4JT4A

Structure of clostridium thermocellum polynucleotide kinase bound to datp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
molecule keywords Metallophosphoesterase
total genus 63
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jt4A00
3P4YA 1GKUB 1Q0UA 1Z6YA 3HYRA 2V7QA 2ZYWX 1ZCAA 4Q9HA 5AUOB 1EXMA 1LS1A 5CLLA 4O25A 2C03A 4KO8A 4LUCA 5EJEA 1BMFA 3ZD6A 2OILA 3LRPA 1DAIA 3MWYW 5KSPA 4ITRC 4FMCF 3EIEA 4HAWA 2XZPA 4C0SA 4EUNA 1TNDA 2BV3A 4Q19A 3VMFA 4GT1A 1A5TA 4OL0A 4URZR 5FUVA 3EXAA 2XNSA 3RC3A 2LKCA 1U9IC 2GCNA 1Q3HA 1A4RA 3ZLJA 4Q1AA 1YQTA 4HZUA 3AVPA 4MKFA 2AX4A 1OT3A 3P20A 2F9LA 4KBGA 5HE9A 2ZREA 2V4ZA 2VSOA 1P75A 3FGNA 4UXJA 1YZGA 1II8A 1ZNYA 3KFVA 4LV5B 3CNNA 4KCGA 1BYUA 3L8ZA 3RS2A 2QENA 2WKQA 3BWDD 2PH1A 3AP2A 1GUAA 5FR2A 2BIFA 2VYFA 3ICQB 1HV8A 1QHXA 1JXOA 2WPDD 2OCBA 1ZNWA 3IBGA 1OH5A 1X8JA 2XAUA 3U3MA 1N0WA 1QDEA 1Z83A 3ZDQA 4HUTA 1TUIA 4HB0A 3O8RA 1R0XA 5GJCA 5EE9A 2HV8A 5AJVB 4D4LA 1AIPA 3Q7QA 4JT4A 3VR2A 1LF0A 4D25A 5GVSA 1BMFD 2QTHA 2ZRMA 1ZIOA 1VCIA 3TAUA 2XJ9A 1Q3TA 3TVTA 4V0NA 1CP2A 4DBLC 2RGCA 2ATXA 3K9LA 3GJ4A 5GJBA 3I73A 1RJ9A 3N5CA 4DSTA 3OE7A 4HAUA 1ZM3A 1HE8B 4TMTA 3U6KA 4LJ9A 1OXVA 1VHLA 4TQ9A 1NVUQ 4LHXA 2OT3B 1GP2A 4RD2A 2EQBA 5JECA 2GCOB 3AKCA 3CKLA 2FGJA 1XJQA 3M4YA 3VR5A 1Z06A 3H0KA 5EP4A 4DCNA 2F43A 2WV9A 1TQDA 1JJVA 5L3QB 2EFHB 2DY1A 2ORIA 2IYTA 2JIZA 1NJGA 3AKYA 3Q8XB 4KODA 4RD0A 4TL9A 2EFGA 2WPDA 5AK0A 2CLDX 4IOLA 2BOVA 2ZAOA 4WVFA 4MYHA 4OHWA 5BWMA 1XU4A 1KO4A 2PEYA 2VLIA 2A5YB 1OIWA 2CE2X 3EZ9A 1GKYA 4PO8A 2PJRA 1BH2A 2ZU0C 4C0HA 5CIWA 1F60A 4B71A 3DKPA 3H2YA 1RYFA 1QHHA 4DLXA 4V02A 4QBIA 1N6RA 2MSEB 4B3GA 3WNBA 2Z5FA 1NG1A 3LXRA 2I4IA 2CLCX 3ZZTA 2HYIC 1NLFA 3LXXA 4PHTA 3ZD7A 5DN6A 2ZJYA 5L3QA 3ASYA 3QNUA 3GLHA 3OE7D 2G3YA 5IDVA 4AK9A 1AQYA 3IIKA 3AF0A 3BAFA 4TSFD 3B60A 3VFDA 4JLAA 4M1TA 3TBKA 4LJ7A 1MO6A 4M21A 3AKDA 2GJKA 3DO6A 1KDPA 1QHGA 1LB1B 2GHIA 5AJYA 1OFIA 5LB4A 2JLWA 1T4GA 4PHHA 2DFLA 1Q44A 3CH5A 4DDVA 1W36D 3AKEA 5FUXA 3KTAA 4R2HA 2R44A 2BJVA 3PUXA 3U3KA 4GDFA 3L0SA 2ODBA 2GILA 2QE7D 1PLJA 2ZIAA 1G7SA 1MV5A 1RRFA 2W2XA 2ZRIA 3MUFA 1GM5A 1SULA 3QEOA 1U0HC 2G1KA 1YVDA 4Q21A 2IS4A 4B3BA 1VIYA 1JEDA 2WBLC 4DEXA 3NDBB 4LGMA 1W4RA 5FL3A 1DADA 2W6ID 3KJHA 4LPSA 5FUWA 1U9IA 4LY6A 1KNXA 1W0KD 1NIPA 4CVNA 3TIFA 5DSZA 2ZE5A 2P5SA 3D8BA 5G41A 1E9CA 3K0AA 1KO7A 2NO1A 4DHEA 121PA 1W44A 5KPDA 1JQJC 3O8DA 4PC1A 4AKHA 2XJ4A 4KAXA 4LBWA 3GPLA 2FX3A 4QFMA 1ZIPA 3WNCA 3EPLA 1IBRA 4I1SA 3BJIC 1S3SA 2HEIA 1KI6B 1GAJA 4C2TA 1NY5A 4R98A 5BQ5A 1IN6A 1UAAA 3LX5A 1UBEA 1DAMA 2C98A 4Q4HB 3C5HA 1ZC3A 2A5JA 2QZ4A 3HP1A 1KOFA 2RHMA 2X2FA 4IVPA 3G5UA 4B74A 5HKKD 1IXSB 1XEXA 3LBIA 1NNEA 1ZBDA 4OYHA 1S8FA 5SZJA 2EYQA 3X1YA 1HT2E 2FZLA 2QE7A 4BRWA 2C95A 3WP1B 2CCJA 2GXAA 3VHXA 4OQMA 4Y0AA 5EZ5A 3M6AA 3VR4A 1M8PA 4Q66C 4KSCA 5JHGB 2UKDA 3C14C 4H1VA 2Q3MA 3UATA 3NG1A 1P73A 1NKTA 4G5GA 4DLZA 4E07A 1JQLB 1GFIA 1RE0A 4A82A 2F7SA 3GEHA 4JIMA 1DAGA 1QHNA 2KI5A 2BDTA 1HA3A 3QKRA 4G01B 5LDDC 4NH0A 4OHVA 4OQNA 3TJZA 1VYUA 5HZHA 2OSBA 2CHVA 2CVHA 3EG5A 3SJCA 4XTRA 4YMUA 1E2JA 4D4MA 4ASUD 2ZRBA 4RZ3A 4Q5IA 1AS2A 1CJMA 1OXTA 2YWFA 4TYYA 1MKYA 4A0HA 5TVKA 4X8OA 4OHXA 3CZPA 3ZVNA 1XJ0A 1G3RA 1Z8FA 2NZJA 2ZITA 3HDTA 5AWFC 4DLTA 1U81A 3SQWA 2GBLA 4U02A 1YZLA 1FL9A 4QHYA 2R6GA 4D6PA 5FUYA 4LYJA 4PANA 1N6HA 2H5EA 2PZGA 1WDTA 4HDQB 4MDEA 1GNPA 2ZEJA 1G5RA 3Q85A 3KKPA 4RD4A 2F3RA 4MYTA 4PHGA 1XXHE 2C04A 4OJQA 3LFUA 5FBRB 3VKGA 3OESA 2XEXA 2RGNA 2H57A 1CJUC 2WSSA 2LWIA 3FKQA 3QE0A 4QNRA 2GJAA 4KU4A 3VR6A 3Q72A 5DISB 1ZCBA 1IN7A 1A82A 5FBLB 1W48A 1VPLA 2KE5A 1RRCA 4PZYA 1YZNA 2RHDA 4M1WA 4H1UA 2ATVA 3CRMA 5DLQC 3R8CA 4DT1A 2KBFA 5GJWC 1E1RA 1KI6A 2G0TA 3GFTA 5J4YA 3PENA 2Z4SA 4L9SA 1Q1EA 2ZI5A 2PX3A 2HJGA 2AXPA 4JJZA 3T1VA 1QF9A 1XWIA 2QMUA 3IUYA 1KYIA 1QHHB 4KITB 3VNVA 4GNKA 2Z6VA 4TZ0A 1A1VA 4XJXA 2CCGA 1W46A 1UADA 4IHQA 2NPFA 2NTYC 1E2MA 1WBBA 1FFHA 3K09C 5C46F 3ZZUA 1I2MA 1UM8A 2BEKA 2BCGY 2AL7A 5HPYB 2V1XA 3L43A 3SYNA 2BC9A 4A8JC 4D26A 4OQXA 2ZI6A 5CIQA 1U8ZA 4XSHA 2O8CA 3T5DA 3I3SR 1KKLA 2EWVA 4OQFA 4FINA 2VHUA 2ZRJA 3BRWD 4HUQA 3GP8A 4Q7LA 3BBPA 4NP6A 2I1QA 2JIZD 3H1TA 3IEVA 3E2IA 4BLTA 1NSFA 3K0CC 3QG1A 2YHSA 1D9XA 5D3MA 2BKUA 5AUNB 1WBDA 4ZKEA 1O3YA 3QXJA 1SHKA 2ZYVX 3CWZA 4Q4JB 2CK3A 2O8EA 4IJMA 1CULC 1W1WA 1JXMA 3FHCB 3DL0A 4HAVA 2VRWA 4B6FA 4RKFA 4CW7A 1A2KC 4QC2A 3NXSA 4QGGA 4HSEA 2CDNA 1G5PA 1UBFA 2WJJA 2XSZD 3I8XA 5FBWB 721PA 4HUQB 4GOJA 4WW0A 1WQ1R 4F93B 4CEIA 1U8YA 2N1BA 4OK3A 4FCWA 4OHZA 5JHHB 3ZQ6A 3QF7A 3ND9A 4JZKA 1IAQA 3TUZC 1ONBA 4UJ3A 3DZ8A 2QNRA 4WA7A 2WICA 2YKGA 1OHHD 1NIJA 2C9OA 3EAQA 4Q4JA 3X1WA 2GCPA 1YE8A 2FH5B 5HR5A 1ZU5A 3GFOA 421PA 4ZCMA 4BLQA 1DAHA 4L15A 5JWOA 1E6CA 4M1YA 2IL1A 4O0MA 5DE3A 2MMGA 1TEVA 5SZKB 1E0SA 1SVIA 1M2OB 1GSIA 5F2EA 3LDAA 3K1JA 3CRQA 3SU8A 3EA0A 1IHUA 1N5JA 2XITA 6Q21A 2VP9A 1Z6XA 2VEDA 4Q9LA 2GK7A 2FEMA 4PHFA 5KPJA 3KQNA 1N3BA 2HCBA 4JLNA 2QUZA 4I4LA 4KJZA 2C5LA 1E4VA 4I1OA 1XEXB 1KI9A 4V0ME 4HLUC 1FPMA 2QP9X 2XB2A 2ZVPX 5IF9A 3THWB 4N0EA 1AS3A 1T6NA 3GLGB 2GBLC 4P33A 1ZJ6A 4PX9A 4PC6A 1W0KA 3I1FA 1CR2A 2ZJBA 2GJSA 2WWIA 4XVUA 3AVTA 1JECA 1G3MA 1U8AA 1GL7A 5JWHA 3WNDA 1MO5A 3OEHA 5P21A 3DKVA 4JBXA 1YZTA 4DUGA 3VX3A 4G5QA 3OIYA 1GZSA 3AVVA 3AVOA 5BW8A 3C7KA 2V3CC 1OHHA 1R5NA 1DO0A 1WRBA 3EIHA 1RW4A 1ESMA 2ZRNA 2O8DA 3CRVA 3CRRA 4HAYA 4Q9KA 2CE7A 4JLJA 1EFHA 1T0HB 3VAAA 4II7A 4TMVA 1DG3A 1UBCA 4TZ6A 4EJSA 3L0PA 3LVRE 1RVDA 2GK6A 1SQ5A 3A1UA 4M9QA 3FB4A 2FDCA 2FZ4A 2HJVA 3RVBA 3ZH9B 4LJ8A 5K8IA 3CRW1 4BFUA 1NLYA 3QI2A 5LD2C 3THXA 1Z0FA 4N0DA 1LFDB 2YOHA 4V0MA 1UKZA 2FF7A 2PMKA 4EQ6A 1A2BA 2OXRA 3PCRB 5IK2A 1XMSA 3K9NA 3BH7A 3WYFA 4ABYA 5JJIA 4TMZA 3CBQA 5JS7A 2ZRPA 3LY5A 4IDPA 2QRZA 2PZEA 1E2PA 1G6HA 1KK3A 1TUEA 5CYPA 1COWD 1UEJA 4RVCA 3SI7A 4DJTA 4WOPA 4QRHA 5GJVC 2IA5A 3P32A 3SHFA 2D3WA 2J0UB 1S96A 2JJ8A 4FN5A 4MITA 1JR3A 4AC9A 3LO5A 1PV4A 1LS6A 3IQXA 1S1CA 1ESNA 3MFYA 5B58C 3T15A 4ZCIA 4ZI2A 2O8FB 3QPUA 4N1AA 4UNNA 1T8TA 3LA6A 4M0LA 1YJ5A 1YR7A 5DI9A 5KNDA 2V9PA 3B78A 2VF7A 1DARA 1P4SA 4PZZA 5LB2A 2HUPA 3TW8B 3RANA 4E09A 1N6KA 3RRNA 1TADA 1W0JD 3RS3A 2W83A 3C5CA 1VYVA 2YC2C 4BZXA 4M4SA 1E99A 4BZPA 4TL6A 1RIFA 3RWMB 3U7GA 2WVJA 3ADKA 5SZIA 2R2AA 2HF9A 4G5RA 4QHSA 2AWOA 3THWA 3TVDA 1Z0IA 3MD0A 5HCNA 1D2EA 1WF3A 3AF3A 2DB3A 4MGZR 2JDIA 1XPUA 1US8A 4MDFA 4US1R 2AFHE 3A1TA 1HTWA 3SJAA 1KK2A 4FCVA 1R10A 2H16A 3W5JA 3NTUA 4B2PA 3E70C 3DPUA 3WRXC 1XZPA 2F55A 5BN5A 1P72A 2NO9A 1E2EA 1ETUA 2XTZA 1CJKC 4FCTA 3UANA 3WXMA 2BJWA 1CJVC 1W47A 1ZD9A 2OFWA 2J59A 3TUIC 1LF5A 2W2TA 4EJSB 3U4QB 2VA8A 3M1IA 3KKMA 5HE8A 1ZNXA 3THYA 3RHFA 1FNNA 1Z29A 5D3MB 5HCIA 4OKSA 5F3WB 4Q1FA 1F2UB 1ZRHA 3LV8A 1W36C 2QGZA 4GMDA 2PMDA 4C0LA 3ZZ0A 1IJFA 5DIFA 3AVUA 3HWSA 4I1UA 4TQUS 2RGGA 2VQSA 4IOMA 1E2HA 2J3EA 4Z8YA 1QVRA 5CDFA 2OXCA 3W6NA 1W4BA 1PLKA 2LCFA 2Z0MA 4D81A 4M1KA 3LVQE 3Q7PA 3CPEA 4EIWA 4OI2A 4OK5A 3EWAA 5CK4A 4C0JA 4ZKDA 2JLSA 3FMPB 3AUXA 2YZ2A 1F2UA 4C0BA 1KY2A 2ZRCA 4HDOB 1E1QA 5BN4A 2NO7A 2EU8A 3B6EA 3I92A 1BKDR 1MABA 2O52A 1UKEA 3K53A 4NCIA 2O8FA 3P27A 1RYHA 1DAEA 2RGBA 3CPHA 3MG9A 2W6JD 3N2EA 2ERXA 3D6TB 1CEEA 4DRZA 5FH9A 3TR5A 3WHKA 1IY2A 1GILA 4BFZA 1FZQA 1E9BA 4HLCA 3BIFA 3F8TA 4ACBA 2IK8A 4BFTA 4Q7KA 2UZ3A 2XNDD 1Z6TA 3UMFA 1Z07A 3T1OA 1G18A 4Q9IA 4EJSC 4UKDA 2FV8A 3CR8A 4BFYA 1S2MA 5AJZA 4F4CA 4URVR 5TARA 1HT1E 3A4NA 4NCNA 2ZI7A 3RNLA 1DE0A 2J45A 4MGYR 3NEYA 2QORA 3N70A 3VX4A 5FPTA 1TMKA 1WMSA 1XJCA 2JJ2A 4I99A 2DFKB 4MRRA 4NE2A 1NMXA 4YDHB 4TTPA 2OHFA 2IEZA 3QQ5A 2J7PA 5JEEA 1Y63A 1EWQA 3GLIE 2Q3FA 4JJKA 2G88A 3QBVA 3T5GA 1HQYE 2BMEA 4G5SA 2UZIR 1GDDA 1FMJA 1UJ2A 2GZHA 3S1AA 1MR3F 3IBYA 4POAA 4GZMA 2D74A 2ZRKA 3FFBA 3VQTA 5KDOA 2IWHA 4AI6A 4EPTA 4HB2A 2O8BB 1IJEA 2WJIA 4RZUA 3TRFA 4DLRA 1T3LA 2PLRA 2IWRA 1G4UR 3ETLA 5F9FA 1X86B 3CW2A 3WP0A 4B44A 2WMOB 1HE1C 4GFDA 4LBZA 1P6XA 4HI0E 3SZRA 1GNQA 4ZIRA 4CGZA 1TQ6A 3D3QA 4CT4B 4YDSA 1T5LA 1ZC4A 1ZAKA 3R9XA 4ZIRB 5H8WA 1OPXA 4HLQB 1E79A 1DOAA 3EA5A 2AKAB 1E3MA 1FMLA 3RS5A 4JBWA 1SHZA 3TSZA 4IDOA 3QKSA 4BLSA 1L7VC 2A3RA 4TLEA 2WJGA 4BLOA 2QQEA 2DR3A 4PTLA 4A0FA 4KFUA 3SYLA 1NBME 4K81B 3OEHD 2WIBA 4LX0A 1K8RA 4KXFB 2DPXA 4NPHA 1II0A 4GP7A 2IF2A 4B3DA 1JR3E 3FYHA 3O47A 4EPVA 2F9MA 3VR3A 1V43A 5FPSA 4B73A 1Q12A 3BB4A 2ZQ5A 4YMTA 2J0QA 1AZSC 2QMOA 2ZUDA 2GF0A 4GPTA 4P4UA 5ANRB 3TH5A 1JR6A 4FIDA 2JASA 2WHXA 3HYTA 3I32A 4LC1A 1BYIA 1G19A 3I62A 4AKIA 2OESA 2AWNA 5C2JB 3ZVRA 3NEJA 2ZSEA 4HATA 4R71A 1ZD1A 2PCLA 1E9RA 1OH7A 3U5ZB 3QIAA 5LD2B 1CIPA 2ZRAA 2OEPA 5E4FA 3PR1A 5FOVA 3GLFB 5G40A 1W2GA 1G3QA 1ZVQA 3GLGE 2ZM5A 1G8HA 1EFTA 2QA5A 4LJ5A 4QG7A 1P3JA 3MGCA 3AVXA 1ELOA 5JI2E 4OBEA 3RS7A 2J87A 4N3NA 1JR3D 3AH8A 2IYRA 3W3AA 1KZGB 3LH5A 3MJHA 2IYUA 4NTZA 4IVQA 3REFA 4B43A 2O0JA 5CM8B 4FMBB 1YZQA 2E1RA 1DTSA 3V4FA 4XVQA 4D80A 1GL6A 1M6NA 4KYIB 3X1ZA 4DIEA 2CL0X 5DO9A 1XD2B 1NF3A 2FFHA 4M9XA 3RRZA 1YRBA 2GJ9A 2AKYA 3K0AB 3KKOA 3ZYCA 2WIAA 1KK1A 1T8UA 1KI2A 2Z83A 3BFXA 4X8LA 2EFEB 5EXSA 4TYNA 1KZ7B 1GKIA 2FEOA 4O2LA 2V6JA 2YNMA 4IEIA 4C0AC 4UNRA 5L3SB 1G8FA 1N6PA 1MO4A 2D7DA 1HH4A 4EQ6B 5FBVB 2D2FA 2OO7A 2V54A 3QPVA 1G9XA 2QTFA 5J4VA 4LC0A 4OJKA 3MJRA 4NKRA 3B1ZA 2HT6A 4W5HA 4C0QC 1E0KA 3CIOA 4A36A 3G0HA 5JCZA 2RGNC 2GJ8A 4GP6A 4QNMA 4MRVA 4W7SA 3KJEA 1YZUA 4DDTA 1TU4A 2JLQA 2O8DB 1P62B 1AK2A 3EARA 3OAAA 3IEUA 4A2WA 3DHWC 3SOPA 2IS6A 2B7BA 5IK2D 4P4SB 2GVDC 3OIVA 1KSJA 1EWRA 2OCPA 4W9MC 2BBTA 2IBMA 5K8UA 4KLNA 1COWA 1W7AA 1QVAA 5DYGA 2R9VA 4G1UC 4RFSB 4PQRA 4RJLA 3GLIA 1TF7A 1J2JA 3BFKA 1VCMA 1E1RD 1E2LA 1P2SA 5FTJA 3JVVA 1TQ2A 3R20A 3BB3A 1G3IA 3VKHA 4OI0A 4TL7A 2Q6TA 1OE0A 2V7QD 5B57C 5EQTA 621PA 1BS1A 2PBRA 4B3FX 1NBMA 3LBNA 4IFEA 2FPMA 4NZYA 4PSVA 4OI4A 4B2IA 2C99A 3KUDA 4AG5A 1E1QD 2WJYA 4PAOA 4PXAA 3T12A 8OHMA 3BD9A 1WE2A 5B2ZA 2GVZC 4Q18A 5JMTA 3O8BA 4A6PA 2FNAA 4XWOA 3PEYA 3AV0B 1LV7A 2K5UA 4I81A 2ZVQX 1N5IA 4A6XA 1QG2A 5C4GB 4ZDIA 3THYB 1FP6A 4QBFA 3TW4A 1X3SA 5DYIA 2NPIA 5L3SA 4F4JA 2XX3A 1CR4A 1UKYA 2BBOA 3B5JA 1GITA 4B48A 5A5GA 3P1JA 3W9YA 2ZU6A 2F6RA 2JLZA 1O87A 4NU0A 3HR8A 1LNZA 2FFBA 2ASEA 2JJ2D 2OAP1 2JJ1D 3QJYA 4LJAA 2V1UA 4B75A 4IOKA 1WP9A 4FMCB 3T35A 3F0TA 5AUQA 3NWJA 2KSQA 3AGQA 4TQAA 5CITA 4EFNA 3RABA 5H68A 1NMZA 1U99A 4TYQA 1L4UA 4AG6A 4NYJQ 3GLHB 4PO9A 1NN1A 4Q47A 3J81k 3SFVA 3ZS9A 1G41A 4KV9A 3SQXA 4I1VA 4PPFA 3RAPR 1A7JA 3X1XA 1D2MA 2JLVA 1AA9A 4EFLA 4S35A 2O8CB 1E96A 2FG5A 3HU3A 1E0JA 1P2TA 3A1VA 3LX8A 5JRZA 1XMIA 1F3OA 4XVRA 4B35A 4MKHA 5DNYB 5DI3B 1S4QA 2G1JA 3U3RA 4DCSA 2R6CA 3B1VA 1XTJA 2P3SA 2ODWA 1G16A 5D3QA 5BN3A 1M74A 2H1LA 2WAYA 5ELXA 4ESVA 1AJEA 4XTCS 4RD1A 4OHYA 4XSGA 5M04A 1E79D 5E95A 1NVVR 1FUKA 4DSUA 3WMGA 4MYCA 5TDHA 4HDCA 4EFMA 1BIFA 4BE7B 5K8TA 2J0SA 4QGFA 4URYR 3DM9B 1FTNA 4JT2A 1NMYA 3THXB 2FWRA 3IPYA 4FD2A 1KAOA 4U5XA 5KDDA 3B82A 3A6PC 2ZETA 2ZUBA 4BRUA 3T1TA 2PCJA 4DZZA 5IHPA 2KB0A 3GJ3A 4U00A 1TQ4A 4PPGA 2VHJA 2VSFA 3QKTA 4BASA 1EX6A 2JA1A 4CEHA 5CK5A 4BFSA 2GESA 5CB6A 3LNCA 1X8LA 1N6OA 5KTYA 3PEWA 3MSXA 3DM5A 3IHWA 3TGPA 2QRNA 3IHLA 1FQKA 4JL8A 1F2TB 1XDBA 1QHYA 2REBA 4MKGA 4LOAA 4V0OA 2ZRGA 2V8OA 1ODFA 2WJHA 2WMNB 4FMDB 4KFRA 4LJ6A 4OK6A 1YU9A 3KXKA 3U3JA 3SEAA 1BO6A 4FI3C 1P9WA 4FWIB 4Q48A 2V6IA 4DVGA 1B0UA 4IFBA 3UWOA 2FJUA 3K09A 5JS8A 3BERA 1QHIA 1RFLA 1YR9A 2XXAA 2QMEA 2GWHA 2IUSA 3IIJA 1ZD8A 1OW3B 4JYBA 1AGRA 2ZR9A 4JLMA 1G7CA 1GRRA 1ANKA 4R2IA 3SBDA 4A4DA 1CBUA 4DDUA 4A2QA 1ZM4A 1IXZA 1NN5A 1Z3IX 2GAAA 3N2IA 3UK6A 2JAQA 3W8NA 1EGAA 2AD5A 3V9PA 5B64A 4Q01A 3GJ8A 4M9ZA 3OEED 4D4KA 1OB2A 1KI7A 2G0NA 3KUCA 4IKEA 2FPLA 2W58A 2QMHA 1F6BA 4M1OA 3EZFA 1P7CA 1PUIA 2ZJZA 1YZKA 4RFVA 1AKEA 5JI3E 4B3XA 1ZYUA 2JLRA 3BH6A 2WSMA 1XEWX 4AKEA 5C18A 1FP7A 1U0LA 1ZM2A 1R0YA 4MUBA 1R6BX 2GF9A 2BM0A 4WZBE 3OHMA 3HR7A 4QKQA 2H18A 1IONA 2OLJA 3X1DA 1SKQA 3AP3A 4JVNA 2JCSA 1XD8A 3L82B 1M1YE 2JATA 5EP2A 4M1MA 1KSHA 2QL6A 2WOJA 3QENA 3OZXA 2VHTA 3UKDA 1FOEB 3CLVA 2EFCB 2GDJA 3GLFE 4Q1CA 4ZDWA 1T3HA 1VG0B 2V55B 2X2EA 2BEJA 3CF2A 4IXMA 5FFMA 4IDNA 4NL4H 4YMWA 4IDHA 2DCUA 2IHBA 4D0GA 1E9FA 3H4MA 3PUYA 1Z47A 2IYQA 5FPYA 4JYCA 4TTRA 1W49A 2NOAA 2WWHA 3CF6R 3I5YA 1TX4B 4TT3D 4P31A 1G8PA 3QXXA 1J70A 1W5TA 2ANCA 4RD6A 2C77A 2VP6A 1D6JA 2XNDA 1N0UA 3EZ6A 2BKEA 2Q9BA 4AURA 5DGXA 2FSGA 4OQLA 3QKUA 1S9HA 1XMJA 3OIWA 3QF4A 4J0QA 4KLZA 4Q00A 5EP1A 2ZJ5A 2ZXUA 1KMHB 1TL7C 4ZV4A 2ZTSA 3CNOA 2W0SA 4JVLA 3AF2A 2SHKA 4RSGA 1W4AA 1M7GA 3IO5A 3LBHA 1Q1BA 3AM1A 4BZQA 4B6EA 3IDQA 3SHWA 4WIAA 4P3YA 1HURA 1OV4A 1JI0A 3NVAA 3VHLB 1MRNA 3DOEA 1P60A 3CWQA 4KHZA 4CF7A 4URWR 1JJ7A 2P65A 2FSFA 5F98A 1Q1ZA 4JVSB 4RFSA 5J4HA 3GLIB 4D0LB 1RRGA 4HZUB 4QM7A 4F38A 4MRSA 4HAXA 1TPZA 4TLDA 4L16A 4Z1MD 5KO2A 1H8HA 3GJ7A 3HPRA 3NBZC 3EPKA 2ZR0A 3AF4A 4GL2A 5EP3A 3NH6A 5TMPA 5EXTA 1IM2A 1E9AA 1XF9A 4H9GA 3KXLA 4DSOA 3GMTA 4CEJB 2A7QA 3KB1A 2B8TA 2GNOA 2CL7X 1SXJE 2RGAA 2ZSFA 2DHRA 3QXHA 4RZ2A 3LAWA 2ZI9A 1JPJA 3BB1A 4TLCA 1ZU4A 3WMFA 2ZANA 1LVGA 1SZPA 4Q4AA 3PUVA 5DHAA 2DBYA 3ZVMA 1OH8A 2NGRA 1Z6AA 4Q02A 3GFPA 4MKIA 2B7CA 3GJXC 5DI3A 1XX6A 1KMQA 2YOGA 3RDPA 1Q1QA 4W5WA 2EVWX 3TSOA 4PC7A 3KDSE 4Q4LA 4AIIA 3U7FB 3EC2A 3SYKA 4QJ4A 4KVAA 4BWYA 4JL6A 5FR1A 4TSFA 5CJ2A 3ZQJA 3ZGXA 2GCOA 5EE0A 2J7PD 4P0TA 2J0UA 4ZDKA 2XB4A 1OXSC 1PUJA 4DC9A 2IC5A 1L8QA 5FOUA 1NBMD 2NO6A 3DOFA 5UKDA 1N25A 2VP0A 2RCNA 1AN0A 1VG1A 3DVLA 4JVMA 3A37A 4A8JB 1GRQA 2IS2A 2G77B 5TB5A 5BXQC 2VHCA 1OB5A 4L9WA 3IGFA 5GADl 3CO5A 3OIUA 3TAHA 1QZXA 3CUEF 1S3GA 2PX0A 3MMPA 5AJWA 4D0NA 1U98A 4IVRA 4AYXA 4LBVA 3R7WA 1PZNA 3MLEA 1XCGB 3EIQA 2HLDD 5FPHA 1G291 2RGXA 1NLZA 4WXPA 2NMVA 2QP3A 1J90A 1XEFA 2A78A 2J5XA 3KXIA 1VDZA 3KJIA 1Z2CA 2O0KA 4PSAA 2P6RA 1Z0DA 3L0OA 1X6VA 3CF0A 1KGDA 4V0LA 4C7OA 2ZE8A 4A2PA 1AM4D 4Q7JB 1CR1A 1Z0KA 4C7OB 2WOOA 3KQUA 3FHOA 2AFIE 2I1VB 4CZ2A 2ERYA 3PFIA 1R0WA 3T06B 2FA9A 3KFXA 2GXQA 1YRAA 1HUQA 3WYAA 2QT1A 5KHOC 821PA 4CEJA 4Q03A 4JSYA 2B6HA 2CMKA 1E0AA 2AXNA 4CEIB 4JBYA 2IYYA 2P0EA 2GAOA 1SXJB 4TMKA 2DFTA 4V03A 3C4JA 4A0RA 1JAHA 2C78A 4KBFA 1CF4A 5JJLA 1J99A 1AKYA 1LY1A 2ZRLA 4E22A 3K70D 2D2EA 4PR0A 1H8ED 1OIVA 4GRAA 3R9WA 1OLOA 5AUPB 4XD7A 4R9UC 1NKSA 3DMNA 1FUUA 4AYWA 1XZQA 4EKDA 1R5OA 1UDWA 1FX0B 3L2OB 1TTTA 5IRCD 1Z63A 3GD7A 3FMIA 4QHTA 4B47A 3FPAA 1VG8A 2IUUA 1KK0A 2F3TA 3FFAA 4C9BA 4CEHB 5J5CA 3A58B 5K8LA 1IY1A 1DAFA 2QP4A 2QT0A 5LPNA 2ECKA 2QM8A 3UG7A 4C4PA 1XCPA 3K70B 3AUYA 3IKJA 2YVUA 4JLBA 2OLKA 2LKDA 3D7MA 4PQFA 1NRJB 2A9KA 1YR8A 1DG1G 3SJZA 1AGPA 1SKYE 3IPXA 1DO2A 1JB1A 4MQBA 4M1SA 4MH0R 2OCYC 3LLUA 3U7HB 4EAQA 3TSWA 2Q0HA 1IN8A 1D5CA 2VTKA 2ZR7A 4DLSA 4HLUA 1KJYA 3CZQA 2VP5A 3B9PA 2VO1A 2FFQA 3KX2A 2WWXA 4EPYA 1EFCA 4NDZA 5A0FA 4BQSA 5JRJA 3NIBA 3NC1C 1CS4C 4PSKA 3AGPA 4B33A 4DCTA 4PAMA 1S1MA 3KL4A 4CT5A 1OKKA 1N6IA 1KO8A 4CRWB 1MH1A 3UPUA 1K5DA 1JNYA 1XD2A 2OFXA 2ZE7A 5FOWA 4GSYA 2O5VA 3VU9B 5BYJA 4BUJA 5JCPA 2DYKA 4TT3A 4PO1A 3GQBA 3GCGA 1VECA 2ZYUX 2AN9A 1GOTA 3SDZA 1XPOA 2PT7A 2J0VA 4B2LA 2R8RA 2GETA 2C9YA 2GKSA 2R6FA 4DB2A 2VP4A 2IW3A 2J9RA 4IEEA 3IIMA 2QEQA 1RC8A 3LWNA 2WWWA 2QN6A 4GI7A 2PLFA 2WZQA 4F91B 2PT5A 2REXB 3ASZA 3K0FA 5EZ6B 4U7DA 1Z0AA 3MRSA 2CLSA 1DS6A 5FTMA 3FE2A 5AJXA 1XTQA 3QPWA 3CB4A 2J41A 4LZZA 1UBGA 3W5IA 3LQRA 4B32A 3RRMA 5KDLA 2IYSA 2C96A 3TUJC 1QHSA 3FMOB 4K8OA 2IYLD 1CTQA 3FDIA 5L8VA 4LSGA 1N6LA 4XWAA 5JBQA 2IYXA 4D4JA 1MABB 1KMHA 2QY9A 3B9QA 1OFUX 2PJZA 1E69A 1P2VA 2QPAA 2AHOA 3WYGA 1E32A 1T9HA 2REOA 4A8JA 3KTAB 2ZUCA 1OKKD 4HEJA 3AP1A 1H8HD 2RB4A 3W8RA 2YC4C 1QRAA 4YXWD 2A30A 4MRPA 4JSTA 2CXXA 5SZHB 1UFQA 4Z1MA 5FOTA 5G3ZA 2ONKA 1ZM9A 4IRUB 4XOIA 3E1SA 2IYVA 1SVMA 5DHFA 1XTRA 2IXEA 4D2IA 1VG9B 5IT5A 5KU1A 2CK3D 3TNFA 4F92B 1HYQA 1R4AA 3WBJA 3QUSA 2DWPA 1US8B 3PEUA 2R65A 4X8HA 1Z5ZA 3U2QA 3G82C 2ZJAA 2VSXA 1CXZA 1X1RA 3UWKA 1TAGA 3DZDA 3THOA 3FHTA 1PJRA 3QKRB 4R7ZA 1G20E 2Q9CA 3K9GA 3V4RA 5FTNA 2OAQ1 2YWGA 1WCV1 2QU8A 4LV6A 4E5UA 3DMDA 1I4DD 1N5KA 3QOFA 5KYKA 3EASA 3BFVA 2X1VA 4M22A 3NKVA 3BS4A 2EFDB 2KWIA 4RKEA 3VU9A 1P61B 4JLDA 4B3CA 1KO5A 2MSDB 2HT1A 4TL8A 3MAAC 1E2IA 4F7WA 2RKOA 4URUR 3TKLA 2QGNA 3LW7A 2X19A 1R8QA 4DLWA 5JFGA 2WWYA 4ZDJA 4A15A 4LYFA 3MWJA 2NG1A 2QROA 3PV0A 1E2KA 1T3SA 4WAUA 2GEVA 5KNCA 4HYYA 2KJQA 1FQJA 3K8YA 4US0R 5L3RA 1XCMA 1BOFA 1G17A 2ZI4A 3AVQA 1CKEA 3OFNA 1VMAA 1ZMXA 3BOSA 3ZJYA 1WA5A 2EW1A 3ZVLA 2IS1A 1OFHA 1ZW6A 2W6JA 1P9RA 4ZI3A 1X1SA 4ARZA 1E2QA 1KHTA 3P4XA 4PPQA 3AB3A 3IQWA 5TV2A 4NHOA 4IOJA 2QAJA 1II9A 3SE0A 1RRPA 2D62A 2ORWA 3CX7A 3O8CA 4NONA 4JKYA 1NG9A 1U2RA 2QSYA 5EE3A 4EPWA 4LJYA 1SVOA 4ILEA 1E94E 5J40A 4RCZA 3GLHE 2WSSD 1G8GA 1R0ZA 2IUTA 3B13B 3RC8A 4TLBA 3ICEA 1G1MA 5A4JA 2IXFA 4TN1A 2O8BA 4ZCLA 3FMFA 3VKWA 4OI1A 2OCAA 2W0MA 2PEZA 1NY6A 1NL3A 2CHGA 3MWKA 4QXAA 1Z6GA 2WAXA 4ZO4A 2D06A 3RYTC 3TQCA 1X8KA 2GEDA 2BBSA 4NCJA 4PC2A 3U3OA 5E3HA 3U4QA 1NN3A 4YONB 2ZS9A 4UQOA 2O8EB 3NH9A 4PZLA 1XXHB 1RZ3A 1JALA 2J7KA 1E2FA 1SXJC 3ONWA 4NBSA 4Q4AB 3GJ5A 1KNQA 1R7RA 1UEIA 1XB2A 1NP6A 4GBMA 5CM9C 3FTQA 2GXUA 3AF1A 1DELA 3T34A 1XTIA 1J8YF 5FL7D 5DH9A 3UG6A 4AY2A 4XD7D 4YC7A 2ZAMA 1W0JA 1D9ZA 3CX6A 2BM1A 4URXR 1IOZA 1VCNA 2ORVA 4MA4A 4Y0VA 4B34A 1OIXA 3EZ2A 1DAKA 1XTKA 5GVRA 5KOYA 2CEAA 1R5BA 2YWHA 2BVNA 1ZUNB 4C2UA 5JSZB 5KSYA 4NYMR 5EUMA 4LHWA 3K70C 4LHYA 2G6BA 2ZROA 1GVNB 2QAGA 3BH0A 4XWKA 1GIAA 2UVQA 3OEEA 4C0KA 2YYZA 2CNWD 3SJBA 3KKQA 2OBMA 3EW9A 3PXGA 2BCJQ 3CR7A 1M7BA 2XOKD 4L4UA 3KB2A 3I72A 3Q3JB 4QM6A 1CRQA 1OJLA 4IDQA 4DKXA 1NVXQ 3LLMA 1VIAA 3PIRA 1EFRD 4TYPA 1XPRA 4BFXA 1W36B 4BLRA 1ZINA 5FI1B 1L4YA 3QY0A 2CVFA 2VPPA 5EE1A 2P6UA 1KI3A 4A1FA 2R6AA 3TMKA 1UDXA 1RPZA 1S0UA 5AR1A 5JSZA 2B92A 1UPTA 4L5BA 2JDID 5H1YA 3W90A 1PVOA 2P5TB 1Q21A 3Q5EA 5FI0B 1KDTA 1VTKA 3U44A 4JLPA 1W5SA 3M0EA 2GXSA 3PQCA 1AS0A 1N2CE 1MO3A 2P67A 5CDFE 3FKSD 3ZS8A 1SGWA 4TLAA 3BORA 1R2QA 3ECCA 2DWQA 4G3XA 4Q9JA 3UMRA 3EX7C 1KI1A 2B8WA 3T61A 2EYUA 2QPOA 2WTUA 1F48A 2IF0A 2XGJA 2Q9AA 2FOLA 2XTMA 2CJWA 3PG5A 4O3MA 2IHYA 1CR0A 2DWOA 1NN0A 3NBXX 1V5WA 3SFZA 2ZPTX 2ONJA 3U61B 4MUAA 5HZKA 2H17A 5EXPA 5J47A 3U44B 1G6OA 3AEZA 4HAZA 1OSNA 2FPKA 4GOXA 5CYOA 3QXSA 2ZYTX 2XTNA 3BXZA 4BEBA 1Z22A 3QSYA 1KDRA 1EFRA 1UF9A 1OXUA 3ZIAA 2XZLA 4QL3A 2VL7A 4HB4A 2GZAA 2N42A 2QG6A 3K9HA 4IW3B 3GJ6A 1JPNA 2FE4A 2OV2A 2OG2A 2I3BA 5KSOA 3GEIA 1K6MA 4CIDA 3ADCA 3AVYA 2FGKA 1FNMA 3CNLA 2OFOA 2QAGB 1XMVA 2TMKA 4YQFA 1VHTA 1IN5A 1CU1A 2Q21A 2ZRFA 3TK1A 5F9HA 4WZAE 5FOSA 2VIIA 3B1YA 1R8SA 3FWYA 5EE5B 4PFSA 3L8YA 5LBIA 1W4CA 5EXXA 4UNQA 4DCVA 3HJNA 2QQ0A 2VBCA 3EZ7A 4BPBA 2A5GA 1JBKA 2IXGA 2H7VA 2O0HA 3CX8A 4C30A 1TEXA 3DDCA 4KYUA 4BLPA 5HTKA 1G21E 2ODEA 3R9IA 4GOKA 1YKSA 1ZP6A 3C15C 1SXJD 2OM2A 3PITA 1NVWQ 4LYAA 3BK7A 4V0KA 5FOXA 3QEJA 4EPXA 1FTSA 1HEIA 4DIDA 2GTPA 1SVWA 3E5HA 1G7TA 1T5IA 4LJ4A 3VNUA 1XNJA 2IX3A 3PUWA 2J1LA 2WKPA 1TU3A 3U7EB 1SVLA 1Z0JA 2FFAA 3GEEA 4Q1DA 4UNPA 3QXCA 4NCHA 4QGAA 3F5FA 1XTSA 5J4LA 2XXAB 2Z4RA 4JS0A 4LHVA 4LYHA 1IQPA 4QJ3A 4DCUA 5JZVA 1AQUA 3QBTA 3REGA 2R6DA 4G5OA 4TMWA 5JJKA 2FSHA 1DEKA 1N6NA 1MOZA 1D2NA 2QPTA 5CLQA 3GLGA 2QAGC 1H8EA 2W2VA 3I61A 4CDGA 4JMPA 3C8UA 1DVRA 1F5NA 4JLVA 5JWRA 1KKMA 1U94A 1GWNA 1ZNZA 3PVSA 2AK3A 4DLUA 3SS8A 3WMEA 1SKYB 1G7RA 2XZOA 1C4OA 1B23P 3A1SA 1XBTA 4C3ZA 3RS4A 3NC0C 1TF2A 3UMSA 3RSOA 1EESA 1SXJA 1UKVY 2J46A 5BYKA 5L3VA 2E9SA 2HLDA 3V00A 1KJZA 3WBKA 3R8FA 3Q5DA 3NHBA 2ZSAA 4BFWA 4NYJR 1U0JA 3LQQA 4JL5A 1PLLA 2EWWA 2ZJ2A 3A8TA 1XP8A 4AWXA 4A92A 1DPFA 2DFNA 1Z2AA 3LD9A 3QVVA 2R62A 3K0CA 1IY0A 1GL9B 2JLYA 3JZAA 3WHLA 2HYDA 4DLYA 2B21A 2ZS8A 3W34A 5KUTA 4P4SA 1G4AE 4ASUA 2OBLA 1N0VC 3B1XA 4BFVA 4Q4HA 4Q1EA 1W2HA 1NVVQ 4D82A 5FTLA 4DDWA 4NYIQ 3PEVA 1K5GA 3UIEA 1Z08A 2GZDA 2CHQA 2PL3A 4WZ6A 4LV8B 5B30A 2WM9B 2NIPA 1ZM7A 4QBHA 1F2TA 3A4LA 2CJWB 2F1HA 4FW9A 4MRNA 3W6OA 3DEFA 1C9KA 4Z51A 5FTKA 2OBNA 3ADBA 3W3ZB 2YINC 521PA 5G3YA 4Q1BA 4US2R 1Q22A 3B7GA 3A1WA 4DT1B 4ESHA 2P6NA 2IYZA 4LRWA 1KAGA 2CCKA 3OFND 4Z54A 2JLUA 5C1BA 3PUZA 5J4KA 2CL6X 1XD9A 2YJTD 3NBYC 4LBYA 4UXHA 2D7CA 1NI3A 4YLGA 5HKKA 3PJRA 2XOKA 1XFAA 3VTKA 1OFTA 2YOFA 4EDHA 2NQ2C 3SN6A 4KFTA 3WRYC 4GMXA 2QBYB 2ZI3A 1M7HA 3B8HA 3BGWA 1C1YA 1MRSA 1OXXK 3OF5A 2C2HA 3UXMA 5EUQB 1T0JB 3IO3A 4K46A 2ANBA 4KI0A 1RKBA 3U6BA 1GG2A 2VH5R 5CJPA 4HZIA 4ARZB 3FOZA 4E03A 3NDPA 1G5TA 2H92A 2X77A 1G8YA 3X2SA 1U90A 1P5ZB 4P32A 2JGNA 2QM7A 3MWLA 1KDOA 2OE2A 4YXWA 3KQHA 1NJFA 2ODNA 1E4YA 4Z8XA 2VF8A 3EC1A 2X8AA 4Q7MB 1KO1A 4PQYA 2IYWA 1II8B 2F1RA 1KTVA 2HDNB 3K0FB 2WWFA 3RRYA 4NYIR 1NSTA 1SVSA 2RMKA 1GRNA 1Q20A 3FKSA 3NHAA 4LK2A 4ERNA 4LI0A 3HPQA 1I4TD 1EFUA 1MT0A 2G9NA 2BMFA 3TLXA 5JLJA 4DWJA 1LTQA 2WJVA 4UXIA 2F43B 1CJTC 3KJGA 2RH5A 3OAAD 4XIGS 1E9DA 4RY2A 4X8MA 1KSGA 5FL7A 1P2UA 1M34E 1JEEA 3B1WA 4HB3A 1XRJA 2OZEA 4FXPA 2A5DA 4KFSA 4DSNA 1GNRA 1WB9A 2ZJ8A 3L0IB 2HXYA 4DEYA 2C9CA 1OYYA 4M9SA 2MSCB 2IEYA 1EG7A 1J8MF 4YMSA 3U60B 3ADDA 3R7WB 3ZIAD 1KI8A 4QJ5A 5C4MA 2N46A 1OH6A 1OYWA 4CYMA 2YWEA 2RGDA 2AK2A 3T1QA 1JAIA 2Z43A 2D4HA 3F3YA 1H65A 2XSZA 4P4TA 4WXRA 3CONA 4TTQA 4BECA 4EPRA 2HXSA 2CNWA 4NMMA 2RAPA 3K0SA 2QBYA 1XXHA 2YV5A 4BEJA 4M2LA 3C16C 3SC3A 1EX7A 1TF5A 5FBQB 2QI9C 2JJ1A 2AD1A 4NCKA 2ZE6A 2W00A 1N5LA 3SNHA 3H84A 2P2LA 2F1IA 2GEUA 2C8VA 3CPJB 3QF4B 1DBSA 2Y8EA 2KBEA 3D31A 1Y3AA 4MGIR 5DN6D 1E2NA 4G0NA 1L2TA 2QTVB 2H8KA 3VR1A 4PAQA 3I5XA 3AQ4A 3BC1A 4DB4A 3JZMA 2BBWA 4NYMQ 3KQLA 4O2RA 2ZRDA 4AKGA 3S1AB 4M53A 5E7MA 4LHZA 4A0GA 3QVUA 4LWZA 4M8NE 2NO0A 3SBEA 1KY3A 3TR0A 2HF8A 2FN4A 5KNBA 3RS0A 2MMCA 2F1JA 3HU2A 2ZSDA 2JEOA 1HQCA 2PZFA 4IXNA 4LDJA 2L0XA 4JKIA 3IILA 2GA8A 1Z28A 3CM0A 3HU1A 4RZXA 1KJWA 2ZS7A 5G53C 3I8SA 1AZTA 3C41J 1P9NA 5TY0A 5FPKA 221PA 3AVWA 4AYTA 4DLVA 3TE6A 4DXAA 2FMXA 2BMDA 4LCBA 1YHNA 3BE4A 1E98A 4HLDA 1OF1A 1KI4A 4AD8A 3Q9LA 1VCOA 2A5FA 2HCJB 3ND8A 4QOSA 1E9SA 4FWTA 3W6PA 2AR7A 1QBKC 3JVUA 4DUGD 5CB8A 4W5JA 4WBSA 4FMDF 3I4LA 2BMJA 4KSBA 2WKRA 4XH9B 4PPNA 4A9AA 4UNSA 1Q57A 2FSIA 3RLFA 4JLOA 2QSZA 4QBGB 1I2DA 2W6IA 1XEWY 2FU5C 4S2EA 3A4MA 1IN4A 4BGDA 4QGHA 1KSFX 2ZJOA 2IT1A 3QKSB 2VHQA 1D8TA 3MCAA 1G64A 2NZ8A 2OUKA 2GRJA 4ACAA 3GJ0A 3P26A 3H86A 2Q3HA 2WWGA 4KVGA 1G3UA 1CLUA 3EWSA 1S9DA 1WXQA 4ON9A 3KQKA 3CH4B 5JEDA 1VYTA 1GTVA 2ZRHA 4TMXA 1E2GA 4LPKA 4RD3A 3WY9A 2G83A 2CBZA 4JLKA 5H70A 1I4LD 1SVKA 4YMVA 5KSZA 4UJ5A 3EPJA 1ZUIA 4MYUA 1LW7A 4PC3A 2E87A 1HY3A 1J7KA 1RJ9B 1FW6A 1EK0A 5E7IA 1CRPA 2BHRA 1T91A 5TXGA 1IXRC 3RWOA 3A36A 3B2EA 2ZSBA 4B76A 1YR6A 3KKNA 3QG5A 4TYWA 3TQFA 4ZPXA 5E7JA 1QG4A 3K0EA 1E9EA 3LW8A 3EPHA 2BWJA 3GLFA 1ZUHA 3B85A 3NBFA 4TWZA 4F4IA 3RSLA 2A2ZA 4GZLA 1E2DA 1VKJA 3SR0A 4RCYA 2RGEA 1KIMA 2VP2A 3KZ1E 1FX0A 2JLXA 4L8GA 3FVQA 4MGKR
chains in the Genus database with same CATH superfamily
1FSPA 3S81A 4Q9HA 1ORVA 5EJ9A 3I6YA 4BVGA 1LS1A 1YS6A 2HWWA 1QFMA 2PRZA 3FYCA 4KO8A 1YZYA 4O25A 4BNJA 1JG6A 4XYGA 5HGJA 2IIBA 2VPTA 3D6AA 3LRPA 4WN9A 2XXJA 3GJRA 3H5LA 3ZY3A 3QFTA 1H2BA 3GRPA 5DTMA 3EIEA 3IR6A 2D5IA 4C0SA 4EUNA 3VMFA 4L6CA 4QE3A 2NUBA 3AR9A 4URZR 5FUVA 1CUJA 3EXAA 3D9QX 4BVFA 1APBA 3VYSB 5JAUA 2C7QA 1HETA 3KPUA 4ISBA 4JBLA 4LW8A 4ZCQA 1KZ4A 4MCAA 4JELA 1AN9A 4ZAZA 4R51A 1AH2A 1A4RA 1Y3DE 1V25A 2JGMA 3ZV7A 4Q1AA 1V71A 5L3ZA 4JDPA 4XSVA 5EIBC 2OY0A 3WJ7A 2FWMX 4D5EA 4F1WA 1V1RA 2VQEB 2F9LA 3GGSA 3L7BA 2WWRA 1HTBA 3ZGZA 5CEEA 5FBKA 2JW5A 3T3HA 2VSOA 2FCAA 3FGNA 3A4IA 1IOWA 1YZGA 4UXJA 3KFVA 4ZO9A 4LV5B 3ORRA 1V48A 3HLYA 1MAUA 3L8ZA 3IALA 2MT9A 1YQUA 3DULA 3UM9A 1Y7PA 2AW5A 3AP2A 5FR2A 2VYFA 4X92A 4CG1A 1HV8A 1ZH4A 3PRHA 2HHHB 2B3TA 5E9QA 2VTBA 2IYAA 3GFFA 2ZUEA 2H7XA 5LWHA 2O6HA 1QDEA 3LF1A 2BH2A 1KEVA 1Y89A 1IUNA 1Z83A 4HUTA 1TUIA 2JLAA 1N5DA 4HB0A 4WLNA 3BBLA 3AESA 3ST7A 3JQ7B 4FR0A 3ZXYA 5B1YA 5J43A 5L4NA 1EBBA 5LQJA 3DD5A 2JI8A 3KUKA 4MJLA 3SR3A 5HIJA 2X1LA 4BY9E 3O9VA 3Q7QA 3VR2A 4ECAA 5B4TA 2R11A 1J9EA 1BMFD 1TD9A 1ULUA 2QTHA 8LDHA 1L9XA 4FYJA 5E1BA 4FOOA 1UXHA 2XJ9A 4HXYA 4ZI7A 3EF1A 3E9MA 2WIDA 4KOEC 4PGHA 1ULHA 4HAUA 1ZD5A 3ZE2B 3L84A 1NURA 1HE8B 1ISJA 1PK7A 2FPIA 3C3WA 4A03A 4JX8A 5CBPA 4ABTA 4LJ9A 1RWKA 1T9GS 1OXVA 4TQ9A 3HYLA 4EGCB 1EIZA 1EZZA 4P1ZA 4E6PA 3LUCA 2H0AA 1QYDA 1UJMA 1L8XA 2GR9A 2GCOB 2ZYRA 3CKLA 2II6A 3M4YA 3SQMA 3VR5A 1E1MA 5I9MA 3ED1A 1Z06A 3H0KA 2F3UA 4U2BA 1OX4A 2BAGA 4HH1A 5FWXA 1GQSA 2C9MA 5IVPA 4ZYLA 2WV9A 1UK7A 3E35A 3WK6A 2ODAA 1QGZA 5JXWA 2IUYA 5F52A 3Q8XB 2FETA 1KVQA 2GSDA 2EFGA 4RD0A 4TL9A 2NUPA 2CLDX 2FQQA 3PR2B 4NFHA 3TLCA 1A98A 1CJCA 5JASA 2DPYA 2NVWA 2WJ6A 3GFQA 1FDRA 4ZOEA 1JHVA 1W19A 2CE2X 3EZ9A 1GKYA 3FSEA 4PO8A 5KKNB 1BH2A 4GGOA 3DKPA 1MX9A 3LPLA 3L4EA 4XGIA 1AGNA 3PQ7A 1XWWA 3QEMA 2EKQA 1N6RA 1NR7A 1PEAA 4QBIA 2QUJA 2A1TS 2BGRA 2Z5FA 5GZ6A 3WNBA 4YRQA 1T4DA 3ZZTA 1FVXA 3ZYZA 2H7CA 2HYIC 2Q8QA 4MVXA 2SECE 3D8TA 3ZNOA 5K0JA 3BEOA 2ZJYA 1TI7A 4BKOA 1OBOA 4F9TA 1MX3A 3ASYA 5I01A 2PWPA 1YB1A 3GLHA 3OE7D 2VWQA 4ME6A 2I67A 5K05A 2PUHA 3GRZA 3LQYA 4MUEA 4TSFD 1RBYA 3OX2A 4KR6A 3B60A 1NRXA 1V6SA 3BWXA 3QK7A 5LKAA 1EB8A 1L1EA 4WOCA 5KX5A 1MO6A 2ZTVA 4U8GA 5MN5A 2VUUA 3L4SO 1ZJJA 1TUGA 1FUYB 3FDZA 4CIXA 3NDRA 5GV8A 2GHIA 1OFIA 2JLWA 3OQOA 4FSHA 2DFLA 4OGFA 4DDVA 1E59A 3ANLA 5JROA 3PUXA 3U3KA 3DV2A 3KWMA 3S2ZA 2BFDA 1E3JA 4I55F 3L0SA 2G4CA 2GILA 3FZGA 2QE7D 5IJ0A 3ED5A 3WLEA 3VRHA 3MUFA 1RRFA 3N8GA 1M5RA 1QQ7A 3HNOA 5HF6A 5G1PA 1Z13A 1I4EB 3OU2A 1YVDA 2BZSA 4Q21A 3IT0A 4AF8A 4B3BA 1D0SA 4EZEA 2IS4A 2W71A 3NPMA 4JKOA 3IELA 2DPMA 1DKLA 2H51A 1JEDA 1K6JA 4JUAA 4XX1A 3O8OB 1P19A 4YJGA 3U62A 4PZEA 4DEXA 2AMJA 1OFUA 1OWNA 4ER5A 2W6ID 3PQ2A 2ZWIA 2UZ1B 3QMWA 5FUWA 3QU2A 1KNXA 1U0EA 3AYZB 1MC1A 3W9UA 1NIPA 5EPOA 2O5CA 1L0BA 3M5CA 3OEWA 4BXOB 2RBEA 3K35A 1OOEA 2I6QA 3ICVA 5KYGA 1QC5B 2D54A 1L7EA 1V16B 1W44A 2G7MC 1TDJA 3A1FA 1JQJC 4K7JA 5BV8A 1Z5PA 2DHCA 1WKCA 3WNCA 2UXCB 5LLTA 3WL7A 2Y6UA 3G49A 1T9GR 5CIYA 4RTOA 1QYVA 4DUZB 4PLPA 3RVRA 1H6BA 2HEIA 2B94A 4C7MA 1TYEB 1NY5A 1FYVA 4LRUA 2HZBA 4LTDA 1IN6A 4M0EA 4OKNA 4X61A 2VVTA 5BQ5A 3W7AA 1UAAA 2WF6A 1BSVA 2OCGA 4C04A 4LWPA 2GBIA 3RIYA 1KOFA 2VCHA 2X2FA 1FW8A 4N0QA 3GFRA 4LGYA 3SAJA 5HKKD 4WKCA 1EMDA 5K3FB 2CLFB 2X5XA 4JJGA 5JCXA 5KOIA 4ND5A 3X1YA 1XNRB 4BRWA 1XVTA 1B93A 1IQRA 2C95A 2WD9A 5A4KA 3WP1B 1CW2B 4CV0A 1ENYA 3TS1A 2CCJA 2GXAA 1GZ6A 4Y0AA 2HBQA 2V4MA 3CH6A 1SBTA 3VHXA 2TRSB 4BKPA 4E11A 2WFMA 2UVPB 3LZDA 1XZNA 4IXWA 4PW0A 2JG3A 4YUWA 2Q3MA 3IUEA 4QU0A 1AHPA 1CR6A 1V8FA 2ETXA 5HMLA 1DRUA 1Y3CE 1B1CA 1BHSA 1UFVA 2IUEA 2JKZA 3JQAD 3NU1A 3VGPA 1QZUA 4G5GA 4KGXA 3UXYA 4E07A 4X63A 4Q3NA 3WVNA 4B6RA 4JIMA 3ZC3A 2IYNA 1KVUA 1TO6A 2IVFA 3LYHA 4HNAB 2CBGA 1UJCA 1WL8A 3R4CA 4HN4B 1THMA 4WI1A 1UPUA 1C3XA 5AW0A 4D41A 5HZHA 2X15A 3JR3A 3SJCA 2CHVA 3EG5A 1NVMB 1QTIA 1SNYA 4AY4A 4DAEA 2LTAA 4ASUD 5EJ6A 3WWOA 1YUNA 1AS2A 2H85A 2XMSA 2YWFA 3HADA 4MR9B 4RDCA 4BMOB 3NALA 5FEMA 1ILEA 4TYYA 3D6VA 1W9MA 5KNDD 2H4JA 3ZCTA 3DE7X 1GCGA 3EIOA 1G3RA 2NZJA 4Q3EA 4TKUA 5AWFC 3SQOA 3U61B 1M1XB 4EJFA 3R3XA 2GBLA 2B5WA 1AKRA 2LD4A 4CLDA 4U02A 4B3IA 2QZPA 3OQIA 2MDTA 4GKAA 3LU1A 4KC0A 2QUAA 2BGTA 5FUYA 3H8WA 2RK3A 3EXG2 5AESA 5CW1A 1Y9EA 5HS4A 1SC9A 4GOMD 1NZJA 3MJ4A 2PZGA 2O0MA 4FC7A 2EC5A 2PM8A 3KLBA 5ECYA 5CVCA 4EDFA 4WKNA 2N0SA 4A5SA 4QYWA 3L93A 1KAMA 2VDWB 3EG9A 3T7DA 4GXTA 4RD4A 4ZICA 2NVBA 4PHGA 3LKDA 5DP2A 2C04A 3TCXB 1Y8QA 1JQEA 1KIFA 3F6EX 5AQEA 2LXNA 1WX1A 1E6MA 3EBOA 5GP1A 4PCAA 1CJUC 1ZK3A 2WSSA 5AI8A 5MN4A 2EGUA 2LWIA 3FKQA 3QE0A 4QNRA 4ZT3A 3IHKA 4KU4A 1DHTA 1LLDA 4MMZB 5D00A 3TTWA 1GL3A 2CLEB 2FUG1 2KE5A 5BWBA 4MQMA 1RRCA 5IVKA 2R8OA 1YZNA 4F2WA 4AZSA 4CG0A 1MDBA 1QIKA 3CRMA 1AQNA 1AF7A 1E1RA 4WZAB 2WEKA 3GFTA 4G0PA 2EF1A 2Z4SA 1IPEA 4WEOA 5LUBA 1QPGA 1E3WB 1Q1EA 4ZP1A 5ARDA 4RTSA 2HJGA 3O26A 1JMKC 3T7RA 1QU3A 3T1VA 1QF9A 1FS4A 1JG3A 3EQ8A 4FX2A 4KMOA 3ZHTA 3JALA 5CGQB 4AZ3A 4D9GA 1HE4A 4I8DA 1KYIA 1QHHB 5A3VA 3HCNA 3VNVA 5CRIA 1OJ7A 3R75A 4JGBA 4TZ0A 4BKQA 1CE8A 2V0CA 4C14A 2CCGA 3V7NA 1U1IA 4CMEC 4HNGA 2J32A 2IVZA 4X64B 1E6EA 1X2BA 1Z62A 2WD7B 1CE8B 1H2WA 5C46F 2FWJA 3NANA 5JTTA 4CKWB 2W4IA 5B1HA 2BEKA 2BCGY 5BUCA 3MGGA 1E89A 4LOJA 3HM9A 2BC9A 2ZJ1A 1QFSA 2YIJA 4PY2A 4XSHA 4KMSA 3I3SR 1KKLA 5TJ9A 3R9KA 2EWVA 4OQFA 4FINA 3NI2A 4IYJA 2F3PA 4PYRA 5JNLA 5T4BA 5JZOA 3BRWD 3JPYA 4DA0A 4YCNA 4Q7LA 5EHGA 3LKBA 4D7AA 2JIZD 4LDQA 4AS2A 3H1TA 3HXOA 1WIWA 3QWFA 3IEVA 1A04A 2P79A 3K0CC 4ZTZB 1AZWA 1BW9B 4KAJA 2GA9A 3RUAA 5KYYA 3OQNA 5B7NA 3HCDA 1QFYA 2BCEA 1BHO1 2R00C 4C3UA 1EWYA 5IBQA 1F3LA 1TVKB 4M1EA 5D3MA 5A0TA 5C35A 1O3YA 1MENA 3DDSA 1LDNA 2JFVA 3CWZA 3QXJA 4YCAA 3HBAA 4FE4A 5CG2A 4Z0TA 4B6FA 2O4CA 4CQJA 3T52A 4A7PA 4QGGA 5TR9A 2AN1A 3KWLA 4AKSA 3IRUA 5G02A 4W1PA 3SEFA 1RE1A 2WJJA 2PAAA 4MP8A 1TCCA 4HUQB 4GOJA 3HS3A 2Q7XA 1SQFA 1OI2A 3H6HA 4CMHA 4O4LB 2V9CA 5F21A 4N47A 3ZQ6A 1KC1A 4FFMA 4YA6A 2H4HA 3OQVA 3QF7A 2VXCA 2XMQA 3QU7A 9MHTA 3EDYA 1HDXA 1KMNA 4LXQA 2DVMA 2FUG6 3BMCB 4RMGA 4TQGA 4G5YA 3Q8WA 1RQNA 2VHYA 2FH5B 3A11A 4M0MA 4TUYB 3UN1A 1ZU5A 1H4QA 3IXLA 4ZCMA 2Y1OA 3DHYA 1DAHA 3MTBA 2JCBA 3QHPA 4L15A 3EQ6A 4G97A 4RCVA 1E6CA 2QZJA 4ZZ0A 2IL1A 5JWOA 4MZDA 2MMGA 1TEVA 4KO3S 5BVHB 3OPMA 2CV2A 1FYXA 3R0VA 2I9KA 1YCDA 2Y77A 2OORA 2VDKB 4GOOD 4XDZA 1FTWA 1PGQA 3ECSA 2XGMA 4KI7A 4NWIA 2AZXA 3MXOA 3K1JA 3PXBA 2Y9PB 1AGXA 1NMQA 2XITA 1FS5A 4TTVA 5EESA 3Q3CA 5MF6A 5ESXA 4HRVA 2BDEA 3H1EA 5TF0A 1RVV1 1N3BA 3I04A 2HCBA 3KUUA 3LUGA 4N76A 2QUZA 4KJZA 4NCAA 2C5LA 1E4VA 3GYGA 4OQZA 3RKSA 4BB5A 1KI9A 3NHSA 4CJXA 4DE5A 4FNMA 4CIBA 3THWB 4AUMA 3BPSA 1T6NA 3WS7A 3GLGB 2XKKA 4P33A 4PC6A 4BNHA 1SK9A 2JFWA 3I1FA 2ZJBA 4M7RA 1UBTS 3VDNB 7MHTA 1GUDA 1YMVA 1TTPB 5FORA 5ENDA 3LIPA 1RRMA 1YIDA 2Z5LA 3AXTA 4IIDA 4Q3DA 1G6KA 5P21A 4BV2A 4RWZA 3F6BX 3VX3A 5I8ZA 3V4ZA 4G4SO 1FXWA 1PDOA 1B8NA 5BW8A 2QSUA 3BXEA 3JWGA 4ZU3A 1WRBA 1DO0A 1C0PA 4B4WA 2YXLA 5CCBA 3ITEA 1ESMA 1VKZA 3DOHA 2O8DA 5U4XA 2FSVA 2J9FB 5GINE 3C3EA 3H5AA 1Y8ZA 2G80A 2QYHA 2PWZA 2C84A 1J25A 3VAAA 4II7A 2UYQA 1FCJA 3OO0A 1UBCA 4EJSA 4DMCA 2GF2A 1PJ8A 1H22A 2VJPA 2XF8A 1Q77A 4RZIA 3A1UA 4CL3A 1NRIA 3FB4A 2HJVA 3HFGA 4FDUA 1L8OA 4RPCA 1E4EA 2HCFA 5HM8A 2OQ2A 1AUVA 4UFPA 5K8IA 2ZIZA 3PE6A 4D9IA 4JJ6A 3QI2A 4BFUA 3THXA 1Z0FA 3OIFA 3IHTA 3Q7TA 4V0MA 1UKZA 1Q7RA 1YCGA 1I2AA 4TWJA 1KQNA 4EQ6A 1YAJA 1QB8A 2C5BA 2XUPA 6CHYA 3WYFA 5JJIA 3U09A 1RWOA 2OHGA 3S6JA 2Z04A 3OLZA 4ZZ3A 3AWIA 4J75A 4X71A 3TB4A 1TUBB 4IS2A 4O4JF 3NTXA 4JQSA 1ISRA 4IDPA 2R7KA 4MPRA 1HOTA 2H2IA 1NTOA 5AKLA 3SD7A 1JZSA 1UP4A 3SI7A 3PGMA 4KPEC 3NATA 2D3WA 4FN5A 1BAPA 4ARCA 4MITA 3T9DA 3KEFA 2Q5EA 2R8PA 3P9ZA 4UBKA 4ZZ2A 5ILQA 1ESNA 1S1CA 2WUFA 3MFYA 4IIXA 3R6LA 2AN5A 4ILKA 3VPDA 4IJWA 1IM8A 4F3TA 1DX9A 3AG6A 2REQB 1KAEA 1YR7A 4M0LA 5DI9A 4HGPA 4UZSA 3TMAA 1ZHFA 2XYQA 2GS9A 1O6CA 3D8NA 3OZCA 4YT2A 1DARA 4DTCA 5LB2A 3IEIA 2HXGA 2GM4A 3RRNA 2IELA 3KZXA 4PIMA 4J29A 1UWLA 3TQSA 2PGIA 4YUVA 4U6QA 1VYVA 3SBXA 4BZXA 3WK9A 1UL1X 4MW5A 3M81A 3IJEB 4TTJA 2WVJA 4FDTA 4FQ7A 2HA0A 1K4YA 2EQ5A 5AKGA 4ZVLA 1YCHA 3O3NB 2GN0A 2AJBA 3L41A 5EINA 3T6KA 2JGRA 2EZ8A 1UQUA 2UZAA 1XQXA 2FMHA 1XPUA 3ENVA 1HNNA 1US8A 2YWXA 2ZULA 1Q0QA 3JQFA 1OTXA 3H83A 4HAIA 3CVXA 1R10A 2H16A 2INGX 4XUEA 1M8FA 1E1CB 3NTUA 4MJ7A 2IP2A 5JFTA 1E1NA 3FPLA 4GXNA 2F55A 4C4ZA 2NO9A 3B7WA 4BMDA 1BMDA 2XWJI 4XASA 5ALWA 5BUQA 1XZGA 1VPVA 1W47A 2CDCA 4NMXB 3TUIC 2W2TA 4HH4A 4CKCA 4EJSB 3L1JA 2JFNA 3LP6A 3NIDB 1JHAA 4JCOA 4KQ9A 1V26A 3RFCA 5DLDA 2PGAA 4WFQA 5HCIA 1TUBA 2R4QA 4Q1FA 3USZA 1PNRA 3GJQA 1ZRHA 4HVLA 4LYGA 5EZYB 1C3LA 4PXYA 4NBWA 2PMCA 3HL4A 3LGXA 2PSHA 1D1PA 3PGJA 3UUEA 4D97A 1TVCA 3OECA 3AJRA 3GEBA 4I9UA 4X1YA 3VZRA 3AVUA 2EJTA 4U6NA 1XZDA 2RGGA 2I6GA 1U3GA 2VQSA 5BQ3A 3BICA 1V11A 4YRMA 2OXCA 4G0WA 4IZ6A 4YNBA 3CA8A 3CNBA 2XUHA 2LCFA 4IDAA 1LBIA 2HPHA 3LS2A 1ZX1A 2FPUA 1KVTA 3LVQE 4JCCA 1RC1A 3Q7PA 3CPEA 4FR5A 4L8VA 3LY9A 4OK5A 5CK4A 2OYCA 1MU0A 1PZHA 4NENB 3CC8A 1YB2A 3GLUA 3L06A 2QT9A 3KTFA 1ZGZA 4ZT7A 5KYUA 1W73A 4OXKA 2VCYA 1WF6A 1YJBA 4GBJA 1AT1A 3B89A 1BXGB 4PWYA 3M1AA 4QUHA 5JJCA 2HW8A 3RYFA 1T35A 5BN4A 3PSHA 2B6NA 5KHAA 1QJCA 4H6XA 1VL5A 4DGSA 2ID4A 1UKEA 5JS6A 4BO2A 1RYHA 3CPHA 3M6MD 3S4YA 5G1NA 2J48A 3LY7A 4KK3A 5FH9A 4FIZA 1GILA 1WPXA 4WLEA 2CZGA 2YHIA 5FV7A 4BFZA 3BIFA 4GXQA 3G8DA 3KKZA 1C1HA 2PQMA 4HV4A 2B0JA 1A4IA 5KNLA 4MWCA 4OMUA 2XNDD 4I36A 2Y99A 3T1OA 2XUFA 1G18A 1TRHA 3ET5A 3JZDA 4U0KA 4UKDA 1IULA 3CR8A 1NAHA 4HWTA 4LG1A 4BFYA 2WB4A 3P9CA 4LQLA 1H5QA 4BJ3A 3ETDA 4FFWA 3W5AA 3OZTA 2BEUA 3B9RA 4TLMB 5TARA 4BO1A 3DUFB 1I33A 5AHOA 4RQUA 1HEYA 2J45A 1NJ1A 2FTKE 2O5RA 3F2VA 3N8HA 4B4VA 4BUCA 1QH8B 1U11A 1QPZA 3T3IA 4I99A 1ZD4A 4DJ5X 5LNK6 3ZV3A 2QU7A 3DE6X 4MRRA 2P9TA 3BE5A 4TTPA 1T2EA 4F2HA 1CDDA 1YZHA 2IEZA 1VPDA 3P2IA 2FEXA 3KBOA 2ZBEA 3H9EO 3MN1A 4NBVA 3H5RA 3FTCA 3E5MA 4PLCA 2G88A 1Q7BA 1HQYE 4G5SA 3V7UA 3GEMA 3T9AA 2P5UA 4OXNA 1UJ2A 1MR3F 4A0SA 2W6ZA 2JGFA 4DMRA 4GZMA 1BJRE 2D74A 1I2BA 3VQTA 4YY3B 3ZDDA 1I7NA 3MQFA 2ABWA 5HW0A 1LTHR 1N2SA 2ARKA 3C3KA 3GRCA 5FPPA 2XMRA 1C9DB 1T3LA 2JIOA 3QIVA 1ZEJA 2IGTA 2EERA 1X86B 3EGVA 1OBCA 3EXHC 3O73A 3ZWDA 5B7QA 3CUYA 2IJGX 2J33A 4FOLA 3PLRA 4GFDA 1WD7A 1SH7A 2X2PA 3R3SA 4HI0E 2H2HA 3UGJA 2PO5A 4CGZA 4YRGA 1LPAB 3C70A 3D3QA 1RHUA 3I64A 2C4TA 1QYXA 1OPXA 2A84A 2WYUA 3BCRA 2EOAA 1B00A 2QTNA 3GN1A 1DEAA 4KXXA 4AMGA 3KPJA 3TSZA 4M8IA 4TS1A 4TXMA 5JAPA 1EYZA 2WYIA 5I51A 1M2WA 1FMTA 1UBMS 1U7TA 3LXUX 5F2KA 2CMDA 3JRNA 4IY1A 1ZD2P 2XT0A 1L5VA 3UMYA 3R76A 4IV8A 4PX3A 4KXYA 4LZJA 3VPSA 1I0LA 4FILA 1DAPA 3N05A 3G0IA 3M9LA 2JIQA 2W2KB 4GP7A 2O3TA 3LM8A 3UMVA 2QRHA 1IK4A 4CN9A 4YAUA 3FYHA 4EPVA 1JVBA 4W6QA 1NJ2A 1V43A 4I0WB 4FQ8A 5FPSA 2IV3A 4DIFA 1V6AA 2P41A 3LHDA 3FNEA 3UICA 1Y98A 1Z12A 3JQGA 3PDWA 4L3WA 4MKRA 5EIAA 1IU9A 1AZSC 1H93A 1KRHA 2DG2A 2QW0X 2Y1KA 1JU4A 3M6IA 5TT1A 4OUDB 1GA4A 2BRUC 2BHTA 1W76A 2JASA 2WHXA 3HYTA 2VI5A 4BX2A 2HTFA 3DKKA 1ZW1A 4S1WA 4YBZA 3FFTA 4IPTA 5C2JB 4RA9B 3EOBI 3A3NA 2WTXA 4DZRA 5ALSA 4K87A 4JJEA 4R71A 2PCLA 1X1DA 1E9RA 1YVRA 2ZVDA 3H99A 1U1FA 2I6SA 3U5ZB 4EKYA 3GT7A 2OEPA 5E4FA 1RFGE 4QPZA 3WHPA 2LNDA 3I83A 5FOVA 1JLHA 1XTTA 1JSCA 2AYXA 2ZWVA 3X1MA 3GLFB 3HBJA 4QSHA 4FFRA 4BU1A 4JJIA 2NYRA 2R5WA 1A5SB 1G8HA 1G8SA 2QA5A 1DIAA 3A05A 3CG4A 3HRIA 1BE0A 4V38A 4I5IA 3RS7A 4RQBA 4N3NA 1O4WA 2FPSA 5JD3A 5HCUA 4EGJA 4JEMA 4J7AA 2IYRA 2H31A 1JDNA 1KZGB 2YJ6A 3O84A 3W3AA 4MTCA 4RH3A 1WDKA 3PDCA 1NW8A 4BVHA 3CJRA 5A1JA 1KFKB 1YZQA 3OJWA 3PPVA 3V4FA 4GIBA 2O2ZA 1R4MA 1WMBA 3SC4A 3FCEA 5IDQA 3X1ZA 4IXDA 4ZPJA 3ZE1B 4ETMA 3RRZA 4Q16A 4ZAWA 5IKOA 1K88A 4ZAXA 4GR4A 2PR7A 3QI7A 4XLLA 2WIAA 4AULA 2PA3A 4IIHA 1XAJA 3OZDA 4ND3A 2EFEB 2BISA 4N3AA 4L9AA 4R1PA 4X1OA 3WLLA 1KZ7B 4TYNA 2C9ZA 3OJXA 4B79A 1AMUA 5MFZA 3CR3C 1DBVO 3LQ4A 4C0AC 4UNRA 3G7SA 1N6PA 2PN1A 1QNFA 5EWMA 3DV0A 3G6WA 2I1WA 1JTEA 1I30A 2OLEA 3HKDB 1DFHA 4JBNA 2D2FA 5PGMA 5ES4B 3QPVA 1NVEA 4OQQA 5HUQA 4MS4A 5LQDA 2ZCJA 1G9XA 3ZCXA 4YMHA 5E7QA 1GAEO 1WNTA 3OT1B 3MJRA 3PIIA 4NKRA 4YJ2B 4Z49A 3B1ZA 3IQFA 4R16A 5IMBA 4W5HA 4ID9A 3HY4A 1E0KA 1L5HA 2A67A 2RGNC 4GP6A 1J7JA 4FOSA 3IE0A 5AXCA 1PYGA 1V95A 3V46A 1E3WA 4LQ4A 1JDVA 1ISPA 2N9UA 1UH5A 1TW3A 1ZCZA 1WCXA 2IYPA 3LCCA 4CV2A 3U80A 3UV3A 4EUKA 2IXAA 3M5WA 1AK2A 1YBFA 4QYSA 2FXIA 5AVTA 3V7WA 2FR8A 1U9YA 3OAAA 4NY1A 3MINA 1U3VA 4QTZA 3DHWC 4JA2A 3HN6A 5K8VA 2EJCA 3ABZA 5ALHA 1EVIA 2AE2A 3KXDA 5MGNA 2HDHA 3O03A 2OCPA 3MD9A 4OSOA 4L2IB 5HJ7A 3G0OA 2IBMA 4R9SA 2FN8A 1J9ZA 4UCQA 4JXKA 1KYQA 3TTVA 3PTAA 3QFFA 2W2QA 4ZQCB 3RUFA 5DYGA 2R9VA 4M6WA 3GLIA 2CFRA 4PYIA 4UPDA 3Q8KA 3MOSA 4ALNA 1FFXB 2XWSA 1E2LA 2B98A 3WGVA 3USCS 1TQ2A 4DYDA 3WICA 1ITZA 3KOUA 4TL7A 1WOMA 5CD1A 1CQWA 4IO1A 4FFSA 3ZDYB 2V7QD 1PJAA 3AF6A 4LDNA 2P2SA 3LCRA 4HX9A 5BT9A 4EW6A 5B57C 2ZJ0A 3OQIB 1TRKA 4OI4A 4OHUA 2I2CA 1IATA 4P4NA 5A1TA 4JR2A 1PDWA 3UFXB 1TCVA 3PPXA 2JHAA 1JAXA 4UHKA 3T12A 3R0JA 4IQ4A 2P9EA 5BWOA 5IHXA 4D8WA 2GVZC 1ZMRA 3PFWO 1T26A 2PXAA 2J09A 4BCBA 5ECWA 3TNLA 2R2GA 3OZGA 3BWEA 5LZ2A 1GPLA 5AKJA 4JJAA 3MJVA 3COSA 4H7FA 5DU2A 2C5EA 2H5IA 1S2OA 5FFNA 5DX8A 1QG2A 3EF0A 1QNLA 4UCWA 1WP4A 2WJ3A 1P7YA 3KRTA 5DYIA 1MG0A 5ARCA 5BSRA 4C76A 3REOA 1LNQA 5HBGA 2FDRA 4P98A 1PI3A 2B4RO 1GITA 3ENZA 4RV5A 5A5GA 3P1JA 1K7FB 3W9YA 3LXMA 2GD2A 3OU6A 4FHDA 2CXQA 2OV1A 4MI9A 3WLFA 1L4NA 2JLZA 4NNOA 1DO8A 4ZHQA 2VYNA 1WPQA 2PD4A 1T5OA 2O7NA 3DCNA 3TR6A 1HFJA 1J2YA 2JJ2D 1VMIA 1L8LA 2C5SA 4KQEA 1MVNA 4U2FA 4A26A 2R6ZA 1RTKA 1AKVA 2V1UA 2AQ8A 3HG7A 1U8XX 1XCBA 3DF7A 3NHMA 4UPVA 3JAMA 5CITA 2CNOA 3RABA 1NMZA 1EUZA 1QO9A 3FDZB 1QGDA 4QT0A 4TUYF 2XUAA 4KMMA 2IZ6A 3DVSX 4NMHA 5LP1A 7REQB 1KZ6A 1NTRA 1KP3A 2QLBA 3GLHB 1Z5OA 2ZXEA 1MH9A 1NN1A 1EINA 1W93A 2N75A 3DT8A 3DUWA 3PIDA 3VH1A 3EQ9A 3SFVA 3T5MA 5AW3A 3SQXA 3JY6A 3VR4H 4I1VA 1JIJA 3UTDA 1GPKA 1XAHA 1A7JA 4AKTA 4EECA 1NBAA 2FWPA 3CCBA 3R23A 3WHIA 3HU3A 2QX8A 2X3FA 3ELUA 1XMIA 1N2ZA 3OBBA 3Q9SA 1Q6YA 1VYHA 1JFTA 1R00A 1JR2A 4HO1X 1O0BA 3RH0A 5ALKA 2Z09A 3E15A 5DI3B 5DNYB 5A5DA 4F72A 2G1JA 3OX3A 1F06A 1A4XA 3B1VA 3C3MA 3HKEA 5BWCA 1KE1A 3ESRA 2DX7A 1ZAYA 1G16A 1YFZA 3KAKA 3TTYA 1DAOA 1RNLA 2C1XA 5JCJD 4J4BA 4RD1A 1TK2A 5ESRA 4TN5A 5H3LA 5JSFA 5M04A 4AZ0A 1FFGA 3TLEA 2BTQA 3GHHA 3GWGA 1YOBA 1E5LA 1NNUA 4EFMA 4QXMA 5K8TA 3QH4A 1Q84A 1GLGA 4QGFA 4OBXA 3QVWA 1FLAA 2WZBA 2YQZA 4JT2A 3IVCA 3D3EA 2R0QC 3CRNA 1U9JA 3DR3A 3E7DA 2FWRA 3AFIA 1UP6A 1JA0A 2VDOB 3LYAA 4KIUA 4L9RA 2BFFA 3SZOA 2B7LA 2RHGB 2ZUBA 3ZU6A 2IIVA 4F3RA 2EBUA 2XVXA 1I14A 1XHFA 2ODPA 3KLMX 5IHPA 1PVDA 3GVIA 3AEXA 1THZA 2VP3A 4PPGA 2Y76A 1FDWA 4RUKA 2VSFA 3VVLA 1A8SA 2D0IA 4C03A 4C4SA 5I7WA 3VJRA 3KWFA 4UNIA 2X0DA 3IEMA 1X8LA 3DLTA 3INRA 3IUMA 1D5WA 2VZ9A 3OCUA 3I2YX 3PA6A 4RVFA 3I12A 3IHWA 3TGPA 5BRJA 1YC2A 3F71A 3Q3GE 3VSBA 4G0UA 1F2TB 3MJCA 2GBPA 4YWHA 2HHJA 2REBA 3A31A 2Y71A 1PR9A 4V0OA 4PCLA 2YS6A 1FB5A 3C7TA 4FMDB 2IKQA 2WILA 1MV8A 3GO4A 3HVHA 4LJ6A 4N5LA 1TZJA 4QASA 3H6KA 3KXKA 3EDCA 1SCQA 3ETJA 3NC4A 4KMRA 4PQEA 4WCFC 4FI3C 3U37A 3UMGA 3I52A 4FGLA 4CF3A 3PNYA 3JQCA 3M6LA 4IQ8A 4RORA 4WNCA 1TLTA 1B1AA 1O8CA 4DMKA 3K09A 4I9GA 3VJLA 1NULA 3B3FA 1ZH6A 4UVEA 1YR9A 4ENSA 3HCPA 2QMEA 2I6TA 2GWHA 2IUSA 2ATCA 1NBHA 2ZR9A 3BUSA 3MPOA 5BV0A 2PGOA 1EDOA 1KOJA 2XDQA 1ANKA 1PBTA 3RREA 1NQAO 3EEBA 1SU8A 2GAAA 3UK6A 5B64A 4Q01A 1B74A 3MERA 4HNUA 1XWFA 2PYIA 1D4ZA 4M9ZA 1XTPA 5ICCA 1KI7A 1OB2A 2FPLA 4A8HA 4ZARA 4Z0NA 1JRLA 1HLFA 5BRNA 2ST1A 4RFVA 1PUIA 5JI3E 4R84A 4RTNA 1O94C 2QJFA 4OREX 7MDHA 2BTQB 2IKSA 4MUBA 1R0YA 4B8WA 2UUCB 1R6BX 3H75A 2GF9A 2IOFA 1QU2A 1DGQA 1Y6JA 1TGVA 2DR2A 3M83A 1AMNA 1IONA 4F4UA 4F9EA 2RD2A 3KB8A 4BATA 1P0PA 2YFKA 1XD8A 5I7VA 9LDBA 3MF4A 3DP7A 2JATA 5EP2A 4M1MA 3S29A 4K9MA 3QRWA 1GZUA 2WR8A 2CVOA 1CP3A 3I2IA 4HL6A 1ZIDA 5JS2A 5AD1A 1YI8A 3WKAA 2JIMA 2GDJA 1O96A 1RU3A 1N8NA 2QL7A 4UULA 3M5PA 3DFMA 1T3HA 1Y1SA 2DY0A 2C2BA 1J8QA 1NHGA 1FRZA 1VG0B 2JAHA 4IGFA 4KACA 4QULA 4UVIA 2FHPA 3NUGA 4C6SA 1XZJA 4PVCA 2DCUA 4OBWA 3IKVA 4ZOLF 4HFMA 4P54A 1SQ6A 4MMXB 4CG3A 1ZS9A 5IDXA 1U0FA 1Z47A 3OA0A 1ZPDA 2OSVA 3DEKA 1JW9B 2IE0A 3EVTA 2JZCA 2G36A 4H2DA 1O95D 1W49A 4TTRA 5AOCA 2WWHA 4AZTA 3IAS1 4BYMA 3I5YA 1ADCA 1LDMA 3C4VA 1KRWA 3QXXA 3EWIA 4RV4A 3VDMA 2HGSA 3VR4D 1T36B 1W5TA 1BE1A 2ANCA 2VP6A 4ZVNA 5B1DA 1N0UA 1Q5PA 4Y1EA 2BKEA 1JU3A 2CWDA 5G4KB 3DFFA 3QW2A 4W63A 2FSGA 5DGXA 5JVDB 2I3GA 1I6LA 5EHZA 1C3JA 1JHQA 1S9HA 3CXUA 3DG9A 5TSDA 1J5EB 3G8BA 1YRHA 4WT7A 4X90A 3ORQA 3W5SA 1F4VA 5K0EA 3F6RA 3LF2A 3QOYA 1JKXA 2AI3A 2ZTSA 2VTVA 3I9MA 3WRVA 3F96A 2EDAA 1PNVA 2W0SA 2VZEA 1CY2A 4JVLA 3AF2A 3KK0A 1RBQA 3R41A 4DLKA 1SFRA 3GA5A 4P08A 5FXMA 3OLQA 4DN6A 4BZQA 5B7GA 3RS2A 2FPPA 2PXHA 3ILSA 1QX3A 3FJOA 3IDQA 3SHWA 1PX2A 3L4KA 4PAWA 1EJBA 2B9VA 3UENA 1HURA 1WXWA 1OV4A 2ZQYA 4HH3C 1JI0A 4HGZA 4QYIB 1PKXA 1EBFA 3DBIA 3FUUA 3T3PB 1C2TA 3SSMA 1SC1A 5JIBA 1P1IA 2QD4A 3MUNA 4MWZA 3PDIA 3ZNPA 2OA0A 1A0OA 2GYWA 1UC9A 5J4HA 4RFSA 5IASA 4D0LB 5TMEA 4FX5A 1A2OA 3AEYA 2JAWA 1E7YA 2VJMA 2XY4A 3OJEA 1F9EA 5K8CA 3WNZA 3EBLA 1FSGA 1K1EA 4OSEA 4TLDA 4XYLA 5DBOA 4DWWA 1NUSA 2VPXA 2XUOA 3OZWA 4Z1MD 5KO2A 5LN1A 4ZWNA 2ZR0A 3ZE7A 1I7QB 4WCFA 4QUEA 3FH0A 5EP3A 3NOXA 4WH0A 4F86A 4ND8A 1C0EA 4RBNA 5FB3A 1XF9A 4PZCA 4CEJB 2CJYA 2I29A 2A7QA 3E9ZA 1X1AA 3KP1A 4KOAA 2B8TA 1PQPA 1NONA 1SXJE 4MMYB 2XDWA 1QQ5A 4G26A 1M72A 2Z8XA 4V2IA 1JIUA 1SBNE 4AO7A 3E9EA 4GRDA 4O4JB 4RK7A 3TECE 2WHRA 1JYEA 1P8AA 1SZPA 5LJIA 2UYOA 3PUVA 4OHKA 1UMDA 2DBYA 1PV2A 2WDZA 3RK1A 1OH8A 1Z6AA 5I7HA 3D2LA 4BVKA 3ZD8A 2DE0X 4FDMA 1XX6A 4FTWA 1PK9A 4G5FA 3TSOA 1Q1QA 4PNHA 4PC7A 3EC2A 3QYFA 4QJ4A 3SYKA 4KVAA 1ENOA 1CG6A 3GGCA 3MAJA 4BWYA 1AV6A 5FR1A 1O6FA 5EWJB 3D7KA 4X00A 4M87A 4R81A 3Q98A 1X3LA 3HJTA 4IJQA 2QTMA 4LMRA