4JSYA

Structure of clostridium thermocellum polynucleotide kinase bound to gtp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
b'SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 63
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jsyA00
1JPNA 4W5WA 3ZH9B 4AC9A 5KNDA 4DUGD 1YR7A 1AQUA 3T1QA 3LX8A 4NTZA 5KYKA 5TY0A 2ZE6A 4B3GA 4DDTA 1W5SA 4QM7A 2FPKA 4IVPA 5EXPA 3RS4A 3FKSD 2GVZC 4ERNA 1XPRA 1S1CA 4TMTA 5DN6A 4DLVA 2FFAA 2HLDD 1XJCA 3CX6A 2J7KA 2ZM5A 1CRPA 2ORVA 3KJEA 4ASUD 4PC1A 1UPTA 2F1RA 3UMRA 3UK6A 3DM9B 3K0CA 4BFVA 1S4QA 3MAAC 5HKKD 2OG2A 3QQ5A 5B58C 2E1RA 3T1OA 2ZE5A 4PC7A 2CL0X 3GLIB 5BYJA 1XWIA 4DSTA 4B48A 2D4HA 1NN5A 3AUYA 3RRMA 4CYMA 4ZO4A 5JZVA 2ZS7A 2QE7D 2J0QA 4IOLA 5EXTA 4RD4A 3GFOA 3THOA 3I8SA 5B2ZA 2XJ4A 3VFDA 2VF8A 3VR5A 4IOKA 3X1DA 4MRVA 4MKHA 3VR4A 1ELOA 2JA1A 2R2AA 2V6IA 3B13B 1XD8A 2W6IA 4ITRC 1XMJA 4NDZA 3SS8A 1KAOA 1ZD8A 4BASA 2F3RA 2QMHA 4CGZA 4HUQA 5JLJA 1E9EA 1ZUIA 2ZRIA 1EFHA 1R8QA 2B8TA 4JT2A 4C2UA 1E3MA 4F4CA 4URZR 1A2BA 2NPFA 2H18A 4F93B 4HB3A 4TT3D 3P4YA 4NCIA 3VR6A 5LBIA 3X1ZA 5DH9A 1Z22A 4DSUA 3U7GA 4EJSB 1KK3A 1YZNA 4P32A 4B33A 3CNNA 3I3SR 4JLJA 4TLDA 4BEBA 1CJTC 2CE2X 4PPGA 1NMZA 3TAUA 5JJIA 1DAHA 1FP7A 4B35A 3HWSA 5LB4A 4B6EA 2QENA 2WJYA 2DFTA 4V0NA 3ZS8A 3W9YA 2L0XA 3AVOA 1E9DA 5CLLA 3M1IA 4TLCA 1VTKA 2VA8A 2WSMA 1IY0A 1IHUA 2P5SA 1W1WA 5HE8A 3BIFA 1G19A 2Z5FA 3OF5A 4JBXA 1YRBA 3MJHA 3AF1A 3WP0A 3NHAA 1RC8A 5E95A 3OIUA 3RRYA 4Q21A 4ZDJA 5FBVB 1E79D 5A5GA 1KOFA 1DAFA 1XJ0A 4B2LA 1DBSA 3B1YA 4PZLA 4D81A 3CWQA 1Q0UA 2XB4A 4HAZA 4A0GA 1G18A 3K0AA 3N2EA 1UKYA 1GL9B 3EPJA 2G0TA 4FIDA 4RKEA 3TLXA 1OXSC 3B1ZA 2BIFA 2ZJZA 5KPJA 3VKGA 3G82C 3J81k 1P2VA 4A9AA 2XEXA 1R5OA 2ZUCA 1COWD 3CRQA 2DCUA 3LNCA 1YZUA 4LJAA 3LDAA 1T91A 3PENA 4TMVA 3LLMA 4ZV4A 4KFRA 3N5CA 3RHFA 1TADA 1OLOA 3DM5A 5JEDA 1T3HA 4S35A 3TUZC 1DELA 1GVNB 4GBMA 2IYQA 2RGEA 3AP2A 5CIQA 4PSAA 3C4JA 2Q9BA 3GJ6A 3MGCA 1ZM2A 2IT1A 3NC1C 5KDOA 3EPLA 2O8CA 5HZHA 2C96A 2ZS8A 4QG7A 3U44A 3U5ZB 2IS4A 1GG2A 2GCOA 2FFBA 4KJZA 2PCLA 5IDVA 1ZP6A 2REOA 4MYTA 3C14C 2LWIA 4B32A 4D6PA 3THYA 1HYQA 4UNSA 1E69A 4WBSA 4YXWA 3DKVA 2FMXA 4CVNA 4ZCIA 1PLKA 4R71A 4LPKA 4PC2A 4AI6A 3VU9B 4C2TA 2O0HA 2PT5A 5FUXA 4KV9A 2OFXA 3FGNA 3BH7A 1NVXQ 4BFYA 1E4YA 3GQBA 1NBME 3QPWA 2QPAA 1UEJA 3W90A 3SHWA 4GZLA 2E87A 3B1VA 2XTMA 4ZI2A 3REFA 2OCYC 3JZAA 5J4VA 4DLRA 2GJKA 1OIVA 5EP2A 2C2HA 2QUZA 1XMIA 4LSGA 3SZRA 3R8FA 2Z4SA 2VIIA 1KDPA 1ZU5A 5FL3A 1Z0AA 2C03A 1M6NA 2LKDA 4Q1AA 1A4RA 5GVSA 3QG5A 3KKQA 4DSOA 4GI7A 4HAUA 4MKGA 5AR1A 2XTNA 3AUXA 1E2IA 1RYHA 1ZCAA 2WSSD 3LD9A 5JI3E 3ASYA 3H2YA 2BEKA 2XJ9A 4HI0E 1Z6XA 4JKIA 2ZANA 3F3YA 1KMHA 3IHWA 5KSYA 4AG6A 3PV0A 2WICA 1G8PA 2A5YB 3CRMA 4HAVA 4Q9KA 2MMCA 4YMSA 3GLFA 3AKDA 1X86B 3A1UA 4CEIA 3WBKA 2WHXA 4DLXA 2ZSBA 1E2JA 1ZM7A 2HXSA 1EG7A 3IBGA 5FOWA 2PMKA 2ZRMA 4KSBA 5CJ2A 1A2KC 1G8YA 3K9NA 2V7QA 3GFPA 3VTKA 4QRHA 5ELXA 2Z43A 1Z47A 1E0SA 3U3JA 4UNPA 4F7WA 1ANKA 1H65A 3MWKA 4DVGA 1OKKA 1LNZA 1NN0A 1GM5A 2VP2A 3UG6A 4JBYA 3LA6A 1QG2A 2OAP1 3GJ7A 4QGGA 2RAPA 1W0KD 4B3DA 4LK2A 2OV2A 2UVQA 3LQRA 4P4SA 4E07A 3SHFA 4A2QA 2X1VA 3QKRB 4DDVA 3C5CA 4V0KA 5JBQA 4X8HA 1FNNA 3ADBA 5H8WA 2F1JA 4U00A 4M1KA 2BKEA 3KJIA 1JJVA 3W5IA 3M4YA 4OYHA 1E2NA 2QORA 1G3MA 3QKSB 4DB2A 4L9WA 1LF0A 1XXHA 2WJGA 3TH5A 4DT1B 2G0NA 2OCAA 1YE8A 1WP9A 3EWSA 3L43A 4QBFA 1VMAA 4WZAE 5EUQB 1T0JB 3FKQA 4M21A 4P31A 4Q1CA 1Q57A 1XTQA 3IO5A 3C8UA 3ASZA 1P60A 5GJCA 4BECA 3NEJA 4TSFA 2QBYB 3B6EA 1HURA 3GLHA 4PPQA 5L3SB 5JSZB 2F43B 2VP0A 2O0KA 2QP9X 4CRWB 3K0SA 1NVVR 3JVVA 4EQ6A 3THXA 2RGAA 2XOKA 3NC0C 2QTHA 3P26A 1WE2A 2KE5A 3AKEA 1II8A 4M9XA 3U4QA 4URUR 4FD2A 5FPSA 4A1FA 3CBQA 4PAOA 3CIOA 4Q1DA 4N3NA 1FW6A 4NONA 1U90A 4TTPA 5FBQB 5FUWA 4I1SA 1MABA 1AZTA 1G3UA 3TR5A 4B3BA 4GT1A 4DC9A 4Q9IA 2BBTA 4D4LA 5KU1A 2FGJA 3EC2A 2X2EA 3T34A 3TW8B 5DE3A 1OSNA 2JLWA 5HCIA 1ZCBA 3P27A 2BVNA 2C99A 2WWIA 3PR1A 4BFUA 4B2PA 1OHHD 1M2OB 1T5IA 5F3WB 2HLDA 3DOEA 3B8HA 4UJ3A 4F92B 3I5YA 5DIFA 2NGRA 5G3ZA 3L0IB 2V8OA 4G5GA 2ATVA 2ODWA 3K70C 3VX4A 5HKKA 3GLGA 3QPVA 2GF0A 3ADCA 4GOJA 3ZLJA 3K9LA 4GSYA 4RJLA 1U0JA 1E2FA 3VMFA 2WKPA 2ZRNA 1IBRA 2OZEA 4WIAA 1P61B 5AUPB 3O8BA 4FMDF 2WMNB 2FSIA 1T9HA 4RCZA 2HYIC 3PUYA 1FQJA 4E22A 4ARZB 2F55A 2J5XA 2VHTA 4OHWA 3RWOA 4WAUA 3ZQJA 3I5XA 1XEWX 4FN5A 1KJYA 2KJQA 2AK3A 1NN1A 1YRAA 2ZI9A 3TBKA 3THWA 4MDEA 1D5CA 1UKVY 5C46F 2JLXA 3B9PA 4TLEA 4OL0A 1XD2A 5GADl 4LV5B 1DADA 3SJAA 5EQTA 1UEIA 1Q1BA 4TT3A 5EP3A 2DBYA 2G3YA 1SXJA 4IDOA 4PSVA 5AJWA 2JJ1A 4LJ7A 4P4UA 4LBWA 4TMWA 4QHTA 2IUUA 1TEVA 4NCHA 4B43A 2ZSAA 4D25A 1XEFA 2Q3HA 3CRRA 5GJVC 4DWJA 1DAEA 3QPUA 1OFHA 3O8DA 1PLJA 1RJ9A 1VIYA 2YYZA 1S9DA 3R7WA 1KDRA 1T3SA 2XZPA 5H70A 5IHPA 3CF2A 5JJKA 4M9ZA 5E7MA 3M6AA 4AKEA 1G5PA 2GDJA 1CJUC 3QKUA 3RDPA 1W7AA 5JECA 3GJ8A 3VR3A 1OFUX 2FEOA 1GZSA 1F3OA 2OXRA 1G9XA 1KI3A 2HXYA 5KSPA 1IXZA 1F48A 1FX0B 1Z0DA 2JLQA 3DMDA 5FPKA 5IF9A 1OF1A 4Q7KA 5CDFE 1LV7A 1F2TB 2IK8A 1KO7A 1Z8FA 1NVWQ 2RGXA 3QEJA 5JMTA 3RANA 4YMVA 3B85A 1E32A 2EW1A 5FTNA 1UF9A 2NZ8A 5GJBA 1T0HB 3JZMA 1G7SA 1E1QD 2P3SA 2H17A 1G5TA 2QQ0A 2R6FA 2VHUA 4BZXA 2PLRA 4QHSA 4BLPA 3A1VA 1Z06A 1HTWA 2AFHE 3ZIAD 1ZC3A 4C0KA 2QSZA 2ZRCA 4V0ME 1I2DA 3CONA 1S1MA 2D3WA 3HR7A 1II0A 4HB2A 2REXB 3L2OB 1JR3D 2RGNC 5AK0A 1ZM9A 3Q85A 3F0TA 4G5OA 3ZD7A 1COWA 4LX0A 1OXUA 3QF4B 4Y0VA 2IX3A 4QJ4A 4JYBA 1IXSB 1GKUB 1M74A 3KB1A 3SNHA 3D7MA 4TMKA 3Q7QA 4D26A 4HLUC 1MO4A 3QOFA 4M4SA 4XVRA 4B6FA 4H1UA 1NSFA 1Q3HA 2CNWD 3AVQA 3K09A 1SVIA 3KUDA 1G6HA 3IIJA 1UAAA 1N25A 2W2VA 1OE0A 2BCJQ 3K0FB 2BHRA 4US1R 3HR8A 4RFSB 3KTAB 3OFNA 2CLCX 4EIWA 2ZRGA 4LHZA 4OHYA 3VKWA 4MRRA 4S2EA 1XP8A 4BLQA 1LTQA 2H8KA 1US8A 4EJSA 4OJQA 4XD7D 5KTYA 1L7VC 2WKQA 3WMGA 2IC5A 1P75A 3H1TA 4EPXA 3O8CA 4L15A 3SYKA 3FHOA 1L2TA 3PJRA 1Q22A 2CJWB 1GTVA 2QL6A 1P9NA 1MO3A 2R9VA 2REBA 3KFVA 2CCJA 2C5LA 2IL1A 5ANRB 1YR8A 1M7HA 4Q7LA 4A15A 3BXZA 5AUOB 1EFUA 2QY9A 2YHSA 1R4AA 4U7DA 1E1RA 4PHHA 2EVWX 2JLSA 4RKFA 2D7DA 4CDGA 2GJ9A 2R8RA 1Q1QA 2EFGA 4CEJB 3W8RA 4A0HA 1KI7A 3KKMA 3EIQA 1Q21A 3RYTC 2H16A 1NLYA 1R10A 1WBDA 3FMPB 3EIEA 2BV3A 1G4AE 2W2XA 1EFTA 1P72A 3BD9A 3NBZC 4JLAA 1GDDA 2JATA 2ZRHA 3K70D 2JLVA 2RH5A 5DYIA 1E9FA 1WF3A 3BB4A 1EGAA 4KLZA 3R9IA 2PJRA 4MYHA 3W8NA 3G5UA 4C0HA 4I1VA 2ODEA 2QQEA 1UADA 3MRSA 1F6BA 1QVRA 3LX5A 4QBGB 4PTLA 2IWHA 3RNLA 2F9MA 3QXCA 3KXLA 1OH5A 1G6OA 1HT1E 3MWLA 1VCNA 5KSZA 4TWZA 2QP3A 2R6DA 1CR2A 4E03A 5LD2B 1KDTA 2YWFA 1Z6GA 5E7IA 3DZDA 3WMFA 4A8JB 4BZQA 1B23P 4LBVA 2XX3A 1YZKA 2J0UB 4LHVA 3KFXA 4HLDA 2LKCA 4R7ZA 1Q3TA 1OB5A 1DEKA 2Z0MA 3VR1A 1KY3A 5TARA 3SR0A 2CCGA 1QHSA 1UBGA 4MRSA 2DWPA 4TZ0A 2UKDA 3GEEA 4TTQA 1YR9A 4LOAA 3A4MA 5B57C 3QSYA 3LQQA 4Q4HB 4PQYA 4LPSA 2OBLA 5FTKA 5D3QA 1ZC4A 1PZNA 4U5XA 1KO8A 1YZQA 1KO5A 4J0QA 4OQNA 3QNUA 2IUTA 3ZDQA 1KI1A 5FR2A 1B0UA 1SXJC 3BFKA 3VU9A 1IM2A 1XTIA 3OIVA 2D06A 4DBLC 4PO9A 1U8YA 1Z83A 1XTRA 4KO8A 3K1JA 4TYPA 1KSJA 3A58B 3W34A 1NNEA 1SGWA 1GL7A 3CM0A 2IYUA 5FI0B 3LY5A 4RFVA 3T06B 4DKXA 5CM8B 3LW7A 4DIEA 3NDBB 1W4RA 2QRNA 2GILA 1E9BA 4A6XA 4XWOA 4EPWA 2CDNA 4Q00A 8OHMA 1N6KA 3P20A 4LWZA 5BN5A 1XXHE 2WJIA 2J45A 3NDPA 5EP1A 4PAQA 3CF0A 2KBFA 1UBEA 4UNQA 3T1VA 2GBLA 1U8AA 5EXXA 2EWVA 4ZI3A 1DAMA 4QBIA 3PEYA 3EIHA 2O0JA 1Y63A 1HE8B 4L9SA 3VNUA 2W00A 4JSTA 2X77A 3FVQA 1P5ZB 2QGNA 3TK1A 1NMXA 1XTJA 1JQJC 1TU3A 4AYXA 2WPDD 5JCPA 3GLHE 1VG9B 4XTRA 3QKTA 3TJZA 3RRNA 1W36C 1CKEA 1P62B 2FZ4A 2J7PD 2ODNA 5CJPA 2I1QA 1G7RA 2A3RA 4L16A 2AD1A 2ZVQX 3AQ4A 3BFVA 3QXXA 3WNDA 4C7OB 1UFQA 3BOSA 4L4UA 2ZJOA 1NJGA 1KYIA 2ORIA 5DI3B 1F5NA 1Z0KA 2HJGA 4JLNA 3W6NA 2VYFA 4XWKA 1OFIA 4FCVA 3QF7A 2AFIE 4Q5IA 1IY2A 3S1AB 5B30A 1KMQA 1MH1A 1EESA 4YMUA 1AZSC 1W5TA 1G8HA 2EQBA 2PCJA 3PUZA 3KB2A 4NZYA 4NHOA 3X1WA 5HR5A 4KXFB 1Z6AA 5J4LA 2J9RA 1FL9A 4HLCA 1EX7A 3RS3A 3SBEA 3OIWA 2P65A 4LC1A 4DEYA 2FF7A 5C4GB 4DXAA 3AF2A 1Z3IX 3V9PA 4QJ3A 2NO6A 3WNBA 4ESVA 2VPPA 4RD2A 3RABA 2I1VB 4IW3B 5A4JA 1D6JA 1GRRA 2ZS9A 3IIKA 2YC2C 3QKRA 5F98A 1P73A 2FSFA 4M1MA 1R5NA 1IAQA 1OPXA 1JALA 2UZIR 2LCFA 3NBFA 3GLGE 4HB0A 5FL7A 5EP4A 2WWYA 2YWGA 2EWWA 4Q9LA 2DPXA 3NVAA 3QKSA 2H7VA 4UXJA 2FZLA 3OHMA 2FE4A 3Q3JB 4DT1A 2JLYA 2ZRPA 1G41A 2VLIA 2YWEA 1HV8A 4IEIA 3RC3A 1P3JA 2Q0HA 1DVRA 3LWNA 1ZD1A 5C4MA 3U61B 1ETUA 4NYJQ 4LRWA 4NYIQ 4QNRA 4LC0A 1G20E 3FWYA 4K46A 3QVVA 1BMFD 1L4UA 4C0JA 1VPLA 2OXCA 3KL4A 5TXGA 1NN3A 1A5TA 4DDWA 3I73A 4NYMQ 4B71A 2QBYA 1GKIA 5L3SA 5JSZA 2F43A 2IWRA 4JMPA 1ZW6A 3MSXA 4B47A 1UM8A 1GWNA 3FMOB 2XXAA 1G7CA 3N70A 4M8NE 2GA8A 3I61A 1IN4A 2GAAA 2GK7A 2PZEA 2FX3A 1SXJE 3FPAA 1GITA 1ZIPA 1T8TA 1E0KA 1KZ7B 5J4YA 1VIAA 3G0HA 2BJVA 2YVUA 2AXNA 2CL7X 1ESMA 4TQUS 3UMFA 4D0GA 2RCNA 2ZRAA 5JI2E 4HLQB 3L0PA 1NG9A 1FP6A 5KUTA 4HAYA 3OE7D 2SHKA 4AY2A 4FCTA 1FTNA 4IHQA 1AN0A 2EFCB 2R6CA 1N6NA 2AKAB 5KO2A 3WYAA 1KKMA 4JL5A 3E70C 3TUJC 3WY9A 4OQXA 1Q1EA 5FPTA 2IHYA 1SKYE 3PUWA 4IDQA 1S2MA 3BAFA 1K8RA 4P4TA 2BBWA 2DFKB 1U9IA 1ZM3A 2WAYA 3VR2A 1XB2A 2IHBA 4PZZA 3TAHA 1NY5A 2P5TB 2PZFA 3ZZUA 1D2MA 1ZRHA 3BE4A 4C3ZA 1E98A 3WHKA 4IKEA 2O8EB 3ZQ6A 1QHXA 1N5IA 5CITA 3CR8A 2J41A 1BYIA 4UXHA 3W5JA 4G5RA 1WB9A 2NMVA 4HZUB 1N5KA 5KOYA 3A8TA 2YV5A 4HDCA 3TSWA 4Q4JB 4R2HA 4NBSA 4G5QA 3UIEA 1LS1A 2BMDA 1WDTA 2R65A 3CRVA 4YDSA 1CR0A 2QNRA 3NHBA 3RLFA 4BLTA 1E96A 2AHOA 3SOPA 2QAGA 1A7JA 1Q44A 1X8JA 5FOXA 2NO7A 3IO3A 4M1YA 1W36D 2W83A 4O3MA 2VP5A 4I99A 4Q1EA 2R44A 1X1RA 5FBWB 5FUYA 4DLUA 1EFRA 1QHGA 3LFUA 5EUMA 4D82A 2WWXA 1TX4B 4ESHA 1OXXK 4HUTA 2B21A 1P7CA 3IQXA 2QGZA 2GRJA 3T12A 1UBCA 2A78A 2QMUA 3RS5A 2NG1A 1NRJB 2NO0A 2W2TA 4L5BA 3KUCA 2JJ2D 2BMFA 3UMSA 3A4NA 2ZQ5A 2FSHA 1KI2A 1ZUHA 5EJEA 1TTTA 4IEEA 2ECKA 4R9UC 4OK5A 1ZVQA 1C1YA 4MGIR 3LVRE 1U98A 3BFXA 5KDDA 2JDID 4LHXA 5CM9C 2VBCA 2XZOA 2QG6A 4MUAA 1JQLB 2JLRA 4GFDA 3PIRA 2Z4RA 4M53A 4OKSA 1FZQA 1FX0A 4YDHB 3EZ9A 1WMSA 1KJWA 3RSLA 1F2TA 4W5HA 1G3IA 2QM8A 1E2QA 1T6NA 1XZQA 1X8KA 2ZR7A 5IK2D 4F91B 4FI3C 1G64A 2ZYUX 2GCNA 2VO1A 5AJVB 3ZGXA 4HYYA 2WKRA 3HP1A 2TMKA 1BYUA 4NMMA 5C2JB 3IUYA 4A2WA 3CPHA 3GJ0A 4UNNA 3Q8XB 3KQNA 1E2KA 2ERXA 4EPRA 4MRNA 3O8RA 4V0LA 1OT3A 3AF3A 1FNMA 3QF4A 4LV8B 4X8MA 1KNQA 2BKUA 2ZU0C 2D7CA 4PHFA 4NE2A 3GFTA 1NBMD 1D9ZA 3PG5A 2PEYA 4KODA 3ONWA 2F7SA 1ZNWA 4UQOA 4UNRA 4IRUB 1ZNYA 3K0CC 4N0DA 3K0EA 2WJHA 3D8BA 3FE2A 1N6OA 4CT5A 3KJGA 5CB6A 1XCGB 2NO1A 1FUUA 1G16A 2G83A 2ZJ8A 1TU4A 1CU1A 3K0FA 3WBJA 2ZI4A 4RFSA 3B5JA 3KTAA 4M22A 2QMOA 4TL9A 5KNBA 2PH1A 1JECA 3DL0A 2FGKA 2WBLC 1KNXA 2VL7A 2ZVPX 2ZE7A 4MKIA 4IOJA 4DCTA 1U2RA 2C9CA 5JJLA 1J90A 4PZYA 1W0JD 4UXIA 1M8PA 1DO2A 3UXMA 2BBSA 2G1JA 1YR6A 2OHFA 2IYWA 2CVHA 1II9A 4KBFA 1AS0A 2IYVA 1IN6A 2WWHA 4L8GA 2B7BA 4B3CA 4KCGA 1AS3A 4BLSA 2ZXUA 4RZ3A 3EZ2A 5KDLA 4TLBA 5JCZA 2OSBA 2CEAA 2ZYTX 3ZVLA 3AP3A 4GL2A 1UKEA 1FMLA 4O25A 1GILA 1Z0FA 121PA 1E2PA 3U7HB 3AKYA 2WOOA 3IDQA 4M1SA 1NIPA 4MGYR 2IEZA 1T5LA 621PA 3AF0A 4PHGA 1G7TA 3LO5A 3K53A 1P2SA 2ZSEA 3QUSA 4WZBE 5KHOC 2CHGA 1W2GA 3LH5A 4NPHA 4WA7A 3NWJA 4DRZA 1TUEA 2V4ZA 4XVQA 4PHTA 2PBRA 2VP4A 1QRAA 3DKPA 1IONA 4LBYA 2WJJA 3W6PA 4BQSA 1E2HA 5HTKA 5TB5A 5LPNA 1YJ5A 4ZKDA 1PV4A 2XSZD 4FINA 3GJ5A 2WZQA 3EWAA 4FMCB 2VSFA 4LYJA 4HATA 1CLUA 1P6XA 4JLVA 4JLMA 1IY1A 1TNDA 2MSEB 2X2FA 1YQTA 3SJCA 4BLRA 1HY3A 4JLOA 1R2QA 1G8FA 3A37A 4ZCLA 1PUIA 1KJZA 2H1LA 3B82A 4JLKA 3OEEA 3BS4A 4ILEA 1TAGA 4Q02A 3CZPA 2J0UA 2YNMA 3HPQA 1G3RA 1AK2A 2HF8A 2ZJBA 1AGRA 1Z2AA 2OUKA 3LXXA 1SVLA 2W6JD 4M1WA 1JNYA 3TNFA 4Z1MD 5JRJA 3K9HA 4K81B 2EFHB 1OB2A 4MITA 3SQXA 4BPBA 4DUGA 2C95A 1LW7A 2QAGC 4MDFA 1AKEA 4Q4HA 3OESA 2VTKA 3L8YA 4H9GA 2A5GA 2A9KA 1JI0A 2A5DA 1NP6A 3FKSA 5JWHA 3V4FA 2WVJA 4BE7B 1VYVA 1XZPA 4HDQB 4DCUA 3OZXA 4TN1A 1KSFX 4ASUA 4TQ9A 1E4VA 1E99A 5J40A 1H8HD 3I4LA 1WQ1R 3FMFA 4BWYA 1GIAA 3MFYA 3IHLA 3SJZA 1Z08A 2ZI5A 2J3EA 4YMWA 5CLQA 5DLQC 4FW9A 2NQ2C 2F1IA 3KZ1E 2DFLA 1DAKA 1Z28A 2QE7A 1RVDA 1U94A 1QHHB 2FH5B 1R5BA 2HEIA 4LJ9A 1GNRA 2CLDX 4OQLA 2WAXA 3NH6A 4G5SA 2CK3D 1RW4A 4GZMA 2BM1A 3KJHA 4ZIRB 1WRBA 1EX6A 4Q4AB 2FPMA 5DN6D 3ND9A 3KQKA 4AURA 2YZ2A 4QGAA 1PJRA 3TIFA 4XTCS 3EX7C 3KKNA 3ADKA 1DS6A 1N6PA 1XD9A 2AX4A 2A7QA 2IYTA 3PVSA 4XJXA 4W9MC 4C7OA 3TMKA 4DB4A 1E9SA 3HU2A 5DI3A 4AG5A 4F4JA 1NKTA 4BFXA 2P6NA 5DGXA 3GJ4A 2IUSA 1L4YA 1XJQA 1EWRA 1U0HC 2NIPA 3AH8A 3OE7A 2MMGA 1Q20A 3S1AA 4MH0R 4D4MA 1ZUNB 4XSGA 1X1SA 4E5UA 2HF9A 1GRNA 3DMNA 1R0YA 3HU3A 4Q18A 2X8AA 1P2TA 4AYWA 2CBZA 3SFZA 1ZNXA 3KXKA 1CIPA 2BEJA 5AJZA 3SC3A 2NO9A 2W6ID 1SVSA 3PEUA 3WMEA 2BC9A 4OQFA 1IN7A 1R8SA 1AJEA 2VSOA 2IXFA 3RRZA 3BK7A 3IPXA 2O8CB 2GZDA 2FSGA 2N1BA 3I62A 2OO7A 3A1SA 1XU4A 5CK5A 2ONKA 1OXTA 3OEHD 4PC3A 3PEVA 5AUNB 1E79A 4P0TA 3K70B 4AKHA 4B34A 3B7GA 4PXAA 4OI2A 3EW9A 1H8ED 2AN9A 2G6BA 3M0EA 4IJMA 1NVUQ 1J8YF 1Z0IA 1KK1A 4D80A 3A6PC 5JWRA 3WYFA 2ZEJA 3GLIA 2ZAMA 4PPFA 5SZKB 3ZYCA 2WJVA 5BN3A 3U60B 5DO9A 2HUPA 3I1FA 3AVUA 3PCRB 5KPDA 4IDHA 1TQ6A 4Y0AA 1P2UA 2P67A 1KO1A 4QNMA 5JRZA 1SULA 4HAWA 4N1AA 1NKSA 1MRSA 1V5WA 2PLFA 4NCJA 3GD7A 3HU1A 1GP2A 4LUCA 2WMOB 1BS1A 2QPTA 4XH9B 1IQPA 5CYOA 3E1SA 2GEUA 1GFIA 3L8ZA 3GPLA 3VNVA 4BRUA 1VDZA 3PQCA 4PX9A 3I92A 4URWR 2HT6A 1JEEA 2WOJA 2I4IA 3HJNA 2JJ2A 3AKCA 5BQ5A 2RGBA 1J99A 1D2EA 2VHJA 2MSCB 4O2LA 4JJKA 4KVGA 1DARA 2Q3FA 3OIYA 1QHIA 3D3QA 4A0RA 4URVR 1KKLA 2G77B 1UDXA 3EAQA 4EPTA 4GMXA 4EFLA 2O8DB 2O8BB 1HE1C 1ZYUA 3MWJA 4G1UC 4QC2A 3W3ZB 2IYZA 4DJTA 4DSNA 2IYLD 3AF4A 4XOIA 4EPVA 1AM4D 3DHWC 1G5RA 2J1LA 4PO8A 5DSZA 1N6HA 4M0LA 5H68A 4FXPA 2WTUA 4BEJA 2P6UA 3MWYW 3FFAA 4RZXA 1G8GA 1N0VC 3QJYA 1G291 5JWOA 1V43A 1XEWY 2O8EA 3A36A 1DO0A 5AUQA 1D8TA 1F2UB 3T61A 4EDHA 3X1XA 4LYHA 1OYWA 2IA5A 2QZ4A 3F8TA 4IDNA 2O8FB 4KLNA 5H1YA 1CRQA 1J8MF 1UDWA 1NY6A 2PEZA 4FMBB 5CIWA 5L8VA 3T1TA 2WSSA 2V1XA 4XIGS 3X1YA 1GOTA 1NF3A 4OI1A 4YXWD 2RGDA 5IRCD 1N2CE 4HZUA 4TL7A 1G1MA 3R8CA 2ZITA 4URYR 1NBMA 2PX3A 4LHYA 2QM7A 4LYAA 2V54A 3DOFA 3EASA 1SZPA 4I1UA 3I72A 4GP6A 3MLEA 4JSYA 2Y8EA 3OAAD 1L8QA 5FTLA 1LB1B 2OCPA 4JVSB 3ETLA 4GPTA 2FWRA 3GCGA 1S9HA 2GXAA 1N0WA 3GLFE 721PA 4RZ2A 3QXHA 4KHZA 1XPOA 3KQUA 3SQWA 1C9KA 4GNKA 1GKYA 2IXGA 2IEYA 3PITA 3ZS9A 1ESNA 1MO5A 1OIXA 3BC1A 5FTMA 2JLUA 3GLHB 2YOGA 2IS2A 1K5GA 2Z6VA 4ACAA 2CHQA 4I1OA 4JBWA 4PFSA 3ADDA 1CS4C 4CZ2A 1ZAKA 1J7KA 3MG9A 3CZQA 1NLZA 3TVDA 4A2PA 5EXSA 1W0KA 5FBRB 4QGFA 3CUEF 1II8B 4QKQA 3TRFA 4LV6A 3DEFA 1NL3A 4LJ4A 3U4QB 3IQWA 3KQLA 1XNJA 2RHDA 1LS6A 3KXIA 5LD2C 4TYWA 4C0LA 1MRNA 3BH6A 5F9FA 1S96A 3ZJYA 3SYLA 4QHYA 2ANCA 1MABB 4Z8YA 1E9RA 1YZGA 1XCMA 2V7QD 4MA4A 1DE0A 3ICEA 3C7KA 2GAOA 4QFMA 2GJAA 2XGJA 4Q19A 1GSIA 3TQFA 1NMYA 1WXQA 2KI5A 2OAQ1 2ZUDA 3LBIA 1E2LA 1E9AA 1ZJ6A 3Q72A 3SFVA 4D0LB 2OCBA 1Q1ZA 2R6AA 2ZRKA 4HZIA 421PA 3PUXA 1XEXB 2XSZA 1W48A 3SBDA 2OEPA 1YHNA 2QU8A 5HPYB 4Q48A 4X8OA 3SN6A 1NVVQ 1CJKC 1NJFA 1IOZA 5BN4A 1OIWA 1Z2CA 4A36A 1ODFA 5D3MB 4DDUA 4OHVA 2C9OA 4DLZA 5FPHA 3AVVA 2Q9AA 4PQFA 2RGCA 1HEIA 3C16C 3CF6R 3A1TA 1Z5ZA 1N0UA 1N3BA 3BH0A 4GRAA 4AKGA 2C8VA 2FFQA 3TQCA 3UANA 1CTQA 5B64A 3H84A 4A92A 2GWHA 1VYUA 2FV8A 3TSZA 2ZSFA 4RY2A 2BWJA 4BZPA 3MJRA 3QENA 3RC8A 2KB0A 1JXOA 4DLTA 4TSFD 5M04A 1CJVC 3K09C 1I4TD 1XPUA 5IT5A 2JLZA 2UZ3A 4NCKA 1XMVA 1U8ZA 1XCPA 2B8WA 1OHHA 1OJLA 4EKDA 2XZLA 3DZ8A 1W2HA 5C1BA 1RKBA 2C9YA 1I4DD 1IN8A 1OH8A 1SXJB 4IFEA 2XOKD 3BGWA 3T35A 2A30A 3B1XA 2C77A 3FHTA 2IYSA 2CL6X 5L3RA 4EJSC 3ZZTA 5FFMA 4Z51A 3B60A 3RS2A 3LBHA 5E3HA 2OFWA 5FUVA 5E7JA 2WM9B 1K6MA 2BCGY 5DHFA 4YC7A 1T4GA 2MSDB 1PLLA 3C5HA 4WXPA 1E2EA 1SKYB 3Q9LA 4DLWA 3ND8A 2RB4A 2CK3A 4PANA 3T5GA 1KGDA 2DHRA 2ANBA 2YC4C 4KVAA 2V1UA 5FOSA 4C0AC 2R6GA 1CULC 4BUJA 1W36B 1U99A 2H57A 2EFEB 2F1HA 4Q03A 1BIFA 3QI2A 2AXPA 1OYYA 2WWWA 2XTZA 1GAJA 4Z8XA 2J87A 2QT1A 4FMDB 3SYNA 3SJBA 1M7BA 2P0EA 5TDHA 1OV4A 3FTQA 1TQ2A 4W7SA 4B75A 3U6BA 521PA 2BDTA 4AIIA 3ZVNA 4BFTA 4QM6A 2DYKA 3U6KA 1JR6A 4EPYA 1FMJA 1LY1A 2W0SA 4NH0A 3MUFA 4MRPA 3N2IA 2ZYWX 4I81A 4TYNA 1JPJA 1LFDB 5BYKA 3UATA 5GJWC 3F5FA 1XBTA 2GEDA 4JKYA 3RS0A 2QRZA 2VP9A 3NXSA 2DY1A 2OLJA 4C30A 4G01B 3OEHA 3REGA 3RVBA 1E1QA 5AWFC 1SXJD 3IGFA 1US8B 4C0SA 3KX2A 2JJ1D 5EE1A 3L82B 3ZIAA 1KI9A 1H8EA 4CW7A 3U7FB 1XRJA 1KY2A 3A4LA 3K8YA 1CEEA 2QN6A 2KBEA 1HUQA 5LDDC 1JBKA 4LYFA 4M9QA 1G17A 3V4RA 3TE6A 3VKHA 1R0WA 1JR3A 4RSGA 1CR1A 4LJ5A 4JS0A 4RZUA 4FWTA 2ZRFA 2N42A 2IW3A 3GLIE 1QHNA 2EFDB 1AKYA 5SZIA 2C78A 1QHHA 2GETA 5CDFA 3TUIC 3U7EB 2GXQA 1KO4A 3U3RA 2OE2A 4ZDKA 2AR7A 2ORWA 3CPJB 1P9RA 2FG5A 4ARZA 2CNWA 4ZIRA 5K8LA 1VCIA 4Q4AA 5K8UA 1S0UA 2GXUA 4Q4LA 1W46A 1QG4A 2J0SA 3ECCA 1VG8A 4Q1FA 1RRGA 3NH9A 4JIMA 1N6RA 5J5CA 2FNAA 2BMJA 3BBPA 4V0MA 1DAIA 4LCBA 1U81A 3BB1A 2GBLC 3T15A 3PXGA 3QE0A 4JVLA 2GESA 4US0R 4XD7A 5CB8A 3GEIA 3BJIC 1HT2E 4JLPA 1W44A 4QGHA 1RIFA 2NTYC 4MYUA 4TYQA 1JB1A 1OXVA 3FYHA 3HYRA 4D2IA 4QOSA 4CT4B 3NEYA 1UJ2A 4TLAA 1X6VA 4JT4A 4QBHA 1DOAA 4YQFA 1MOZA 3ICQB 1BH2A 1PVOA 4JLDA 4TYYA 4BFWA 1QF9A 1JEDA 1KZGB 2VQSA 1E2GA 3A1WA 4KITB 3GMTA 1TUIA 2IXEA 2ZYVX 1HQCA 1C4OA 4ZKEA 3AVWA 3K9GA 3H86A 2G9NA 3OFND 4O0MA 4LJYA 5FI1B 5EE5B 4DIDA 2HJVA 2OBNA 1W47A 2J46A 5FR1A 4IFBA 4TTRA 2CVFA 4EFMA 1VCMA 1TF2A 2W0MA 4LHWA 2RKOA 2ZE8A 4AKIA 2Q3MA 3D31A 4US2R 1MKYA 2OILA 1SQ5A 4RD1A 1A1VA 2WIAA 4MQBA 3CKLA 4V02A 3ZVRA 1EK0A 3VHXA 5JHGB 5DNYB 1GRQA 3GJXC 4O2RA 2QPOA 3QG1A 1Y3AA 3OAAA 3TW4A 2XNSA 4KBGA 3QEOA 1E1RD 3LVQE 1KI4A 4ON9A 5CK4A 3UG7A 3VAAA 4TZ6A 1CXZA 1EWQA 3KDSE 2GKSA 1CP2A 5KSOA 2GNOA 1JAHA 3I8XA 3VX3A 3ZVMA 2IF2A 1XMSA 3P32A 4BGDA 3U3OA 1P9WA 4H1VA 1OW3B 5BWMA 2JIZD 4E09A 3FB4A 2GHIA 4WZ6A 4Q47A 3SDZA 1Z0JA 3WNCA 5L3QB 1KI6B 1ZNZA 1E94E 4JVMA 4OI0A 1XFAA 4OBEA 4BFSA 3EXAA 4M1TA 2ZROA 1RE0A 1DPFA 4N0EA 1BO6A 1KDOA 3V00A 4DLYA 3EA0A 3I32A 2CJWA 4PQRA 4OHXA 1TF7A 2O8DA 2O8BA 1RRCA 1GL6A 2QI9C 3LRPA 5EE0A 1N5JA 4LDJA 3DO6A 2IF0A 3SEAA 2ERYA 4TMXA 2PJZA 3E5HA 3LAWA 2V6JA 3PFIA 3L0SA 1KAGA 2J59A 1AGPA 1VECA 2V55B 1E0AA 1X3SA 2EYUA 4CEHB 4CEJA 2ZJ2A 3EARA 1DG3A 2B6HA 4ZPXA 2JASA 2PX0A 5EE3A 3RWMB 1WA5A 1F2UA 5EZ6B 5SZHB 2AD5A 4POAA 1RFLA 4BLOA 3IBYA 2ZRDA 4QJ5A 5J47A 2O8FA 4R98A 1MV5A 4GMDA 4TQAA 3UWKA 3EG5A 3FOZA 1F60A 2AKYA 2ZR9A 4OK3A 2WPDA 2FJUA 2WWGA 2OLKA 3VHLB 1U9IC 1XTSA 2FFHA 2RGNA 1ONBA 2WWFA 3QBTA 5UKDA 2FEMA 2QTFA 2J7PA 2BJWA 4XVUA 2YINC 2ZREA 5FTJA 3QXJA 2B7CA 3NKVA 4JYCA 4Q9HA 4HLUA 1MR3F 3QBVA 2ZAOA 3Q5EA 2XNDD 1QVAA 3CW2A 2CXXA 5FOUA 4R2IA 4JL8A 2D2EA 2RMKA 1JAIA 2F3TA 2P2LA 3P4XA 1NI3A 1YZLA 4F38A 3CO5A 2CMKA 4A8JA 3C41J 3HYTA 5G3YA 1UBFA 3RSOA 2EYQA 4BRWA 1IXRC 4DCNA 3B78A 1I4LD 2A2ZA 3NG1A 1GNPA 2ZR0A 2GF9A 1K5DA 5HZKA 3ZZ0A 2GXSA 4B3XA 5FPYA 4IVRA 2IYRA 3CPEA 1Z6TA 4TL6A 1KSHA 2ZI6A 2QEQA 2XXAB 2Z83A 3CLVA 4RCYA 1KK2A 3EZFA 2KWIA 3DDCA 4HUQB 4B2IA 2PZGA 3UWOA 2QA5A 4TMZA 4C9BA 2XAUA 4YLGA 3C15C 4RVCA 4AWXA 2IBMA 2NZJA 4Q7MB 4LBZA 3H4MA 1RRPA 2V9PA 5LB2A 3CRW1 2K5UA 4FWIB 5EE9A 4GOKA 2HV8A 3MMPA 1QBKC 4OJKA 4NKRA 4G3XA 2W58A 5FOTA 3R9WA 1G21E 2IS6A 2VHQA 1SKQA 4OI4A 3B2EA 3NBYC 3P1JA 4C0QC 4M1OA 2DB3A 4OK6A 3DVLA 2YKGA 1BMFA 1VG0B 4D0NA 3B1WA 1FUKA 2ODBA 1XEXA 2PT7A 3L0OA 1S3GA 3CX8A 4WVFA 2PL3A 3NIBA 4JL6A 1QZXA 3CR7A 1WCV1 2HCBA 1KI8A 1VHTA 2JAQA 1W4CA 3X2SA 3KQHA 1G3QA 4M9SA 3SI7A 2HYDA 4IDPA 2FN4A 2N46A 2DWOA 5DYGA 4D4KA 2GJ8A 1O3YA 5D3MA 3AP1A 3EZ7A 2HT1A 3WYGA 2ASEA 5TV2A 3BWDD 5FL7D 2G88A 2OBMA 4V03A 3AVTA 3K0AB 1TF5A 1TPZA 2PMDA 2ZUBA 1E9CA 2AK2A 4NYJR 1FQKA 2B92A 2YJTD 3LLUA 1YKSA 4NYIR 3LV8A 2BBOA 3RS7A 1VCOA 1TEXA 2ZRJA 2DR3A 2QP4A 5A0FA 821PA 4MKFA 4NYMR 4ZCMA 2AWOA 3E2IA 2QAGB 2ZPTX 1ZMXA 4PO1A 2ZJAA 3KKPA 3QXSA 3TVTA 4PR0A 2GVDC 1SHZA 1KHTA 5FBLB 4URXR 4RD6A 4LGMA 3AM1A 2O52A 4KAXA 2XITA 2A5FA 1XTKA 1Z07A 2ZI3A 4NU0A 2FPLA 5BXQC 1W4BA 3AEZA 4KI0A 2H92A 2I3BA 3TKLA 3BERA 3U44B 3LBNA 2D74A 5KNCA 2KSQA 2GCOB 1AA9A 3NTUA 4G0NA 3CNLA 3U2QA 1IN5A 3Q7PA 4WW0A 3THYB 3AGPA 3W6OA 1Z63A 4X8LA 1JXMA 1Z6YA 4II7A 5P21A 1JR3E 2D62A 2ONJA 2FDCA 2QSYA 3JVUA 3WP1B 2HDNB 3MD0A 5E4FA 2OFOA 3EC1A 3CNOA 1AS2A 2IYYA 3FDIA 4WOPA 4JLBA 1M1YE 1FTSA 1ZIOA 4Q7JB 1VKJA 3PUVA 3CB4A 1LVGA 1PUJA 2NPIA 3U3MA 4C4PA 2D2FA 4C0BA 2F9LA 2QROA 3EPKA 1KSGA 4F4IA 4AYTA 1SVOA 1N6LA 1J70A 1RRFA 1U0LA 1UKZA 5GVRA 2ZSDA 3IIMA 4NP6A 4UJ5A 1R0XA 1MO6A 5DHAA 5J4HA 1M34E 4DLSA 4TL8A 1S3SA 3TR0A 3LW8A 2ZRBA 1SVKA 2JCSA 1CJMA 1OH6A 3CH5A 1IJFA 4LI0A 4U02A 1KMHB 2OT3B 3EA5A 1D9XA 4ZDIA 4P33A 4PAMA 2V3CC 1P4SA 2ZJ5A 2YOFA 2CHVA 3LXRA 3GLFB 2Q9CA 2JDIA 4D4JA 4CEIB 4ACBA 4ABYA 4LJ8A 3U3KA 2BMEA 4IXMA 4A8JC 5HE9A 1KTVA 2ZJYA 5TVKA 1XX6A 3WRYC 3AVPA 2H5EA 4Q01A 4B3FX 1RYFA 5IK2A 3R9XA 1KIMA 1T3LA 2CE7A 2DWQA 4ZDWA 1IJEA 5SZJA 4AK9A 1EFRD 4QXAA 1RZ3A 5TMPA 2ZRLA 5CYPA 1W4AA 4MUBA 3MCAA 1BOFA 2ZETA 1R6BX 2C98A 4EAQA 2VHCA 2VP6A 4GOXA 4M2LA 1XF9A 1MT0A 1NSTA 4DZZA 3HDTA 2ZIAA 2ATXA 2XB2A 1J2JA 1SVWA 3FMIA 4P4SB 5L3VA 3VQTA 4PC6A 1CR4A 4Q1BA 2OESA 1FOEB 1RPZA 2JGNA 1E2MA 1FPMA 5F9HA 4EUNA 4MYCA 3UKDA 2P6RA 2VSXA 2OM2A 3NBXX 1JJ7A 5C18A 3IEVA 4BFZA 2R62A 4Q4JA 2IS1A 1HH4A 4A0FA 2J0VA 4KU4A 2AWNA 3AVYA 4Q9JA 3KKOA 1W49A 4KSCA 1HQYE 2RGGA 4B73A 3SE0A 1XXHB 1M7GA 2ZU6A 1NG1A 2JJ8A 2JIZA 4KYUA 3R20A 4LJ6A 4MGZR 3QIAA 4B76A 1A82A 2Q21A 3EPHA 4DCSA 1AIPA 2HCJB 4W5JA 4DCVA 4IOMA 2NOAA 2CCKA 2WV9A 1NIJA 4JVNA 1LF5A 1W0JA 3FFBA 5G53C 2Q6TA 1OFTA 4I4LA 3T5DA 3H0KA 3GP8A 3EZ6A 3GEHA 6Q21A 2GK6A 4AD8A 3AGQA 5J4KA 1N6IA 4EQ6B 1CBUA 3IPYA 3THXB 3IEUA 3Q5DA 4QL3A 1E6CA 3W3AA 4DEXA 5JEEA 5JS7A 1E0JA 4OQMA 1N5LA 2VH5R 4RD0A 4HEJA 3WXMA 4B74A 2QT0A 1EFCA 4UKDA 4CIDA 3TGPA 1KK0A 4A4DA 4YONB 2GTPA 2QAJA 4KFSA 1R0ZA 4LY6A 2YWHA 5K8IA 4IXNA 5JHHB 4A82A 2IYXA 1ZD9A 1OH7A 4B44A 2QTVB 5G41A 3DPUA 2GZAA 1Q12A 2CLSA 2ZTSA 4LZZA 1GUAA 221PA 3BB3A 4XWAA 4HAXA 4YMTA 5BW8A 4EFNA 5K8TA 1HA3A 4GDFA 1OKKD 2G1KA 2YOHA 1YZTA 3WRXC 3SU8A 2GCPA 4NL4H 3HPRA 4JJZA 2GJSA 3CWZA 1ZINA 4V0OA 3BRWD 1GNQA 4PSKA 3GJ3A 1AQYA 3TSOA 1VG1A 1YVDA 4RD3A 1ZBDA 2ZI7A 4MGKR 5HCNA 2XNDA 3CX7A 2DFNA 2RHMA 1YU9A 1S8FA 3GLGB 3UPUA 1QDEA 2FOLA 1WBBA 1I2MA 2QMEA 1SVMA 4XSHA 1XDBA 4DHEA 1BKDR 1TQ4A 5AJYA 2AL7A 4FMCF 1E2DA 1CF4A 1VYTA 4Q66C 2VRWA 2BOVA 4NCNA 4Z1MA 2W6JA 3WHLA 1DG1G 2F6RA 1SHKA 1T8UA 5DI9A 4CF7A 2O5VA 4KFTA 3FHCB 4OHZA 4FCWA 2BM0A 2A5JA 5L3QA 1VHLA 1KI6A 2VEDA 3AV0B 4JZKA 5FH9A 3RAPR 4HSEA 3QY0A 2C04A 5F2EA 1DTSA 2E9SA 4P3YA 1TMKA 1ZM4A 3THWB 3PEWA 3BORA 1XD2B 4KFUA 2GZHA 3AVXA 2JEOA 4Z54A 1X8LA 3QVUA 3IKJA 5JFGA 1NLFA 5G40A 4PPNA 5JS8A 3D6TB 4GP7A 1DAGA 4KYIB 5EZ5A 4IVQA 4WXRA 1D2NA 1H8HA 3B9QA 5FOVA 2GEVA 2FU5C 2WIBA 1EXMA 4HDOB 1G4UR 3OEED 2X19A 3AB3A 1TQDA 4A6PA 3R7WB 1RJ9B 2EU8A 1FFHA 3ZD6A 1Z29A 3CH4B 1R7RA 2FA9A 1QHYA 5DISB 3IILA 1ZU4A 3O47A 4CEHA 4K8OA 4HB4A 5AJXA 1TL7C 2VF7A 1O87A
chains in the Genus database with same CATH superfamily
1V9LA 3AL2A 1XCJA 1PZMA 2J9XB 1YR7A 5AKZA 3ZH9B 4AC9A 4DUGD 3LX8A 4NTZA 5BWBA 2FE1A 4WK4B 1KR2A 4KNWA 3N2GB 4QM7A 4XIJA 4BGEA 4ER6A 3J80A 3L8FA 3G8CA 5A4IS 2DR2A 3IB3A 4H7DA 3RS4A 2YHIA 3GCXA 3INGA 4DLNA 4ERNA 1AY0A 1XPRA 5DULA 4C4XA 3KV3O 2QTAA 2WB4A 3F6EX 2Y4NA 5JYDA 2L82A 1XJCA 1KP9A 3QHQA 1GPAA 3WWYA 3ZCXA 2CXHA 4KOEC 1UDRA 1C3EA 5KHLB 2ZYAA 3I2IA 2CLKB 1XCBA 3T9BA 1QC5A 2H85A 2HHLA 1B2LA 3DBLA 7MDHA 3RGGA 3FDJA 5KOHB 5FJIA 3K8ZA 3UK6A 3VHQA 3R24A 3DM9B 2INGX 1UAGA 3KZOA 5DWDA 3MAAC 5HKKD 3QQ5A 1UQTA 3AIOA 4YAIA 1O5OA 2ZE5A 4P86A 3ZC3A 1NXTA 2A1IA 1XWIA 2VPTA 5FT9A 4F38A 3L1VA 3RRMA 1PSWA 1UC4B 5A0VA 2G7MC 2CHUA 4IIEA 2Q6VA 5E9AA 3PKZA 3EGXB 1VL1A 3AIMA 5EXTA 4F84A 4RD4A 1WKCA 4OAQA 4WRRA 3GFOA 2PUHA 3AY3A 3HWRA 3IR5A 4ZO9A 5B2ZA 3T3IA 1U1EA 3G2OA 3VR5A 2R48A 3C8ZA 4RJTA 4I50A 1PK8A 1WSBA 4RK1A 2W6IA 1TLLA 4BASA 3K4PA 2QMHA 1QH8A 1P4JA 4Y2VA 4NULA 1ZUIA 1C80A 1R8QA 4FT2A 4DBLE 4F4CA 1MC8A 4URZR 1KE2A 3N86A 3K96A 4OLFA 4DLPA 4HB3A 2PYDA 2Y0EA 5LBIA 4KKVA 1XL0A 1Z22A 2IZOA 1I32A 2VYVA 3WA6A 2WSYB 1N1MA 4ZARA 1QIJA 2WUGA 4P32A 1A95A 4B0PA 1W581 3I3SR 3IUQA 4TLDA 4TTVA 2NU6A 4K6GA 4IIGA 4PPGA 1QO9A 3TAUA 3KAKA 4YCMA 2PO7A 5LP6B 3HWSA 3IEMA 4MAMA 4W82A 3WWCA 1ESDA 3TZCA 2YXBA 4JVOA 2DFTA 2F8MA 2G9VA 2WG0A 3JARB 1ZQ9A 1E9DA 1DKUA 4R7GA 4RMGA 3GNSA 5IJ0A 4MW2A 5FRDA 2QD1A 4F3KA 5CVDA 3ZV4A 4XSVA 1G19A 3ZWAA 4OH7A 4RLFA 1MG5A 3ZHSA 1SXGA 4E2FA 1A9ZA 1IXKA 3A1EA 4KWTA 4ZVNA 1JPUA 3VJRA 3NZEA 1CIJA 2BN4A 5M34A 2FWNA 1FJ2A 3OIUA 3HI6A 3VI4B 3LUPA 4QBKA 3IUMA 4OHUA 4TSRA 1XZHA 2FW0A 2XMSA 3C8HA 3CWQA 2HH9A 2QUHA 3GUZA 4JJEA 4P98A 5LFAA 2BEWA 3CLSD 1J8FA 1QVWA 5FEMA 5K2OA 3N2EA 3EPJA 3JQ8B 1U7HA 1W6UA 4BNTA 3MMXA 3JRNA 3G49A 5JCJD 1OAOC 1W1IA 2J48A 3CLTC 3A0RB 5A0TA 4UTRA 2ZJZA 3VKGA 1B41A 4A9AA 3MXOA 5LC1A 5AW6A 1R5OA 2WF5A 3TCKA 4CCSA 3FBWA 1YZUA 4P3KA 4AP5A 4LJAA 4I9FA 4O02B 2GFHA 1ZA1A 5EL0A 4RPJA 4BWVA 3RHFA 3CUYA 3OU7A 5KKAA 4RJ2A 3KVNA 5LA6A 4YJ3B 1ESCA 4D8WA 5FWDA 4MUIA 4L8VA 1DELA 3C45A 4C7KA 1GVNB 3UUGA 1V8OA 1YRHA 4GUAA 4REQB 4BMSA 2VDMB 4ENUA 4GI5A 1IY8A 5CX4A 5F7XA 3C4JA 3CB2A 4TV8F 4A8TA 1T9KA 2RK3A 2UUBB 1Y3HA 3R3WA 4QG7A 5KNBH 3EEBA 5AVTA 2WIDA 4Q7QA 1GCUA 2XWBF 4MROA 3UV6A 2IS4A 1L4MA 2Q3BA 1QFZA 2HSJA 3CRNA 1POWA 1WL8A 1ZP6A 3C14C 3WLTA 3I9LA 4CG2A 1E69A 2VXBA 3A14A 3QRWA 2FMXA 4O2BF 2A4KA 4LPKA 4EB6B 4EG5A 4NF2A 2PT5A 3TPZA 1NM5C 4M87A 3MMZA 1N2IA 2JIDA 4BFYA 1VI2A 5BT8A 3Q7IA 4JXJA 1JKMA 4EATA 4X92A 1UEJA 2OCKA 3EG9A 3BJZA 2Q4RA 5ALWA 3IVCA 5TGZA 1G55A 2X0FA 1UOPA 5AJUA 5BSMA 3V7YA 4B82A 2C61A 4D5EA 1TK9A 2C2HA 5E6RA 3ROMA 2QVCA 5A05A 2YV4A 2GPWA 4WZBB 1ZVVA 1UKBA 5DHTA 1DNPA 4Q3CA 3AYZB 4Q4CA 3JR3A 4GLBA 3BN3A 3HSSA 3QG5A 1G2QA 4GI7A 5IKXA 4HAUA 2IITA 3I30X 5AR1A 1NQOA 4KWHA 1EWKA 3AUXA 1RYHA 1ZCAA 2AJ8A 4Z99A 1EDEA 3CO0S 3GIDA 3AJEA 4ZTZB 4WOJA 3AQIA 3S2ZA 3H2YA 4GHWA 3PYMA 1TTPB 1OREA 4HI0E 4NV0A 5EWJA 3IHWA 5GY7A 4KB5A 5M5BA 3X44A 4MS4B 3FYCA 4RU1A 3PV0A 1W52X 3PNLA 1G8PA 2A5YB 4NU5A 1BKSB 5I6DA 1X86B 2ORED 3QFRA 2WHXA 5JZ9A 1DCMA 3DV0B 5FV7A 3HXPA 5L7TA 4J3NA 4MB0A 5EJ6A 2ZRMA 3LBFA 2AMFA 5IKOA 4O4HA 5KVCA 2WD9A 4HDNA 2HV9A 1YQDA 2FPIA 3JR7A 3K9NA 3PQ6A 3BGDA 5COBA 2RI6A 4BX9A 3HZHA 4FNGA 2Z43A 5JAUA 5ARCA 4X45A 4F7WA 3QNMA 4HDKB 3RVNA 3MWKA 2IV2X 2VP2A 4KQJA 5BMVF 2B83A 1QQ6A 3NO4A 1JWAB 2PGDA 3BIWA 1MPTA 3QELB 4WECA 3JQBA 2B78A 3FUTA 1JE1A 3I05A 1QG2A 3ISJA 5GONF 3PIDA 4ZHQB 4QGGA 5ITSA 4OQPA 1I9CA 4R3NA 4LK2A 1TVKB 2OV2A 5KYWB 3E8XA 3BFPA 4ICIA 3DT9A 3NALA 3SHFA 1E6WA 1A9XA 4CKBB 3KHTA 3I34X 4V0KA 5JBQA 5ITWA 3B3FA 5JY1A 4JFRA 1WSWA 5BO5A 4U00A 1ZJJA 1IL0A 3NJ4A 1QBGA 2CB9A 4F5EA 3W5IA 1Y9JA 2IHKA 3M4YA 5DHRA 3RB8A 4BNHA 3BEOA 4L1KA 2XKBA 4GI2A 2QORA 4E11A 1SC1A 1D7AA 2K7FA 5G0SA 4X1IA 1W85A 3AHEA 3HGQA 3DQZA 1FSGA 4E2YA 7REQB 5KVVA 2O48X 3DEKA 3ELDA 3W9BA 2DM6A 1DQPA 2GZ2A 4ZWNA 1SK9A 4FYMA 3ODGA 3L43A 1CJBA 4EYQA 2G06A 3KLNA 3PJGA 1J0CA 1A69A 1OJ7A 4JCOA 5D8DA 5ALRA 5GPBA 1O0BA 5LQMA 3Q7TA 4XWTA 1C9JA 5ALIA 1CUCA 4K03A 3ASZA 5E0OA 4KXVA 5CEEA 3NEJA 3EFOB 2ZUWA 1KIAA 2B8EA 3B6EA 4Q37A 1TT5A 4H7EA 3OJOA 1BOOA 1J0BA 3EBPA 5L3SB 4DV5B 4CRWB 3HO1A 3K0SA 3KE9A 3JVVA 3WJAA 4EQ6A 4GD3Q 5EIEA 1WW2A 2I66A 2RGAA 3T7KA 2XOKA 3PLAE 2QTHA 1F06A 3HA2A 3QLTA 4FLFA 3P26A 1U3UA 2P5YA 2P2NA 3S2IA 4LVNA 1II8A 3PCXA 5H0IA 1BMQA 4HNAB 1OUMA 2XE8A 3LNTA 4URUR 3WLJA 3CBQA 3LHSA 3CIOA 4Q1DA 2OR3A 3Q6IA 1FW6A 1U90A 4J1TC 4C5AA 1P44A 1X7GA 2HPVA 2WG1A 4I1SA 1AZTA 3TR5A 4BX8A 2HIHA 4GT1A 5B5SA 1HE3A 4Q9IA 2BBTA 4D4LA 1PW5A 5H82A 3TN7A 3N9IA 4JENA 1XQWA 4UAGA 1W6RA 3FDZA 2AOXA 2IDJA 2Q9UA 4ITVA 4RENA 2C99A 2WWIA 3L7CA 3PR1A 2NO5A 4BFUA 1Y5MA 4AAYA 1Q7CA 4EARA 3RFXA 1NULA 1RQ7A 1MGPA 5J1TB 3TIVA 2ZUEA 2AJTA 5LJLA 3PNOA 1U1DA 1U2TA 4HP8A 4NQZA 4GU5A 16PKA 4V0SA 2QN2A 1UXIA 3UF0A 1LK5A 1I3KA 1L5YA 4HDSB 5DSTA 5TVGA 1SD1A 3DZGA 2L2QA 3PQ4A 4NMWA 1AU9A 4C7XA 5J58A 3K70C 1DX6A 3GLGA 1GTSA 3LX6A 2CLLB 3MPUA 4IGAA 3ZWPA 5BRAA 3ZLJA 4FSXA 2GLUA 5GV8A 3AM5A 4ZZ2A 1K2VN 1U0JA 4NBLA 4GM4A 2ZJ6A 3CKKA 5A6SA 5BQXA 1J4AA 1E2FA 1MNQA 1RQXA 1S3IA 2WKPA 5LBUA 4ZGGA 4PO3X 4WIAA 2XD9A 4GO1A 5AUPB 4ETWA 3T5PA 4FMDF 4MZXA 3QK7A 2FSIA 5AI9A 4NCAA 1QIIA 3W77A 2DAPA 4MUGA 2W43A 4GVLA 5KMGA 4ARZB 3RK1A 1W75A 2VHTA 1V8BA 4TTIA 3GGOA 2ECOA 4G63A 3WBFA 2NVBA 3ZQJA 5HWSA 2UXDB 1KAQA 4ER5A 2ZGVA 2SNIE 4UTNA 4MDEA 3RREA 2O9JA 1D5CA 1UKVY 3R5FA 1NW8A 3O4GA 4ML3A 2M1ZA 2HMAA 1F2DA 3HBAA 4OL0A 1ID1A 3I58A 1BHJA 4NJMA 4EA9A 4LNUB 2GN2A 5HIAA 3TZEA 1UEIA 1XJWA 5CBPA 1CF2O 5K8LA 3HRHA 4EA8A 4CM9D 4JJ6A 4MWBA 1NUTA 1E58A 2XMCA 4IDOA 4JXZA 5JSKA 3UYKA 5AK3A 4LBWA 4AY3A 1ZR2A 1GQYA 3V6MA 2EKBA 2XVXA 4EW3A 1I7PA 1QAOA 3BWEA 3DS8A 3NI2A 1FDOA 2H4XA 4OUDA 1V8PA 1KQNA 1OFHA 1PLJA 1VIYA 3O91A 1P3DA 1S9DA 1KDRA 2XZPA 1VCHA 4Z86A 1T43A 1KL7A 2C4TA 4ZT5A 4CKEA 2PRSA 1MA3A 4IV0A 2YYAA 3CA8A 4M9ZA 4MS1B 4RESA 5FWNA 3MIZA 3ICOA 5BUCA 2GDJA 3PUJA 4IMJB 1RC0A 4RABA 4QLOA 5FO0A 3OLYA 5JECA 1QFJA 1OFUX 2FEOA 2R66A 1KVQA 1GSOA 3U4GA 2OXRA 4GECA 1G9XA 2JFXA 1RHRA 1VMEA 4CM6A 4DJ5X 2OXIA 1F48A 3MJEA 1FX0B 5CXUA 4JI7B 3GMDA 1P9LA 4TYMA 1OF1A 4GGMX 1JL3A 4NZZA 3WO1A 5CDFE 1LV7A 5LYJA 5IF9A 5JAMA 1HWYA 1PSDA 5J5VA 3D59A 1MTOA 2HB6A 2XVZA 2RGXA 4TLLB 1QOZA 3IDFA 3RANA 2RFLA 2BGNA 3T99A 5AKIA 3W1EA 4YMVA 2I7DA 3KD3A 4N6NA 2EG9A 3C8DA 3JYQA 1AUXA 1E1QD 3LS2A 3TEMA 1G5TA 3O4IA 2R6FA 3EXHC 3GELA 1NNUA 1ZK2A 1A4IA 2X7XA 4NDAA 4BLPA 4C0KA 2QSZA 4KRFA 1RPJA 3JQBC 2ZRCA 1RWXA 1C30B 2G0AA 2CB0A 2HLHA 1I2DA 3CONA 1S1MA 5BNZA 1GN8A 1II0A 4PG8A 1Y5IA 2DPLA 2REXB 2MHCA 4B45A 2IUYA 5AK0A 4UATA 5A9SB 3ZD7A 4BE9A 3F7TA 1OXUA 4Y0VA 3T4XA 4F4FA 3LO8A 3DWIA 4FKBA 4QJ4A 4K9NA 3TNDA 1GKUB 3P9PA 4H7KA 2CDRA 5TPWA 1DTEA 3G85A 4E2ZA 4PG4A 3KVVA 3QOFA 4XQ9A 5AVWA 3H8WA 4XX0A 4B6FA 2X40A 4H1UA 2TMDA 5IP5A 3G02A 3FHLA 3K09A 1T8SA 5CA1B 2IHNA 5JFTA 3DV2A 3EEQA 1UKAA 3IIJA 4LY3A 4YJ2B 4RK5A 5DU2A 3UB4A 3WK9A 5C7LO 2V3VA 4IMRA 4QUIA 1L7EA 1OE0A 2BCJQ 2EJBA 2W9XA 3EGOA 4RFSB 4AJPA 3KTAB 4YJ3F 1DKOA 3GDWA 5DGTA 4EIWA 4IINA 4ZT4A 4OHYA 3VKWA 4QEDA 4QQKA 1C5KA 4IPTA 3C7TA 1HDYA 5DCUA 1GGNA 2JGEA 5TIIA 1FDWA 1US8A 5KTYA 1PQYA 2WKQA 1SB9A 1XA0A 3IUSA 1HSOA 4K9OA 4HGRA 3WMGA 4EPXA 3CX3A 2NX2A 3FHOA 4L15A 1EIZA 3SYKA 4BL5A 5BSVA 3OPNA 4QXOA 4RWZA 2VDUE 2ZAIA 4QUAA 1UMCA 1V8ZA 1GTVA 1Z35A 2SKCA 3OZGA 4F9FA 2REBA 2CSXA 2CCJA 1ZR4A 2RSLA 4NJEA 1IM8A 1QP7A 1YR8A 4EYGA 3KZKA 4Q7LA 5AUOB 2VRNA 4K88A 1JAYA 3A3PA 1NPDA 1YJBA 1R4AA 2J5RA 1DC4A 2H08A 3EF3A 1PT5A 4MIYA 3MUOA 1WR8A 2BI8A 1H2ZA 2PUCA 1QLHA 1IUPA 1E3WB 1EHYA 1C0LA 3KLOA 5DT9A 5KYYB 2R8RA 3CISA 2EFGA 1F8UA 4L75A 2QQFA 3VGPA 4YMHA 1Q21A 3N05A 3LI2A 4TM7A 3Q9SA 1VM6A 1QYRA 3EIEA 1ZN8A 5IMSA 3NBZC 3BD9A 2HIAA 3PT5A 4JLAA 1Z25A 2JK1A 1USIA 2JATA 1D1TA 4F45A 3REOA 2JLVA 1O77A 4B6RA 2B37A 4C78A 3R9IA 2Z2JA 1FLVA 4MYHA 3W8NA 4RGBA 3ZW9A 5HQ3A 1A27A 4YT2A 4C0HA 2QQEA 4BC0A 3MRSA 3WJ7A 3O0DA 4AS1A 5CYGA 2Q5LA 4J3JA 1MJ5A 1YMVA 2ZIFA 3ANLA 3FPHA 3NWBA 4FNOA 4TWBA 3MTBA 2W37A 2WHPA 3NNSA 4PTLA 4BV2A 1J21A 3WQBA 3PF9A 5HGXA 1YB1A 1OH5A 1HT1E 3MWLA 1BWSA 5AJHA 3WV5A 1BQ3A 1GFWA 1LUAA 3G9UA 1VKRA 2LPMA 3CJQA 3WK8A 1I0IA 2WHEA 4O5OA 4UFNA 1KDTA 5E7IA 2H4ZA 5JV5A 4L3OA 4DY6A 5LKAA 1OLUA 1B23P 1N8KA 3IE1A 2QRLA 4ENTA 4G09A 4HK4A 2QUJA 1M0SA 1YZKA 2J0UB 2M9MA 3BSSA 1JILA 3KFXA 4HLDA 4LHVA 4R7ZA 3JQFA 5FQNA 5J2TF 4C1BA 1L9KA 2RCYA 1OB5A 3VR1A 3IVGA 2B2NA 4CLRB 5TARA 1UBGA 3I23A 5ALMA 1CG6A 2UKDA 1X42A 2V7GA 1OC4A 1ZLXA 4LOAA 2G9ZA 4EEXA 3OQIB 3D0OA 2ZB8A 1M6HA 1XU7A 5TR9A 5JEEA 4B8YA 1L7XA 1ZC4A 3N8NA 2FWPA 1YZQA 3ETCA 3RIMA 4E5VA 2GWRA 3NBMA 2HI0A 2IUTA 1ZJ5A 4B8ZA 4R1QA 4RPCA 5FORA 3SBOA 3VU9A 1XTIA 4DBLC 1YQQA 4PO9A 4RTOA 1VBMA 3PHCA 3GPDG 3ISTA 4GMHA 4ZAVA 3UJ3X 4C1NA 4R5HA 3N87A 5DTQA 5IPFA 1GL7A 1LW6E 1XE3A 1YE5A 3CM0A 3GH3A 1W19A 1AZLA 2CXOA 3B53X 3LY5A 3QE2A 3Q5GA 1E1CB 2BMVA 3NFYA 4HS9A 3VC2A 4GLFA 3ZV6A 1PNRA 4DIEA 1RXUA 1W4RA 3D8SA 1P1IA 2PZLA 7MHTA 4BNNA 1QRDA 4K9PA 3OIFA 4PGGA 4JAVC 1HFEL 2QN9A 5BR1A 3LRXA 4P22A 2CBGA 3HB1A 4ROTA 3NVKI 1RR6A 2UZ4A 1Z38A 2ZSUA 2PANA 3NDPA 3CF0A 2C82A 4UNQA 9ATCA 1JLLB 1UBKS 1S2DA 2GBLA 4MVJD 5EXXA 3T1VA 4QBIA 4NXMB 1UZLA 2PS1A 1DXOA 1MAHA 1TQHA 1DT5A 4DDKA 3D6NB 2BGRA 4UUNA 2W6NA 2W00A 1WZEA 2R0QC 2WJPA 1P5ZB 1Y4DE 2QGNA 4KREA 5IW8A 1SU8A 2XI4A 3RAFC 2AB0A 1AQIA 1NJ8A 1TK2A 2P1RA 3BK2A 1W36C 2GNAA 5IWAB 4ZU3A 2Y1OA 5EN4A 2I1QA 2A3RA 4DC1A 4Z5XA 2K4MA 3H6KA 2P68A 4DA4A 1XZKA 4MWCA 5K0CA 3AQ4A 5TT1A 5AI6A 3N3AC 1VP9A 2QOEA 3H7IA 4UHKA 4C7OB 5DTEA 2YCLA 3JS5A 1OTYA 5AQEA 1ECLA 3R0IA 3R7BA 1TO2E 4JLNA 2ZWMA 1I1NA 1CZHA 1SU7A 1R0SA 1JBEA 2JKVA 3EXEA 4FCVA 2EKLA 1ACLA 3B6ZA 3HN2A 4H0CA 4J7AA 4EF4A 4Q5IA 1JT2A 1ONPA 3MLBA 2NZVG 2YWBA 2H1SA 1P1FA 3LHKA 4HN2A 2DXIA 1PFUA 3NYWA 3FRHA 1PZEA 3H17A 1FY2A 2YDYA 1HDOA 1W5TA 1YJ8A 3PUZA 2GB4A 4KXFB 1Z6AA 1W4ZA 4FGZA 1Z4NA 1YUBA 1EX7A 3HV0A 4ZQGA 4PEVA 4DEYA 2Q1XA 1Z2OX 2IE8A 4ID9A 3JQAB 5C4GB 1U11A 5ILOA 1X1CA 2BRUA 2OENG 3LL4A 2NO6A 1RI1A 4MR8A 2VPPA 1QHEA 5DYNA 4QJ3A 1D6MA 3UO8B 4BP8A 3U56A 1XZIA 3IAM1 2E4XA 4QDZA 3ZW8A 4GE0A 4DDHA 1QO0A 3OQMA 3QKRA 2YC2C 1P73A 2FWAA 2FSFA 1CUYA 1JMVA 2OFFA 4BX0A 4PQGA 4TXJA 4C14A 4YFVA 2GK4A 2VWHA 3SJUA 4ZYVA 5T67A 2J3QA 3D43A 3CEMA 3JXEA 1HYHA 2X5OA 5EP4A 1GARA 2X8JA 3K0KA 4DAOA 1VMDA 1GGHA 4YAOA 3V3KA 3ABIA 3VC3A 7AT1A 2FE4A 4DT1A 2B34A 5G0WA 1EYZA 1PRYA 1MC5A 3HZZA 3TD6A 3VRHA 2YWEA 3EIOA 1U8FO 3RC3A 4F6RB 4MOWA 5JH7A 1DVRA 2WP0A 1AB6A 5HW0A 3ORSA 5AOAA 5C4MA 5I7EA 3U61B 2FW9A 4LRWA 4DXHA 4PLZA 4LC0A 4WLNA 5E7QA 4BZWA 1L4UA 1T9ZA 2WD7A 1NN3A 5DSXA 4F12A 1AH2A 1B26A 2GZRA 1BEZA 1GKIA 4OBBA 4ZN6A 4S1WA 2F43A 1BXGB 1QYVA 2TSYB 1ZW6A 3MSXA 2V4MA 2V5VA 2XNCA 1KJNA 1ISRA 1RAGA 2Y1FA 1DIBA 1EQAA 4NAHA 5TPZD 6PFKA 4FYPA 4I5DA 3ZYZA 1DOHA 1GO2A 2PVSA 1IN4A 3C74A 4O4LA 2I33A 2PZEA 1WCIA 2BFWA 4A0QA 4C6TA 1N3IA 3VUFA 4MB6A 1ZIPA 1T8TA 2YH2A 1KZ7B 3ZDYB 3KE8A 4AZSA 1VIAA 2CJXA 5J4YA 3G0HA 2BJVA 1K8YB 3HA5A 3P9YA 4IKOA 3SIXA 4EHHA 1ESMA 1O95C 4EK9A 3COWA 5KUTA 1BW9B 2ON6A 3GP3A 2WE7A 3ICWA 4X20B 4B7XA 2HAEA 4YREA 4EM6A 3GVCA 1TCUA 1AN0A 2EFCB 2QUIA 1CS0B 2BFBA 4QYMA 4ALLA 5KTNA 2AKAB 1H2WA 2DMRA 3WYAA 5KO2A 3E70C 2OHIA 3ZDCA 3LGAA 2HFKA 1U9JA 1Q1EA 3FPEA 1GFZA 4O2AF 4D42A 2RHHA 2ZM6B 4FFPA 3V32A 3S2YA 1SKYE 3PUWA 1N75A 1L0BA 3BAFA 1K8RA 4P4TA 1I1QB 4QTUB 3G3EA 4QXQA 3D2LA 3K9BA 5EKTA 1YTUA 1GUDA 4YALA 3SJ7A 3TRKA 1OGYA 3P52A 3BGSA 4J49A 2WAYA 4MQEB 1JEYA 3NJRA 1NYLA 4ZZ3A 2P5TB 2QVLA 4DCJA 1T3ZA 2ECPA 1ZRHA 2B61A 2ZAYA 5FXMA 3ZOZA 4WY2A 1DXHA 4IKEA 2JHFA 4MR9B 1QHXA 4X95A 3TYXA 2WKSA 5C51B 3R3JA 1FSFA 2CLMB 1GGMA 3PNYA 4DR2B 3IP6A 3OBBA 1TYBE 3DBHB 3EQ6A 1BYIA 2I55A 3GMSA 3H99A 3ZH2A 2PK3A 2R1TB 4U6NA 3AZQA 4G5RA 4IEFB 4UU8A 3TIGA 2VK1A 3WYEA 1WB9A 4Z0HO 1VKOA 2DG2A 4WFJA 5KX5A 4RHCA 5LXTA 1VJDA 4JJ4A 4KXXA 3TSWA 2HQSA 3TZ6A 1VOTA 4NICA 4NBSA 4G5QA 5BVGA 4YP0A 2GBIA 3PRYA 1SWWA 3HRKA 4OGLA 1D4OA 4ZCPA 4IX9A 4CLHA 1GEEA 1O6ZA 4JGIA 3EXFB 4XCVA 5GAJA 2DU8A 3FTPA 1QKJA 2VP3A 2NO7A 5FLKA 4UFPA 4O3MA 1KOJA 2VP5A 2YUIA 3H1EA 4I99A 1J06A 2VPWA 1NW3A 1LPAB 1PG0A 2AFRA 4B09A 5FUYA 3NOVA 1VLMA 3HJTA 4GOLD 1NR7A 1SG9A 2Q6LA 3LFUA 5EHNA 3RTDA 5B7PA 1AOXA 2WWXA 5B4TA 1OXXK 1P7CA 2R11A 2GRJA 2A78A 2W2KA 3H3XA 5JCOC 2W2TA 4ARAA 2XWSA 3VI3B 8LDHA 3C0KA 4AJJA 4PVCA 2G17A 1SK8A 2WIJA 2GBCA 2WV7A 1M2VA 4B4OA 1LSOA 3BMCB 1S8NA 1CZRA 4OK5A 1JU3A 5KDDA 3BFXA 4EEKA 1HT0A 3AY0A 2QG6A 4NPCA 2C4MA 4M53A 2P2ZA 1EWTA 1CVRA 2AR9A 1RWPA 1C1DA 3K8QA 4LDRA 1WMSA 2NNLD 2VJMB 3DE1X 2RHCA 2CXRA 2BP7B 1F2TA 2H9AA 2Q5IA 4WNYA 1JDVA 3RCBA 5C7IO 1XZQA 3G8AA 1X8KA 4XUGB 1HNNA 1P1RA 1U5CA 1WZNA 2ZR7A 1G64A 2ZYUX 2GCNA 4L4RA 4M99A 3P96A 4ZOLF 4EJ6A 4OMUA 3FVTA 4UBIA 5CT6A 1JDUA 1WMEA 4P08A 4EKGA 2YASA 1BXKA 1MB2A 5GIPE 2R8PA 2QZ9A 3IUYA 4UUOA 4YP1A 1XAIA 1PQ4A 3PE3A 3RG8A 3GJ0A 1J42A 2IXDA 2Y4OA 5DJ5A 1CUJA 2OA0A 3GVIA 3UAGA 1FJXA 3SLRA 2EJWA 2VWPA 1AF7A 5CTAA 2ERXA 3U4AA 4DTIA 2X58A 1I36A 1TB4A 2GKOA 3O2QB 3R5TA 3NOQA 1OT3A 4BO0A 4RPLA 2GARA 2Q5JA 1FTQA 2SICE 2IZ7A 4IUYA 4PHFA 3SGLA 4HWRA 4HQNA 2GZSA 4CQJA 1D9ZA 2HF7A 5DOZA 5BN4B 1XMQB 1ZNWA 4H3HB 3AHCA 2J4DA 2PS3A 3D8BA 4RE6A 4AX8A 3WLFA 1YCGA 1DJNA 1L9XA 4UPVA 1XCGB 5DTIA 3L4KA 2VVTA 3C85A 1TU4A 1AURA 3T9DA 3TSCA 1SKAA 5HIIA 1C41A 4NZMA 4TL9A 4ZQHA 3QH4A 5KNBA 4GKJB 1JECA 2XLBA 1FS4A 2DGDA 4LVOA 3C4VA 3OQHA 4YUZA 3PX2A 3BGOS 5GTDA 1GA6A 2ZE7A 4DCTA 4X71A 5KKCA 3PX7A 4LX8A 2ZJ1A 3E8SA 1NV8A 5A4DA 3L9XA 4MUFA 2ZP1A 3OCJA 2B1RA 4PS0A 2WNIA 2CYCA 1RYEA 4XM1A 4PYRA 4YAFA 1RAAA 3LQ1A 1B15A 3R5XA 4UVHA 1BWPA 3OQ6A 4WE3A 3W3AD 4HBGA 3BRWA 4BLSA 3OQ1A 2IYEA 2ET6A 1JIVA 2BZSA 2OSBA 3GPIA 3VVCA 1NUPA 4BKMA 5FP0A 3LYHA 3ZNOA 5DYYA 4GL2A 2CYBA 1WNTA 3KOXA 4H31A 1Q0HA 2EX1A 121PA 1M1NB 2ZT8A 3IMKA 5JAQA 3WTCA 2PMBA 3C2QA 1ZK3A 3L5KA 2HREA 5ALEA 3IDQA 4D74A 3QFTA 2QW8A 4C08A 4MGYR 3PZBA 621PA 2Y1GA 5K6AC 3AF0A 3GT0A 4PHGA 3E9CA 3LO5A 4OA8A 2PMFA 5K01A 1B43A 1W2GA 3LH5A 4NPHA 13PKA 1TUEA 2PBFA 5G1OA 1S2LA 2VP4A 2E18A 3PD0A 2QGFA 2C3OA 4L9RA 2EKPA 2EOAA 4YJFB 5KQPA 4I8XA 4BQSA 4D97A 1YL7A 4DSAA 3HYSA 4WESA 1D0IA 4ZKDA 4RKWA 4EX7A 5B3JC 1PV4A 3GJ5A 3I64A 3VSCA 4HDRA 1T2UA 2WZQA 3DPSA 4R3UC 3OU2A 4FT4A 4EYKA 4F6LA 3Q0IA 4HATA 2YHAA 4E4YA 1CLUA 1P6XA 2WU1A 5I4BA 3LQFA 1MJHA 1TNDA 3USES 2PYZA 4IYJA 1RI5A 1YQTA 3SJCA 5AQ1A 4BLRA 2YXNA 2OZPA 3FZNA 2XUJA 4N0PA 4C21A 1R2QA 1SXIA 3MGAA 2Q28A 2YYYA 3OOEA 4G36A 1FMCA 5CFNA 4YH1A 3K73O 4ILEA 5CJJA 3MJTA 1P0CA 4Q02A 4MGHA 1H3FA 3CZPA 4JJIA 2MR6A 3WRYA 2GFIA 2YNMA 5T7BA 2O3RA 1GV1A 1Z2AA 3WLIA 4AN0A 1JNYA 4RGQA 1CB7A 1ORWA 1MVLA 2CVPA 2QG9A 2YVKA 4MITA 1RQGA 2I2DA 1Z2EA 2C95A 1GXSA 2OGTA 3N75A 3Q7SA 3R0ZA 4Q4HA 4Y67A 1YOVA 3L0DA 4H9GA 4RUKA 2B9VA 2XE4A 3KQPA 4DF3A 4L27A 3TE7A 2NP6A 1TTHA 5JWHA 1G6Q1 3P0FA 2WVJA 3T8YA 4NK5A 3HFSA 1PCXA 1VYVA 4LVUA 4QDJA 1BDMA 1M5TA 2PHZA 2FPGA 2QV0A 2X5XA 4LVCA 1V37A 1YS2X 1BWRA 1GTL1 4P54A 4TN1A 3ZIUA 1BS9A 1PJTA 4ASUA 3IEPA 4N54A 4C89A 2C92A 3RVKA 3DHVA 2R00A 1JSXA 4BWYA 4NR0A 2JIPA 2A0FA 2NAFA 2J3EA 2D0PB 4TXNA 1FMFA 3OFJA 5DLQC 4FW9A 3U1VA 5A5DA 3OQNA 4X65B 2F1IA 4DYDA 2DFLA 3OLWA 4CNBA 3F6RA 1ZXBA 1TJ4A 2XHZA 3OPYB 1J6UA 1GGFA 1YKFA 5H9WA 1V7CA 4NECA 4NQRA 3NH6A 2P9GA 1Y1TA 4GZMA 1XVVA 3G5TA 4N82A 4OQYA 2C3PA 2B0CA 4ZCSA 1TFRA 3KQKA 3ND9A 4PSCA 4AURA 1UBJS 3FF1A 3EZYA 3H3JA 4HGOA 4UTXA 4EHFA 1N9KA 3PDWA 1U3VA 3DVSX 1QFMA 2FR1A 2JIOA 4X94A 3O1JC 3TIFA 2FB9A 5JSHA 1RAEA 3ZNNA 4OBWA 1PNVA 2REQA 1DS6A 5L9AA 3L4EA 3PVSA 4A23A 1M34B 4HC4A 5DI3A 4E4RA 2XAAA 3EGWA 1SZDA 4HGPA 2E5WA 1VBNA 4F4JA 2FLVA 5KQRA 2P6NA 2AUMA 1L4YA 1NONA 1OLXA 1O8CA 1NW6A 1EWRA 1XJQA 2OKGA 4AJ9A 1HG0A 1Q20A 4TVOA 2XGGA 4MH0R 4D4MA 1DGQA 1E6EA 4KH1A 1R8JA 2EF0A 3PKJA 4X1YA 2YJ6A 4E5UA 4WVLA 3ZY6A 5BVHA 2ZTMA 4Q18A 1Z0SA 1X1TA 3RYFA 3VR5D 4AYWA 1Y8RA 3SFZA 2AW5A 2XWQA 3O0TA 3IDSA 3RU7A 2W6ID 4RVSA 5LP1A 2PSJA 3KKLA 3R09A 1U80A 1YMQA 3CU5A 3IE0A 1R8SA 3ZHZA 3WQHA 4YAWA 2PE5A 2QL9A 1YR2A 2LIPA 2YJ3A 4KVFA 2QN1A 3ZDAA 1A7AA 3BK7A 1ODSA 1SBQA 2PMEA 4LWQA 1WHSB 2BFDA 2FSGA 2K7ZA 3GO4A 5KKNB 4R1OA 1XU4A 2WYVA 4KYTA 4KXLA 5EMNA 1RXSA 1D2CA 4PC3A 1RT9A 1BFKA 3DOHA 5AM2A 1E79A 3WDLA 3FTEA 4EO4A 1BHSA 3GL9A 3ZXXA 4C87A 4OI2A 1H8ED 2G6BA 3M0EA 4R9SA 1O4WA 3NRBA 1LQ2A 4BQPA 1J8YF 1Z0IA 4G9EA 4X24A 5IXJA 2YJGA 3IP3A 4TRRA 4NG5A 5I7RA 5BR7A 3GLIA 3ZWVA 4AJNA 4ZXPA 3M6FA 3F5DA 3W4IA 2ZT6A 2WJVA 3L6CA 3ZYCA 3ESQA 4Y8VA 3UEOA 1QIFA 5BN3A 2FOXA 3OM1A 5CHYA 3BJRA 3E22B 2JIBA 1CNFA 3F49S 1XMPA 3L0BA 1Y6RA 1H3EA 3PFNA 2WDZA 3C7CB 4Y0AA 3VSDA 2FUEA 1WB5A 4CM8A 2P67A 4QNMA 1XU9A 3V5NA 3FAZA 3QWHA 3RYHB 4B83A 1CQPA 1NKSA 1CQIA 1NQVA 3OWOA 4MS3B 4I1IA 4G24A 1LC0A 3EQ8A 3HU1A 1E3EA 1FYFA 4LUCA 3U48A 4XH9B 4NBTA 4BYMA 2YXEA 4EELA 3D7LA 3BD8A 2ZTHA 3H8SA 1D8AA 5IJ9A 3E1SA 1ZWKA 4CM1A 2WFMA 5D6NA 1GFIA 3GPLA 2BTEA 2QYOA 4K6MA 1BSVA 3D3WA 3ELBA 3NVMB 3I92A 4C6RA 1OAKA 2HT6A 2QLMA 1YDWA 3GGJA 2ABWA 4RIHA 3COSA 2D0IA 2VRCA 3G59A 3GUUA 2JJ2A 4C3OB 4C4RA 1Q15A 2C7GA 1VPVA 2VHJA 5EERA 1T9DA 2GERA 1SBHA 4URFA 2NP7A 1T4CB 1D0VA 4KVGA 1DARA 2FPWA 5FA5A 2Q3FA 4ZD6A 3OIYA 5A9TA 1QHIA 2QTGA 3PHBE 2YFYA 3EAQA 4F2WA 1HE1C 3MWJA 3HJGA 3AEUA 4DSNA 2UYHA 5HKBA 2GN1A 2BFMA 5JS1A 3NV9A 1QP8A 3IR6A 4RZHA 1TJ5A 3FTNA 2M6LA 1JLMA 3UMBA 2CF6A 5DSZA 3E82A 2W6MA 4CMHA 4FXPA 3WFZA 5HCUA 1RTKA 1ZY2A 4RANA 1CE8B 1HKHA 3FFAA 5HK8A 4CKWA 3N2LA 4ZTUB 1G291 5JWOA 4L8FA 3EYAA 3H1BA 4BDSA 4WX2B 3I42A 4Y2HA 1SFRA 2BW0A 2NV0A 2FCRA 4CFYA 2VAXA 3NHWA 1EXNA 1OWNA 2EKDA 4GX5A 5H9VA 1OYWA 2QZ4A 2VUIB 3F8TA 1C29B 1J07A 3RM3A 3TZQA 2PEZA 4I2VA 3WAKA 5KTMA 3R8XA 4XIGS 2V1XA 3X1YA 4C3UA 1NF3A 4I5EA 5B1HA 3SQMA 2VCEA 4HZUA 3R8CA 3A9TA 1KZ4A 1NPTO 2WUFA 4QUBA 5LYYA 1NBMA 5DV9A 2R00C 4GP6A 5AM5A 3F71A 2Y8EA 2YYSA 3LQ2A 1X2EA 3OAAD 1L8QA 2LTAA 1NBAA 3AG5A 2C2KA 5FTLA 2OCPA 4JVSB 3NC4A 1ARZA 4GPTA 4FSHA 4IIJA 4JP2A