4JT5C

Mtordeltan-mlst8-pp242 complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
317
structure length
317
Chain Sequence
b'VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 75
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jt5C01
1P22A 4JSPC 4GGCA 1SQJA 4LG8A 1YFQA 5EARA 4GM9A 3BWSA 4A2MA 3PXSD 4I79A 4ZN4A 3PE7A 4PBYA 3GFCA 4JT6C 4CZVA 2AGLA 3J81g 1ERJA 2CO0A 4LG9A 4E54B 2G99A 2Z2NA 4FAVD 4X63B 3SJLD 3OKTA 5EMJB 3ORVD 2HJBA 2HKRA 3NVQA 5THAA 4BH6A 3VH0A 4CI2A 2OVRB 3CFSB 4IMMA 5FKRA 4A09B 5IC7A 5HYNB 5HE2B 4JXMA 5I5IA 4FA5D 2H9PA 3MXXA 4J0WA 3V9FA 4TZ4A 2H13A 4BUJC 3L4MD 5CYKB 1OLZA 4PNKB 2YNOA 4A0AA 3F3FA 2MTAH 2J57G 4O1QD 5TEFA 3MZKA 4J84A 4PBZA 3EI2B 4FHLA 3C5MA 3E0CA 4XEIC 1K8KC 2IURA 1OMWB 4GGAA 3OKYB 3U4YA 3UVMA 2G9AA 2OIZA 3FRXA 3RN0D 2HXCA 3C99A 4QL1A 3IIYA 4ES0A 2H68A 4ZOYA 2W18A 5GXIA 4NSXA 5JWZA 2TRCB 4L3GD 1JMXB 3OL2B 4A11A 4K3JB 5TF2A 3PVWB 2HESX 3K26A 3MKQA 4H5JA 5H14A 3MZLA 3I7KA 3FM0A 2IWKA 4X61B 3UVLA 5EAMA 2P9IC 5FLXg 5FA5B 4AOWA 4ZOXA 4ERYA 3I7NA 2I0SA 2GNQA 3AFCA 4X3EA 4J82A 4CC9A 3KRWB 1L0QA 3F3GA 2XL2A 3EU7A 3SHFA 2P9SC 1GOTB 2AH0A 3AL8B 3EI3B 4J86A 3EI1B 4X60B 3UVOA 1PI6A 3C9CA 3N0DA 2HYEA 2H9LA 3OW8A 3UKUC 2XL3A 2YMUA 3RRMC 3RMZD 4ERZA 3I8EA 1U4CA 4OZUA 4GGDA 5CXCB 4AEZA 3NVNA 5AFU3 3UR4A 4ZOVA 4E54A 1XIPA 3I7HA 1FWXA 3SN6B 4J8BA 3BG1A 5GSAA 4J8GA 3SXTD 5B4WA 5AJAA 3EMHA 3V5WB 3JZNA 1K32A 2H6QA 3F3PA 4H5IA 5EMLB 2CE8A 4KFMB 2I3SA 4A09A 1GP2B 4EWRA 5FKQA 4Y7RA 3ODTA 4XYHA 4UI9R 4GZ8A 3IJ1A 2I0TA 2H6NA 3SBQA 1TBGA 3PSLA 5CYKA 5H17A 2YB8B 3P4FA 2OK6A 2AQ5A 3JZHA 2P9NC 4J79A 5EAPA 5GXHA 4QT8A 4O3UB 4FA1D 1QNIA 3AH8B 2EBSA 4GQBB 5FKTA 2CN2A 3DXMC 4GQ1A 3EI2A 3OKWA 4J73A 3I7PA 4O9DA 4GQ2P 1RI6A 3DM0A 3EG6A 3OKYA 2AH1A 2CN3A 1MG3A 5IJ8E 2Z2OA 2H47A 2UZXB 3ZWLB 4JT5C 2P9KC 5IGQA 2B4EA 4A08B 1VYHC 2H3XA 2IUQA 2Q7QA 4GMBA 1XHMA 4J78A 1MDAH 1SHYB 4J81A 3OL2A 4L3HD 1A0RB 3DSMA 3SWSD 2P9LC 2QXVA 4FA9D 3MMYA 2CE9A 4O45A 5IJ7E 2B5MA 3PSCB 4PSXB 3DWLC 3IIWA 4BL0A 2YNNA 3ULEC 4L9OA 3L4OD 1JMZB 3I7LA 2GC7A 1B9XA 4CZXA 1JOFA 3EI4B 3I89A 5CXBB 5K19A 2YNPA 5IT9g 3AL8A 3EI3A 2OVPB 1PBYB 3FGBA 4CI8A 3EI1A 4E5ZB 3IKOA 2UZYB 3CFVA 3UVKA 4Y5RD 1PEVA 3SLED 3IJCA 2H6KA 3DXKC 5EM2B 2IWFA 4CY3A 3SMRA 3NVXA 3A0FA 3PXTD 4A7JA 5CXCA 4D0KA 4QRJA 5EMKB 3PVUB 5K1CC 1B9YA 2B5LA 3RSEC 1U2VC 5EALA 3JROA 2O9KA 5TEEA 2BCJB 4U7AA 3RFHA 2CNXA 3MKSB 4ESGA 4OWRA 4YVDA 2IUVA 3RFGA 2AGWA 2B5NA 1MG2A 4JSNC 3OTTA 4A0BB 3JRPA 4FA4D 4J0XA 4PXWA 2PM9B 1R5MA 1NR0A 4J87A 4PSWB 2AGZA 3B7FA 4JSXC 3CIKB 4QQEA 2I3TA 3J80g 3GREA 4CI3A 3C75H 3PXWD 2PM7B 3JB9L 2OJYA 3V7DB 3EWEA 1N6EA 4D6VA 4A08A 4PC0A 4L1QD 3KRXB 2IAAA 2I0RA 5HE1B 5FXYA 3UKRC 4J77A 5EMMB 4O3TB 3SVWD 5TDHB 4XYIA 4CY2A 1XKSA 2CO0C 1TYQC 1Q47A 4ERQA 3SBRA 1GXRA 3SBPA 3SFZA 3I7OA 3K27A 2AGYA 4CY1A 1GG2B 3JZGA 2GC4A 2PBIB 1PGUA 4A0AB 1S4UX 3IJ0A 4FB1D 1JJUB 3EI4A 3RLMD 5I5JA 3I8CA 3HFQA 2H14A 2H9NA 5CXBA 2AGXA 3W15A 5IGOA 5GMKn 4E5ZA 5A2Qg 4ZOZA 5C2WB 5H1MA 3BG0A 2HKMA 5HE3B 4CZYA 4A2LA 5HQGA 2Z2PA 2XYIA 2OK4A 3AL9A 2IUPA 2OVQB 5EM2A 4JSVC 4IA9A 4CI1A 5C9ZB 4FWWA 2QC5A 1NEXB 5FKSA 2XU7A 4A11B 4K3ID 2PM6B 2P9PC 2H9MA 4N14A 1N6FA 3JPXA 2J56H 2HJ4A 3VA6A 4HDJA 2YBAA 4GM8A 5C2VB 2P9UC 5SXMA 4FAND 4G56B 3SCYA 4CY5A 3I2NA 4JD2C 4R7AB 5FQDA 2BBKH 4A0BA 5AMSA 3UVNA 3VGZA 4LGNA 3N0EA 3JAMg 2PM9A 4Z8LA 4MK0B 5KDOB 5HE0B 2J55H 5I5MA 1SQ9A 4U1EI 1N6DA 3RN1D 4GM3A
chains in the Genus database with same CATH superfamily
1P22A 2JKXA 4JSPC 4GGCA 3DDUA 1SQJA 4LG8A 1YFQA 4WK4A 3ZE0A 5EARA 4GM9A 3BWSA 4A2MA 3PXSD 1A12A 4I79A 4ZN4A 3PE7A 4PBYA 3GFCA 4JT6C 3IUJA 3ZDZA 3KCIA 2AGLA 4CZVA 3J81g 3ZDYA 1ERJA 2CO0A 4LG9A 4E54B 2G99A 2WQ8A 3O4JA 2Z2NA 4FAVD 4X63B 2QZPA 3SJLD 4BCCA 3OKTA 5EMJB 3ORVD 4NC4A 2HJBA 2HKRA 3NVQA 5THAA 1K3IA 3GC3B 4BH6A 3VH0A 4CI2A 2OVRB 3CFSB 4IMMA 5FKRA 4A09B 5IC7A 5HYNB 5HE2B 4JXMA 5I5IA 4FA5D 2H9PA 3MXXA 4J0WA 3V9FA 4TZ4A 2H13A 3EQ8A 1TYEA 3ZE2A 4BUJC 3L4MD 5CYKB 1OLZA 4PNKB 2YNOA 1E8MA 4A0AA 3F3FA 1QFMA 2MTAH 2J57G 4O1QD 5TEFA 3MZKA 4J84A 4PBZA 5C92A 3EI2B 4L1MA 4FHLA 3IUMA 3C5MA 3E0CA 4XEIC 1K8KC 4WK0A 2IURA 1OMWB 4GGAA 3OKYB 3U4YA 3UVMA 1H2WA 2G9AA 1L5GA 2OIZA 3FRXA 3RN0D 2HXCA 3C99A 3NIGA 5FFOA 3V4PA 4QL1A 3IIYA 4ES0A 3NIFA 2H68A 4JHNA 4ZOYA 2HU5A 2W18A 5E6UA 5GXIA 4AN1A 4NSXA 5JWZA 2TRCB 5E6RA 1E8NA 4L3GD 1JMXB 3OL2B 4A11A 4K3JB 5TF2A 3PVWB 2HESX 1H2ZA 3K26A 3MKQA 4H5JA 4UM8A 5H14A 3MZLA 1JTDB 3I7KA 3FM0A 4G1MA 2IWKA 4X61B 3UVLA 5EAMA 2P9IC 5FLXg 5FA5B 1M1XA 4AOWA 4ZOXA 4ERYA 3I7NA 2I0SA 2GNQA 3AFCA 3FCUA 4X3EA 4J82A 3K6SA 4CC9A 3KRWB 1L0QA 1E5TA 4AX4A 3F3GA 2XL2A 5E6SA 3EU7A 3SHFA 2P9SC 4AMZA 3MVDK 1GOTB 2AH0A 3AL8B 3EI3B 5M5VA 4J86A 3EI1B 4X60B 1O6GA 3UVOA 1PI6A 3C9CA 3N0DA 2HYEA 2H9LA 3OW8A 3UKUC 2XL3A 2YMUA 3RRMC 2XZGA 3RMZD 4ERZA 3FCSA 3I8EA 3IULA 3IURA 1U4CA 4OZUA 4GGDA 5CXCB 4AEZA 3NVNA 5AFU3 3UR4A 4ZOVA 4E54A 1XIPA 3I7HA 1FWXA 3SN6B 4J8BA 3BG1A 4DNVA 5GSAA 4J8GA 3SXTD 4UM9A 5B4WA 5AJAA 3EMHA 3V5WB 3JZNA 1K32A 2H6QA 3F3PA 4H5IA 5EMLB 2CE8A 4KFMB 2I3SA 4A09A 1GP2B 4EWRA 4RE5A 2VZ1A 4BCDA 5FKQA 4Y7RA 3ODTA 4XYHA 4UI9R 4GZ8A 3IJ1A 2I0TA 2H6NA 3SBQA 1JV2A 1TBGA 3PSLA 5CYKA 5H17A 2YB8B 3P4FA 2OK6A 2AQ5A 3NIDA 3JZHA 3EQ7A 2P9NC 2EIEA 4J79A 5EAPA 5GXHA 4QT8A 3T3PA 4O3UB 4FA1D 1UOQA 1QNIA 2XDWA 3AH8B 2EIDA 2EBSA 4GQBB 3O4HA 5FKTA 2CN2A 3DXMC 4GQ1A 3EI2A 1UOOA 3IUQA 3OKWA 4J73A 3I7PA 4O2WA 4O9DA 4GQ2P 1RI6A 3DM0A 3EG6A 3OKYA 2AH1A 2CN3A 1MG3A 5IJ8E 2Z2OA 2H47A 2UZXB 3ZWLB 4JT5C 2P9KC 4Z7OA 5IGQA 2B4EA 4A08B 1VYHC 4QAMA 2H3XA 2IUQA 2Q7QA 4GMBA 1XHMA 4J78A 1MDAH 1UOPA 1SHYB 4J81A 3OL2A 3IJEA 4L3HD 1A0RB 3DSMA 3SWSD 2P9LC 2QXVA 2BKLA 4FA9D 3MMYA 2CE9A 4O45A 5IJ7E 2B5MA 3PSCB 4PSXB 3DWLC 3IIWA 3QI0A 4BP9A 4BL0A 2YNNA 3ULEC 4L9OA 3L4OD 1JMZB 4RE6A 3I7LA 2GC7A 1B9XA 4CZXA 1JOFA 3EI4B 3I89A 2EIBA 5CXBB 5K19A 2YNPA 5IT9g 3AL8A 3EI3A 2OVPB 1PBYB 3FGBA 4Z7NA 4CI8A 3EI1A 4E5ZB 1I2MB 3IKOA 3MUOA 3OF7A 4AN0A 2UZYB 1U8CA 3CFVA 5HDBA 4Y5RD 3UVKA 1PEVA 3SLED 3IJCA 2H6KA 3DXKC 5EM2B 1C9IA 2IWFA 4CY3A 5FFGA 3SMRA 3NVXA 1YR2A 3A0FA 3PXTD 4A7JA 5CXCA 4D0KA 2VDPA 5M5TA 4MMXA 5M61A 4G55A 1GOFA 2VDQA 2VDRA 4QRJA 5EMKB 3PVUB 1VZ2A 5K1CC 1B9YA 2B5LA 3RSEC 1U2VC 3K72A 3O4GA 5EALA 3JROA 1C9LA 2O9KA 4WK2A 1QFSA 5TEEA 2BCJB 4U7AA 3RFHA 2CNXA 3MKSB 4ESGA 4OWRA 4YVDA 2IUVA 3RFGA 2EICA 3VI3A 2AGWA 2B5NA 1MG2A 4O02A 3IUNA 4JSNC 3OTTA 4A0BB 3JRPA 4FA4D 4J0XA 4AMYA 4PXWA 2PM9B 1R5MA 2VDKA 3MUNA 1VE6A 1NR0A 4J87A 4PSWB 2AGZA 2VDMA 3B7FA 5M5SA 4JSXC 3CIKB 4QQEA 2I3TA 3J80g 3GREA 4CI3A 3C75H 3PXWD 4G1EA 4MMZA 2PM7B 3JB9L 4D9SA 2OJYA 3V7DB 1H2XA 3EWEA 1GOHA 1N6EA 4D6VA 4A08A 4PC0A 4L1QD 3KRXB 2IAAA 2I0RA 4MMYA 5HE1B 5FXYA 3UKRC 4J77A 2HU8A 5EMMB 4O3TB 3SVWD 5TDHB 2HU7A 4XYIA 2XE4A 4CY2A 1XKSA 2CO0C 1T2XA 1TYQC 1Q47A 3T3MA 3SBRA 4ERQA 1GXRA 2VC2A 3SBPA 3SFZA 3I7OA 3K27A 2VDOA 2AGYA 4CY1A 1GG2B 3JZGA 4NAAA 2GC4A 2PBIB 1PGUA 1H2YA 4DNUA 4A0AB 1S4UX 3IJ0A 4FB1D 1JJUB 3EI4A 3RLMD 5I5JA 3I8CA 3HFQA 2H14A 2H9NA 5CXBA 2AGXA 1GOGA 3VI4A 3W15A 5IGOA 5GMKn 3GD1I 4JHPC 4E5ZA 4Z7QA 5A2Qg 4ZOZA 2VDNA 5C2WB 5H1MA 3BG0A 1VZ3A 2HKMA 5HE3B 1VE7A 4A2LA 4CZYA 5C86A 5HQGA 2Z2PA 2XYIA 2OK4A 3AL9A 2IUPA 2OVQB 5EM2A 4JSVC 3ZE1A 4IA9A 4CI1A 2VDLA 3O4IA 5C9ZB 5M5RA 4FWWA 2QC5A 1NEXB 3EQ9A 5FKSA 2XU7A 4A11B 4K3ID 2PM6B 2P9PC 4NBMA 2H9MA 3V4VA 4N14A 1N6FA 3JPXA 1O6FA 2J56H 2HJ4A 3VA6A 4HDJA 2YBAA 4GM8A 3ZDXA 5C2VB 2P9UC 5SXMA 4FAND 4G56B 3SCYA 4CY5A 4BCBA 2VZ3A 3I2NA 4BP8A 4IRZA 4JD2C 4DNWA 4R7AB 3QHYB 2QR5A 3K71A 5FQDA 5M5UA 2BBKH 4A0BA 5AMSA 3IVMA 3UVNA 3VGZA 1UTCA 4LGNA 4WJKA 3N0EA 1BPOA 3JAMg 2PM9A 4Z8LA 4MK0B 5KDOB 4NENA 5HE0B 2J55H 5I5MA 1SQ9A 4U1EI 1N6DA 3RN1D 4GM3A
chains in the Genus database with same CATH topology
1P22A 4JSPC 4GGCA 1SQJA 4LG8A 1YFQA 5EARA 4GM9A 3BWSA 4A2MA 3PXSD 4I79A 4ZN4A 3PE7A 4PBYA 3GFCA 4JT6C 4CZVA 2AGLA 3J81g 1ERJA 2CO0A 4LG9A 4E54B 2G99A 2Z2NA 4FAVD 4X63B 3SJLD 3OKTA 5EMJB 3ORVD 2HJBA 2HKRA 3NVQA 5THAA 4BH6A 3VH0A 4CI2A 2OVRB 3CFSB 4IMMA 5FKRA 4A09B 5IC7A 5HYNB 5HE2B 4JXMA 5I5IA 4FA5D 2H9PA 3MXXA 4J0WA 3V9FA 4TZ4A 2H13A 4BUJC 3L4MD 5CYKB 1OLZA 4PNKB 2YNOA 4A0AA 3F3FA 2MTAH 2J57G 4O1QD 5TEFA 3MZKA 4J84A 4PBZA 3EI2B 4FHLA 3C5MA 3E0CA 4XEIC 1K8KC 2IURA 1OMWB 4GGAA 3OKYB 3U4YA 3UVMA 2G9AA 2OIZA 3FRXA 3RN0D 2HXCA 3C99A 4QL1A 3IIYA 4ES0A 2H68A 4ZOYA 2W18A 5GXIA 4NSXA 5JWZA 2TRCB 4L3GD 1JMXB 3OL2B 4A11A 4K3JB 5TF2A 3PVWB 2HESX 3K26A 3MKQA 4H5JA 5H14A 3MZLA 3I7KA 3FM0A 2IWKA 4X61B 3UVLA 5EAMA 2P9IC 5FLXg 5FA5B 4AOWA 4ZOXA 4ERYA 3I7NA 2I0SA 2GNQA 3AFCA 4X3EA 4J82A 4CC9A 3KRWB 1L0QA 3F3GA 2XL2A 3EU7A 3SHFA 2P9SC 1GOTB 2AH0A 3AL8B 3EI3B 4J86A 3EI1B 4X60B 3UVOA 1PI6A 3C9CA 3N0DA 2HYEA 2H9LA 3OW8A 3UKUC 2XL3A 2YMUA 3RRMC 3RMZD 4ERZA 3I8EA 1U4CA 4OZUA 4GGDA 5CXCB 4AEZA 3NVNA 5AFU3 3UR4A 4ZOVA 4E54A 1XIPA 3I7HA 1FWXA 3SN6B 4J8BA 3BG1A 5GSAA 4J8GA 3SXTD 5B4WA 5AJAA 3EMHA 3V5WB 3JZNA 1K32A 2H6QA 3F3PA 4H5IA 5EMLB 2CE8A 4KFMB 2I3SA 4A09A 1GP2B 4EWRA 5FKQA 4Y7RA 3ODTA 4XYHA 4UI9R 4GZ8A 3IJ1A 2I0TA 2H6NA 3SBQA 1TBGA 3PSLA 5CYKA 5H17A 2YB8B 3P4FA 2OK6A 2AQ5A 3JZHA 2P9NC 4J79A 5EAPA 5GXHA 4QT8A 4O3UB 4FA1D 1QNIA 3AH8B 2EBSA 4GQBB 5FKTA 2CN2A 3DXMC 4GQ1A 3EI2A 3OKWA 4J73A 3I7PA 4O9DA 4GQ2P 1RI6A 3DM0A 3EG6A 3OKYA 2AH1A 2CN3A 1MG3A 5IJ8E 2Z2OA 2H47A 2UZXB 3ZWLB 4JT5C 2P9KC 5IGQA 2B4EA 4A08B 1VYHC 2H3XA 2IUQA 2Q7QA 4GMBA 1XHMA 4J78A 1MDAH 1SHYB 4J81A 3OL2A 4L3HD 1A0RB 3DSMA 3SWSD 2P9LC 2QXVA 4FA9D 3MMYA 2CE9A 4O45A 5IJ7E 2B5MA 3PSCB 4PSXB 3DWLC 3IIWA 4BL0A 2YNNA 3ULEC 4L9OA 3L4OD 1JMZB 3I7LA 2GC7A 1B9XA 4CZXA 1JOFA 3EI4B 3I89A 5CXBB 5K19A 2YNPA 5IT9g 3AL8A 3EI3A 2OVPB 1PBYB 3FGBA 4CI8A 3EI1A 4E5ZB 3IKOA 2UZYB 3CFVA 3UVKA 4Y5RD 1PEVA 3SLED 3IJCA 2H6KA 3DXKC 5EM2B 2IWFA 4CY3A 3SMRA 3NVXA 3A0FA 3PXTD 4A7JA 5CXCA 4D0KA 4QRJA 5EMKB 3PVUB 5K1CC 1B9YA 2B5LA 3RSEC 1U2VC 5EALA 3JROA 2O9KA 5TEEA 2BCJB 4U7AA 3RFHA 2CNXA 3MKSB 4ESGA 4OWRA 4YVDA 2IUVA 3RFGA 2AGWA 2B5NA 1MG2A 4JSNC 3OTTA 4A0BB 3JRPA 4FA4D 4J0XA 4PXWA 2PM9B 1R5MA 1NR0A 4J87A 4PSWB 2AGZA 3B7FA 4JSXC 3CIKB 4QQEA 2I3TA 3J80g 3GREA 4CI3A 3C75H 3PXWD 2PM7B 3JB9L 2OJYA 3V7DB 3EWEA 1N6EA 4D6VA 4A08A 4PC0A 4L1QD 3KRXB 2IAAA 2I0RA 5HE1B 5FXYA 3UKRC 4J77A 5EMMB 4O3TB 3SVWD 5TDHB 4XYIA 4CY2A 1XKSA 2CO0C 1TYQC 1Q47A 4ERQA 3SBRA 1GXRA 3SBPA 3SFZA 3I7OA 3K27A 2AGYA 4CY1A 1GG2B 3JZGA 2GC4A 2PBIB 1PGUA 4A0AB 1S4UX 3IJ0A 4FB1D 1JJUB 3EI4A 3RLMD 5I5JA 3I8CA 3HFQA 2H14A 2H9NA 5CXBA 2AGXA 3W15A 5IGOA 5GMKn 4E5ZA 5A2Qg 4ZOZA 5C2WB 5H1MA 3BG0A 2HKMA 5HE3B 4CZYA 4A2LA 5HQGA 2Z2PA 2XYIA 2OK4A 3AL9A 2IUPA 2OVQB 5EM2A 4JSVC 4IA9A 4CI1A 5C9ZB 4FWWA 2QC5A 1NEXB 5FKSA 2XU7A 4A11B 4K3ID 2PM6B 2P9PC 2H9MA 4N14A 1N6FA 3JPXA 2J56H 2HJ4A 3VA6A 4HDJA 2YBAA 4GM8A 5C2VB 2P9UC 5SXMA 4FAND 4G56B 3SCYA 4CY5A 3I2NA 4JD2C 4R7AB 5FQDA 2BBKH 4A0BA 5AMSA 3UVNA 3VGZA 4LGNA 3N0EA 3JAMg 2PM9A 4Z8LA 4MK0B 5KDOB 5HE0B 2J55H 5I5MA 1SQ9A 4U1EI 1N6DA 3RN1D 4GM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P22 A;  4JSP C;  4GGC A;  1SQJ A;  4LG8 A;  1YFQ A;  5EAR A;  4GM9 A;  3BWS A;  4A2M A;  3PXS D;  4I79 A;  4ZN4 A;  3PE7 A;  4PBY A;  3GFC A;  4JT6 C;  4CZV A;  2AGL A;  3J81 g;  1ERJ A;  2CO0 A;  4LG9 A;  4E54 B;  2G99 A;  2Z2N A;  4FAV D;  4X63 B;  3SJL D;  3OKT A;  5EMJ B;  3ORV D;  2HJB A;  2HKR A;  3NVQ A;  5THA A;  4BH6 A;  3VH0 A;  4CI2 A;  2OVR B;  3CFS B;  4IMM A;  5FKR A;  4A09 B;  5IC7 A;  5HYN B;  5HE2 B;  4JXM A;  5I5I A;  4FA5 D;  2H9P A;  3MXX A;  4J0W A;  3V9F A;  4TZ4 A;  2H13 A;  4BUJ C;  3L4M D;  5CYK B;  1OLZ A;  4PNK B;  2YNO A;  4A0A A;  3F3F A;  2MTA H;  2J57 G;  4O1Q D;  5TEF A;  3MZK A;  4J84 A;  4PBZ A;  3EI2 B;  4FHL A;  3C5M A;  3E0C A;  4XEI C;  1K8K C;  2IUR A;  1OMW B;  4GGA A;  3OKY B;  3U4Y A;  3UVM A;  2G9A A;  2OIZ A;  3FRX A;  3RN0 D;  2HXC A;  3C99 A;  4QL1 A;  3IIY A;  4ES0 A;  2H68 A;  4ZOY A;  2W18 A;  5GXI A;  4NSX A;  5JWZ A;  2TRC B;  4L3G D;  1JMX B;  3OL2 B;  4A11 A;  4K3J B;  5TF2 A;  3PVW B;  2HES X;  3K26 A;  3MKQ A;  4H5J A;  5H14 A;  3MZL A;  3I7K A;  3FM0 A;  2IWK A;  4X61 B;  3UVL A;  5EAM A;  2P9I C;  5FLX g;  5FA5 B;  4AOW A;  4ZOX A;  4ERY A;  3I7N A;  2I0S A;  2GNQ A;  3AFC A;  4X3E A;  4J82 A;  4CC9 A;  3KRW B;  1L0Q A;  3F3G A;  2XL2 A;  3EU7 A;  3SHF A;  2P9S C;  1GOT B;  2AH0 A;  3AL8 B;  3EI3 B;  4J86 A;  3EI1 B;  4X60 B;  3UVO A;  1PI6 A;  3C9C A;  3N0D A;  2HYE A;  2H9L A;  3OW8 A;  3UKU C;  2XL3 A;  2YMU A;  3RRM C;  3RMZ D;  4ERZ A;  3I8E A;  1U4C A;  4OZU A;  4GGD A;  5CXC B;  4AEZ A;  3NVN A;  5AFU 3;  3UR4 A;  4ZOV A;  4E54 A;  1XIP A;  3I7H A;  1FWX A;  3SN6 B;  4J8B A;  3BG1 A;  5GSA A;  4J8G A;  3SXT D;  5B4W A;  5AJA A;  3EMH A;  3V5W B;  3JZN A;  1K32 A;  2H6Q A;  3F3P A;  4H5I A;  5EML B;  2CE8 A;  4KFM B;  2I3S A;  4A09 A;  1GP2 B;  4EWR A;  5FKQ A;  4Y7R A;  3ODT A;  4XYH A;  4UI9 R;  4GZ8 A;  3IJ1 A;  2I0T A;  2H6N A;  3SBQ A;  1TBG A;  3PSL A;  5CYK A;  5H17 A;  2YB8 B;  3P4F A;  2OK6 A;  2AQ5 A;  3JZH A;  2P9N C;  4J79 A;  5EAP A;  5GXH A;  4QT8 A;  4O3U B;  4FA1 D;  1QNI A;  3AH8 B;  2EBS A;  4GQB B;  5FKT A;  2CN2 A;  3DXM C;  4GQ1 A;  3EI2 A;  3OKW A;  4J73 A;  3I7P A;  4O9D A;  4GQ2 P;  1RI6 A;  3DM0 A;  3EG6 A;  3OKY A;  2AH1 A;  2CN3 A;  1MG3 A;  5IJ8 E;  2Z2O A;  2H47 A;  2UZX B;  3ZWL B;  4JT5 C;  2P9K C;  5IGQ A;  2B4E A;  4A08 B;  1VYH C;  2H3X A;  2IUQ A;  2Q7Q A;  4GMB A;  1XHM A;  4J78 A;  1MDA H;  1SHY B;  4J81 A;  3OL2 A;  4L3H D;  1A0R B;  3DSM A;  3SWS D;  2P9L C;  2QXV A;  4FA9 D;  3MMY A;  2CE9 A;  4O45 A;  5IJ7 E;  2B5M A;  3PSC B;  4PSX B;  3DWL C;  3IIW A;  4BL0 A;  2YNN A;  3ULE C;  4L9O A;  3L4O D;  1JMZ B;  3I7L A;  2GC7 A;  1B9X A;  4CZX A;  1JOF A;  3EI4 B;  3I89 A;  5CXB B;  5K19 A;  2YNP A;  5IT9 g;  3AL8 A;  3EI3 A;  2OVP B;  1PBY B;  3FGB A;  4CI8 A;  3EI1 A;  4E5Z B;  3IKO A;  2UZY B;  3CFV A;  3UVK A;  4Y5R D;  1PEV A;  3SLE D;  3IJC A;  2H6K A;  3DXK C;  5EM2 B;  2IWF A;  4CY3 A;  3SMR A;  3NVX A;  3A0F A;  3PXT D;  4A7J A;  5CXC A;  4D0K A;  4QRJ A;  5EMK B;  3PVU B;  5K1C C;  1B9Y A;  2B5L A;  3RSE C;  1U2V C;  5EAL A;  3JRO A;  2O9K A;  5TEE A;  2BCJ B;  4U7A A;  3RFH A;  2CNX A;  3MKS B;  4ESG A;  4OWR A;  4YVD A;  2IUV A;  3RFG A;  2AGW A;  2B5N A;  1MG2 A;  4JSN C;  3OTT A;  4A0B B;  3JRP A;  4FA4 D;  4J0X A;  4PXW A;  2PM9 B;  1R5M A;  1NR0 A;  4J87 A;  4PSW B;  2AGZ A;  3B7F A;  4JSX C;  3CIK B;  4QQE A;  2I3T A;  3J80 g;  3GRE A;  4CI3 A;  3C75 H;  3PXW D;  2PM7 B;  3JB9 L;  2OJY A;  3V7D B;  3EWE A;  1N6E A;  4D6V A;  4A08 A;  4PC0 A;  4L1Q D;  3KRX B;  2IAA A;  2I0R A;  5HE1 B;  5FXY A;  3UKR C;  4J77 A;  5EMM B;  4O3T B;  3SVW D;  5TDH B;  4XYI A;  4CY2 A;  1XKS A;  2CO0 C;  1TYQ C;  1Q47 A;  4ERQ A;  3SBR A;  1GXR A;  3SBP A;  3SFZ A;  3I7O A;  3K27 A;  2AGY A;  4CY1 A;  1GG2 B;  3JZG A;  2GC4 A;  2PBI B;  1PGU A;  4A0A B;  1S4U X;  3IJ0 A;  4FB1 D;  1JJU B;  3EI4 A;  3RLM D;  5I5J A;  3I8C A;  3HFQ A;  2H14 A;  2H9N A;  5CXB A;  2AGX A;  3W15 A;  5IGO A;  5GMK n;  4E5Z A;  5A2Q g;  4ZOZ A;  5C2W B;  5H1M A;  3BG0 A;  2HKM A;  5HE3 B;  4CZY A;  4A2L A;  5HQG A;  2Z2P A;  2XYI A;  2OK4 A;  3AL9 A;  2IUP A;  2OVQ B;  5EM2 A;  4JSV C;  4IA9 A;  4CI1 A;  5C9Z B;  4FWW A;  2QC5 A;  1NEX B;  5FKS A;  2XU7 A;  4A11 B;  4K3I D;  2PM6 B;  2P9P C;  2H9M A;  4N14 A;  1N6F A;  3JPX A;  2J56 H;  2HJ4 A;  3VA6 A;  4HDJ A;  2YBA A;  4GM8 A;  5C2V B;  2P9U C;  5SXM A;  4FAN D;  4G56 B;  3SCY A;  4CY5 A;  3I2N A;  4JD2 C;  4R7A B;  5FQD A;  2BBK H;  4A0B A;  5AMS A;  3UVN A;  3VGZ A;  4LGN A;  3N0E A;  3JAM g;  2PM9 A;  4Z8L A;  4MK0 B;  5KDO B;  5HE0 B;  2J55 H;  5I5M A;  1SQ9 A;  4U1E I;  1N6D A;  3RN1 D;  4GM3 A; 
#chains in the Genus database with same CATH topology
 1P22 A;  2JKX A;  4JSP C;  4GGC A;  3DDU A;  1SQJ A;  4LG8 A;  1YFQ A;  4WK4 A;  3ZE0 A;  5EAR A;  4GM9 A;  3BWS A;  4A2M A;  3PXS D;  1A12 A;  4I79 A;  4ZN4 A;  3PE7 A;  4PBY A;  3GFC A;  4JT6 C;  3IUJ A;  3ZDZ A;  3KCI A;  2AGL A;  4CZV A;  3J81 g;  3ZDY A;  1ERJ A;  2CO0 A;  4LG9 A;  4E54 B;  2G99 A;  2WQ8 A;  3O4J A;  2Z2N A;  4FAV D;  4X63 B;  2QZP A;  3SJL D;  4BCC A;  3OKT A;  5EMJ B;  3ORV D;  4NC4 A;  2HJB A;  2HKR A;  3NVQ A;  5THA A;  1K3I A;  3GC3 B;  4BH6 A;  3VH0 A;  4CI2 A;  2OVR B;  3CFS B;  4IMM A;  5FKR A;  4A09 B;  5IC7 A;  5HYN B;  5HE2 B;  4JXM A;  5I5I A;  4FA5 D;  2H9P A;  3MXX A;  4J0W A;  3V9F A;  4TZ4 A;  2H13 A;  3EQ8 A;  1TYE A;  3ZE2 A;  4BUJ C;  3L4M D;  5CYK B;  1OLZ A;  4PNK B;  2YNO A;  1E8M A;  4A0A A;  3F3F A;  1QFM A;  2MTA H;  2J57 G;  4O1Q D;  5TEF A;  3MZK A;  4J84 A;  4PBZ A;  5C92 A;  3EI2 B;  4L1M A;  4FHL A;  3IUM A;  3C5M A;  3E0C A;  4XEI C;  1K8K C;  4WK0 A;  2IUR A;  1OMW B;  4GGA A;  3OKY B;  3U4Y A;  3UVM A;  1H2W A;  2G9A A;  1L5G A;  2OIZ A;  3FRX A;  3RN0 D;  2HXC A;  3C99 A;  3NIG A;  5FFO A;  3V4P A;  4QL1 A;  3IIY A;  4ES0 A;  3NIF A;  2H68 A;  4JHN A;  4ZOY A;  2HU5 A;  2W18 A;  5E6U A;  5GXI A;  4AN1 A;  4NSX A;  5JWZ A;  2TRC B;  5E6R A;  1E8N A;  4L3G D;  1JMX B;  3OL2 B;  4A11 A;  4K3J B;  5TF2 A;  3PVW B;  2HES X;  1H2Z A;  3K26 A;  3MKQ A;  4H5J A;  4UM8 A;  5H14 A;  3MZL A;  1JTD B;  3I7K A;  3FM0 A;  4G1M A;  2IWK A;  4X61 B;  3UVL A;  5EAM A;  2P9I C;  5FLX g;  5FA5 B;  1M1X A;  4AOW A;  4ZOX A;  4ERY A;  3I7N A;  2I0S A;  2GNQ A;  3AFC A;  3FCU A;  4X3E A;  4J82 A;  3K6S A;  4CC9 A;  3KRW B;  1L0Q A;  1E5T A;  4AX4 A;  3F3G A;  2XL2 A;  5E6S A;  3EU7 A;  3SHF A;  2P9S C;  4AMZ A;  3MVD K;  1GOT B;  2AH0 A;  3AL8 B;  3EI3 B;  5M5V A;  4J86 A;  3EI1 B;  4X60 B;  1O6G A;  3UVO A;  1PI6 A;  3C9C A;  3N0D A;  2HYE A;  2H9L A;  3OW8 A;  3UKU C;  2XL3 A;  2YMU A;  3RRM C;  2XZG A;  3RMZ D;  4ERZ A;  3FCS A;  3I8E A;  3IUL A;  3IUR A;  1U4C A;  4OZU A;  4GGD A;  5CXC B;  4AEZ A;  3NVN A;  5AFU 3;  3UR4 A;  4ZOV A;  4E54 A;  1XIP A;  3I7H A;  1FWX A;  3SN6 B;  4J8B A;  3BG1 A;  4DNV A;  5GSA A;  4J8G A;  3SXT D;  4UM9 A;  5B4W A;  5AJA A;  3EMH A;  3V5W B;  3JZN A;  1K32 A;  2H6Q A;  3F3P A;  4H5I A;  5EML B;  2CE8 A;  4KFM B;  2I3S A;  4A09 A;  1GP2 B;  4EWR A;  4RE5 A;  2VZ1 A;  4BCD A;  5FKQ A;  4Y7R A;  3ODT A;  4XYH A;  4UI9 R;  4GZ8 A;  3IJ1 A;  2I0T A;  2H6N A;  3SBQ A;  1JV2 A;  1TBG A;  3PSL A;  5CYK A;  5H17 A;  2YB8 B;  3P4F A;  2OK6 A;  2AQ5 A;  3NID A;  3JZH A;  3EQ7 A;  2P9N C;  2EIE A;  4J79 A;  5EAP A;  5GXH A;  4QT8 A;  3T3P A;  4O3U B;  4FA1 D;  1UOQ A;  1QNI A;  2XDW A;  3AH8 B;  2EID A;  2EBS A;  4GQB B;  3O4H A;  5FKT A;  2CN2 A;  3DXM C;  4GQ1 A;  3EI2 A;  1UOO A;  3IUQ A;  3OKW A;  4J73 A;  3I7P A;  4O2W A;  4O9D A;  4GQ2 P;  1RI6 A;  3DM0 A;  3EG6 A;  3OKY A;  2AH1 A;  2CN3 A;  1MG3 A;  5IJ8 E;  2Z2O A;  2H47 A;  2UZX B;  3ZWL B;  4JT5 C;  2P9K C;  4Z7O A;  5IGQ A;  2B4E A;  4A08 B;  1VYH C;  4QAM A;  2H3X A;  2IUQ A;  2Q7Q A;  4GMB A;  1XHM A;  4J78 A;  1MDA H;  1UOP A;  1SHY B;  4J81 A;  3OL2 A;  3IJE A;  4L3H D;  1A0R B;  3DSM A;  3SWS D;  2P9L C;  2QXV A;  2BKL A;  4FA9 D;  3MMY A;  2CE9 A;  4O45 A;  5IJ7 E;  2B5M A;  3PSC B;  4PSX B;  3DWL C;  3IIW A;  3QI0 A;  4BP9 A;  4BL0 A;  2YNN A;  3ULE C;  4L9O A;  3L4O D;  1JMZ B;  4RE6 A;  3I7L A;  2GC7 A;  1B9X A;  4CZX A;  1JOF A;  3EI4 B;  3I89 A;  2EIB A;  5CXB B;  5K19 A;  2YNP A;  5IT9 g;  3AL8 A;  3EI3 A;  2OVP B;  1PBY B;  3FGB A;  4Z7N A;  4CI8 A;  3EI1 A;  4E5Z B;  1I2M B;  3IKO A;  3MUO A;  3OF7 A;  4AN0 A;  2UZY B;  1U8C A;  3CFV A;  5HDB A;  4Y5R D;  3UVK A;  1PEV A;  3SLE D;  3IJC A;  2H6K A;  3DXK C;  5EM2 B;  1C9I A;  2IWF A;  4CY3 A;  5FFG A;  3SMR A;  3NVX A;  1YR2 A;  3A0F A;  3PXT D;  4A7J A;  5CXC A;  4D0K A;  2VDP A;  5M5T A;  4MMX A;  5M61 A;  4G55 A;  1GOF A;  2VDQ A;  2VDR A;  4QRJ A;  5EMK B;  3PVU B;  1VZ2 A;  5K1C C;  1B9Y A;  2B5L A;  3RSE C;  1U2V C;  3K72 A;  3O4G A;  5EAL A;  3JRO A;  1C9L A;  2O9K A;  4WK2 A;  1QFS A;  5TEE A;  2BCJ B;  4U7A A;  3RFH A;  2CNX A;  3MKS B;  4ESG A;  4OWR A;  4YVD A;  2IUV A;  3RFG A;  2EIC A;  3VI3 A;  2AGW A;  2B5N A;  1MG2 A;  4O02 A;  3IUN A;  4JSN C;  3OTT A;  4A0B B;  3JRP A;  4FA4 D;  4J0X A;  4AMY A;  4PXW A;  2PM9 B;  1R5M A;  2VDK A;  3MUN A;  1VE6 A;  1NR0 A;  4J87 A;  4PSW B;  2AGZ A;  2VDM A;  3B7F A;  5M5S A;  4JSX C;  3CIK B;  4QQE A;  2I3T A;  3J80 g;  3GRE A;  4CI3 A;  3C75 H;  3PXW D;  4G1E A;  4MMZ A;  2PM7 B;  3JB9 L;  4D9S A;  2OJY A;  3V7D B;  1H2X A;  3EWE A;  1GOH A;  1N6E A;  4D6V A;  4A08 A;  4PC0 A;  4L1Q D;  3KRX B;  2IAA A;  2I0R A;  4MMY A;  5HE1 B;  5FXY A;  3UKR C;  4J77 A;  2HU8 A;  5EMM B;  4O3T B;  3SVW D;  5TDH B;  2HU7 A;  4XYI A;  2XE4 A;  4CY2 A;  1XKS A;  2CO0 C;  1T2X A;  1TYQ C;  1Q47 A;  3T3M A;  3SBR A;  4ERQ A;  1GXR A;  2VC2 A;  3SBP A;  3SFZ A;  3I7O A;  3K27 A;  2VDO A;  2AGY A;  4CY1 A;  1GG2 B;  3JZG A;  4NAA A;  2GC4 A;  2PBI B;  1PGU A;  1H2Y A;  4DNU A;  4A0A B;  1S4U X;  3IJ0 A;  4FB1 D;  1JJU B;  3EI4 A;  3RLM D;  5I5J A;  3I8C A;  3HFQ A;  2H14 A;  2H9N A;  5CXB A;  2AGX A;  1GOG A;  3VI4 A;  3W15 A;  5IGO A;  5GMK n;  3GD1 I;  4JHP C;  4E5Z A;  4Z7Q A;  5A2Q g;  4ZOZ A;  2VDN A;  5C2W B;  5H1M A;  3BG0 A;  1VZ3 A;  2HKM A;  5HE3 B;  1VE7 A;  4A2L A;  4CZY A;  5C86 A;  5HQG A;  2Z2P A;  2XYI A;  2OK4 A;  3AL9 A;  2IUP A;  2OVQ B;  5EM2 A;  4JSV C;  3ZE1 A;  4IA9 A;  4CI1 A;  2VDL A;  3O4I A;  5C9Z B;  5M5R A;  4FWW A;  2QC5 A;  1NEX B;  3EQ9 A;  5FKS A;  2XU7 A;  4A11 B;  4K3I D;  2PM6 B;  2P9P C;  4NBM A;  2H9M A;  3V4V A;  4N14 A;  1N6F A;  3JPX A;  1O6F A;  2J56 H;  2HJ4 A;  3VA6 A;  4HDJ A;  2YBA A;  4GM8 A;  3ZDX A;  5C2V B;  2P9U C;  5SXM A;  4FAN D;  4G56 B;  3SCY A;  4CY5 A;  4BCB A;  2VZ3 A;  3I2N A;  4BP8 A;  4IRZ A;  4JD2 C;  4DNW A;  4R7A B;  3QHY B;  2QR5 A;  3K71 A;  5FQD A;  5M5U A;  2BBK H;  4A0B A;  5AMS A;  3IVM A;  3UVN A;  3VGZ A;  1UTC A;  4LGN A;  4WJK A;  3N0E A;  1BPO A;  3JAM g;  2PM9 A;  4Z8L A;  4MK0 B;  5KDO B;  4NEN A;  5HE0 B;  2J55 H;  5I5M A;  1SQ9 A;  4U1E I;  1N6D A;  3RN1 D;  4GM3 A; 
#chains in the Genus database with same CATH homology
 1P22 A;  4JSP C;  4GGC A;  1SQJ A;  4LG8 A;  1YFQ A;  5EAR A;  4GM9 A;  3BWS A;  4A2M A;  3PXS D;  4I79 A;  4ZN4 A;  3PE7 A;  4PBY A;  3GFC A;  4JT6 C;  4CZV A;  2AGL A;  3J81 g;  1ERJ A;  2CO0 A;  4LG9 A;  4E54 B;  2G99 A;  2Z2N A;  4FAV D;  4X63 B;  3SJL D;  3OKT A;  5EMJ B;  3ORV D;  2HJB A;  2HKR A;  3NVQ A;  5THA A;  4BH6 A;  3VH0 A;  4CI2 A;  2OVR B;  3CFS B;  4IMM A;  5FKR A;  4A09 B;  5IC7 A;  5HYN B;  5HE2 B;  4JXM A;  5I5I A;  4FA5 D;  2H9P A;  3MXX A;  4J0W A;  3V9F A;  4TZ4 A;  2H13 A;  4BUJ C;  3L4M D;  5CYK B;  1OLZ A;  4PNK B;  2YNO A;  4A0A A;  3F3F A;  2MTA H;  2J57 G;  4O1Q D;  5TEF A;  3MZK A;  4J84 A;  4PBZ A;  3EI2 B;  4FHL A;  3C5M A;  3E0C A;  4XEI C;  1K8K C;  2IUR A;  1OMW B;  4GGA A;  3OKY B;  3U4Y A;  3UVM A;  2G9A A;  2OIZ A;  3FRX A;  3RN0 D;  2HXC A;  3C99 A;  4QL1 A;  3IIY A;  4ES0 A;  2H68 A;  4ZOY A;  2W18 A;  5GXI A;  4NSX A;  5JWZ A;  2TRC B;  4L3G D;  1JMX B;  3OL2 B;  4A11 A;  4K3J B;  5TF2 A;  3PVW B;  2HES X;  3K26 A;  3MKQ A;  4H5J A;  5H14 A;  3MZL A;  3I7K A;  3FM0 A;  2IWK A;  4X61 B;  3UVL A;  5EAM A;  2P9I C;  5FLX g;  5FA5 B;  4AOW A;  4ZOX A;  4ERY A;  3I7N A;  2I0S A;  2GNQ A;  3AFC A;  4X3E A;  4J82 A;  4CC9 A;  3KRW B;  1L0Q A;  3F3G A;  2XL2 A;  3EU7 A;  3SHF A;  2P9S C;  1GOT B;  2AH0 A;  3AL8 B;  3EI3 B;  4J86 A;  3EI1 B;  4X60 B;  3UVO A;  1PI6 A;  3C9C A;  3N0D A;  2HYE A;  2H9L A;  3OW8 A;  3UKU C;  2XL3 A;  2YMU A;  3RRM C;  3RMZ D;  4ERZ A;  3I8E A;  1U4C A;  4OZU A;  4GGD A;  5CXC B;  4AEZ A;  3NVN A;  5AFU 3;  3UR4 A;  4ZOV A;  4E54 A;  1XIP A;  3I7H A;  1FWX A;  3SN6 B;  4J8B A;  3BG1 A;  5GSA A;  4J8G A;  3SXT D;  5B4W A;  5AJA A;  3EMH A;  3V5W B;  3JZN A;  1K32 A;  2H6Q A;  3F3P A;  4H5I A;  5EML B;  2CE8 A;  4KFM B;  2I3S A;  4A09 A;  1GP2 B;  4EWR A;  5FKQ A;  4Y7R A;  3ODT A;  4XYH A;  4UI9 R;  4GZ8 A;  3IJ1 A;  2I0T A;  2H6N A;  3SBQ A;  1TBG A;  3PSL A;  5CYK A;  5H17 A;  2YB8 B;  3P4F A;  2OK6 A;  2AQ5 A;  3JZH A;  2P9N C;  4J79 A;  5EAP A;  5GXH A;  4QT8 A;  4O3U B;  4FA1 D;  1QNI A;  3AH8 B;  2EBS A;  4GQB B;  5FKT A;  2CN2 A;  3DXM C;  4GQ1 A;  3EI2 A;  3OKW A;  4J73 A;  3I7P A;  4O9D A;  4GQ2 P;  1RI6 A;  3DM0 A;  3EG6 A;  3OKY A;  2AH1 A;  2CN3 A;  1MG3 A;  5IJ8 E;  2Z2O A;  2H47 A;  2UZX B;  3ZWL B;  4JT5 C;  2P9K C;  5IGQ A;  2B4E A;  4A08 B;  1VYH C;  2H3X A;  2IUQ A;  2Q7Q A;  4GMB A;  1XHM A;  4J78 A;  1MDA H;  1SHY B;  4J81 A;  3OL2 A;  4L3H D;  1A0R B;  3DSM A;  3SWS D;  2P9L C;  2QXV A;  4FA9 D;  3MMY A;  2CE9 A;  4O45 A;  5IJ7 E;  2B5M A;  3PSC B;  4PSX B;  3DWL C;  3IIW A;  4BL0 A;  2YNN A;  3ULE C;  4L9O A;  3L4O D;  1JMZ B;  3I7L A;  2GC7 A;  1B9X A;  4CZX A;  1JOF A;  3EI4 B;  3I89 A;  5CXB B;  5K19 A;  2YNP A;  5IT9 g;  3AL8 A;  3EI3 A;  2OVP B;  1PBY B;  3FGB A;  4CI8 A;  3EI1 A;  4E5Z B;  3IKO A;  2UZY B;  3CFV A;  3UVK A;  4Y5R D;  1PEV A;  3SLE D;  3IJC A;  2H6K A;  3DXK C;  5EM2 B;  2IWF A;  4CY3 A;  3SMR A;  3NVX A;  3A0F A;  3PXT D;  4A7J A;  5CXC A;  4D0K A;  4QRJ A;  5EMK B;  3PVU B;  5K1C C;  1B9Y A;  2B5L A;  3RSE C;  1U2V C;  5EAL A;  3JRO A;  2O9K A;  5TEE A;  2BCJ B;  4U7A A;  3RFH A;  2CNX A;  3MKS B;  4ESG A;  4OWR A;  4YVD A;  2IUV A;  3RFG A;  2AGW A;  2B5N A;  1MG2 A;  4JSN C;  3OTT A;  4A0B B;  3JRP A;  4FA4 D;  4J0X A;  4PXW A;  2PM9 B;  1R5M A;  1NR0 A;  4J87 A;  4PSW B;  2AGZ A;  3B7F A;  4JSX C;  3CIK B;  4QQE A;  2I3T A;  3J80 g;  3GRE A;  4CI3 A;  3C75 H;  3PXW D;  2PM7 B;  3JB9 L;  2OJY A;  3V7D B;  3EWE A;  1N6E A;  4D6V A;  4A08 A;  4PC0 A;  4L1Q D;  3KRX B;  2IAA A;  2I0R A;  5HE1 B;  5FXY A;  3UKR C;  4J77 A;  5EMM B;  4O3T B;  3SVW D;  5TDH B;  4XYI A;  4CY2 A;  1XKS A;  2CO0 C;  1TYQ C;  1Q47 A;  4ERQ A;  3SBR A;  1GXR A;  3SBP A;  3SFZ A;  3I7O A;  3K27 A;  2AGY A;  4CY1 A;  1GG2 B;  3JZG A;  2GC4 A;  2PBI B;  1PGU A;  4A0A B;  1S4U X;  3IJ0 A;  4FB1 D;  1JJU B;  3EI4 A;  3RLM D;  5I5J A;  3I8C A;  3HFQ A;  2H14 A;  2H9N A;  5CXB A;  2AGX A;  3W15 A;  5IGO A;  5GMK n;  4E5Z A;  5A2Q g;  4ZOZ A;  5C2W B;  5H1M A;  3BG0 A;  2HKM A;  5HE3 B;  4CZY A;  4A2L A;  5HQG A;  2Z2P A;  2XYI A;  2OK4 A;  3AL9 A;  2IUP A;  2OVQ B;  5EM2 A;  4JSV C;  4IA9 A;  4CI1 A;  5C9Z B;  4FWW A;  2QC5 A;  1NEX B;  5FKS A;  2XU7 A;  4A11 B;  4K3I D;  2PM6 B;  2P9P C;  2H9M A;  4N14 A;  1N6F A;  3JPX A;  2J56 H;  2HJ4 A;  3VA6 A;  4HDJ A;  2YBA A;  4GM8 A;  5C2V B;  2P9U C;  5SXM A;  4FAN D;  4G56 B;  3SCY A;  4CY5 A;  3I2N A;  4JD2 C;  4R7A B;  5FQD A;  2BBK H;  4A0B A;  5AMS A;  3UVN A;  3VGZ A;  4LGN A;  3N0E A;  3JAM g;  2PM9 A;  4Z8L A;  4MK0 B;  5KDO B;  5HE0 B;  2J55 H;  5I5M A;  1SQ9 A;  4U1E I;  1N6D A;  3RN1 D;  4GM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...