4JSYA

Structure of clostridium thermocellum polynucleotide kinase bound to gtp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
molecule keywords Metallophosphoesterase
total genus 63
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jsyA00
4D4LA 1JB1A 3IBYA 4ZCIA 2Q0HA 3THYA 1VIAA 2IEYA 1NVWQ 3GQBA 2ZI3A 4I81A 2ONJA 2FU5C 1L2TA 2QAGA 2ZYUX 3HDTA 3CWZA 1YJ5A 4OHZA 1XXHA 5K8TA 1WF3A 2GZAA 3KQNA 2ORWA 4DWJA 1IXRC 1KAGA 4MA4A 4LJAA 4Z8YA 2YV5A 4JLVA 2O8CB 2W2XA 1G3MA 2JLZA 4ACAA 2QT1A 3A4NA 3LA6A 1VMAA 1AA9A 4MDFA 3FHCB 5B2ZA 3V4FA 1VTKA 4W7SA 4PPGA 1N5KA 1KI2A 3DL0A 3LVQE 3LXRA 1P5ZB 1NBME 1G5RA 4CEHB 2J45A 4OK3A 4QGAA 1EFRD 1FZQA 2J0UA 1VG8A 2JJ2A 1XD8A 1U0LA 1TU4A 4WAUA 4LK2A 3IHLA 4Q66C 1WQ1R 4QBGB 1SXJE 4EPXA 3JZMA 1G7CA 3R8CA 5JS8A 3Q8XB 4A8JB 621PA 2GEUA 1I4LD 1Q21A 3C7KA 1DADA 4Q21A 1XCPA 1KSFX 1VG0B 4V0OA 3QXXA 5D3QA 3DZDA 1L8QA 1IN5A 2BBTA 1C4OA 3KXLA 2Q9CA 2WMOB 5FUVA 2CXXA 2FOLA 2OLJA 4BLSA 3ADDA 2HT1A 4RY2A 1TQ6A 3P4YA 3EPKA 2R6FA 3W6OA 5HKKA 4DCUA 5J4KA 4L8GA 1IJEA 1TEXA 4N1AA 2JLWA 3O8BA 1XXHE 1XMVA 4A0GA 2QORA 1P7CA 4CEIB 1QRAA 5FL7D 3LH5A 1R5BA 4M53A 4Q7JB 2PT5A 4MRVA 4N0EA 3W5IA 5J4YA 3GPLA 4CT4B 2PX0A 2RGCA 2XAUA 1X3SA 3D31A 1HTWA 1KI1A 2IX3A 4GNKA 4GSYA 3GJ6A 1W4BA 1T4GA 1ANKA 2WVJA 3ASZA 4KSCA 2IWHA 4D2IA 5DHAA 2QP9X 1KO4A 2ZEJA 5A4JA 2I3BA 5L3QB 3WMGA 4QJ4A 2BJVA 1MV5A 1G9XA 2IS2A 3LBNA 4QHSA 1CJUC 1E2FA 4RKFA 1M7BA 1P2VA 2JJ2D 2NOAA 2IXGA 1S3GA 1WCV1 2QMOA 4DVGA 3BH0A 3SJBA 4A2PA 1W36D 1UFQA 5JWRA 2WKQA 2ZANA 1S1CA 5TARA 4B34A 4B3DA 1OLOA 4HYYA 1R6BX 3V4RA 3K9LA 4YDHB 3EC1A 4UNPA 5FBQB 4B3BA 3KKMA 2CJWB 3KB1A 3TIFA 4LYHA 1AKEA 1GFIA 1QHHB 1R8QA 1XEWX 1TF5A 2DPXA 3C8UA 1OT3A 4IFBA 4RJLA 1SXJA 2RAPA 5FTLA 3ZD7A 4IVRA 4WXRA 2QRZA 4PAQA 4NYMQ 2EVWX 2FFBA 1W36C 2WAXA 5C4GB 2B21A 1JXOA 5F3WB 1Z08A 4M1SA 4CEIA 3U7FB 4Q7MB 1IN6A 2BHRA 3SC3A 1U8AA 2W2TA 3SNHA 4P4SB 4OYHA 1Q3TA 1O3YA 3VR2A 3K53A 3NHAA 1ZNWA 3IQXA 1ZINA 2MMGA 3AVTA 2DWOA 1U0HC 1WA5A 1YZNA 2AHOA 3M6AA 3QEOA 4S2EA 1YZTA 2FN4A 5DIFA 4C0HA 1J90A 1M34E 4JLBA 3LWNA 4JT4A 2QGZA 1XZQA 2GXSA 4LBZA 1GSIA 2YWEA 3DEFA 1PLLA 2V7QA 1M8PA 3P20A 4XVRA 3SEAA 4WIAA 3THYB 1VKJA 4H1UA 2AL7A 1E9EA 3LLMA 1Z6AA 5LPNA 3T1TA 1W0KA 3WNDA 4BFSA 1H8HD 4OQXA 4GZMA 3U3MA 4NDZA 5BW8A 3OE7A 1QG2A 1Z0AA 2ZRDA 4OK6A 3ICQB 4HAVA 3WXMA 5EP1A 1U94A 5AK0A 1WB9A 2BMDA 2C9YA 5D3MB 4TSFD 2VPPA 3I8SA 1KHTA 4TYQA 1N5JA 3L8YA 1A1VA 1GKYA 4NU0A 4IW3B 2O0JA 3ZVMA 1BYUA 2BVNA 2FWRA 2IYZA 1KK1A 1A2BA 1XXHB 1PUIA 2VA8A 2OM2A 1SVMA 3K70B 1W36B 3L0OA 3BERA 3DM5A 1G3UA 4NH0A 4LY6A 2HV8A 2WSSA 2XEXA 5DI3B 5EE1A 1Q1BA 1FL9A 2QQEA 5FTMA 4GP7A 3BS4A 4M21A 1NI3A 4L15A 4ZIRA 1N6HA 2R44A 1E94E 4PANA 1HH4A 5FI1B 5DNYB 1TMKA 1J7KA 4IDOA 4PZLA 4QFMA 2EFHB 3CRRA 1IHUA 3CPHA 2F1RA 1XD2B 2PZFA 2RGXA 4F91B 1IXSB 1Z0JA 2OAQ1 1RKBA 2VL7A 1N6LA 1NN1A 2QA5A 1EX7A 1T5IA 4HB2A 5EZ6B 4DDTA 4JLAA 3Q7QA 1MT0A 2ZI5A 2D2EA 2WWHA 1CIPA 4HDCA 3B8HA 4PHFA 4URUR 4ZDWA 521PA 4BRWA 5KPDA 3NIBA 4JLMA 4D0GA 4MKHA 4C3ZA 5CIQA 4MYUA 1WBBA 1ZW6A 4ON9A 1EGAA 3ZIAA 4JT2A 2ZRHA 4EFMA 4RVCA 4ZDIA 4ZCMA 2OXRA 3TVTA 3UKDA 2PBRA 1EWQA 2HJVA 2NPIA 3E70C 4LCBA 2ZXUA 2ZSDA 3OEHD 3IPYA 2GJ9A 5DGXA 4IDPA 3OESA 3SQXA 3GLFB 4UNQA 1C1YA 1KNXA 1ZYUA 3KKNA 2FPKA 5AJXA 2QPTA 3IPXA 4YC7A 4D0LB 3W8RA 1DAMA 2FFQA 4URXR 2IS6A 4FMCB 4LZZA 1BKDR 4GI7A 2ZRCA 3LRPA 3AVPA 4CIDA 4E09A 1JNYA 4Q00A 4A2WA 3A58B 2DR3A 3ASYA 3MWJA 4LOAA 2N46A 6Q21A 2QM7A 3TAHA 2Z5FA 4TT3A 2FSIA 3KKQA 4KJZA 4E03A 1XEXB 5KHOC 3K70C 3RS3A 5KNCA 1QHHA 2GETA 4KV9A 4YXWD 5AUOB 4KITB 2HYDA 3AUXA 3PUXA 3ZD6A 4JSTA 2GA8A 1E2QA 2GCOA 5FR2A 3VHXA 1MABA 4AG6A 5FOTA 3VR3A 4PFSA 2EYQA 5CLQA 2ZRMA 2Z83A 3FVQA 1R10A 3RSOA 5K8IA 4A2QA 5ELXA 2HCJB 4QGFA 2XB4A 5CJPA 4Q03A 1Z5ZA 4H1VA 1CJKC 4A6XA 4US0R 2XSZA 4P3YA 4NYMR 3EZ9A 2NZ8A 4NYJR 4P33A 2OXCA 4W5WA 2GRJA 4MITA 3BXZA 3DZ8A 1U0JA 5KSPA 4NP6A 4UKDA 1AZSC 2PH1A 1KI7A 2WOJA 1D2NA 2O8FA 4DCVA 2QROA 5A5GA 5J4VA 3F0TA 5JMTA 1M74A 1E0JA 3BD9A 1RC8A 2O8DB 1CXZA 1KMHB 1KO7A 4EAQA 2ZRKA 2J59A 2ZR9A 3QOFA 3V9PA 3ECCA 3B1YA 3R9WA 3VX4A 3W5JA 2GJSA 1G291 2RH5A 3VNUA 2QQ0A 1QDEA 3CRW1 3TSZA 4BE7B 3DDCA 4BEJA 2WAYA 3A8TA 2RGAA 1NBMD 1MOZA 3H4MA 3L82B 2WBLC 4KO8A 1RRCA 1SULA 1JJ7A 4CT5A 2EU8A 4WBSA 3ZH9B 2JLRA 2MSCB 1XRJA 1E1QD 2J0UB 3QENA 1GAJA 1E6CA 4PTLA 1NJGA 1V5WA 3CKLA 1VCNA 4ZDJA 1BO6A 1T3SA 2GVDC 2W0MA 3ZVRA 1T5LA 1OW3B 3W6NA 2VH5R 1TEVA 4G5RA 4D6PA 5L8VA 3REFA 1DELA 3TE6A 2EW1A 1R7RA 1W0KD 4A8JA 3UG7A 4QGHA 1N2CE 1ZU4A 2FJUA 1TPZA 3A4LA 3B1XA 3EA5A 2C04A 2ZRLA 3FKQA 3NDPA 3NH9A 3PUYA 2G9NA 4QC2A 5CK4A 1FTSA 1W4AA 4DDWA 1TF7A 3HU2A 1WXQA 4C2TA 1IN8A 1GITA 3CM0A 4TYYA 2KI5A 4Q4AA 4ZIRB 3TUZC 2B8WA 3I5XA 1KKLA 2R2AA 3NC1C 2HT6A 2H5EA 4HZIA 2BIFA 3PFIA 1OIXA 3MMPA 4LYJA 4ASUA 2HF8A 1T9HA 2ZE7A 3DHWC 4FWTA 1R5OA 2RCNA 2J46A 1EFHA 3K09C 3SYLA 5TXGA 1FQKA 1UM8A 4Q4HB 1BOFA 4XOIA 1E4VA 5JCZA 1CLUA 2ZPTX 2QBYA 2XZOA 1CJMA 2Y8EA 1HYQA 1IXZA 4LHVA 1DS6A 3BB4A 4LYFA 3U3RA 2IEZA 4X8OA 2VHUA 3O47A 2ZR7A 2ERYA 4DSNA 5L3QA 1Z47A 4Y0AA 2C03A 2LKCA 5B64A 1YZLA 4TZ0A 3NG1A 2ATVA 1E2JA 2WTUA 1BIFA 5TDHA 1CBUA 3FMIA 3B2EA 3QKSB 1YZKA 2F1IA 4AKEA 1P9WA 2VF7A 3TBKA 1Z29A 1LS1A 1KMQA 2ZTSA 2QSZA 1NVUQ 2VP2A 4F92B 1EK0A 1GP2A 1S9DA 1N6RA 2CDNA 3MFYA 5E7JA 1PLKA 3RLFA 3TJZA 4M0LA 3TLXA 4WZ6A 2GTPA 4AIIA 4B2LA 1W7AA 1OE0A 3CH4B 3F5FA 2H7VA 2NTYC 1CU1A 1COWA 4LC0A 2H92A 5JRZA 4BFZA 5G53C 3LBIA 3TMKA 2A78A 2D62A 3RRYA 3EPLA 2IXEA 3LW7A 2GJ8A 4C30A 4NKRA 4PPNA 4MYCA 4EJSC 3A37A 4ZCLA 3CRMA 3X1YA 4DXAA 4Z1MD 4QRHA 4EJSB 1XB2A 4WVFA 1BMFD 4I1UA 1JECA 1OYYA 3BJIC 3EZ6A 3B9PA 1GUAA 2R62A 2WKRA 1TF2A 2ZR0A 1II0A 2BCJQ 2ZAMA 5HZKA 3F8TA 3ADKA 4Q19A 5CDFA 4AWXA 5KO2A 2GJKA 1E9AA 1Z07A 4P0TA 4C0QC 5DI3A 2REOA 1X86B 1S2MA 2REXB 1UDWA 3KQUA 3KB2A 5EXTA 3SR0A 3FGNA 3EC2A 3GJ5A 1JPJA 4L9WA 5FL7A 2WJYA 4LYAA 1UBFA 2PJZA 3G82C 3PR1A 3I73A 3QXJA 4NPHA 1G16A 2OZEA 4JLJA 3R9IA 4JZKA 4AC9A 2OILA 1E32A 4FD2A 4JJKA 1VG9B 4IDQA 2FPLA 2VP6A 1M2OB 3A1TA 3QKTA 4ZO4A 4KLNA 1FQJA 2XZPA 1E9CA 3EASA 3AVVA 5DSZA 2CVFA 3SJCA 3GLGE 1RFLA 1KJWA 1UADA 4AYWA 1N3BA 2YVUA 5JECA 2AD5A 2FH5B 2A7QA 2MSEB 2WIAA 2ZITA 3BFKA 1RYHA 3U3KA 4TQAA 1M7GA 2O0KA 3LQQA 4TL6A 3KX2A 3AQ4A 1Z22A 3W3AA 1LV7A 4FWIB 4AD8A 4DJTA 1X8JA 1KY3A 2JIZD 4UNNA 2D4HA 1GRQA 2JLUA 1E2KA 3AEZA 3VR1A 1PV4A 5JEEA 1E2IA 2G88A 5FH9A 3EAQA 3K09A 2FG5A 2A2ZA 2VSFA 3MCAA 1GIAA 3CH5A 4GOKA 5TV2A 4G5GA 1EXMA 3PJRA 1P61B 3NXSA 2BM1A 2OCAA 2HF9A 2QZ4A 5E7MA 3O8CA 1IN7A 1GWNA 1P9NA 2A5JA 5L3VA 3RRZA 4BLPA 3TVDA 3RRMA 5LD2C 3JVUA 2D06A 2KE5A 4IVPA 3R8FA 3AVQA 2PCLA 5B58C 4HAXA 2ZUBA 2WJIA 2AN9A 2YWGA 1FP7A 1LW7A 1F48A 1SKYB 1OKKA 3FFBA 4UXIA 5GJBA 4LJ8A 1G3QA 1E3MA 3FWYA 4FIDA 3FB4A 3GFOA 4MYTA 1ZUHA 1T8TA 1XMIA 4TMWA 1XTRA 3AP3A 3WMEA 2IL1A 3IILA 1YR9A 2IF0A 1Z0IA 2QP3A 4HZUA 3B78A 3GLHB 1LY1A 2J7KA 3IHWA 3T5GA 5CIWA 3IIJA 3B13B 1G7SA 2C96A 4QJ5A 2XZLA 4A82A 2V54A 5CB6A 4TTRA 1JAIA 4O2LA 3P4XA 3ZS8A 3GLGA 721PA 1HA3A 2QGNA 4IOLA 4IEIA 3CO5A 1CKEA 1RRFA 1ZC3A 4R7ZA 4BWYA 3ZVNA 1Z6GA 2C99A 2DB3A 1KSGA 1OH6A 2R8RA 2O52A 1XF9A 2BV3A 2G0TA 1IY2A 1VIYA 1AS0A 4LJ5A 1D2MA 4R9UC 1XD9A 1FPMA 1AGPA 3FOZA 3K0AA 3SS8A 1NY5A 1IBRA 1KGDA 1FMJA 2BC9A 2ANBA 4JLNA 5P21A 4PQFA 4PO8A 3A1UA 2GXAA 2DFKB 2X19A 4KBFA 4MGIR 2JLVA 4E07A 2JIZA 3EZ7A 1HEIA 3ZZTA 2AK2A 1EWRA 1P9RA 4DIEA 2R65A 2O0HA 4XJXA 1Y63A 5IK2D 2AK3A 3WP0A 2J9RA 3THXB 1A5TA 1M7HA 3Q5DA 1ZNXA 4PQYA 5FPYA 3TW4A 5KYKA 2CNWD 1ONBA 4X8MA 1OXSC 1P2SA 4ZI2A 1J8MF 3I62A 3KQLA 2RKOA 2IYQA 4HLUA 5H70A 5FTJA 3AKCA 4LBYA 3D3QA 4FCTA 4LHWA 1XJQA 2NZJA 3U5ZB 3DOFA 4XTRA 2Q6TA 5C2JB 1JAHA 2W2VA 3IBGA 4OI0A 2RGGA 3W34A 4MYHA 2QE7D 3KJIA 4KSBA 1DAFA 2EFGA 4GOXA 2J41A 2GEDA 3ZS9A 1KZ7B 1E2PA 2L0XA 4LV6A 1VCIA 2O5VA 1UBCA 3MWLA 4PSVA 5EUQB 3BB1A 2FEOA 2YOFA 3A1VA 4OQMA 3AV0B 4Q5IA 2QTVB 3GJ0A 5CYPA 1JBKA 1VYUA 1TUIA 4MRPA 4BFWA 2GNOA 4TT3D 821PA 5H8WA 4XVUA 3CRVA 1YQTA 3AKYA 2MSDB 4QM6A 1G20E 1AZTA 1US8A 1KI4A 2AXNA 4URZR 3SHWA 2OEPA 2AKYA 3GJ7A 4MQBA 4HLDA 4DBLC 3UWKA 1OXUA 1F2UB 3NEJA 4OJKA 3SQWA 4WA7A 1NJFA 4JKYA 2BJWA 4LDJA 1KO1A 3AF2A 3HYTA 1G8GA 1TNDA 3DMNA 3TR0A 2ZM5A 2XXAA 4AI6A 1I2DA 2VLIA 1YR8A 4V03A 3ZZUA 4ZI3A 4ARZA 3LDAA 3ADCA 1FFHA 2C2HA 1W5TA 2GF9A 1NVVR 1X6VA 2HUPA 3AH8A 5SZJA 2G77B 2G3YA 1G21E 2CBZA 4RD3A 5IHPA 1DOAA 5BN5A 1MKYA 1HV8A 2VSOA 2SHKA 5JHHB 4Y0VA 2WPDD 1NIPA 3SJAA 1CR1A 2JJ1D 1OKKD 2V3CC 3Q85A 4A0RA 4PPFA 1OXVA 3GJ4A 2VHCA 2GK7A 1TU3A 1G5TA 4Z51A 4OHVA 1D5CA 3A6PC 1CR4A 1QG4A 1KTVA 2YC4C 3LX5A 2ZSFA 4QGGA 2Z4SA 1E79A 5JBQA 4D4KA 3I4LA 4L16A 3RWOA 2TMKA 2F3RA 1MO3A 1ZD8A 2O8CA 2KBEA 4KFRA 3H84A 2BM0A 2P5TB 2QBYB 1GZSA 1HE8B 2QUZA 1SKYE 2QT0A 4I4LA 4CF7A 2H1LA 1GTVA 3AF4A 3SN6A 2PEZA 2GAOA 5DYIA 2OBNA 1YE8A 1E2GA 2YOGA 3C41J 3NBFA 4JMPA 3OIWA 2ATXA 4M1OA 2W6ID 4Q4JA 5LBIA 4Q7KA 3C5CA 4MRRA 1U9IA 4W5JA 3GLHA 2BBSA 3AP1A 3DVLA 1D6JA 1ZM2A 3KJEA 4M1KA 2RGBA 4HB4A 1UDXA 1KY2A 3ONWA 1OH7A 1W46A 1E2NA 3SZRA 1C9KA 5G40A 3RS2A 3SJZA 3MSXA 3P32A 3ZYCA 2O8BB 3AUYA 2EWVA 3DKPA 2DFLA 3NC0C 3RSLA 1UBGA 4DLUA 4PC3A 1N0WA 5EXPA 3VKGA 4I99A 4NTZA 3CB4A 4DKXA 2W6IA 2PZEA 4V0NA 2A5FA 2ZS8A 4JS0A 3GD7A 4DCSA 3AVUA 4MKGA 2PJRA 4RD4A 5CB8A 1U81A 3BH7A 2LKDA 4JL5A 3O8DA 5FUYA 1N0UA 5B57C 4N0DA 2G6BA 4YMVA 1G41A 1NKTA 3U44A 1N25A 1Z6XA 5CJ2A 1TUEA 3Q72A 4ACBA 3L0PA 5KSOA 1Y3AA 4KLZA 2ASEA 4B3XA 3IUYA 2FFAA 2F3TA 2P65A 2PT7A 421PA 3RRNA 1ZUNB 3K0SA 1VCOA 4DEXA 3BRWD 4RFSA 2OFOA 4IOJA 4DB2A 2VO1A 3TRFA 2VRWA 3S1AA 1R2QA 1G8PA 3SBEA 1F2TA 1OYWA 1KZGB 1ZMXA 2IYRA 4J0QA 1N6OA 5HE8A 2CEAA 3THXA 1Q57A 3UXMA 2HLDA 2XNSA 1ZCBA 4R2HA 4RD1A 4KFSA 1TQDA 3CPJB 1G8YA 3QSYA 5KOYA 4LI0A 4AG5A 1Q1ZA 1S96A 1KK0A 3JZAA 1XDBA 4A36A 1E9RA 1R5NA 1U8ZA 1RIFA 5UKDA 4B71A 4PXAA 2AWNA 3EX7C 2D2FA 1GRRA 4KBGA 3P1JA 4IRUB 2W6JD 1E98A 3AVYA 5GJWC 3CBQA 1OPXA 4O0MA 2WOOA 2JDID 5TVKA 2VTKA 3PG5A 4A9AA 2ZI4A 5EQTA 1K5DA 2CE7A 3QPUA 1AS3A 2NGRA 3RAPR 1FX0A 2F43B 4C0BA 4V02A 4YMTA 1I2MA 1EX6A 4LX0A 3GLIB 1DARA 5JRJA 4M9SA 1QF9A 3WBKA 3MWYW 3U44B 4ILEA 2ZJZA 2F1JA 3AVWA 3CZQA 4URYR 2PMKA 5DO9A 4DT1A 1U2RA 2OCPA 1MR3F 3K0CC 1AQYA 2P67A 1XP8A 3OIYA 3QKRA 1N5LA 3OFND 2ZVPX 1MRSA 5AJZA 2YC2C 1AN0A 2JASA 2A9KA 1KDRA 3GCGA 3ND8A 4C4PA 3D6TB 2GKSA 5D3MA 2VQSA 5KPJA 1R0WA 1E0AA 5CM8B 1HQYE 2X1VA 1U8YA 3TUIC 3CRQA 4M9QA 3CR8A 1NN0A 3AF0A 2XXAB 1L4YA 3FHOA 4RFVA 3C5HA 4CEJB 1XJCA 1PZNA 2V9PA 4ZKDA 5J4LA 5FPTA 4IFEA 3H0KA 3SE0A 1G64A 1TAGA 4JLDA 3KKPA 2C78A 4L5BA 1S4QA 5JWHA 2IT1A 2PZGA 1ESNA 3CX8A 3B1VA 4TL9A 5DHFA 5G3YA 2D74A 2KB0A 3HJNA 4LSGA 5FBLB 5DI9A 4HLQB 3CX7A 4FMCF 4BLQA 1G8HA 4F4IA 1DEKA 1IN4A 2ZRFA 3R20A 4HAUA 1WP9A 1ZBDA 2CJWA 4QXAA 3KJGA 4B48A 121PA 3F3YA 2YKGA 2GZHA 2WKPA 3WYGA 1DAHA 2A5DA 1IM2A 2ZJ8A 4AKIA 2X2FA 4B47A 2IBMA 2CE2X 1OH8A 1SVIA 2JEOA 4LHZA 3A1SA 3QY0A 4QM7A 3OZXA 1NSTA 5GJVC 4F4CA 1ESMA 5AUNB 1IONA 4HI0E 1X1RA 5GADl 1E1QA 3G5UA 2YWHA 3U7GA 1T0HB 2C8VA 2WWFA 3SFZA 2V1UA 2E1RA 3P26A 1JXMA 2YOHA 3KJHA 1XTJA 4Q4LA 4DB4A 4FW9A 1N6PA 5C4MA 2B92A 2V7QD 4MRNA 4DUGA 5H1YA 3ADBA 4G5QA 4GL2A 4W5HA 4PR0A 1E0KA 2B6HA 2EYUA 3PCRB 3QVVA 2D7CA 3M0EA 2D3WA 3AF1A 4B76A 4JJZA 1KSJA 3TUJC 2BEJA 3VMFA 2FX3A 1W2GA 1E2MA 2EQBA 2CLSA 3LO5A 4HUQA 4JBYA 1OF1A 5EP4A 4DCNA 5KUTA 4A0HA 3RS5A 4C0LA 3ZLJA 4W9MC 2CLDX 3FYHA 1KJZA 1E9FA 1W4RA 4E5UA 2W6JA 3KUCA 4XVQA 2GXQA 4DLVA 4C7OB 5JI3E 3AB3A 4K81B 1Z06A 4Q1FA 3UWOA 3VU9A 1UEIA 1F3OA 1E69A 3MJRA 1YZUA 1SXJD 4FMDF 2J5XA 3GEHA 2QRNA 4B3FX 3MG9A 1AK2A 3HP1A 2ORVA 3QVUA 4D4JA 5CM9C 1KI6B 3NTUA 3QKUA 1GDDA 1XNJA 4I1OA 4O2RA 5E3HA 4PSAA 5F9HA 1NP6A 4WW0A 2EFDB 1M1YE 1R0YA 5C46F 5HCIA 1XJ0A 4F7WA 3EG5A 2PX3A 5IK2A 2V4ZA 2J7PA 1QVAA 4OJQA 2WWWA 2AKAB 5FUXA 5J40A 2Z43A 4TQUS 4JL8A 2ZE8A 1E9DA 3T1OA 4RZ2A 5LDDC 3QPWA 5FUWA 2WWXA 4L4UA 1JR3A 3ZGXA 1JEDA 1P4SA 2ZS7A 1KOFA 4CZ2A 1R4AA 1SXJC 3ETLA 3U3OA 3QXHA 3BH6A 1ETUA 5LD2B 3A36A 2CCKA 3KXKA 2WJVA 1DAIA 1GRNA 1R0ZA 2IYYA 3L0IB 4JYBA 4TLDA 1Q12A 5KU1A 1XTQA 2FFHA 2ORIA 1E2DA 4B2IA 3OIVA 3DMDA 3QBVA 3W8NA 2C9CA 4LWZA 3SBDA 4U00A 4ZKEA 2B7BA 4URVR 1XPRA 2VIIA 5EE0A 4Q9KA 4K46A 5DISB 3QUSA 3AGQA 2ONKA 3TW8B 1X8KA 3K1JA 3RHFA 1YZQA 4OI4A 3TKLA 2ZI6A 2QTHA 4Q02A 2PEYA 2FE4A 2JGNA 2WWIA 1QHIA 2OO7A 1NBMA 2CL6X 2RMKA 4LBWA 1OHHD 2ZETA 3G0HA 3WBJA 4C2UA 1H8EA 2G83A 4TYNA 2WJHA 3BC1A 1X8LA 4PSKA 4XD7D 4DLWA 4ERNA 3RS7A 5GVRA 1ELOA 1GL7A 1OIWA 3LNCA 2RB4A 1F60A 1ZM7A 2O8BA 2VEDA 3NVAA 2BBWA 1US8B 3NKVA 1NN5A 1P3JA 4OHWA 4BLRA 3U6BA 1DVRA 4B43A 3MGCA 3E1SA 3OF5A 1RVDA 2QI9C 2FMXA 1F2UA 3NBYC 1G4UR 4NYIR 2QY9A 2WICA 4DT1B 5HE9A 5AUQA 2ZRNA 1JR3E 1ZD1A 3RYTC 4D25A 4LV8B 2J0SA 2IHYA 2A30A 4FN5A 1OH5A 3TR5A 4M2LA 4YMUA 3W9YA 2JJ1A 4U5XA 5JSZB 4RZXA 3NBZC 3PXGA 1P72A 3IO5A 4HB0A 2Z4RA 1COWD 3LXXA 4JKIA 4NCHA 5FPSA 4RZUA 4OI1A 1XFAA 1KDTA 3X1XA 4XH9B 4G3XA 1YVDA 1ZU5A 4P4TA 1SVWA 2BMFA 4PQRA 1AJEA 5CK5A 5JJKA 3DPUA 4Q48A 2KJQA 1XPOA 1RJ9B 4TLAA 4OL0A 3VNVA 3UANA 1SVKA 4Q1EA 5JI2E 4NCKA 1Z0DA 3QNUA 2W0SA 2PLRA 3LLUA 5FTKA 1J70A 1XEXA 3PITA 2DBYA 2ZE6A 4EPTA 2OT3B 2IA5A 1XPUA 4XWKA 1LNZA 3K9GA 1M6NA 2IHBA 1SGWA 4B32A 3IKJA 3X1WA 3RDPA 4C0KA 4LHYA 2VBCA 4HZUB 2G0NA 2WHXA 2IYVA 1YRAA 3CPEA 4FXPA 4LJYA 2J7PD 4TTQA 3IEVA 1XX6A 2BCGY 5HZHA 3VR4A 2VYFA 1XBTA 1TX4B 3UG6A 4TMTA 4C0JA 1LVGA 3BOSA 4PPQA 1RE0A 1FP6A 5FOSA 2MMCA 5EP3A 5EZ5A 3E5HA 3VKHA 1VDZA 2P6NA 1JPNA 3WYFA 5M04A 4QHTA 4Z54A 3U60B 4EQ6A 1BYIA 2ZUCA 1N0VC 3SFVA 4DUGD 1KI8A 1XMSA 4CDGA 4E22A 2XTMA 2WSMA 3VAAA 3IO3A 2FV8A 2B8TA 3B6EA 4M1YA 5JCPA 1B23P 1BMFA 3VU9B 1EFRA 3U3JA 2XJ4A 1ZNYA 1HE1C 3IGFA 4JIMA 3BE4A 2IUTA 1NL3A 1J8YF 4A4DA 3KKOA 2PL3A 3MD0A 1D8TA 1FOEB 2Q3MA 4EPWA 3SOPA 3CZPA 3GFTA 3KUDA 4QOSA 3LAWA 4URWR 4EDHA 4JBWA 2HCBA 2R9VA 3RVBA 2DCUA 1XEWY 2FGKA 1L7VC 3GEIA 3THWA 4CEHA 2C9OA 4EFLA 4DC9A 3OE7D 1JR6A 5BXQC 3QF4B 4JBXA 1HQCA 1GG2A 4G01B 5JLJA 5EXXA 4A92A 2QE7A 4MDEA 1G18A 4IXMA 1UJ2A 3SU8A 2PCJA 2ZRAA 4BRUA 1G7RA 3RC8A 4KHZA 2FA9A 5DN6D 5L3RA 4OQFA 2ZRJA 4QBIA 4BUJA 4Q1BA 3RS4A 1KAOA 2C5LA 4IKEA 2DWQA 2W58A 2JA1A 3BFXA 2PMDA 4POAA 4BEBA 3BIFA 4JL6A 3UATA 5CITA 4MH0R 1CTQA 1RYFA 2VHJA 1PVOA 3EPHA 1W49A 3QG1A 5SZHB 1FW6A 4D0NA 1U99A 3KZ1E 2WM9B 2ZRPA 4KFUA 5JWOA 1CF4A 4OQLA 4JLOA 4MUBA 5BN3A 4BFVA 1KNQA 1NG1A 3U7HB 1ZCAA 4QNMA 3Q9LA 4DCTA 2KWIA 2IF2A 2CCJA 4TN1A 3ND9A 4B75A 2GWHA 3ZVLA 2G1KA 1BH2A 4R71A 4HDOB 1FUUA 4JVLA 2P6RA 5J5CA 2HYIC 1F5NA 2JLYA 2ZI9A 1TTTA 2QN6A 1MRNA 2F55A 4EUNA 4C0AC 4PHHA 1UKEA 5K8UA 4LHXA 2IK8A 2QM8A 4TMVA 3TH5A 4EKDA 2N1BA 1T0JB 3W90A 5KDOA 1DE0A 4OK5A 2AD1A 2NO1A 1VHLA 3MJHA 4DLZA 2GJAA 5AJYA 1QHGA 2P5SA 3WHLA 4KVGA 1QVRA 4S35A 2H18A 2NO0A 5AR1A 4A1FA 1NIJA 1XEFA 4BZPA 3X2SA 2ZSEA 2QNRA 3RWMB 4AYXA 4F93B 1Z6TA 1N6IA 3CW2A 4EJSA 2CK3D 4LJ7A 2GZDA 2QPAA 3MUFA 4PC6A 5E4FA 2GXUA 1N5IA 2HDNB 3MLEA 2NO9A 3QKRB 2AX4A 4Q9JA 2HJGA 3QBTA 4QG7A 5JJLA 4WZBE 3CNOA 4KYIB 2ODEA 3OEHA 2OV2A 3CNLA 1G7TA 5JFGA 5JEDA 1UEJA 3WNBA 3DO6A 2VP4A 1JALA 3DKVA 4EQ6B 1EFUA 4PAMA 2OUKA 1QHXA 2XSZD 3T12A 4BGDA 1T3LA 1E1RA 1G8FA 3SDZA 3K9HA 4HLCA 3VR5A 3V00A 4HB3A 4DDUA 5HR5A 5BYJA 3A4MA 4HAWA 4IDHA 4P31A 3HU3A 1QBKC 2QEQA 3WP1B 2IS4A 1L4UA 2ZREA 5F98A 4MUAA 4KU4A 2LWIA 3KFXA 4EFNA 3CIOA 3LFUA 4BECA 2A5YB 3I3SR 1XMJA 3WY9A 4KYUA 4NYJQ 2DFNA 3W6PA 2B7CA 4TMZA 4NCIA 1S0UA 1OIVA 5G3ZA 3PV0A 3MAAC 4A15A 4R98A 3EZ2A 2DYKA 1RPZA 1KJYA 2EWWA 4GMDA 2QTFA 2A3RA 4QL3A 2XNDA 5FOWA 1OSNA 5KDDA 4UXJA 5DYGA 5BWMA 2OHFA 2CLCX 5E7IA 2XOKA 4LUCA 2RHDA 2ZS9A 1A7JA 3THOA 5KSYA 4OHXA 3B9QA 3AKDA 5EE3A 2YZ2A 5IRCD 3EWAA 1ZP6A 1EFTA 1NMZA 2ZE5A 4I1SA 3T06B 3RNLA 4XWAA 5KDLA 4X8HA 1NKSA 2V55B 1DAEA 3R7WA 4XWOA 2XX3A 5J47A 1VPLA 2RHMA 3GFPA 3Q7PA 5EE9A 1P60A 2V6JA 1S3SA 3GJ8A 1RJ9A 2IW3A 2J1LA 1SVSA 4GOJA 1SQ5A 2DFTA 4M1WA 2XTZA 4MRSA 4PX9A 1Z0FA 1VCMA 1NLYA 1IQPA 1Z2CA 2V6IA 3I8XA 2QSYA 2REBA 3K70D 3D8BA 3X1DA 3AM1A 1QZXA 2OBMA 2OG2A 1RW4A 1G6HA 2VP9A 4G0NA 1G1MA 4V0MA 1IY1A 4V0ME 4Q9HA 4LV5B 2ZJOA 1W48A 4B3CA 3CNNA 1FX0B 2OFWA 2OSBA 2GCPA 4P32A 3EZFA 2KSQA 3PUVA 1W4CA 1QHSA 4EPYA 5EUMA 2CHQA 4CW7A 2CHGA 3QPVA 4LC1A 4XIGS 5JJIA 3U7EB 3N2EA 3LVRE 4U02A 3OFNA 3DM9B 3L2OB 1DAGA 3CF0A 5FOXA 3GP8A 1NMXA 2IS1A 2P0EA 4ITRC 4M22A 1WRBA 1N6NA 1RRPA 4PO1A 2EFEB 4CRWB 2N42A 4NCJA 2FSGA 4AK9A 5JS7A 3WRXC 1I4DD 3PUWA 3HWSA 4LPSA 3FKSA 4YQFA 3NWJA 1D9ZA 4PZZA 3VR6A 5DLQC 2Q3HA 2JCSA 2BKUA 3BFVA 4GZLA 5TB5A 2C98A 1G3RA 2FSHA 2QMHA 4Q01A 1W44A 2H17A 3AP2A 3C4JA 4P4SA 4GFDA 1G4AE 4BFXA 3HPQA 1DO2A 2R6DA 2RGEA 1PJRA 1UPTA 4TWZA 4QBHA 5GJCA 2NG1A 5GVSA 2H16A 3GLIA 2NQ2C 5F2EA 1DG1G 1KDPA 1QHNA 4FMBB 4TMKA 4G5SA 2WIBA 4B35A 1LF5A 3KL4A 3BAFA 4UNSA 1YU9A 2IYWA 1NVXQ 2GF0A 2XGJA 2ZYWX 5JSZA 3BB3A 2NMVA 1ZAKA 4QHYA 3QQ5A 2O8EA 1WDTA 1ZJ6A 2ANCA 1PLJA 3L8ZA 4RD0A 1XTSA 4EIWA 3Q3JB 3AF3A 1J2JA 4KAXA 2OLKA 3RC3A 1DBSA 1CRPA 4OKSA 2WZQA 2CCGA 1KSHA 1GILA 1D9XA 221PA 2QU8A 4GMXA 5SZIA 1CJVC 2HEIA 4DIDA 1AKYA 1HY3A 2OAP1 5KSZA 1NNEA 1CR2A 3REGA 1AIPA 1LS6A 4MKFA 1F2TB 3OEED 2WJJA 2BDTA 1S8FA 5JHGB 1J99A 1G5PA 1N6KA 2FEMA 3FKSD 4N3NA 5CYOA 1GM5A 5DN6A 4B6EA 1FNNA 4HSEA 4US2R 3EARA 1OFIA 3LY5A 3X1ZA 4TLCA 2YNMA 1IY0A 4G5OA 3EA0A 1GL9B 2IUUA 5AJWA 4DLRA 5KTYA 4TZ6A 5AWFC 1P6XA 3UMSA 4LJ6A 5CLLA 1QHYA 1FMLA 3J81k 2ZYVX 4KVAA 1II8B 5FBWB 1JR3D 4B73A 3BORA 4TQ9A 3PIRA 4FI3C 2IUSA 4JLKA 4YXWA 3GEEA 1HUQA 3CF6R 3M1IA 4HEJA 4DLSA 4Q4JB 1E1RD 3ZZ0A 2ZRIA 3E2IA 3WHKA 4TL7A 2W83A 4FCVA 1UKVY 1XU4A 4PO9A 2NO6A 1GNQA 3GLIE 2AFHE 3B60A 2H57A 2YINC 1W1WA 4KFTA 3KTAB 4LGMA 3U4QB 1U98A 1NMYA 1Q1QA 2YJTD 2JDIA 3EIEA 3GMTA 1YR6A 1VECA 2OCYC 5IDVA 3NHBA 4PHGA 2Z6VA 1G3IA 1F6BA 2E87A 3ICEA 3GJ3A 1Q44A 2RGDA 2ZQ5A 3K0EA 3RABA 2VHTA 2ZAOA 4YDSA 3K0FA 4FMDB 1CRQA 1GOTA 1P2UA 5L3SA 2J0VA 4B2PA 4B3GA 4IHQA 4M9ZA 1AQUA 1Z28A 3C15C 3RANA 3ZIAD 3OHMA 1XZPA 2FSFA 5DH9A 1LFDB 4MGYR 4OI2A 2WPDA 3CLVA 4RKEA 3EXAA 4UQOA 4KODA 4A8JC 1P75A 2Q9AA 3B85A 4Q4AB 3SI7A 1Q3HA 2BMJA 3FPAA 2C77A 3QF4A 1CULC 3QIAA 5ANRB 3I32A 4GT1A 3TNFA 1EESA 1Z8FA 2IYUA 2ZSAA 1KK2A 1LTQA 3LV8A 2Q21A 4AYTA 3TQCA 2V1XA 1FNMA 4RFSB 3L0SA 5FPHA 4A6PA 2QAJA 4Q1CA 4D4MA 3TGPA 1IJFA 2GDJA 2R6CA 3BGWA 4FINA 4F4JA 1TADA 4HUQB 3H1TA 1R0XA 2HXSA 5EE5B 3T61A 1E4YA 3UMRA 5HPYB 4CEJA 1A82A 1NSFA 3U4QA 2VHQA 4Q4HA 1XD2A 4NZYA 4DLXA 3M4YA 4IOMA 2O8DA 2FPMA 4BASA 2FZ4A 4CVNA 2WMNB 4JYCA 2VSXA 1MH1A 1VYVA 3LX8A 1NLFA 3H2YA 1YKSA 4B44A 4DSTA 4HUTA 2P6UA 5G41A 5F9FA 3D7MA 1CJTC 5KNBA 4ABYA 3TAUA 1OFHA 2GBLA 2IYLD 3QG5A 1LB1B 1JEEA 1OV4A 3WNCA 1KMHA 2BOVA 1E96A 3DOEA 3FMOB 3OEEA 1U90A 5FOVA 4B74A 4D81A 1SVOA 3KXIA 1K5GA 3NH6A 1UKYA 1T8UA 1V43A 4PC1A 1ZM4A 1MO6A 4BPBA 2ZJAA 3TK1A 2CNWA 4G1UC 2NIPA 1NF3A 4D26A 4BFYA 1WMSA 4NE2A 4QJ3A 2ZVQX 1ZM3A 4II7A 1P2TA 3FDIA 4TMXA 4QKQA 4CGZA 3QE0A 3PENA 4F38A 4RCZA 2IWRA 2FNAA 4D80A 5BYKA 3PVSA 1XWIA 4HAZA 4XD7A 1ZNZA 5FTNA 1XTIA 4HATA 1KI3A 3QF7A 4NBSA 2BKEA 4YMWA 1X1SA 3TQFA 5KNDA 3PQCA 1Q20A 2NO7A 2ODWA 5IT5A 2RGNA 3Q5EA 4ESVA 1DG3A 2FF7A 2O8EB 4LJ9A 1TL7C 1YRBA 4KI0A 2RGNC 4TYPA 4JLPA 2W00A 1OFUX 1HT2E 3CWQA 3NDBB 2XOKD 4H9GA 2QP4A 2GCNA 2HXYA 2YHSA 1H8HA 1G19A 2AFIE 3T1VA 3GLFE 2KBFA 1OB2A 1KO8A 4Q47A 2FDCA 2YYZA 2J3EA 2ZRGA 2H8KA 3AVOA 2F43A 4M1MA 2F9MA 1NN3A 2C95A 2VF8A 5CDFE 3JVVA 3MRSA 2G1JA 4IJMA 4RSGA 5EJEA 4GDFA 1KI9A 3ZJYA 4RD2A 2F7SA 3HU1A 5FBVB 3K8YA 1UF9A 2VP0A 5A0FA 4BZQA 3KDSE 1E9BA 4OBEA 2LCFA 5EP2A 1YHNA 3UMFA 2QMUA 5FPKA 2ZYTX 4XTCS 1UKZA 4WOPA 4UJ5A 1Z63A 4DLTA 2GESA 4C7OA 1IAQA 3VX3A 3CR7A 4US1R 2GBLC 1Z0KA 3BK7A 2UKDA 1GKUB 2AWOA 4M8NE 3EIHA 2NPFA 1S9HA 1NLZA 4Q9LA 4KXFB 4FCWA 5K8LA 2IYXA 4K8OA 3OAAD 4PHTA 1E2LA 1ZIOA 2E9SA 1GKIA 1FUKA 2JATA 1W0JD 3W3ZB 1NVVQ 1B0UA 4P4UA 2IYSA 3N5CA 1P62B 1TQ4A 2OBLA 3IEUA 3QI2A 4X8LA 4XSHA 3T1QA 1OFTA 3WRYC 1W0JA 2DHRA 2ZU0C 1JI0A 3IQWA 1CR0A 4NHOA 3AGPA 3FHTA 3PEYA 4ZDKA 2XB2A 4YLGA 1DPFA 1WE2A 1A2KC 4IVQA 2OCBA 1IOZA 5C18A 2WWYA 1Q1EA 2EFCB 1Z6YA 1CP2A 1DO0A 3AKEA 4UXHA 3SHFA 4CYMA 1VYTA 4WZAE 3EPJA 4B33A 4DZZA 5TY0A 2R6AA 1P73A 1ODFA 2GK6A 4JVMA 4NL4H 1H8ED 3RS0A 1R8SA 4DHEA 1OHHA 2J87A 3PEUA 4IOKA 2UVQA 1SHZA 1MO4A 2CMKA 3K0FB 2CHVA 2QENA 1ZVQA 3PEWA 2ZIAA 4TTPA 1KI6A 2P3SA 4JSYA 1CEEA 1II9A 2ZJ2A 2UZIR 1GNPA 3GLGB 4AKHA 3R7WB 4PZYA 4C0SA 2OFXA 2PLFA 5IF9A 2QPOA 3KTAA 1JJVA 1KYIA 1ZRHA 2P2LA 2QL6A 5HCNA 3BWDD 1ZM9A 3FE2A 3KQKA 2D7DA 1SXJB 4JVNA 5AJVB 1GL6A 3IIKA 1UBEA 5FR1A 3WMFA 4O3MA 5FL3A 2IC5A 1TQ2A 1E0SA 2JJ8A 3VKWA 4GPTA 1E79D 1EFCA 1W5SA 4BLTA 2BMEA 4DRZA 5BN4A 4DSOA 5E95A 2J0QA 1E2HA 1PUJA 2ZJYA 3ZQ6A 1Z2AA 4RD6A 1G6OA 4RCYA 3VTKA 1KKMA 3QKSA 4GRAA 4JVSB 3A1WA 1AS2A 2ZRBA 3I72A 1Q0UA 4LJ4A 2JLQA 4I1VA 1ZD9A 4R2IA 1H65A 3B7GA 1II8A 4ASUD 4EPVA 3GLFA 3NBXX 3GLHE 3CONA 1O87A 4BLOA 5C1BA 4PC2A 1Z83A 3FTQA 4YONB 2XJ9A 3TSOA 1YZGA 3QJYA 2V8OA 2I1VB 3U61B 4A0FA 2ZROA 4OHYA 4GBMA 2JAQA 1AGRA 1T91A 4YMSA 4Q1DA 2K5UA 4TLEA 4V0KA 4KCGA 3PEVA 1E2EA 2R6GA 4B6FA 1U9IC 5HTKA 4AURA 3K0AB 1WBDA 3KQHA 3PUZA 3I5YA 2DWPA 1ZC4A 3C14C 4Z8XA 4EPRA 1OB5A 1NG9A 1W47A 2ZU6A 4HAYA 2GAAA 1Q22A 4MKIA 2GCOB 2ODNA 3CUEF 4LPKA 3QXSA 3UK6A 3U2QA 1NY6A 2FGJA 2XITA 1VG1A 2X2EA 3EWSA 1XCGB 2I4IA 4WXPA 4BFTA 2ZJ5A 3LW8A 2IXFA 2BBOA 1SVLA 2Q9BA 4O25A 2JLSA 3LBHA 3K0CA 4XSGA 4RZ3A 1D2EA 2YWFA 2OESA 4AY2A 4ZPXA 3B1ZA 1ZUIA 4HDQB 4TL8A 4UNRA 1UAAA 4L9SA 1OXXK 1W2HA 2WV9A 2WWGA 3LQRA 1JQJC 1RRGA 8OHMA 4V0LA 3FMPB 2AXPA 4QNRA 5J4HA 3HR8A 3HYRA 2O8FB 2IYTA 3L43A 5HKKD 4MGZR 2ZUDA 3R9XA 4NMMA 3QEJA 4NCNA 5AUPB 1KK3A 1ZIPA 2F9LA 2A5GA 1OJLA 5LB2A 3U6KA 1SZPA 3GJXC 3UPUA 2VP5A 4ARZB 2ODBA 2F6RA 3C16C 3FFAA 4DSUA 3SYKA 3T15A 3CX6A 2ZSBA 3B82A 3I1FA 3THWB 1KIMA 4TYWA 1K8RA 1CS4C 3OAAA 3EIQA 1KDOA 2QAGB 2ZI7A 2F1HA 4DDVA 3HPRA 1FTNA 3P27A 2CK3A 2X77A 2GVZC 2ZJBA 1SHKA 4M1TA 3B5JA 3T35A 4ESHA 5JZVA 1HT1E 2XTNA 4BZXA 5LB4A 4BQSA 4IEEA 2GHIA 4M4SA 5B30A 1XCMA 1I4TD 1A4RA 2GEVA 2WJGA 4LRWA 4LBVA 1GNRA 2XNDD 3B1WA 3ZQJA 2AR7A 1Z3IX 5EXSA 3QXCA 2WSSD 3N70A 4OQNA 4Q9IA 1BS1A 1EG7A 3FMFA 3I61A 4Z1MA 1K6MA 2Z0MA 2I1QA 4NYIQ 1AM4D 4NONA 3NEYA 1OXTA 3T5DA 1JQLB 5BQ5A 4QBFA 5TMPA 4ZV4A 4AKGA 1DAKA 3BBPA 3WYAA 3AVXA 3TSWA 2X8AA 2Q3FA 2QG6A 2ERXA 4PC7A 4DEYA 4DLYA 4TSFA 2DY1A 4IXNA 3UIEA 1YR7A 5L3SB 1E9SA 2JLXA 3VQTA 1KO5A 5FFMA 4HLUC 4BFUA 3KFVA 5SZKB 5FI0B 1SKQA 1HURA 2CL0X 2BWJA 3OIUA 4UJ3A 3T34A 3SYNA 4D82A 3H86A 4PAOA 3K9NA 3EW9A 3MWKA 3HR7A 3N2IA 4Q7LA 1T3HA 2GILA 5H68A 1MO5A 2FZLA 3S1AB 2QAGC 4Q1AA 1E99A 4MGKR 3IIMA 3IDQA 1LF0A 2UZ3A 4C9BA 5DE3A 4Q18A 3ZDQA 1DTSA 1RZ3A 1VHTA 1XTKA 1T6NA 2BEKA 3VFDA 1G17A 3CF2A 4GP6A 2ECKA 4M9XA 2CVHA 4IDNA 2CL7X 4TLBA 3O8RA 2QMEA 1S1MA 2HLDD 5FBRB 3VHLB 3I92A 1MABB 2OE2A 5FOUA 4U7DA 3LD9A 1GVNB 1NRJB
chains in the Genus database with same CATH superfamily
4G1EB 5HBRA 1BS2A 1DFHA 3IBYA 4RVOA 3THYA 2WPNA 3BRCA 3GQBA 4MV5A 4WL0A 3ZWCA 1Q7GA 2OXEA 3TEFA 5DTEA 4E3WA 5E3JA 1L2TA 3HDTA 1SCKA 5ULLA 3CWZA 3H97A 2HPVA 3NASA 4M98A 4UW9A 1XXHA 4OHZA 2ZSHA 3KQNA 4EMUA 1H9BA 4MA4A 4HG2A 2P27A 1BX1A 1X1TA 2Q6VA 4PYIA 4Z8YA 1FP4A 3ZD9A 2O20A 1NRXA 2OMEA 3FJYA 2ON6A 1QWOA 3B7WA 1VMAA 3H4TA 3NWEA 4JB8A 5T64A 1VOTA 1IBLB 3M6MD 1ODIA 4BBAA 4B3RB 2BGUA 4LC9A 1UDCA 2ZUUA 5CVDA 3WGNA 3R3JA 4JB3A 3LVQE 2YY5A 3RTEA 3WWCA 3LXRA 1P5ZB 4P3KA 1T5DX 2J45A 3MWEA 2V45A 4OK3A 1WV1A 2VCYA 3CFYA 1FZQA 2XVMA 4NPAA 5CT5A 1SXQA 4ESEA 5MF6A 1NXWA 2QN7A 3BK2A 1K0UA 4RS3A 2XKJE 4M0DA 2ZYGA 3VSBA 2A7XA 2FXVA 5BNZA 4PQEA 2W2QA 1LDGA 4AM8A 3R8CA 4YYZA 5JS8A 1MVLA 5ALPA 4K9SA 1OZHA 4TLLB 2GT1A 3C7KA 4H77A 2NO4A 1EVJA 1FDUA 2YCLA 4N65A 1QRDA 1XCPA 1KSFX 4RVDA 4GOLD 1U9ZA 4MNTA 4QBTA 1Y6QA 2BBTA 1C4OA 1F0YA 2Z8XA 3NHMA 3SZMA 2WMOB 1ODLA 1DL5A 1FSFA 1Y4ZA 2R1ZA 2OLJA 2GYUA 2ZWPA 2HT1A 4ND8A 1P0IA 1E0DA 2BISA 4DMFA 4UCXA 5DTMA 3C3PA 3LK6A 1M0TA 1SUEA 2J4FA 4FN4A 4ISBA 2Z3WA 4JP5A 4Y9RA 1JWLA 2WVGA 2JLWA 2Z5GA 3HMKA 2PA0A 1XMVA 3RTBA 5FAXA 3FZYA 1P7CA 1M0WA 3FUWA 5D2CA 5FL7D 1FFDA 5B58C 5DIZA 4A6DA 1LCIA 1YS2X 3PSHA 2GASA 4F56A 2J9FB 5J4YA 4N0EA 3NUGA 3GPLA 1E89A 5AI0A 1YDGA 3D5QA 4FTWA 2XAUA 1HM5A 1WZIA 1X3SA 3D31A 2E6KA 1NE7A 1WB5A 4PN3A 3UB3A 1UJ4A 2H07A 1CT9A 1NW9B 2IEBA 5AW6A 4UVGA 1LXCA 5DHAA 2ZEJA 2I3BA 1VSTA 4KWEA 3IEMA 4REMA 3WMGA 1ZMRA 1U7DA 3WXBA 4B7CA 2BJVA 3AJ9A 1IXKA 3TQOA 1YJQA 3LBNA 3TX2A 1E2FA 4RKFA 1FRVA 1M7BA 5A71A 4DVGA 2IXGA 2QMOA 1CRLA 1GZ7A 1MAWA 3QP9A 4OREX 4A2PA 1UFQA 3EZGA 5JWRA 4DJFC 3ZGYA 5G02A 1C7IA 2QK4A 2D8AA 1C0IA 3TGWA 1TI7A 5BRAA 1RI4A 4IDDA 4MKXA 4JHXA 4EKIA 4MYSA 5IULC 3N8NA 1P0PA 3I5MA 3M4JA 4MV1A 3RNOA 4L8FA 1P7ZA 2NSDA 3T4XA 3TCXB 5EJ6A 4GPBA 3ZD8A 1C3LA 3TIFA 4CIXA 1XVAA 1GLVA 4LYHA 1GFIA 3LC2O 4IFBA 4M1ZA 5A7GA 3C8UA 5COQA 2ZT6A 5CCDA 4G0UA 1WSBA 2GN4A 2ONYA 3IPLA 5ALRA 5CLIA 3S44A 4FYWA 1DDOA 2ACEA 4QDOA 2Q5QA 4F86A 1RM0A 3ETNA 4XIIA 4OL9A 3O26A 3UV6A 1YTLA 1Y7HA 2Y4NA 3IMEA 4C2AA 3QWIA 5C4GB 5D1NA 4F85A 1PT8A 4P7GA 1JXOA 2FLKA 3ESRA 5B3JC 1Z08A 1HL7A 4M1SA 3TNDA 3UGJA 3VU3A 2BHRA 4G26A 2W2TA 3FLEA 4OYHA 3BXOA 3VR2A 4BNUA 3NHAA 3AVTA 2MMGA 3H6GA 1WA5A 2AHOA 1EWYA 2JFOA 1CQZA 3OETA 3LJKA 4WNCA 3ZHVA 3DJYA 2RKWA 5U9CA 3LWNA 1PUXA 1XZQA 3DYVA 3EAGA 1GSIA 3SEAA 4H1WA 1PLLA 4FKBA 1M8PA 1IWPB 1K27A 1W29A 3OI7A 4L2IB 4WIAA 2BF7A 1VKJA 4FNMA 2DHDA 4H1UA 2AL7A 3QW4B 4RTJA 1DKRA 3UWMA 2BGLA 4BDTA 3KZKA 3LLMA 5SYNA 3OE1A 3OP1A 5KHAA 3KOOA 1RQNA 1NXOA 2PIAA 1FYFA 2Z08A 3AIOA 4OQXA 9LDTA 2XKAA 1FTWA 4NDZA 3U3MA 3VDMA 2EJWA 2OD2A 3CJTA 2BZ0A 3RADC 4UAVA 1ZR2A 4OXKA 4AP5A 4JJAA 5EP1A 1U5AA 3WLOA 4E51A 3B6ZA 2BMDA 2UYGA 2C9YA 4H6WA 4F3YA 4B87A 5H7XA 2BF4A 4EHBA 4TYQA 2R8EA 5BNFA 3BD6A 4GUAA 1N5JA 3GUCA 4P5DA 3EOZA 1A1VA 4NU0A 2UXDB 4IW3B 1QF6A 1EVQA 1ZK1A 2IYZA 3GFBA 4CQMB 5DK6A 1TRKA 1NYTA 1SQSA 2VA8A 1CIJA 4KIFA 3K70B 2G7MC 1W36B 3L0OA 4XE5A 2G25A 1MOPA 1ISSA 4JJIA 3CEHA 1PZGA 4FQ7A 5DHUA 4L08A 3MINB 1Q1BA 4MI1A 5FTMA 5M3BA 3ASVA 4ZIRA 1XC7A 2FPPA 4YCSA 3AB7A 1NKVA 3INGA 1UBRS 3A3KA 4R2KA 3TLJA 2F1RA 2I34A 2ZBVA 3H1EA 1V11A 1N6LA 3RYFA 1NN1A 2QA5A 1TCCA 3OOHA 4FEYA 4BBPA 5GIOE 4GKKB 5BPFA 2X0IA 1EM8A 2H0AA 4IJWA 521PA 3OZGA 3B8HA 5L51A 4Z0PA 5BMVB 1H42A 5KREA 3NIBA 1SUWA 4MKHA 1V4VA 1Y9JA 2YV4A 1DFGA 3JR3A 4MYUA 3O2QB 5CIQA 4EX7A 4EYOA 1N92A 1EGAA 1KC1A 4AF8A 1NNI1 5AXBA 4RVCA 4LWPA 4ZCMA 8ATCA 2GN0A 4P3PA 4KQ2A 2PBRA 2NPIA 5IH3A 1R50A 4MUFA 5I5GA 2ZSDA 3OEHD 2ZSJA 2FZKA 5CYFA 3OESA 4WUTA 3AUJB 4CNBA 3GLFB 4OMUA 5EKSA 3MBKA 5KNLA 5GOZA 3BKXA 4FYIA 1ODCA 1QFJA 1V1RB 3BHNA 5ES4B 2IS6A 3ZY6A 1Y89A 4NU8X 3UXYA 3AVPA 4Z4IA 4E09A 1HZZC 1KORA 3NONA 4Q4DA 1BN6A 1OLSA 4UTPA 2DR3A 2IEIA 4QXRA 4FDAA 1UMCB 4J0EA 2QJRA 5KHOC 3TAHA 1CY8A 1XKXA 2FSIA 4L28A 2OYCA 1Q7EA 3HZZA 4ZT5A 4ZVUA 3R8XA 3ELBA 1ADBA 2QVXX 3CW8X 5A4IS 1QHHA 3PNOA 4YXWD 5AUOB 2SKEA 2EEZA 2AOTA 2XXBA 4F4DA 3HSYA 1JSRA 4PYQA 2UVPB 2WJ3A 3C4QA 3HBAA 3E05A 4HTFA 4IHJF 3FBGA 4IJQA 5I8ZA 2GCOA 3VBEA 7REQB 3AKZA 1MABA 1P1RA 2JBAB 1VBFA 3JYOA 3LUBA 2ZRMA 5LQUA 2CV0A 1R10A 1N2CB 3P0EA 2WM2A 2GRUA 4A2QA 5E6SB 1IAVA 1RQLA 4CIVA 3DBLA 1Z5ZA 1WU7A 3EDOA 2W8BB 1H5NA 1CJKC 1SG6A 3PC4A 1Z25A 2X5XA 2XSZA 3A6DA 4NYJR 2Z8YA 1RI1A 4W5WA 4W63A 2GRJA 5IAEA 2H1OA 1UBOS 3CSDA 1U0JA 3K4HA 5JY6A 4YGXB 4PNHA 3B6MA 2AVNA 4NP6A 3P97A 2LPMA 3RCBA 5AVQA 1D2NA 3QELA 2BGRA 2QROA 1E3WA 3GWGA 3O2NA 1QANA 2HBYA 3FI0A 3QITA 3ZV7A 1S2LA 4NDAA 4J4TA 3ROTA 3WYNA 5HKOA 5BSUA 4XQ9A 1VI2A 1CXZA 4EAQA 2O23A 1AV6A 1W5AA 1YQGA 2C2XA 2J59A 3CEMA 2HCTA 1BXKA 4OG2A 3ROXA 3I5AA 4LOIA 1M5TA 1NR1A 1LPAB 3U7QB 2XHEA 3VNUA 1BKSB 1QJCA 2VUIB 2OHJA 5TMDA 2AC2A 3EE6A 1OAKA 4FD3A 3AR7A 1G21B 1KPGA 1NBMD 2C57A 2NU7B 1Q0RA 2WBLC 3KZMA 1SULA 3FW1A 4YMVA 3W5BA 3NHFA 2BONA 1MW8X 2O3JA 4WBSA 3NW9A 4BDSA 1OGYA 1P5HA 2JLRA 2J0UB 4AUKA 1GAJA 3ZHQA 4MUNA 1T43A 4WNIA 1NJGA 1MC4A 2R7MA 2IOQA 5BV1A 3VC3A 4GKVA 1W581 4ZVTA 1EA5A 1GCOA 1ZSYA 5L8VA 5L4LA 3REFA 3TE6A 1D7OA 4UDXX 2C94A 1M2EA 1RAIA 2G63A 1TRHA 4HWGA 4XLLA 1ZU4A 1JFRA 1T2VA 2WP0A 1A50B 3DR5A 3B3QA 3UG7A 3FKQA 3NU1A 4R69A 5IJ9B 1HPLA 1G0OA 2H54A 4C4AA 4X0EA 1Y98A 3HCNA 4EHDA 1DCTA 1XGKA 1BXZA 1EX1A 2A92A 3HXMA 1LI7A 1DMSA 3EIUA 1WXQA 1DLJA 3UMGA 3CM0A 5C3UA 4WZZA 3W78A 2KI5A 4Q4AA 2CKMA 4DV2B 1W93A 3G5TA 3T7TA 3NC1C 2R2AA 3F3MA 4BO4A 1EWTA 2H5EA 3DLIA 2QV0A 4ASUA 3PFIA 1OIXA 3MMPA 2ID8A 1QR6A 2HF8A 3DHWC 4ENTA 3OKPA 3MQ4A 3NHZA 5K0EA 1VL5A 2B94A 5DGTA 2A9JA 2W90A 4E2XA 4X91A 4C7XA 2QRHA 3AM3A 3K09C 2K7FA 3SYLA 3JWHA 1CRWG 4RJTA 3H2KA 1UM8A 4KQJA 1JTEA 3STTA 4C04A 5JCZA 1CLUA 2AF4C 2QBYA 4MWSA 1CJMA 2Y8EA 3K5WA 2P9ZA 1PR5A 1Z4KA 7REQA 4LF5B 3IR5A 5EIBC 4LHVA 3HG7A 4FP9A 1NVEA 4RENA 1N33B 4LYFA 4X8OA 5D8DA 1NW4A 1BX0A 3O47A 4G5XA 1F06A 1L1QA 2ERYA 3UY4A 1D2HA 5A7FA 3BRQA 5CVJA 3KOMA 5DFAA 3MYYA 2Q1UA 4QSHA 3NG1A 4EG7A 4OV6B 2W8ZA 2WTUA 5TDHA 4PEVA 1GPLA 1PR4A 4I50B 5EHQA 3GRVA 3B2EA 3EVGA 2F1IA 2ZSKA 3QKSB 5DHPA 2E18A 5DSXA 4QUGA 4PIVA 3TBKA 1LS1A 5AESA 3UAVA 1PR9A 1KMQA 2BFMA 3C1OA 4I4IA 2QSZA 5LYJF 2CLMB 3DH0A 3IBCA 1MC1A 1NVUQ 1G9SA 1S9DA 3CH6A 3QVOA 4PVCA 5CTJA 5JAMA 3TQQA 4M83A 3RFXA 1QYVA 1H6DA 3R4CA 3TLXA 4B2LA 4BUCA 1W7AA 2GN2A 3CH4B 2O8VA 4TQGA 2H7VA 2VDWA 5DBEX 3K94A 1COWA 2I2BA 2H92A 2HA0A 1CLEA 4II2A 5G53C 1VI6A 3RVKA 3LBIA 3PVCA 2A78A 1GCIA 3H99A 2WMYA 1AG9A 4NEGA 2XUHA 5KJEA 4ZQFA 3VZBA 5LLDA 3AM5A 4CTMA 2ZB8A 2I22A 2GQ0A 2NADA 3NI2A 5FJJA 1E1KA 2XGOA 4C87A 2G5GX 2R0QC 1S7CA 2GJ8A 1BWPA 3A0UA 2WHYA 4MYCA 3D3JA 4NU5A 3FRIA 4O63O 4MEBA 4C30A 4Z1MD 4XASA 5AKEA 4IDGA 1SCQA 4AZTA 3X0DA 1IMJA 2VYCA 2LXNA 4ZI7B 1OYYA 1VKOA 2FOIA 1PFUA 3B9PA 3ON5A 4CM9A 3I2HA 1II0A 1LJ8A 1UIMA 2P2DA 5HZKA 2K4MA 1X7XB 2VOEA 4U7JA 1W30A 4MKRA 5B4TA 4P2BA 4EG6A 2NSJA 4P0TA 5EMJA 1ZIXA 3PHIA 4Q3AA 4R1TA 1K7YA 2TS1A 4NJMB 5CEJA 1YULA 5F21A 1QQ5A 3KYDB 3KQUA 3F9IA 3JQBA 4JI0B 1XMQB 5EA2A 3EC2A 1ZVVA 1K1EA 1ZD2P 1MEOA 4L9WA 2VPTA 4LGVA 4LYAA 2FQYA 4WASA 1GVHA 5DN9A 5CDTA 2QN9A 3G82C 5LIPA 1QK3A 1MJNA 2D3TA 4HBZA 4YHBA 2OBYA 3R9IA 1JG6A 2OILA 1NZDA 5FWXA 1VG9B 1GR0A 4MJXA 1R8JA 4GKBA 2Z2XA 3PLAE 2FPLA 3EY4A 4G07A 3QKTA 2XA1A 3O21A 3ESBA 3ZWQA 1XALA 4G4SP 2IZ6A 4KDFA 3AVVA 1L5ZA 2JGAA 3GGPA 5C31A 3G8DA 5LUAA 3VR6D 4JYZA 2RI0A 2RHHA 1RFLA 3M1YA 1Q7BA 3STUA 2HWXA 1Z88A 2A35A 4CKWA 2UYCA 4Y2SA 2FH5B 2A7QA 2BFFB 1P9OA 1Z4PX 1Y48E 3BFKA 3FF1A 4OLJA 1ENPA 4XM2A 3ZBTA 5KYUA 4B4DA 3LYHA 1NBOA 4EKYA 2JGRA 4BN0A 4OH1A 4QUBA 5BQPA 1MEJA 2BFPA 1E1MA 1AE1A 1VGVA 3DW1X 5JAQA 4BNHA 4GX0A 2OAEA 3X3HA 4QGSA 2D4HA 5JSFA 4UEJA 4UUPA 2QZJA 2ZSUA 3P2YA 1U2QA 3O3MB 4YCBA 2WD8A 2LTAA 5CX1A 2O2EA 1GGMA 2D5LA 2BDEA 2LRHA 4LHEA 2JLUA 2UUPA 1E2IA 5G2OA 4ND1A 3EAQA 1X0VA 3K09A 1LDYA 1U8CB 4RK1A 1BFKA 2ILTA 2W7TA 3H9JA 2LE0A 3G5MA 4B31A 2G9VA 3HXKA 4JBHA 3MHTA 1R00A 2Q4RA 4RPKA 5JC8A 4E6PA 2A1TR 3L7KA 1E1LA 1RC1A 3HP7A 1V71A 2OCAA 3NWOA 5E7MA 4HQ6A 4CV1A 5JR3A 3ZLBA 3O8CA 2QTAA 2WNHA 1GWNA 1P9NA 2A5JA 1JHOA 2EP7A 4P4GA 2DF8A 2A0WA 3RRMA 3S8MA 3UOWA 4BLPA 1ZL2A 2R85A 2ZG6A 4G0ZA 1L5MA 1BW9A 3OF3A 1UPCA 2AN9A 1GGEA 1QCCA 2C3OA 2ZB7A 5GJBA 3LP5A 2OCGA 2OK7A 1FJHA 3JARA 3T1YB 3EZYA 4RABA 3GQVA 5DASA 3WKCA 4D8VA 3EEOA 3I0NA 3B6KA 3MWGA 2VNHA 4HQKA 5IFLA 2JBWA 4OYRA 2CFTA 1QGUB 3AP3A 1X1CA 2IEDA 5HZMA 2VT2A 2Y2UA 5MN6A 4HZUA 5CA0A 1E58A 2J6HA 3B78A 2J7KA 3KTDA 3T5GA 1S2NA 1AO0A 3B13B 4L02A 3EY9A 2IX9A 4QPZA 2CNNA 3VZRA 4UE3S 1JDNA 3RVRA 4YT8A 4UCQA 5CB6A 1Q2UA 4TTRA 1DQNA 1JU9A 7ABPA 2QUIA 5BW4A 2YXDA 3RUEA 3ZS8A 2QGNA 4IEIA 3CO5A 3G13A 4H59A 4C3OB 1CKEA 3R0ZA 4RANA 5EOVA 3HWWA 4EECA 2WLSA 1G8SA 3E7DA 2BFNA 5DHRA 3H9BA 1UKAA 3HBMA 2FRVA 4Q9AA 3ZVNA 1NBWB 4TKUB 2L69A 5TJ9A 5FA8A 1WW3A 2BV3A 2ZIFA 2G0TA 4L3OA 4PCAA 5A5FA 1QQ6A 1V8PA 4RMIA 4M6WA 4CM8A 4DQLA 1RKVA 1HDIA 1DBIA 1FFYA 1F8XA 2XB9A 3AL0C 4FOLA 3FOZA 4QTZA 1H6AA 2P2SA 2WNIA 4XD2A 1IBRA 1FMJA 1ZEJA 4BVHA 1V3VA 3BHMA 2FXIA 1YV9A 2VDNB 5JH7B 1RXSA 4KBFA 2HD4A 3VUFA 2JLVA 1SO8A 1B76A 4PX3A 3SSMA 5C4IA 1P9RA 4I1RA 1P1CA 3BE8A 1LPOA 5ERGB 1PWXA 1U7UA 2J9RA 3F3KA 2IU3A 4PICA 1A5TA 3DZCA 1JFFB 4DIFA 4U2CA 5CFQA 3Q5DA 4LF4B 3I9FA 1FNCA 5E9QA 4KUEA 5KYKA 3IV6A 1V26A 2FEXA 1OY1A 4BVJA 3ICWA 1I1OA 3I62A 4BO0A 1SC6A 3EJ6A 3IVRA 1IOLA 2AGVA 4KACA 5KTTA 4HLUA 4WBNB 1XDGA 5LCXA 1FS6A 5CBKA 1M9NA 3IMFA 5BV2P 2FDXA 3G02A 2NXJA 4MJLA 5LZ9A 1XJQA 2VS1A 1CCWA 2EZ8A 5C2JB 1JAHA 1OX5A 2AG8A 4OI0A 2G5CA 3BZWA 4J9VA 1CE8B 2ORYA 4YRDA 2RGGA 3WIOA 1BJTA 1FMCA 4MYHA 4ZVMA 2O2DA 2GBCA 4EB0A 2I2WA 3Q6IA 2VHYA 2OQVA 1E6WA 5DTJA 5FEMA 2GEDA 2I2DA 3ZS9A 3OUTA 4R0VA 5G0TA 2F64A 3EZLA 4LV6A 2NSYA 4G86A 3MWLA 2Q0QA 5IU6A 1XROA 2P40A 4F7DA 4ROSA 5HFNA 2FEOA 1L5KA 1Y37A 3T54A 1U2PA 4JX8A 5CYPA 1VYUA 3WVNA 2EOAA 3AZQA 1TUIA 3KK0A 2FOXA 821PA 1TM7E 1XZEA 3FOBA 1OLXB 4HWTA 1UPAA 4NATA 2GM4A 4BXOB 1YQTA 3M2PA 3Q12A 1UWVA 4GVPA 5ALJA 5AW8A 4UBKA 2AXNA 4URZR 1IBKB 4LFBB 3SHWA 1L1RA 2I33A 5GZ1A 1ZSVA 4FR2A 2XQGA 3CZAA 4K3UA 3IDSA 4MQBA 2XRMA 2M6LA 3N86A 3QWAA 1VPWA 2PWYA 3SQWA 2B61A 4DN6A 1CR6A 2V7PA 3HYTA 2ZM5A 1G8GA 1TNDA 2MHCA 3DMNA 3H0EA 2ZZNA 3ECAA 3N2ZB 3NHSA 1NPYA 1OLUA 4FGKA 4ZQIA 2E2WA 4F71A 3MJTA 2QN2A 4CM4B 2NSHA 1Z8DA 4PV7A 3CVUA 1YDEA 4FFLA 2CF5A 4NFSA 1OTYA 1FFHA 2VDLB 2GF9A 1F5SA 1W73A 1X6VA 3TFWA 4R51A 2XDQB 4MX8A 3NALA 4DL9A 3M8KA 4MLDA 2G3YA 1CUIA 4D3ZA 1RAEA 2Y1DA 2YZ7A 4BWFB 5DHQA 4RD3A 5IHPA 4L85A 1X1AA 4AQDA 1MKYA 3H19A 4XB2A 4YV2A 3C7TA 4NC9A 3DKKA 1SELA 3DHEA 5K0JA 3DPSA 1JR2A 1CC1S 3ZK7A 5DDIP 2JJ1D 4B6SA 1F8GA 2Q0SA 4S24A 3R6DA 5I47A 3HO6A 1S3IA 5L4NA 1TU3A 1DT5A 3ZBUA 3ODPA 3A6PC 4EGFA 1QG4A 1M1NB 2YC4C 1Z56C 1MB0A 2Z4SA 1T9GS 4UULA 4D4KA 3BREA 3DWIA 3RWOA 1JUDA 4ZYVA 3DOIA 1ZD8A 2O8CA 2ZTLA 2CMGA 2P5TB 2H1VA 2ZAYA 3C3JA 1EJBA 4IH1A 1HE8B 4OSOA 2F8SA 4I4LA 3WBFA 2I4OA 2FVYA 3ELUA 1CEYA 2PEZA 3REQB 4TVOA 5DYIA 4AY3A 5CGZA 2E4VA 3NBFA 3OIWA 2ORED 5DYNA 5K6RA 4ENSA 2HCRA 1IMOA 2JLAA 4RMGA 3OZDA 4W5JA 1KBOA 1AGNA 2KX7A 3AETB 3GLHA 2PM8A 4ITUA 1A9OA 2VTVA 1T9DA 3TQRA 1HDZA 2MINB 4IGAA 3HFSA 1R9NA 4J0KA 1OXBB 2A9OA 2G5TA 2SECE 2Q6KA 3ONWA 1KEWA 3D8SA 4C05A 4JWTA 4LYYA 2DPYA 3RS2A 5F2OA 5LMNB 1J23A 3MSXA 2P4HX 3WSWA 3ZYCA 4HFJA 5F12A 2O8BB 4AJIA 3ETHA 2DFLA 4YECA 3NC0C 3PKJA 1P4HA 4UHCA 5IVDA 4PC3A 1N0WA 3P5BA 1ZGZA 3DWEX 5EXPA 5A4MS 3QTTA 4FB5A 4DKXA 3VKGA 1OROA 3L8FA 4MPJA 2W6IA 4ES6A 4Y2RA 1TJNA 3CKYA 5LJLA 3QGMA 5LQAA 2DP4E 1N5MA 3AR4A 4O4JB 2AFVA 3QVXA 1AO3A 4JS0A 3AVUA 4MKGA 2OC9A 5E6UB 3ISJA 1BHQ1 1U81A 1O1YA 2LKDA 1CQJB 1P1IA 2QQ5A 2Y76A 4EEKA 4N0DA 4QPPA 1E1YA 3RW9A 4N0QA 3WGIA 2I3GA 3RSZA 4TRRA 5IVPA 1WSDA 1N25A 3FYCA 3M70A 3ONFA 5CJ2A 4ARSA 1TUEA 1FDRA 3BXFA 4IQGA 4LOKA 4ACBA 2QY6A 2ZPAA 1Y3AA 4KLZA 1GYPA 4B3XA 2I8LA 4KHPB 421PA 2PT7A 4LG1A 4M7PA 3DW3X 1ZUNB 4Q39A 3K0SA 1QIKA 1VCOA 3BX1A 3U37A 1TMYA 3RVOA 3FYTA 2CXHA 4FBMA 1K66A 2J09A 3KCNA 4KPUB 4QQKA 3FFTA 4BLWA 2XRFA 2VRWA 3S1AA 1R2QA 4D9MA 1V6CA 1JT9A 4K6OA 2X7JA 2CDRA 2M9MA 9MHTA 3D2CA 4RJKA 2YMQA 1IOVA 3VZSA 4MO2A 2Z04A 4DQDA 4IS3A 1E3LA 1WUJS 4R2HA 2WUVA 2QPLA 4RD1A 2VAVA 1G8YA 4I7EA 3V7YA 1ISFA 5JROA 1Y1SA 3PFHA 3SZ3A 4B85A 2HJRA 4EDFA 4WZAA 3L9XA 2QMZA 1OMOA 4INAA 1JVBA 4B71A 2DLDA 4RJ2A 3A4IA 4KBGA 3BMOA 2W42A 3DVAB 1Y9AA 3QM1A 3IUJA 2GYVA 4GXTA 3W2FA 4ALKA 4FGSA 4DABA 3CBQA 4UMVA 2JDID 4PAWA 4CG3A 3DVQX 3V8QA 5KNBD 1D4OA 3GUZA 1C30A 5LIRA 3SEZA 1GZ5A 1K6XA 4M1QA 1GJRA 4ODIA 4U1RA 1BE1A 2KS6A 5EQTA 5HGJA 4F46A 4DSAA 1DC4A 2NGRA 3E0QA 3L8MA 4C0BA 1U0SY 1EX6A 3GJQA 3HKCA 4IPTA 5J2UB 4GPD1 1XDWA 5JRJA 2QRMA 2AN3A 4M9SA 5TPZA 4ZGBA 5BVGA 3PPVA 3WBKA 1FFCA 1HO3A 1USKA 4URYR 4BQEA 3O95A 1H3NA 3HJGA 1RZRA 3C2QA 4E31A 5GM2A 3SJ7A 3F78A 1AQYA 2Q0XA 3IAEA 1TT7A 4I8DA 3E5NA 1Z2EA 4KTTE 3UFXB 1K3UB 1MRSA 4EHNA 1SBYA 3CLRC 2VJOA 4AECA 2ZAGA 1KDRA 3GCGA 3N8IA 3K35A 3MELA 4IFIA 4FUQA 4QUIA 3L1JA 2X0KA 5IXSA 3UHJA 2VQSA 1YBVA 3B9BA 4OX9B 3JALA 5KPJA 4RSMA 1R0WA 1E0AA 3SC2A 1U8YA 1XHLA 4RCVA 1EVLA 4YV7A 4M9QA 3FDFA 3PQ5A 1FTGA 4LN1A 5FPPA 4K9MA 4K9QA 2TRSB 5JCOA 1D1PA 3C8ZA 3BPSA 1PZNA 5J4LA 2IPAB 4ZKDA 3JASB 3IFSA 3OLCX 4JU9A 5FPTA 1G64A 4JA0A 3T0FA 1VP9A 4NARA 3EMBA 3NO4A 1ECJA 4UU0A 3VYSB 5I7WA 5IT5A 2XLCA 5ESXA 4D4GA 3LUGA 4UHHA 5JWHA 4CMGA 1ESNA 1ISGA 9LDBA 3PDHA 1YXMA 4D8TA 1T9AA 4QUJA 1FIUA 5AI9A 5HKLA 2PGAA 1RCUA 1SKBA 1XG5A 4LSGA 5CAEA 5DI9A 4HLQB 1UBJS 2QNBA 4CQLA 1KF0A 4M6WB 3RS8A 1DEKA 1FXWA 4XYGA 1V8DA 1RQPA 4A73A 5CDGA 1KZ4A 3E3MA 4MEAA 2VTDA 5J2UA 3OA0A 4NG5A 4B48A 1AMNA 4WOKA 2YKGA 5C1PA 3DDWA 1X7YA 2A5DA 2A9VA 3D1JA 4F2HA 3M3HA 4G0MA 2CE2X 2VSYA 3MPOA 5TQ0B 3GG2A 3KLOA 3A1SA 4IGIA 4C07A 5BQFA 1F4LA 1ZJ4A 1NSTA 2Y05A 4HRVA 2MWMA 4MMXB 3WWPA 4F4CA 4CUZA 4DKJA 2YV2A 5JYCA 2HMWA 2QL5A 1ZBQA 3HY4A 2PXAA 3HFJA 2O3UA 4HI0E 2BY4A 1PJ3A 4J2OA 5IM5A 4BLVA 1VSVA 3M3PA 3G5UA 4UNIA 3JV7A 4CLOA 3BGOS 1T0HB 1J1UA 2ZK7A 4JDUA 3N0XA 2YIDA 2V1UA 1JXMA 3K15A 2X3YA 4DB4A 2TYSB 4HGYA 4FW9A 3T3GA 1N6PA 2XYRA 3F67A 5AXCA 2B92A 3TTSA 3DAOA 4MRNA 4M0KA 2V9CA 4B1FA 3HO1A 2D2IA 3N2KA 4G5QA 3VPFA 4GLBA 4CKBB 3HRHA 4ND8B 5HQTA 1FS4A 1RAHA 2EYUA 2VF2A 3PCRB 3CJRA 1VIMA 1PNVA 3M0EA 2D3WA 1Y1RA 1MZVA 2E89A 1KSJA 3JAKB 3QNWA 4D6YA 3OFVA 1TM2A 4D9FA 3VMFA 1I2BA 4ENRA 1W88A 1W2GA 4KPUA 1L7EA 4V1CA 4O4HF 2AQ8A 5EP4A 3DOCA 1NVKA 2A1TS 1CNFA 3AIMA 3ZHYA 3ZLJA 4JT8A 2I7DA 1Y4UA 2EIHA 3RTGA 5C8YB 1TQ8A 2O1WA 1CUAA 1KJZA 1W4RA 4XVQA 3KUCA 1FU8A 1UP6A 5FBKA 5BYBA 3DXXA 3UWOA 1F3OA 3PFWO 1X7WA 3F8SA 3OD5A 3ORSA 1BSVA 4FMDF 4L73A 4UHKA 3UJCA 5FOQA 4BATA 1AK2A 4PZDA 3T7EA 4D97A 1KI6B 3ID6C 4MA0A 2BCEA 1GPAA 4WD3A 1U1FA 3GEGA 1L8AA 4PSAA 5FI5A 2O2YA 4PZ0A 1W85B 1NP6A 2P9EA 4WW0A 2EFDB 1M1YE 5AHWA 4BKUA 3A2KA 3I9MA 5LU9A 4NXMB 3WAGA 4YX9A 4MOWA 3ANLA 4QREA 4WVLA 3MS2A 3ET4A 1D2RA 3B8EA 3EG5A 4JP8A 5IK2A 2J7PA 5H9WA 5ELMA 3VPHA 4RZ2A 3VR3D 1ECLA 1MX1A 3H3JA 3QPWA 5FUWA 3AERA 4QQRA 3H65A 4P83A 3HCFA 3V7NA 2ZS7A 2JZOA 2WJAA 1SXJC 3RT7A 4DV0B 2QVGA 2JVIA 3ONNA 3U3OA 3FLMA 2R1TA 1U1IA 3BH6A 3R0QA 2ADMA 1AQLA 1FP1D 2D59A 3TG2A 2WJVA 1B6TA 2Q8PA 1GRNA 3MT9A 1GCUA 2C0QA 2L2QA 4QT0A 5EQDA 3VHQA 1YB6A 1PQUA 3SLKA 4UOEA 5JSQA 5KU1A 1LSSA 1E2DA 3GEMA 3IRUA 2LP4Y 4PQGA 3GNLA 2PUFA 1R3DA 2HJ9A 4YTEA 4Z53A 4LWZA 2WB4A 3OMWA 3R23A 4WCDA 4QPCA 2ETXA 2IPMA 2P9FA 4LQDA 4DXHA 4EL5A 1IWOA 2XBLA 5ALSA 2IZ5A 3C6QA 3FPEA 3PA8A 4UC0A 4Q9KA 3ULKA 4IBOA 5HZGA 3KUUA 4MS4A 3QUSA 5AW9A 1RKUA 5B6JA 3TW8B 4K8RB 4KDEA 5AO9A 3K1JA 3KLPX 2ZWIA 2ZI6A 1TLTA 4RHYA 2C8KA 4ZQGA 4AF7A 4EG3A 2FE4A 2JGNA 3GRCA 2OO7A 3JQFC 2J85A 1QU2A 1YDWA 2RMKA 1A8IA 3KETA 2QYOA 1ISPA 5E9WA 1H8EA 1B8VA 2FN9A 1UZMA 2XUKA 4DANA 3TZ6A 5ARBA 5IKEA 1X9HA 4QECA 4EHAA 4PLZA 1KYWA 1GRCA 3K32A 4I46A 1ELOA 3FNIA 4NQRA 5ES3A 1B0ZA 2D1QA 1AQIA 3E9ZA 2VATA 1TVCA 3NVAA 4L9RA 2IHNA 1HTTA 2Q5FA 3DD5A 2A9RA 3PQ6A 3ZR4B 2BI7A 3T3NA 3PTZA 3I28A 3EUEA 4RAQA 4YALA 1OXKB 1TQHA 2VJKA 4DLBA 1Y8QA 1KHHA 1I2ZA 3LQ2A 2O59A 4UVDA 1KIFA 1R9JA 1FDOA 3OF5A 1XYGA 2QI9C 3F90A 4NYIR 2VXOA 2QY9A 2WICA 3H8JA 4DYVA 5K6AC 4D4HA 4D25A 3RYTC 5IZCC 1HFWA 1O95A 3NOOA 3MQ2A 1Y1TA 3TNJA 4YMUA 1DBPA 2JJ1A 3BMQB 4XUGB 1BCRB 2RK3A 3A1FA 4GM0A 3HV0A 1P72A 2BGTA 1X70A 3LUFA 1UEXC 3PXGA 1MW9X 3S29A 1U6JA 1G6KA 4NE9A 1M2WA 1AOXA 1P1KA 3BE6A 1ACLA 4XUDA 5CXQA 4CIWA 4RZUA 5LQRA 3FVWA 1XFAA 1KDTA 3HCDA 4JEMA 5F35A 3RASA 1YVDA 1O8CA 5EUBA 4JH0A 5AW0A 3H5TA 5JJKA 1Q0LA 4GIBA 3BEOA 4K6HA 3DPUA 5IAGA 5LBUA 4B3JA 4X1YB 5B4UA 2WC1A 4GOOD 3VNVA 1JPVA 2W9XA 3UANA 4HGQA 2C4HA 3N2GB 5AOCA 4FB4A 4IS2A 1J70A 3GPBA 3PITA 2DBYA 2E0IA 2PH5A 5M2QA 3H6HA 2IA5A 1KFKB 4XWKA 4YJGA 1OOEA 4JK3A 4MGEA 3SZLA 3SDSA 4IIJB 1M6NA 2IHBA 4B32A 4Q4CA 1Y5LA 4C4TA 3BD7A 4HADA 1O89A 4LHYA 1JIUA 1YMUA 3NT2A 1QCYA 4ARCA 1JIKA 2J32A 5KX5F 2IYVA 4DWWA 4MUMA 4CTOA 4E30A 4H18A 1YTUA 4XLTA 4B4WA 3WIBA 1WKVA 4WI1A 4GUDA 4YWHA 5CVUA 4TTQA 1HFKA 2X0FA 2AZMA 2VYFA 1XBTA 3VU8A 1NUQA 2CUNA 4DIMA 3UG6A 4A16A 4E46A 4LZPA 5KIAA 1IULA 3HADA 4HEA1 3OJXA 5EIXA 4PPQA 3V2UA 1VLJA 1XKTA 1RE0A 1FP6A 2WAOA 5FOSA 2MMCA 5EP3A 1CUVA 1ZSNA 3BSSA 3VKHA 3ELWA 3U60B 1PS0A 5BN1A 1Q92A 4ID9A 1LV8A 3O8NA 3SFVA 3IO3A 1UBNA 3KEOA 2B8TA 1BTOA 1B23P 3VU9B 3PXEA 4MULA 1Q0HA 3U3JA 4BO1A 1POXA 1T8WA 1ZNYA 2BMAA 1UPBA 1PE0A 4JIMA 1BXGB 4GSKA 2BTQB 2PHZA 3PT5A 1PR3A 1D1TA 4YP1A 3J80A 1Q0TA 1J8YF 3UWSA 5I5EA 3KKOA 3MD0A 5TT1A 2XGGA 3I1JA 4QAJA 4QOSA 1NX9A 1E3QA 1T8RA 4INJA 1P1BA 2FE1A 2R9VA 1XEWY 2FGKA 2L82A 4QLOA 3ZWMA 2AW5A 2FWBA 2HWKA 3GEIA 2G76A 3SD7A 3WIUA 1F7UA 2C9OA 1CUFA 3RIYA 4DC9A 4EFLA 1T1JA 3GFSA 2BP7A 4FWBA 1U1GA 4G1MB 1FS5A 2XKBA 4JBXA 5TSDA 4BB9A 1B6RA 2EJUA 3OOEA 3SZGA 4E6EA 2BFOA 2KLHA 3FWHA 1PG5A 1TUBB 4RPJA 2HA3A 4K6KA 2NUPA 3OT1B 4MDEA 1SEVA 3KJZA 5ADVA 4R1UA 4W8OA 1G7RA 2WU0A 3W04A 5DM70 3RC8A 3STWA 2KHZA 2FWPA 3WLQA 4GICA 4EYSA 5L3RA 3ZW7A 1ZWLA 3QY9A 4H0FA 2EEPA 3IERA 4AWAA 1TD1A 4HT3B 5L6MB 2CDAA