4JT4A

Structure of clostridium thermocellum polynucleotide kinase bound to datp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
molecule keywords Metallophosphoesterase
total genus 63
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jt4A00
1GG2A 2NGRA 4M1OA 1NY6A 3CONA 1PUIA 1Z29A 4TMZA 1CS4C 3PXGA 3SDZA 4RZUA 4QGAA 1N6HA 3X1YA 2QP3A 1VIAA 1RC8A 2RHDA 4DT1B 2J7PA 5FUVA 1G8YA 1XD2B 4GP6A 2CL0X 1J90A 3KQKA 4MGZR 4DDUA 1XMSA 2V3CC 1YRAA 3C5CA 2PBRA 1P2TA 2PMKA 1LS6A 3DZ8A 4Q4JA 3P20A 3BH7A 1E99A 4MGKR 3I61A 3PIRA 2GDJA 4QL3A 3VR4A 4BLOA 3U6BA 1XD9A 2OFXA 5C2JB 2OCYC 2A5FA 1JPJA 3PUYA 1DVRA 2ZVPX 2CMKA 1CRQA 2B7CA 2ZJZA 1RPZA 4OBEA 3ASZA 2AR7A 1E2FA 3RANA 2R6DA 4PSAA 1R7RA 2UVQA 4RD2A 3GLFB 4H1UA 2C5LA 4JLJA 1B0UA 5L3RA 3OF5A 3X1XA 1XZQA 3WHLA 4E5UA 3C14C 3VHLB 3WRYC 3EA0A 5G40A 5F9HA 3MSXA 1I4TD 2QU8A 4M8NE 2AWNA 2FPMA 1XWIA 1KSFX 4US1R 5FUYA 1MO6A 1TTTA 3UPUA 1ZCAA 4IOMA 2MMCA 2CE2X 1W44A 3AH8A 4YXWD 3PITA 4O25A 5DE3A 3K09A 4ZI2A 5LPNA 3AKYA 4Z54A 4MDFA 3CF2A 1ESMA 1P9RA 2EQBA 3EIEA 3L0PA 4MYTA 4OQFA 4RZ3A 1X8KA 2B7BA 1D9ZA 2TMKA 1US8B 3SI7A 4PPQA 3K9LA 2AKYA 4R9UC 4B76A 4JSYA 3SNHA 4TL6A 3R8CA 1SHZA 1KGDA 3CR7A 1MT0A 3RWMB 3SJCA 1CU1A 3BWDD 1GRNA 1IXRC 1T3HA 3U60B 2VSFA 2GTPA 1V43A 1FW6A 1NG9A 2N46A 3RRYA 5K8LA 4Q9KA 2W6JD 2PCJA 2VA8A 1W48A 4QG7A 2DYKA 4G5QA 2G9NA 1GNRA 3E2IA 4I1OA 2O8EA 1L4YA 1NKTA 1GL6A 4MRPA 1KSHA 4URZR 3DKPA 1JXMA 4XWKA 1WBDA 3M0EA 2J0UA 4GMDA 4BWYA 3ZZ0A 2BVNA 4KO8A 1DG1G 2D62A 2IF0A 1XXHE 4GOJA 1KO1A 2G0TA 4CT4B 2V6JA 2J0UB 2QT0A 4D80A 1ZNYA 3BOSA 1Z3IX 1OB2A 4TYWA 5DHAA 3CNLA 4D26A 1IOZA 1P2SA 1X6VA 2VQSA 4Q9HA 4JBYA 4UKDA 1KO8A 1TEXA 3QVVA 2DFKB 3MGCA 3U3OA 4RZ2A 3Q72A 2REOA 3CPHA 5EE9A 1JQLB 1CULC 1VTKA 1W36B 5J4YA 4N0DA 3SFZA 5EE5B 1E1RA 2QORA 4ZKDA 5LB2A 1VDZA 4PC3A 5IT5A 4OI2A 2GEVA 2L0XA 3AVPA 1E1QA 4A8JC 3AGPA 3CM0A 4RD0A 3ZIAD 4HAYA 4II7A 4FCVA 5HE9A 4UNRA 3BAFA 5DO9A 4CGZA 3W6PA 1KTVA 3G82C 3OESA 3B7GA 1DARA 3NHBA 3GPLA 4IOKA 2PJZA 4ARZA 3QXCA 2NOAA 1N0VC 1E32A 2CXXA 2ZU0C 4TZ6A 5JWHA 2OUKA 3SBEA 2QAGA 1W4RA 1DS6A 1FTSA 1VG9B 4W7SA 1SQ5A 1CR1A 1GUAA 4MKGA 4HLDA 2YINC 4QJ3A 4UXIA 1NVUQ 4JBWA 1NLZA 2WAYA 3FMIA 2ZE5A 3K9GA 1NRJB 5CYPA 2ORIA 3Q7PA 1XCMA 1AK2A 3GLFA 1GZSA 2QAGB 4F7WA 5J40A 3PJRA 1P2VA 3SJAA 2OEPA 1WRBA 2QTHA 2V7QD 3AP1A 4ARZB 3PQCA 2CHVA 3A4LA 5FPHA 3AKEA 2BKUA 2C77A 3RYTC 1P9WA 5B57C 1F2TA 2WOOA 3A4MA 3EPLA 2QT1A 1X1SA 4V0MA 4EPVA 1I4LD 5AUNB 2JJ8A 1SKYE 3EPKA 3V4RA 2NMVA 1AQYA 4NZYA 4BRUA 4BEBA 2QMEA 1IONA 4GBMA 4LWZA 2IC5A 2FF7A 2BOVA 1BIFA 1XD8A 1N6KA 2C96A 1E96A 5J5CA 1IN4A 2BIFA 3MRSA 3DPUA 5CM9C 4Q9IA 2J7PD 1G8HA 2UZ3A 4KLNA 2IXGA 2NO9A 3U7HB 2CK3A 1ZNWA 2ZJ5A 1E2PA 2X1VA 4PC2A 3FVQA 4LJ9A 4D25A 1EWQA 3KJGA 1Q0UA 4LJYA 4PAOA 3R9XA 4LHZA 5D3MA 1Z0AA 2OXRA 1R5OA 1VYVA 1IHUA 2ZROA 4IVRA 5CK5A 3KQLA 3D6TB 1E2QA 2ZRBA 3KUCA 3ECCA 1E9CA 2VIIA 2D2FA 1ESNA 4HAVA 3ADDA 2LKDA 4JBXA 1T8TA 1ZAKA 5CLQA 3QJYA 2BJWA 1LB1B 1IY2A 5FL7A 4LBWA 4Z51A 4F4CA 3WBKA 3HYTA 1CP2A 3BFVA 2ZRFA 3B1WA 1G64A 3QKTA 3MWYW 4L9WA 5KTYA 3FMPB 4V0KA 3JVUA 4WBSA 2XB2A 5EZ5A 3GJ5A 3NXSA 3WNBA 3TAUA 2Q21A 4XWOA 4KAXA 5CDFE 2BBSA 3A1UA 1CJVC 2F9LA 3BS4A 4FMCB 4XVQA 5DYGA 4F93B 2ZJYA 1OF1A 3BD9A 3MWJA 3LXRA 4MKIA 3L2OB 5JS7A 2VO1A 1GKUB 3X2SA 4TT3A 3BB4A 1SVKA 1SGWA 1MO5A 4RY2A 1E0SA 3ZVNA 1GILA 1VHTA 1AN0A 3KFVA 5KSYA 3UMRA 1L2TA 2ZU6A 4OK6A 2A5GA 621PA 4XH9B 2IF2A 3H4MA 3CO5A 1D5CA 4LC0A 5HPYB 4TTRA 3RRZA 4A9AA 4DDWA 5LBIA 4P4SA 5EUMA 1YU9A 1UKZA 4HLUC 3O8DA 2Q3FA 2CHQA 3ZS8A 1D9XA 4B35A 4EKDA 3HR8A 1J99A 1G18A 1SXJC 1S2MA 1Q20A 5F2EA 4LPSA 2YVUA 1Z6XA 4YMWA 5EE3A 3FB4A 4V0ME 1CR4A 2OE2A 4DLWA 2DB3A 1S4QA 4RCYA 2XITA 4Q02A 1HE1C 1P7CA 3ZQ6A 2IS1A 2IWHA 4B73A 2V6IA 4NHOA 5AUQA 4JYCA 2JLSA 3C8UA 1IN7A 3LLUA 1KI9A 821PA 3OE7D 4GMXA 4NDZA 4KFUA 2WJJA 4H1VA 2HYDA 1WE2A 3PEWA 4GRAA 4WXRA 4A82A 4Q4JB 4BLSA 2JLXA 1E2GA 1RKBA 4G5OA 3C41J 4TLDA 3R9IA 1J2JA 1U90A 1P62B 1UDXA 4QC2A 4DZZA 4PPNA 3RS2A 3BBPA 1M7GA 4KV9A 1B23P 1TU3A 3UATA 1GWNA 3AGQA 4JVMA 2ZANA 4MDEA 4DDTA 4IDQA 4LI0A 3I8SA 4DVGA 3LVQE 3GJXC 3LBNA 1FX0B 1UJ2A 4DEXA 2RH5A 2FZ4A 3BXZA 3GJ8A 4C7OA 3LNCA 4OHZA 3ICQB 4IRUB 2WKQA 1G19A 2WHXA 4MRNA 2BCJQ 2QROA 2WJVA 4BZXA 5CM8B 5H1YA 3TSWA 4B48A 4QFMA 1KI4A 5H68A 3IO5A 2XTMA 3VR6A 3FMFA 3GLGE 4HYYA 1MV5A 4BZQA 1XEWX 3NEYA 5FOSA 4ERNA 2WJGA 3Q85A 1Z0KA 4QNMA 2DFTA 2ZSEA 2R6FA 2WJYA 3MMPA 1E1RD 3RS4A 4JLBA 4QHSA 2AK2A 3GEEA 1XEWY 3EZ6A 4F38A 2GXAA 1BMFD 2XJ9A 5AUOB 3EPJA 1UAAA 2O5VA 2BHRA 5G53C 3IILA 4PHHA 3SZRA 2OAP1 4DLXA 1Z08A 2W2TA 3ZIAA 2BJVA 1NVWQ 2LCFA 2XAUA 5EXXA 3QKSB 1KZ7B 2ATVA 1CEEA 3CX8A 4IDHA 1F60A 4HB3A 4RKEA 3H0KA 5K8UA 2HF9A 3AF0A 1JB1A 2JIZD 2H8KA 2QENA 1YZQA 1C4OA 2ODBA 3U3JA 3W8NA 4BFWA 4EPWA 3PENA 2FDCA 4XOIA 3A58B 1U9IA 2BM1A 1OIXA 4A2PA 4W5WA 2C04A 1SULA 4V0NA 2EFCB 5D3QA 3IIKA 5GJVC 4R2HA 2HLDD 3HP1A 4GFDA 1E79D 1ZMXA 1ZW6A 2ECKA 4D0LB 3T35A 3B82A 3I72A 4I1UA 1T0HB 3R7WB 4LHWA 2GXQA 1YRBA 2FSHA 2WAXA 2ZSAA 2D7DA 5L3SA 1Z2CA 1JAHA 2FE4A 4IXNA 2ZI5A 1G6HA 4C0BA 4LHXA 4G01B 2ZS7A 2R9VA 2W6IA 5GVSA 4LBYA 4DIEA 4EJSC 1OFTA 3LD9A 3RDPA 3QXJA 1ETUA 5BQ5A 1VG0B 4DSNA 2G1JA 2EU8A 1LF5A 1Q3HA 5AR1A 4D82A 4MRVA 5EUQB 4WIAA 3CR8A 2W6JA 3CF6R 3AVUA 3NVAA 4TN1A 4EPTA 1W1WA 5GJWC 4HDOB 4BLQA 3QPUA 2QP4A 3K9NA 4HSEA 1XMIA 2WBLC 1A4RA 3AP2A 1HURA 4IJMA 5JCPA 4CZ2A 2DWPA 2RGAA 2VL7A 5FPKA 2ANCA 4JJKA 2VHJA 1E9AA 4TT3D 2OV2A 3CUEF 4DLVA 3TE6A 1W7AA 2K5UA 1PLJA 5CYOA 4BFVA 3NC1C 4M9ZA 5A4JA 3CWQA 3IDQA 2CJWB 1ZNZA 4PHFA 4A8JA 3MWKA 4A92A 3GLGB 3B1XA 1IAQA 1YZUA 2YC2C 1TF5A 3IEVA 5B2ZA 1U98A 2EFHB 3UWKA 4B33A 4PHGA 4ZKEA 1J70A 1OH5A 2RGXA 3OFND 4RJLA 2ZAOA 1J7KA 2R62A 3EAQA 4HUTA 5JI2E 3A37A 1NMYA 2YYZA 3B13B 2NPFA 1Q1ZA 1NP6A 2BCGY 2QAGC 3W90A 2FSIA 5LD2C 1GKYA 1G6OA 5FL3A 3GP8A 3N2IA 4KJZA 4R98A 3K0CC 1MOZA 2ZREA 3KXLA 4LC1A 1SVWA 1JJ7A 1RRGA 2JLRA 2QP9X 3MWLA 4HDCA 5HCIA 4DCUA 3CRQA 1N3BA 4IXMA 4ZCMA 5D3MB 4DLUA 2ZI9A 1F2UA 2JASA 1KNXA 4MGYR 5FI0B 4UNPA 3ZVRA 1Y63A 2GJ9A 3FHOA 4PPGA 1AA9A 4TTPA 4B3GA 4ON9A 3GCGA 2ZYWX 3QE0A 1N6NA 1XCPA 1J8MF 1Z6GA 2VEDA 3CIOA 1VG1A 3DVLA 3EIQA 5EP3A 3P1JA 2GF0A 3G0HA 4JVLA 5SZKB 1M2OB 1F3OA 3WNDA 1P9NA 4NE2A 3NKVA 2OO7A 3LBIA 5TARA 2YWFA 2GNOA 2RB4A 4ZO4A 4NCHA 4B47A 1BYUA 5FBVB 2W83A 4FCTA 5E95A 4LZZA 2D4HA 4M1MA 2FPLA 4KCGA 4LDJA 4Q47A 5G3YA 2GWHA 3ADBA 1WF3A 2XJ4A 2VSXA 2AFHE 3QXXA 3UMSA 2VPPA 5JHHB 2KWIA 3OHMA 3CB4A 1ZUNB 4TMXA 1ZC3A 2ANBA 3B2EA 5FL7D 1KDOA 1QHNA 5P21A 4QXAA 3A6PC 1OV4A 3BIFA 3TJZA 4BRWA 1UKVY 1IQPA 4HAWA 2EWWA 2JDIA 2OFOA 1E79A 1L8QA 3VU9A 2ODEA 3B1VA 3EC2A 1S96A 2IS6A 5KPJA 1W36C 3DM5A 1Z28A 3CX7A 4FMCF 4RFVA 1Q22A 3K0SA 1KSJA 1XPOA 1BMFA 5FPYA 5AJXA 1MKYA 1KO7A 2RGDA 3W9YA 4B3FX 1OXVA 4CT5A 4EUNA 2ZTSA 2IYTA 1E1QD 3X1WA 2EW1A 1RRPA 2QBYB 4JZKA 4CIDA 3CF0A 4H9GA 2WWXA 2VHTA 4QOSA 3Q9LA 1NMZA 2DWOA 2XNDA 1P2UA 3CRVA 1KI6A 1OXUA 1QVAA 5FOVA 1OXTA 1NN3A 1G7SA 1AZTA 5EXSA 5KOYA 2ZXUA 5FTJA 1U94A 2A5DA 421PA 3C4JA 4OQLA 3E1SA 2ZE6A 3SS8A 1OFUX 4F91B 2W2VA 3CRRA 1P5ZB 1KMHB 2AFIE 5LD2B 2G77B 4E09A 1OH8A 4LHVA 3KUDA 3LFUA 3TBKA 1GM5A 1G16A 2H57A 3FYHA 4XTCS 3VKGA 4V0LA 1Z06A 4QBIA 2YC4C 1NNEA 2OCAA 1IM2A 2QGNA 2QTVB 2RGGA 2OZEA 3TLXA 4EQ6A 5F3WB 3HJNA 1G8FA 1NVVQ 4QRHA 1WP9A 3K0AB 1RYFA 3MFYA 2GEUA 4HZIA 2C03A 3THOA 3VAAA 2IX3A 2QPAA 2OFWA 2ORVA 1H65A 1E3MA 3AEZA 3AVVA 4OHYA 1NVXQ 2GK7A 3PEVA 4B2IA 1R8QA 1IN5A 3THXB 1TUEA 2ZSDA 2NO0A 3ZD7A 1NN1A 3ETLA 2ZRAA 3I73A 4RCZA 4Q66C 1ZIOA 4P0TA 4IOLA 1KK2A 3GLFE 2HV8A 3R9WA 4B6EA 1YR9A 3LRPA 2AXPA 2IYWA 3IGFA 3B1ZA 1LNZA 3AF1A 3C15C 4NCJA 4AYWA 2O8DB 1H8HA 1AS3A 3TW4A 4TQUS 4XD7A 1UBCA 2IS2A 4M1KA 4TTQA 3H86A 3NC0C 2N1BA 4FD2A 4M4SA 4QBHA 2FU5C 5SZHB 2A2ZA 2XB4A 1EESA 1FNNA 3EPHA 4HZUB 2UZIR 2P67A 1FMJA 4OHWA 5DIFA 5JS8A 1AIPA 2W0MA 3TRFA 2ERYA 2ZYUX 4NYMQ 121PA 2ZRIA 4AK9A 4Q1DA 1Z8FA 4QJ5A 3SR0A 4QM7A 4YQFA 4A2WA 5JJLA 3WYFA 4BASA 1YJ5A 2WMNB 1M7HA 2ZVQX 4B2PA 4XVUA 1XZPA 4X8MA 5FOTA 4WVFA 1RIFA 4XD7D 5CIWA 1Z6TA 4PQYA 5E7JA 2Z5FA 1F48A 2ZRLA 1XJCA 1MO3A 1K6MA 1LY1A 3ZJYA 4D4LA 5JI3E 2DR3A 4IEEA 4C0QC 2G0NA 5HZKA 1COWD 1S1MA 3AQ4A 5F98A 4AI6A 4C3ZA 2A9KA 4LCBA 1II9A 1SHKA 3NHAA 4JMPA 2BEJA 4PHTA 4DLZA 4PZLA 4DT1A 3ZGXA 4DEYA 2WWWA 3BFXA 3QY0A 1XXHA 3THXA 3CNOA 2VP2A 1NJFA 3ND9A 2IYSA 1UM8A 1N0WA 4POAA 1G3QA 2ZQ5A 4CEJA 2YOFA 2VYFA 4HB0A 2WMOB 2Q9CA 3LX5A 3Q3JB 4B32A 5CJ2A 4A0GA 1F6BA 1CJMA 2GAOA 3LX8A 1SXJE 1OXXK 1XCGB 1QHYA 2HXYA 2WWHA 3WRXC 2XGJA 3P32A 2O0KA 4ZV4A 3B60A 3EX7C 2BM0A 3B6EA 4NTZA 4JL6A 3OAAA 4MKHA 3H84A 3GQBA 1VCIA 1Z6AA 3EARA 4F92B 4WAUA 1HE8B 2VP5A 1KAOA 4JL8A 2P3SA 2RCNA 1LTQA 1S9HA 4GT1A 4YXWA 4Q1BA 1HY3A 4ZPXA 2UKDA 1WBBA 1R8SA 1BYIA 1E2HA 4A8JB 3THWB 221PA 5KU1A 1RJ9A 2CJWA 1UFQA 4OQXA 3MCAA 1D8TA 3W3AA 2WJIA 3GFOA 1U81A 3WYGA 4B3DA 3VX4A 3LDAA 4K46A 2OSBA 1VKJA 4HI0E 2NZ8A 3EIHA 2QBYA 1YE8A 1COWA 4D0GA 4PX9A 2FX3A 1W49A 1CJUC 1M8PA 4TLCA 2XEXA 1AKYA 1II8A 3LY5A 4BUJA 5GADl 1Z07A 3KFXA 1OYYA 3OE7A 4RD1A 3VR2A 4PO1A 3A1WA 2OT3B 1Z83A 2V1XA 3QF4B 2YJTD 2XSZD 3AKDA 4MYHA 3TIFA 4BLRA 4E03A 3N70A 1ZM4A 2ZE7A 4M53A 3M6AA 5CITA 4NP6A 3ADCA 5BW8A 3TUIC 3AVWA 3DKVA 4JT4A 1XD2A 4RZXA 2A5YB 2X2EA 3SFVA 2QM8A 1I2DA 5JWOA 4OJQA 1W0KD 4Q00A 4EFNA 5TMPA 2RKOA 1T9HA 4V0OA 4LSGA 1KHTA 4EJSA 2QMUA 2XZPA 1S8FA 3K9HA 1S0UA 2PX3A 4LJ8A 5DN6D 2PX0A 3UWOA 4PFSA 2CL7X 4GPTA 4XWAA 1P75A 3OIVA 3SN6A 5KNCA 4GSYA 1T8UA 1R2QA 2QGZA 4NYJQ 4B71A 1EFTA 4DIDA 3KB2A 5A0FA 4JVSB 4CRWB 3AM1A 3FHTA 1RYHA 1Q44A 3AV0B 1EFRD 4C0SA 1KY2A 2OG2A 4XIGS 1XRJA 4JLDA 5AK0A 1R0XA 2YKGA 4L8GA 3T1QA 3IEUA 3RHFA 2GXSA 1E98A 1UPTA 5JEDA 1TQ6A 2FFAA 1OH6A 2CLCX 4M2LA 1ZUIA 2GKSA 4OQMA 1U2RA 5FH9A 4LOAA 4GI7A 1E2MA 1WCV1 3BB3A 2D3WA 2I1QA 4EPYA 1R10A 2ZUBA 2ZI7A 2I3BA 4PC7A 5TY0A 5HKKD 3FWYA 5EP2A 5JFGA 3N5CA 1Z22A 1UEJA 1OLOA 4HATA 5KO2A 3TUZC 4PZYA 1ZM7A 4CEIB 4YC7A 4MRRA 1CR2A 1UKEA 4KYUA 4X8HA 3GFTA 2BC9A 1LF0A 1T6NA 1XNJA 1Q1QA 1DAGA 2ZI6A 4KI0A 2O8BA 4QHTA 1P6XA 2ZJOA 4A36A 1IN8A 2VHUA 2C99A 2FOLA 1W0JD 3KTAB 4LV6A 4PANA 3SOPA 1XBTA 2OCPA 2QRNA 3WP0A 1EXMA 3BC1A 5FBLB 1G5RA 4GP7A 3K53A 4G5RA 5J4HA 4M0LA 3G5UA 4MUAA 4FCWA 1FQKA 3DZDA 3OEEA 2QUZA 1ELOA 1UKYA 2H17A 3LVRE 4JIMA 1MABB 2WM9B 1EX7A 5KDLA 1SKQA 2OBNA 3PEYA 3MAAC 2D7CA 3NWJA 3DOFA 2Z43A 2JLZA 3THYA 1XU4A 5KHOC 2D06A 1DOAA 4G3XA 2PEYA 5IK2D 2REBA 1U0LA 3VMFA 2DPXA 1XB2A 5BN3A 1BS1A 3BJIC 3LAWA 1CF4A 2A30A 2Q6TA 4LYFA 2VP4A 4LJ6A 1U99A 4KFSA 1H8EA 1W0KA 2GZHA 1O87A 2RMKA 2F43A 1PUJA 3SHFA 3ZZTA 2Q9BA 1NSFA 2FFQA 2A7QA 4C9BA 3THYB 2QEQA 3K1JA 4EPRA 1VG8A 1YR6A 4US0R 4M1SA 1NN5A 4OHVA 4FW9A 4Q9LA 4JYBA 5E7MA 3TK1A 4DLTA 4WA7A 1Q1BA 1E9DA 2J59A 3ZD6A 3IBGA 1KAGA 4B74A 4LGMA 4AD8A 3HU3A 2QL6A 4WZ6A 3W5JA 3GJ6A 4B2LA 4URXR 5KSPA 3RSOA 1DG3A 1YR7A 2H16A 1TX4B 2IYLD 3NIBA 4K81B 1KO5A 3EWSA 1LV7A 3LQRA 2FGKA 4MH0R 4DC9A 4KVAA 3WMEA 2ZR0A 1E0JA 4IEIA 4JT2A 3TUJC 4DWJA 1ZBDA 1ZM3A 2GJSA 4OKSA 4TQ9A 1HQCA 2C9YA 3LV8A 4P4UA 4Z1MA 4DDVA 2CVHA 4Q4HA 1OT3A 1XJ0A 1K5GA 1I2MA 4B3XA 5JJKA 1DBSA 1P61B 4FIDA 5JZVA 1UBFA 2R6AA 2Z0MA 2ZITA 4URYR 4KBGA 4RD3A 3GMTA 1AJEA 2XTNA 4CEIA 2P5TB 5FTMA 3LXXA 2RGNA 4AWXA 3B8HA 3QKSA 4YLGA 5HR5A 4HDQB 1P72A 3IIMA 1N5IA 1N25A 1MH1A 1OPXA 3BE4A 1JR3A 3MJRA 2FEOA 3CWZA 5CK4A 4YMSA 4O0MA 1KK1A 4G0NA 4RD4A 6Q21A 5IDVA 2JDID 4TMVA 1IXSB 1II0A 1DAFA 2QQEA 4OI1A 2HDNB 3ZS9A 2V9PA 3OEHA 1NLYA 1MR3F 2J5XA 2I4IA 4LUCA 2JJ2D 3AB3A 2ZUDA 4AKGA 4LRWA 1HV8A 2IL1A 4AURA 2ZR7A 4Q7LA 1A2BA 4AY2A 1QHXA 4XJXA 3O8RA 3QSYA 4D4KA 2C78A 2QQ0A 5HZHA 5KPDA 2VTKA 3ZLJA 1AGPA 1DAMA 2WIAA 4MUBA 3QOFA 1SVOA 3QVUA 1OH7A 2YOGA 3T1TA 5FOXA 5CDFA 1GOTA 2VBCA 1OYWA 1Q1EA 1GAJA 1KI2A 1G20E 2FH5B 3LLMA 4NONA 4NU0A 1XTSA 2B6HA 2FMXA 1A5TA 3UMFA 1FPMA 3QIAA 4NCIA 4Q48A 2BMDA 2AWOA 1FL9A 2ERXA 4Q1CA 4UJ5A 1N5KA 2BKEA 3RS3A 3PUZA 1ZINA 3U3MA 1EFRA 5L3SB 3VNVA 4V02A 2ODNA 1OJLA 4WOPA 2GETA 4IDOA 3A1SA 4MYUA 2IYZA 4ZCIA 4P3YA 1LS1A 4P4SB 3KKPA 5DISB 1VYTA 4G5GA 1TQ4A 2N42A 1Z0JA 5E7IA 1N6IA 2AD5A 3DM9B 3ONWA 3A36A 4BFTA 1DELA 4MKFA 2IW3A 3V9PA 2R8RA 2B21A 1ZM2A 2WSSA 1N6LA 4WXPA 1YQTA 1JJVA 1XFAA 1EFUA 1M74A 1PVOA 1IN6A 1MRNA 1TAGA 2VF7A 1E9SA 1HYQA 5DI3B 1C1YA 3AKCA 1RJ9B 2NG1A 1ZU5A 5EE1A 4LYHA 3OIWA 2P6RA 3DMDA 3BB1A 1E9BA 1DTSA 1QZXA 4BGDA 2GHIA 2HYIC 2ZRMA 1UBEA 2P2LA 1GL7A 2BBOA 4KU4A 4A0HA 2RGCA 4QGFA 2X77A 5KDOA 1IBRA 3ND8A 4O3MA 1L4UA 3TQCA 3W8RA 2BMFA 1TF7A 4Q21A 4Q4LA 1KZGB 1AQUA 1YZTA 3KDSE 2BMEA 3BFKA 2QTFA 1YHNA 1TF2A 3QF7A 4S35A 1QHIA 2V4ZA 2CCKA 2XSZA 3KXKA 2QZ4A 3QKRA 2NIPA 3GEIA 2V1UA 2SHKA 2I1VB 4ZDIA 4CEJB 1G5PA 4HAXA 1U8YA 4K8OA 4Q1AA 4C7OB 1LW7A 4QBGB 4A15A 2QPOA 2Z83A 1KI3A 1N6PA 1XTIA 4BFXA 4PR0A 4UNNA 3BH0A 1T0JB 4NPHA 4OI0A 1QRAA 4ZIRB 2IUUA 2NTYC 1GNPA 2C95A 4UNQA 5GJCA 4IW3B 1D2NA 4OL0A 3VFDA 1EG7A 1Z5ZA 2JJ1D 1ZCBA 4Q7JB 2Q9AA 5FFMA 3IQWA 3CRW1 3M4YA 5FTKA 1ZP6A 1VCNA 2J9RA 2AN9A 5JSZB 1FMLA 3OFNA 3RS7A 1GDDA 4JSTA 2WKPA 1G7TA 5J4LA 3Q8XB 1FQJA 1DAEA 5JLJA 1OB5A 3VNUA 5CJPA 1GIAA 2OLKA 3I8XA 5AWFC 3SJBA 1QG4A 5BN4A 3LW7A 3AUXA 1E69A 3CPJB 2YWEA 3I92A 3SU8A 3K70D 2QSYA 3U7FB 2CHGA 4AG6A 1PLLA 1S9DA 2ZRCA 1FNMA 5M04A 5DNYB 5BYKA 4OK5A 1N6RA 3KXIA 5FUWA 3WMFA 4JKIA 3FKSD 3AUYA 3KKNA 3W6OA 2WWGA 2GBLC 1ZVQA 2QA5A 4BFUA 1E0AA 1G7CA 2RGBA 5DSZA 2KBEA 2ZE8A 4IFEA 3SBDA 1M7BA 4HZUA 1EFHA 3ZH9B 2MSCB 4LK2A 2Q0HA 3AVQA 5DN6A 2CLDX 3ADKA 2XXAB 1CJKC 3AP3A 2AK3A 1DE0A 1R0ZA 4QJ4A 2ZUCA 3HPRA 1Q12A 3RC8A 4M9XA 3CX6A 4NMMA 1VIYA 3MG9A 1ZD1A 2R65A 1R0YA 2FFBA 1EGAA 2WPDA 4B34A 4TYYA 3KZ1E 2BMJA 2R6GA 4CVNA 1XTRA 1G21E 2J0QA 1X8LA 2GVDC 5EP4A 1Y3AA 2G3YA 3RS0A 1XEXA 4LYAA 4DSUA 1LFDB 3OIYA 2GAAA 2VP6A 4FN5A 2CVFA 2O52A 3CH4B 4BFZA 3U61B 1DAKA 3T15A 1OSNA 2ZYVX 1X8JA 4U02A 5EQTA 3U3KA 1X1RA 3REFA 1W46A 4I81A 2C98A 1FTNA 2ZRNA 3I4LA 5K8TA 1OE0A 4V03A 2HJVA 3KQNA 1XTJA 3BGWA 3I62A 2PLFA 4X8LA 2YV5A 4CEHA 1KK3A 1NBMA 1OFIA 4AC9A 4U7DA 5FR2A 2O8DA 4Q1EA 1YZKA 2IWRA 4C0AC 2IYUA 3AF2A 3NH9A 1Q21A 1WQ1R 1XX6A 3F5FA 4AKEA 2HEIA 4EIWA 3U6KA 1X3SA 2IA5A 4PO8A 1E94E 5EXTA 1L7VC 1DEKA 5E4FA 5TVKA 4US2R 2GK6A 3KKOA 5JEEA 1KY3A 1JR3E 1KI8A 1IY0A 4UXJA 4XTRA 1N0UA 1VYUA 3EWAA 3PR1A 3T5DA 2GJKA 3A4NA 1IJEA 2V55B 3BRWD 5EZ6B 4ZI3A 1A82A 1E2NA 1D2EA 2WIBA 2G83A 3EZFA 5CB8A 3DMNA 4QGGA 1QHHA 1H8HD 3KQUA 4C0HA 4LJAA 1DADA 3QEOA 1DAIA 2VLIA 4DB2A 2AL7A 1ZD8A 2XX3A 2PH1A 4ITRC 1TMKA 1QF9A 2QE7A 3WNCA 2H1LA 4JKYA 4KFTA 2QNRA 1JNYA 3AVXA 4LY6A 4ZDWA 5L8VA 1Z0FA 2O8EB 2AHOA 3CRMA 1YZLA 4FI3C 4M9SA 3TR0A 2RHMA 1NSTA 3A8TA 4PSKA 1EWRA 3RRMA 4TZ0A 1RRCA 1CKEA 3VU9B 1NVVR 3ZVLA 3PV0A 4OYHA 4BLPA 3QQ5A 3K70B 2KI5A 2X2FA 1P3JA 4IDNA 4Q19A 3GLIB 3E70C 4A2QA 1XEXB 2ONKA 2KJQA 3SC3A 1Z0DA 2PZEA 2FNAA 3LW8A 4MA4A 3QBTA 5HE8A 2F9MA 4GZLA 1A2KC 4TLEA 1TADA 3K0EA 3PUWA 1TU4A 1HH4A 1OIVA 4W5JA 1EX6A 1G1MA 1NN0A 2VH5R 1ONBA 1F5NA 1G9XA 2XXAA 4M1WA 2ZSFA 1NBME 4NH0A 4TSFA 2F7SA 3KX2A 4JS0A 3U3RA 4PC1A 1DPFA 3RWOA 1XDBA 1GNQA 2CK3D 4UXHA 3SYNA 2LKCA 1SZPA 2NO7A 2B8WA 2BDTA 5DI3A 4HUQA 5KYKA 3JVVA 2FA9A 1CBUA 2YHSA 3K0FA 3IPYA 2VRWA 3HU2A 4JLMA 1XJQA 3U7EB 2OAQ1 4FMDF 4YDSA 3V00A 2ZI3A 4OI4A 3NG1A 3CNNA 3R7WA 1V5WA 4TQAA 1KMQA 1E2DA 3X1ZA 3SHWA 1G41A 2F55A 1Q57A 2IXFA 2IK8A 3V4FA 1XF9A 4C0KA 4QBFA 3PUVA 5DYIA 1GP2A 1SVIA 2V54A 1GL9B 4L9SA 1TNDA 4EAQA 4DLSA 2ZJAA 3AF4A 1ZYUA 5JSZA 2Z4RA 1ZJ6A 1QDEA 4TMTA 3IUYA 2X8AA 3OIUA 2JLYA 1P60A 2EVWX 3KKMA 2EFDB 4A1FA 1C9KA 4B3BA 5IK2A 2EFGA 3KB1A 3R20A 1WMSA 2FSGA 2Q3MA 1KDRA 5FBWB 4EQ6B 2C8VA 2JGNA 2VF8A 1P4SA 1OIWA 3F8TA 1W4BA 3QBVA 4JLVA 2QAJA 3A1TA 5IRCD 4DLYA 1E2EA 4Y0VA 2IYQA 3PCRB 3IO3A 5G41A 4TL8A 2OCBA 2WVJA 5FOWA 4DUGD 4BE7B 1U9IC 2GVZC 3OEED 2LWIA 3T1OA 4L15A 3QXSA 1J8YF 1S1CA 4DBLC 4NL4H 4R71A 3GLGA 1JR3D 1AM4D 1RFLA 1UDWA 1KSGA 3TKLA 1KDPA 2WWFA 3ZQJA 2PJRA 2CEAA 1IJFA 2CNWD 1T5IA 4YDHB 1JPNA 4Q03A 2P6UA 4QM6A 3T34A 4NYMR 3WHKA 5C4MA 2GCOA 3MLEA 3IHLA 4Q4HB 5EE0A 5FI1B 2GESA 3HYRA 4E22A 4NKRA 1IXZA 3W3ZB 3BK7A 4N1AA 5F9FA 3LA6A 2CL6X 4JLNA 3UG7A 3N2EA 1MO4A 2G6BA 4DUGA 1HEIA 4MYCA 5DLQC 2FWRA 3VR1A 3I32A 3W6NA 2J1LA 4I1VA 2FSFA 2RAPA 5FTLA 1XP8A 3NBYC 2QE7D 3U7GA 3OZXA 2J46A 2XNDD 3UG6A 1PLKA 3IPXA 4PSVA 4ZDKA 5L3VA 4RFSA 1KI7A 3IQXA 2OM2A 2NPIA 1U0JA 2ZRHA 1OKKA 1VCMA 3L8YA 4BPBA 1T3LA 2WPDD 5EP1A 3L0IB 2F1JA 4U00A 2HLDA 2YWGA 1GRQA 1N5JA 1PZNA 4O2LA 4Q4AA 4Q4AB 1QG2A 2B92A 3HDTA 3RNLA 1Z47A 2QI9C 4QKQA 4KSBA 3EASA 4BFYA 3FFBA 3H2YA 4MQBA 4CDGA 2VSOA 3ASYA 4TWZA 2P5SA 2EYUA 3K0FB 2OBLA 3WP1B 5J4VA 5JHGB 4GL2A 2R6CA 4LX0A 4LBVA 2F3TA 3FGNA 4XVRA 4L5BA 4I1SA 4NYJR 4C0JA 4F4JA 5KDDA 3KJHA 5JWRA 5FBRB 5H8WA 1E9FA 1HT1E 1U8ZA 3BH6A 3IIJA 3NEJA 5HCNA 4ACBA 3KQHA 2IUTA 2X19A 2FN4A 4AIIA 2GF9A 4E07A 2IYYA 3D3QA 1AZSC 3EXAA 1KYIA 1VECA 4UNSA 3UANA 4WZBE 1KKLA 3I1FA 4HB4A 4CW7A 1RVDA 1E9EA 1W0JA 2W2XA 4P32A 4DLRA 3UK6A 1KOFA 2FGJA 2J7KA 1AS2A 2EFEB 1O3YA 2WICA 1G3UA 3FKSA 4J0QA 4KFRA 1FUUA 2VP0A 4KXFB 1OXSC 4DSOA 1SXJA 4HB2A 4S2EA 2IHBA 4D81A 2QMHA 1DO2A 1KIMA 2O8FA 1EK0A 1G4AE 3QKUA 1UF9A 4PZZA 2DY1A 2WSSD 1NJGA 1NG1A 2IYXA 2KBFA 2YZ2A 4A6PA 4M1TA 3J81k 1YR8A 1YVDA 1NF3A 2PT7A 2GRJA 3F0TA 4HAUA 4L4UA 2WOJA 3I5XA 4LBZA 2XZLA 3GJ3A 4P4TA 4DSTA 3U44B 4EPXA 4ILEA 3QUSA 2WSMA 3SE0A 1N5LA 2ZYTX 2WTUA 3RS5A 1WA5A 4XSHA 1OHHD 3QEJA 1KO4A 1JEEA 4LYJA 2ZIAA 4RD6A 4X8OA 1Z2AA 3GLHB 1WXQA 1SXJD 3FPAA 2ZJ2A 2WZQA 4OQNA 4YMTA 3M1IA 3GJ7A 1XTKA 3UIEA 3KL4A 3DHWC 1RZ3A 3X1DA 3T61A 2ZJBA 2J87A 1KI1A 3WY9A 1QVRA 1JEDA 2IBMA 5DGXA 4TLBA 3LO5A 2DFLA 1G17A 2J45A 3FDIA 1T91A 1D2MA 3WMGA 3NBFA 1FP6A 3FE2A 4NBSA 4Q01A 1OHHA 1W5TA 2J41A 1CLUA 1ZUHA 4HUQB 3L82B 3NDBB 4A6XA 5L3QB 4HLCA 2GCNA 5H70A 5B58C 1CJTC 5TV2A 2A3RA 3HR7A 2YWHA 4TMWA 4Z1MD 2JEOA 4CEHB 2OXCA 1F2TB 2BBTA 2XOKD 3F3YA 3QXHA 2GJAA 4TL9A 5BYJA 3SJZA 4EDHA 3RSLA 5EJEA 5IHPA 2WJHA 1W2GA 1ZNXA 4HLQB 3HU1A 4GOXA 4IHQA 2FJUA 2Z4SA 2JLUA 3U4QB 3K09C 2AX4A 5KNDA 1UADA 2GXUA 3QI2A 5KUTA 1E2JA 1ZC4A 2PL3A 1S3SA 3EC1A 3L8ZA 1E4YA 1SVLA 2MMGA 1SVSA 2VP9A 3K0CA 4OJKA 4QGHA 2OBMA 1GSIA 4IOJA 3TNFA 1R6BX 4ASUD 4BLTA 3A1VA 3GLIE 4B6FA 3K70C 2XOKA 4MITA 2AXNA 4A4DA 1GRRA 4N3NA 3ICEA 5J4KA 2JATA 1G3RA 4Q9JA 4D6PA 2HT1A 4MRSA 4GOKA 2O8BB 3ZYCA 2ZRDA 2BBWA 1WB9A 3WBJA 4ESVA 2ZAMA 1XEFA 2F1RA 1ZRHA 2P6NA 1NMXA 1W4AA 1Z6YA 1EFCA 4G1UC 4PPFA 2GCPA 2ZPTX 1QHHB 2DHRA 2H92A 3D31A 2QPTA 2ZEJA 5HKKA 4XSGA 1D6JA 3THWA 4I99A 2NO1A 2JLVA 1M1YE 2E87A 2J3EA 3MUFA 5CB6A 2IXEA 4PAQA 1JBKA 1NLFA 2R44A 4ASUA 2QRZA 1FX0A 2DBYA 3TQFA 1X86B 4HEJA 1G291 1DAHA 2WKRA 2PZFA 3UKDA 4C4PA 5JRZA 5FBQB 4PAMA 5FTNA 4CYMA 2H5EA 3RRNA 1CXZA 1TPZA 2W00A 2QMOA 4KBFA 5FOUA 4GNKA 2Y8EA 2CDNA 4OHXA 3P27A 3EA5A 4P31A 1HA3A 3CH5A 4ZIRA 1Z0IA 3DDCA 4DB4A 1FOEB 5ANRB 1W5SA 1JQJC 5CLLA 1ANKA 4YMUA 2J0VA 3VKWA 3AVOA 1XPRA 2JLWA 4BEJA 1E6CA 2A5JA 2W0SA 3TVTA 4EJSB 4EFMA 3CZPA 1FZQA 1UEIA 3MJHA 4TYQA 4BFSA 1A7JA 1CR0A 5ELXA 3GEHA 3FFAA 2KSQA 2XNSA 3QNUA 1KI6B 8OHMA 1XTQA 2O8CA 4L16A 3K8YA 5B64A 2CLSA 1JR6A 2C2HA 2ZRPA 5CIQA 1TL7C 5BWMA 4KHZA 2REXB 2EYQA 5B30A 3SQXA 4B3CA 2IEYA 3T06B 2PLRA 2OHFA 4WW0A 1GITA 5TB5A 1RRFA 4NCNA 4M21A 1K8RA 5K8IA 2ODWA 1U8AA 2QG6A 1II8B 2O0HA 1G8PA 2H18A 2KE5A 2MSEB 2ZI4A 2C9CA 1YZGA 4KYIB 4URWR 4D0NA 1GKIA 4Y0AA 3B9PA 1QHSA 4HLUA 1SVMA 1G4UR 1KJWA 4RKFA 2O8CB 2NZJA 4Q1FA 4R2IA 1AGRA 2E9SA 2WWYA 2R2AA 3C5HA 3P26A 3TMKA 4A0RA 1FUKA 2ZM5A 2DWQA 3DL0A 2OILA 4ABYA 5EXPA 3VHXA 1R5BA 1PJRA 1R5NA 2JA1A 3B9QA 2RGNC 1M34E 1OW3B 1OFHA 1KJZA 3QENA 4KVGA 1BO6A 5AJWA 1TEVA 4DJTA 4AKHA 2JJ1A 1I4DD 2IYVA 3NTUA 3ZVMA 5L3QA 2HCBA 2G88A 3VR5A 5DHFA 2GEDA 2A78A 3BORA 1W2HA 3VR3A 1ZIPA 3B1YA 4FMDB 4IVPA 3AVTA 4UJ3A 3NBXX 3R8FA 3EZ9A 4JJZA 1T5LA 4TSFD 4YONB 3RABA 4C2UA 1KMHA 4FMBB 521PA 3TSOA 4KODA 2F1HA 1F2UB 1NI3A 2ONJA 4TMKA 3HPQA 3ZZUA 4Z8XA 1XMJA 1WDTA 4TLAA 3T5GA 4DCSA 5KSZA 1XXHB 4DXAA 3RVBA 3PFIA 2H7VA 2KB0A 4DCTA 1E4VA 2HT6A 4QNRA 2NO6A 2IS4A 3L0SA 3GLHE 4JVNA 4PO9A 3OEHD 3EZ2A 2IHYA 4AG5A 5JBQA 4G5SA 1KNQA 3GD7A 2IEZA 1VMAA 2J0SA 1HT2E 4IDPA 1LVGA 3SEAA 4URUR 3U44A 2YOHA 1T3SA 3E5HA 5SZJA 4PC6A 3LH5A 4DCVA 4JLKA 3UXMA 2D2EA 3QG5A 5C46F 1U0HC 3VKHA 3W34A 5DI9A 4NYIR 1JXOA 2HCJB 4D4JA 3I3SR 1DO0A 1W47A 2ZRJA 5E3HA 4D4MA 3CKLA 4IKEA 1W36D 5JRJA 3I5YA 2O8FB 4QHYA 3O8CA 3T12A 4B44A 2CCGA 4DKXA 1N2CE 1US8A 2WV9A 2MSDB 4W5HA 5IF9A 1BKDR 1NBMD 3NDPA 2CNWA 5J47A 4LV8B 3CW2A 3PVSA 5G3ZA 5KNBA 1KKMA 3QPWA 4U5XA 2GBLA 4KSCA 2Z6VA 1NKSA 4LJ7A 2YNMA 4KLZA 4CF7A 2AKAB 3LQQA 3O47A 2FFHA 3FTQA 3U5ZB 3FHCB 4LJ4A 1NIPA 2GZDA 5TXGA 3L0OA 4KITB 1YZNA 4BECA 4GDFA 5HTKA 2CE7A 3WXMA 4Z8YA 3U2QA 3GJ4A 3KJIA 3U4QA 3SYLA 2Q3HA 3D8BA 3VQTA 2ZRKA 1AKEA 1RW4A 4Q18A 5C4GB 1PV4A 5TDHA 4ACAA 1G3MA 1NY5A 4M9QA 3DEFA 1FP7A 4P33A 3MD0A 4M22A 2WWIA 4IFBA 4TYNA 2XZOA 2O0JA 4WZAE 4Q7KA 5JJIA 3TVDA 1E2IA 1E9RA 4C0LA 4YMVA 3K0AA 1K5DA 2E1RA 1QHGA 5AJVB 1OKKD 3WYAA 5GVRA 4JL5A 1G3IA 1IY1A 3L43A 5FR1A 4C2TA 3Q5EA 4Q5IA 4AYXA 3LBHA 1KK0A 4LJ5A 5LDDC 3REGA 2AD1A 2QY9A 3NBZC 3FKQA 4UQOA 1GFIA 2ASEA 2HJGA 4DRZA 4PTLA 4MGIR 1YKSA 1TQ2A 4DCNA 3HWSA 2GILA 3AVYA 2ZR9A 3QKRB 2DFNA 3VTKA 3H1TA 1NIJA 4FWTA 1R4AA 2ZS8A 1BH2A 2XTZA 2GCOB 3GJ0A 3IBYA 3GLHA 3OAAD 2VHCA 4LPKA 5C18A 1SXJB 1XPUA 1CIPA 4PXAA 2QM7A 1JECA 2ZRGA 3O8BA 3JZAA 3ZDQA 1G5TA 2IUSA 4GZMA 4C30A 2GZAA 1HQYE 3GFPA 3S1AA 2CCJA 4URVR 1VCOA 2ZETA 5UKDA 4F4IA 1SKYB 2HXSA 1FFHA 1HUQA 2EWVA 2V7QA 3RAPR 3T1VA 1Z63A 3RLFA 4ESHA 3Q7QA 4FXPA 4A0FA 2ZSBA 3EZ7A 2CBZA 4D2IA 3LWNA 1XMVA 3QG1A 1JI0A 5JECA 2GJ8A 4BQSA 4W9MC 2VHQA 3FOZA 2QN6A 2JLQA 5AJZA 3PG5A 4HAZA 4AKIA 1VPLA 4OK3A 1JAIA 2F43B 3SQWA 3KKQA 1E2LA 4O2RA 4DHEA 2BWJA 1CTQA 1ODFA 1E2KA 2RGEA 3PEUA 3TSZA 4ZDJA 3PUXA 1QBKC 1TUIA 4PQRA 1ZM9A 4EFLA 1ZD9A 3TH5A 3SYKA 4TL7A 4JLAA 2ZJ8A 3P4XA 5LB4A 4Q7MB 4B75A 2NQ2C 3KJEA 2W6ID 1VHLA 2PEZA 1G8GA 4PQFA 1GTVA 4I4LA 4RFSB 1N6OA 2ZS9A 5A5GA 2JIZA 2PZGA 2QSZA 2PCLA 4IVQA 2BV3A 5FUXA 5GJBA 2FG5A 2P0EA 2C9OA 3TR5A 3P4YA 4RVCA 2FPKA 2OESA 5C1BA 1A1VA 3EG5A 3QF4A 1UBGA 1W4CA 5JMTA 4FINA 2V8OA 1MRSA 2F3RA 3AF3A 2HUPA 3IKJA 4RSGA 3S1AB 2FV8A 5DH9A 1R0WA 2D74A 2GA8A 5KSOA 5BXQC 1HTWA 1BOFA 4N0EA 4LV5B 2F1IA 3C16C 5AJYA 2IYRA 3D7MA 2ATXA 4R7ZA 4AYTA 5FPTA 1CRPA 3Q5DA 1KDTA 4NCKA 5JCZA 3GLIA 3C7KA 1M6NA 5FPSA 3TAHA 3DO6A 1MABA 2JCSA 4ZCLA 3B85A 1GVNB 2PMDA 1E0KA 2DCUA 1T4GA 2HF8A 2BEKA 3DOEA 2IT1A 4M1YA 1P73A 1KJYA 4LHYA 2PT5A 2W58A 3CPEA 1Q3TA 3EW9A 3KTAA 3W5IA 2FZLA 721PA 1NL3A 2FEMA 4JLPA 4B43A 3NH6A 3TW8B 3CBQA 5AUPB 1TQDA 2P65A 3TGPA 5SZIA 3QPVA 2B8TA 3FMOB 2JJ2A 4FWIB 3B78A 1S3GA 1RE0A 1ZU4A 3RC3A 2ORWA 3BERA 5BN5A 2F6RA 4JLOA 3VX3A 1JALA 3CZQA 1AS0A 4BZPA 1H8ED 3B5JA 3CLVA 2OLJA 4NYIQ 3IHWA 2JAQA 3JZMA 2G1KA 1G7RA 4TYPA
chains in the Genus database with same CATH superfamily
1V1MB 1TPYA 5K51A 1I51A 1PUIA 1Z29A 2BKAA 2ZWPA 2SKEA 4PTZA 4YP6A 2ZAGA 3TG8A 2BF4A 3KT8A 1M1YA 1ESCA 3L49A 3PXGA 3SDZA 1VSQA 2JH8A 2PUFA 3O4HA 1WKBA 2VC2B 3X1YA 2QP3A 4LRYA 4X66B 4DA8A 2XXBA 1A2QA 3M9XA 2BSAA 3DFZA 3JQCA 4KPGA 2CL0X 1PNTA 2PVSA 2XVMA 3O1HB 4YTEA 4MGZR 4Y6QA 3H4TA 2V3CC 3S7ZA 2ZUUA 3LSYA 1BDBA 1P2TA 3VOBA 1LA2A 5IT0A 3DL4A 1DMSA 2HI0A 3ANXA 4QL3A 3U6BA 3F5SA 3LUGA 1M34A 1UH5A 4C3UA 1XD9A 8ATCA 2G9QA 2OCYC 1S4MA 2A5FA 1L4HA 3IAAA 4WINA 5BT9A 4BB6A 4U5QA 2TMGA 1RPZA 2UVDA 4OBEA 1D6MA 1UOEA 5NLLA 3RANA 4WN9A 1R7RA 1PJ3A 2QTAA 2UVQA 4M1QA 1U4SA 1H42A 4XCXA 3ZUPA 3QEMB 5IG2A 4JLJA 5EHQA 2PZLA 1G8SA 3UMMA 3WHLA 3DE3X 3IT3A 3STHA 1U0GA 2LBPA 3C14C 3VHLB 3EA0A 3PX3A 1QH8B 1ES9A 5HKLA 1U8CB 3WRYC 4BDTA 2QU8A 2UZ4A 1JP7A 4M8NE 4L75A 1XWIA 1BH6A 1RNLA 2C5GA 5FUYA 1TTTA 1BCRB 5FAKA 4LNHA 1TQ8A 1A04A 1UL1X 5BV0A 1SD5A 4WN3A 2WYUA 1R37A 3AXTA 1LC3A 3LUPA 3SJ7A 5HJEA 3RJMA 2PBFA 3F4BA 1MB2A 1I1OA 4YX9A 3YASA 1RRVA 5ETJA 2IOFA 1KMNA 4D57A 1Z13A 2AZ4A 4R2JA 3EIEA 4EW6A 1X8KA 1JH8A 2P68A 5CA1F 3ABZA 1NJ1A 3C3KA 5E4TA 5AW2A 4HKTA 1US8B 1M54A 1UOQA 2I7DA 5B3JC 1Z2PX 2BZ0A 1IIBA 3WFIA 4MWOA 2XI4A 3R8CA 5JV5A 1G66A 2HRQA 4TOIA 3X43A 1CU1A 2D00A 1IQRA 1WMDA 4W8GA 2YYSA 3ENKA 5JO0A 3KR0A 3QLEA 1MW8X 2AEEA 1ZIDA 2CBXA 3TQQA 3RIYA 1AHNA 3GGCA 3NHMA 2VSFA 1NG9A 2N46A 3PRJA 4PX5A 2CXRA 2PCJA 1YS7A 3D0RA 2QRQA 3HCEA 2CXUA 2BSXA 3NTVA 1XHLA 4G5QA 5ARDA 1EEHA 2G9NA 3HEAA 3E2IA 4AN1A 1MQ9A 2O7VA 2VPTA 3JQBA 2O8EA 3ROKA 4UEOA 4Z86A 4EHFA 1JXMA 1WBDA 5DK4A 4G5XA 1M5TA 4BWYA 5K0GA 2BH2A 2B4AA 2WFAA 1RJDA 4PIMA 5DM1A 1K0UA 5K3OA 5IWAB 3JQAB 3OZBA 4JODA 1GTSA 1P1RA 3GYBA 4MB2A 4D80A 3UC5A 2MU1A 4RKQA 1NPYA 1OB2A 3ETNA 3BULA 4INOA 4D26A 1IOZA 1JHPA 1P2SA 4X1OA 3RHTA 4Q9HA 1L1FA 3VZPA 4RTKA 3UGJA 2RKWA 2P2YA 1CUIA 1WHSB 4LZAA 3TQSA 1P1HA 1S8NA 2WDPA 3H13A 4KO3S 2W4QA 1JQLB 2DZDA 1NPDA 1CULC 1VTKA 3VZSA 3PWSA 5J4YA 4OX9B 5ECYA 2H8GA 4ZKDA 2HQSA 1IB0A 5JROA 3AUJB 3ZWQA 1OR8A 2V8BA 5AW5A 4L4YA 1YNOA 3DTVA 4PC3A 2Z9BA 2NSDA 3IURA 2L0XA 3AVPA 2FSVC 2HJHA 3HCFA 2HQBA 3CM0A 5DK6A 5EYPA 3JRWA 4QATA 5HE9A 4FCVA 4D3YA 1BE1A 3DMGA 1KEUA 3BAFA 1GPYA 3ISTA 4UNRA 1MX3A 2C8JA 1K6IA 1OVMA 4GM4A 2VJAA 4UUMA 5A5FA 1EFPA 3G82C 2QYOA 2HFKA 3LT2A 4KO4S 4IGFA 4LYEA 4IOKA 2PJZA 4OG2A 4ARZA 1T2FA 4EG0A 3GPLA 4TSKA 2CB9A 2NOAA 2EWMA 4JQSA 3ORSA 3PE3A 3SBEA 5JNSA 4E11A 1FTSA 1MPTA 1CR1A 5CJJA 2B36A 5E0KB 4K03A 4Y30A 3WBBA 4JBWA 3ZCVA 1NLZA 2A1UA 2A1UB 4UQPA 5GONF 4EF4A 3I23A 3K9GA 3IQGX 4LWOA 2WWTA 3Q7PA 2QX9A 1AK2A 3GGJA 1XAJA 2HY7A 3FLAA 4ZQGA 1CZLA 3JAKB 3TLZA 4C7OA 1K8QA 2EGHA 2G82A 1HT3A 1P2VA 5AVTA 1D0IA 1PL7A 2OEPA 1KMMA 3IHKA 4MWSA 2QTHA 1IJBA 3EQ8A 2V7QD 4UTZA 5AO9A 4AJ9A 4GMFA 2ON6A 4ARZB 1CLEA 3RBZA 1GPAA 3A4LA 1WDWB 4L3WA 4BAGA 2NYRA 5B57C 3NOXA 4Y8VA 1QTRA 2WOOA 3A4MA 1K6XA 2HDOA 3EPLA 1I4LD 2NUPB 4D5GA 3TNYA 4GX1A 1DJLA 1AQYA 2P75A 4PAGA 3MN1A 1Q50A 1E3WA 5JCJA 2P9TA 3EVTA 1X7YA 2WE8A 3GJQA 2DETA 3ZJTA 2XA1A 3LM8A 2CZQA 3NGMA 2FF7A 3OICA 1AKTA 4IGEA 3VDXA 3G68A 5FX2A 2R11A 1S2DA 2C96A 3DTVB 1CZRA 2JHAA 5IARA 2BIFA 1JI3A 2FPGA 2NU9A 3MRSA 5CM9C 1R8XA 1KEZA 1G8HA 3RTAA 1FFBA 2UZ3A 4A16A 3AG6A 4KLNA 1UOOA 2ISSD 2CK3A 1ZNWA 2ZJ5A 2Y27A 2FR1A 1KBQA 4LJ9A 3W0LB 4NBVA 1Y9JA 2ZWOA 3KJGA 4PAOA 3EWIA 1A8QA 4ZOLA 4ZOLB 4LHZA 5D3MA 1Z0AA 2OHIA 1A9TA 1CIJA 3E22A 1SXIA 3FJOA 5F1KA 3FGZA 1UC8A 2ZROA 4P84A 3OTIA 1JMVA 2VJNA 1E2QA 3THXA 4QPPA 3FF4A 3WK4A 3OIDA 3KUCA 3B6ZA 2BGKA 4KR7A 2ZBEA 2VIIA 5B55A 3HNPA 2LKDA 1VQ1A 1QV6A 4JBXA 4ERXA 1T8TA 1F6DA 4JXZA 4HWPA 1LB1B 4W5QA 3MOSA 1QFYA 1DUIA 4QSHA 1PSZA 1CP2A 3Q8WA 4BKQA 1EK1A 2ZRFA 3VAYA 2H9YA 3B1WA 2WAOA 5HQTA 1G64A 3VVMA 2GVNA 5IT4A 1IOLA 4V0KA 3M3PA 1DQNA 1VMIA 4GGPA 2IHJA 4NE9A 4NI5A 1F4LA 3DAYA 4MQFB 2N1MA 4ZZ2A 4KR3A 3I9KA 4HJXA 5DZSA 1NBWB 1LV8A 3A1UA 1XROA 1XGKA 4GVXA 3A9UA 2ZJYA 3W5VA 2VVTA 3BD9A 3H0CA 2CKMA 2DHDA 4KN8A 1DWUA 2VO1A 2E4AA 3FSGA 3WL8A 5GZ6A 1Q7GA 2F3QA 4DM7A 2O0LA 1Q14A 2C0CA 3KHSA 1E0SA 2PWBA 1VHWA 4AMZA 1RZRA 3AM4A 1EZ1A 1GILA 2BLNA 2JAXA 1FY2A 5DEIA 5EPOA 5CD9A 5AKEA 3KFVA 1NQAO 5BWCA 5CFQA 1L2TA 2VWGA 2YXDA 1XO1A 4MGEA 1J7JA 5AOVA 2VTBA 3COPA 1PFQA 3VPDA 5A5VA 5F52A 2I2DA 3O90A 1MTZA 4BQNA 1QB7A 2P69A 3GN1A 4TTRA 3ZJ4A 1HRDA 3VVLA 4A9AA 4DDWA 2D6FA 3HVHA 1YHYA 4YS6A 3M33A 3R76A 1IOVA 1PNQA 1Z75A 5L4NA 1SXJC 4YR7A 5F2EA 4PZPA 2VPYA 3G88A 2WU8A 1Q84A 2YVUA 2R1VB 2Z3ZA 1EDEA 1DV1A 3FB4A 4V0ME 1Z4OA 1SB9A 3RSQA 1S4QA 4ILKA 5BSFA 4N5MA 2WSYB 4LNUB 5E6UB 3WIOA 4EA8A 4DV6B 3LY8A 1ACMA 4CM3A 2DFVA 3H0EA 2FN3A 3BMQB 2IS1A 3VV2A 1K9SA 3N3BC 1Y7HA 4FP9A 1A2OA 2OSVA 1S5PA 2JLSA 4ZEXA 4P5DA 2FWAA 1ZD3A 4M60A 2FR8C 4BO8A 1IN7A 1QZZA 2WFZA 2B5OA 1WPRA 3EIFA 4OY3A 3NR2A 1QLWA 3G8YA 3OE7D 1QIFA 4NDZA 5K09A 1RI4A 3ZWCA 1NKVA 5JS6A 1JKFA 2G1PA 3PEWA 3KXPA 2IEIA 3T9FA 4GRAA 2A3NA 3H8SA 4GW3A 4M1EA 5JDIA 4X00A 3RVOA 4Q4JB 1ZXLA 4YJ2A 1G5FA 1N92A 1TK9A 5BN5B 3DLTA 1E2GA 4FC7A 2JLXA 4UMVA 3R5TA 3VU1A 4CCAA 4M0EA 3C41J 1A8HA 3ADPA 1P62B 4QOGA 3E9EA 4YJHB 5BNTA 4DZZA 4PPNA 3RS2A 3GDWA 3BBPA 2JW5A 2J3MA 4XM2A 3MERA 3I05A 3MM4A 3OT1B 4LGVA 3UATA 3WGKA 3BN3A 3DUWA 4CXMA 2B82A 1ZQ9A 2Q0QA 4JVMA 4D79A 1UANA 2QIPA 3ZG6A 4XQ9A 3I8SA 1Q5PA 3LVQE 3QUQA 3FWHA 3LBNA 3H1EA 1JAZA 2RH5A 3CZRA 3WSWA 1G5IA 2RFLA 5EMNA 4CKCA 3KVVA 3N0WA 2WKQA 1RP1A 4WLOA 1G19A 3O3OB 2DULA 4EA6A 3HFJA 4O4HB 5J9FA 5JYBA 2BCJQ 2WJVA 4AMGA 4BZXA 3LOUA 5H1YA 1BE0A 1CUEA 3RAJA 1ICEA 1H2YA 1QPGA 1V6AA 2OCDA 4R3WA 3IO5A 3W06A 3WL5A 4BX9A 1Q2XA 2PR2A 1MV5A 4FGSA 4ZK6A 1YC2A 1M0WA 4CKXA 4KIUA 2C9ZA 2E4WA 4NCXA 2BMAA 2DFTA 4MW5A 1JS1X 3RTCA 2UZ1A 2WJYA 3HJCA 4JC5A 3G9TA 2IP2A 3NTOA 4ND1A 4QHSA 3JATA 1XEWY 2HSWA 3EZ6A 4FUQA 2YRXA 4NENB 3P0RA 4AZWA 4F38A 2HWUA 1BMFD 3BJMA 4EG7A 4YEDA 1VCHA 4GI3A 1VRCA 1GCAA 3EOBI 5AJUA 4ZRDA 5K0CA 5K0FA 1E6MA 3UPTA 2OO5A 3UJHA 5BOSA 4DLXA 2I6FA 2QDKA 1KMIY 3MT8A 4H7HA 4B6SA 3ZOZA 1UAGA 2XAUA 1P3Y1 2K2QB 1IJKA 1NOJA 1FMCA 2PSFA 2WM8A 4RKEA 1P2DA 4H27A 2NTNA 2BZGA 1BE6A 2JIZD 2H8KA 2ODBA 3PUKA 3A3YA 4NOMA 4ZT7A 3U3JA 5K3FB 3DMRA 3ZC3A 4C0XA 1C0KA 2HSGA 1U9IA 2EFYA 2FJ0A 4FZVA 1ST3A 1TIPA 1Y4UA 1DL5A 2C94A 1OIXA 1ZSVA 5B3LA 2C04A 1ZRNA 1SULA 2H07A 2MSNA 4UU8A 4V0NA 3UW1A 3FROA 2EFCB 3BXFA 5GJVC 3C3BA 4RZHA 1Z7EA 5ELLA 1DQRA 4WFIA 1ZMXA 2ECKA 1QSGA 2WD8A 4LHWA 5F21A 2AMYA 2A9QA 3COJA 2QL9A 1X0XA 4C0BA 2BKVA 1XC7A 4K9PA 4G01B 2ZS7A 2AVNA 3WLNA 4C4YA 4DIEA 1WXEA 2FUEA 3ZDXB 4AL4A 1OFTA 4MMXB 3LD9A 4EJSC 3EQ7A 1L7NA 4F6RA 5I9IA 1E4OA 1ETUA 4Y6GB 4IDAA 2G1JA 2ZYRA 5AI6A 1LF5A 1KJIA 4EY8A 1L5ZA 4MRVA 5HP4A 1JUDA 4WIAA 5EUQB 1SU7A 1DIBA 3IESA 3CF6R 3OF3A 3RBXA 3RRJA 3NVAA 3NZEA 4EPTA 2AG5A 2AQIA 1XQ1A 2FZ5A 4CODB 4FFLA 3PF9A 4ZYZA 2C29D 2A4KA 2R0QC 3W4IA 1X77A 4I36A 4WLUA 5K8JB 4RIFA 4WCFB 3K9NA 2ONZA 1RCTE 3VH4A 3AP2A 3ZXXA 3ZXIA 2RGAA 2IOHA 4A27A 3HN6A 4JJKA 3KVNA 1E9AA 4GLBA 2OV2A 3CUEF 5FCDA 2K5UA 3LCMA 2XOXA 3OJEA 4M9ZA 4AFNA 4BFVA 2E6UX 5JY1A 1ZNZA 3MELA 2NVUB 4PHFA 1NVMB 2ZFUA 5DNEA 4A92A 3K2BA 5AK3A 3C1AA 4PSCA 1G2OA 3AI7A 3EXEB 2D0OB 5IVPA 3WGHA 1WNFA 5HJ2A 1OZ0A 5IU6A 1W73A 3KYIB 5LSAA 5LP6F 1R8YA 3B70A 3O3CA 2EFHB 3ILVA 4PHGA 2JBAA 4GICA 2PVPA 2XODA 1JHOA 4MQUA 4NBNA 5EWLA 5HS6A 1NC3A 5CFOA 2GSWA 3LHSA 3A37A 2XDQA 1J0BA 2RHCA 2BY4A 2PAFA 2DE0X 2YYZA 3BE5A 3G8AA 5ALSA 5C8VA 4BL5A 2QAGC 3W90A 4O3FA 2PPLA 5T41A 2QG9A 1G6OA 1N4AA 5FL3A 1OAAA 4FFBA 1KE2A 3N2IA 4FU0A 4KJZA 4KPUA 1EJ2A 3LQYA 4UVDA 3ZQUA 1SPBS 4ZYXA 1QZTA 3PC6A 4D46A 4UOEA 1SVWA 3EFBA 1D3AA 4HDCA 4M8LA 4XGQA 2ZT8A 5BVGB 4ENTA 5CBPB 3FPEA 1YI8A 5ED4A 2PUJA 2XWSA 1F2UA 1RPTA 1KNXA 2IIQA 2JASA 4MGYR 1CQPA 4UNPA 2O3QA 4UBOA 2GJ9A 4Z9YA 1EFDN 1V6CA 5EZYB 1K89A 2VXBA 4P93A 1E3IA 3BDAA 3VC7A 5EG5A 2JJQA 2WHQA 4XARA 1J8MF 3TTTA 3DMYA 2V4MA 2ODTX 3IJRA 1CHNA 1E7YA 2GF0A 4BVAA 4EKYA 1V9SA 4RACA 4GL4A 3L7JA 4EELA 1M2HA 2B5WA 5H02A 4DXHA 1M2OB 1PK8A 4H0CA 3WNDA 1XSEA 1P9NA 5IDWA 3OLYA 3HM9A 5EJ9A 2N75A 5TARA 3VISA 4ARIA 2OQ2A 3M8KA 2YZGA 4KDRA 1XZJA 4B47A 1ZKDA 5K03A 2W83A 2C54A 4R6WA 4XDGA 4KCGA 4CM6A 1JFFB 4ZANA 4BJ1A 2GYYA 5ES3A 3VU8A 1E1CA 1JJBA 2XJ4A 3QKIA 3UMSA 5HR5A 4GI5A 2M6LA 1SQ0A 2FRVA 2PMFA 3OHMA 3EDQA 1ZUNB 1PT6A 1VPDA 1LZKA 2VT6A 4TMXA 5FL7D 2ZTUA 5E1MA 1KDOA 2BR5A 3WGVA 4TKVA 7REQA 2IOQA 3KSUA 4I14A 3NW9A 3KO8A 3VJLA 1GADO 2B20A 4IQ0A 4HAWA 2GNAA 1NX9A 2JDIA 2WVGA 4MR9B 3WGGA 4DMLA 3INRA 5CX1A 2VJOA 1C4KA 1PU2A 2BHLA 3CYFA 1DX4A 2XWPA 3V1KA 5BPHA 5ITVA 3DM5A 4GPEA 5K05A 3FCSB 1JEAA 5KQLA 5KYYB 1W52X 1WTAA 2O2IA 2X3YA 1YOBA 3GLUA 1PWYE 4FFRA 4TKZA 4XGIA 4EG5A 2D13A 1LDYA 3DH0A 1OXVA 4CIXA 2IYTA 1RM5A 1Z5PA 1GTMA 2XMZA 3GBVA 4JZKA 4CIDA 3FCXA 1B15A 3CF0A 4CLRB 1WLYA 4KVFA 4QOSA 5G1OA 2JGDB 4DABA 3PWZA 4QOJA 1OXUA 1NX6A 1UT6A 4LVOA 3EA4A 4D9MA 4QPJC 1C80A 4MAMA 1VL0A 3BL6A 5EXSA 3EXHA 5LR6A 5ILGA 4DA0A 5AVQA 4J94A 1ECLA 2RIPA 421PA 3QLVC 2WMYA 1QFSA 2ZE6A 1LBHA 1ZSYA 2VYVD 1XZAA 1X42A 4F91B 3CRRA 2GOYA 5DTJA 1WZEA 1P5ZB 1ZG3A 3N6XA 2ZTVA 2AFIE 4XKJA 3WNQA 1V9LA 1WIWA 4ZHSA 5F2NA 5JYDA 5LD2B 1OU4A 1EIWA 1OH8A 4E09A 1DC7A 2GB4A 3SE7A 4IIYA 4DRXB 5C8DA 1WXWA 5ALHA 3LFUA 1QRSA 5EIHA 3TBKA 4WGGA 1GM5A 1FUYB 1G16A 3FYHA 2D1SA 4V0LA 1NI4A 1KVSA 5AXBA 2DWUA 2RHOA 1Z25A 4V0SA 5LA6A 5EJ6A 1YRYE 1JMKC 2OOKA 2OZEA 5F3WB 2QXUA 2HJWA 3KEFA 5K9ZA 1MC8A 1G8FA 2H2FA 3L05A 1UPFA 3B3JA 2X40A 1ZGBA 4Y2PA 3PGXA 1RYFA 3INGA 3MFYA 4HZIA 4XM0A 3THOA 3D4IA 1Z4LA 3EXIA 3IUBA 3K0HA 3OSZA 1CY7A 2QPAA 4QXRA 5EWJB 4J2HA 4KB5A 5JANA 3SWWA 3BJRA 5FWDA 2JLBA 2JGLA 2QRGA 1RKXA 3F5DA 1FVFA 1T4DA 3AVVA 4OLFA 3FPLA 4I55F 3PEVA 4B2IA 3DWIA 1NMSA 2BEVB 3GRAA 2EV9A 1SZJG 2HADA 3GNTA 3INNA 1CUYA 4ZTBA 3THXB 1YS1X 3EXHB 3M9WA 4JR0A 1NBEA 2NO0A 4OM8A 2JD1A 3JYQA 4MS1B 5I7VA 2NM0A 1SCDA 4QUKA 3IEPA 4P0TA 1W76A 3K7EA 1W25A 3LT4A 1JKMA 3QVKA 2WY2D 4FEGA 4MQMA 7AT1A 3Q9SA 3GLFE 4RK1A 3R9WA 3SX2A 3C70A 1NDUA 5C7IO 2H4HA 1RYBA 1KIAA 4NCJA 1DV2A 1LNZA 3AF1A 4JHXA 2O8DB 2AN3A 4P5EA 1NBAA 1H8HA 4KXWA 1PZFA 2C3PA 3VPFA 3AILA 1YCGA 3FTPA 1UBCA 4XD7A 1JLRA 4M1KA 2OXIA 3ZQKA 3H86A 3HN2A 5D5QA 2GZ1A 1F20A 3NC0C 3NYIA 1NZJA 4B3HA 1JZTA 4JX9A 1V5IA 4RPKA 3C8DA 2CXNA 2O3TA 3OQHA 3R3HA 3GRZA 3I58A 5H3LA 3KHUA 1T2NA 3WKAA 4E2XA 1G21A 4ZI7B 1RLMA 3MYYA 4JB3A 2PU7A 1NJ8A 3U48A 1ZGJA 3HH8A 4DG5A 5JY6A 121PA 4AZ3A 3WICA 4ESEA 2IE8A 3BCRA 2Z9CA 4W82A 5F77A 5H83A 4B80A 1DBIA 2D2XA 3SR0A 1LPMA 3E3AA 3FHLA 1C1XB 1RU3A 2NXCA 4FNOA 4MUXA 4PZUA 2EJVA 4C6TB 1F4PA 3PQ5A 5IAEA 3VC3A 3ZHSA 1MIHA 4DNPA 4YQFA 3BHMA 4DIKA 5K2OA 1JU4A 3DQPA 4BASA 3R1IA 4QYIA 5T6MA 4B2PA 4XVUA 3ENZA 3DV0B 2PUDA 4OBBA 4RHYA 1RIFA 2GD2A 1PIWA 1Z6TA 4PQYA 3NAMA 4XB2A 1CZUA 1JSXA 2KHZA 4H3SA 1MENA 1WWKA 1G5HA 3EXIB 4ZVNA 2ZRLA 1XJCA 4HUJA 4Y6PA 3LT5A 1K6MA 3L06A 3QBJA 3H8VA 3ZJYA 1GCUA 4UUPA 4BIMA 1COWD 1S1MA 2WLTA 3AQ4A 4BVHA 1KEKA 5F98A 4JGGA 1ZRMA 4P6VF 3DB2A 4D9BA 3X3HA 5H4GA 1IY9A 3D3JA 1XVLA 4DLZA 4PZLA 1C7FA 3UMYA 1E4EA 1S2OA 2R7NA 3NOVA 1T0BA 2C92A 4MEAA 5E0OA 4J2OA 2HL6A 4UASA 1Q0QA 3F71A 1YB5A 3QFFA 5G4KB 3KJNA 1ADJA 2ACKA 3BRCA 2LD4A 1NJFA 3DZHA 1ZH4A 1M3SA 1ZJYA 2GWRA 1DI0A 3JPWA 3ND9A 1G3QA 1IEXA 3PHIA 4G25A 4MR7A 1VJGA 3I39X 4LG1A 4NQRA 2YOFA 1PFKA 5EIAA 4GG1A 4CMIB 5JC8A 4CEJA 2Q9CA 2PGDA 2O5EA 1W2WB 5CJ2A 3N76A 5FUMA 1CJMA 3GMDA 2GAOA 2GZ3A 3LX8A 4FT2A 2RHJA 1OXXK 3L46A 3PFCA 1HYBA 4MNTA 1QHYA 3N8NA 3H5RA 3IKVA 3WRXC 4MWCA 4AUEA 4N54A 4B9AA 1Q1NA 1POWA 3B6EA 4NTZA 4G97A 4I9NA 3VR5D 4JL6A 3GFFA 1GCOA 4MKHA 3GP5A 1WD5A 4F92B 3DE5X 3HBLA 1KAOA 2IDJA 4PZEA 3MAJA 3UK1A 2F8MA 3WL7A 1FPQA 4NOJA 4E32A 5K45A 2RCNA 1LTQA 1XVTA 3EVCA 4PLVA 4YXWA 5JAPA 3L9WA 3EC7A 4CF4A 5MN5A 2UKDA 2ILTA 1R8SA 1QIKA 4OXNA 3THWB 3ELDA 5KU1A 2B98A 4B45A 5LQUA 1V3UA 1TOAA 1P81A 4PXSA 4KUGA 2FB9A 2Q0XA 3UC9A 4PLFA 1JZQA 1SCUB 1SG0A 3FLBA 4UW9A 3WWDA 4Z99A 3FF1A 3K1TA 3VX4A 1QR6A 3QYPA 2Y9PB 4UBLA 4YRNA 2OSBA 3VJRA 3CEPB 3MTQA 1QCDA 4M36A 2QBYA 2DH5A 1YE8A 4CCYB 3FPCA 3H7AA 3HO1A 3DHEA 4JELA 2AA3A 3F2IA 4JBHA 4FJ1A 3V1TC 1E63A 3WLQA 1QYCA 2WHYA 2F2TA 2XEXA 2Q4TA 1Z07A 3IAHA 5KTKA 1S8OA 3MWEB 4TTVA 1XKLA 1Z83A 1JDVA 2OT3B 1Y1RA 4MYHA 4E03A 1AZWA 3DOIA 1KEWA 1LLQA 2G4LA 3GF4A 3SEQA 4M53A 3M6AA 4FUTA 4NP6A 1CDZA 3N0VA 1E0AA 3C3JA 3ADCA 2LTAA 3FTCA 4F3KA 4UTRA 2MSLA 2NNWB 3E5MA 1EUCB 3FCUB 1XD2A 3VR6H 1MJNA 2QM8A 3FOAA 3QFSA 7MHTA 5DX1A 1FSPA 2M1ZA 1L7BA 1OLUA 2OECA 3L6BA 3OIGA 1Z17A 3TLAA 3ML1A 8ABPA 3GRKA 1KHTA 2I6SA 4UZSA 5J5AA 5DN6D 3STYA 3K9HA 1JVNA 1MA0A 2EJWA 2FK8A 3I5MA 2OCGA 5EQJB 3U5TA 5H3CA 1O0SA 5SY6A 3KLOA 3A1EA 1TM4E 3OIVA 5KNCA 1K97A 2DCMA 4O8ZA 1R2QA 3PFKA 2OAEA 4NYJQ 4KQ2A 1UIRA 3IKTA 4I4NA 2F64A 1T8PA 2B0CA 3W2IA 3FHTA 3S5JA 4NU6A 4CHGA 5IZCA 4C0SA 3GR6A 3NMUF 1KY2A 3VPBA 1G5QA 2OG2A 3PLNA 1XRJA 1CRLA 2PRZA 1R0XA 3CZCA 3IVXA 1QVVA 4QEDA 4ZA2A 3RU9A 1K1EA 5G0WA 1UPTA 1PJ2A 4KQCA 3W5CA 2DPYA 2CLCX 3LC0A 1OH6A 1I32A 1JHYA 1BSVA 4OQMA 1C9DB 4IKPA 2JBAB 1P0QA 2W2KA 5EWLB 1BEZA 2BFBA 1Q7EA 5A1JA 2D3WA 2O5CA 1NSYA 1RI5A 3M4ZA 3HBAA 4FYKA 4IVNA 4NBUA 5EGNA 4KX5A 4ZRNA 3FOCA 5EESA 4XDHA 5JFGA 1JEYB 3QFCA 5CA0F 2J6IA 5JMOA 3WKCA 1Z22A 1OLOA 4RIIA 2GSDA 1A69A 1ZM7A 1G8KA 3WJ2A 1RHKA 4YC7A 2XF2A 2AT1A 3AI2A 3U9SA 3LY7A 3TEMA 4KAAA 3GFTA 3P9QA 1LF0A 2ZUTA 4BV9A 1YA6A 3GRRA 1OBOA 1VJDA 3GJSA 3GJTA 5I5GA 1DAGA 4KI0A 1OX4A 2O8BA 1IN8A 1KKUA 2C99A 1XZKA 4PANA 1CY6A 1WCIB 1XL1A 3BBLA 2QRNA 3PGKA 1XRQA 4IJQA 5A4FS 4UTVA 5AH0A 4JCCA 3BC1A 5FBLB 1L5KA 4REQB 4XPZA 3CLTD 3NT4A 2F48A 3OY7A 4GP7A 4M0LA 1SOUA 4EYQA 3OQ6A 4RVDA 5FNVF 2BFBB 1XRLA 1HTTA 3LVRE 4LF4B 3PI6A 1F9AA 4AZ0A 3BGSA 3CUKA 2WM9B 1UZAA 1ZI8A 3IUEA 2FUCA 2RDMA 1ZGCA 3JSAA 3FNFA 4YGXB 5LYJB 1NU8A 4TROA 3PNYA 3DOFA 3PDHA 2BGLA 2UDPA 1KQFA 5BNWA 4F0JA 4MUIA 3TOCA 4KXVA 2B0JA 5LDHA 5KHOC 2D06A 1DOAA 4OHKA 4RA6A 5IK2D 3UXYA 1QK5A 1YRWA 1HE5A 4BKRA 3WISA 4YJGB 1XB2A 5AM5A 1HR0B 3T3OA 3FMGA 3PFFA 3VGPA 2RGWA 1CF4A 1HDCA 1RQLA 2WJWA 3KPWA 2VNKA 1KU6A 4P7KA 5CW1A 2NXWA 2O8NA 1T9AA 4R68A 4FT4A 3ZWWA 5HKOA 4C03A 3IAFA 1NF9A 2RMKA 1LU9A 4FK8A 3Q2OA 5HOEA 1M2VA 4HS4A 2B8JA 4W1QA 5JCOA 1C30B 3N2GB 5DMXA 4YIKA 3K1JA 1VG8A 1QGAA 4M1SA 5EPUA 3TK1A 2A59A 4FW9A 4IGAA 2PA0A 4W9NC 1TW2A 1KQ3A 4NCBA 3IBGA 1YA4A 2FW9A 4P34A 4B74A 4F96A 4KH0A 4F86A 5F4ZA 4URXR 1JLMA 2XCIA 3UJ8A 3WB9A 4B2LA 2IYLD 3OQMA 4K81B 1UODA 1KO5A 2AW3A 1ND5A 5B1IA 2A14A 2FGKA 4ZT5A 4DC9A 3I01A 3WMEA 3IT2A 4IEIA 3DWFA 4REMA 5ARBA 1QMGA 1WZIA 1JLKA 1AGYA 3H2HA 3NHFA 3OETA 4JT2A 4OKSA 3PIDA 2P3LA 3CCCA 4KQGA 4Z1MA 5EE1A 4DDVA 2CVHA 4Q4HA 5AKKA 5F7OA 5EEHA 1NLMA 1DBSA 4FIDA 4E1VA 2FHSA 2Z0MA 2I6TA 4GX2A 3NKLA 1BQEA 2DUWA 4RD3A 1PL6A 3ZK9A 1ZZGA 3CVUA 3CLSC 1GUFA 3RBAA 5EWMA 3IA2A 3LXXA 1Y33E 2FQYA 3UTDA 1KMCA 2RGNA 4AWXA 3RJZA 1A76A 3UHOA 1N5IA 4W1RA 1ZH0A 4RNDB 3BE4A 1JR3A 2CGEA 2FEOA 3OA0A 1BN6A 3GFQA 4K2AA 4NBRA 1Q92A 4RD4A 5K20A 1TA0A 2VXCA 5IDVA 4GGMX 4MIEA 2H29A 2PSJA 1QO7A 1II0A 1YVRA 4WKBA 4FBGA 3EZNA 3OEHA 4LUCA 3ZVKA 3W05A 2HH9A 3AB3A 3OT1A 3WGOA 2NXJA 3RODA 2AHRA 2XH8A 1EHIA 2ZBPA 1PGPA 4ZQBA 3UWMA 1YR1A 2W22A 3KZXA 4AURA 3RLIA 2VBIA 4RORA 4CF6A 3D5EA 4AY2A 1QHXA 4XJXA 2G67A 3TSYA 1ABBA 3KR2A 5A02A 1GZHB 1GGFA 5BY2A 1U0BB 3T52A 2HIHA 4HQLA 3QVUA 3R5XA 2YOGA 1UBSB 3U0BA 1FK8A 1R1DA 2VBCA 3PHHA 1GAJA 3LLMA 1G20E 4FEAA 2LVBA 4CM8A 1A5TA 4Y1RA 3BMQA 4AS2A 1B3RA 1T0UA 4FTWA 3H1AA 3AHHA 4XCQA 4P7GA 1K27A 5BSGA 4Q1CA 1VL1A 2IQ5A 5L3SB 1Y5IA 2I1WA 3DAOA 3VNVA 1WNTA 4D8XA 3FPKA 1OJLA 5B7PA 1NZFA 4TVSA 3A1SA 4ZCIA 2ESRA 4N5NA 5K4HA 1VRWA 3Q8MA 3QVGB 1B16A 4AP9A 1TTQB 1H6DA 3G2HA 5JZSA 5HUQA 3CUSA 4KVZA 4FYHA 1J00A 1SJ9A 1GPWB 5E7IA 1ESZA 2GZ2A 2JI7A 5P8WA 1OWOA 5EXDA 3JAKA 3O9ZA 4J0IA 1PGOA 4MKFA 2QUIA 1C1XA 3QVOA 2BTEA 4LXTA 3CEAA 1IN6A 1G63A 1TAGA 4Y98A 1H4SA 3KOOA 4R40A 5EVCA 3T3MB 1MA3A 2PPVA 2AW5A 3AKCA 2NW6A 3OOYA 4H6VA 5BYAA 3P2JA 1A9XB 5CVCA 3IPCA 1F2DA 3OIWA 3BB1A 3G0BA 1DTSA 1GPNA 3D5TA 4JQYA 1QKJA 4L78A 2P2LA 4PX3A 1KFEB 1TM5E 5AM2A 1ZA2A 2CFTA 1HKUA 3RYIB 1FX1A 4Z3DA 2JFQA 3PZRA 3ND8A 2FEXA 1L4UA 3TQCA 3T3NA 1BMQA 5IASA 2WM2A 3QTTA 4M98A 5AXCA 2BMFA 2FWJA 2J5RA 4YY3B 1VB3A 3NU1A 4Q21A 4Y2RA 1KZGB 1AQUA 1RM0A 4JP1A 4CDGA 5DYTA 5WRFA 2XCQA 4IDFA 1MAAA 3QF7A 3DS8A 4IIEA 1U2GA 4PSDA 1KZYC 3PD7A 5E8JA 2QZ4A 3H16A 4FKBA 2QVLA 4QOFA 2I3DA 1G5PA 3WOHA 4K8OA 4DA4A 3RT1A 2PWYA 1A3CA 1LW7A 4M8KA 3QGMA 4ZVMA 4CIWA 2QMYA 2Z83A 1N6PA 3CGGA 1RAFA 4OP2A 1XV5A 3MSCA 4UNNA 2XQJA 1H93A 4OI0A 4MUGA 2IUUA 2G1AA 1GNPA 4QUDA 1T5TA 2CMGA 2ZT5A 3LX6A 4IX1A 3OKAA 5GJCA 2AF3C 3RFTA 4CMEA 2R7LA 4AS3A 1U7WA 1QOPB 3UJDA 5A4MS 3NQ41 3RTEA 3TXXA 1Z5ZA 2OQRA 1JYSA 4R2LA 4OB6A 5FFMA 2AZMA 3CMMA 3IQWA 3SSOA 3CRW1 1SUSA 2IXDA 2QDXA 5FTKA 4ZCTA 3NHUA 5JSZB 1FMLA 3N6RA 3TWOA 4A91A 4FFWA 3SF8A 5B2EA 3FTFA 1YMVA 2H1FA 3LUDA 2QG4A 4MQ4A 3UAVA 4DC0A 3Q8XB 1OB5A 1TAQA 5JLJA 3WWEA 3VNUA 1GZVA 5CJPA 4JIGA 4GOMD 3I8XA 2OLKA 4NZNA 2YIDA 5TMBA 1R3UA 1N2ZA 4FYIA 4LK3A 2X15A 3I92A 1YL6A 2QSYA 3F1LA 2CHGA 1U7DA 4AG6A 1PGJA 4A0QA 1THTA 5M04A 3PRKE 1SXGA 3E3NA 4IQFA 5KREA 5DNYB 1N6RA 3KXIA 2XQVA 4TKMA 3T4PA 5HJ7A 1FW8A 3K32A 3KKNA 4M3NA 4UTOA 3E2PA 1OVGA 1BCSB 1PE0A 1ZVQA 2EF1A 2NU6A 2RGYA 4U2EA 5CPFA 3THSA 3ZH9B 3LI2A 2E4ZA 1IZYA 3HFRA 3TTWA 3W5SA 2DERA 1OPRA 3A06A 2IGTA 3GPIA 1XRMA 3IJEB 1I3MA 1U3FA 3UH1A 2H11A 4NH4A 3HGTA 4NMLA 1JLLA 1LJLA 1P0FA 1U0NA 2O3JA 2G0AA 1DE0A 2MTBA 2X5NA 2FW6A 1ZICA 2ZUCA 3DDSA 3HPRA 2BT4A 3EXFA 2H1WA 3H3FA 4Z0HO 5B1YA 1Y7LA 5JNWA 4MO2A 5IM4A 4HEQA 1U2PA 1VIYA 4KQ9A 4CCYA 4F4DA 5KYNA 1VZ2A 2WPDA 3OT4A 2FFBA 1GKLA 5DGDA 2KYRA 2R6GA 3E9CA 1RC0A 2PLWA 3NIDB 3KE8A 3P9YA 1NPTO 5G0UA 1UC4B 4PW0A 1ZPDA 1Y3AA 3VU3A 1XEXA 1HYGA 4JT8A 4MS1A 1SXPA 4BFZA 1DAKA 4PZCA 1Y3DE 5AXDA 5BN4B 3T15A 1O8BA 2AI1A 4HN4B 1CDDA 1X8JA 5EQTA 4LFCB 4EY4A 3R24A 4NE7A 5AVWA 2LCIA 4J7CA 2C98A 1FTNA 2ZRNA 3JV7A 4AP5A 1C4WA 1OE0A 1FXUA 4UEWA 5JTTA 1P31A 1XTJA 4DYVA 4N12A 4P8RA 3BGWA 4QBTA 3H04A 4CLEA 3L79A 3SQOA 2YV5A