4JSYA

Structure of clostridium thermocellum polynucleotide kinase bound to gtp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 63
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jsyA00
1F5NA 5KHOC 2DCUA 4M9XA 1ZIPA 4FMDF 3LW8A 3VR5A 5B2ZA 4WVFA 4LYJA 3C41J 3E5HA 3O8RA 4RSGA 2AL7A 1IXZA 2IYYA 3LH5A 3MWLA 3QKRA 4B2PA 2D2FA 5FTJA 2FEMA 1JR3D 1Q57A 2ZRCA 2OBNA 4OI1A 2JJ2A 4C7OB 4CZ2A 4ZDJA 3QE0A 2O8DA 4C4PA 2PEYA 2FZLA 1KO8A 4X8HA 1QDEA 4A6PA 2FX3A 1GNQA 4V0KA 3IIKA 2F3RA 2HF8A 4D81A 2YZ2A 4A0RA 5B30A 3SQWA 3ADCA 3TAHA 1DADA 2DWQA 2D74A 2PT5A 4MKIA 4TQAA 4DCNA 2PEZA 3OE7D 2AXPA 1DAGA 4F38A 1EFUA 3U60B 4B74A 1X8JA 3SBEA 1EXMA 4RFVA 3R8FA 1OSNA 4TTRA 2V1UA 3IIJA 1NN0A 3HU2A 4PHGA 4OK6A 1GDDA 5FUWA 4MH0R 2XOKA 1TPZA 1J2JA 3B1XA 1G8HA 4MKHA 5DN6D 3RYTC 3QVUA 1MO5A 1E9DA 3AF0A 3K9HA 2H57A 2J59A 1OW3B 1DAFA 2OT3B 3IEVA 5DSZA 2C98A 4IDHA 3PEYA 3WHKA 1TQ4A 3AUXA 1JAHA 4UJ5A 4LV5B 4QJ4A 2XXAB 1H8EA 2ORVA 4CGZA 3BJIC 1GP2A 4GZLA 5G41A 4FI3C 4F91B 4PO8A 1M8PA 4LWZA 2F6RA 1W2GA 5EZ6B 5JWHA 1W0KA 2ZE5A 3SOPA 1E0SA 1UF9A 3O8DA 3GEEA 1NJGA 2PCLA 2QTVB 2F7SA 1GNPA 2GAAA 2IT1A 4A4DA 4B34A 1CJTC 4NCHA 1HT2E 1G41A 3K53A 5BYJA 3MUFA 4D4LA 5JRJA 1MT0A 3FKQA 2WV9A 2ZE7A 221PA 2WJJA 1KI3A 1UBEA 5JHGB 3AVYA 2VEDA 4EJSA 5J4HA 1XJCA 3K9LA 2XB2A 4AWXA 2GILA 1T3HA 2VP5A 4C0KA 4W5WA 4HZUA 3VR3A 4AYTA 3ZVMA 1SVIA 1UKZA 4QGFA 1VCNA 3RSLA 4DCVA 5CIWA 2GK6A 4IDPA 2OCPA 4OYHA 4Z1MD 1T0HB 1U90A 2IS2A 1XZPA 1MOZA 2FJUA 3EA0A 4OHYA 4DSNA 2DFLA 2R65A 3QEJA 3QKSA 4PC6A 3GJ0A 3LBHA 1P72A 3MG9A 3Q3JB 4RZ3A 5E95A 4DC9A 1FW6A 2ERXA 1Z0KA 2H18A 2OILA 3CPHA 4E22A 3I3SR 1E2FA 4CF7A 5K8TA 1VDZA 2RGGA 2IYZA 4D6PA 2G3YA 2IW3A 4C2UA 3A1TA 4NYMR 4P32A 2J87A 1FL9A 4KAXA 5J4LA 3S1AA 1RZ3A 5BXQC 2QEQA 2YNMA 1NJFA 3I72A 4BUJA 2FMXA 4CW7A 1KSFX 3M0EA 4Q4HB 5TVKA 5HTKA 2WKPA 4B6FA 2IS1A 1Z63A 1J90A 1NSFA 3AKYA 4KFRA 3FKSA 2P5TB 1XD2A 2VHTA 2ZITA 3H86A 4LV8B 3SI7A 2ZSDA 5E7IA 1U99A 1Z5ZA 1Z47A 1JB1A 2V55B 4Q7MB 3FMFA 5KYKA 1LW7A 2ZEJA 1CRQA 4NHOA 1XTSA 5JECA 2NOAA 3KJEA 1U8ZA 4Q9LA 3U7GA 3ASZA 2CJWB 3U7FB 4MRPA 1KJYA 2ZAOA 4RJLA 3EARA 5DGXA 2EWVA 4G5SA 3KKOA 2FNAA 2C2HA 2WWWA 3W5JA 2VHJA 4AG5A 1KDTA 1ZD9A 4GRAA 1OXSC 2QP4A 5FOUA 2ZJOA 3A58B 4ZPXA 5SZIA 2ZRKA 2CEAA 3P1JA 4Q4JA 2WSSA 3KB2A 1R8SA 3B7GA 4TWZA 4B43A 1KKLA 4OI4A 1TQ2A 2GEVA 3IHWA 3C14C 4A0FA 2FGKA 1G16A 4Q1FA 1DTSA 2WWYA 1Y3AA 3QXXA 4US1R 4WIAA 2V7QD 4PAMA 4OQLA 1G5PA 1VIYA 2DBYA 4M2LA 4ACAA 4DRZA 4D2IA 1TF2A 1QG4A 1JPJA 1OKKA 3MWYW 1KK2A 1NP6A 2J3EA 4HDCA 2IX3A 1AJEA 4P4SA 3EAQA 2ZXUA 4XH9B 1RFLA 3TJZA 3RC8A 2GXUA 2FDCA 2G1JA 4NH0A 4P0TA 2HLDA 3CW2A 1RKBA 2FN4A 2NTYC 4NONA 5F98A 2XZOA 2AHOA 1KMQA 5C46F 1TEVA 5CITA 2ZRAA 3PJRA 4LV6A 4JVSB 3WMGA 3GMTA 1P2TA 4QKQA 2JASA 4N3NA 2FF7A 1E2QA 4JL8A 2B7BA 2OAQ1 2GF0A 2GKSA 1SVMA 2BV3A 3IO3A 4HATA 3LAWA 4C0HA 4XVUA 1ZM7A 3KTAA 4KLNA 2D7DA 2ZIAA 3EZ9A 2ZRHA 4PX9A 5FUXA 3C5CA 3TSOA 3H2YA 1DG3A 4GOJA 3SYLA 1FTSA 3T61A 3Q72A 1I2DA 2WWIA 4BZXA 4OHXA 3DM9B 4ZIRB 1XD8A 2Q9AA 2FEOA 5FH9A 4WZBE 5M04A 2IUSA 1OJLA 2HCBA 2BKEA 3C4JA 1HA3A 1KKMA 3WRXC 1DAEA 4BEJA 1XTJA 4BGDA 3SHFA 3L0OA 5E4FA 4HAWA 4MYTA 2CL7X 3ADDA 621PA 3U3KA 1ODFA 4JLBA 2CE2X 2V4ZA 3IO5A 4HB3A 4M1YA 4DLSA 2JIZD 4G01B 2FH5B 3T1TA 4V0NA 3NDBB 3E2IA 2WPDD 3RWMB 5JCPA 4KJZA 4Q1AA 4BPBA 2FZ4A 3PIRA 1XTRA 2Q0HA 2W2TA 1Q22A 1Z28A 4TYQA 2DFKB 3KB1A 3RWOA 3GLHE 2GZHA 4DLZA 5JEEA 2ZROA 1G7CA 1BYIA 4QJ5A 2PLFA 4YMUA 1DARA 4ZCIA 2ONKA 4HB4A 1BMFA 1KI8A 2CNWA 1PLKA 1R5NA 1Z6GA 3BIFA 2IF2A 3DKPA 4MDFA 2RH5A 5FL3A 3I92A 2WMNB 4KYUA 4ESVA 3KXIA 4HAZA 1T5IA 2ZJ8A 2O8EA 2A5YB 3ZZ0A 2GJAA 3RRYA 3T1QA 4FMCB 3OFND 2QP9X 2Z43A 3ZZUA 1II8A 4B32A 4CEHA 5UKDA 1U8YA 3GQBA 4B71A 1E32A 1G6HA 5GJWC 4B73A 4F4IA 1P9NA 3HU1A 1E9SA 5KSOA 2VP2A 5KDOA 3X2SA 3Q7QA 2FE4A 2P6UA 4DT1A 3KX2A 2C96A 1CR1A 5DYIA 2CVFA 1QHXA 2C9OA 2ZAMA 3QOFA 4PSAA 4DLRA 1L8QA 2IXGA 3I62A 1KI2A 1S9HA 1GL9B 5L3QB 3VNUA 2JJ8A 2WM9B 3FHTA 2QA5A 1U2RA 2NQ2C 1JEDA 3ZIAA 1E0AA 2G6BA 2O0KA 3QJYA 1M74A 3ZQJA 2WMOB 1UPTA 1XTKA 4PSKA 5G3ZA 2AN9A 3VHLB 1EG7A 1XEWY 2AK3A 3SYKA 4M8NE 3K70D 4IOMA 1S0UA 5AK0A 1ZCAA 1OXTA 1D2MA 5C4MA 1RRGA 3ND9A 3ZDQA 1D6JA 1CRPA 3L0SA 2FPKA 4EDHA 4XTCS 4D4KA 2ODNA 5JRZA 3LD9A 1L2TA 3NTUA 1BO6A 3UWOA 4Q4AA 3BD9A 3RSOA 3CH4B 3TIFA 3QSYA 3K0AB 1OH5A 2GCOA 1SVLA 5IK2D 1NVWQ 3U2QA 3REGA 4D4JA 3N5CA 4MGIR 3RS0A 1TF5A 4Q4LA 2ZYUX 2Q3HA 1JECA 4LJ8A 5FI0B 4JLDA 2XB4A 1K5GA 1CS4C 4LY6A 3WMEA 3PENA 1EK0A 1RJ9A 4NZYA 1SXJD 4M0LA 3AVTA 2CL6X 5C4GB 4NL4H 2YC4C 5F3WB 1PJRA 4NDZA 1HURA 2BJWA 2CDNA 4YC7A 3V00A 1NG9A 3NH9A 1PZNA 3AH8A 2NMVA 4QBFA 5L3VA 1P73A 1KOFA 4HLDA 2Y8EA 1FX0B 1G4AE 3K0FB 3NBYC 2EFCB 2OAP1 3WBKA 3LDAA 4BE7B 5J4YA 1GWNA 1ELOA 2XSZA 3MWJA 5DH9A 1EFRA 1ZC4A 2Q3FA 5HCIA 4BRUA 5HKKA 1IBRA 3B78A 4XD7A 3QBTA 4Q9HA 3SS8A 4KSCA 3THYA 4Q00A 3VQTA 1NBMD 3UXMA 2J0UB 1N0VC 5EUMA 2XJ9A 2OLKA 3K8YA 1S96A 1JPNA 3K70B 4R98A 8OHMA 1XXHB 3WY9A 3KJGA 1NL3A 5F9HA 1KGDA 2YYZA 2WSMA 1D2NA 4RFSA 3TVTA 4EFMA 1SZPA 1P7CA 3UPUA 2CK3A 4IEIA 4KODA 1KJWA 3THXA 2BCJQ 2E9SA 4V0OA 2BMDA 3OF5A 2IHBA 1G3UA 1XRJA 3QKTA 4PC1A 4C0QC 3E70C 5JS7A 4BLOA 3GLFB 2ERYA 3RC3A 4LOAA 1CJMA 3P26A 4TLBA 5D3MB 3Q5DA 4PZLA 1IJEA 1N6KA 1U94A 2EQBA 3DPUA 4NCJA 2J7PA 4P3YA 5FUVA 1LS1A 4DLVA 2JJ2D 2YWHA 1EFCA 3GLGA 2NO1A 2G0NA 1OB5A 1MR3F 2QM8A 3Q85A 1DAIA 1Z83A 1G7RA 3CUEF 2BM0A 3NH6A 3ADBA 2WWXA 3VR2A 3CNOA 1TU3A 2ZRNA 2LKCA 4YQFA 1BS1A 3SU8A 4A8JB 4NTZA 1DAMA 1IXSB 5FPYA 3KQNA 2QBYB 1YZLA 2DFNA 4M1MA 2VSXA 4LBYA 2ANCA 5E7MA 1VG1A 2UZ3A 4MA4A 2EYUA 3ADKA 1IJFA 3EA5A 2B6HA 4KVAA 2ANBA 2OZEA 2H8KA 4BFSA 2WAYA 3OESA 3EIQA 3MSXA 3I8SA 3VTKA 1TADA 2J41A 5TMPA 1G8GA 4FWTA 4LRWA 4B3GA 1DOAA 4M53A 2QL6A 4DSUA 3LRPA 5FTKA 2XOKD 2PT7A 2IL1A 3L0PA 1DEKA 1X6VA 1NI3A 1XMJA 1YKSA 3L0IB 3LNCA 4A6XA 4B44A 1RE0A 4N0DA 5HCNA 2GNOA 1W0JA 4LCBA 2FA9A 4KYIB 1A2KC 5HE9A 1MABB 3X1DA 5L3RA 3QENA 1K8RA 1R0XA 3OHMA 1H8ED 4QRHA 3NC1C 3LW7A 3A1VA 2NZ8A 4IXMA 3B8HA 2R6DA 3KQKA 4HAUA 5CM8B 3EWAA 2PCJA 3QI2A 5EZ5A 3QQ5A 2JLQA 1W0KD 2A2ZA 1YZNA 1KMHA 1OXUA 1G64A 2GXAA 5A0FA 3FFAA 4JVMA 1YE8A 4Q7LA 1G20E 5TARA 4FWIB 1OIVA 1P60A 4IVQA 3L82B 3ND8A 1FUKA 4TLAA 2IEZA 3CNNA 5JWRA 4BFUA 2DFTA 5ELXA 1GKUB 1TAGA 1KO7A 4DLTA 4CT4B 3AKCA 2ZR0A 1QHHB 2OHFA 1W36D 1KI1A 3PFIA 2XTMA 1UBGA 2IF0A 2GHIA 1IN6A 4JKYA 3UG7A 1SXJE 1TMKA 2WIAA 1VYVA 1Z6XA 2E87A 5FPTA 4OK3A 4C3ZA 1T9HA 4QBGB 1XDBA 1ZM3A 3U61B 3CRW1 4V0ME 4HLQB 1YZGA 1KK3A 2FGJA 1RYHA 4FD2A 1L4YA 1ZM9A 3WXMA 1J99A 2FWRA 4BQSA 1E2IA 2IUUA 3T06B 4A82A 2GWHA 1PUJA 2HV8A 2HYDA 2C78A 2IYTA 4LX0A 4RZUA 4D0GA 5JHHB 1E9RA 2IYWA 1J7KA 1TUIA 1COWA 4NYIR 1EFHA 2WZQA 2JCSA 2R8RA 1WDTA 3LFUA 3AVQA 5KDLA 1TTTA 1BOFA 1AQYA 4Y0VA 4Q66C 4CEJA 4LBZA 2ZSAA 1G3RA 1U8AA 1GKYA 1NBME 2WAXA 1E2PA 4Q7JB 2ODBA 5FL7A 5CK5A 4KI0A 5KNDA 5CK4A 3Q7PA 1DELA 2OG2A 1UFQA 4JT4A 4NP6A 5FI1B 3UK6A 5B58C 5JJLA 2H7VA 4M4SA 1E98A 4D0LB 2REXB 4FMDB 2XEXA 2V6JA 4FCWA 3EPLA 2HXYA 1OPXA 4IFEA 4LJ6A 2D3WA 5G40A 1KO4A 4ZDKA 4I81A 3FKSD 3GFOA 2VP6A 3Q8XB 2ZANA 3FGNA 2YC2C 1GVNB 1UJ2A 2QAJA 2RGNC 2QZ4A 4JL5A 3K0CA 4R9UC 4UQOA 4QBIA 4EIWA 3IBYA 1HUQA 3FE2A 2ZSEA 3BS4A 3A1WA 2NZJA 1P2UA 2YVUA 2YOFA 1P9RA 3CF2A 4V0MA 5SZKB 3RRMA 1WBDA 2JATA 4TTPA 1ZCBA 2REBA 3WBJA 2GRJA 1GSIA 2CHQA 1IY1A 2QORA 3CBQA 1KNQA 5LB4A 4HUQB 3A6PC 3BORA 3WNCA 3GFPA 3HU3A 1W2HA 4DBLC 4JBYA 2OCAA 2TMKA 1VTKA 2B8TA 3LVRE 2A7QA 3PUVA 3ECCA 2WSSD 1KHTA 3TK1A 1ZM4A 3GPLA 3D7MA 3TSZA 2F43B 1KY3A 2WOJA 3QF4B 3KQUA 3UMSA 4P33A 1NSTA 1VYUA 4BFYA 4F4JA 2GEUA 5LPNA 3MFYA 1E9FA 2QY9A 4U00A 1GAJA 2CCJA 3BBPA 2HF9A 3B6EA 1OKKD 3WMFA 4N1AA 4ARZA 2VSOA 2IYLD 4Q1CA 3WNBA 1TF7A 3W6PA 1FUUA 1N6NA 1T3SA 1E2MA 1DO0A 2HLDD 4I1OA 2GEDA 4LJ7A 3LLMA 3K0CC 2IA5A 1SVWA 1GILA 1W1WA 3GEIA 2PJZA 4RD6A 1DE0A 2QN6A 3CRQA 3EWSA 2OV2A 1SHZA 1VKJA 4G3XA 3ZYCA 2VO1A 1U9IC 4QL3A 4TSFA 5F2EA 4W7SA 821PA 2QTHA 1HV8A 4YDHB 2GVDC 1AS0A 5GJVC 1GFIA 1FNMA 3QPVA 3VAAA 1IOZA 4FXPA 1R6BX 1OE0A 1SKQA 2O8FA 1HTWA 4RD4A 4R71A 2OBMA 4OJQA 4RD0A 4WXPA 3LWNA 1U98A 4OQNA 3KXLA 3MJHA 4HEJA 2ZJBA 1E9BA 4JLMA 1ZBDA 4A8JC 4WBSA 4ASUA 3AM1A 1E2LA 4Y0AA 3BOSA 2YKGA 3EC1A 2O8CA 5EE3A 2BHRA 4XWOA 3T5GA 1ZRHA 1EX6A 4L15A 2N42A 2V54A 5J5CA 1IN7A 1GITA 2IYSA 2AKAB 4QNMA 6Q21A 4KVGA 1XPUA 3B5JA 3MWKA 4P4UA 1Q1QA 4A36A 4MKGA 1W4BA 1T6NA 2QI9C 4DZZA 3KDSE 2EFDB 1OLOA 3EC2A 2MMCA 3PEUA 4QGHA 4PQFA 3F8TA 3KUCA 4TL6A 4D4MA 1XEXB 1M7BA 1R0WA 4DDUA 1Z08A 2BVNA 2W58A 3ZH9B 3TKLA 3EIEA 4MUAA 1G8YA 3THWB 4JLPA 3Q9LA 1PVOA 1BMFD 4DJTA 2CNWD 1ZNXA 3PCRB 4IOKA 3FOZA 3O8CA 1SHKA 2XNSA 1Z6YA 3IUYA 3TUJC 2O8BA 2W6IA 4PSVA 2GJ8A 5FPHA 5FTMA 4PANA 1KI7A 3VKGA 3IQWA 2N1BA 5AJVB 1ZNYA 4Z54A 4TYWA 1OFUX 4U5XA 2P67A 2VYFA 3VR6A 2X19A 1ZNWA 4A1FA 3DMDA 3A36A 2V6IA 2JDIA 3G0HA 4QFMA 1PV4A 3I5XA 2FSFA 2W00A 2QPAA 2RGAA 4MRNA 1YR9A 1F2UB 3DZ8A 2VIIA 2X77A 3U44B 3QXHA 4FINA 1E2EA 3ZIAD 3LX8A 4ZV4A 2L0XA 3IILA 4URVR 1CKEA 1DBSA 1KAGA 3TE6A 2GESA 4DEYA 3IGFA 3UMFA 2WWGA 2PJRA 4KBGA 2HCJB 3W6NA 1WB9A 4O0MA 1F2TA 2ZU6A 3GLIA 3T1OA 1J8MF 3IPXA 5P21A 2YWGA 2ZETA 2XGJA 2W0MA 1GTVA 3EXAA 2ZRMA 4JJZA 1Q44A 3AVPA 4BFZA 1DPFA 2Z4SA 1XZQA 2FPLA 4QHTA 1AIPA 4DDTA 5DNYB 4LI0A 4Q1EA 4K46A 4PAQA 1DVRA 1FMJA 1ZIOA 1HYQA 4GOKA 1N5IA 3MLEA 5DI3A 3RAPR 4KLZA 1WE2A 3FFBA 4LDJA 1OFIA 4WOPA 1NG1A 1OIWA 4EUNA 4JZKA 2WVJA 2PZFA 3PITA 4NE2A 4TMZA 4L4UA 2LKDA 2IYXA 1E96A 4MYCA 1X86B 3H84A 1W44A 3SYNA 1GOTA 1N6IA 1XMVA 1U0LA 4BECA 4CRWB 4M1KA 3TUZC 2RGEA 2ZRFA 1U0JA 1N0UA 2AX4A 2P2LA 1EGAA 3QKUA 4M22A 5CLLA 1V5WA 4IOJA 3WRYC 1JJ7A 1XWIA 2A5FA 2YWFA 4RD1A 3ZQ6A 4GP7A 3RS4A 3LQQA 2GZDA 1NKTA 4CEHB 3F5FA 3HP1A 5JMTA 2I3BA 5GVSA 1NIPA 2Q9BA 2MMGA 4KITB 1TX4B 4TZ6A 1LFDB 1S3SA 2Q9CA 1A4RA 3CX7A 4A92A 4US2R 5SZJA 5JSZB 2Q6TA 4OQMA 5J4VA 3SZRA 4F93B 3DVLA 2XSZD 5HKKD 1EFRD 2R9VA 2ZJYA 5E7JA 4C7OA 1G8PA 3U3RA 4XD7D 1AKEA 4AURA 1E2KA 3LVQE 5L3SB 1Z6AA 3W34A 2HUPA 2ZUDA 4TMXA 2OXRA 4TQ9A 5FBQB 2XAUA 2WJHA 1CP2A 4JLAA 3VU9B 3EX7C 2A5JA 4JSYA 4A2PA 1G18A 3GLHB 4ZO4A 1NVVQ 1P75A 3B82A 3SN6A 3ETLA 4FN5A 4BWYA 1VYTA 4DSOA 2CK3D 4B3BA 3U3MA 3CX6A 1G5RA 3VX4A 3FMIA 5KUTA 1XP8A 2A9KA 1IXRC 4PAOA 4Q4AB 3REFA 3SNHA 1Q3HA 1NY5A 4NKRA 3UIEA 5C18A 1G6OA 5EQTA 1W4RA 3E1SA 4YXWA 5CB8A 5H8WA 4JYCA 4CVNA 2KWIA 2J7PD 2C5LA 2WJGA 5FPSA 5G53C 1XPOA 1H8HA 4C0AC 2QT1A 3W5IA 4DUGA 2AR7A 3NKVA 4ZI2A 1R5BA 2C77A 4OQFA 5TXGA 3U7EB 5KDDA 2VH5R 2EU8A 2XXAA 3U4QB 5FBWB 4QC2A 2IK8A 2MSDB 4QBHA 5FFMA 1MRNA 2HT6A 3CRMA 2OCBA 1OT3A 3NXSA 4Q5IA 1A2BA 2QSYA 3MAAC 2HYIC 3FWYA 1XU4A 4DVGA 3P27A 4IKEA 2IXFA 2MSCB 5HZHA 3VHXA 3AF2A 2ZS9A 2ZJAA 5DI9A 5K8LA 3W3AA 3FHOA 1WRBA 4RCYA 3DL0A 3NDPA 4D80A 1C1YA 3CM0A 1OYWA 4DWJA 3EZ7A 1HQYE 4E03A 3TMKA 1AN0A 1JXOA 3CLVA 4WA7A 3SHWA 2OESA 4RZXA 4DEXA 1W46A 1E2NA 3PUZA 1F48A 2R62A 4L9WA 2XITA 4GP6A 1W7AA 3I32A 1YR6A 2OEPA 1W0JD 1MKYA 3RS7A 3W90A 1YRBA 5FPKA 2ZQ5A 1Z0FA 2DHRA 1OIXA 3AP1A 2ODWA 1YZUA 1ZU4A 3OE7A 1SKYE 2IBMA 5EXPA 1RRFA 3CH5A 5DYGA 3SFVA 2ASEA 3I1FA 2DWOA 4TMKA 4B3CA 1UADA 3K1JA 2IYQA 4M9ZA 2D4HA 3AKEA 4KSBA 2JLVA 2BMEA 3CWZA 5EE0A 5FOTA 4YMVA 1Z0IA 2REOA 3BB4A 4UNQA 2HDNB 2IHYA 4JKIA 4URYR 1E4VA 2WBLC 3K0SA 4NCKA 3B2EA 1E0JA 1KJZA 4TLCA 2ONJA 5FOXA 3I5YA 4UJ3A 4V02A 5FUYA 4F92B 4DHEA 1DO2A 2IWHA 3FB4A 1QG2A 3N2IA 4HI0E 4O25A 5A5GA 4WAUA 1R0YA 3EZ2A 3T12A 1QRAA 2BWJA 3N2EA 1G3QA 2W2XA 4Q4HA 1ESMA 1E69A 1CEEA 4URZR 1I4TD 1G5TA 4UXIA 1RPZA 3L2OB 4TYNA 3G5UA 5BN5A 1I4DD 4ZKEA 1C9KA 2ZJ5A 4OI2A 1VPLA 4RVCA 2ZI6A 2VQSA 3AF3A 3DZDA 3ZS8A 3ZVLA 5H70A 3LV8A 2QQ0A 3TNFA 1QHSA 4B33A 2F1HA 4FIDA 4PTLA 1KSJA 3JZMA 1COWD 2CJWA 1ZUHA 3TLXA 2XX3A 121PA 1RVDA 1VG9B 2B21A 2JGNA 2Z0MA 5EE1A 1T5LA 2CE7A 1N25A 3IEUA 1CF4A 3F3YA 4YLGA 4DDWA 2AD1A 4B47A 2I4IA 1VG8A 1DAHA 2GJSA 2QENA 2QTFA 5KU1A 5HE8A 5IHPA 1KI6B 1PLLA 4NCNA 3SJCA 4XWKA 3KFVA 1A5TA 3AGPA 4D82A 2JLRA 2BEKA 4LGMA 3BB3A 2A5GA 3AP3A 2LWIA 4DIEA 3AVWA 3GJ8A 2QAGB 3P32A 4XVQA 4AY2A 4IVPA 2WWFA 1S1CA 4G0NA 1Z2AA 3PUYA 4WZ6A 1QHGA 2ZI5A 2ZSBA 1KY2A 5BWMA 5CJPA 2R6FA 1S2MA 4G5QA 4QXAA 2XZLA 2OE2A 5BQ5A 3GLGE 4ITRC 3TVDA 4C2TA 4LC0A 1T91A 2KJQA 2A30A 2CCKA 1YJ5A 2RGBA 4EAQA 4AC9A 2ZI9A 2RHMA 3BFVA 1D2EA 3NWJA 1B23P 2ZRJA 1E79D 1FFHA 3B1YA 3P4XA 4L5BA 4LUCA 3B1VA 4GDFA 1KO5A 3U7HB 2AFIE 1SULA 3QPWA 1NN1A 1US8A 5AJZA 5GJCA 2IYVA 4W9MC 2UVQA 1G9XA 1AM4D 3VR4A 4K8OA 4TQUS 4TL8A 3BB1A 5C1BA 2R6AA 4OK5A 1L4UA 3FDIA 2YOGA 1ZJ6A 3ONWA 4NPHA 2K5UA 1UKYA 3QBVA 2GF9A 1XCMA 1CR0A 1ZW6A 4C0JA 1DS6A 2FFBA 3GJ6A 3O47A 4PFSA 3QIAA 3AP2A 2ZRIA 4HLUC 1CBUA 4LPSA 4PHHA 2PMDA 1ZINA 1AKYA 1BKDR 4HAYA 4S2EA 2YJTD 3A4LA 1M7HA 3FMPB 2D06A 1WQ1R 3LBIA 3TH5A 1ZUIA 2V8OA 3HYRA 4XVRA 2F1RA 3KKQA 4MRSA 3L43A 2BBTA 2CHGA 1XCGB 3V4FA 1JXMA 1HT1E 1LS6A 1Z0JA 1TQ6A 2V7QA 1U0HC 1HQCA 2ZRGA 2ZYVX 3SE0A 4TSFD 1ONBA 2ZVPX 1KK1A 5JWOA 4NMMA 2I1QA 3QY0A 2RGDA 4Q1DA 2RMKA 2Z6VA 1VMAA 3LX5A 3MJRA 4Q18A 2YV5A 5CIQA 2H5EA 4EQ6B 4MYHA 2JLSA 1SXJB 1EWQA 1AGPA 5KPJA 1Z2CA 2MSEB 1W4CA 4LBWA 4TT3A 1UAAA 3CPEA 5F9FA 3NIBA 2C9YA 2F3TA 4DCTA 3SC3A 2B8WA 4WZAE 5FR2A 4B76A 1GL7A 3M1IA 2C95A 2NG1A 1M1YE 2NGRA 2D62A 2GJ9A 2VHUA 5KO2A 3QG5A 4GT1A 1UDXA 2GBLA 1E1RA 3W3ZB 1Z6TA 5CM9C 3HR8A 4IHQA 3TQCA 3VNVA 1NKSA 3D31A 3K9NA 2BDTA 2O5VA 2NPFA 1R0ZA 2DYKA 2QMOA 4URUR 5EJEA 2AWOA 3ASYA 2BKUA 3ZLJA 4DLYA 4J0QA 1GL6A 1EFTA 2C8VA 5CDFE 4BFVA 5C2JB 5L3QA 2QGZA 1XJQA 3AVXA 4F7WA 4NYMQ 4AKGA 2JLYA 3UG6A 5AUNB 3BGWA 2BEJA 2ZRLA 1WF3A 3QEOA 4PC2A 5FOSA 4IFBA 3X1WA 2J9RA 4GMXA 4XOIA 3GJ3A 4EPRA 4UNNA 1Y63A 2OUKA 5AUQA 3QKRB 1AZTA 3G82C 4KXFB 1R10A 2WOOA 3CR8A 1NVVR 4Q02A 4Q9IA 4I4LA 2W6ID 4AK9A 4CT5A 5J47A 2ZS8A 1OYYA 1XNJA 2DY1A 3F0TA 1G17A 3HR7A 1Q1BA 4Q48A 2O8DB 3A1UA 3PUWA 3PEVA 5EP4A 3DHWC 5BN3A 4QG7A 3A4MA 2CL0X 2BCGY 2P3SA 2GBLC 1KSGA 5IF9A 4JLJA 3AGQA 5DISB 3K0AA 2WWHA 1G3MA 4KFTA 2RGNA 4IDNA 2JDID 4PPNA 2NIPA 4H1VA 1N2CE 3O8BA 1HE1C 1KZGB 4RZ2A 1HE8B 4LSGA 3NEJA 2KI5A 3BH0A 3C8UA 4POAA 3OAAA 4OL0A 1N6HA 4GPTA 1Z07A 1TL7C 2ZRDA 4MITA 4IVRA 1IHUA 2EW1A 1D8TA 2J46A 4P4TA 4RKFA 2ZR7A 3HDTA 5CDFA 4JMPA 3EPJA 3DEFA 3RS2A 1YU9A 2BBSA 1IY2A 1FX0A 3K0FA 4LC1A 3CKLA 1NIJA 2KB0A 3AF4A 5EP1A 1S9DA 2EFHB 3T35A 2OCYC 2OFXA 3P4YA 4HZIA 4L9SA 2BMJA 2R6CA 4HSEA 1Z8FA 1J8YF 2F55A 2X1VA 3ZVNA 3KJIA 1UM8A 4LYHA 4RD2A 4BZQA 5KNCA 2IUTA 2J0UA 2NPIA 3FVQA 4YDSA 1MRSA 2P5SA 2EWWA 2WJYA 2QP3A 3B1WA 3BWDD 5DE3A 2OBLA 1XXHA 3AEZA 5JEDA 1VCOA 3CR7A 2J5XA 1UBCA 4B6EA 2Q21A 4DLWA 1Q1EA 2QAGC 1CR2A 1KAOA 2HJVA 2FFQA 1YZQA 4JVLA 1AQUA 2G77B 5L8VA 4PC3A 2ZSFA 1GRRA 2PX0A 1U9IA 4IJMA 3J81k 4M1WA 1W36B 2QGNA 1O3YA 4FW9A 2QUZA 4EJSB 3GLFA 5FBVB 3KKPA 1QHNA 5AR1A 5IK2A 4B75A 4JL6A 2FSHA 4HZUB 1V43A 4B3DA 2GXQA 2UKDA 4YONB 2KBFA 4R7ZA 3NHAA 5IRCD 2KE5A 3NVAA 4Q01A 1VIAA 4HB2A 5JS8A 4NYJQ 4WW0A 3VKHA 4UNSA 4HB0A 5JCZA 2P0EA 1LV7A 1E1QA 3CNLA 4RD3A 4QJ3A 1X3SA 4ZDWA 1Q20A 1LTQA 4A8JA 3BK7A 4DLUA 4JSTA 3QKSB 4W5HA 1T8UA 2QBYA 3RANA 4OQXA 1X8LA 4PQRA 3SFZA 2ZJZA 4BLPA 1NN5A 3K70C 3PV0A 4CEIA 3NBFA 1SVOA 4UNPA 1IAQA 1WA5A 2JAQA 3S1AB 1N0WA 5DI3B 1E9EA 5LBIA 4ESHA 4ABYA 1M2OB 4D0NA 1W48A 4YXWD 2F9LA 3D6TB 3KFXA 1E94E 5GVRA 3B9PA 1PUIA 1XD2B 1NN3A 4Q47A 4DUGD 5EXXA 2YWEA 2VP0A 3GFTA 5JZVA 4V03A 2Q3MA 1OXVA 3AV0B 1MABA 5JBQA 1GUAA 2OLJA 4JJKA 4AYWA 2JJ1A 2RCNA 1SXJC 4JVNA 3K09A 2C99A 1E2HA 1T8TA 2A3RA 3U5ZB 1CIPA 4LZZA 2BC9A 2OO7A 2QSZA 3V9PA 2F1IA 4IOLA 4KV9A 4M1SA 1N6OA 4I1VA 1YQTA 4X8MA 3OIWA 1OHHA 3U3JA 4Q1BA 4ZCLA 4PO9A 4Q4JB 4PQYA 1B0UA 4AG6A 2ZS7A 3GP8A 1KDOA 1QHHA 1W4AA 3MRSA 4LYAA 4O2RA 1P6XA 2J7KA 3IPYA 1S4QA 2ZRPA 3WYFA 2VRWA 2ATXA 1NLFA 2VLIA 3CB4A 1Z0DA 2QRNA 1GRQA 5KSPA 1WXQA 5K8UA 3KUDA 3UATA 4B3FX 1NNEA 1RC8A 1IONA 2PBRA 4P4SB 1XCPA 4QGAA 4LHZA 3GLIE 2I1VB 1N5JA 1ZC3A 4WXRA 3UKDA 1NVUQ 3A37A 4NU0A 4PHFA 4AD8A 1NY6A 3CF0A 2CLSA 4JBWA 3RABA 4R2IA 1ETUA 4C0LA 5KSYA 2ZPTX 1CXZA 3RDPA 1X1SA 4HYYA 4FCTA 2CLCX 1G3IA 3TQFA 2ZI4A 1E2GA 3WNDA 2ZM5A 4O2LA 1P61B 4US0R 3T34A 1N3BA 2JLZA 2ZE8A 3K09C 5AUOB 3IIMA 2FU5C 1Z22A 3KTAB 3LLUA 2NO0A 4AI6A 2ZREA 2FFHA 3ZJYA 1XPRA 1VHTA 3NHBA 2KSQA 3OEHA 4M9QA 5AJXA 1EX7A 4QGGA 2W83A 1CU1A 3B85A 2G9NA 1OF1A 1WP9A 2GCNA 1XTIA 2HEIA 1PLJA 2J0QA 4A2WA 3QPUA 2FV8A 5JJKA 4HUTA 2QT0A 2BBWA 3CF6R 1HEIA 3IBGA 4PXAA 5EXSA 5E3HA 2OFOA 3MGCA 5D3QA 5BYKA 1LY1A 3PEWA 4MQBA 1IM2A 3H1TA 2BIFA 4PHTA 2CVHA 3KXKA 2VSFA 3RRZA 2QE7A 2FPMA 1C4OA 3CRRA 3AB3A 4HUQA 2DB3A 1F6BA 2CCGA 3R7WA 1T4GA 1R8QA 1CLUA 1R4AA 2ECKA 4OI0A 2UZIR 4L8GA 2JA1A 1EESA 3B9QA 2W6JA 4IXNA 4MGYR 5GADl 2FSIA 4A15A 2F43A 2XNDA 3QF4A 1RW4A 3L8ZA 5FBRB 4M1OA 3KQLA 4IDQA 1P5ZB 2DR3A 2KBEA 4GZMA 3CZPA 2IXEA 1LNZA 2OSBA 4JLOA 2W2VA 3T15A 5HPYB 4GNKA 4W5JA 1XD9A 2QMEA 3TR5A 4R2HA 2RAPA 4OBEA 4DLXA 2O8EB 4GI7A 4QOSA 1GZSA 1K5DA 3TAUA 1JR6A 2G1KA 1Q3TA 3GJ4A 3D8BA 1II8B 3M4YA 3ZD6A 4LJ5A 3KKMA 1TQDA 1G19A 3U6KA 2H17A 1KK0A 2ZE6A 1DG1G 1W5TA 3QXJA 1RRCA 3GJXC 4HLCA 2QNRA 2QMHA 2FSGA 1H65A 2PLRA 1GNRA 3TW4A 4DT1B 1W36C 2QPOA 2C04A 1FP7A 2QQEA 4PZZA 4EJSC 3TR0A 2EFEB 3UANA 1RYFA 3RNLA 2IYRA 2WKRA 3ZD7A 1W47A 3VR1A 2GTPA 5EXTA 1MV5A 1JR3E 5J4KA 2HXSA 1P9WA 3BRWD 3FHCB 1BH2A 1J70A 4Q9JA 1WBBA 4B3XA 5EP2A 4KFUA 3GJ7A 1JNYA 2RGCA 5H68A 1SKYB 1ZD8A 2ZI7A 4BFTA 3TRFA 1ZD1A 4B2IA 3HYTA 4D25A 2XTNA 1XMIA 2QRZA 4LHWA 2CMKA 3T1VA 3IKJA 1CULC 3MCAA 4M21A 4DXAA 4F4CA 1I4LD 1ZYUA 2EYQA 5IDVA 5A4JA 4GFDA 4ERNA 1E9CA 4QHYA 1LVGA 1SVSA 1ZVQA 3H0KA 4KFSA 1QF9A 2IS6A 4TYPA 2J45A 2R6GA 2HJGA 2GCOB 2X8AA 2IS4A 4LJAA 1AS2A 3B13B 5KPDA 4QM7A 1W5SA 1ZM2A 5JFGA 3ICQB 1GIAA 1P3JA 5TB5A 3SDZA 3OEEA 2JEOA 2ZJ2A 5GJBA 1XEXA 2A5DA 2EFGA 4GBMA 4I1SA 1FTNA 1RJ9B 3C7KA 3RLFA 2V9PA 1OXXK 1YZKA 4TT3D 3W8NA 3NEYA 1IY0A 2J0SA 2GA8A 3WHLA 3CX8A 2NO6A 3THWA 3R20A 4KO8A 3I73A 2WJIA 4LK2A 1E6CA 5B57C 2PZEA 3LO5A 2WJVA 3NBXX 1G1MA 4HDQB 2IC5A 4PPQA 1VCIA 2ZYTX 3R9WA 4LHXA 2QROA 1KNXA 4I1UA 3AVUA 3WP1B 3A8TA 1MO3A 4ZKDA 1JR3A 3EZ6A 2X2FA 1FZQA 1GG2A 2RGXA 3BH7A 2ZI3A 4GOXA 1YHNA 1II0A 2ORWA 3N70A 1E1RD 5LB2A 4A0GA 1JBKA 3CIOA 3JVUA 5AJYA 5TDHA 1US8B 1G4UR 2VL7A 3THYB 2QM7A 4LYFA 4LHYA 4MGKR 4Q9KA 4AKIA 4UXJA 3D3QA 4G1UC 2Z83A 4TMVA 5CYOA 1AK2A 4NYIQ 2RHDA 1XMSA 4EPWA 1JALA 3THOA 3WYGA 2GVZC 5AWFC 3IDQA 1TEXA 1E2JA 4ACBA 1Z29A 1AZSC 2V1XA 1E0KA 1GM5A 4RFSB 4TZ0A 1XTQA 1UEJA 3LBNA 4DSTA 4NYJR 5H1YA 4HAXA 4TMWA 1F2UA 1UKVY 4AKHA 3U44A 3THXB 3SBDA 3M6AA 1DAKA 4URXR 3BERA 3DO6A 1XEWX 4DB4A 3JVVA 5K8IA 2Z5FA 2WIBA 2SHKA 3SJZA 2X2EA 2DPXA 4KU4A 5DN6A 1T0JB 4A0HA 5EUQB 2P65A 4TMTA 3GLGB 4MKFA 1OFTA 5HR5A 2F9MA 2G88A 4AKEA 4QHSA 5ANRB 521PA 2ZUBA 2AKYA 2J0VA 4JBXA 3PQCA 3ZVRA 1BYUA 1W49A 2YINC 3DMNA 1CTQA 3X1ZA 4O3MA 1NVXQ 1RRPA 4BLRA 2P6RA 1NF3A 1VCMA 1QZXA 1NLZA 4EPTA 2AK2A 3PR1A 2QG6A 5DIFA 5HZKA 4C30A 3AVOA 3KL4A 1U81A 3HJNA 3EPKA 3X1XA 3VFDA 5LD2B 3KKNA 4JT2A 3OAAD 4E5UA 1XFAA 2PMKA 3BH6A 1FOEB 1Q0UA 5CYPA 1GRNA 5KOYA 3RRNA 2AD5A 2VF8A 4PPGA 1FP6A 3TGPA 1E99A 2IEYA 2W0SA 4XJXA 1XBTA 2JLUA 1OH8A 4TL9A 1YR7A 1A82A 5TV2A 3HWSA 2CBZA 3GD7A 4BEBA 3SQXA 4TLDA 5DLQC 2GJKA 5CJ2A 1KI9A 4AIIA 5FL7D 5JSZA 4ON9A 2YHSA 3LXRA 2WICA 1M6NA 3W9YA 1NMXA 4FCVA 1O87A 4A2QA 1A7JA 2O0HA 3EG5A 3CRVA 5L3SA 4N0EA 4Q7KA 4PR0A 1F3OA 4Z1MA 4EPXA 2H16A 1Q21A 4RKEA 4B35A 4KCGA 1YR8A 4HLUA 4LPKA 3EIHA 3K0EA 2C03A 1N5LA 3BE4A 3VU9A 1KMHB 2AWNA 2VP9A 2WHXA 3GLHA 1P4SA 1OV4A 1Q12A 3QXSA 3ZS9A 1N6LA 1XJ0A 4I99A 4G5OA 4G5RA 5KTYA 4EKDA 4C0BA 2OFWA 2EVWX 4QNRA 2IWRA 1YRAA 2BOVA 1EWRA 1S8FA 4HAVA 4JLNA 4L16A 2RB4A 3CWQA 4CIDA 1BIFA 1WMSA 3LXXA 4OKSA 1MO6A 3BC1A 1UBFA 3I61A 1MO4A 3A1SA 2D2EA 4A9AA 1NLYA 4IDOA 1E4YA 4E09A 3C15C 2P6NA 4FMCF 3ZZTA 3ICEA 3EASA 5FBLB 3KJHA 5BW8A 2FOLA 4BRWA 4DCUA 2B92A 3BAFA 1VG0B 2CXXA 1E1QD 2GCPA 5JI2E 3U4QA 3NG1A 4URWR 3SJAA 1KYIA 3UMRA 4LJ9A 4MRVA 1AA9A 1KTVA 1L7VC 1S3GA 2AXNA 4Z8YA 5JLJA 4JS0A 2H92A 4ZIRA 4CEJB 2QU8A 1QVAA 1QBKC 3L8YA 5TY0A 1CJVC 4NBSA 5LDDC 1Z0AA 1AGRA 1ZAKA 4ZDIA 2VBCA 4JLVA 4KHZA 1KI4A 4C0SA 3DM5A 3EZFA 1JQLB 1G291 1RIFA 2C9CA 3BFXA 2IYUA 2LCFA 2A78A 5KSZA 2OXCA 1G21E 4ZCMA 3EW9A 4MRRA 2BM1A 1JEEA 2BMFA 1SQ5A 4LBVA 4QM6A 1N6RA 4GSYA 3QXCA 2ODEA 2VP4A 4UNRA 2CLDX 1GKIA 1F60A 1P62B 3R8CA 4D26A 3QG1A 2BBOA 4PPFA 4EPVA 1VECA 2GK7A 3AQ4A 4JYBA 3RS3A 1JJVA 3C16C 2GDJA 1Z06A 1LF0A 2JJ1D 1IQPA 2V3CC 1FPMA 1I2MA 3CZQA 4H9GA 4U02A 1A1VA 1N5KA 3P20A 1G7SA 3TW8B 4YMTA 3KQHA 2VHCA 4LHVA 3RS5A 2Z4RA 3I4LA 3PUXA 4ASUD 1FMLA 1ANKA 1KDPA 2BJVA 4P31A 1OHHD 4FMBB 1KZ7B 3TUIC 3V4RA 4XTRA 4UXHA 5G3YA 3AF1A 3QUSA 3OIUA 3R9IA 4EFLA 1K6MA 1MH1A 2B7CA 4EFNA 1JAIA 4BLTA 3SR0A 1IN5A 3H4MA 1VHLA 2VHQA 2ATVA 5EP3A 1HY3A 3SEAA 2H1LA 4X8OA 4V0LA 3PVSA 2ZRBA 4Q21A 4B2LA 4ARZB 1UKEA 2R2AA 2ZU0C 4Q03A 2QPTA 5FR1A 3OZXA 3HPRA 3FMOB 1XX6A 2PX3A 1XB2A 5FTLA 4CEIB 2VTKA 1OH6A 1S1MA 2XTZA 3I8XA 1R2QA 4ILEA 2R44A 1XEFA 1SGWA 2XZPA 4OHVA 3FTQA 4Z51A 4CYMA 3ZGXA 1X1RA 3AUYA 4PO1A 3HPQA 3W6OA 2GZAA 2JIZA 2QMUA 1AS3A 1ZNZA 2O0JA 3X1YA 1N6PA 2FG5A 2WPDA 3LA6A 5IT5A 2D7CA 2G0TA 2HT1A 1NMYA 1UDWA 3GJ5A 4BASA 3RHFA 1KI6A 1XXHE 3OIYA 2VF7A 4GMDA 5FOVA 3OEHD 4BFXA 4OHWA 4GL2A 2O8FB 1JQJC 3UWKA 1NMZA 1ZUNB 4LJ4A 1JI0A 1LB1B 4JLKA 4TL7A 1Z3IX 3WYAA 4XWAA 1OB2A 3GEHA 3TSWA 2QAGA 2VA8A 4TTQA 1CJUC 1YZTA 4TLEA 2GXSA 5J40A 2O8CB 3GLFE 1WCV1 4CDGA 1E2DA 1FQKA 1KIMA 4M9SA 3QNUA 1KSHA 1QVRA 2ORIA 3OFNA 3BFKA 3VMFA 5CLQA 3K9GA 4DKXA 4DDVA 1M34E 4PC7A 3OIVA 3Q5EA 5LD2C 2ZTSA 3DOFA 2QE7D 5DHFA 1E9AA 3PXGA 3GCGA 4X8LA 1M7GA 4MYUA 2AFHE 1CJKC 1ZP6A 4U7DA 3DOEA 1ZMXA 1KO1A 1OH7A 2OM2A 1QHYA 3WP0A 1NRJB 2PZGA 3NBZC 4EPYA 4TN1A 5EE9A 2F1JA 2W6JD 1TUEA 4LJYA 3FYHA 4BFWA 2DWPA 5SZHB 1R5OA 2XNDD 5FTNA 3TBKA 3IHLA 3CONA 5CB6A 5AUPB 4ZI3A 4JIMA 2ZVQX 3PG5A 1YVDA 1ESNA 3CO5A 3NC0C 3R9XA 3JZAA 5EE5B 1IN8A 3AKDA 1X8KA 2O8BB 3C5HA 4S35A 4AYXA 3LY5A 1CR4A 4XSHA 4IEEA 1P2SA 1G8FA 4RCZA 4TYYA 1T3LA 2GETA 3IQXA 4IRUB 4BLSA 1LF5A 2J1LA 2N46A 4Q19A 3VKWA 4BLQA 4DCSA 4DIDA 5BN4A 1II9A 1D9XA 3MD0A 4G5GA 2JLWA 421PA 1ZU5A 1HH4A 4XSGA 2WKQA 1OFHA 3RVBA 2G83A 3DDCA 3EPHA 5D3MA 4YMWA 4UKDA 5DO9A 3BXZA 5KNBA 3DKVA 4OJKA 3LQRA 4EQ6A 2RKOA 2O52A 1SXJA 2NO9A 721PA 1TU4A 3U6BA 4B48A 3QVVA 1Q1ZA 2E1RA 4DB2A 2JLXA 1QHIA 2GAOA 3U3OA 1F2TB 4PZYA 1UEIA 3GLIB 4K81B 1SVKA 4RY2A 1P2VA 4OHZA 3AVVA 1D5CA 5JI3E 5AJWA 2CHVA 4MGZR 2FFAA 3R7WB 1D9ZA 4KBFA 3B60A 1G7TA 4Z8XA 3W8RA 3MMPA 3FPAA 4XIGS 3CPJB 1E79A 4MUBA 2ZYWX 3B1ZA 5B64A 1FQJA 3SJBA 2YOHA 3T5DA 3VX3A 1FNNA 1IN4A 3KZ1E 4C9BA 3QF7A 4IW3B 1R7RA 4HDOB 4E07A 1KDRA 2ZUCA 1NBMA 2ZR9A 2NO7A 2XJ4A 4II7A 5FOWA 2PH1A 2WTUA 1XF9A 4MDEA 1E3MA 2PL3A 4NCIA 1H8HD 2VPPA 4BZPA 3OEED 5JJIA 4M1TA 4H1UA 3A4NA 1TNDA 5DHAA 4YMSA
chains in the Genus database with same CATH superfamily
3AEUA 2RFLA 3ZG6A 1Y1SA 2P5YA 5KHOC 4M9XA 5A0TA 3OM1A 1F51E 5DM0A 2ZTVA 3FPFA 3LW8A 1CEXA 3ZY3A 4RELA 3FRJA 2QUIA 4FT4A 4ZVLA 2GGSA 3E5HA 3ZCUA 2Y1OA 2IYYA 4R0NA 1ECBA 2DZDA 4FE7A 4BNWA 4IP0A 1GZ3A 1P2DA 1LJLA 1X7YB 1N75A 4I5DA 1Q57A 2O3JA 4BTLA 2IH4A 4FE3A 4LQ4A 4GIBA 4Z9AA 5AHOA 3A6EA 4NOMA 1HE2A 1QG0A 2JJ2A 2PU7A 4GDMA 2WFAA 2GO7A 4LJSA 1Z0ZA 2BZ1A 3TEJA 2PEYA 2CGEA 2FZLA 4Y1RA 3AK4A 1USUA 2JFGA 3PNQA 2XLBA 1V48A 4HRVA 3M5DA 3T38A 4BC1A 4EEXA 3L8MA 4D57A 1ICEA 4RSHA 1QYDA 3ZE6A 2ODQA 2FVYA 2NXCA 1MDBA 3S5JA 4CKXA 3IIKA 3A2KA 1ISPA 4D81A 3VKUA 2IPMA 3LYHA 4HMQA 1N32B 5KC9A 4PYLA 5ILQA 3Q0TA 4RPGA 4H35A 5A2QA 4XJVA 1H3NA 1Z39A 1JU9A 3EAFA 2AXPA 4JJAA 2HWYA 1KEPA 3G7NA 3VDXA 5K8JB 3LM8A 3ZHTA 1B3BA 4ZGGA 5K0SA 5LQUA 1X8JA 3SBEA 4YT5A 1FYVA 2NO4A 1E4OA 3S70A 3FNFA 3R8FA 1AQNA 2BD0A 3A1CA 3IIJA 3EVEA 3ZCTA 1GDDA 3UAWA 1JG6A 3IIIA 1ZXLA 2DPHA 2GZ3A 5E3IA 4O2BB 3O3NB 1J2JA 3FYUC 3FSJX 4JH0A 4OB8A 5L45A 1KS9A 4X85A 1CFJA 2V9ZA 2I4LA 1GN8A 1A4XA 3K9HA 5CR9A 2CJPA 2H57A 2OXEA 2J59A 3PDUA 5I7OA 4YAJA 2ZIUB 1Y1LA 3GT0A 3H5LA 3IEVA 1ZVMA 5DSZA 3S4YA 2GN6A 3FTDA 3HNRA 4GSLA 3WHKA 3WJ7A 4O1HA 3PEYA 1TQ4A 2X42A 4R40A 1IWPB 4MGEA 4UJ5A 3WJAA 3U4DA 1K98A 5LQJA 3DCYA 2F3SA 2I33A 4DMHA 2NSDA 3USZA 3EXEA 1ODSA 3BULA 4GZLA 4QUJA 5A6SA 4HC4A 4QU5A 2DP4E 2YASA 1Y8RA 5SV2A 3TM5A 4PO8A 4E5MA 5IPFA 1SG0A 2G36A 4WJLA 3RV3A 5EZ6B 4DPLA 1NQOA 2AX3A 2ZT5A 3GAMA 3RFVA 4BDTA 1W0KA 2O1SA 2V6FA 1LPNA 3E9DA 3IP3A 4HGRA 4UULA 1OFGA 3AR9A 1MX1A 4DTCA 3GL9A 3O8DA 2BGTA 1EHCA 3VPSA 2H11A 3L46A 4Q3NA 3IMKA 1DJQA 2IT1A 5K0BA 3F6CA 4G86A 1WTAA 4D4LA 3WLNA 4KP7A 2GASA 2HXGA 3FKQA 4O2AB 2WV9A 1GTL1 2WYVA 1QIJA 3Q7TA 1MXFA 4KIFA 1FB5A 2DBQA 2XRYA 2LNDA 5EHXA 1ENZA 1GNVA 3OG9A 1XHFA 2ZIGA 5HYVA 5L7TA 3MWEA 4XB2A 4G26A 1RJEA 2BYTA 4AWXA 3JVIA 4CIBA 1KL7A 1NP7A 3OQBA 4HZUA 4W1SA 4UOQA 3VR3A 4AYTA 2A3NA 1E66A 4MO9A 3DV2A 1SVIA 2QX8A 2ZKIA 3EQ9A 3ZVMA 2VK8A 1KIAA 1K0UA 3HRIA 2GBPA 5C35A 3WDLA 1E3QA 2GK6A 1UMDA 3BL8A 4ZHQA 4OYHA 5DT9A 3G8AA 4TMFA 1GSHA 1TVCA 1XZPA 1GUDA 1NW3A 3M4NA 4J91A 1BDHA 8ABPA 4OHYA 4XARA 1AQJA 1K2WA 2Q5IA 3MWGA 4PC6A 2AV6A 4UBLA 3LBHA 1P72A 4RZ3A 4X97A 5DB4A 4CPDA 4DC9A 3A27A 2ERXA 3CU5A 1Z0KA 4L4SA 5HQ3A 2OILA 3CPHA 3B8EA 3VTZA 4D44A 1X7HA 1E2FA 1RIIA 2RGGA 3WL7A 2IYZA 3H0CA 4IMRA 3EISA 3U4MA 2V59A 1Q74A 3A25A 3LKZA 3ZK7A 3W5DA 1IATA 1ULSA 3RUEA 5IT4A 3IODA 3TWOA 5BWBA 4EGSA 4F46A 1U8UA 1X7DA 4PBRA 1F9EA 2VPTA 3IP5A 3NTVA 4ERXA 2Y05A 3AKYA 1V11A 3OP1A 2P5TB 1XD2A 2EJBA 3T4EA 2ZITA 3DEYX 4LV8B 2IQIA 3HJBA 5FJIA 2ZSDA 1K5PA 1U99A 1Z5ZA 3WIVA 5A4KA 5JSQA 2PSJA 3NASA 5KS2A 2V55B 1A04A 3OT1B 4FNOA 1MPXA 4Q7MB 4I6EA 1SOUA 1A9ZA 3FMFA 1KPIA 1LW7A 1T9CA 3GDOA 4RABA 4LVCA 4UAUA 4E88A 3GGGA 4F2DA 2G9UA 2FP4B 2PS0A 4REOA 4LXHA 2VYQA 2Q5JA 3FWHA 1U1EA 4IVNA 2A7XA 1GXSA 2Y76A 1Z4IA 4CKYA 4TRJA 4I2NA 4G5SA 4ZTBA 5KNCD 2WIFA 2C2HA 2WWWA 5ESDA 3LUPA 1WCWA 3LPLA 3ZPXA 3PC2A 2FUG1 4DPMA 1U3TA 2W5UA 2HA3A 1P2FA 2C5SA 2WM3A 3JVEA 3M8KA 4IFIA 1LDGA 1Z56C 2A14A 2PU5A 2ZRKA 3MB5A 4LSWA 1KYXA 1REQB 1VSBA 3KB2A 3U9SA 4HX9A 4TWZA 3AB8A 2F8MA 2OKGA 1TQ2A 4KNYA 4DNXA 2O54A 1SFRA 3QEMB 4Q7QA 2SKEA 4Y2SA 3N0RA 2C2BA 3LQ2A 3C14C 4KQ6A 4A0FA 2PGNA 3HC7A 2DKFA 3MOSA 1O96A 2Q5HA 1U1DA 3VV3A 4D79A 1Y3AA 3DDUA 4US1R 3LKBA 3W5VA 5K01A 3CLRC 4M2LA 4YUWA 3FVWA 4U2CA 4E6EA 4F2HA 1EIWA 1WNTA 1Y0BA 2GKOA 1GU0A 3OE4A 4HDCA 1NP6A 3LKDA 2D8AA 3IA7A 1E6LA 3IDSA 3QVGA 1RFLA 1Q50A 2GXUA 1HC7A 2C4NA 4ZCQA 4K6KA 3B6KA 4N5LA 4H77A 5TS3A 1AMUA 1MW8X 5LP6C 1RKBA 2NTYC 1JZSA 2XZOA 1U1CA 3P19A 4MHOA 2L17A 1ZJJA 3VKVA 5C46F 1ZA2A 5BURA 2GEFA 3K8OE 4JP3A 5CITA 5A5VA 4O4JF 4UPVA 4HVTA 3PJRA 1I5RA 1LW6E 2NU6B 3R24A 1FVXA 4KRYA 2Y4NA 1F7UA 4X24A 1EJBA 1RQ2A 2JBAB 4LKRA 3WV4A 3EEBA 1E2QA 1NSYA 4ZAYA 1ZR2A 5A3RA 4U2FA 4JL8A 1W34A 1HDRA 2GF0A 2OAQ1 1SVMA 1YS4A 4FDMA 4J3FA 1HT0A 4MUHA 4Y6GB 1ZM7A 3MQ4A 4DIFA 3V2HA 1I5OA 1U28A 4R8KA 2D7DA 2J3JA 2ZRHA 5FUXA 2V58A 3ABQB 4FC7A 1FTSA 3ZNOA 4OQEA 4MV9A 4HUJA 3UMMA 1DFGA 1B8NA 1KVUA 2G0AA 3NHRA 2OCXA 5TF4A 1I2DA 5BMVF 1XTTA 3VJKA 5FH9A 2HMVA 2Q9AA 4CDMA 2FPGA 4Q4DA 2YDXA 1PFKA 1RM4A 5FA8A 4NX2A 4E2YA 3KOXA 1HA3A 1Y7IA 4CG3A 2VC2B 1XTJA 1B2RA 4MUFA 1JE0A 4HZGA 2AZTA 2PHZA 1LPMA 4D74A 3P2OA 5K3FA 3WGQA 3TLYA 5BNIA 2IYOA 3FB1A 3YASA 3ADDA 1Q7CA 3PBKA 2PO5A 5TGDA 3ZJ5A 3BXPA 4ER7A 4YR9A 4BDSA 3LWBA 2WE8A 3D6FA 3DZIA 2OV1A 4G01B 2R5NA 2CLIB 4LAFA 3T1TA 4N40A 3E2IA 2XPCA 2WPDD 3KCQA 3LYLA 4YCDA 5FYDA 2VAXA 3RWMB 4BKPA 4CMIA 5E9AA 3HR4A 4KJZA 3EMBA 2IW1A 3PIRA 3QOWA 1FPQA 1CWUA 1XTRA 2Q0HA 2W2TA 1Z28A 2XIJA 2DFKB 2C9ZA 4TYQA 3IMEA 2PRIA 3FCSB 3O8OB 1FFCA 4DLZA 1DEAA 1M2NA 1R6TA 1HSOA 2EW2A 5JEEA 1DARA 5BY2A 2XT9A 1K88A 4I1RA 2ZYSA 5DK6A 5AIBA 2VPZA 2FMHA 2XA1A 4OCZA 4JGBA 1HWYA 2O06A 5EKSA 4KPEC 3DA8A 2O9JA 4HYQA 5AJHA 4CG1A 2I2BA 4KYUA 2P9HA 2PD4A 4DN6A 3SS9X 4UCXA 1ZSYA 5EJAA 5CLGA 4QT4A 2K4MA 4JEMA 3G7SA 1XQ9A 4PWZA 3GJZA 3RRYA 1Y8AA 1II8A 4YUXA 2H07A 3K4HA 2CMHA 2NSYA 4CCYA 1UZMA 4KR2A 1E9SA 1JKFA 3LYUA 4FCCA 1ZGCA 1JDZA 3Q7QA 4N54A 4M7OA 1L4LA 3RUAA 4RUKA 3L0DA 5F76A 3KX2A 2C96A 1EQ2A 3C70A 3FYCA 3KEGA 3QY9A 4ZQBA 2CL5A 3TS1A 1QHXA 1UJNA 4PSAA 1IVYA 1PYDA 3M6IA 4L95C 4MWZA 3CEAA 5AW7A 2Y68A 4II3A 1HR0B 4AMVA 4G2TA 1SUWA 3UAYA 1JEDA 4IZHA 2XKBA 3A3YA 1SBYA 4XFKA 4BVGA 1EVZA 1GT6A 3MNFA 2OGUA 3BMQB 4QU9A 1CV2A 1GPJA 1I33A 1M74A 4DJJA 3QX9A 4PSKA 2VSNA 1XEWY 2G7ZA 3HVHA 4KO4S 5AK0A 3W1EA 3T5PA 1PYOA 3FNBA 3DYVA 5C4MA 3ZY6A 1YUMA 1CRPA 3EY4A 3IESA 1XRRA 4CKWB 5AW0A 4E14A 4QODA 2BFDB 2M1XA 4AZ0B 4XI9A 2W22A 3AWIA 5AYVA 4D4KA 1V8ZA 3OLQA 4INJA 2JHPA 2A9OA 1AO3A 4DQDA 3CCCA 4GI1A 4D8TA 4YY3B 4OUKX 3UWOA 4P3KA 3QU9A 3RSOA 1IQ0A 3CH4B 3TIFA 1V5EA 4GI2A 5CG1A 3UJBA 3TPCA 2GCOA 1E3SA 3AL3A 4FGZA 1XMQB 5IK2D 5LMCA 1I3KA 1IHPA 2QLJA 3FOBA 4ND3A 3N5CA 1YBVA 1TF5A 5LQAA 3ZDBA 1ZXXA 2H4WA 3L40A 1Z6PA 4JLDA 1VI5A 2OR3A 4GOOD 1FBNA 1T2NA 3CNBA 4LY6A 2EJUA 1PFGA 1GRCA 3L7CA 4HN9A 3D8SA 3LI2A 4K88A 2YN4A 4LGVA 3HCEA 4NZYA 1NRIA 3E3AA 2C7VA 4KW7A 2YC4C 4NVRA 2PTGA 3S44A 3ZHXA 1IBKB 5F3WB 2VUHB 3V1TC 2H4YA 3HQ4O 1L1QA 2OGWA 1FYDA 3TTUA 2WP8J 4ZREA 1RBZA 1WZNA 1CY8A 3H9BA 4GKBA 3L7YA 4P7KA 5HIKA 4LZPA 1KOFA 5IZCA 1G4AE 3NBYC 4ZCRA 4DV6B 4YAIA 3WBKA 4HCJA 3JQFC 5B12A 4BU0A 2ZCUA 2XSZA 3PNSA 5HCIA 1EFRA 3MUNA 5KWSA 4BRUA 3LCUA 1Z68A 2F17A 3DTVB 4KR9A 3BMOB 3HBNA 1KXZA 4Q00A 4Q3KA 3VQTA 1NBMD 3I01A 3UXMA 1DP4A 3DQZA 4LRXA 1XTVA 1YZ3A 1BX1A 4YQZA 3AOEA 5E0OA 2CLFB 2VLBA 1IC6A 4PE5B 3SVTA 1Q1GA 3D1JA 1GJRA 5BQ3A 4RFSA 1FVHA 1N3IA 4LF8B 1WVMA 3G8CA 1DBPA 1P7WA 2CK3A 3KHSA 3NWEA 3C48A 4KODA 4EY8A 3WYDA 3H83A 2AW5A 4NBKA 3MVEA 4P3XA 3PQEA 3WHPA 3C3YA 3OZGA 3GXBA 4PRZA 5F33A 4BO4A 1LSOA 3WSVA 4BLOA 1VXOA 2HGZA 1CJMA 3Q5DA 1U94A 1N6KA 1PR1A 2G09A 5FUVA 1I6LA 3JPYA 3C97A 2RH9B 1QJ4A 4JOCA 2JJ2D 3O4VA 4NICA 2E21A 4ZC8A 4OMFG 1EFCA 1S8OA 3R2JA 4BX9A 2NO1A 4FYIA 3R5XA 1I6MA 1IEQA 2QM8A 4GM4A 1EGMB 1Z83A 1G7RA 2AT1A 4RVUA 5FD8A 4N0MA 3U7IA 5CLJA 1AHPA 3CNOA 3L6EA 2F8SA 2JIQA 2AFHB 3SX4A 4NOKA 1CUCA 2O7VA 2O20A 3U1VA 4CGZA 1ENYA 1G6KA 1PJZA 1T24A 3R7NA 4NY1A 4JI7B 2DQKA 4LBYA 2H7YA 1HT3A 1VG1A 1DINA 5E7MA 3ADKA 2QT9A 2O2CA 2PJUA 3EA5A 3N05A 2P2NA 4NWIA 2ANBA 4F71A 5HFNA 3RYCA 3EIQA 4DBVO 2BONA 1XLTA 2CXPA 2X23A 4D9FA 1RXEA 2AE1A 1G8GA 4FWTA 1YI0A 1P5FA 4CKZA 3SSOA 1ZUD1 1GTZA 3DXZA 3FVRA 2IQ5A 3ENVA 3CLUD 1E9VA 3RSGA 1U1IA 2SKDA 3UT5A 1R8YA 2HK8A 2PWPA 1GCUA 2FQYA 1GU7A 1IHYA 3KB6A 4LY3A 4C03A 3BMCB 3KKZA 4L85A 5J58A 3LNCA 3L0IB 4OAPA 3EIXA 4B44A 2H31A 2D0DA 4H0CA 3AERA 3B20A 4N0DA 3BJRA 1E1CA 4C1BA 1CX9B 2CVQA 1GV1A 2FA9A 3B2QA 3QMWA 3RWBA 3V4VB 4AUKA 4C87A 4WEQA 1GCOA 4V39A 2CLMB 4G41A 1UJMA 2B4QA 4FBGA 2ZP1A 2D1YA 1M1UA 5HE9A 1MABB 3ZJ4A 3SVZA 3QENA 5JNTA 3O38A 2JK0A 5CHEA 1DXOA 4DS3A 1TTPB 1C50A 4OUDA 3A1VA 2ACVA 2WVAA 4Y2PA 1LI7A 2R6DA 5DX0A 1JWBB 2C54A 2CUZA 2YWXA 4HAUA 4Y8VA 3QI2A 4FPXA 5CM8B 3KQKA 2JGDB 2JLQA 1W0KD 4K6FA 5JXWA 5CUQA 1LRJA 3FR7A 4I4TF 4Y6SA 3CN9A 2GXAA 3N0VA 5T3UA 4C2BA 1ADGA 1BCSA 1J09A 2FLVA 3CUVA 2OAEA 4JVMA 1JTFA 3V8PA 1WMEA 5AHWA 3WHIA 4TXHA 3PJDA 3ICWA 3L0BA 4TLAA 1GKUB 1TAGA 1KO7A 4TVBA 4Y1RB 4YRLA 4HLNA 1ADFA 3EF0A 4WZAA 2YHUA 4MWDA 5I9LA 3L7DA 1QHHB 2OHFA 3M6MD 1KI1A 4UFNA 2XTMA 2OPBA 5E2IA 1PWYE 2Z3WA 1PNRA 2J3IA 4ZT2A 3UG7A 1TMKA 2LPMA 1XQVA 2Q6LA 1KOGA 4QBGB 3IOBA 3VR3D 3RVNA 3GZTB 4U4AA 3CRW1 1T5BA 4MR7A 4DAEA 4BO9A 2YZ7A 4N8EA 3KQYA 1YZGA 2IU0A 4CL8A 4ZO8A 4RVHA 1RYHA 5BMOA 1HL7A 3PF9A 1BXKA 2FWRA 4MO2A 2UUPA 4IV0A 3GJSA 4ENUA 2GWHA 4RZUA 4YJHB 4EO7A 3OCWA 1NNLA 4AJLA 4F0JA 1THZA 3MJ4A 2PKYX 2C3MA 5FLKA 2ZUSA 5AIAA 1TUIA 4JP8A 4O29A 4LE0A 5FO1A 1U7WA 2D2IA 2JCSA 1J1IA 3AVQA 1U3GA 4WCVA 1H6CA 2XECA 4OIFA 1SXHA 1AQYA 5AKIA 4L3WA 4Q66C 1WSWA 3MOIA 1G3RA 3B7PA 1ATIA 4UTZA 5HMLA 3H9CA 3V7NA 3KSDO 1CB0A 3THRA 1KFBB 3CW9A 3GUYA 4HOYA 1EFKA 2VDPB 5DZSA 5J63A 2OFFA 2VNKA 5BNWA 1WUHS 2B61A 4KI0A 4I19A 1ESZA 4IYRA 3Q7PA 1D7AA 1NPDA 1UFQA 2OG2A 2UZAA 3F78A 1M8FA 3H8SA 4C3UA 2P7HA 5AI0A 1QP8A 3ZCRA 5CLHA 2REXB 2O2ZA 3OCVA 2XEXA 4FCWA 3EPLA 2C5FA 1WKCA 2FOIA 1VRWA 4LJ6A 5AHRA 3UXEA 5DNWA 3K73O 4HEA6 4I81A 2VP6A 3T7KA 1DNPA 2ZANA 2Q1WA 3FGNA 4BMOB 4YT8A 2X5OA 3E9QA 1HORA 2D1FA 2QZ4A 3I6MA 4KL8S 3LQ4A 4UQOA 4AO7A 2ZWVA 2DUJA 3IBYA 2ZIFA 3P7MA 4KQFA 2ZSEA 5FV7A 1YFJA 1DQRA 2NZJA 5HFAA 3TQIA 3CF2A 1P9RA 5MN6A 1OCEA 2REBA 5ALMA 3SIPA 2CSXA 1IY1A 3MWEB 4HNAB 1O7JA 1O6ZA 2WF6A 1KNQA 3A6PC 3FR8A 3UMJA 3BORA 3ZLVA 4B3RB 2XDAA 1W2HA 4JBYA 4KPFC 4M0KA 3I6YA 1KH3A 2A7QA 4UBOA 5M29A 1R15A 2QMYA 3OOHA 1GG8A 2V74B 3ULKA 2D00A 3ITDA 5EEHA 4NBLA 3I9OA 3LBFA 3GPLA 2C5AA 1X94A 3IPLA 3L18A 1ZD4A 5BT8A 3D7MA 3TSZA 4EB0A 2VRCD 1D2RA 1I2BA 1TAHA 2PDAA 3L6OO 2EP7A 2HSJA 2WOJA 3QF4B 4I3FA 5DYYA 3UMSA 3RS9A 2PXCA 1XLVA 2GEUA 4DM7A 3PXXA 3TPFA 5LPNA 3MFYA 1M0SA 5DYWA 2RBKA 3H11A 3KSAC 5EXDA 2O2GA 4BLWA 4EYEA 1P31A 3NKLA 4L28A 3EGIA 3MCTA 3TQSA 3CNQS 3WMWA 2X0JA 3UOAB 1SU4A 3NIFB 4N1AA 1P0QA 2FSSA 3ECAA 3JWGA 4E5PA 5HQ3B 6CHYA 1A4IA 1I2ZA 1A50B 2HJ9A 3VSBA 3WNBA 1DKRA 1TF7A 4Z2YA 5KKNB 3UPTA 1FUUA 4M9RA 1T3SA 1XMXA 4BJ3A 3G1TA 2GEDA 3CVUA 3I5MA 3ISVA 3LLMA 2P91A 1OWMA 3K0CC 4I50F 4PHCA 5T8KC 1QFJA 4BJ1A 3F8SA 4INOA 2QUBA 1GILA 3JQ7B 3GEIA 3L4EA 4IJUA 5ENZA 2F64A 1T4CB 1KU6A 3EWSA 2VHWA 2FW9A 1CC1S 3OO0A 4DRYA 1CHDA 4Y9UA 5FQOA 1JJBA 2BHSA 3NP7A 2BEUB 4IEFB 4RF3A 3WKCA 3ZNPA 5JQGB 4LFBB 2GX6A 2H1HA 1QYXA 2B83A 4OGFA 3MRVA 4RA6B 2BGLA 2QTHA 2XMPA 3LP6A 1HV8A 3GEPA 3O6VA 2GVDC 4YDHB 1AS0A 3ZWYA 4XQ9A 1W75A 2B34A 2VDVE 4JAVC 5IFKA 2ZCJA 1Y3BE 1N2GA 1FNMA 2A9RA 2O6HA 3NAQA 1MFZA 5HILA 1IOZA 3VAAA 3ZK8A 3JWHA 2OCDA 2BKXA 3H8JA 1OE0A 3FNEA 4FXPA 2I62A 2OP0A 4K6MA 2B4YA 2OBMA 4OJQA 4RD0A 4CL3A 1ZUNA 2IHTA 2VT6A 1YR1A 4JX9A 1SBNE 1K4MA 1YRLA 3OQVA 4X95A 3AL0C 1CK4A 2X0NA 3MJHA 4HHEA 4I9HA 4QTYA 1E9BA 1GUBA 4I4NA 3ZWAA 4JLMA 1T8SA 4P4LA 3AC0A 1VA4A 4JUFA 1O5OA 4EQZA 1TRKA 2PLNA 3EC1A 4G4JA 4B6QA 4MRMA 4MLZA 1JDJA 1PR3A 5BNFA 1EVJA 3AHEA 3NT4A 3PDIB 4NECA 4BXOA 1FXWA 4R83A 2AKAB 3GEDA 2P4QA 4BGEA 3MWKA 3NHPA 2DKOA 1JLLA 3IMGA 3PHHA 4UD6A 3SC2A 4KXVA 1EUDA 4MKGA 1BA2A 2QI9C 2NV6A 4J16A 2AJDA 4RHCA 2H5LA 5CURA 4Z6KA 3DAGA 1B73A 3TMAA 4B8ZA 4LDRA 3EC2A 2MMCA 1MQ9A 5KQSA 1IK6A 3IQHX 4NBNA 1P18A 4D4MA 1XEXB 1ZGAA 4E2ZA 4M9CA 5IJ0B 3OP4A 4PR3A 1R0WA 2BVNA 3CB2A 1YSCA 2JGAA 1TO1E 1V71A 2ZJ7A 3IJRA 2IBTA 4F1JA 1ZCZA 3L9XA 1SQSA 3THWB 4JLPA 4RMIA 1YDMA 4RSRA 3SKXA 5JFOA 1O5TA 4DJTA 3VNAA 4GWKA 5E9QA 3K6KA 4YMGA 2W7TA 1B93A 1RM5A 1SHKA 2Y1CA 3R0XA 3TUJC 2FEKA 3KZCA 4G97A 4L2IA 3CVVA 2ZQYA 5KVCA 1E6UA 4NZOA 2Q46A 3EG9B 2X0DA 3W2IA 5A02A 4IKPA 1JI3A 2HA5A 2HKIA 4D4IA 1NJ1A 2FWIA 3U44B 3BWCA 3IQWA 3NP9A 4HFJA 2MT9A 1ZNYA 3SLRA 4MPTA 2HOQA 3PUIA 1SZCA 3SS7X 1E3LA 2FMUA 3MQ2A 1IDN1 1AF4A 2O2IA 4BNZA 2X19A 1XALA 2EBFX 3OJWA 1KJ9A 1KR2A 4XQ0A 2H0RA 1ZNWA 4GL4A 3R3SA 4A1FA 4OLBA 3A36A 1N5RA 2X86A 2ZB3A 3TXYA 1X87A 5JH7F 2D54A 4Y6RA 4MVJM 4GD3Q 5E8RA 2G80A 1N9GA 2PGLA 3J81A 3RD5A 2GKGA 4MRNA 5IAAA 1JHUA 4DREA 2VIIA 1RC1A 3BVPA 2H9AA 1E2EA 1MD9A 1U2DC 3IILA 5LKRA 1CKEA 3TE6A 1KAGA 4Q3BA 2GESA 2I1LA 3AM3A 3FI9A 2PJRA 1ZHHA 4BVBA 4HDRA 2OQVA 1WB9A 3M34A 1F2TA 4V2IA 4XXHA 5KHLB 5LR6A 5JCOC 3GLIA 1SPXA 1JEAA 4TV9F 2XGJA 3DJYA 2C7BA 5EGNA 4WGGA 3KVVA 2FPLA 1T0IA 3KP1A 2QN3A 1T2DA 3RC1A 5BRJA 5AKZA 4LI0A 4WCDA 4RIEA 4Q1EA 2COKA 2BFOA 4K46A 3FPEA 2L42A 2YV3A 1DVRA 4PAQA 5F1OA 5I9TA 3WZ2A 3ORQA 4GOKA 1N5IA 4IIUA 4LRQA 4RZQA 1N9KA 1U8FO 3RAPR 5JXGA 4WKPA 3JAWA 4IQ4A 4BZZA 4EG6A 3TNDA 3GZNA 2VQDA 3H75A 5DBGA 5DCYA 3FBGA 1XZCA 2FUKA 2RGYA 4KX3A 1O8BA 1X86B 5EIFA 2XNKA 3H84A 3I9MA 3OZUA 4DDWA 5HKAA 2ZULA 3P2EA 1ZWLA 3AR2A 3FH0A 5LQSA 5T57A 1XMVA 2QWXA 2CDBA 3GAAA 4M1KA 1X9IA 3AZOA 3TUZC 3TECE 3AR5A 1ZH8A 5CLLA 3WRYC 1P7ZA 4IOJA 1PT5A 4J4HA 1XWIA 2G9VA 4E5KA 3AV3A 1C0LA 5ER9A 4RETA 3KE9A 3CTPA 3CWCA 3F5FA 4ZV9A 3H1FA 2OHOA 3HVUA 5CTJA 1RAGA 2Y1DA 1H9BA 3V1KA 4KITB 5ALSA 5JS1A 3F7OA 1S3SA 4DARA 1A4RA 3CX7A 3FFTA 3OO1A 4IG9A 4X6LA 2Q6TA 2F62A 4OQMA 3WQRA 4DANA 4PLZA 4OQ4A 3VHRA 4FDLA 2P78A 4HEA1 3SF0A 4CLEA 1PQWA 3AEKA 4F93B 2XSZD 3D7SA 1EFRD 2R9VA 2IYEA 1G8PA 1A98A 1GFWA 2F9FA 2QXYA 2RONA 2WFLB 3B3FA 4RTRA 5ICGA 2VT2A 1D1QA 4BN5A 1E2KA 3LVQE 4M8SA 3DW1X 5LFAA 1LSSA 2WABA 1UBRS 1SY7A 1XGKA 1ZHFA 1VL5A 3PXUA 4MV1A 2ZUDA 4DIMA 4BUCA 2VKTA 3D1LA 1EBUA 3TE7A 2VNAA 5IWAB 3S2YA 4ALNA 3JX9A 2JVJA 4JLAA 3VU9B 1JIUA 5CA0B 4IX1A 1G18A 2AG1A 3MTGA 4XYEA 4ZO4A 4A2PA 5K8CA 3B82A 1N2BA 3HKCB 3ETLA 2PIAA 3EVBA 3GRZA 3NHJA 5DBFA 3SN6A 1ZJWA 4W5NA 1Y6JA 4DSZA 2LVBA 2VYNA 4FYMA 4H7KA 1QDUA 2CK3D 3BE6A 4H27A 4QXPA 2R5WA 2JFWA 3CX6A 3GDFA 1KC3A 2BR5A 4FDVA 4CHTA 4KUGA 1XP8A 4ZK2A 2JLCA 2V7XA 4QELA 2OENG 5KUTA 2OBBA 3E84A 1GEEA 1I01A 4ZOAA 4F72A 4CV1A 5SYAA 3RK4A 5EQTA 5CB8A 1PG2A 5CMLA 4JYCA 4LI3X 4CVNA 2KWIA 1H1TA 1SPBS 1ZWKA 2ES4A 4HFNA 2VTDA 2QT1A 3EEQA 3IEPA 4L5IA 1W1UA 3OX4A 4ENRA 4TM7A 3SC6A 1V2GA 1R5BA 3M1YA 4UCFA 1A4UA 4XCXA 4OQFA 3DLBA 4F96A 3U7EB 1MQSA 4C22A 3RSFA 4EECA 1AHNA 4C7MA 3FKJA 4DYVA 2XNCA 1NQAO 1XZBA 2EZ8A 5FFMA 4I5IA 2HT6A 1G98A 1HE4A 1JU3A 4MINA 5K03A 3MTJA 2HADA 3ESBA 2H2WA 3NXSA 1UDBA 1IZYA 3P27A 2IXFA 1PEDA 4D0GA 4BMSA 4KOAA 3QX7A 1TZBA 3V4PB 3MSCA 2W8ZA 2QTVA 3DLPX 5EWJA 3FHOA 3VYTB 3DL0A 3NDPA 1KJJA 1C1YA 2Q4RA 2YXLA 3BEOA 3WLLA 4YJ2F 4P0QB 3OOSA 4DWJA 2E5LB 3IB3A 1AN0A 2NVBA 5HS4A 4RZXA 4DEXA 1W46A 1E2NA 4XYBA 1F48A 4BNDA 4D8VA 2AJLI 2PX2A 4QOHA 1LJ8A 1UBJS 3F74A 2PA3A 4HTAA 2JZOA 3AW9A 1WOYA 5A5FA 4KQIA 2C8LA 1WQ4A 3ACBA 2OEPA 3K6SA 1NDQA 3CIFA 5DNVA 2D0IA 2ZT7A 4YB8A 1YRBA 3A9SA 3N59A 3O91A 3P94A 3ZOKA 4GF5A 3ETHA 3H2ZA 5EXPA 4K05A 3CH5A 3SFVA 1HXHA 1T36B 3I23A 4CLOA 1T3ZA 2PD6A 2V7PA 1BE0A 1KQFA 4TMKA 1EFVA 1UADA 4M9ZA 3U5TA 3O94A 4Q9AA 3C3PA 2C9DA 3GT7A 2JLVA 2BMEA 4ID3A 5EE0A 5FOTA 1JFLA 5GWXA 5KTMA 3UHPA 1NXVA 2IHYA 2QQFA 3EIFA 3NV9A 1QVWA 1H9CA 3PC4A 2D3TA 2HA2A 2HDWA 5CVVA 2OD7A 3K0SA 3I42A 1SUDA 4MQEB 1N8TA 4BO3A 3B2EA 5CNJA 2I80A 4EAAA 2UXBB 1OFUA 5DK4A 3I5YA 5FUYA 4EB3A 4QPZA 4DHEA 2IWHA 1T9BA 5A5GA 4O25A 1FZTA 1CUWA 1I14A 4UPDA 3NMUF 3JZFA 4MS3A 4DA7A 1SXIA 2O6LA 4HGOA 4GPBA 2FX5A 2N1MA 2W2XA 1J25A 2P3LA 1TZCA 3AESB 1ESMA 3MYYA 3N28A 4GOND 1A9RA 4UZEA 3V4SA 4RL6A 2WTBA 1I4TD 5KOIA 1V1RB 1G5TA 3OD1A 5K2MA 1RPZA 1ACJA 2BM8A 1M8GA 1LH0A 2RKBA 2QRMA 2OVBA 3IDZA 3WL8A 5H4GA 4TYNA 3OZAA 1AKUA 3BGOS 4FR5A 2SCUA 1JR4A 3ZXSA 3HUFA 1BCRA 4O5OA 3ONEA 2H52A 2V7TA 2ZI6A 4FU0A 1RWQA 3N8KA 1GQQA 2X4IA 5AM4A 4WGFA 1PSDA 3BIJA 1NU6A 2QQ0A 3LV8A 4C4XA 4YJ3A 3H65A 4PTLA 4K5QA 4MEBA 2AC4A 4I14A 3AR4A 3HFGA 4C4RA 2BZGA 5HJ7A 2G63A 2B69A 4F56A 1S3IA 1N25A 3DD1A 2H4ZA 5M7EA 2PD3A 1CF4A 3ZK9A 1ZG3A 3HBAA 4B47A 3FBWA 1L4GA 1MC1A 1VG8A 2FAXA 5REQA 4BZWA 3JQQA 5HE8A 4CKEB 2JRCA 5IHPA 2MR6A 3TLGB 4NCNA 1IOVA 1OYVA 1BMTA 1SBQA 2R1VA 2ETXA 3EQZA 4Z0PA 3A6ZA 3AGPA 2WTEA 3LUHA 1XU7A 3PZBA 4D99A 1FS4A 1HYBA 5F9MA 3W7BA 3WGGA 3KHUA 2P6MA 4JI0B 3P32A 4BO7A 4IVPA 3N6VA 4AZ3A 2QX9A 4M86A 3H4IA 3U0BA 1Z2AA 2WUWE 3PUYA 4W1QA 1DRVA 4BMPB 1Y6FA 3AILA 3V46A 1USGA 3G2LA 5CJPA 3RT7A 1S2MA 1BHSA 2R8OA 2ZB2A 1WDMA 4XIIA 1GTSA 3UK0A 4HEQA 3GLGE 1X1DA 3OTGA 1V37A 3TVDA 3QW2A 1T91A 5THKA 1OGYA 3SOZA 5A1TA 2RGBA 4ZAVA 3AI2A 4X0EA 3RU7A 1F9AA 1PHPA 1H4VB 1VHDA 2PZJA 1B23P 3FWZA 3EDCA 4P08A 1GAXA 4L5BA 4WE3A 1VBNA 5DM4A 3QIVA 1TKBA 1VDMA 2AFIE 2B30A 3L49A 4UMEA 3RFTA 2PUFA 3PFNA 1VLZA 2UYGA 4W9MC 3RTGA 4LC9A 3D8NA 1J56A 1WLYA 2X6RA 3R6WA 4K8OA 1TW2A 1Z5GA 2QYSA 2G9QA 3LX4A 2R6AA 3PD1A 1L4UA 5MFZA 4NPHA 2WHQA 3G9ZA 5GPBA 3QEBZ 1XMOB 3SF8A 1C1XA 3EPPA 3I0NA 4M1QA 3ZTWA 4YMLA 1OI7A 3ML1A 4FS8A 4PHHA 4QQRA 3FZQA 1XVIA 1TD1A 4JN6B 4HAYA 4JEHA 4MQFA 1YNOA 2R4QA 1YB6A 2OK7A 3C5VA 3S2IA 3LBIA 3MOGA 4IF4A 2RCYA 4IWNA 1OX5A 3QHAA 4YP1A 2NUTA 1EA7A 1PL6A 3FCAA 3UUEA 1R4NA 2RAUA 4BP3A 5HX7A 5D86A 1JT9A 2BBTA 4ZTUB 1XO1A 1E89A 1LX7A 1XA4A 3RJ9A 3V4FA 3PC3A 5CH5A 5FEUA 2V7QA 5D5QA 2HPVA 1V4NA 1Y81A 3LCMA 5CT4A 1TYDE 1ZCJA 3K9WA 1L5HA 3G6KA 3SQNA 4HKTA 1OFVA 3MJRA 3LX5A 1VMAA 3RU3A 1IK4A 2Y1KA 2YV5A 4QO7A 4P0PB 4EQ6B 5T5QA 3OVMA 1YZVA 4X1OA 3WKDA 4MV5A 3PFCA 5KPJA 3MD9A 1W4CA 5LYYA 3B48A 1QR6A 1FYFA 3EMDA 2OZLB 4DNQA 3NBKA 4TUYA 3VPDA 2Y1WA 1PX2A 4PN3A 3SC3A 1FJXA 1UH5A 3OHSX 3DC7A 5FR2A 4ZHSA 2Z9BA 3ENZA 4UZSA 4CMJA 3LJKA 2NG1A 4P80A 1L8AA 3T52A 4FLMA 4ALIA 2NUBA 2NGRA 5KO2A 1LBEA 2CDRA 3PLAE 3QG5A 1A9TA 4GT1A 4AJKA 4U7HA 2V0NA 1GDHA 1JRLA 1Z6TA 3TRDA 2GNPA 1UAGA 4IHQA 3MPUA 3LA8A 5JZBA 2AN1A 2FZWA 4BQRA 2NPFA 2OBXA 1JHDA 5H81A 2HL6A 3H2JA 5EJEA 3MB8A 3AY6A 1IQUA 4O02B 2Z2XA 2AZMA 3BYZA 3VC7A 4CR8A 5JCXA 1X15A 4N7JA 3ND7A 1VKNA 2H2DA 3AU9A 5CXSA 3T95A 5FHQA 4MVCA 3TM4A 5J2UA 1EFTA 1WR8A 2GSWA 5CDFE 1QWSA 3H99A 4BFVA 3FHJA 2Q99A 3EE6A 4RM3A 5C2JB 1D09A 4RSMA 4F7WA 1JSXA 2BJHA 3SD7A 1EB9A 4J49A 5IFLA 2YIDA 3O4HA 4ZVQA 3SC4A 3SZMA 1HNWB 2GM9A 3WQQA 3HSYA 4UNNA 3TLKA 5EJ9A 1AZTA 3G85A