4JT4A

Structure of clostridium thermocellum polynucleotide kinase bound to datp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Metallophosphoesterase
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 63
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jt4A00
4UXJA 2D62A 2ZRKA 3S1AA 3I61A 3K0SA 4IVRA 4DJTA 1E2DA 3IEUA 1J70A 4P4SB 3U2QA 5EP1A 2Q3MA 3L0IB 1VKJA 2ZREA 3L8YA 4BLRA 2BBSA 2V6JA 1UM8A 5EXTA 3L0OA 2F7SA 3GFTA 1YE8A 2EFDB 3MUFA 3RSOA 3G82C 2AK3A 1XB2A 1W0JD 1N0UA 1W0KA 3RWOA 2FFQA 3FMIA 1W48A 4YXWD 1N6RA 2GZDA 5F9HA 5DNYB 2IWHA 3W5JA 4AKGA 2GCPA 3IO5A 3GLGB 1ZIPA 1E94E 3ZD6A 3A4NA 4GP6A 1Z8FA 2IW3A 2RKOA 2UZ3A 1ZBDA 2WWXA 3CIOA 1QHYA 4YMTA 3AEZA 3SHFA 3ZIAA 1G16A 2ZJZA 1E2KA 3SC3A 2XNDD 4YMVA 3EWAA 1GWNA 4ITRC 1VG1A 1XP8A 3DMNA 1ZD9A 4HLUA 2CCKA 2MMCA 2PLFA 4US0R 4IFEA 3C7KA 3T35A 4BZPA 5L8VA 3BFKA 3OEED 4DDUA 1I2MA 3B9PA 4PPGA 5AK0A 2GJ8A 4XVRA 1GITA 4L16A 1AQYA 3FE2A 3GPLA 1Z0DA 2O52A 2ZRCA 1XBTA 4JLNA 4BFWA 1OXVA 2Z4SA 4PC3A 4GOXA 5E4FA 3ASYA 4LRWA 2X2EA 3QEJA 1XMIA 2FNAA 2N1BA 1P62B 2Q0HA 4AG5A 4TT3A 4L8GA 3AM1A 5SZKB 1D2NA 5FBQB 4M2LA 4B34A 4EUNA 1JEEA 3BFVA 3RWMB 3BK7A 1F2UB 2ZJBA 4MRNA 1Z47A 3LVRE 4TLEA 4PC6A 1US8A 1XTRA 4Q19A 1G5PA 4I1SA 3SDZA 4B75A 1N6NA 2W6IA 4PO8A 5G3ZA 2V7QD 3VU9B 2Q3FA 4L5BA 4UNNA 1KTVA 1DELA 1ELOA 1JXMA 1RYFA 3PVSA 3TIFA 1NIJA 4PFSA 1OXTA 3DPUA 1XCPA 4R9UC 2GILA 2OG2A 1Q12A 3SN6A 3AP1A 4Q4HB 2AXNA 1G8PA 1KSFX 4BFTA 1DG3A 1T5LA 2P2LA 3CRMA 5EP3A 2XXAB 1VYTA 4RCZA 4RZ3A 1E2EA 2C9OA 1GKUB 2QT1A 3FDIA 2YV5A 5KO2A 5HTKA 4KLZA 4AY2A 5JWOA 2QROA 2YOHA 4LHZA 1KI4A 3B8HA 1ZYUA 4I81A 3LW8A 3CRVA 3DZDA 1CEEA 1GNPA 2KI5A 2MMGA 1E6CA 2VTKA 4GT1A 1JR6A 1SVKA 4JLBA 3CB4A 3EASA 2OESA 3FFAA 4NPHA 2HEIA 2H8KA 4EQ6B 2NO9A 3QEOA 3GQBA 4DLRA 1OSNA 1A5TA 4FMDB 1WCV1 5J4YA 2FEOA 2ONJA 1XTJA 3EPJA 3M4YA 2QPTA 4FIDA 2LKDA 2QMEA 4G5RA 2JDIA 4LJ7A 4I99A 4G5OA 4J0QA 3KKOA 3SYNA 1VG8A 4LV5B 2GCOA 2W6JD 1R8SA 4D6PA 2WWFA 2ZI9A 2JLVA 3D3QA 1MV5A 1ZIOA 2IF0A 3GJXC 3Q9LA 4K46A 3ZZTA 4B32A 5JS8A 1CRPA 1RIFA 1T6NA 1E2QA 3GLIB 3D8BA 1Q57A 2RH5A 1II0A 4IEIA 1X8KA 3NEYA 4WIAA 3B13B 2GTPA 2FOLA 2MSDB 3DM5A 3WYAA 3CO5A 4BWYA 2WAXA 3KB2A 1R10A 1ZD1A 3T1OA 1YRBA 1HH4A 4B43A 1E79A 4ZKEA 3TW4A 1NVVQ 4EAQA 4P4UA 5FL7D 2ZS9A 4H9GA 2C99A 3VHLB 2FA9A 2QZ4A 3ICEA 2CVHA 4Q01A 2ZPTX 4XOIA 3U44B 1N6KA 2FU5C 2DHRA 4LOAA 1P9NA 3X2SA 1LY1A 2ZSFA 5DH9A 2DY1A 3MMPA 3HR8A 2XTNA 821PA 1CLUA 1F6BA 5JJKA 2IXEA 3E5HA 1AZTA 3RAPR 4PANA 1GKIA 4C2TA 1LNZA 1YKSA 3CPEA 5IK2A 1DAHA 3H84A 1Y3AA 2UZIR 4HLUC 4BLOA 1TQ6A 5BWMA 1Z63A 5BN3A 1Q21A 2RGDA 1MO4A 4RD0A 5FI0B 2VP4A 1ETUA 5DI3B 1CU1A 5IRCD 1AK2A 3AUXA 3MWKA 5SZJA 4G0NA 4RSGA 4LV6A 4Q4AA 3FMFA 4Q9IA 1Q1BA 2ORWA 4Q7LA 4U5XA 4R98A 2GAAA 4A1FA 2VEDA 4TT3D 1W4RA 4IDQA 3DOFA 2V8OA 3K0EA 2WM9B 1E9BA 2P5TB 4NCKA 4DUGD 4DSUA 4JBYA 3TBKA 4X8HA 3UK6A 3FMOB 3OFND 1XMJA 1G21E 2F9LA 3DDCA 4JLDA 4I1OA 5F9FA 2XZPA 1OF1A 2BWJA 1VIYA 4PSVA 3KUCA 3O47A 2GWHA 3U61B 3HWSA 4MKHA 4DSOA 4EJSB 1CP2A 4TQUS 1G3RA 3ZYCA 3FFBA 3PFIA 3LWNA 3AF4A 2H5EA 4MGIR 3ETLA 3HU2A 4JT4A 1A1VA 2ZI7A 3LAWA 1IXSB 3AUYA 1T5IA 3X1ZA 3P32A 1ZAKA 3I4LA 4JL8A 4LGMA 2VP9A 3W6PA 3MLEA 3U5ZB 1SQ5A 1NMYA 4DT1A 4TLCA 1L2TA 3PITA 3ONWA 1MH1A 1RW4A 4KBFA 1F2UA 5BQ5A 3NHAA 3N70A 4I1VA 5D3MB 1P9RA 4F4CA 2ZRJA 2V54A 4OI2A 4N0EA 1EFTA 1OHHA 3A1WA 1P61B 2ZU6A 4HLQB 1G64A 3RVBA 2CL0X 3VU9A 4LBWA 1EFRD 1E2GA 3VAAA 3QBVA 2EYUA 1OH8A 3GCGA 4EPYA 1M8PA 2GVDC 2PZFA 2I3BA 2A5JA 1OPXA 3SBEA 1CJTC 2GZAA 4PPQA 1ONBA 2EFCB 2RGXA 4NYIR 3P1JA 1E79D 1OIXA 3CH4B 4NH0A 1NN5A 3TW8B 2JIZA 4A9AA 1LF0A 2IL1A 3FB4A 3B7GA 3R9IA 1XEXB 3BIFA 2QQEA 2IYXA 5EE9A 2VF7A 2IYTA 1N2CE 1XXHB 4DVGA 2NPIA 1XTSA 3AH8A 1Z6AA 1NG1A 2G0TA 2ODWA 4ON9A 1ESNA 4KSBA 1FPMA 2OM2A 3AKYA 3PEVA 4PAQA 4CEHB 2ZRIA 1JR3D 2KE5A 1OYYA 2NO0A 4BFUA 5BW8A 2YOFA 1GIAA 2QE7A 3EAQA 2NZJA 4A8JA 4FW9A 3SJAA 1KGDA 1WRBA 1II8B 3IQWA 5EQTA 1I4TD 1OFTA 5DN6D 4A0FA 3UWOA 2FX3A 4Z8YA 2AHOA 1R0XA 1AA9A 5CDFE 3PIRA 1OH7A 1NF3A 5LB2A 1Z6TA 4N1AA 4RZXA 2B7BA 1FTSA 2GF9A 4ARZA 5JI2E 1TUEA 2PEZA 3OE7A 1WP9A 3A4MA 4AC9A 3K09A 2GNOA 1JBKA 2ZIAA 2RHMA 2X8AA 4WOPA 1KNQA 2J0UA 2QSZA 1NRJB 4FCTA 4LBVA 3SI7A 2YJTD 4V0MA 1E1RA 1ZCAA 3CX8A 5C2JB 3B2EA 4MUBA 4PSKA 4PC1A 2ZRPA 4D2IA 4A2PA 2ZE7A 3TUIC 5KTYA 4FWTA 4TL6A 1M2OB 2OCYC 3TR0A 5J4KA 4MYHA 2FEMA 4EIWA 3CZPA 4BRUA 2NG1A 3ZZ0A 1DAMA 3KJEA 3KXLA 1FTNA 4JIMA 1U9IA 3AVTA 1YU9A 1D2EA 1E96A 4ABYA 3Q5DA 1UKVY 5FTNA 2ZR7A 4AYWA 1XD2B 3F0TA 3MRSA 4CIDA 1PV4A 3HYRA 1YJ5A 1JB1A 2EU8A 4LJ5A 2O8FA 4BQSA 1RRCA 4FWIB 1HTWA 4UJ3A 2BBTA 2V6IA 1A4RA 2ZYWX 2HLDD 2CNWD 4WZAE 1X1SA 2H17A 2WJYA 2QY9A 3R7WB 3AGPA 1RKBA 5JRJA 5AJZA 1AGRA 1UEIA 1HA3A 3AF1A 4RD6A 2ZVPX 4YDHB 2GJSA 2VBCA 4Q9KA 1IHUA 1R5NA 4Q48A 1NBME 2TMKA 2ZANA 4E09A 4X8OA 2IA5A 4F92B 1BMFA 1P2UA 3P26A 1J99A 1MABB 2C98A 4FCVA 4D4KA 3WRYC 4E07A 1FNMA 3U6KA 4QNMA 4D4JA 2PJRA 5M04A 3LXRA 4EJSA 4HDQB 3THOA 2FZLA 3GEIA 1QZXA 2WKPA 3LX5A 2BCGY 1DG1G 4PTLA 3PJRA 1IY2A 2VA8A 1W2HA 2ODBA 2C8VA 1FOEB 1KMHA 1Q1EA 4RFSB 3WP0A 4IW3B 2OT3B 5CM8B 4B2IA 1DAFA 3UWKA 1NG9A 2P67A 1V5WA 1MRNA 1ZUHA 2CJWB 2FSFA 3NBZC 1KYIA 2C03A 2D2EA 3VQTA 1EX7A 2IUSA 4PXAA 4TQ9A 1C4OA 2RGAA 3FVQA 2NO6A 1S1CA 4ZCIA 4KFSA 3QKSB 1SXJE 3PEUA 2DCUA 2VO1A 1EGAA 3AF2A 3SQXA 3WXMA 1M7GA 4PZYA 2GJKA 5K8LA 3TH5A 1U81A 2W2VA 1NY5A 1TADA 1OKKA 4H1UA 2IS6A 2R6FA 2XOKA 3OIYA 4C7OA 4A0HA 2P6RA 4S2EA 3DKPA 4WXPA 3CUEF 4MRPA 1UJ2A 1VMAA 3LBIA 4GBMA 3W90A 1IY1A 4A8JC 4WW0A 6Q21A 4N3NA 2EQBA 3AV0B 2B21A 3Q3JB 4OK5A 2WICA 3C5CA 5B30A 4CDGA 5JCPA 2WJHA 1PUJA 3M0EA 5E7JA 5KSOA 3ZLJA 5J40A 4NCNA 5SZIA 1XNJA 1E2NA 2H16A 3GLHE 1E1RD 2IEZA 1XXHA 3K09C 2WIBA 3NVAA 4XD7D 2BC9A 4UXHA 3GJ0A 4Y0AA 2C04A 1BYUA 2IWRA 2IYQA 1W36D 2BM0A 1EG7A 3TNFA 1YZQA 4Q5IA 3AVQA 3PV0A 1TUIA 4QGAA 3SR0A 2QBYB 1TX4B 4JVSB 2HCJB 4CEHA 3G0HA 4R71A 3EARA 2WKQA 1OH5A 5BN4A 4IOMA 4E5UA 3VMFA 3A4LA 1W1WA 1W36C 3NG1A 1NL3A 1N3BA 5DHFA 3T1VA 5L3VA 1GDDA 3KDSE 1MO6A 2W2XA 3AP3A 3DZ8A 4FMCF 4L4UA 5KNCA 1U9IC 1IAQA 5LD2C 3LO5A 4BEBA 2J7KA 2BMEA 1BKDR 1W0JA 4O3MA 4TL8A 2CLDX 2HJVA 3WNDA 3DMDA 2QEQA 4GMDA 4PR0A 3BJIC 3QKTA 5EUQB 4YXWA 1C1YA 3VX3A 2FFAA 3PQCA 2R44A 1NVVR 3JZAA 4DEYA 2HJGA 3A8TA 3C16C 5HR5A 2IUTA 2ATVA 1XEFA 1M6NA 4RKEA 2SHKA 4ZDIA 1GKYA 1SHZA 4MA4A 2BMFA 3ZD7A 1NLYA 1CTQA 2QU8A 1IXRC 1GVNB 3QI2A 2G1JA 2RGNA 2O8EB 2XNDA 4OQMA 4XSHA 4JKIA 1KK3A 4NMMA 4OI1A 4HAUA 1KNXA 4ZI3A 3OEEA 1G7SA 3CW2A 4NCHA 1T0JB 2V9PA 1D5CA 1N6OA 1ZVQA 2AD1A 1UKEA 4C0LA 3MWJA 1LTQA 1QG4A 4BUJA 3THXA 1Q3HA 1S8FA 2GJAA 1W7AA 2G88A 3SBDA 2WAYA 1OFIA 4Q1FA 3LW7A 3LFUA 3BOSA 1DO2A 4R2HA 4Z54A 3LA6A 2XTMA 1RJ9A 4QOSA 3CH5A 4F4JA 1Q22A 5FI1B 4BASA 2MSCB 4UNPA 2X1VA 3CWQA 4WZ6A 4KVAA 1RC8A 4Q03A 4DLXA 1R2QA 4US2R 2ZYVX 421PA 1ZD8A 3N5CA 2A5DA 3HP1A 3QVUA 1II9A 2WVJA 3WMFA 4ASUA 3U60B 2WSMA 5DGXA 3R7WA 5JEDA 4IOLA 2DWOA 4D4MA 1CIPA 4JLOA 3CNLA 1H8HD 3LH5A 2Z4RA 3CNNA 1JECA 1QG2A 2PMDA 5P21A 3GD7A 2V7QA 4HEJA 2JJ1D 1NVXQ 4MKFA 4KLNA 3KKMA 4GI7A 1SKYB 2IT1A 3TSOA 5DSZA 1UBFA 2OLKA 4B71A 2XOKD 2P6NA 3DKVA 4FD2A 1P2TA 2N42A 4M9SA 4MUAA 4L9WA 1KI7A 2XB2A 1G291 1JQJC 2BKEA 2OV2A 2YC4C 5TV2A 3UG6A 1M7BA 1H8ED 1VG9B 2WJGA 1TU4A 2VRWA 3OHMA 2VIIA 4NHOA 4I1UA 3NXSA 3QUSA 2J0SA 4A36A 3NBYC 3ZH9B 1IN5A 1WBBA 3ZVNA 1CULC 2WKRA 2J41A 2CHVA 1VHTA 1XTQA 3UANA 3R9WA 1XJQA 4XIGS 1OW3B 3A6PC 2CJWA 2Q21A 2C96A 5DHAA 3ZQ6A 1AKEA 3ZVMA 4WXRA 3IEVA 2FFBA 4MKIA 3TQCA 5FPHA 4NYMQ 1MO3A 4PQRA 3UXMA 2BJVA 1G3IA 4PAOA 1TPZA 2W6JA 2QAJA 3QKSA 5BYKA 621PA 3IPYA 5TVKA 3QNUA 4YMSA 4BLSA 4UXIA 1KSGA 4F7WA 1QF9A 2J0QA 1DAKA 2UKDA 3AGQA 2OCPA 4D4LA 1ZNYA 2PMKA 4NONA 1B0UA 2ORVA 3U7GA 3KXIA 3IUYA 4Q4AB 3LLMA 1L4YA 2VHTA 4C0HA 4EPTA 1GL7A 721PA 2IS2A 2ZE8A 1G8FA 2ZSEA 1WB9A 2EWVA 4DHEA 4JJZA 3WYFA 1ZU5A 2ZITA 3CR7A 4GL2A 3GEHA 1CXZA 5FL7A 2W83A 4M1MA 3RANA 3OIUA 4QC2A 5FOUA 1AZSC 4C0QC 4D0NA 2OAQ1 1ZC4A 2PH1A 1VPLA 1TQDA 2WWGA 4B47A 4NTZA 1XD8A 1XX6A 4B74A 5B58C 5JFGA 2XB4A 4C0JA 5IF9A 3BBPA 4LHXA 3T1QA 1GNRA 4TMTA 1W5SA 3IHLA 4Q9HA 2O0KA 2CXXA 5FTLA 1DO0A 2FPKA 2J45A 4Q02A 5J5CA 2QNRA 3VKGA 4UNRA 3DM9B 1R0WA 2QBYA 4FMBB 1FMJA 2YWGA 3KJIA 5CIQA 2RGEA 2RGNC 5FPYA 5HCIA 3GLFB 2BMJA 2AX4A 2GETA 3PR1A 3DL0A 2XNSA 3LQRA 4TMVA 1VHLA 2HUPA 5L3RA 2WWWA 1VECA 1UDWA 4HAVA 1IY0A 1E98A 2AWNA 4QBHA 3PUXA 5C18A 3W6OA 2GVZC 2GXQA 2JJ8A 2R2AA 5CK4A 1E1QA 3BE4A 3T5GA 1G4AE 4O2LA 2ZM5A 1Z08A 2FF7A 3PG5A 2FSIA 2BBOA 3AF3A 4M21A 4DT1B 1G7TA 1VDZA 2IYVA 2OUKA 3KUDA 3AVWA 4DCNA 1OXUA 2ZR9A 4KBGA 3CRRA 3UKDA 4QKQA 1RRGA 2GZHA 2ZE6A 3EPLA 2HCBA 4ASUD 3GFOA 4DUGA 3H2YA 2QORA 4MYCA 3WNBA 1YZNA 3QPUA 4DSNA 4C2UA 3TQFA 1GUAA 1H65A 1E3MA 1E2MA 2C77A 5KNBA 1UEJA 3H4MA 3OFNA 1O87A 4G1UC 1Y63A 4C0SA 3IGFA 4C0AC 2O8EA 4QL3A 4A2QA 2RCNA 2VH5R 2A3RA 3SQWA 2IYUA 2BM1A 2GEDA 4OQNA 3BH7A 3WP1B 2ZROA 4KYUA 3R8FA 4OKSA 3QG1A 3TAHA 3TSZA 1XPUA 4IXMA 1WQ1R 3RS7A 4YMUA 4FN5A 1G7CA 1SKQA 3QPVA 4DLSA 1RE0A 4RFVA 1G18A 4CEIB 3WNCA 2CL7X 2PCLA 5AJWA 4V0NA 1GNQA 3TK1A 2DFNA 2QPAA 4HUQB 5FOWA 4TYNA 1KDPA 5GJCA 5CLLA 5EXXA 1EXMA 4LHYA 3KQNA 5AR1A 5J47A 4BFSA 1T9HA 1K5DA 4KODA 4TYWA 1GRQA 1DE0A 4A8JB 1Q3TA 4BZXA 3QJYA 1KI8A 1EFRA 1Z29A 2DPXA 1KIMA 2DR3A 2CVFA 1N5LA 4TLDA 2BEKA 5CIWA 1OH6A 5KU1A 2CEAA 3KKQA 1UAAA 1UPTA 4RZUA 3C41J 1ZINA 4II7A 3Q5EA 4KU4A 4B76A 1X86B 1Z0KA 1NBMD 2Q9CA 4HAXA 4OJQA 5AJVB 3M6AA 1SVMA 3K8YA 4ZPXA 5EZ6B 1GILA 5H68A 2EYQA 3KB1A 3Q7QA 1YR7A 3WYGA 4ARZB 5IT5A 4CGZA 3W3AA 1BH2A 1A7JA 4URVR 3R8CA 4QM7A 3B82A 4HB2A 4TTPA 1TU3A 3A1SA 2QQ0A 1Z07A 2A30A 4PX9A 5DISB 2J0UB 1AS3A 2GXUA 5LB4A 1NLZA 3O8CA 3NEJA 4B6EA 1N0WA 3B78A 2ANBA 3DHWC 2G9NA 1QBKC 4ILEA 5FR1A 3L0PA 1TL7C 1W36B 1RVDA 4LDJA 2Z6VA 2R65A 2Z43A 1JR3A 5EP2A 2QENA 1E2PA 4EPVA 1TTTA 1DEKA 5F3WB 4LYJA 1QHXA 1W4BA 4BLTA 2H1LA 5LD2B 1DARA 3QENA 4IDNA 3EG5A 3WBJA 5DN6A 1LVGA 2O8FB 3CX6A 3I5YA 1R0ZA 2GA8A 1E1QD 3IO3A 4C30A 3TVDA 1SXJD 2OZEA 2ZI3A 1TF7A 2KBEA 1NN0A 3UG7A 1NJGA 1T8TA 5JMTA 1E9DA 3SYKA 4A4DA 3NBFA 3A1TA 2Z5FA 2ZI5A 2FFHA 2FE4A 2JAQA 2Z83A 4DBLC 1CR4A 3BB1A 5JSZA 2WTUA 1X3SA 3ZQJA 3BAFA 2ZUDA 1S96A 3MFYA 4V0OA 1XFAA 5CK5A 5FOXA 3ZZUA 1P75A 3W9YA 1TEXA 4KFTA 4YLGA 3EC1A 1ESMA 1YRAA 3LV8A 4Q4LA 3RC8A 5DO9A 2OXRA 1G7RA 2ZR0A 1F2TB 4PQFA 2QI9C 3GLFA 4OHVA 1N5JA 1GL9B 3L8ZA 1E0KA 1TMKA 1NN3A 3TVTA 4M9QA 2Z0MA 2IK8A 5TMPA 2R6AA 2PLRA 3ZS9A 2C78A 3DVLA 4CVNA 3C4JA 3U4QB 5TARA 521PA 1C9KA 1KMHB 1E2JA 5JWRA 4ERNA 4V02A 2A5FA 2RB4A 2IYZA 1G5TA 2XZLA 2QP9X 2GXSA 2ORIA 3OF5A 4G5SA 2HLDA 2CNWA 4B3CA 4B3XA 1VCIA 3FHTA 4NCJA 1CS4C 2D06A 5UKDA 3I5XA 4QRHA 4LV8B 1E4YA 1EK0A 1R7RA 2OXCA 3PUWA 5JCZA 3LVQE 2GDJA 1JEDA 2NMVA 2EVWX 4KAXA 4AYXA 2PCJA 2VHUA 4DB4A 2YINC 3EZ9A 1YQTA 4XWAA 1CKEA 1G9XA 4DC9A 3T12A 1KK1A 1XMVA 1XPRA 4PSAA 4M53A 1IN6A 3OIWA 4IDHA 3GP8A 4S35A 4C7OB 1P7CA 3THWB 1OE0A 3L82B 4NKRA 4AIIA 4QG7A 2GKSA 2H92A 3SOPA 4F4IA 1J8MF 5A5GA 5CLQA 4HATA 1KZ7B 1XJ0A 1QHHA 2QMOA 5CYPA 4CEIA 4PHTA 1NKSA 1UBCA 1MOZA 3ASZA 3RRNA 3BRWD 3KQLA 4HUQA 4TWZA 2Q3HA 3NIBA 3B1WA 4YONB 3KXKA 1HT1E 1UKZA 1Q20A 1N6IA 1I4LD 3GJ5A 4AURA 3VX4A 4IKEA 1XRJA 2OBMA 3EZ2A 1JAIA 5K8IA 1Q1ZA 1E9SA 4TLBA 4TSFD 1I4DD 1WBDA 1TQ2A 5DI9A 3BH0A 1EFUA 4MGKR 2PZGA 4LJAA 3X1DA 4DLZA 1FX0B 3QXXA 4WZBE 1B23P 4TTRA 2HT6A 4KI0A 4AK9A 1UFQA 1ZW6A 3MAAC 4YMWA 1COWD 4WA7A 1U90A 3MGCA 2XTZA 4OJKA 3TUJC 1U0LA 3RS5A 1DPFA 1ZM7A 1Z0IA 1P72A 4TMZA 1DS6A 1AIPA 3K9NA 3UMRA 5FUXA 1IM2A 3AVXA 4PHHA 4LBYA 4TN1A 2PT5A 4ESHA 2ZVQX 1NVWQ 4JBWA 5C4MA 2MSEB 4XD7A 4IOJA 4ACBA 5CITA 2QTHA 1YHNA 4EDHA 1XPOA 3ICQB 2YNMA 3RSLA 4CRWB 1GFIA 4DLUA 1FFHA 1WA5A 4U00A 3T5DA 1UF9A 2HF8A 3K0AA 4RY2A 3SJZA 4NYMR 3UIEA 4YC7A 2J7PD 3AKDA 1E32A 3THXB 2WV9A 4MDFA 2OSBA 4R7ZA 4URXR 4B73A 1E99A 2IEYA 2OCAA 3A36A 4CT5A 3E2IA 2Q6TA 1RJ9B 1VCMA 3NKVA 5CJ2A 2XZOA 3IQXA 4ZCLA 3FMPB 1S2MA 4D25A 2XX3A 3KJGA 2ZRNA 3VR5A 4RZ2A 3W34A 1ZNZA 2O0HA 2LKCA 4MH0R 1D8TA 4MRRA 2NTYC 2ZRAA 1PUIA 2FGKA 1U8YA 2JATA 3E70C 1FQJA 3JVUA 3KX2A 2ZRGA 3FGNA 3NDPA 2ONKA 1T3HA 1E0JA 4B2LA 1JJ7A 4D81A 3U7FB 1NY6A 1ANKA 1SVWA 2QRZA 4B3BA 2O8DA 2P3SA 4O0MA 3SS8A 3T61A 4US1R 4DDVA 4DKXA 2W2TA 3B5JA 4Q9JA 3RHFA 1FMLA 1V43A 5AJYA 2ZU0C 2HXSA 3FYHA 3N2EA 1HT2E 3CNOA 3L0SA 5J4LA 2P6UA 3HU3A 1T4GA 4JS0A 4TQAA 3BS4A 1P60A 4QHYA 1F2TA 1GTVA 2ANCA 2CK3A 4MRVA 2JCSA 1EESA 4HZIA 3D7MA 4GPTA 4W5JA 5KYKA 1KDOA 2YWEA 1G1MA 1ZUNB 2OEPA 4POAA 4LI0A 2A5YB 4C3ZA 5LPNA 3U4QA 1SVLA 3BXZA 4G5GA 4C0KA 1NJFA 1R5OA 4LHVA 1ZP6A 2A9KA 4GMXA 2FWRA 4QM6A 3PUZA 1CR2A 5KNDA 4FINA 1G41A 4RVCA 2FPMA 1YR9A 2GHIA 4Q9LA 2R9VA 3R20A 1KI9A 1KI2A 1P4SA 3Q8XB 4Q47A 5CB8A 4G3XA 1KO5A 4A2WA 3AVOA 2FPLA 3AF0A 2F3TA 1H8HA 5KDLA 1RZ3A 1VYUA 3IIJA 3QOFA 2RGBA 1Q44A 3MWYW 2K5UA 3ZJYA 2F6RA 3MCAA 1QHGA 2OLJA 3WBKA 1VCOA 3SJCA 2JJ1A 1S0UA 1SGWA 3AB3A 3K9GA 1W4AA 4QHTA 3X1XA 1CJUC 1P6XA 3THWA 1W46A 1XEWX 1G5RA 1X8JA 2AFIE 2ZE5A 2YC2C 1WDTA 1Z2AA 4UKDA 4RD2A 1KMQA 1XZQA 4MGZR 1XEWY 2XJ4A 1H8EA 2GF0A 2WIAA 2YVUA 3TRFA 3KTAA 4URWR 2P0EA 3TE6A 1ZM2A 3TLXA 4DCVA 3T1TA 2CMKA 2BOVA 2F1IA 4CT4B 1AS2A 2O5VA 1YZUA 1FZQA 2WPDD 5FR2A 1AKYA 3EZ7A 4IVQA 3VNVA 3NH9A 5HPYB 1SVIA 1IOZA 1P73A 4AKHA 3I8SA 3TUZC 4Q1EA 1GM5A 3WRXC 1R5BA 2ASEA 5HZHA 3N2IA 1LFDB 3QXSA 4O25A 2AN9A 4BPBA 2BJWA 1XTIA 3GJ4A 1IN7A 2CL6X 4C9BA 1FX0A 2AXPA 2I1VB 2V55B 3QVVA 2WWHA 3KKPA 5ANRB 3U3OA 3JZMA 4P4TA 5FPTA 4UQOA 5AUQA 1SXJB 4JSYA 4KSCA 2D3WA 1KJZA 3MD0A 5B64A 4A6PA 1G6HA 3FKSD 4W7SA 3SZRA 2KBFA 3B60A 2F3RA 1RFLA 3AVPA 2GEUA 2X77A 4IOKA 4QFMA 2WWYA 2F9MA 5AJXA 1NKTA 1EWRA 2E9SA 3NH6A 2JJ2D 4QGHA 1OXSC 4JVMA 5FOSA 3K70D 3TGPA 2PX0A 3U3MA 5KDDA 4FMCB 4TMXA 1IN8A 2ZI6A 3QKRB 2DWPA 3CPJB 5J4VA 1UDXA 3P4XA 3VTKA 3REFA 3LBHA 2ZJOA 1HQYE 2VYFA 3KZ1E 1UBEA 1T3LA 1Z5ZA 3LLUA 2PEYA 4B3FX 3H86A 1ZJ6A 4BE7B 1OYWA 2R6CA 3LRPA 2CK3D 1X1RA 2BIFA 4JL5A 3GLHB 5ELXA 3PENA 1R6BX 2ATXA 4OQFA 4X8LA 1RPZA 1ZUIA 4LBZA 5K8TA 3QXJA 4LYAA 1LF5A 2C2HA 2C5LA 1CBUA 1X8LA 3EA5A 5BN5A 1E2FA 3CONA 3K0CA 2KSQA 3LBNA 4M1YA 3GJ3A 3HPRA 1KY2A 2NGRA 1S9DA 2NPFA 2PJZA 4LY6A 3TKLA 5FBWB 4Z8XA 3IPXA 2ZJAA 3RYTC 4JLKA 1NSTA 5E7MA 3T34A 1G3UA 4GRAA 4DLWA 4JVNA 1EFCA 1UBGA 1IQPA 1NI3A 4EPRA 2A7QA 2FG5A 2QSYA 3IIMA 3HPQA 5CDFA 4B6FA 1CRQA 4CF7A 3EIHA 3P4YA 5EXSA 2N46A 3ECCA 1FUUA 1YR6A 4F93B 4LYHA 4D26A 1YR8A 1A2BA 2BMDA 4JKYA 1GP2A 3LY5A 4RD4A 4C4PA 4Z1MA 4ZIRA 5JRZA 3T15A 2XGJA 1SZPA 2ZYUX 1M34E 1JALA 2REBA 1VCNA 4MYTA 2B92A 3B9QA 1NIPA 3RS4A 1K8RA 2ZSAA 1XJCA 1P2SA 1I2DA 2QP4A 4LWZA 2DFKB 4JLPA 2PBRA 4KXFB 5BYJA 1J7KA 2J3EA 2GAOA 2F1RA 3P20A 5FOTA 4CEJB 1DOAA 2XSZA 3M1IA 4BLQA 1PJRA 2J46A 2ZRMA 1HY3A 2IF2A 2WMNB 3GFPA 3IBYA 5AUOB 2R8RA 3EA0A 4EFNA 2HYIC 4RJLA 3EZ6A 3OEHA 4F38A 3GLGE 4QJ5A 4RKFA 2EW1A 2YWFA 5JHGB 2BV3A 4DSTA 2DYKA 5JJIA 5J4HA 5KDOA 1G3QA 2QAGB 4KFRA 4TZ6A 5KSZA 1F48A 1TAGA 3K0FA 2YOGA 3LX8A 2QMUA 1WMSA 3A1UA 3ADCA 2H7VA 2AKYA 1CF4A 4HAYA 1Z2CA 1U99A 2XEXA 1KOFA 2D2FA 1OFHA 4QBFA 2JLXA 4TL7A 3QIAA 3B1ZA 2GK6A 3AKEA 3EPKA 5CYOA 4AKEA 1DTSA 3QXHA 1P3JA 1N5IA 1NBMA 4JBXA 4YDSA 4Q1BA 1E0SA 1AGPA 1P5ZB 2A2ZA 5IHPA 1ZNXA 5C46F 1OXXK 4OI0A 4OK3A 3K9LA 4RD3A 3EW9A 5EE1A 4LJ9A 2FZ4A 2V4ZA 1FQKA 4EPWA 1OLOA 1QRAA 5JSZB 4PPNA 2J59A 4ZDKA 3C8UA 2RAPA 2AD5A 2VLIA 3B1YA 1D9XA 2IYLD 2CLCX 2FGJA 3DOEA 3EIEA 4LJYA 4RD1A 1XCGB 3NC0C 3V9PA 4B48A 2WJIA 4BFVA 1GSIA 4DDWA 2IBMA 4ZDWA 4IVPA 2ZRDA 3BFXA 4MQBA 4U7DA 4QNRA 5A0FA 2WJVA 5H8WA 3ADDA 3IKJA 4OHZA 2J87A 3KFVA 2NIPA 1G4UR 1KDTA 5CB6A 1G20E 2B6HA 1XD9A 1Z0FA 3RS2A 3RS0A 2NO1A 1JI0A 2OILA 1DAIA 4JL6A 5FPSA 1ZM4A 4JLJA 4HUTA 2GXAA 2BCJQ 3TJZA 1U94A 5KOYA 3RS3A 1YZKA 1KK2A 4IRUB 2F1JA 3W5IA 1VG0B 4MYUA 4QBIA 4D80A 1CR0A 1SXJA 3CF2A 3BH6A 4M9XA 4NU0A 2AR7A 2D74A 3RLFA 1FL9A 3K0CC 2O8CB 1OT3A 4QJ3A 1S3SA 1ZMXA 1G17A 2J1LA 1HUQA 1K5GA 2IYWA 4OYHA 4KYIB 3K1JA 2G6BA 1WF3A 1JAHA 1K6MA 3IILA 4TL9A 5FH9A 4ESVA 2FDCA 1AS0A 4TTQA 1DADA 2OBNA 4K8OA 4Q7KA 3CPHA 3O8RA 4HDCA 3QKRA 4OL0A 1TQ4A 4DLTA 1N0VC 2F55A 4QGGA 3ADKA 4IHQA 3SJBA 4Z1MD 3GJ8A 1NMZA 2ZJ5A 3I72A 2P5SA 5A4JA 4K81B 5FOVA 4HAWA 4TLAA 1GRRA 4IXNA 1OJLA 3GLIE 2D7DA 3GLHA 4W5HA 1CJVC 2X19A 1QHHB 2JEOA 4LPSA 3MG9A 4Q21A 2V1XA 4A0RA 3HU1A 3DO6A 3VR2A 2YKGA 3R9XA 3QG5A 3NBXX 4HZUA 1JJVA 4NCIA 1P2VA 3K53A 5HKKD 1SHKA 2E87A 2XSZD 4DRZA 5HZKA 4OHYA 3VR4A 4IEEA 4LX0A 1Z22A 2JA1A 4WBSA 3OEHD 1AJEA 1HEIA 3CR8A 4HB4A 4FMDF 4V0ME 4HAZA 4XTCS 1PLKA 1KKLA 4B33A 1W5TA 4D0GA 2ZRFA 5DLQC 1Z83A 2AK2A 5DE3A 3LNCA 1IJEA 4LCBA 3CWZA 2IXFA 4NBSA 2IYSA 5JJLA 1E2LA 3CM0A 3ND8A 3OESA 3RC3A 1VTKA 2EFGA 2HYDA 4KCGA 1XF9A 3CBQA 4CZ2A 1DVRA 2QP3A 1O3YA 1KDRA 3C5HA 3QF4A 3EZFA 3GEEA 1VYVA 4BECA 2WBLC 5F98A 1G8YA 2NZ8A 3PXGA 3I8XA 2NOAA 3VR1A 1KSHA 5JBQA 2JASA 2OO7A 4PPFA 5IDVA 3NTUA 2OBLA 2QTFA 4PZZA 4EPXA 1MO5A 5B2ZA 4Q4JA 4LJ6A 3V4FA 4XTRA 5TXGA 1LV7A 2LWIA 1EWQA 1QHSA 4IJMA 3EPHA 2G0NA 3H0KA 4YQFA 2OCBA 4CEJA 4B44A 2ZETA 3EXAA 3SEAA 4KJZA 5KSPA 4A82A 4MDEA 3U3JA 3BC1A 1XMSA 3WHKA 5CJPA 1W0KD 1SVSA 2O0JA 4TSFA 4A15A 3K0AB 1E9CA 1TNDA 2QM8A 3HJNA 2QAGA 4TYYA 3FOZA 3THYA 1JNYA 3U7EB 2ZSDA 2A5GA 5FL3A 1CJMA 1IXZA 4KVGA 4OI4A 5KSYA 1BS1A 1CR1A 2O8BA 2P65A 2DFLA 2YYZA 2CE2X 4LZZA 1L8QA 4MGYR 5EP4A 2FJUA 1COWA 1AN0A 3ZIAD 3QE0A 5G41A 1HE1C 4PHFA 3SU8A 5EE5B 1A82A 1D9ZA 4H1VA 2BEJA 5AWFC 2AKAB 2OAP1 1XWIA 5G3YA 3NDBB 1BO6A 2C9CA 1LS1A 2RGGA 5CM9C 3REGA 3UATA 3EC2A 1ZM9A 1ZM3A 4GP7A 3EX7C 2WHXA 3P27A 4WAUA 5E7IA 3U3RA 1R0YA 1SXJC 1NLFA 2AWOA 5FTKA 3VFDA 4P4SA 2VP0A 3EIQA 3O8BA 1UADA 3K70B 2VHJA 4D82A 2O8DB 3D31A 1HQCA 2R6DA 3F5FA 3LDAA 4KV9A 3WHLA 2H18A 3PEYA 1U0HC 4M4SA 5G40A 5D3QA 3BB4A 3I1FA 1J8YF 4JLVA 1PLJA 4XSGA 4DDTA 1N25A 1R4AA 3QBTA 4A92A 3X1WA 2DFTA 3SFZA 2R62A 1Q0UA 3QSYA 3BD9A 2J7PA 2QUZA 3KQUA 1FNNA 3CLVA 2Q9BA 2PZEA 5FBRB 1XDBA 2ODEA 3TAUA 3GLGA 5JECA 2WJJA 2OFWA 4NL4H 3CF6R 1KHTA 1ZU4A 2WOOA 5FFMA 3U3KA 2W6ID 4NYJQ 4L9SA 2JLWA 3O8DA 4G01B 1NVUQ 1E9AA 4GDFA 4HI0E 2VHQA 2W00A 2ZEJA 4GFDA 2QRNA 4HB3A 4OBEA 1GOTA 4LSGA 2RGCA 2H57A 2GESA 2O8CA 4JSTA 4ZO4A 3OAAA 3MJHA 4AYTA 2KJQA 3I62A 2I4IA 1XXHE 2ZXUA 4EFMA 1OV4A 4JYBA 4BGDA 2JLSA 1AQUA 1LB1B 5TDHA 2IX3A 1W4CA 2ZQ5A 3I32A 3IBGA 2HT1A 1X6VA 2PL3A 3CX7A 4I4LA 1TF2A 3AQ4A 2F43B 3PCRB 4MRSA 2B8TA 4HB0A 4AWXA 4JJKA 1G19A 1KY3A 4DCUA 1MT0A 1S1MA 4QGFA 5HE9A 1M1YE 3VR6A 3SNHA 2VSXA 2ZS7A 2BVNA 5G53C 1HE8B 1GRNA 4URUR 2JDID 4BFXA 1BYIA 2ZTSA 2J0VA 4HSEA 3KTAB 5BXQC 1XZPA 3PEWA 3LD9A 4LHWA 4Q18A 4ACAA 2DWQA 4NDZA 1YVDA 2VSFA 4FXPA 4IFBA 4M8NE 4M1WA 2KB0A 121PA 2G1KA 1E2HA 2XJ9A 4TMKA 1DBSA 3LQQA 1HV8A 1T0HB 5FTMA 4E22A 2JLYA 1NNEA 4Y0VA 2VL7A 4HYYA 4R2IA 1QVAA 3EWSA 2FSGA 4Q4HA 5TB5A 4E03A 4V03A 1N6LA 2QTVB 1FP7A 2XXAA 4O2RA 3A1VA 5FUWA 2IHYA 2WOJA 5JLJA 1E0AA 2ZRBA 3ZS8A 2VP2A 3PUYA 4CW7A 3AP2A 4AD8A 5L3SB 5KHOC 2OHFA 4QJ4A 3ZVRA 4KO8A 3CRQA 3OIVA 1J2JA 3GJ6A 1E9EA 5EUMA 5LDDC 2QAGC 1KI6B 3UMSA 4OQLA 4QXAA 2REOA 3GMTA 4EQ6A 3OZXA 3CKLA 5K8UA 1XTKA 3SFVA 1E9FA 4M0LA 2ERXA 2VF8A 4NE2A 4DIEA 4BEJA 2B7CA 3RDPA 1W49A 3C15C 4ZKDA 1W44A 5IK2D 5GJVC 4Q1CA 4EFLA 4IDPA 2ZJ8A 4L15A 1Z28A 2FSHA 1ODFA 2OFXA 5C1BA 2WPDA 4M1KA 3W8RA 3GLIA 2ZI4A 4PAMA 4MITA 2CBZA 1KAOA 4UNQA 1OIWA 3FTQA 1OFUX 2GBLA 4Q1DA 2FMXA 2ZYTX 1JQLB 2QL6A 1XU4A 2PT7A 4F91B 2QT0A 1CJKC 4B3DA 3C14C 2W0MA 5GVSA 5LBIA 1YZGA 3V00A 4B35A 4JLMA 4JYCA 4DEXA 1S3GA 4B3GA 1OB5A 2VSOA 3QPWA 2WSSA 1TF5A 3BERA 3U44A 2CHQA 1Z0JA 4M1OA 3FHOA 1N6PA 1MRSA 4HLCA 4PO1A 1NSFA 1Q1QA 2L0XA 2ODNA 3QQ5A 4X8MA 1KI3A 3NWJA 1HURA 3Q85A 5EE3A 1E69A 2VPPA 3FKSA 3VKWA 1NMXA 1ZRHA 2QPOA 4D0LB 4W5WA 3QKUA 2GRJA 1FUKA 3HDTA 3OAAD 2JJ2A 3B6EA 3ZGXA 2Y8EA 1E9RA 2JLQA 4RCYA 1W47A 4Z51A 4XVQA 1EX6A 1HYQA 1JPNA 3IHWA 3WMEA 4LC1A 5GJWC 5DI3A 4OHWA 2VQSA 2YZ2A 4EKDA 5AUNB 3W8NA 5JZVA 1LS6A 2GEVA 1QHIA 3I92A 4DLYA 1D2MA 4ZIRB 2G83A 4IDOA 2RHDA 1A2KC 1NP6A 4NZYA 2JLRA 4GZLA 4LK2A 3B1VA 2E1RA 2EWWA 3BB3A 4V0KA 4DXAA 5JHHB 2GK7A 2AFHE 3BWDD 3NHBA 1WE2A 2REXB 4CYMA 4ZDJA 1L4UA 2W0SA 2JLUA 1OHHD 3WY9A 4JVLA 1PZNA 3I73A 1U0JA 5EJEA 1J90A 3VHXA 1DAEA 3RRYA 4JLAA 3U6BA 2ECKA 3Q7PA 4A0GA 4PC2A 1R8QA 2BHRA 3PUVA 1KAGA 5GJBA 2BDTA 3H1TA 2IYYA 4TMWA 2IHBA 3MWLA 1G8HA 2R6GA 5FPKA 2JGNA 2NO7A 3CZQA 2WZQA 4XH9B 4BLPA 3LXXA 1GG2A 1KJYA 4GZMA 1FW6A 3K0FB 2QG6A 2JIZD 2NQ2C 2ZSBA 5JI3E 3AVUA 2JLZA 5E3HA 1OIVA 2QGNA 4LUCA 2CE7A 3UPUA 4DCSA 1S9HA 4PHGA 4OK6A 4V0LA 4Q1AA 1IN4A 1QHNA 5F2EA 2F43A 1KZGB 3KJHA 3W6NA 2V3CC 4TZ0A 5HE8A 4MKGA 3WMGA 2J9RA 5HCNA 2ZRHA 1T8UA 3ND9A 8OHMA 5L3QB 1U8ZA 3GJ7A 2OFOA 3S1AB 1TEVA 3T06B 5D3MA 1OB2A 4WVFA 3VKHA 4BRWA 4Q66C 1RRFA 3A58B 3KFXA 1LW7A 5EXPA 2QE7D 1F3OA 4HDOB 3W3ZB 2HF9A 4PO9A 4URZR 5FBVB 1L7VC 2CLSA 2QMHA 2IXGA 4DLVA 1EFHA 2ZAMA 1F5NA 4ZI2A 2WMOB 4BFZA 4URYR 4KITB 2X2FA 4GSYA 4W9MC 1QVRA 3K9HA 5H70A 3JVVA 5TY0A 2UVQA 1S4QA 1NN1A 4XWOA 5JS7A 2C9YA 2CCJA 4ZCMA 2IUUA 4PQYA 3OE7D 2GBLC 4GOKA 3TMKA 1G6OA 4FI3C 4DCTA 3QF7A 1ZNWA 5L3SA 1GAJA 1SVOA 2KWIA 3FKQA 4DIDA 4LJ4A 5GVRA 2QM7A 3VR3A 1YZTA 2WSSD 5C4GB 1XEXA 4NP6A 3AVYA 3IDQA 1IONA 1M74A 2G3YA 1XCMA 1KI6A 3QXCA 3KQKA 4LC0A 3IIKA 4U02A 3KQHA 2ZAOA 2ZRLA 4LPKA 1JXOA 1BIFA 2VP5A 3F8TA 221PA 1AM4D 1FP6A 1KI1A 3Q72A 3MSXA 3SYLA 2FV8A 5E95A 1KO7A 5KUTA 4JZKA 3E1SA 4DZZA 4JT2A 4P32A 5JWHA 1GL6A 4TYPA 3ADBA 2V1UA 3AVVA 1M7HA 2BBWA 3KL4A 2QGZA 2RMKA 1RYHA 4DWJA 2W58A 2ZUCA 2AL7A 1II8A 1U2RA 1KJWA 2ZJYA 3NC1C 1P9WA 2CCGA 1Z0AA 1G8GA 3D6TB 4QBGB 2G77B 4AKIA 4P31A 3K70C 1PVOA 3U7HB 4QHSA 3CF0A 3TR5A 2IYRA 1MKYA 3V4RA 2Q9AA 2XITA 4OQXA 2ERYA 1SKYE 5FUYA 3AKCA 3FHCB 2C95A 2F1HA 3UMFA 1US8B 1F60A 1Z6GA 4M22A 5DYGA 3VNUA 2VP6A 1MR3F 3QY0A 4HZUB 4G5QA 2J5XA 4XVUA 2HV8A 4KHZA 3F3YA 4AI6A 4Q7MB 1IBRA 1Z3IX 4PZLA 1BMFD 4XWKA 1Z6XA 4AG6A 3KKNA 1PLLA 1E2IA 1GZSA 1ZC3A 5DYIA 4OHXA 1KKMA 4XJXA 2D4HA 2GCNA 3RRZA 4NYIQ 1U98A 4A6XA 2QN6A 3RRMA 1KO1A 4LJ8A 1VIAA 5SZHB 4DB2A 1UKYA 3SE0A 4P3YA 5KPJA 2BKUA 4EJSC 1XD2A 5EZ5A 5GADl 1ZCBA 1JR3E 2PX3A 2QA5A 4PC7A 3G5UA 1RRPA 1E4VA 3BORA 4GNKA 3QF4B 1DAGA 5FTJA 3FWYA 1N6HA 1JPJA 4HLDA 5FBLB 3MJRA 2YWHA 5FUVA 1Z06A 4JMPA 4P0TA 3I3SR 2A78A 2D7CA 3RABA 4C0BA 1W2GA 1Z6YA 3BGWA 2XAUA 4KFUA 1N5KA 1T91A 3DEFA 2GCOB 1KK0A 1KSJA 4ZV4A 2VHCA 4M1SA 1KO4A 5AUPB 4LYFA 2EFHB 3X1YA 4Q4JB 2EFEB 5H1YA 4NYJR 5HKKA 1SULA 2ZUBA 1OKKD 2ZJ2A 5EE0A 1MABA 5DIFA 2ZS8A 5B57C 3RNLA 3SHWA 2YHSA 3L43A 1WXQA 4M1TA 1KO8A 4BZQA 3A37A 5JEEA 2DBYA 3TSWA 4M9ZA 2IS4A 3ZVLA 4Q00A 2FN4A 2GJ9A 4P33A 2WWIA 4BFYA 1G3MA 4GOJA 3CRW1 2I1QA 1IJFA 1D6JA 3HYTA 3THYB 3HR7A 1YZLA 3B1XA 1U8AA 2HXYA 4UJ5A 2CHGA 1QDEA 2OE2A 2IC5A 3J81k 3GLFE 3L2OB 4B2PA 4TYQA 2O8BB 4RFSA 2LCFA 2IS1A 4Q7JB 2DB3A 4FCWA 4UNSA 5KPDA 1T3SA 2B8WA 2CDNA 3ZDQA 2FH5B 1BOFA 3FPAA 4N0DA 3B85A 2HDNB 5L3QA
chains in the Genus database with same CATH superfamily
4JI5B 3BIWA 4IVRA 2YW2A 1GDTA 5BW4A 4P4SB 3IEUA 3OF2A 1TRHA 3BXPA 2OGSA 1T0PA 4NZMA 3U48A 3WJAA 3L0IB 3HRKA 2P27A 3WADA 2VT2A 3AUKA 4BLRA 4IXWA 3CT6A 5LP6A 1OC4A 1TZJA 2Q62A 3ASVA 4G2TA 4LTNA 2F7SA 4YNBA 3SHOA 3LOUA 4HGYA 1HNWB 3KFLA 1QLHA 4YB8A 1YE8A 4A0FA 3GXBA 5FUMA 5ALRA 3UCFA 4X97A 5DCYA 2JJYA 1W48A 5DNUA 4DFDA 4IKOA 2GZDA 3GN2A 3DCYA 1U0TA 2PMBA 3TR6A 3FLMA 1W1UA 4BDTA 1FRNA 2VZEA 4TWBA 1THMA 2D7JA 1U3WA 1RCFA 3QBEA 1U9ZA 5EYPB 3DWIA 1ZIPA 3AY3A 1X9HA 2XXBA 1BQ3A 1JT2A 2J3JA 3MA0A 5EUBA 4V3CA 3Q8MA 1P1BA 1ZBDA 1PEDA 2GTIA 1QHYA 3BXGA 1USIA 3AEZA 3JRWA 5FBZA 3T8YA 3ZIAA 5C53B 3AZOA 2XNDD 4FLFA 1IL0A 1JVBA 1ZGJA 2VSYA 3I05A 4HBGA 1XP8A 3U3XA 2GN1A 1ZD9A 2XVZA 5AM1A 2MMCA 4RJIA 4FYJA 4BZPA 3BFKA 1G59A 5FULA 2PKWA 1J2YA 2D2IA 2PK3A 5AW4A 1QJCA 2XBLA 3BZBA 3DW1X 5JROA 2VF2A 1GITA 4ENSA 1CZLA 5GPBA 3WQRA 1Z0DA 2HNAA 2O52A 3N8HA 4IY1A 2DWUA 5I7RA 1ZRMA 1XBTA 1NQXA 2XQGA 1NUPA 4QEZA 1GTL1 1TCAA 2Q1XA 2H48A 3CBGA 2IUFA 2PT9A 5CP8A 5E4FA 1L9KA 1DKLA 1RRKA 4PICA 2IXBA 5IBRA 4R2XA 1BEEA 3GG9A 4YP9A 1XMIA 2FNAA 3BRQA 1ORRA 3DFIA 4TT3A 4L8GA 4N8EA 2OKGA 2YXDA 3GAMA 3QELB 5FBQB 5SZKB 3X2EA 4B40A 4EUNA 3BFVA 4KH1A 1Z37A 3GN1A 3TF5A 1E3QA 3GJSA 5FD8A 4RY0A 2QTMA 2WTAA 2JFFA 5CW1A 1KVRA 4TLEA 4PC6A 4G07A 4P84A 4Q19A 4H15A 1G5PA 2LDXA 2VPZA 4XM1A 3SDZA 4B75A 2W6IA 1XIVA 1JB9A 1MG5A 3MTEA 4U7WA 2Q3FA 4UNNA 5AKXA 1ELOA 5IM4A 4N65A 1U28C 3GPCA 4PFSA 2MCFA 3T6KA 1DOHA 4WV3A 2FPPA 2AEMA 3DPUA 1BMDA 3HCCA 1PR6A 2VKTA 2GILA 4D3ZA 4F8YA 5CLIA 3IEMA 2AXNA 2ZSKA 1M2KA 5JVDF 3FYTA 3ZU5A 3CRMA 3IRVA 4GSKA 5EP3A 3C3DA 3JWEA 4OAPA 4RZ3A 1K6IA 1LSSA 1I3NA 2C9OA 5KO2A 3FDIA 2HC9A 1EK5A 2PS0A 2WUEA 1QCZA 2IIVA 2JD1A 5HTKA 2QROA 2YOHA 3T4PA 4F6RB 4UTPA 1KI4A 4W1QA 4PRYA 3OA2A 2J8ZA 2EQAA 3ZU4A 1GNPA 5TRTA 2VUSA 2XYHA 2VTKA 5ALNA 3PIDA 1SVKA 4Q7EA 4JLBA 2I29A 3EASA 3KWMA 4NPHA 3OZEA 1QWSA 2HK9A 4GBED 5CGZA 5GIOE 5CMLA 5BNTA 5GONB 1OSNA 4HVAA 4P82A 3GFRA 5J4YA 2DQKA 2JCYA 1PIWA 2I2DA 1R9JA 4HEHA 4N6GA 4XXHA 1G5IA 2VPXA 3JD4A 4FIDA 4G5RA 3S2FA 3UWDA 1MJNA 4OY3A 4I99A 2BFMA 3KKOA 1PW7A 2GCOA 1MJFA 1PGPA 2V0NA 3QU5A 3E9DA 4GAEA 2JLVA 3QIVA 3HNOA 3G7SA 5DYNA 5JS8A 1CUCA 3K6SA 1RIFA 3FRIA 3SR3A 1WCIA 1T6NA 5LZ2A 1BE6A 1FE8A 1NJSA 2O2YA 3WO0A 4KN5A 2FUEA 1JXAA 1E4EA 1XOIA 5LMUB 1CJSA 3DB2A 1TKAA 3DEZA 1E89A 4KZKA 1JG6A 1Y81A 2MSDB 2GNAA 5AJUA 4D9IA 1PFUA 4II2A 1R10A 4EA9A 1GGFA 1HDEA 1QIHA 4LK3A 4AWAA 4L08A 4MQ5A 5FL7D 1UT5A 1RXUA 1D1PA 3VKUA 3MPUA 1FQOA 5KJ6A 1CYDA 3MTDA 4B6OA 4HEQA 4Q01A 5B7QA 4M7RA 3ZX5A 1Q0RA 3P0HA 4XOIA 1JPUA 1RYNA 3U44B 1SQ6A 2QL5A 3KETA 3AZQA 3GY0A 4LOAA 1EFPA 3X2SA 1VA4A 2LUOA 1LX6A 2ONZA 2VT6A 1C1HA 1OGJA 1UODA 3MMPA 2XTNA 1MFPA 4HFNA 1JLLB 4HNHA 4BX0A 4GE3A 4EG8A 5JJKA 3UMJA 2IXEA 1AZTA 4M37A 4PANA 1V6SA 1XRMA 1XLWA 3LLSA 3O92A 5IM5A 4DC1A 4YYEA 5IJ9B 4E14A 2A1TR 4ER6A 2HTEA 1DAHA 4H2DA 1Y3AA 4BLOA 1TQ6A 1YDWA 3STUA 5IT0A 4OOEA 5I8PA 3AI2A 1FP2A 2IOHA 4PGHA 5DI3B 1B26A 5IRCD 4H3KB 2IZ6A 1AK2A 3AUXA 1IWPB 1F17A 1PNOA 3HJFA 4G0NA 4WK4B 3C0KA 3VA7A 3NUGA 2R1VA 4LV6A 4Q4AA 1GV1A 2YRFA 3IBSA 4Z3KA 1TTQB 3FVTA 1U3CA 4HDAA 2A0UA 4UEWA 4AZ0A 1T2VA 1V26A 2W6ZA 1WBJB 3JPWA 1BW9A 1OBCA 5AK4A 3YASA 4OUDA 1XRNA 2VEDA 5K20A 2Z1DA 4TT3D 1W4RA 5L3ZA 5JNLA 1QRDA 4NCAA 3DOFA 1MX1A 1F8XA 4E5VA 4KACA 1T2AA 4F3YA 1QG6A 5K5EA 5BVHB 3PU6A 3I9NA 3UAGA 3MJEA 3NW9A 3OLCX 4IH1A 4R5HA 5AVUA 4PLPA 1SG0A 2YVQA 5IASA 2M98A 1E3SA 1VPEA 1Z2NX 2C2YA 1J39A 3N5KA 3R0VA 3FMOB 4H17A 4LEIA 1RKUA 3LYAA 3DDCA 1GGEA 2VNSA 4I1OA 4YDRA 5AI5A 2JB9A 5G0UA 3H1EA 2J67A 2VDKB 2XZPA 3RYIB 5F9FA 3OC6A 2ACVA 1YD7A 3PNMA 4HJXA 4PSVA 3II6X 2ZUTA 4WJLA 3U61B 1FDTA 5CM2Z 1K9SA 4PYMA 3IXQA 4MKHA 2H0RA 4PLGA 2RHJA 3G5TA 4AMYA 1Y9ZA 3JYHA 3ZYCA 1NF2A 3G17A 3Q1KA 5KQSA 1ZD2P 3PQ7A 2CWWA 5U1PA 2H5EA 4MGIR 3HU2A 4L0MA 4RPHA 5JQGB 1IZ9A 3RW9A 1A1VA 2HWXA 3RARA 3ZI7A 4I7EA 4UVHA 5DPMA 5LU9A 4IEFB 2IOFK 2P2GA 3X1ZA 1PD0A 1ODKA 1NASA 2H4HA 2ZBFA 5ALQA 3UHFA 4MNTA 5BO5A 4PZCA 4G1CA 1EWKA 3I4LA 3L8HA 2PKQP 3W6PA 2VDQB 3WAGA 3JTMA 4WGGA 1MA3A 5ICCA 4OHPA 4EI9A 1RXIA 1SQ5A 5CXSA 2X3UA 3K9CA 3R4CA 4TLCA 3PITA 1L1RA 2R6HA 2QQFA 5DTIA 4BNNA 1OA1A 4UZSA 3VHRA 4EGJA 4ZTUB 4M89A 4W1RA 5A4FS 1F38A 1B16A 3M6WA 5D3MB 4ZVNA 1RFGE 4OI2A 4N0EA 2NXJA 3GAFA 1RPNA 1MC4A 4GD3Q 5HZMA 1BC5A 2IVZA 1J8FA 5AIBA 1HRDA 1T6XA 3VU9A 4U3JB 4X54A 1WL8A 3EXG2 1Z35A 3AINA 2EYUA 5IZ4A 5A71A 4QFBA 2QK4A 2FAXA 1PT7A 1ZMRA 2YXBA 1T1RA 3ZE2B 1KBQA 1EJ0A 1M8PA 3DL7A 3KTDA 5DMXA 1FC0A 3V48A 2I3BA 3W5HA 4MR9B 3JARA 3K2BA 4KQFA 1CJTC 4PPQA 3SBEA 4LYEA 2Q41A 1QGOA 4DZTA 1U5AA 2P9TA 2B37A 2GBFA 3L01A 2BR4A 1OIXA 3I45A 3ETNA 3P1JA 2JF0A 4IHKA 3VPSA 2HIHA 3ZCPA 1CNFA 1M8JA 4EJFA 4LS3A 4A03A 1DLIA 1HBJA 3AG6A 3FXAA 2C20A 2PXHA 1V1RB 3QVGB 4Y8VA 3B7GA 3KD3A 5A4KA 4YALA 2XRYA 2H1OA 3PXBA 2QJOA 2X6QA 3I0ZA 1EP2B 2QRVB 5EE9A 1YQGA 5BSEA 1TM2A 1U65A 1I33A 2DQ4A 1YA4A 3G2OA 1XZGA 5CAEB 5HJEA 5FLEX 1NG1A 1GTMA 2ODWA 3CSDA 2HA5A 3VNSA 4BB6A 4QT4A 2XZTA 1E8DA 1Z5OA 3BHNA 4KQWA 1MJGA 3CUWA 4AT1A 3LIIA 5FBHA 1RYZA 4PAQA 1HYEA 2Y2VA 4LNHA 4OGFA 2A67A 1P7ZA 2NO0A 5EMJA 1EUDB 1G8JA 3LP8A 2WVAA 2FWIA 3PPXA 3LZ6A 3MJTA 5LC1A 2W98A 4RMGA 5JCJD 5D01A 3F8SA 5JD6A 4OGLA 3SR4A 3V33A 2Z30A 4CLEA 1YWGO 1RPAA 1U1IA 4MCIA 3IQWA 5EQTA 1CUHA 3UOAB 2K7FA 2VT7A 1R0XA 2W4MA 4CUZA 5BNWA 3HA2A 1X7HA 1YR2A 3MOIA 3MWDA 1C80A 1P29A 3IPAA 3QVXA 3PIRA 4I5DA 3SEFA 2OVBA 5CDFE 1WHSB 2E1PA 2POCA 2GCEA 4PTZA 4HDRB 4MYSA 2O2DA 4MWSA 4D97A 4IGEA 2XRZA 1YS7A 2GF9A 1C8VB 2I54A 4OHUA 4A8PA 1TIBA 2BHLA 3GRRA 4D98A 5EIEA 3DLIA 1G2OA 5KNDH 4FFWA 1WP9A 2AN4A 4XQCA 4KXUA 3UNXA 1PNQA 2VA9A 4JEIA 5L4NA 2BFBB 4H7PA 3ZCXA 2CZQA 2H1IA 3WZLA 4WOPA 2J0UA 1ODIA 2QUAA 3BRCA 4LBVA 4OJMX 5IWAB 2YJTD 1ZCAA 3CX8A 3PGJA 3B2EA 4IAOA 1XQ1A 4PSKA 4G1MB 1VPDA 4PC1A 2ZRPA 1FYEA 4A2PA 5KTYA 3TUIC 3P9ZA 3H2JA 1SXIA 2OCYC 2RHGB 3ML1A 5J4KA 4I9UA 4B6SA 3U7QA 4LFAB 3RS8A 3MTIA 4ZOCA 1U9IA 3AVTA 1YU9A 1YO6A 2DSNA 3ICOA 4H6VA 4Y9SA 2PSSA 4ABYA 2WSLA 2Q4EA 1WMFA 3PTAA 3GZTB 1D4ZA 4HVCA 3MRSA 3FDXA 2G6TA 2XA1A 3RTGA 2EU8A 2G36A 3ZDAA 2CFRA 3NIGB 4D3DA 1RYYA 1HTWA 2XODA 1QLJA 5DH9A 3UGKA 1L4BA 2QTCA 4V24A 1P31A 2ZYWX 1GGVA 2HLDD 3R5HA 4RVFA 5BYAA 3FZNA 4JDUA 4LNAA 3SS9X 3RO7A 5CNIA 1TJPB 3OTHA 2XA9A 1RKBA 4MVJH 1LLUA 4O4JB 3BDIA 4EHAA 4XZ3A 4PV7A 5E8RA 3T94A 4EDFA 2BDEA 9MHTA 4RD6A 1PFVA 2ZVPX 2GJSA 2VBCA 1KDZA 3G1TA 1R5NA 4Q48A 1BRTA 1NBME 3HCFA 2TMKA 4BZWA 3FMVA 5A3SA 3CLHA 2Q8PA 1G8AA 2ZANA 3FYCA 3I9LA 3ZWQA 4HWPA 2WHPA 1CY6A 2IA5A 2KM1A 1CUFA 1ZKDA 4QYIB 4X8OA 4ZEVA 2X76A 3T3MB 3P26A 3OOSA 4JH0A 4FCVA 3GAZA 4MUEA 3HBFA 1FNMA 2Q3CA 4D4KA 4DPKA 4GOND 2XPCA 5M04A 3LXRA 3M8KA 2ZWOA 2BONA 4HDQB 2O05A 2UXDB 5B53A 4ADSG 2C3MA 3GEIA 2OSVA 5JDCA 2PVSA 1ZFNA 1Z5NA 2PAFA 3LU1A 4LXHA 4U7JA 4TTTS 2AN1A 4CWAA 3ZJTA 2J07A 5LMCA 1IY2A 1HSOA 4ZVTA 2VA8A 1W2HA 2ODBA 2P0AA 4NECA 3KM0A 1FOEB 1XK7A 3MXTA 4C04A 1SMKA 3WP0A 4PNEA 2GO7A 2DOKA 2OT3B 3H9QA 1A7KA 4PCLA 1DAFA 2P75A 3F3MA 3UWKA 4AY5A 4C43A 2P67A 4CM3A 1EUZA 5ES4B 1QS0B 1MRNA 3GLTA 4RENA 4HWSA 1BGVA 5IARA 1KYIA 4CCWA 1QQAA 5JD3A 1C4OA 3CW9A 2YS7A 1IUOA 1TD9A 3E9YA 3HLKA 3M70A 4G5XA 2PKRA 2RGAA 4I6EA 4MSUA 5T5QA 1JG7A 1ITZA 3ESDA 4DMGA 3QKSB 3D7LA 1IDOA 5JCOA 4HQ0A 4D96A 3PEUA 2DCUA 1EJ2A 3SSAA 3CVXA 3LRTA 2VT3A 2FPRA 4BNTA 4DBLE 5A3QA 1P9LA 1SOWA 2HZBA 1KBOA 2X1LA 1U7ZA 1M7GA 4KWHA 4Y2JA 3PQEA 1WW3A 1NP3A 1Y5NA 2GJKA 4P5DA 5B5SA 1U81A 3K8ZA 1R6DA 1NY5A 3QMPA 1OKKA 4KXQA 3RI3A 3UV3A 2XDAA 4RELA 1UK7A 2JCVA 1S5PA 3OIYA 3UJCA 2ZRQA 2X6TA 3GLVA 5CW2A 5ALFA 3SCZA 2PPLA 4EO7A 1DNPA 4BRSA 1VMAA 2RAFA 3LBIA 4GBMA 1NYRA 1IY1A 4A8JC 5HM8A 4DANA 1I51A 3OBBA 1J23A 2EP8A 1ZGAA 4MTCA 6Q21A 2IU4A 1W8IA 2EQBA 3H6GA 1N0HA 4D79A 1M33A 3CXUA 2R00A 1ECFA 4RLFA 4QNNA 2W9XA 5JCPA 3NRCA 2WJHA 4A1OA 3ZLJA 1V0JA 1RLOA 1EDZA 4NCNA 5SZIA 3PPYA 1E2NA 4QX6A 5T57A 5AW9A 1XRSB 2IEZA 1EP1B 1MX5A 3DPIA 2IX9A 3BGVA 3FJOA 3K72B 4MVJA 4E70A 2BC9A 4WKCA 4Y0AA 4L5YA 4FP9A 3KQOA 1EG7A 1KKUA 4MLPA 2GAFA 4XUCA 1NZFA 3IKTA 1JDSA 4ETNA 3AI1A 4R71A 2YJ3A 3EARA 2PYDA 1SG9A 2ESRA 5DM4A 3WMXA 4E5UA 1HNZB 3VMFA 6PFKA 1PL8A 1KP3A 1T10A 2A4KA 4LF6B 3A6ZA 3NG1A 2BAGA 5H4GA 4PG4A 3KT3A 4WH0A 4ZYUA 3T1VA 4A4DA 3LPNA 1TT5B 1J42A 4GPAA 2JRLA 3FFWA 4BNGA 1MB9A 3KDSE 1R37A 2A5LA 2JIRA 3JAMA 4GKJB 1KZHA 4UE6A 2R3SA 1M2NA 1PEKE 1IAQA 3RUAA 5LD2C 4PQEA 5LMZA 2CLDX 4N3GA 1BJKA 3CVJA 1ZOPA 1C7EA 3DMDA 3HACA 4GMDA 3H9UA 4EF6A 5K45A 3LIPA 2VQFB 3N39C 1WKCA 3OPYB 3BTSA 1BE1A 1Y1LA 2FZWA 1NVVR 2R44A 4HOYA 3GUHA 4CFYA 4DEYA 4G0MA 3GB9A 4FYHA 1M6NA 3QUCA 4LRSB 4UM5A 4G4IA 3LFHA 1Z4JA 4MA4A 4MW0A 1JBQA 2BMFA 2RHHA 3ZD7A 4O8CA 1RBMA 1GVNB 3QI2A 3GARA 4WTOA 2RGNA 4RGQA 4D46A 2O8EB 1ZNQO 1AHNA 2PH3A 5H59A 2X7XA 4NMMA 4RIGA 4HAUA 2OK7A 1P0QA 4HGPA 4EY5A 3VSEA 3CW2A 4ECAA 1N6OA 1P4RA 1ZVQA 5TT1A 16PKA 4NENB 3RSCA 1U1EA 4R9SA 2IUYA 2YMMA 4ZPJA 1KFEB 3THXA 4NOKA 3R76A 2EGHA 3L0ZA 4LDNA 3COJA 3U3ZA 4Q1FA 1QBGA 2V4MA 3WIDA 1FFXB 2CYAA 2O0MA 1DO2A 3BOSA 3LHDA 2IDKA 1WDWB 3UAYA 5BV0A 5JADA 4YJ2A 4QOSA 3CH5A 4MOWA 5FUQA 1NXOA 3IDSA 5FI1B 3VMMA 2YXEA 1P4JA 3WNVA 2JHFA 2X1VA 4CN8A 4KVAA 2RHBA 1KOGA 1L5GB 5KNDD 1R2QA 4FDLA 4FBLA 3FOBA 2FG7C 1DQSA 1AE1A 4XUDA 421PA 1Q77A 4FYKA 4NMXB 3QVUA 3ER9A 3U60B 2WSMA 2R1TB 3R7WA 3T3NA 1TAUA 1ZN2A 5C9ZA 1PG0A 2JBWA 2O1SA 4M1EA 3CNLA 4IDFA 1A9RA 4YUYA 1T5OA 5F23A 1DC6A 1GU0A 1PTKA 1VBMA 3DBRA 3FFXA 3GD7A 1EZZA 4HH1A 3DAHA 4M86A 1XDSA 1GGKA 2R8PA 3CF4G 4XDHA 5IBPA 5JXJA 5KNLA 3TSOA 1YRHA 1MH9A 5IVPA 5DSZA 3JYQA 1UBFA 5G0SA 3H1FA 3DKVA 2HD4A 1NZJA 3L0BA 3LUJA 1WW8A 4N49A 4MUAA 4QDJA 4YP1A 2O1WA 1JI3A 1KI7A 4R8RA 5DYWA 3A3NA 1XVIA 3GRKA 3A6DA 1J49A 2BKEA 4BJ5A 3O9VA 5ICSA 4EMUA 1C81A 3R3SA 4DS3A 1H1LB 3IKVA 3M2PA 4RTSA 4P8RA 1JKXA 2VRWA 4L6AA 2L17A 2VIIA 3IP6A 2OFFA 2A9OA 5IEJA 3L7OA 4YP6A 4C21A 2RJ3A 1NHGA 5HIIA 4B4DA 4Q34A 1P1JA 5BSMA 1E7MA 3OFVA 2IDJA 5AQ1A 1KH3A 3L02A 5B37A 3GUCA 3GNTA 4U2DA 3OCJA 3F71A 3MQ4A 4XIGS 3V1UA 4CIXA 2PHZA 1OW3B 1VIDA 2CJWA 4UUNA 3A6PC 3ZDDA 4WA8A 4OSEA 4AAYA 3ZVMA 1TDJA 4A91A 1WSBA 4KV7A 5IYZB 2BJVA 1EXWA 1Q19A 3NYIA 4OB7A 4DGQA 2ZSIA 3QZUA 3DBIA 1YKFA 1RT9A 1QF9A 4WZAA 4MEAA 3SLGA 1A88A 2OCPA 3OU6A 1ZNYA 5A02A 3S2GA 4F6CA 3P0FA 1PZGA 3TXXA 1B0UA 5KWSA 3U7GA 3KXIA 3FTCA 3V2UA 3LSTA 1CB0A 2NZXA 5EGSA 2VDMB 4OXIA 5D1NA 4E2WA 3M4NA 1BDIA 3OFJA 3CMMA 2IS2A 1YUMA 3IIIA 4F3RA 3HZHA 4Z7NB 2PGXA 3ORHA 4JXKA 2Y27A 3A9TA 4M1MA 4QC2A 3NJ8A 1R8YA 4RVHA 1ULAA 3LCUA 3ZWPA 2V59A 3PC8C 4GRIA 3DR5A 1SUSA 3CRNA 4QDXA 4BZZA 1I5OA 4G09A 3WLOA 4B47A 1WZCA 2IGBA 3NX4A 3RFUA 3H3XA 5JFGA 2XB4A 4J2TA 4LHXA 1DEOA 5C31A 1GNRA 3NWEA 1M0TA 4HUJA 5ICFA 3IHLA 4DPMA 4BAGA 2O0KA 3LXUX 2B4RO 3U4CA 4L85A 1N1EA 4XAQA 1L7BA 1QQTA 5E1DA 2P8JA 1Q3KA 3GEDA 3N2KA 1Q15A 1R0WA 4FUTA 5KJEA 1FMJA 1O5OA 2QYHA 3HO8A 2RGEA 3KJIA 4H0NA 4C3VA 2YJ4A 3EZYA 1CUYA 4MAFA 3KJXA 2GETA 4KXVA 1VB3A 3DL0A 2XNSA 2HSEA 4YMGA 1DXOA 1B73A 3ZWNA 2HUPA 2WWWA 1A69A 4K9SA 2A1TS 5EWJA 3E9NA 1IMJA 4Y30A 4R81A 3W6OA 3W3AH 3WK7A 4CTNA 1U9JA 3FNHA 1H2EA 1PGQA 2GXQA 2J9FB 2FHSA 5CK4A 1E1QA 1QRTA 2ZM5A 1G4AE 1Z08A 4C29A 1OX5A 4FB4A 2JIDA 1J2TA 2LR0A 3PG5A 5LP1A 2V7VA 2FSIA 1KFCB 5F52A 2YY5A 3SJ7A 3WYEA 1COZA 5B1DA 1OXUA 3BHJA 1Y7PA 2JKYA 1Z8DA 3UKDA 3SVLA 4NBVA 3NTLA 1TT7A 3ZV5A 5HBGA 3NDRA 3G0BA 4DUGA 1E2UA 1T15A 2QORA 3AFHA 4MO2A 1UMKA 1YZNA 3AUFA 3K4HA 3QPUA 4MYCA 3T7JA 3TQFA 1YB7A 2AG6A 4TXMA 4BVGA 2WLTA 3L7BA 3MIZA 1ULTA 4G26A 3F7OA 2C77A 4L8WB 3D2CA 3Q0IA 1J8VA 4IIFA 5I48A 3K1AB 3EQ7A 3E9CA 3QEMB 2IE0A 2NXCA 2R87A 3RH0A 2EHDA 4QL3A 4IS3A 3WO1A 2JRCA 1W6RA 4BKOA 5FEUA 1C30A 3H9EO 4AJ2A 4Z2AA 5B3JC 5A7FA 4DR2B 3E2MA 2H85A 2C5GA 2QTTA 2R7AA 4J0HA 1BSVA 4KYUA 2I7DA 4UHEA 3SK0A 1WMAA 4O2BA 3DWGA 4YFYA 4N41A 3K1ZA 4IXMA 4YMUA 4MS1A 5CEEA 4FN5A 3UJDA 1HNXB 1G7CA 3ILVA 1SKQA 3PD0A 2JHCA 3AU9A 1ZVVA 2D59A 3KLBA 1U7OA 2C4HA 2CUTA 4FZ5A 3U19A 1PWEA 4LRTB 2P35A 1SN7A 4KDCA 3WRVA 3PIIA 3G2HA 4GX2A 3IAM1 3SC2B 4C4ZA 1TIPA 5HRCA 2DFNA 2X1HA 3OQ6A 1HI9A 1UBMS 3DVSX 4QO7A 4HYEA 4IIJF 4KW7A 2LW7A 5EKTA 4BP1A 1DC3A 3T3EA 2IU0A 5AFSA 3IEPA 5CLFA 3ND5A 5JY1A 1YACA 5EXXA 1XV5A 5JVDB 3VSDA 2I6SA 4TKVB 5AR1A 3ZY4A 2Z6UA 3FDJA 2PV0A 1TD1A 1E6EA 4F96A 4Y67A 1ENOA 4DV2B 1QE0A 1J20A 4BZXA 4M1ZA 5D5QA 2GB4A 1OA0A 1JHOA 1EFRA 1MIOA 1A8QA 1U2SA 5EA2A 1KIMA 2DR3A 2MDTA 3PGXA 3PQDA 1DWPA 4I3HA 3SQOA 4TLDA 3QOWA 3KVYA 5IP5A 4RHCA 2AG5A 5EJGA 1U8EA 2QNBA 3OZAA 2FCAA 2FRDC 1ZCZA 4FI3F 3ICCA 4HY3A 4HDNA 1VL8A 4II7A 1YIAA 3C8DA 4KU4A 1UPBA 2Q9CA 1G55A 3STTA 3NETA 3QMWA 4HAXA 5AJVB 5EZ6B 1SVMA 3CS3A 3OKFA 1W5BA 2B2NA 2QF7A 2ZYSA 3W3AA 1X80A 3ENWA 4BMNA 4R54A 5KX5F 3R8CA 2OMKA 4ZVUA 3CX3A 1TLLA 1HDYA 2IW1A 2PXAA 3P96A 4TTPA 1TU3A 1K7SN 4Y2QA 3O2JA 4M8IA 5DISB 2OQIA 2YY6A 3FWZA 3IR7A 4EYGA 1JHPA 2XMDA 1WXDA 1NLZA 4WLVA 4PONA 5LB4A 1LLDA 2W6PA 1NLMA 3R74A 4B6EA 4DNOA 1FYXA 2G9NA 3ORSA 1QBKC 3PFFA 4PYNA 1C8BA 4NV1A 3PNBA 1CVLA 1W36B 3H0CA 4KQHA 5U4XA 5BSHA 1B0AA 3NM5A 4J3FA 4K2HA 2EW8A 9ABPA 2G08A 1C7QA 4X0EA 3ZWBA 1SBQA 2GZMA 3KCNA 4BLTA 4AVYA 4CQLB 1SD2A 1VI5A 2FTKE 2H1LA 3HRIA 4DQXA 3HFJA 2XR1A 4PSCA 3OURA 4F11A 1PNRA 1MJHA 4QUDA 3LF1A 4OKNA 1R6XA 4N12A 5K3EA 5C7LO 5H3HA 2XAAA 3I2YX 2V6GA 5EIOA 4E30A 2Q5IA 4NMWA 5HGJA 1E1QD 3IO3A 2Q4DA 4A5SA 2EP5A 4KXYA 4NR0A 1SXJD 4O4HA 4Z4IA 1V11B 2C7RA 2GLXA 2KBEA 4ZMRA 4QUAA 4HS9A 3SICE 3W8EA 4CDMA 3SYKA 4PLTA 1J06A 1OLUA 1YHYA 2V96A 1CY7A 4RUKA 5KMGB 5LQUA 1J24A 2ZI5A 2FFHA 3L05A 3VGJA 2MIIA 4DBLC 4G89A 3BB1A 4O0LA 2R4UA 4WI1A 3BAFA 3TFOA 4C01A 4OM7A 4HFJA 1D4OA 4J0JA 5FOXA 4C7BA 2XE4A 3VBEA 4YAEA 1Y8CA 5IF3A 1P5FA 1TEXA 4YLGA 5ALPA 3LV8A 4CIVA 2P2NA 2ZR0A 3LJKA 1O5IA 1AGYA 3A14A 4IDGA 3P0JA 3AIIA 4PQFA 4WCFA 4XQ0A 1QK3A 1E1MA 5F2KA 3DUFB 1C0KA 3QTTA 3MAJA 4DDKA 1E0KA 2ZZKA 5EPOA 4EB3A 4WNAA 2JGDB 2MOKA 3BXXA 5DWQA 2VHZA 2FETA 1TZKA 3KR2A 4M9QA 5T67A 4RS3A 2CC2A 2C78A 5EJFA 4CVNA 4X1YB 3MK31 4K9LA 4MQ4A 2EIXA 1K98A 1KVQA 2MU1A 1C9KA 2R97A 4JR1A 4UNIA 4F5YA 1L5NA 3CUYA 3C3BA 4QEDA 5HS6A 3RRBA 3UHPA 2FOXA 2GXSA 1T5TA 4AF6A 3WQSB 5KQPA 5JJBA 3ZCQA 3PXUA 2H54A 1G5HA 3FGZA 1WB6A 4IV8A 5DT2A 4PSUA 1VCIA 4FYMA 4RDXA 1VRWA 2PZJA 4I14A 1HZJA 2D06A 2D5LA 4NCJA 4NJOA 5UKDA 3I5XA 3WLTA 4EAAA 1E4YA 1EK0A 2OXCA 5C52B 2V4UA 5I9SA 3STYA 2GFQA 3EQZA 2GDJA 1JEDA 2DPLA 5K03A 3IP8A 2VHUA 1EM8B 2XIJA 3HMKA 3ESQA 1CZUA 3VVLA 4XWAA 1CKEA 2ZYAA 1FP4A 3T12A 5I01A 3ISJA 3EVZA 3P9QA 4N5HX 1XPRA 4PSAA 2OZVA 1IN6A 3OIWA 4IDHA 3GP8A 4S35A 4ARVA 4CMIA 1ZHOA 3ROGA 2A1UA 3L82B 3F3KA 4NKRA 3UQYS 1JHZA 2AJLI 4AIIA 3AC0A 4F2GA 4MIEA 1USWA 1Z8NA 2Q4OA 4UUQA 3C7TA 1FU7A 4PS1A 3KG2A 5EHGA 4BX9A 4EYEA 5FYQA 5C3MA 4DA8A 3W3AD 5A5VA 4YJ3F 2X3FA 1L5SA 3UWPA 5FWXB 4KQ9A 2JAUA 1ZI8A 2HA0A 1ZXXA 4F1KA 1NDHA 4ZANA 1KQPA 5I4KA 4ARAA 3P9YA 2XUJA 4TVOA 2WFZA 5FQNA 1A8IA 4HUQA 3AJDA 4IIYA 2Q3HA 1MAWA 1UT6A 3B1WA 2NAFA 2C7PA 2CW5A 4IH9A 2P6OA 2FEKA 1PG5A 1X7XB 4ZVSA 3AY0A 4DJ5X 5AW8A 4AZWA 1DKOA 2M1XA 3PT5A 2OBMA 3QU2A 2WAOA 3VX4A 3EZ2A 2MYTA 1Z88A 2HO5A 4R40A 1Y6FA 3BMOB 4PO3X 1Q1ZA 1Y82A 2P2DA 3CUSA 1DIBA 1IIBA 3UC9A 1V2HE 1NAHA 4QVKA 1TQ2A 5FFNA 1WBDA 1EFUA 2HIMA 3Q2KA 4LJAA 1Z12A 1T2FA 3ZD9A 2B4QA 3EBLA 1B23P 1BX1A 1BS2A 1WQ3A 2HT6A 3AR7A 4JDPA 2W2NA 4AK9A 3P5SA 4AZTA 1UFQA 3MAAC 5L7YA 2YVAA 3EOAI 3UWSA 2X9GA 3UUGA 4HHEA 4EKYA 1COWD 1GNLA 2QD3A 1RC1A 2QZZA 4GDMA 1D5WA 1USGA 1VL0A 3I58A 3O84A 4H6XA 1TIKA 1UWCA 1U0LA 3KVVA 4CETA 2CDRA 2XZDA 3PUHA 1ZM7A 5DM2A 1LDNA 1N3IA 2I87A 3CG0A 1P72A 4WOCA 5BWCA 3EW7A 3VU1A 1BMTA 2J3HA 3FGOA 5ESRA 4KRGA 1EA5A 3A32A 4DWVA 2YZKA 2XYGA 4ZAGA 1BCRB 1XA3A 2AOUB 1X2BA 2PT5A 4YRPA 3VPGA 4HNQA 2NU9A 4CTKA 4MUIA 1BWRA 5BXYA 1TC2A 2A94A 2YFYA 5T4HA 2MSEB 3IL2A 3HBLA 4IOJA 5CITA 1PL6A 2ZCVA 3LQ2A 1YHNA 4GR4A 3C3PA 2YNMA 4OB8A 1JLRA 4NU6A 3K0AA 1XDZA 4U2CA 3SJZA 3LC2O 1JILA 4NYMR 2HHLA 2J7PD 1N2CB 2C4VA 2QX4A 1Z17A 2WV9A 3HVIA 4TWAA 5D8DA 5DHTA 1CQJA 4URXR 2FF5A 1T8PA 3O7WA 4MS3A 2IEYA 3A36A 3KXDA 1AY0A 2Q6TA 3U9TA 1VCMA 2D1RA 3HXOA 4WINA 1Z2DA 2IITA 1PUXA 4ZCLA 4CTMA 4JI2B 1N9KA 4D25A 2I7TA 3ZDEA 1Z2OX 2XX3A 3DCNA 4MEJA 3IAXA 4O08A 4RKQA 4RZ2A 4TRJA 4KAFA 2A6PA 4MH0R 5EXDA 4MRRA 2C8LA 4FN4A 5EWMA 5DSTA 2A8YA 5LLSA 2JATA 3ZXIA 4QREA 1U0BB 4FDMA 2VYNA 5KI6A 1IOVA 1C0PA 3JVUA 3KOWA 3NTVA 2I8AA 2X23A 5FI3A 2LCIA 3Q7RA 2ONKA 2FSVA 4U1RA 3D6AA 3BMNB 4MVJP 1TUBA 3N8NA 2JAWA 1GSHA 1SVWA 4RM3A 5BP7A 3Q40A 4D42A 1DFIA 5C5IA 2BFEA 2O8DA 1WKVA 1WMEA 3L7MA 3SS8A 2V7UA 3T61A 2BYTA 2EL7A 4US1R 3G5LA 3LC1O 2W2TA 4Q9JA 1T2CA 1V43A 4J0EA 5K0BA 1M2VA 3FYHA 1SXGA 1L4LA 1WUTA 3N2EA 3A2KA 2WD7B 3M9WA 4IUBS 3M3HA 4M99A 3L1HA 4UHHA 3JYOA 2OG1A 3I04M 5T4BA 4OHCA 1V71A 4DUYB 2AG1A 4K6HA 3TLEA 5F1KA 3C3KA 1GTVA 2ANCA 1IEWA 3MRTA 1U8TA 1KU0A 4QZVA 1WM1A 5F78A 3D7MA 4GPTA 4NPAA 4PGFA 3C5EA 4AIRA 5LNK1 4YR7A 1KDOA 1TQ8A 2WF6A 2F3QA 1BCSB 2OZKA 1G1MA 2NPOA 3I3OA 2OXIA 2JFVA 4HRXA 2XWQA 3NLLA 2EX0A 1PL0A 2F62A 2YHBA 1AMOA 4ZAFA 2J9GA 5HG0A 2OCKA 3OFSA 1KRWA 1R66A 1OWLA 1X8XA 4GMXA 4RADA 4RORA 3PUZA 3QBDA 4EVSA 4DXDA 3G8AA 3WWYA 5I7UA 1YR9A 2GHIA 4W8HA 1Z4QA 5K09A 3R20A 4YY3B 1P4SA 1XTBA 2UXBB 1C4XA 4A2WA 4PYIA 4J94A 4BFCA 4ZRNA 4XWGA 4PYOA 5SV2A 3RFVA 1VYUA 5HF8A 1M10A 1JR4A 4RQUA 4K1XA 1KEPA 4PGAA 2FSPA 4XASA 3SJCA 3WWEA 2JJ1A 2OOKA 3F5DA 4D9JA 2BHTA 1SGWA 3AB3A 1E5LA 1UCFA 3TAXA 3DMFA 3EVFA 5DX8A 5LP6F 2PKEA 2ZJ4A 3KVRA 3RLIA 5B4VA 1CJUC 4EW2A 1DAOA 1C9DB 2HHCA 4N18A 1P6XA 4YO7A 1W46A 3LVBA 1X8JA 1P44A 1MZVA 2AFIE 2ZE5A 4BGEA 3THWA 1KMQA 3KOUA 4O8ZA 1ENPA 3GUZA 3IPCA 4LE0A 4W1PA 4CMAA 1JEOA 3E0QA 2ZWPA 1PT5A 3AG5A 1H8EA 1FJ2A 4LRQA 2WIAA 4J2OA 2ZTLA 3ENQA 3PEEA 5IJ0B 4URWR 3T9DA 4DCVA 1J8QA 3FJ1A 2VHWA 2JFHA 3AO0B 3NC4A 3TMAA 1ECGA 4MA0A 3EVNA 3PRHA 1YVRA 3VNVA 3NH9A 1SVUA 2A35A 5G0TA 1HGXA 4PU0A 3VSBA 1IOZA 3AHJA 4KQKA 3EIXA 2X8JB 5ELLA 4Q1EA 1U1GA 1Z6ZA 2J3KA 5LCXA 1R5BA 4FOPA 1UJMA 5MFPA 3N2IA 3MPOA