GC4A 4OZUA 3C5MA 3PVWB 4XYIA 2H9NA 3EI1A 3EI2B 5CYKB 5HE0B 3SJLD 4XEIC 4FA1D 4CZVA 1ERJA 3J81g 4O1QD 5EARA 3N0EA 4ES0A 4FHLA 4FAND 3JZNA 4CY3A 2AGZA 2H9MA 4JD2C 2AH0A 3VGZA 3RMZD 4D6VA 4A11A 4GGCA 2P9UC 4GZ8A 4J0XA 2I0RA 5AJAA 5EM2A 5HE1B 4FB1D 4J0WA 5H1MA 5HYNB 4J79A 4ZOZA 2HKMA 3AL8A 1MG3A 4ZOVA 4J86A 1JOFA 4UI9R 5JWZA 1P22A 3KRWB 2H6KA 2OK6A 3ULEC 4GGDA 2P9SC 3VA6A 2AGLA 3UKRC 1XIPA 3BG0A 4CC9A 2BCJB 4H5IA 2AGYA 4O3UB 3RLMD 3I7LA 4MK0B 4J8GA 2H14A 3BWSA 3F3PA 1B9YA 3SHFA 5HQGA 4CY5A 1RI6A 2J57G 1XHMA 4J77A 3SFZA 5FKTA 3IJCA 5SXMA 2P9PC 2YNNA 3RN0D 3UVOA 4XYHA 3AL9A 2PM7B 1JJUB 3JB9L 5EMMB 5AFU3 3HFQA 1N6EA 3I2NA 4GMBA 5IGOA 2XL3A 3EI3B 4GM8A 5FA5B 4E5ZB 3OL2A 2XU7A 2CO0A 2H3XA 2PM9B 4CI8A 3FM0A 4E54B 3ORVD 2HJ4A 5H14A 4AEZA 2W18A 2AGXA 4U1EI 1K8KC 4A08B 2IURA 4LGNA 2Z2PA 5B4WA 3IJ1A 4GQ2P 5H17A 5AMSA 2I3SA 2CE8A 3UR4A 3RFGA 3I89A 4GQ1A 1U2VC 4A0AB 5TEEA 2P9NC 4CZXA 2IUQA 3NVXA 2OIZA 5FXYA 4J78A 3NVNA 2P9IC 2IAAA 3IKOA 3SWSD 1N6DA 2HYEA 3MZLA 5I5MA 1N6FA 2Z2OA 3E0CA 3IIWA 4JT5C 5HE2B 5EMKB 3SCYA 4BL0A 5I5JA 2H47A 4JT6C 4A0BA 2BBKH 3V7DB 4JSPC 4L1QD 4PSXB 3OKWA 1TYQC 4PBZA 4X63B 5CXCB 2EBSA 4R7AB 3JROA 5EALA 2H6QA 3L4OD 3GFCA 5IJ8E 2MTAH 2YB8B 3B7FA 3V9FA 3I8CA 4FA9D 2CNXA 3SBQA 3SMRA 5CXBB 2IWKA 1JMXB 5TF2A 3RRMC 4JSVC 5K19A 2B5LA 5IGQA 5GMKn 2P9KC 2TRCB 4QRJA 3OKYA 1GG2B 4JSNC 4A09B 5C2WB 4I79A 4CY2A 1MG2A 3DXMC 2OK4A 2G9AA 1PGUA 3EI4A 1TBGA 2P9LC 3OTTA 2H68A 3CFVA 3EMHA 4A0AA 3BG1A 2HESX 2HKRA 2HJBA 2Q7QA 3N0DA 2XYIA 3VH0A 3I8EA 5FKRA 1JMZB 3AH8B 4LG9A 4PBYA 1FWXA 3DWLC 3JRPA 3EI2A 4L9OA 5CYKA 2UZXB 3C75H 3SBRA 3P4FA 3GREA 4J73A 5FKSA 3DSMA 4IA9A 3EI1B 2OJYA 1Q47A 4KFMB 1SQ9A 3EWEA 1GOTB 2CN3A 3CFSB 3L4MD 4G56B 2I0TA 3JAMg 2G99A 3UVKA 1A0RB 1YFQA 1GXRA 5IT9g 3FGBA 4ZN4A 5EAPA 2IUPA 3SVWD 5KDOB 2YNOA 4A11B 4D0KA 4CI1A 3RN1D 1OLZA 2B5MA 3PXSD 3AL8B 4O45A 5TEFA 2AQ5A 3F3GA 4OWRA 5FKQA 4QT8A 3J80g 2O9KA 3I7PA 4J84A 4J8BA 4ZOXA 3RSEC 3K27A 3U4YA 4LG8A 5GXHA 2IWFA 2H6NA 4PC0A 1PEVA 5C9ZB 3PE7A 4H5JA 4O9DA 5I5IA 1VYHC 4L3GD 3EG6A 3SLED 4FA4D 3C9CA 3ODTA
chains in the Genus database with same CATH superfamily
1U4CA 4AMYA 1NR0A 2GC7A 4QAMA 2VDQA 3UVMA 4IMMA 3I7HA 4Z7QA 1GP2B 3PSCB 4BUJC 1NEXB 1C9IA 2HU5A 4WJKA 4WK2A 3EI3A 4PSWB 3V5WB 1PBYB 4BH6A 4Y7RA 3UVNA 4E5ZA 1OMWB 2B5NA 1SQJA 3FRXA 5IC7A 1H2YA 2BKLA 3V4VA 3OW8A 3VI3A 5EMLB 3I7KA 2PM9A 1S4UX 3DM0A 2QXVA 3EQ7A 2YBAA 3QHYB 4X61B 4GGAA 3KRXB 2HU7A 4E54A 3OL2B 3OF7A 2IUVA 2PBIB 5FFOA 3SN6B 3OKTA 4PNKB 2UZYB 4A08A 1UTCA 2EIBA 4ERYA 4ERZA 3I7NA 2VDLA 3F3FA 4QQEA 4NSXA 3MZKA 4JSXC 4CY1A 1XKSA 2I0SA 3MXXA 4PXWA 4ERQA 2XDWA 4FWWA 5THAA 5FQDA 4EWRA 3SXTD 3K6SA 4JHPC 3DDUA 4Y5RD 4BP8A 4DNVA 5C2VB 2H9LA 2PM6B 3RFHA 4GM9A 3A0FA 3PSLA 3EQ9A 3UVLA 3MKQA 3SBPA 4L3HD 4FA5D 2CO0C 4CI2A 4O3TB 4TZ4A 2OVPB 4K3JB 3IUMA 2J55H 5GXIA 4JHNA 4Z7NA 4J81A 3O4JA 3I7OA 4A2MA 3O4IA 5C92A 1L0QA 5FLXg 3JZHA 4FAVD 2I3TA 2AH1A 2OVQB 4CI3A 2CN2A 2QC5A 4GM3A 3PXWD 4G55A 2VDMA 1QFSA 5CXCA 3W15A 3UKUC 4A0BB 3IIYA 1QNIA 3FCSA 2XL2A 1R5MA 4U7AA 3NIFA 5FFGA 3FCUA 4NBMA 2HXCA 4JXMA 4A2LA 2YNPA 5CXBA 1E8NA 3K26A 5EMJB 5A2Qg 2OVRB 2GNQA 3MKSB 1VZ3A 3IULA 5EM2B 1GOFA 3EU7A 5EAMA 3PXTD 5K1CC 2QR5A 3C99A 1SHYB 4MMXA 4X3EA 4HDJA 4YVDA 1BPOA 4ESGA 4A09A 3JPXA 2H9PA 4N14A 3ZE1A 5IJ7E 4QL1A 1I2MB 1O6FA 1K3IA 3OKYB 5TDHB 2J56H 3AFCA 5GSAA 4AOWA 3IVMA 3DXKC 3V4PA 5HE3B 1K32A 3ODTA 2Z2NA 1MDAH 4ZOYA 3JZGA 4K3ID 4CZYA 2CE9A 5M5SA 1UOOA 1B9XA 4Z8LA 4J87A 3PVUB 1TYEA 4X60B 3EI4B 3ZWLB 2AGWA 2EICA 2YMUA 4WK0A 3IJ0A 1H2ZA 1PI6A 3O4HA 3CIKB 3MMYA 2H13A 3IUQA 3NVQA 4GQBB 2B4EA 4RE5A 4J82A 4A7JA 2GC4A 4OZUA 3C5MA 3PVWB 1VE6A 4XYIA 2H9NA 3EI1A 3EI2B 5CYKB 5HE0B 3NIDA 3SJLD 4XEIC 4FA1D 4CZVA 1ERJA 3J81g 2XE4A 4O1QD 5EARA 3N0EA 4ES0A 4FHLA 3ZDXA 4G1MA 4FAND 3JZNA 3ZE0A 4CY3A 5M5UA 2AGZA 2H9MA 5E6SA 1E8MA 1U8CA 1A12A 4JD2C 2AH0A 3VGZA 3RMZD 4D6VA 4A11A 4GGCA 2P9UC 4GZ8A 4J0XA 2I0RA 5AJAA 5EM2A 5HE1B 4FB1D 3IJEA 4J0WA 5H1MA 5HYNB 4J79A 1H2WA 4ZOZA 2HKMA 2VDNA 3AL8A 4BCBA 1MG3A 4ZOVA 4J86A 1JOFA 4UI9R 3ZE2A 5JWZA 3KRWB 1P22A 3IUNA 2H6KA 2OK6A 3ULEC 4GGDA 1E5TA 2P9SC 3VA6A 2AGLA 3UKRC 4AN1A 1XIPA 3BG0A 2WQ8A 4CC9A 2BCJB 1UOQA 4H5IA 4IRZA 2AGYA 4O3UB 4NC4A 3RLMD 5M5RA 3I7LA 4MK0B 4J8GA 2H14A 3BWSA 3F3PA 1B9YA 3SHFA 5HQGA 2VZ1A 4CY5A 1RI6A 2J57G 1XHMA 4J77A 3T3PA 5FKTA 3SFZA 3IJCA 5SXMA 2P9PC 2YNNA 3RN0D 1O6GA 3UVOA 4XYHA 3AL9A 1GOHA 1JJUB 2PM7B 3JB9L 5EMMB 5AFU3 5E6UA 4D9SA 3HFQA 4G1EA 1N6EA 3I2NA 4GMBA 5IGOA 2XL3A 3EI3B 4GM8A 5FA5B 4E5ZB 4NENA 3OL2A 2XU7A 2CO0A 2H3XA 2PM9B 2EIDA 4DNWA 4CI8A 3FM0A 4E54B 2XZGA 2HJ4A 3ORVD 2VDOA 5H14A 4AEZA 2QZPA 2W18A 1VE7A 2AGXA 4U1EI 1K8KC 1T2XA 4A08B 2IURA 4LGNA 2Z2PA 5B4WA 3IJ1A 4BCCA 4MMZA 1L5GA 4GQ2P 5H17A 5AMSA 2I3SA 2CE8A 3UR4A 3RFGA 3I89A 4GQ1A 1U2VC 4A0AB 5TEEA 2P9NC 4CZXA 2IUQA 3ZDZA 3NVXA 2OIZA 5FXYA 4J78A 3NVNA 2P9IC 2IAAA 3IKOA 3SWSD 1N6DA 1H2XA 4NAAA 2HYEA 3MZLA 5I5MA 1N6FA 2Z2OA 3E0CA 3IIWA 4JT5C 5HE2B 3MUNA 5EMKB 4DNUA 2JKXA 3SCYA 4BL0A 2HU8A 5I5JA 2H47A 4JT6C 4A0BA 2BBKH 3V7DB 1VZ2A 4JSPC 1UOPA 4L1QD 4PSXB 3OKWA 1TYQC 4PBZA 4X63B 5CXCB 2EBSA 4R7AB 3JROA 4Z7OA 5EALA 2H6QA 2VZ3A 3IUJA 3L4OD 3GFCA 5IJ8E 2MTAH 2YB8B 3B7FA 3K72A 3I8CA 3V9FA 4FA9D 2CNXA 3SBQA 3SMRA 5CXBB 2IWKA 1JMXB 5TF2A 3RRMC 4JSVC 5K19A 2VDPA 2B5LA 5IGQA 5GMKn 4BCDA 2TRCB 3K71A 2EIEA 4QRJA 3OKYA 1GG2B 3MVDK 1M1XA 4JSNC 4A09B 5C2WB 4I79A 1GOGA 4CY2A 4BP9A 1MG2A 3DXMC 4WK4A 2OK4A 2G9AA 1PGUA 3EI4A 3GD1I 1TBGA 2P9LC 3NIGA 3OTTA 5M5VA 2H68A 3CFVA 3EMHA 4A0AA 3BG1A 2HESX 2HKRA 5E6RA 4O02A 2HJBA 4MMYA 4O2WA 2Q7QA 1C9LA 4RE6A 3N0DA 2XYIA 3VH0A 3I8EA 5FKRA 1JMZB 3AH8B 4LG9A 4PBYA 1FWXA 3DWLC 2VC2A 3JRPA 3EI2A 4AMZA 4L9OA 5CYKA 2UZXB 3C75H 3SBRA 3P4FA 1JV2A 3GREA 4J73A 5FKSA 3DSMA 2VDRA 4IA9A 2OJYA 3EI1B 1Q47A 4KFMB 1SQ9A 3EWEA 3VI4A 1GOTB 2CN3A 3CFSB 3L4MD 4L1MA 4G56B 2I0TA 1JTDB 3JAMg 4UM8A 2G99A 3UVKA 1A0RB 1YFQA 1GXRA 5M61A 5IT9g 3FGBA 4ZN4A 5EAPA 2IUPA 3SVWD 5KDOB 2YNOA 4A11B 4D0KA 3EQ8A 4CI1A 3RN1D 1OLZA 3IURA 2B5MA 3MUOA 3PXSD 3AL8B 4O45A 5TEFA 2AQ5A 1QFMA 3F3GA 4OWRA 5FKQA 4QT8A 3QI0A 3J80g 3T3MA 2O9KA 2VDKA 3I7PA 3O4GA 4J84A 4J8BA 3ZDYA 4ZOXA 3RSEC 3K27A 4UM9A 4LG8A 3U4YA 5GXHA 2IWFA 2H6NA 3GC3B 4PC0A 1PEVA 5C9ZB 3PE7A 5C86A 4AN0A 5M5TA 4H5JA 4O9DA 5I5IA 1YR2A 1VYHC 4L3GD 3EG6A 3KCIA 3SLED 5HDBA 4FA4D 3C9CA 4AX4A 2P9KC
chains in the Genus database with same CATH topology
1U4CA 1NR0A 2GC7A 3UVMA 4IMMA 3I7HA 1GP2B 3PSCB 4BUJC 1NEXB 3EI3A 4PSWB 3V5WB 1PBYB 4BH6A 4Y7RA 3UVNA 4E5ZA 1OMWB 2B5NA 1SQJA 3FRXA 5IC7A 3OW8A 5EMLB 3I7KA 2PM9A 1S4UX 3DM0A 2QXVA 4X61B 2YBAA 4GGAA 3KRXB 4E54A 3OL2B 2IUVA 2PBIB 3SN6B 3OKTA 4PNKB 2UZYB 4A08A 4ERYA 4ERZA 3I7NA 3F3FA 4QQEA 4NSXA 3MZKA 4JSXC 4CY1A 1XKSA 2I0SA 3MXXA 4PXWA 4ERQA 4FWWA 5THAA 5FQDA 4EWRA 3SXTD 4Y5RD 5C2VB 2H9LA 2PM6B 3RFHA 4GM9A 3A0FA 3PSLA 3UVLA 3MKQA 3SBPA 4L3HD 4FA5D 2CO0C 4CI2A 4O3TB 4TZ4A 2OVPB 4K3JB 2J55H 5GXIA 4J81A 3I7OA 4A2MA 1L0QA 5FLXg 3JZHA 4FAVD 2I3TA 2AH1A 2OVQB 4CI3A 2CN2A 2QC5A 4GM3A 3PXWD 5CXCA 3W15A 3UKUC 4A0BB 3IIYA 1QNIA 2XL2A 1R5MA 4U7AA 2HXCA 4JXMA 4A2LA 2YNPA 5CXBA 3K26A 5EMJB 5A2Qg 2OVRB 2GNQA 3MKSB 5EM2B 3EU7A 5EAMA 3PXTD 5K1CC 3C99A 1SHYB 4X3EA 4HDJA 4YVDA 4ESGA 4A09A 3JPXA 2H9PA 4N14A 5IJ7E 4QL1A 3OKYB 5TDHB 2J56H 3AFCA 5GSAA 4AOWA 3DXKC 5HE3B 1K32A 2Z2NA 1MDAH 4ZOYA 3JZGA 4K3ID 4CZYA 2CE9A 1B9XA 4Z8LA 4J87A 3PVUB 4X60B 3EI4B 3ZWLB 2AGWA 2YMUA 3IJ0A 1PI6A 3CIKB 3MMYA 2H13A 3NVQA 4GQBB 2B4EA 4A7JA 4J82A 2GC4A 4OZUA 3C5MA 3PVWB 4XYIA 2H9NA 3EI1A 3EI2B 5CYKB 5HE0B 3SJLD 4XEIC 4FA1D 4CZVA 1ERJA 3J81g 4O1QD 5EARA 3N0EA 4ES0A 4FHLA 4FAND 3JZNA 4CY3A 2AGZA 2H9MA 4JD2C 2AH0A 3VGZA 3RMZD 4D6VA 4A11A 4GGCA 2P9UC 4GZ8A 4J0XA 2I0RA 5AJAA 5EM2A 5HE1B 4FB1D 4J0WA 5H1MA 5HYNB 4J79A 4ZOZA 2HKMA 3AL8A 1MG3A 4ZOVA 4J86A 1JOFA 4UI9R 5JWZA 1P22A 3KRWB 2H6KA 2OK6A 3ULEC 4GGDA 2P9SC 3VA6A 2AGLA 3UKRC 1XIPA 3BG0A 4CC9A 2BCJB 4H5IA 2AGYA 4O3UB 3RLMD 3I7LA 4MK0B 4J8GA 2H14A 3BWSA 3F3PA 1B9YA 3SHFA 5HQGA 4CY5A 1RI6A 2J57G 1XHMA 4J77A 3SFZA 5FKTA 3IJCA 5SXMA 2P9PC 2YNNA 3RN0D 3UVOA 4XYHA 3AL9A 2PM7B 1JJUB 3JB9L 5EMMB 5AFU3 3HFQA 1N6EA 3I2NA 4GMBA 5IGOA 2XL3A 3EI3B 4GM8A 5FA5B 4E5ZB 3OL2A 2XU7A 2CO0A 2H3XA 2PM9B 4CI8A 3FM0A 4E54B 3ORVD 2HJ4A 5H14A 4AEZA 2W18A 2AGXA 4U1EI 1K8KC 4A08B 2IURA 4LGNA 2Z2PA 5B4WA 3IJ1A 4GQ2P 5H17A 5AMSA 2I3SA 2CE8A 3UR4A 3RFGA 3I89A 4GQ1A 1U2VC 4A0AB 5TEEA 2P9NC 4CZXA 2IUQA 3NVXA 2OIZA 5FXYA 4J78A 3NVNA 2P9IC 2IAAA 3IKOA 3SWSD 1N6DA 2HYEA 3MZLA 5I5MA 1N6FA 2Z2OA 3E0CA 3IIWA 4JT5C 5HE2B 5EMKB 3SCYA 4BL0A 5I5JA 2H47A 4JT6C 4A0BA 2BBKH 3V7DB 4JSPC 4L1QD 4PSXB 3OKWA 1TYQC 4PBZA 4X63B 5CXCB 2EBSA 4R7AB 3JROA 5EALA 2H6QA 3L4OD 3GFCA 5IJ8E 2MTAH 2YB8B 3B7FA 3V9FA 3I8CA 4FA9D 2CNXA 3SBQA 3SMRA 5CXBB 2IWKA 1JMXB 5TF2A 3RRMC 4JSVC 5K19A 2B5LA 5IGQA 5GMKn 2P9KC 2TRCB 4QRJA 3OKYA 1GG2B 4JSNC 4A09B 5C2WB 4I79A 4CY2A 1MG2A 3DXMC 2OK4A 2G9AA 1PGUA 3EI4A 1TBGA 2P9LC 3OTTA 2H68A 3CFVA 3EMHA 4A0AA 3BG1A 2HESX 2HKRA 2HJBA 2Q7QA 3N0DA 2XYIA 3VH0A 3I8EA 5FKRA 1JMZB 3AH8B 4LG9A 4PBYA 1FWXA 3DWLC 3JRPA 3EI2A 4L9OA 5CYKA 2UZXB 3C75H 3SBRA 3P4FA 3GREA 4J73A 5FKSA 3DSMA 4IA9A 3EI1B 2OJYA 1Q47A 4KFMB 1SQ9A 3EWEA 1GOTB 2CN3A 3CFSB 3L4MD 4G56B 2I0TA 3JAMg 2G99A 3UVKA 1A0RB 1YFQA 1GXRA 5IT9g 3FGBA 4ZN4A 5EAPA 2IUPA 3SVWD 5KDOB 2YNOA 4A11B 4D0KA 4CI1A 3RN1D 1OLZA 2B5MA 3PXSD 3AL8B 4O45A 5TEFA 2AQ5A 3F3GA 4OWRA 5FKQA 4QT8A 3J80g 2O9KA 3I7PA 4J84A 4J8BA 4ZOXA 3RSEC 3K27A 3U4YA 4LG8A 5GXHA 2IWFA 2H6NA 4PC0A 1PEVA 5C9ZB 3PE7A 4H5JA 4O9DA 5I5IA 1VYHC 4L3GD 3EG6A 3SLED 4FA4D 3C9CA 3ODTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4C A;  1NR0 A;  2GC7 A;  3UVM A;  4IMM A;  3I7H A;  1GP2 B;  3PSC B;  4BUJ C;  1NEX B;  3EI3 A;  4PSW B;  3V5W B;  1PBY B;  4BH6 A;  4Y7R A;  3UVN A;  4E5Z A;  1OMW B;  2B5N A;  1SQJ A;  3FRX A;  5IC7 A;  3OW8 A;  5EML B;  3I7K A;  2PM9 A;  1S4U X;  3DM0 A;  2QXV A;  4X61 B;  2YBA A;  4GGA A;  3KRX B;  4E54 A;  3OL2 B;  2IUV A;  2PBI B;  3SN6 B;  3OKT A;  4PNK B;  2UZY B;  4A08 A;  4ERY A;  4ERZ A;  3I7N A;  3F3F A;  4QQE A;  4NSX A;  3MZK A;  4JSX C;  4CY1 A;  1XKS A;  2I0S A;  3MXX A;  4PXW A;  4ERQ A;  4FWW A;  5THA A;  5FQD A;  4EWR A;  3SXT D;  4Y5R D;  5C2V B;  2H9L A;  2PM6 B;  3RFH A;  4GM9 A;  3A0F A;  3PSL A;  3UVL A;  3MKQ A;  3SBP A;  4L3H D;  4FA5 D;  2CO0 C;  4CI2 A;  4O3T B;  4TZ4 A;  2OVP B;  4K3J B;  2J55 H;  5GXI A;  4J81 A;  3I7O A;  4A2M A;  1L0Q A;  5FLX g;  3JZH A;  4FAV D;  2I3T A;  2AH1 A;  2OVQ B;  4CI3 A;  2CN2 A;  2QC5 A;  4GM3 A;  3PXW D;  5CXC A;  3W15 A;  3UKU C;  4A0B B;  3IIY A;  1QNI A;  2XL2 A;  1R5M A;  4U7A A;  2HXC A;  4JXM A;  4A2L A;  2YNP A;  5CXB A;  3K26 A;  5EMJ B;  5A2Q g;  2OVR B;  2GNQ A;  3MKS B;  5EM2 B;  3EU7 A;  5EAM A;  3PXT D;  5K1C C;  3C99 A;  1SHY B;  4X3E A;  4HDJ A;  4YVD A;  4ESG A;  4A09 A;  3JPX A;  2H9P A;  4N14 A;  5IJ7 E;  4QL1 A;  3OKY B;  5TDH B;  2J56 H;  3AFC A;  5GSA A;  4AOW A;  3DXK C;  5HE3 B;  1K32 A;  2Z2N A;  1MDA H;  4ZOY A;  3JZG A;  4K3I D;  4CZY A;  2CE9 A;  1B9X A;  4Z8L A;  4J87 A;  3PVU B;  4X60 B;  3EI4 B;  3ZWL B;  2AGW A;  2YMU A;  3IJ0 A;  1PI6 A;  3CIK B;  3MMY A;  2H13 A;  3NVQ A;  4GQB B;  2B4E A;  4A7J A;  4J82 A;  2GC4 A;  4OZU A;  3C5M A;  3PVW B;  4XYI A;  2H9N A;  3EI1 A;  3EI2 B;  5CYK B;  5HE0 B;  3SJL D;  4XEI C;  4FA1 D;  4CZV A;  1ERJ A;  3J81 g;  4O1Q D;  5EAR A;  3N0E A;  4ES0 A;  4FHL A;  4FAN D;  3JZN A;  4CY3 A;  2AGZ A;  2H9M A;  4JD2 C;  2AH0 A;  3VGZ A;  3RMZ D;  4D6V A;  4A11 A;  4GGC A;  2P9U C;  4GZ8 A;  4J0X A;  2I0R A;  5AJA A;  5EM2 A;  5HE1 B;  4FB1 D;  4J0W A;  5H1M A;  5HYN B;  4J79 A;  4ZOZ A;  2HKM A;  3AL8 A;  1MG3 A;  4ZOV A;  4J86 A;  1JOF A;  4UI9 R;  5JWZ A;  1P22 A;  3KRW B;  2H6K A;  2OK6 A;  3ULE C;  4GGD A;  2P9S C;  3VA6 A;  2AGL A;  3UKR C;  1XIP A;  3BG0 A;  4CC9 A;  2BCJ B;  4H5I A;  2AGY A;  4O3U B;  3RLM D;  3I7L A;  4MK0 B;  4J8G A;  2H14 A;  3BWS A;  3F3P A;  1B9Y A;  3SHF A;  5HQG A;  4CY5 A;  1RI6 A;  2J57 G;  1XHM A;  4J77 A;  3SFZ A;  5FKT A;  3IJC A;  5SXM A;  2P9P C;  2YNN A;  3RN0 D;  3UVO A;  4XYH A;  3AL9 A;  2PM7 B;  1JJU B;  3JB9 L;  5EMM B;  5AFU 3;  3HFQ A;  1N6E A;  3I2N A;  4GMB A;  5IGO A;  2XL3 A;  3EI3 B;  4GM8 A;  5FA5 B;  4E5Z B;  3OL2 A;  2XU7 A;  2CO0 A;  2H3X A;  2PM9 B;  4CI8 A;  3FM0 A;  4E54 B;  3ORV D;  2HJ4 A;  5H14 A;  4AEZ A;  2W18 A;  2AGX A;  4U1E I;  1K8K C;  4A08 B;  2IUR A;  4LGN A;  2Z2P A;  5B4W A;  3IJ1 A;  4GQ2 P;  5H17 A;  5AMS A;  2I3S A;  2CE8 A;  3UR4 A;  3RFG A;  3I89 A;  4GQ1 A;  1U2V C;  4A0A B;  5TEE A;  2P9N C;  4CZX A;  2IUQ A;  3NVX A;  2OIZ A;  5FXY A;  4J78 A;  3NVN A;  2P9I C;  2IAA A;  3IKO A;  3SWS D;  1N6D A;  2HYE A;  3MZL A;  5I5M A;  1N6F A;  2Z2O A;  3E0C A;  3IIW A;  4JT5 C;  5HE2 B;  5EMK B;  3SCY A;  4BL0 A;  5I5J A;  2H47 A;  4JT6 C;  4A0B A;  2BBK H;  3V7D B;  4JSP C;  4L1Q D;  4PSX B;  3OKW A;  1TYQ C;  4PBZ A;  4X63 B;  5CXC B;  2EBS A;  4R7A B;  3JRO A;  5EAL A;  2H6Q A;  3L4O D;  3GFC A;  5IJ8 E;  2MTA H;  2YB8 B;  3B7F A;  3V9F A;  3I8C A;  4FA9 D;  2CNX A;  3SBQ A;  3SMR A;  5CXB B;  2IWK A;  1JMX B;  5TF2 A;  3RRM C;  4JSV C;  5K19 A;  2B5L A;  5IGQ A;  5GMK n;  2P9K C;  2TRC B;  4QRJ A;  3OKY A;  1GG2 B;  4JSN C;  4A09 B;  5C2W B;  4I79 A;  4CY2 A;  1MG2 A;  3DXM C;  2OK4 A;  2G9A A;  1PGU A;  3EI4 A;  1TBG A;  2P9L C;  3OTT A;  2H68 A;  3CFV A;  3EMH A;  4A0A A;  3BG1 A;  2HES X;  2HKR A;  2HJB A;  2Q7Q A;  3N0D A;  2XYI A;  3VH0 A;  3I8E A;  5FKR A;  1JMZ B;  3AH8 B;  4LG9 A;  4PBY A;  1FWX A;  3DWL C;  3JRP A;  3EI2 A;  4L9O A;  5CYK A;  2UZX B;  3C75 H;  3SBR A;  3P4F A;  3GRE A;  4J73 A;  5FKS A;  3DSM A;  4IA9 A;  3EI1 B;  2OJY A;  1Q47 A;  4KFM B;  1SQ9 A;  3EWE A;  1GOT B;  2CN3 A;  3CFS B;  3L4M D;  4G56 B;  2I0T A;  3JAM g;  2G99 A;  3UVK A;  1A0R B;  1YFQ A;  1GXR A;  5IT9 g;  3FGB A;  4ZN4 A;  5EAP A;  2IUP A;  3SVW D;  5KDO B;  2YNO A;  4A11 B;  4D0K A;  4CI1 A;  3RN1 D;  1OLZ A;  2B5M A;  3PXS D;  3AL8 B;  4O45 A;  5TEF A;  2AQ5 A;  3F3G A;  4OWR A;  5FKQ A;  4QT8 A;  3J80 g;  2O9K A;  3I7P A;  4J84 A;  4J8B A;  4ZOX A;  3RSE C;  3K27 A;  3U4Y A;  4LG8 A;  5GXH A;  2IWF A;  2H6N A;  4PC0 A;  1PEV A;  5C9Z B;  3PE7 A;  4H5J A;  4O9D A;  5I5I A;  1VYH C;  4L3G D;  3EG6 A;  3SLE D;  4FA4 D;  3C9C A;  3ODT A; 
#chains in the Genus database with same CATH topology
 1U4C A;  4AMY A;  1NR0 A;  2GC7 A;  4QAM A;  2VDQ A;  3UVM A;  4IMM A;  3I7H A;  4Z7Q A;  1GP2 B;  3PSC B;  4BUJ C;  1NEX B;  1C9I A;  2HU5 A;  4WJK A;  4WK2 A;  3EI3 A;  4PSW B;  3V5W B;  1PBY B;  4BH6 A;  4Y7R A;  3UVN A;  4E5Z A;  1OMW B;  2B5N A;  1SQJ A;  3FRX A;  5IC7 A;  1H2Y A;  2BKL A;  3V4V A;  3OW8 A;  3VI3 A;  5EML B;  3I7K A;  2PM9 A;  1S4U X;  3DM0 A;  2QXV A;  3EQ7 A;  2YBA A;  3QHY B;  4X61 B;  4GGA A;  3KRX B;  2HU7 A;  4E54 A;  3OL2 B;  3OF7 A;  2IUV A;  2PBI B;  5FFO A;  3SN6 B;  3OKT A;  4PNK B;  2UZY B;  4A08 A;  1UTC A;  2EIB A;  4ERY A;  4ERZ A;  3I7N A;  2VDL A;  3F3F A;  4QQE A;  4NSX A;  3MZK A;  4JSX C;  4CY1 A;  1XKS A;  2I0S A;  3MXX A;  4PXW A;  4ERQ A;  2XDW A;  4FWW A;  5THA A;  5FQD A;  4EWR A;  3SXT D;  3K6S A;  4JHP C;  3DDU A;  4Y5R D;  4BP8 A;  4DNV A;  5C2V B;  2H9L A;  2PM6 B;  3RFH A;  4GM9 A;  3A0F A;  3PSL A;  3EQ9 A;  3UVL A;  3MKQ A;  3SBP A;  4L3H D;  4FA5 D;  2CO0 C;  4CI2 A;  4O3T B;  4TZ4 A;  2OVP B;  4K3J B;  3IUM A;  2J55 H;  5GXI A;  4JHN A;  4Z7N A;  4J81 A;  3O4J A;  3I7O A;  4A2M A;  3O4I A;  5C92 A;  1L0Q A;  5FLX g;  3JZH A;  4FAV D;  2I3T A;  2AH1 A;  2OVQ B;  4CI3 A;  2CN2 A;  2QC5 A;  4GM3 A;  3PXW D;  4G55 A;  2VDM A;  1QFS A;  5CXC A;  3W15 A;  3UKU C;  4A0B B;  3IIY A;  1QNI A;  3FCS A;  2XL2 A;  1R5M A;  4U7A A;  3NIF A;  5FFG A;  3FCU A;  4NBM A;  2HXC A;  4JXM A;  4A2L A;  2YNP A;  5CXB A;  1E8N A;  3K26 A;  5EMJ B;  5A2Q g;  2OVR B;  2GNQ A;  3MKS B;  1VZ3 A;  3IUL A;  5EM2 B;  1GOF A;  3EU7 A;  5EAM A;  3PXT D;  5K1C C;  2QR5 A;  3C99 A;  1SHY B;  4MMX A;  4X3E A;  4HDJ A;  4YVD A;  1BPO A;  4ESG A;  4A09 A;  3JPX A;  2H9P A;  4N14 A;  3ZE1 A;  5IJ7 E;  4QL1 A;  1I2M B;  1O6F A;  1K3I A;  3OKY B;  5TDH B;  2J56 H;  3AFC A;  5GSA A;  4AOW A;  3IVM A;  3DXK C;  3V4P A;  5HE3 B;  1K32 A;  3ODT A;  2Z2N A;  1MDA H;  4ZOY A;  3JZG A;  4K3I D;  4CZY A;  2CE9 A;  5M5S A;  1UOO A;  1B9X A;  4Z8L A;  4J87 A;  3PVU B;  1TYE A;  4X60 B;  3EI4 B;  3ZWL B;  2AGW A;  2EIC A;  2YMU A;  4WK0 A;  3IJ0 A;  1H2Z A;  1PI6 A;  3O4H A;  3CIK B;  3MMY A;  2H13 A;  3IUQ A;  3NVQ A;  4GQB B;  2B4E A;  4RE5 A;  4J82 A;  4A7J A;  2GC4 A;  4OZU A;  3C5M A;  3PVW B;  1VE6 A;  4XYI A;  2H9N A;  3EI1 A;  3EI2 B;  5CYK B;  5HE0 B;  3NID A;  3SJL D;  4XEI C;  4FA1 D;  4CZV A;  1ERJ A;  3J81 g;  2XE4 A;  4O1Q D;  5EAR A;  3N0E A;  4ES0 A;  4FHL A;  3ZDX A;  4G1M A;  4FAN D;  3JZN A;  3ZE0 A;  4CY3 A;  5M5U A;  2AGZ A;  2H9M A;  5E6S A;  1E8M A;  1U8C A;  1A12 A;  4JD2 C;  2AH0 A;  3VGZ A;  3RMZ D;  4D6V A;  4A11 A;  4GGC A;  2P9U C;  4GZ8 A;  4J0X A;  2I0R A;  5AJA A;  5EM2 A;  5HE1 B;  4FB1 D;  3IJE A;  4J0W A;  5H1M A;  5HYN B;  4J79 A;  1H2W A;  4ZOZ A;  2HKM A;  2VDN A;  3AL8 A;  4BCB A;  1MG3 A;  4ZOV A;  4J86 A;  1JOF A;  4UI9 R;  3ZE2 A;  5JWZ A;  3KRW B;  1P22 A;  3IUN A;  2H6K A;  2OK6 A;  3ULE C;  4GGD A;  1E5T A;  2P9S C;  3VA6 A;  2AGL A;  3UKR C;  4AN1 A;  1XIP A;  3BG0 A;  2WQ8 A;  4CC9 A;  2BCJ B;  1UOQ A;  4H5I A;  4IRZ A;  2AGY A;  4O3U B;  4NC4 A;  3RLM D;  5M5R A;  3I7L A;  4MK0 B;  4J8G A;  2H14 A;  3BWS A;  3F3P A;  1B9Y A;  3SHF A;  5HQG A;  2VZ1 A;  4CY5 A;  1RI6 A;  2J57 G;  1XHM A;  4J77 A;  3T3P A;  5FKT A;  3SFZ A;  3IJC A;  5SXM A;  2P9P C;  2YNN A;  3RN0 D;  1O6G A;  3UVO A;  4XYH A;  3AL9 A;  1GOH A;  1JJU B;  2PM7 B;  3JB9 L;  5EMM B;  5AFU 3;  5E6U A;  4D9S A;  3HFQ A;  4G1E A;  1N6E A;  3I2N A;  4GMB A;  5IGO A;  2XL3 A;  3EI3 B;  4GM8 A;  5FA5 B;  4E5Z B;  4NEN A;  3OL2 A;  2XU7 A;  2CO0 A;  2H3X A;  2PM9 B;  2EID A;  4DNW A;  4CI8 A;  3FM0 A;  4E54 B;  2XZG A;  2HJ4 A;  3ORV D;  2VDO A;  5H14 A;  4AEZ A;  2QZP A;  2W18 A;  1VE7 A;  2AGX A;  4U1E I;  1K8K C;  1T2X A;  4A08 B;  2IUR A;  4LGN A;  2Z2P A;  5B4W A;  3IJ1 A;  4BCC A;  4MMZ A;  1L5G A;  4GQ2 P;  5H17 A;  5AMS A;  2I3S A;  2CE8 A;  3UR4 A;  3RFG A;  3I89 A;  4GQ1 A;  1U2V C;  4A0A B;  5TEE A;  2P9N C;  4CZX A;  2IUQ A;  3ZDZ A;  3NVX A;  2OIZ A;  5FXY A;  4J78 A;  3NVN A;  2P9I C;  2IAA A;  3IKO A;  3SWS D;  1N6D A;  1H2X A;  4NAA A;  2HYE A;  3MZL A;  5I5M A;  1N6F A;  2Z2O A;  3E0C A;  3IIW A;  4JT5 C;  5HE2 B;  3MUN A;  5EMK B;  4DNU A;  2JKX A;  3SCY A;  4BL0 A;  2HU8 A;  5I5J A;  2H47 A;  4JT6 C;  4A0B A;  2BBK H;  3V7D B;  1VZ2 A;  4JSP C;  1UOP A;  4L1Q D;  4PSX B;  3OKW A;  1TYQ C;  4PBZ A;  4X63 B;  5CXC B;  2EBS A;  4R7A B;  3JRO A;  4Z7O A;  5EAL A;  2H6Q A;  2VZ3 A;  3IUJ A;  3L4O D;  3GFC A;  5IJ8 E;  2MTA H;  2YB8 B;  3B7F A;  3K72 A;  3I8C A;  3V9F A;  4FA9 D;  2CNX A;  3SBQ A;  3SMR A;  5CXB B;  2IWK A;  1JMX B;  5TF2 A;  3RRM C;  4JSV C;  5K19 A;  2VDP A;  2B5L A;  5IGQ A;  5GMK n;  4BCD A;  2TRC B;  3K71 A;  2EIE A;  4QRJ A;  3OKY A;  1GG2 B;  3MVD K;  1M1X A;  4JSN C;  4A09 B;  5C2W B;  4I79 A;  1GOG A;  4CY2 A;  4BP9 A;  1MG2 A;  3DXM C;  4WK4 A;  2OK4 A;  2G9A A;  1PGU A;  3EI4 A;  3GD1 I;  1TBG A;  2P9L C;  3NIG A;  3OTT A;  5M5V A;  2H68 A;  3CFV A;  3EMH A;  4A0A A;  3BG1 A;  2HES X;  2HKR A;  5E6R A;  4O02 A;  2HJB A;  4MMY A;  4O2W A;  2Q7Q A;  1C9L A;  4RE6 A;  3N0D A;  2XYI A;  3VH0 A;  3I8E A;  5FKR A;  1JMZ B;  3AH8 B;  4LG9 A;  4PBY A;  1FWX A;  3DWL C;  2VC2 A;  3JRP A;  3EI2 A;  4AMZ A;  4L9O A;  5CYK A;  2UZX B;  3C75 H;  3SBR A;  3P4F A;  1JV2 A;  3GRE A;  4J73 A;  5FKS A;  3DSM A;  2VDR A;  4IA9 A;  2OJY A;  3EI1 B;  1Q47 A;  4KFM B;  1SQ9 A;  3EWE A;  3VI4 A;  1GOT B;  2CN3 A;  3CFS B;  3L4M D;  4L1M A;  4G56 B;  2I0T A;  1JTD B;  3JAM g;  4UM8 A;  2G99 A;  3UVK A;  1A0R B;  1YFQ A;  1GXR A;  5M61 A;  5IT9 g;  3FGB A;  4ZN4 A;  5EAP A;  2IUP A;  3SVW D;  5KDO B;  2YNO A;  4A11 B;  4D0K A;  3EQ8 A;  4CI1 A;  3RN1 D;  1OLZ A;  3IUR A;  2B5M A;  3MUO A;  3PXS D;  3AL8 B;  4O45 A;  5TEF A;  2AQ5 A;  1QFM A;  3F3G A;  4OWR A;  5FKQ A;  4QT8 A;  3QI0 A;  3J80 g;  3T3M A;  2O9K A;  2VDK A;  3I7P A;  3O4G A;  4J84 A;  4J8B A;  3ZDY A;  4ZOX A;  3RSE C;  3K27 A;  4UM9 A;  4LG8 A;  3U4Y A;  5GXH A;  2IWF A;  2H6N A;  3GC3 B;  4PC0 A;  1PEV A;  5C9Z B;  3PE7 A;  5C86 A;  4AN0 A;  5M5T A;  4H5J A;  4O9D A;  5I5I A;  1YR2 A;  1VYH C;  4L3G D;  3EG6 A;  3KCI A;  3SLE D;  5HDB A;  4FA4 D;  3C9C A;  4AX4 A;  2P9K C; 
#chains in the Genus database with same CATH homology
 1U4C A;  1NR0 A;  2GC7 A;  3UVM A;  4IMM A;  3I7H A;  1GP2 B;  3PSC B;  4BUJ C;  1NEX B;  3EI3 A;  4PSW B;  3V5W B;  1PBY B;  4BH6 A;  4Y7R A;  3UVN A;  4E5Z A;  1OMW B;  2B5N A;  1SQJ A;  3FRX A;  5IC7 A;  3OW8 A;  5EML B;  3I7K A;  2PM9 A;  1S4U X;  3DM0 A;  2QXV A;  4X61 B;  2YBA A;  4GGA A;  3KRX B;  4E54 A;  3OL2 B;  2IUV A;  2PBI B;  3SN6 B;  3OKT A;  4PNK B;  2UZY B;  4A08 A;  4ERY A;  4ERZ A;  3I7N A;  3F3F A;  4QQE A;  4NSX A;  3MZK A;  4JSX C;  4CY1 A;  1XKS A;  2I0S A;  3MXX A;  4PXW A;  4ERQ A;  4FWW A;  5THA A;  5FQD A;  4EWR A;  3SXT D;  4Y5R D;  5C2V B;  2H9L A;  2PM6 B;  3RFH A;  4GM9 A;  3A0F A;  3PSL A;  3UVL A;  3MKQ A;  3SBP A;  4L3H D;  4FA5 D;  2CO0 C;  4CI2 A;  4O3T B;  4TZ4 A;  2OVP B;  4K3J B;  2J55 H;  5GXI A;  4J81 A;  3I7O A;  4A2M A;  1L0Q A;  5FLX g;  3JZH A;  4FAV D;  2I3T A;  2AH1 A;  2OVQ B;  4CI3 A;  2CN2 A;  2QC5 A;  4GM3 A;  3PXW D;  5CXC A;  3W15 A;  3UKU C;  4A0B B;  3IIY A;  1QNI A;  2XL2 A;  1R5M A;  4U7A A;  2HXC A;  4JXM A;  4A2L A;  2YNP A;  5CXB A;  3K26 A;  5EMJ B;  5A2Q g;  2OVR B;  2GNQ A;  3MKS B;  5EM2 B;  3EU7 A;  5EAM A;  3PXT D;  5K1C C;  3C99 A;  1SHY B;  4X3E A;  4HDJ A;  4YVD A;  4ESG A;  4A09 A;  3JPX A;  2H9P A;  4N14 A;  5IJ7 E;  4QL1 A;  3OKY B;  5TDH B;  2J56 H;  3AFC A;  5GSA A;  4AOW A;  3DXK C;  5HE3 B;  1K32 A;  2Z2N A;  1MDA H;  4ZOY A;  3JZG A;  4K3I D;  4CZY A;  2CE9 A;  1B9X A;  4Z8L A;  4J87 A;  3PVU B;  4X60 B;  3EI4 B;  3ZWL B;  2AGW A;  2YMU A;  3IJ0 A;  1PI6 A;  3CIK B;  3MMY A;  2H13 A;  3NVQ A;  4GQB B;  2B4E A;  4A7J A;  4J82 A;  2GC4 A;  4OZU A;  3C5M A;  3PVW B;  4XYI A;  2H9N A;  3EI1 A;  3EI2 B;  5CYK B;  5HE0 B;  3SJL D;  4XEI C;  4FA1 D;  4CZV A;  1ERJ A;  3J81 g;  4O1Q D;  5EAR A;  3N0E A;  4ES0 A;  4FHL A;  4FAN D;  3JZN A;  4CY3 A;  2AGZ A;  2H9M A;  4JD2 C;  2AH0 A;  3VGZ A;  3RMZ D;  4D6V A;  4A11 A;  4GGC A;  2P9U C;  4GZ8 A;  4J0X A;  2I0R A;  5AJA A;  5EM2 A;  5HE1 B;  4FB1 D;  4J0W A;  5H1M A;  5HYN B;  4J79 A;  4ZOZ A;  2HKM A;  3AL8 A;  1MG3 A;  4ZOV A;  4J86 A;  1JOF A;  4UI9 R;  5JWZ A;  1P22 A;  3KRW B;  2H6K A;  2OK6 A;  3ULE C;  4GGD A;  2P9S C;  3VA6 A;  2AGL A;  3UKR C;  1XIP A;  3BG0 A;  4CC9 A;  2BCJ B;  4H5I A;  2AGY A;  4O3U B;  3RLM D;  3I7L A;  4MK0 B;  4J8G A;  2H14 A;  3BWS A;  3F3P A;  1B9Y A;  3SHF A;  5HQG A;  4CY5 A;  1RI6 A;  2J57 G;  1XHM A;  4J77 A;  3SFZ A;  5FKT A;  3IJC A;  5SXM A;  2P9P C;  2YNN A;  3RN0 D;  3UVO A;  4XYH A;  3AL9 A;  2PM7 B;  1JJU B;  3JB9 L;  5EMM B;  5AFU 3;  3HFQ A;  1N6E A;  3I2N A;  4GMB A;  5IGO A;  2XL3 A;  3EI3 B;  4GM8 A;  5FA5 B;  4E5Z B;  3OL2 A;  2XU7 A;  2CO0 A;  2H3X A;  2PM9 B;  4CI8 A;  3FM0 A;  4E54 B;  3ORV D;  2HJ4 A;  5H14 A;  4AEZ A;  2W18 A;  2AGX A;  4U1E I;  1K8K C;  4A08 B;  2IUR A;  4LGN A;  2Z2P A;  5B4W A;  3IJ1 A;  4GQ2 P;  5H17 A;  5AMS A;  2I3S A;  2CE8 A;  3UR4 A;  3RFG A;  3I89 A;  4GQ1 A;  1U2V C;  4A0A B;  5TEE A;  2P9N C;  4CZX A;  2IUQ A;  3NVX A;  2OIZ A;  5FXY A;  4J78 A;  3NVN A;  2P9I C;  2IAA A;  3IKO A;  3SWS D;  1N6D A;  2HYE A;  3MZL A;  5I5M A;  1N6F A;  2Z2O A;  3E0C A;  3IIW A;  4JT5 C;  5HE2 B;  5EMK B;  3SCY A;  4BL0 A;  5I5J A;  2H47 A;  4JT6 C;  4A0B A;  2BBK H;  3V7D B;  4JSP C;  4L1Q D;  4PSX B;  3OKW A;  1TYQ C;  4PBZ A;  4X63 B;  5CXC B;  2EBS A;  4R7A B;  3JRO A;  5EAL A;  2H6Q A;  3L4O D;  3GFC A;  5IJ8 E;  2MTA H;  2YB8 B;  3B7F A;  3V9F A;  3I8C A;  4FA9 D;  2CNX A;  3SBQ A;  3SMR A;  5CXB B;  2IWK A;  1JMX B;  5TF2 A;  3RRM C;  4JSV C;  5K19 A;  2B5L A;  5IGQ A;  5GMK n;  2P9K C;  2TRC B;  4QRJ A;  3OKY A;  1GG2 B;  4JSN C;  4A09 B;  5C2W B;  4I79 A;  4CY2 A;  1MG2 A;  3DXM C;  2OK4 A;  2G9A A;  1PGU A;  3EI4 A;  1TBG A;  2P9L C;  3OTT A;  2H68 A;  3CFV A;  3EMH A;  4A0A A;  3BG1 A;  2HES X;  2HKR A;  2HJB A;  2Q7Q A;  3N0D A;  2XYI A;  3VH0 A;  3I8E A;  5FKR A;  1JMZ B;  3AH8 B;  4LG9 A;  4PBY A;  1FWX A;  3DWL C;  3JRP A;  3EI2 A;  4L9O A;  5CYK A;  2UZX B;  3C75 H;  3SBR A;  3P4F A;  3GRE A;  4J73 A;  5FKS A;  3DSM A;  4IA9 A;  3EI1 B;  2OJY A;  1Q47 A;  4KFM B;  1SQ9 A;  3EWE A;  1GOT B;  2CN3 A;  3CFS B;  3L4M D;  4G56 B;  2I0T A;  3JAM g;  2G99 A;  3UVK A;  1A0R B;  1YFQ A;  1GXR A;  5IT9 g;  3FGB A;  4ZN4 A;  5EAP A;  2IUP A;  3SVW D;  5KDO B;  2YNO A;  4A11 B;  4D0K A;  4CI1 A;  3RN1 D;  1OLZ A;  2B5M A;  3PXS D;  3AL8 B;  4O45 A;  5TEF A;  2AQ5 A;  3F3G A;  4OWR A;  5FKQ A;  4QT8 A;  3J80 g;  2O9K A;  3I7P A;  4J84 A;  4J8B A;  4ZOX A;  3RSE C;  3K27 A;  3U4Y A;  4LG8 A;  5GXH A;  2IWF A;  2H6N A;  4PC0 A;  1PEV A;  5C9Z B;  3PE7 A;  4H5J A;  4O9D A;  5I5I A;  1VYH C;  4L3G D;  3EG6 A;  3SLE D;  4FA4 D;  3C9C A;  3ODT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...