4JT5C

Mtordeltan-mlst8-pp242 complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 75
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jt5C01
4J8GA 3I7PA 3BWSA 3DXKC 3JZHA 2P9KC 5HE1B 4A11B 4FA5D 2CO0A 4GM8A 2I0TA 4ERQA 5FQDA 2CO0C 4J84A 4J73A 3V7DB 3EI3B 4J82A 3JROA 3OL2A 4L9OA 4PSWB 2BBKH 2H9PA 2I3SA 4JSNC 1JJUB 4FA1D 3F3FA 3EMHA 3FRXA 4D6VA 2I3TA 2P9SC 3MZLA 2Z2NA 3PSLA 1JMZB 2GNQA 4X60B 5K19A 3NVNA 4JT6C 4J81A 4LG9A 4EWRA 3C75H 3SFZA 4CI3A 3IJ1A 1MG3A 5I5MA 2AGYA 3ZWLB 2H9MA 5C9ZB 3RFGA 4NSXA 2PM9A 3PXWD 4GMBA 3UVLA 1SQ9A 2P9IC 4OZUA 3EI4A 3IJCA 4BL0A 2O9KA 3BG1A 3V9FA 2H3XA 4LG8A 3C99A 3UVOA 4CZYA 3OL2B 3VH0A 3F3PA 5EAMA 4CY5A 4A09A 3KRXB 2H13A 4O1QD 3SVWD 2IUVA 2IWKA 4D0KA 4CI8A 5EMKB 4JD2C 5IC7A 5GXHA 3W15A 5I5IA 3IIYA 1PI6A 1U4CA 4A2MA 4JT5C 4IA9A 4O3UB 3U4YA 5EM2A 3F3GA 4XYHA 2UZYB 1VYHC 5FKTA 3FM0A 3J81g 1OMWB 4JSXC 1GG2B 3RFHA 1S4UX 3RN1D 3NVQA 4A09B 4PXWA 2PBIB 2XU7A 3I7LA 4CY1A 3JZGA 4A11A 4BH6A 1QNIA 2HJBA 4HDJA 5CXCA 2H9NA 2B4EA 2H68A 4K3ID 3J80g 1N6DA 2H14A 2OK4A 3I8EA 5AJAA 3B7FA 4O3TB 3A0FA 4J87A 2OK6A 2IUQA 4QT8A 3I7OA 1SHYB 2YNNA 3KRWB 5GMKn 2B5NA 5EM2B 2XL3A 2EBSA 5EAPA 2PM7B 1NEXB 3ULEC 2Z2PA 3I7NA 4QL1A 5JWZA 4TZ4A 3DXMC 3NVXA 3RRMC 5FLXg 3JAMg 3SWSD 5A2Qg 5GSAA 5K1CC 1MG2A 2XL2A 5CXCB 4FA4D 3AL8A 4J79A 2B5MA 3C9CA 3RN0D 4FWWA 4MK0B 2OVQB 3I2NA 1JMXB 1XIPA 5FKQA 5IJ8E 5EMLB 2TRCB 1FWXA 4YVDA 2IWFA 5TF2A 4GQ1A 1B9YA 5IGQA 3MMYA 2IURA 2YB8B 3SJLD 3I7KA 1YFQA 4IMMA 4X61B 2OVPB 4JSPC 5EMMB 5H14A 3DSMA 3HFQA 4J0WA 4O45A 4A2LA 2HKMA 5GXIA 3CFVA 4PBZA 3PSCB 3CIKB 4A08B 4ERYA 3AL8B 5SXMA 4ERZA 3UVMA 4X63B 3EWEA 4ZOZA 4CZVA 4PSXB 3SMRA 4A0AA 2GC7A 4ZOXA 1OLZA 4FA9D 4CI1A 4G56B 3K27A 2AGLA 4X3EA 3EU7A 4PBYA 5FA5B 1K8KC 4J8BA 4JSVC 5TDHB 2Q7QA 4ZOYA 3AH8B 1RI6A 4XYIA 2OIZA 3PXSD 5EMJB 1TYQC 3VA6A 2J55H 2P9NC 4KFMB 4GGAA 2HKRA 4I79A 3VGZA 4GGDA 5H17A 2MTAH 3L4OD 5FXYA 3OKYA 4AEZA 4ZOVA 4FHLA 3OTTA 2CE9A 4A0AB 2OVRB 4J78A 1P22A 2CE8A 2H6NA 4OWRA 1L0QA 2HESX 1SQJA 3UVNA 4PC0A 3OKWA 2W18A 5AFU3 3EI1A 2H9LA 5H1MA 2Z2OA 3I8CA 4GZ8A 3K26A 4U7AA 2I0RA 3OW8A 4L3HD 3SXTD 5IGOA 4CC9A 3BG0A 4J77A 2IUPA 3CFSB 5TEFA 3OKYB 4E54A 3PVUB 4A0BB 4ZN4A 4GQ2P 2P9PC 5C2VB 2AGXA 2B5LA 1N6FA 3EG6A 3MKSB 3RMZD 2YNPA 5CXBB 3N0DA 3SHFA 4A08A 5FKRA 4K3JB 3EI1B 3SBRA 4CY2A 2J56H 4Z8LA 3AL9A 3I89A 4ESGA 2GC4A 3EI2B 3SLED 4L3GD 4Y7RA 4QQEA 3JZNA 4BUJC 2I0SA 2UZXB 4E54B 3L4MD 3SBQA 1PGUA 3RLMD 2AH0A 2CN2A 5CYKA 5HE2B 2AGWA 4GQBB 3IIWA 4R7AB 2P9UC 2QXVA 4GGCA 1GXRA 1A0RB 1XKSA 4AOWA 4PNKB 3UVKA 1K32A 3SCYA 4JXMA 4FAVD 2YMUA 4E5ZA 3PE7A 3MKQA 1B9XA 4LGNA 4Y5RD 4FB1D 3AFCA 4L1QD 4XEIC 2PM6B 5HQGA 1NR0A 1MDAH 3I7HA 2G9AA 4N14A 2J57G 4CI2A 4GM9A 3UR4A 5EARA 4CZXA 5IT9g 4H5JA 3E0CA 5B4WA 5CYKB 1ERJA 2HYEA 1U2VC 5TEEA 4GM3A 3DWLC 5AMSA 1N6EA 5HYNB 4H5IA 2HXCA 3PXTD 4FAND 3ODTA 1GP2B 2P9LC 4A0BA 3JB9L 3V5WB 1PEVA 4E5ZB 3ORVD 2CN3A 4UI9R 1R5MA 5CXBA 2OJYA 2PM9B 5I5JA 2AGZA 3SBPA 2AQ5A 1PBYB 3EI4B 4J86A 3RSEC 1GOTB 2H6QA 5C2WB 1TBGA 2CNXA 3P4FA 4QRJA 2YBAA 5EALA 4CY3A 3EI2A 3C5MA 3DM0A 3JRPA 2QC5A 5HE0B 2BCJB 4A7JA 2IAAA 3GREA 5THAA 1Q47A 1XHMA 2XYIA 2G99A 3OKTA 3MZKA 3N0EA 3EI3A 3IJ0A 1JOFA 3GFCA 3MXXA 3IKOA 2H47A 3SN6B 4J0XA 2HJ4A 4O9DA 4ES0A 3UKUC 5IJ7E 2AH1A 5FKSA 4U1EI 3FGBA 3PVWB 5HE3B 3UKRC 2YNOA 2H6KA 5KDOB 3JPXA
chains in the Genus database with same CATH superfamily
2QR5A 4J8GA 3I7PA 1L5GA 1UOPA 3BWSA 3DXKC 3JZHA 2P9KC 5HE1B 4A11B 4FA5D 2CO0A 3IUMA 4GM8A 2I0TA 4ERQA 5FQDA 2CO0C 2VDKA 4J84A 4J73A 3V7DB 3EI3B 4J82A 3JROA 3OL2A 4L9OA 4PSWB 2BBKH 2H9PA 2I3SA 3ZE1A 4JSNC 1JJUB 4FA1D 3F3FA 3EMHA 3FRXA 4D6VA 2I3TA 2P9SC 3MZLA 2Z2NA 3PSLA 1JMZB 2GNQA 4X60B 5K19A 3NVNA 4JT6C 4WK0A 3K72A 4J81A 4LG9A 4EWRA 3C75H 5M5VA 3SFZA 4CI3A 3IJ1A 1MG3A 5I5MA 2AGYA 5E6RA 3O4IA 3ZWLB 2H9MA 5C9ZB 1GOFA 3RFGA 4NSXA 3VI4A 2PM9A 3PXWD 4GMBA 3UVLA 1SQ9A 2P9IC 4AMZA 4OZUA 3EI4A 3IJCA 3ZDZA 4BL0A 2O9KA 3BG1A 3V9FA 2H3XA 4LG8A 3C99A 3UVOA 4CZYA 3OL2B 3EQ7A 4IRZA 3VH0A 3F3PA 5EAMA 4CY5A 4A09A 3KRXB 2H13A 3OF7A 4O1QD 2IUVA 3SVWD 2IWKA 4D0KA 4CI8A 5EMKB 4JD2C 5IC7A 5GXHA 4NBMA 3W15A 5I5IA 3QHYB 3IIYA 1PI6A 1U4CA 5M61A 4A2MA 4JT5C 4IA9A 2HU7A 3FCUA 4O3UB 3U4YA 5EM2A 3F3GA 1UOOA 4XYHA 2UZYB 5E6SA 1VYHC 5FKTA 2XZGA 3FM0A 3J81g 1OMWB 4JSXC 1GG2B 3RFHA 1S4UX 3RN1D 3IVMA 3NVQA 4L1MA 4A09B 4DNUA 4PXWA 2PBIB 2XU7A 3I7LA 3ZE2A 4CY1A 3JZGA 4A11A 4BH6A 1QNIA 2HJBA 4HDJA 5CXCA 2H9NA 2B4EA 2H68A 2VDOA 4K3ID 3J80g 1N6DA 2H14A 2OK4A 3I8EA 5AJAA 3B7FA 3DDUA 4G1MA 4O3TB 3A0FA 4J87A 4AX4A 2OK6A 2IUQA 4QT8A 3I7OA 1SHYB 2YNNA 3KRWB 5GMKn 2B5NA 5EM2B 2XL3A 2EBSA 2EIDA 5EAPA 4NENA 2PM7B 4Z7QA 1NEXB 3K6SA 3ULEC 5E6UA 2Z2PA 3I7NA 4QL1A 5JWZA 1E8NA 4TZ4A 4Z7NA 4MMYA 3DXMC 3NVXA 4DNVA 3RRMC 5FLXg 4WK4A 3JAMg 2VC2A 3SWSD 5A2Qg 5GSAA 5K1CC 3NIDA 1MG2A 2EICA 2XL2A 3EQ8A 5CXCB 2EIEA 4FA4D 3AL8A 4J79A 2B5MA 3C9CA 3RN0D 4FWWA 4MK0B 2OVQB 1QFMA 1JMXB 3I2NA 3MVDK 1XIPA 5FKQA 5IJ8E 4BP9A 5EMLB 4RE6A 3IUQA 4WK2A 2TRCB 1FWXA 4YVDA 2IWFA 5TF2A 4GQ1A 1B9YA 5IGQA 1U8CA 4BCBA 3MMYA 2IURA 2YB8B 3SJLD 3I7KA 1YFQA 4WJKA 5FFGA 4IMMA 3NIFA 4X61B 2OVPB 4JSPC 5C92A 4BCCA 5EMMB 3K71A 3IURA 5H14A 1H2ZA 3DSMA 3HFQA 4J0WA 4O45A 4A2LA 2HKMA 5M5UA 5GXIA 3CFVA 4PBZA 3PSCB 3CIKB 5M5SA 4A08B 3IJEA 3V4PA 4ERYA 3AL8B 5SXMA 4ERZA 3UVMA 3EQ9A 4JHPC 1O6FA 4X63B 3EWEA 4ZOZA 4CZVA 4PSXB 3SMRA 4A0AA 2GC7A 4ZOXA 1OLZA 4FA9D 4CI1A 4G56B 3K27A 2AGLA 4X3EA 1E8MA 3KCIA 4MMXA 2VDQA 1TYEA 3EU7A 4PBYA 5FA5B 1K8KC 4J8BA 4JSVC 5TDHB 2Q7QA 4ZOYA 2BKLA 3AH8B 1RI6A 4XYIA 2OIZA 3PXSD 5EMJB 2VZ1A 1TYQC 3VA6A 2J55H 2P9NC 3NIGA 4GGAA 4KFMB 2HKRA 4I79A 3VGZA 4GGDA 5H17A 2MTAH 3L4OD 3IUNA 4MMZA 5FXYA 3OKYA 4UM8A 4AEZA 4ZOVA 2EIBA 1UOQA 3OTTA 4FHLA 2CE9A 4A0AB 2OVRB 4J78A 4RE5A 1P22A 2CE8A 2H6NA 4OWRA 4G1EA 2VDNA 1L0QA 1H2WA 2HESX 2VDMA 4AN0A 1SQJA 1C9IA 3T3PA 3UVNA 4PC0A 3OKWA 2W18A 5AFU3 3EI1A 3VI3A 2H9LA 5H1MA 2Z2OA 3I8CA 4GZ8A 3K26A 4U7AA 1YR2A 2I0RA 1BPOA 3OW8A 4L3HD 3SXTD 5IGOA 4CC9A 3BG0A 4J77A 2IUPA 3CFSB 5TEFA 5C86A 2QZPA 3OKYB 4JHNA 4E54A 3PVUB 4A0BB 1JV2A 4ZN4A 4GQ2P 2P9PC 5C2VB 2AGXA 2B5LA 4O02A 1N6FA 3EG6A 3MKSB 3RMZD 1E5TA 2YNPA 5CXBB 3N0DA 3SHFA 4A08A 2VDRA 5FKRA 2HU5A 4K3JB 3EI1B 3SBRA 3MUNA 2J56H 4Z8LA 4CY2A 2XDWA 3AL9A 3I89A 4ESGA 2HU8A 5HDBA 4DNWA 1O6GA 2GC4A 3EI2B 4O2WA 4NAAA 3ZE0A 3ZDYA 3SLED 1UTCA 3IULA 4L3GD 4Y7RA 4QQEA 1VZ3A 3JZNA 4BUJC 5M5TA 2I0SA 2UZXB 3GC3B 4E54B 3L4MD 3SBQA 1PGUA 3RLMD 3MUOA 2AH0A 2CN2A 5CYKA 5HE2B 2AGWA 4GQBB 3IIWA 3GD1I 4R7AB 2P9UC 2QXVA 4GGCA 1GXRA 4QAMA 1A0RB 1XKSA 4AOWA 1VZ2A 4PNKB 3V4VA 3FCSA 3UVKA 1K32A 3SCYA 4JXMA 4FAVD 1VE7A 2YMUA 4E5ZA 3PE7A 3MKQA 1B9XA 4LGNA 4Y5RD 4FB1D 3AFCA 4L1QD 4XEIC 2PM6B 3IUJA 5HQGA 1NR0A 1MDAH 3QI0A 3I7HA 1A12A 2G9AA 4N14A 2J57G 4CI2A 4Z7OA 4GM9A 1H2YA 3UR4A 5EARA 4CZXA 5IT9g 4H5JA 3E0CA 5B4WA 1H2XA 5CYKB 1ERJA 4AN1A 2HYEA 1U2VC 2VDPA 5TEEA 4GM3A 3DWLC 4G55A 5AMSA 4UM9A 4AMYA 1N6EA 1JTDB 5HYNB 4H5IA 1GOHA 2HXCA 3PXTD 4FAND 3ODTA 5FFOA 4BCDA 1GP2B 2P9LC 4A0BA 3JB9L 4NC4A 3V5WB 1PEVA 4E5ZB 3ORVD 2CN3A 4UI9R 1I2MB 1C9LA 1R5MA 5CXBA 2OJYA 2PM9B 5M5RA 5I5JA 2AGZA 3SBPA 2AQ5A 1PBYB 3EI4B 3T3MA 4J86A 3RSEC 1M1XA 1GOTB 2H6QA 5C2WB 1TBGA 2CNXA 3P4FA 4QRJA 2YBAA 5EALA 4CY3A 3EI2A 3C5MA 3O4HA 3DM0A 3JRPA 2QC5A 5HE0B 2BCJB 4A7JA 2IAAA 3GREA 5THAA 2JKXA 2XE4A 1T2XA 1K3IA 1Q47A 1XHMA 2XYIA 2G99A 3OKTA 2WQ8A 4BP8A 4D9SA 1VE6A 3N0EA 3MZKA 3EI3A 3IJ0A 1JOFA 3GFCA 2VDLA 3MXXA 3IKOA 1GOGA 2H47A 3SN6B 4J0XA 1QFSA 2HJ4A 3O4GA 2VZ3A 4O9DA 4ES0A 3UKUC 5IJ7E 2AH1A 5FKSA 4U1EI 3FGBA 3PVWB 5HE3B 3UKRC 3O4JA 2YNOA 2H6KA 3ZDXA 5KDOB 3JPXA
chains in the Genus database with same CATH topology
4J8GA 3I7PA 3BWSA 3DXKC 3JZHA 2P9KC 5HE1B 4A11B 4FA5D 2CO0A 4GM8A 2I0TA 4ERQA 5FQDA 2CO0C 4J84A 4J73A 3V7DB 3EI3B 4J82A 3JROA 3OL2A 4L9OA 4PSWB 2BBKH 2H9PA 2I3SA 4JSNC 1JJUB 4FA1D 3F3FA 3EMHA 3FRXA 4D6VA 2I3TA 2P9SC 3MZLA 2Z2NA 3PSLA 1JMZB 2GNQA 4X60B 5K19A 3NVNA 4JT6C 4J81A 4LG9A 4EWRA 3C75H 3SFZA 4CI3A 3IJ1A 1MG3A 5I5MA 2AGYA 3ZWLB 2H9MA 5C9ZB 3RFGA 4NSXA 2PM9A 3PXWD 4GMBA 3UVLA 1SQ9A 2P9IC 4OZUA 3EI4A 3IJCA 4BL0A 2O9KA 3BG1A 3V9FA 2H3XA 4LG8A 3C99A 3UVOA 4CZYA 3OL2B 3VH0A 3F3PA 5EAMA 4CY5A 4A09A 3KRXB 2H13A 4O1QD 3SVWD 2IUVA 2IWKA 4D0KA 4CI8A 5EMKB 4JD2C 5IC7A 5GXHA 3W15A 5I5IA 3IIYA 1PI6A 1U4CA 4A2MA 4JT5C 4IA9A 4O3UB 3U4YA 5EM2A 3F3GA 4XYHA 2UZYB 1VYHC 5FKTA 3FM0A 3J81g 1OMWB 4JSXC 1GG2B 3RFHA 1S4UX 3RN1D 3NVQA 4A09B 4PXWA 2PBIB 2XU7A 3I7LA 4CY1A 3JZGA 4A11A 4BH6A 1QNIA 2HJBA 4HDJA 5CXCA 2H9NA 2B4EA 2H68A 4K3ID 3J80g 1N6DA 2H14A 2OK4A 3I8EA 5AJAA 3B7FA 4O3TB 3A0FA 4J87A 2OK6A 2IUQA 4QT8A 3I7OA 1SHYB 2YNNA 3KRWB 5GMKn 2B5NA 5EM2B 2XL3A 2EBSA 5EAPA 2PM7B 1NEXB 3ULEC 2Z2PA 3I7NA 4QL1A 5JWZA 4TZ4A 3DXMC 3NVXA 3RRMC 5FLXg 3JAMg 3SWSD 5A2Qg 5GSAA 5K1CC 1MG2A 2XL2A 5CXCB 4FA4D 3AL8A 4J79A 2B5MA 3C9CA 3RN0D 4FWWA 4MK0B 2OVQB 3I2NA 1JMXB 1XIPA 5FKQA 5IJ8E 5EMLB 2TRCB 1FWXA 4YVDA 2IWFA 5TF2A 4GQ1A 1B9YA 5IGQA 3MMYA 2IURA 2YB8B 3SJLD 3I7KA 1YFQA 4IMMA 4X61B 2OVPB 4JSPC 5EMMB 5H14A 3DSMA 3HFQA 4J0WA 4O45A 4A2LA 2HKMA 5GXIA 3CFVA 4PBZA 3PSCB 3CIKB 4A08B 4ERYA 3AL8B 5SXMA 4ERZA 3UVMA 4X63B 3EWEA 4ZOZA 4CZVA 4PSXB 3SMRA 4A0AA 2GC7A 4ZOXA 1OLZA 4FA9D 4CI1A 4G56B 3K27A 2AGLA 4X3EA 3EU7A 4PBYA 5FA5B 1K8KC 4J8BA 4JSVC 5TDHB 2Q7QA 4ZOYA 3AH8B 1RI6A 4XYIA 2OIZA 3PXSD 5EMJB 1TYQC 3VA6A 2J55H 2P9NC 4KFMB 4GGAA 2HKRA 4I79A 3VGZA 4GGDA 5H17A 2MTAH 3L4OD 5FXYA 3OKYA 4AEZA 4ZOVA 4FHLA 3OTTA 2CE9A 4A0AB 2OVRB 4J78A 1P22A 2CE8A 2H6NA 4OWRA 1L0QA 2HESX 1SQJA 3UVNA 4PC0A 3OKWA 2W18A 5AFU3 3EI1A 2H9LA 5H1MA 2Z2OA 3I8CA 4GZ8A 3K26A 4U7AA 2I0RA 3OW8A 4L3HD 3SXTD 5IGOA 4CC9A 3BG0A 4J77A 2IUPA 3CFSB 5TEFA 3OKYB 4E54A 3PVUB 4A0BB 4ZN4A 4GQ2P 2P9PC 5C2VB 2AGXA 2B5LA 1N6FA 3EG6A 3MKSB 3RMZD 2YNPA 5CXBB 3N0DA 3SHFA 4A08A 5FKRA 4K3JB 3EI1B 3SBRA 4CY2A 2J56H 4Z8LA 3AL9A 3I89A 4ESGA 2GC4A 3EI2B 3SLED 4L3GD 4Y7RA 4QQEA 3JZNA 4BUJC 2I0SA 2UZXB 4E54B 3L4MD 3SBQA 1PGUA 3RLMD 2AH0A 2CN2A 5CYKA 5HE2B 2AGWA 4GQBB 3IIWA 4R7AB 2P9UC 2QXVA 4GGCA 1GXRA 1A0RB 1XKSA 4AOWA 4PNKB 3UVKA 1K32A 3SCYA 4JXMA 4FAVD 2YMUA 4E5ZA 3PE7A 3MKQA 1B9XA 4LGNA 4Y5RD 4FB1D 3AFCA 4L1QD 4XEIC 2PM6B 5HQGA 1NR0A 1MDAH 3I7HA 2G9AA 4N14A 2J57G 4CI2A 4GM9A 3UR4A 5EARA 4CZXA 5IT9g 4H5JA 3E0CA 5B4WA 5CYKB 1ERJA 2HYEA 1U2VC 5TEEA 4GM3A 3DWLC 5AMSA 1N6EA 5HYNB 4H5IA 2HXCA 3PXTD 4FAND 3ODTA 1GP2B 2P9LC 4A0BA 3JB9L 3V5WB 1PEVA 4E5ZB 3ORVD 2CN3A 4UI9R 1R5MA 5CXBA 2OJYA 2PM9B 5I5JA 2AGZA 3SBPA 2AQ5A 1PBYB 3EI4B 4J86A 3RSEC 1GOTB 2H6QA 5C2WB 1TBGA 2CNXA 3P4FA 4QRJA 2YBAA 5EALA 4CY3A 3EI2A 3C5MA 3DM0A 3JRPA 2QC5A 5HE0B 2BCJB 4A7JA 2IAAA 3GREA 5THAA 1Q47A 1XHMA 2XYIA 2G99A 3OKTA 3MZKA 3N0EA 3EI3A 3IJ0A 1JOFA 3GFCA 3MXXA 3IKOA 2H47A 3SN6B 4J0XA 2HJ4A 4O9DA 4ES0A 3UKUC 5IJ7E 2AH1A 5FKSA 4U1EI 3FGBA 3PVWB 5HE3B 3UKRC 2YNOA 2H6KA 5KDOB 3JPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8G A;  3I7P A;  3BWS A;  3DXK C;  3JZH A;  2P9K C;  5HE1 B;  4A11 B;  4FA5 D;  2CO0 A;  4GM8 A;  2I0T A;  4ERQ A;  5FQD A;  2CO0 C;  4J84 A;  4J73 A;  3V7D B;  3EI3 B;  4J82 A;  3JRO A;  3OL2 A;  4L9O A;  4PSW B;  2BBK H;  2H9P A;  2I3S A;  4JSN C;  1JJU B;  4FA1 D;  3F3F A;  3EMH A;  3FRX A;  4D6V A;  2I3T A;  2P9S C;  3MZL A;  2Z2N A;  3PSL A;  1JMZ B;  2GNQ A;  4X60 B;  5K19 A;  3NVN A;  4JT6 C;  4J81 A;  4LG9 A;  4EWR A;  3C75 H;  3SFZ A;  4CI3 A;  3IJ1 A;  1MG3 A;  5I5M A;  2AGY A;  3ZWL B;  2H9M A;  5C9Z B;  3RFG A;  4NSX A;  2PM9 A;  3PXW D;  4GMB A;  3UVL A;  1SQ9 A;  2P9I C;  4OZU A;  3EI4 A;  3IJC A;  4BL0 A;  2O9K A;  3BG1 A;  3V9F A;  2H3X A;  4LG8 A;  3C99 A;  3UVO A;  4CZY A;  3OL2 B;  3VH0 A;  3F3P A;  5EAM A;  4CY5 A;  4A09 A;  3KRX B;  2H13 A;  4O1Q D;  3SVW D;  2IUV A;  2IWK A;  4D0K A;  4CI8 A;  5EMK B;  4JD2 C;  5IC7 A;  5GXH A;  3W15 A;  5I5I A;  3IIY A;  1PI6 A;  1U4C A;  4A2M A;  4JT5 C;  4IA9 A;  4O3U B;  3U4Y A;  5EM2 A;  3F3G A;  4XYH A;  2UZY B;  1VYH C;  5FKT A;  3FM0 A;  3J81 g;  1OMW B;  4JSX C;  1GG2 B;  3RFH A;  1S4U X;  3RN1 D;  3NVQ A;  4A09 B;  4PXW A;  2PBI B;  2XU7 A;  3I7L A;  4CY1 A;  3JZG A;  4A11 A;  4BH6 A;  1QNI A;  2HJB A;  4HDJ A;  5CXC A;  2H9N A;  2B4E A;  2H68 A;  4K3I D;  3J80 g;  1N6D A;  2H14 A;  2OK4 A;  3I8E A;  5AJA A;  3B7F A;  4O3T B;  3A0F A;  4J87 A;  2OK6 A;  2IUQ A;  4QT8 A;  3I7O A;  1SHY B;  2YNN A;  3KRW B;  5GMK n;  2B5N A;  5EM2 B;  2XL3 A;  2EBS A;  5EAP A;  2PM7 B;  1NEX B;  3ULE C;  2Z2P A;  3I7N A;  4QL1 A;  5JWZ A;  4TZ4 A;  3DXM C;  3NVX A;  3RRM C;  5FLX g;  3JAM g;  3SWS D;  5A2Q g;  5GSA A;  5K1C C;  1MG2 A;  2XL2 A;  5CXC B;  4FA4 D;  3AL8 A;  4J79 A;  2B5M A;  3C9C A;  3RN0 D;  4FWW A;  4MK0 B;  2OVQ B;  3I2N A;  1JMX B;  1XIP A;  5FKQ A;  5IJ8 E;  5EML B;  2TRC B;  1FWX A;  4YVD A;  2IWF A;  5TF2 A;  4GQ1 A;  1B9Y A;  5IGQ A;  3MMY A;  2IUR A;  2YB8 B;  3SJL D;  3I7K A;  1YFQ A;  4IMM A;  4X61 B;  2OVP B;  4JSP C;  5EMM B;  5H14 A;  3DSM A;  3HFQ A;  4J0W A;  4O45 A;  4A2L A;  2HKM A;  5GXI A;  3CFV A;  4PBZ A;  3PSC B;  3CIK B;  4A08 B;  4ERY A;  3AL8 B;  5SXM A;  4ERZ A;  3UVM A;  4X63 B;  3EWE A;  4ZOZ A;  4CZV A;  4PSX B;  3SMR A;  4A0A A;  2GC7 A;  4ZOX A;  1OLZ A;  4FA9 D;  4CI1 A;  4G56 B;  3K27 A;  2AGL A;  4X3E A;  3EU7 A;  4PBY A;  5FA5 B;  1K8K C;  4J8B A;  4JSV C;  5TDH B;  2Q7Q A;  4ZOY A;  3AH8 B;  1RI6 A;  4XYI A;  2OIZ A;  3PXS D;  5EMJ B;  1TYQ C;  3VA6 A;  2J55 H;  2P9N C;  4KFM B;  4GGA A;  2HKR A;  4I79 A;  3VGZ A;  4GGD A;  5H17 A;  2MTA H;  3L4O D;  5FXY A;  3OKY A;  4AEZ A;  4ZOV A;  4FHL A;  3OTT A;  2CE9 A;  4A0A B;  2OVR B;  4J78 A;  1P22 A;  2CE8 A;  2H6N A;  4OWR A;  1L0Q A;  2HES X;  1SQJ A;  3UVN A;  4PC0 A;  3OKW A;  2W18 A;  5AFU 3;  3EI1 A;  2H9L A;  5H1M A;  2Z2O A;  3I8C A;  4GZ8 A;  3K26 A;  4U7A A;  2I0R A;  3OW8 A;  4L3H D;  3SXT D;  5IGO A;  4CC9 A;  3BG0 A;  4J77 A;  2IUP A;  3CFS B;  5TEF A;  3OKY B;  4E54 A;  3PVU B;  4A0B B;  4ZN4 A;  4GQ2 P;  2P9P C;  5C2V B;  2AGX A;  2B5L A;  1N6F A;  3EG6 A;  3MKS B;  3RMZ D;  2YNP A;  5CXB B;  3N0D A;  3SHF A;  4A08 A;  5FKR A;  4K3J B;  3EI1 B;  3SBR A;  4CY2 A;  2J56 H;  4Z8L A;  3AL9 A;  3I89 A;  4ESG A;  2GC4 A;  3EI2 B;  3SLE D;  4L3G D;  4Y7R A;  4QQE A;  3JZN A;  4BUJ C;  2I0S A;  2UZX B;  4E54 B;  3L4M D;  3SBQ A;  1PGU A;  3RLM D;  2AH0 A;  2CN2 A;  5CYK A;  5HE2 B;  2AGW A;  4GQB B;  3IIW A;  4R7A B;  2P9U C;  2QXV A;  4GGC A;  1GXR A;  1A0R B;  1XKS A;  4AOW A;  4PNK B;  3UVK A;  1K32 A;  3SCY A;  4JXM A;  4FAV D;  2YMU A;  4E5Z A;  3PE7 A;  3MKQ A;  1B9X A;  4LGN A;  4Y5R D;  4FB1 D;  3AFC A;  4L1Q D;  4XEI C;  2PM6 B;  5HQG A;  1NR0 A;  1MDA H;  3I7H A;  2G9A A;  4N14 A;  2J57 G;  4CI2 A;  4GM9 A;  3UR4 A;  5EAR A;  4CZX A;  5IT9 g;  4H5J A;  3E0C A;  5B4W A;  5CYK B;  1ERJ A;  2HYE A;  1U2V C;  5TEE A;  4GM3 A;  3DWL C;  5AMS A;  1N6E A;  5HYN B;  4H5I A;  2HXC A;  3PXT D;  4FAN D;  3ODT A;  1GP2 B;  2P9L C;  4A0B A;  3JB9 L;  3V5W B;  1PEV A;  4E5Z B;  3ORV D;  2CN3 A;  4UI9 R;  1R5M A;  5CXB A;  2OJY A;  2PM9 B;  5I5J A;  2AGZ A;  3SBP A;  2AQ5 A;  1PBY B;  3EI4 B;  4J86 A;  3RSE C;  1GOT B;  2H6Q A;  5C2W B;  1TBG A;  2CNX A;  3P4F A;  4QRJ A;  2YBA A;  5EAL A;  4CY3 A;  3EI2 A;  3C5M A;  3DM0 A;  3JRP A;  2QC5 A;  5HE0 B;  2BCJ B;  4A7J A;  2IAA A;  3GRE A;  5THA A;  1Q47 A;  1XHM A;  2XYI A;  2G99 A;  3OKT A;  3MZK A;  3N0E A;  3EI3 A;  3IJ0 A;  1JOF A;  3GFC A;  3MXX A;  3IKO A;  2H47 A;  3SN6 B;  4J0X A;  2HJ4 A;  4O9D A;  4ES0 A;  3UKU C;  5IJ7 E;  2AH1 A;  5FKS A;  4U1E I;  3FGB A;  3PVW B;  5HE3 B;  3UKR C;  2YNO A;  2H6K A;  5KDO B;  3JPX A; 
#chains in the Genus database with same CATH topology
 2QR5 A;  4J8G A;  3I7P A;  1L5G A;  1UOP A;  3BWS A;  3DXK C;  3JZH A;  2P9K C;  5HE1 B;  4A11 B;  4FA5 D;  2CO0 A;  3IUM A;  4GM8 A;  2I0T A;  4ERQ A;  5FQD A;  2CO0 C;  2VDK A;  4J84 A;  4J73 A;  3V7D B;  3EI3 B;  4J82 A;  3JRO A;  3OL2 A;  4L9O A;  4PSW B;  2BBK H;  2H9P A;  2I3S A;  3ZE1 A;  4JSN C;  1JJU B;  4FA1 D;  3F3F A;  3EMH A;  3FRX A;  4D6V A;  2I3T A;  2P9S C;  3MZL A;  2Z2N A;  3PSL A;  1JMZ B;  2GNQ A;  4X60 B;  5K19 A;  3NVN A;  4JT6 C;  4WK0 A;  3K72 A;  4J81 A;  4LG9 A;  4EWR A;  3C75 H;  5M5V A;  3SFZ A;  4CI3 A;  3IJ1 A;  1MG3 A;  5I5M A;  2AGY A;  5E6R A;  3O4I A;  3ZWL B;  2H9M A;  5C9Z B;  1GOF A;  3RFG A;  4NSX A;  3VI4 A;  2PM9 A;  3PXW D;  4GMB A;  3UVL A;  1SQ9 A;  2P9I C;  4AMZ A;  4OZU A;  3EI4 A;  3IJC A;  3ZDZ A;  4BL0 A;  2O9K A;  3BG1 A;  3V9F A;  2H3X A;  4LG8 A;  3C99 A;  3UVO A;  4CZY A;  3OL2 B;  3EQ7 A;  4IRZ A;  3VH0 A;  3F3P A;  5EAM A;  4CY5 A;  4A09 A;  3KRX B;  2H13 A;  3OF7 A;  4O1Q D;  2IUV A;  3SVW D;  2IWK A;  4D0K A;  4CI8 A;  5EMK B;  4JD2 C;  5IC7 A;  5GXH A;  4NBM A;  3W15 A;  5I5I A;  3QHY B;  3IIY A;  1PI6 A;  1U4C A;  5M61 A;  4A2M A;  4JT5 C;  4IA9 A;  2HU7 A;  3FCU A;  4O3U B;  3U4Y A;  5EM2 A;  3F3G A;  1UOO A;  4XYH A;  2UZY B;  5E6S A;  1VYH C;  5FKT A;  2XZG A;  3FM0 A;  3J81 g;  1OMW B;  4JSX C;  1GG2 B;  3RFH A;  1S4U X;  3RN1 D;  3IVM A;  3NVQ A;  4L1M A;  4A09 B;  4DNU A;  4PXW A;  2PBI B;  2XU7 A;  3I7L A;  3ZE2 A;  4CY1 A;  3JZG A;  4A11 A;  4BH6 A;  1QNI A;  2HJB A;  4HDJ A;  5CXC A;  2H9N A;  2B4E A;  2H68 A;  2VDO A;  4K3I D;  3J80 g;  1N6D A;  2H14 A;  2OK4 A;  3I8E A;  5AJA A;  3B7F A;  3DDU A;  4G1M A;  4O3T B;  3A0F A;  4J87 A;  4AX4 A;  2OK6 A;  2IUQ A;  4QT8 A;  3I7O A;  1SHY B;  2YNN A;  3KRW B;  5GMK n;  2B5N A;  5EM2 B;  2XL3 A;  2EBS A;  2EID A;  5EAP A;  4NEN A;  2PM7 B;  4Z7Q A;  1NEX B;  3K6S A;  3ULE C;  5E6U A;  2Z2P A;  3I7N A;  4QL1 A;  5JWZ A;  1E8N A;  4TZ4 A;  4Z7N A;  4MMY A;  3DXM C;  3NVX A;  4DNV A;  3RRM C;  5FLX g;  4WK4 A;  3JAM g;  2VC2 A;  3SWS D;  5A2Q g;  5GSA A;  5K1C C;  3NID A;  1MG2 A;  2EIC A;  2XL2 A;  3EQ8 A;  5CXC B;  2EIE A;  4FA4 D;  3AL8 A;  4J79 A;  2B5M A;  3C9C A;  3RN0 D;  4FWW A;  4MK0 B;  2OVQ B;  1QFM A;  1JMX B;  3I2N A;  3MVD K;  1XIP A;  5FKQ A;  5IJ8 E;  4BP9 A;  5EML B;  4RE6 A;  3IUQ A;  4WK2 A;  2TRC B;  1FWX A;  4YVD A;  2IWF A;  5TF2 A;  4GQ1 A;  1B9Y A;  5IGQ A;  1U8C A;  4BCB A;  3MMY A;  2IUR A;  2YB8 B;  3SJL D;  3I7K A;  1YFQ A;  4WJK A;  5FFG A;  4IMM A;  3NIF A;  4X61 B;  2OVP B;  4JSP C;  5C92 A;  4BCC A;  5EMM B;  3K71 A;  3IUR A;  5H14 A;  1H2Z A;  3DSM A;  3HFQ A;  4J0W A;  4O45 A;  4A2L A;  2HKM A;  5M5U A;  5GXI A;  3CFV A;  4PBZ A;  3PSC B;  3CIK B;  5M5S A;  4A08 B;  3IJE A;  3V4P A;  4ERY A;  3AL8 B;  5SXM A;  4ERZ A;  3UVM A;  3EQ9 A;  4JHP C;  1O6F A;  4X63 B;  3EWE A;  4ZOZ A;  4CZV A;  4PSX B;  3SMR A;  4A0A A;  2GC7 A;  4ZOX A;  1OLZ A;  4FA9 D;  4CI1 A;  4G56 B;  3K27 A;  2AGL A;  4X3E A;  1E8M A;  3KCI A;  4MMX A;  2VDQ A;  1TYE A;  3EU7 A;  4PBY A;  5FA5 B;  1K8K C;  4J8B A;  4JSV C;  5TDH B;  2Q7Q A;  4ZOY A;  2BKL A;  3AH8 B;  1RI6 A;  4XYI A;  2OIZ A;  3PXS D;  5EMJ B;  2VZ1 A;  1TYQ C;  3VA6 A;  2J55 H;  2P9N C;  3NIG A;  4GGA A;  4KFM B;  2HKR A;  4I79 A;  3VGZ A;  4GGD A;  5H17 A;  2MTA H;  3L4O D;  3IUN A;  4MMZ A;  5FXY A;  3OKY A;  4UM8 A;  4AEZ A;  4ZOV A;  2EIB A;  1UOQ A;  3OTT A;  4FHL A;  2CE9 A;  4A0A B;  2OVR B;  4J78 A;  4RE5 A;  1P22 A;  2CE8 A;  2H6N A;  4OWR A;  4G1E A;  2VDN A;  1L0Q A;  1H2W A;  2HES X;  2VDM A;  4AN0 A;  1SQJ A;  1C9I A;  3T3P A;  3UVN A;  4PC0 A;  3OKW A;  2W18 A;  5AFU 3;  3EI1 A;  3VI3 A;  2H9L A;  5H1M A;  2Z2O A;  3I8C A;  4GZ8 A;  3K26 A;  4U7A A;  1YR2 A;  2I0R A;  1BPO A;  3OW8 A;  4L3H D;  3SXT D;  5IGO A;  4CC9 A;  3BG0 A;  4J77 A;  2IUP A;  3CFS B;  5TEF A;  5C86 A;  2QZP A;  3OKY B;  4JHN A;  4E54 A;  3PVU B;  4A0B B;  1JV2 A;  4ZN4 A;  4GQ2 P;  2P9P C;  5C2V B;  2AGX A;  2B5L A;  4O02 A;  1N6F A;  3EG6 A;  3MKS B;  3RMZ D;  1E5T A;  2YNP A;  5CXB B;  3N0D A;  3SHF A;  4A08 A;  2VDR A;  5FKR A;  2HU5 A;  4K3J B;  3EI1 B;  3SBR A;  3MUN A;  2J56 H;  4Z8L A;  4CY2 A;  2XDW A;  3AL9 A;  3I89 A;  4ESG A;  2HU8 A;  5HDB A;  4DNW A;  1O6G A;  2GC4 A;  3EI2 B;  4O2W A;  4NAA A;  3ZE0 A;  3ZDY A;  3SLE D;  1UTC A;  3IUL A;  4L3G D;  4Y7R A;  4QQE A;  1VZ3 A;  3JZN A;  4BUJ C;  5M5T A;  2I0S A;  2UZX B;  3GC3 B;  4E54 B;  3L4M D;  3SBQ A;  1PGU A;  3RLM D;  3MUO A;  2AH0 A;  2CN2 A;  5CYK A;  5HE2 B;  2AGW A;  4GQB B;  3IIW A;  3GD1 I;  4R7A B;  2P9U C;  2QXV A;  4GGC A;  1GXR A;  4QAM A;  1A0R B;  1XKS A;  4AOW A;  1VZ2 A;  4PNK B;  3V4V A;  3FCS A;  3UVK A;  1K32 A;  3SCY A;  4JXM A;  4FAV D;  1VE7 A;  2YMU A;  4E5Z A;  3PE7 A;  3MKQ A;  1B9X A;  4LGN A;  4Y5R D;  4FB1 D;  3AFC A;  4L1Q D;  4XEI C;  2PM6 B;  3IUJ A;  5HQG A;  1NR0 A;  1MDA H;  3QI0 A;  3I7H A;  1A12 A;  2G9A A;  4N14 A;  2J57 G;  4CI2 A;  4Z7O A;  4GM9 A;  1H2Y A;  3UR4 A;  5EAR A;  4CZX A;  5IT9 g;  4H5J A;  3E0C A;  5B4W A;  1H2X A;  5CYK B;  1ERJ A;  4AN1 A;  2HYE A;  1U2V C;  2VDP A;  5TEE A;  4GM3 A;  3DWL C;  4G55 A;  5AMS A;  4UM9 A;  4AMY A;  1N6E A;  1JTD B;  5HYN B;  4H5I A;  1GOH A;  2HXC A;  3PXT D;  4FAN D;  3ODT A;  5FFO A;  4BCD A;  1GP2 B;  2P9L C;  4A0B A;  3JB9 L;  4NC4 A;  3V5W B;  1PEV A;  4E5Z B;  3ORV D;  2CN3 A;  4UI9 R;  1I2M B;  1C9L A;  1R5M A;  5CXB A;  2OJY A;  2PM9 B;  5M5R A;  5I5J A;  2AGZ A;  3SBP A;  2AQ5 A;  1PBY B;  3EI4 B;  3T3M A;  4J86 A;  3RSE C;  1M1X A;  1GOT B;  2H6Q A;  5C2W B;  1TBG A;  2CNX A;  3P4F A;  4QRJ A;  2YBA A;  5EAL A;  4CY3 A;  3EI2 A;  3C5M A;  3O4H A;  3DM0 A;  3JRP A;  2QC5 A;  5HE0 B;  2BCJ B;  4A7J A;  2IAA A;  3GRE A;  5THA A;  2JKX A;  2XE4 A;  1T2X A;  1K3I A;  1Q47 A;  1XHM A;  2XYI A;  2G99 A;  3OKT A;  2WQ8 A;  4BP8 A;  4D9S A;  1VE6 A;  3N0E A;  3MZK A;  3EI3 A;  3IJ0 A;  1JOF A;  3GFC A;  2VDL A;  3MXX A;  3IKO A;  1GOG A;  2H47 A;  3SN6 B;  4J0X A;  1QFS A;  2HJ4 A;  3O4G A;  2VZ3 A;  4O9D A;  4ES0 A;  3UKU C;  5IJ7 E;  2AH1 A;  5FKS A;  4U1E I;  3FGB A;  3PVW B;  5HE3 B;  3UKR C;  3O4J A;  2YNO A;  2H6K A;  3ZDX A;  5KDO B;  3JPX A; 
#chains in the Genus database with same CATH homology
 4J8G A;  3I7P A;  3BWS A;  3DXK C;  3JZH A;  2P9K C;  5HE1 B;  4A11 B;  4FA5 D;  2CO0 A;  4GM8 A;  2I0T A;  4ERQ A;  5FQD A;  2CO0 C;  4J84 A;  4J73 A;  3V7D B;  3EI3 B;  4J82 A;  3JRO A;  3OL2 A;  4L9O A;  4PSW B;  2BBK H;  2H9P A;  2I3S A;  4JSN C;  1JJU B;  4FA1 D;  3F3F A;  3EMH A;  3FRX A;  4D6V A;  2I3T A;  2P9S C;  3MZL A;  2Z2N A;  3PSL A;  1JMZ B;  2GNQ A;  4X60 B;  5K19 A;  3NVN A;  4JT6 C;  4J81 A;  4LG9 A;  4EWR A;  3C75 H;  3SFZ A;  4CI3 A;  3IJ1 A;  1MG3 A;  5I5M A;  2AGY A;  3ZWL B;  2H9M A;  5C9Z B;  3RFG A;  4NSX A;  2PM9 A;  3PXW D;  4GMB A;  3UVL A;  1SQ9 A;  2P9I C;  4OZU A;  3EI4 A;  3IJC A;  4BL0 A;  2O9K A;  3BG1 A;  3V9F A;  2H3X A;  4LG8 A;  3C99 A;  3UVO A;  4CZY A;  3OL2 B;  3VH0 A;  3F3P A;  5EAM A;  4CY5 A;  4A09 A;  3KRX B;  2H13 A;  4O1Q D;  3SVW D;  2IUV A;  2IWK A;  4D0K A;  4CI8 A;  5EMK B;  4JD2 C;  5IC7 A;  5GXH A;  3W15 A;  5I5I A;  3IIY A;  1PI6 A;  1U4C A;  4A2M A;  4JT5 C;  4IA9 A;  4O3U B;  3U4Y A;  5EM2 A;  3F3G A;  4XYH A;  2UZY B;  1VYH C;  5FKT A;  3FM0 A;  3J81 g;  1OMW B;  4JSX C;  1GG2 B;  3RFH A;  1S4U X;  3RN1 D;  3NVQ A;  4A09 B;  4PXW A;  2PBI B;  2XU7 A;  3I7L A;  4CY1 A;  3JZG A;  4A11 A;  4BH6 A;  1QNI A;  2HJB A;  4HDJ A;  5CXC A;  2H9N A;  2B4E A;  2H68 A;  4K3I D;  3J80 g;  1N6D A;  2H14 A;  2OK4 A;  3I8E A;  5AJA A;  3B7F A;  4O3T B;  3A0F A;  4J87 A;  2OK6 A;  2IUQ A;  4QT8 A;  3I7O A;  1SHY B;  2YNN A;  3KRW B;  5GMK n;  2B5N A;  5EM2 B;  2XL3 A;  2EBS A;  5EAP A;  2PM7 B;  1NEX B;  3ULE C;  2Z2P A;  3I7N A;  4QL1 A;  5JWZ A;  4TZ4 A;  3DXM C;  3NVX A;  3RRM C;  5FLX g;  3JAM g;  3SWS D;  5A2Q g;  5GSA A;  5K1C C;  1MG2 A;  2XL2 A;  5CXC B;  4FA4 D;  3AL8 A;  4J79 A;  2B5M A;  3C9C A;  3RN0 D;  4FWW A;  4MK0 B;  2OVQ B;  3I2N A;  1JMX B;  1XIP A;  5FKQ A;  5IJ8 E;  5EML B;  2TRC B;  1FWX A;  4YVD A;  2IWF A;  5TF2 A;  4GQ1 A;  1B9Y A;  5IGQ A;  3MMY A;  2IUR A;  2YB8 B;  3SJL D;  3I7K A;  1YFQ A;  4IMM A;  4X61 B;  2OVP B;  4JSP C;  5EMM B;  5H14 A;  3DSM A;  3HFQ A;  4J0W A;  4O45 A;  4A2L A;  2HKM A;  5GXI A;  3CFV A;  4PBZ A;  3PSC B;  3CIK B;  4A08 B;  4ERY A;  3AL8 B;  5SXM A;  4ERZ A;  3UVM A;  4X63 B;  3EWE A;  4ZOZ A;  4CZV A;  4PSX B;  3SMR A;  4A0A A;  2GC7 A;  4ZOX A;  1OLZ A;  4FA9 D;  4CI1 A;  4G56 B;  3K27 A;  2AGL A;  4X3E A;  3EU7 A;  4PBY A;  5FA5 B;  1K8K C;  4J8B A;  4JSV C;  5TDH B;  2Q7Q A;  4ZOY A;  3AH8 B;  1RI6 A;  4XYI A;  2OIZ A;  3PXS D;  5EMJ B;  1TYQ C;  3VA6 A;  2J55 H;  2P9N C;  4KFM B;  4GGA A;  2HKR A;  4I79 A;  3VGZ A;  4GGD A;  5H17 A;  2MTA H;  3L4O D;  5FXY A;  3OKY A;  4AEZ A;  4ZOV A;  4FHL A;  3OTT A;  2CE9 A;  4A0A B;  2OVR B;  4J78 A;  1P22 A;  2CE8 A;  2H6N A;  4OWR A;  1L0Q A;  2HES X;  1SQJ A;  3UVN A;  4PC0 A;  3OKW A;  2W18 A;  5AFU 3;  3EI1 A;  2H9L A;  5H1M A;  2Z2O A;  3I8C A;  4GZ8 A;  3K26 A;  4U7A A;  2I0R A;  3OW8 A;  4L3H D;  3SXT D;  5IGO A;  4CC9 A;  3BG0 A;  4J77 A;  2IUP A;  3CFS B;  5TEF A;  3OKY B;  4E54 A;  3PVU B;  4A0B B;  4ZN4 A;  4GQ2 P;  2P9P C;  5C2V B;  2AGX A;  2B5L A;  1N6F A;  3EG6 A;  3MKS B;  3RMZ D;  2YNP A;  5CXB B;  3N0D A;  3SHF A;  4A08 A;  5FKR A;  4K3J B;  3EI1 B;  3SBR A;  4CY2 A;  2J56 H;  4Z8L A;  3AL9 A;  3I89 A;  4ESG A;  2GC4 A;  3EI2 B;  3SLE D;  4L3G D;  4Y7R A;  4QQE A;  3JZN A;  4BUJ C;  2I0S A;  2UZX B;  4E54 B;  3L4M D;  3SBQ A;  1PGU A;  3RLM D;  2AH0 A;  2CN2 A;  5CYK A;  5HE2 B;  2AGW A;  4GQB B;  3IIW A;  4R7A B;  2P9U C;  2QXV A;  4GGC A;  1GXR A;  1A0R B;  1XKS A;  4AOW A;  4PNK B;  3UVK A;  1K32 A;  3SCY A;  4JXM A;  4FAV D;  2YMU A;  4E5Z A;  3PE7 A;  3MKQ A;  1B9X A;  4LGN A;  4Y5R D;  4FB1 D;  3AFC A;  4L1Q D;  4XEI C;  2PM6 B;  5HQG A;  1NR0 A;  1MDA H;  3I7H A;  2G9A A;  4N14 A;  2J57 G;  4CI2 A;  4GM9 A;  3UR4 A;  5EAR A;  4CZX A;  5IT9 g;  4H5J A;  3E0C A;  5B4W A;  5CYK B;  1ERJ A;  2HYE A;  1U2V C;  5TEE A;  4GM3 A;  3DWL C;  5AMS A;  1N6E A;  5HYN B;  4H5I A;  2HXC A;  3PXT D;  4FAN D;  3ODT A;  1GP2 B;  2P9L C;  4A0B A;  3JB9 L;  3V5W B;  1PEV A;  4E5Z B;  3ORV D;  2CN3 A;  4UI9 R;  1R5M A;  5CXB A;  2OJY A;  2PM9 B;  5I5J A;  2AGZ A;  3SBP A;  2AQ5 A;  1PBY B;  3EI4 B;  4J86 A;  3RSE C;  1GOT B;  2H6Q A;  5C2W B;  1TBG A;  2CNX A;  3P4F A;  4QRJ A;  2YBA A;  5EAL A;  4CY3 A;  3EI2 A;  3C5M A;  3DM0 A;  3JRP A;  2QC5 A;  5HE0 B;  2BCJ B;  4A7J A;  2IAA A;  3GRE A;  5THA A;  1Q47 A;  1XHM A;  2XYI A;  2G99 A;  3OKT A;  3MZK A;  3N0E A;  3EI3 A;  3IJ0 A;  1JOF A;  3GFC A;  3MXX A;  3IKO A;  2H47 A;  3SN6 B;  4J0X A;  2HJ4 A;  4O9D A;  4ES0 A;  3UKU C;  5IJ7 E;  2AH1 A;  5FKS A;  4U1E I;  3FGB A;  3PVW B;  5HE3 B;  3UKR C;  2YNO A;  2H6K A;  5KDO B;  3JPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...