4JT6C

Structure of mtordeltan-mlst8-pi-103 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
molecule keywords mTOR
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 70
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jt6C01
3AL8A 2YNOA 4L1QD 4ESGA 4AEZA 3HFQA 3N0EA 3SVWD 2OK6A 4PSXB 2CO0C 4L3GD 4X60B 4E5ZB 3VA6A 5EALA 2CN3A 5EAPA 2I0RA 4Z8LA 3PVUB 4J82A 4MK0B 5K19A 5IGOA 2GC4A 1NEXB 5H1MA 4N14A 4ERYA 4FA1D 2H9PA 1GOTB 2HKRA 1P22A 2OJYA 4A08A 3NVNA 2YBAA 2UZXB 5SXMA 4A09B 2AGLA 3J81g 4J8BA 1GXRA 2J57G 3UKRC 3C99A 3ORVD 3PSCB 3OTTA 2J56H 4GM8A 3DWLC 4JSPC 3JB9L 4QT8A 2XL3A 4O1QD 4A11A 4JSXC 1OMWB 4GQ1A 3RFHA 4ZN4A 2B4EA 4J87A 2YB8B 5C9ZB 5EAMA 4A0AA 2CO0A 2B5LA 3EI3A 3SJLD 3MXXA 1SQ9A 4X61B 4CI2A 1B9XA 3EI2B 2YNPA 2PBIB 4J78A 3NVXA 4ES0A 3UR4A 2P9IC 4IMMA 4JT6C 2I0TA 1TYQC 4JT5C 2QC5A 4J81A 4A2MA 3FRXA 1R5MA 2OVRB 4FWWA 2H6QA 4Y7RA 3DM0A 2PM9A 1PGUA 4ZOZA 2G99A 3OKYB 3PSLA 3I89A 5IGQA 3OW8A 2Z2PA 3V9FA 2CNXA 3I8CA 4L9OA 5TEEA 5I5IA 5A2Qg 5EM2B 4O3TB 4G56B 3MKSB 5EMKB 4NSXA 1TBGA 1XHMA 3CIKB 3MKQA 2XYIA 3MZKA 2H14A 3DXKC 3IJ1A 1S4UX 3OKWA 2H47A 3I7PA 5JWZA 4A0BB 3F3PA 5FKSA 1JOFA 2IUVA 4BL0A 2H9MA 4A0AB 4XYIA 3JPXA 4ZOXA 3EI3B 1B9YA 5H17A 1OLZA 3K26A 5H14A 4FA9D 1PI6A 3IJ0A 4PC0A 4J8GA 1GG2B 2PM7B 5TEFA 2MTAH 3JZGA 1VYHC 1SQJA 4PBZA 5GSAA 5IJ7E 1GP2B 3C9CA 3W15A 4CC9A 2YNNA 5TDHB 2CE9A 5HQGA 4ERZA 2PM9B 2W18A 3NVQA 2OIZA 3VH0A 2Q7QA 3F3GA 4J0WA 3EMHA 4JD2C 4IA9A 5THAA 4QL1A 5AJAA 5CYKA 1RI6A 2H9NA 3RFGA 2H6NA 5EMMB 4CY3A 4HDJA 4TZ4A 4FAVD 2OVPB 5GMKn 5EMLB 3EI4B 3V5WB 2P9UC 3K27A 4CI8A 5HE0B 1MDAH 4A7JA 3FGBA 3PXWD 3UVMA 5HE3B 3AL9A 4CY2A 2GNQA 2OK4A 3AL8B 4ZOYA 2BBKH 2I0SA 4XEIC 3JAMg 3I8EA 3UVKA 4EWRA 4GZ8A 2H6KA 3EWEA 1QNIA 4O45A 4Y5RD 3U4YA 2YMUA 2AGYA 3A0FA 4LG8A 1JMXB 4H5JA 2CN2A 2IUPA 2AH0A 5EARA 3V7DB 3IIWA 1K32A 3KRWB 4PXWA 5FXYA 1U4CA 4FA4D 2H13A 4O9DA 3EI1A 5I5JA 3OL2A 2J55H 4CZYA 5HYNB 3JZNA 3SCYA 3EG6A 4GGDA 2H68A 3I7HA 2H9LA 4H5IA 3JRPA 2HXCA 3SXTD 4BUJC 4A08B 2HJBA 4GMBA 5B4WA 2OVQB 2CE8A 2TRCB 4GM3A 3AH8B 4D6VA 2AGXA 1ERJA 4GM9A 2UZYB 3SHFA 4E5ZA 5IC7A 5CXBA 4CY1A 1FWXA 2O9KA 5K1CC 4FB1D 5CXCA 3DSMA 3I2NA 3SFZA 4QRJA 3SMRA 1XKSA 4A11B 3IJCA 1K8KC 4J84A 3I7NA 2B5MA 3BG0A 1MG3A 3C5MA 2P9SC 4UI9R 2BCJB 3CFVA 3MZLA 3JZHA 4J79A 3KRXB 3J80g 1L0QA 4GGCA 4ZOVA 1N6EA 2AGZA 2EBSA 2IAAA 3OL2B 2HYEA 2P9PC 1JJUB 4L3HD 3E0CA 4U1EI 1N6FA 2P9KC 2AGWA 3PE7A 4CY5A 4J73A 3DXMC 3SWSD 2I3TA 3CFSB 3UKUC 1MG2A 4YVDA 3BG1A 2QXVA 3B7FA 4LG9A 4LGNA 3VGZA 5CXBB 4FA5D 3JROA 3F3FA 3EI2A 5EMJB 5CXCB 3PVWB 4CZXA 3IKOA 1JMZB 4PSWB 4OZUA 2GC7A 1PEVA 3ODTA 3GFCA 1SHYB 3GREA 1Q47A 4ERQA 4JSNC 3ULEC 2I3SA 4R7AB 5GXHA 5FKQA 3OKYA 5FQDA 2AH1A 3P4FA 4J77A 3RN0D 2IWFA 4BH6A 4CI1A 4A2LA 5FA5B 2XL2A 5EM2A 4X63B 2Z2NA 4CZVA 2IWKA 5HE2B 3IIYA 5FKRA 3N0DA 4X3EA 2G9AA 3C75H 4CI3A 4OWRA 4FHLA 3FM0A 3MMYA 4A0BA 3L4MD 4K3ID 5C2VB 3PXTD 1YFQA 4E54A 4J86A 2AQ5A 2HJ4A 5CYKB 2HESX 3AFCA 1PBYB 2HKMA 2P9NC 4QQEA 2P9LC 1NR0A 3SLED 4XYHA 2IURA 5TF2A 5GXIA 3SBPA 3OKTA 3I7LA 2Z2OA 4PNKB 5IJ8E 3I7OA 3SN6B 4J0XA 3I7KA 3SBRA 4K3JB 4GQBB 5I5MA 4KFMB 5AMSA 5FLXg 4O3UB 3UVLA 5IT9g 1XIPA 4U7AA 3ZWLB 2XU7A 4GGAA 4D0KA 3BWSA 3RRMC 5C2WB 3RMZD 5KDOB 4A09A 4JXMA 5HE1B 3PXSD 5FKTA 4AOWA 3SBQA 1N6DA 4I79A 3RLMD 3L4OD 2IUQA 2H3XA 4GQ2P 3RN1D 4PBYA 3EI4A 3RSEC 2PM6B 3EU7A 3EI1B 3UVOA 2B5NA 5AFU3 1U2VC 3UVNA 1A0RB 4JSVC 4FAND 4E54B
chains in the Genus database with same CATH superfamily
1K3IA 2EIEA 3AL8A 2YNOA 4L1QD 4ESGA 4AEZA 3HFQA 3N0EA 1UOPA 3SVWD 2OK6A 4MMYA 4PSXB 2CO0C 4L3GD 4X60B 4O2WA 2VDRA 5EALA 2CN3A 2VZ3A 3VA6A 4E5ZB 5EAPA 1H2YA 2I0RA 4Z8LA 3PVUB 2XZGA 4J82A 4MK0B 5K19A 5IGOA 2GC4A 3FCUA 1NEXB 5H1MA 4N14A 4ERYA 4FA1D 2H9PA 3EQ7A 1GOTB 2HKRA 1P22A 2OJYA 4NBMA 4A08A 3NVNA 2YBAA 2UZXB 1M1XA 5SXMA 4A09B 2AGLA 3J81g 2VDOA 4J8BA 1GXRA 2J57G 3UKRC 3GC3B 3C99A 3ORVD 2HU5A 2VDQA 3PSCB 1UTCA 3OF7A 3OTTA 2VDMA 2J56H 4GM8A 3DWLC 4JSPC 3JB9L 4QT8A 2XL3A 4O1QD 4A11A 4JSXC 5M5SA 1OMWB 4GQ1A 4AMYA 3RFHA 4ZN4A 3K71A 2B4EA 4J87A 4AX4A 2YB8B 2HU8A 5C9ZB 5EAMA 4A0AA 2CO0A 2B5LA 3EI3A 3GD1I 1UOOA 5M61A 3SJLD 5C86A 1UOQA 1I2MB 3MXXA 1SQ9A 4X61B 4CI2A 3EQ9A 4BP9A 1B9XA 3EI2B 1C9IA 5E6RA 2YNPA 3NIDA 5M5RA 2PBIB 4J78A 3NVXA 4ES0A 4DNVA 3IUQA 3UR4A 2P9IC 4IMMA 4JT6C 2I0TA 5E6SA 1TYQC 1YR2A 4JT5C 2QC5A 4AN0A 4J81A 3ZE0A 4A2MA 3FRXA 1R5MA 2OVRB 4FWWA 2H6QA 4Y7RA 3DM0A 2PM9A 1PGUA 4ZOZA 4NC4A 2G99A 3OKYB 3VI3A 3PSLA 3I89A 5IGQA 3OW8A 2Z2PA 3V4PA 3V9FA 2CNXA 3I8CA 1QFSA 4L9OA 5TEEA 5I5IA 3O4IA 5A2Qg 5EM2B 4O3TB 4G56B 1GOGA 3MKSB 5EMKB 4NSXA 1TBGA 1XHMA 1GOHA 3CIKB 4WK4A 1TYEA 3MKQA 2XYIA 3MZKA 2H14A 3DXKC 1E8MA 3IJ1A 1S4UX 4DNUA 3OKWA 2H47A 3I7PA 5JWZA 4A0BB 3F3PA 3IUNA 5FKSA 1JOFA 2IUVA 4BL0A 2H9MA 2BKLA 4A0AB 4XYIA 3JPXA 4ZOXA 3EI3B 1B9YA 5H17A 2VDLA 1OLZA 3FCSA 3K26A 5H14A 4FA9D 2QR5A 4UM8A 1PI6A 3IJ0A 3ZDYA 4PC0A 4J8GA 1GG2B 2PM7B 5TEFA 2MTAH 3JZGA 1VYHC 1SQJA 4PBZA 5GSAA 5HDBA 5IJ7E 1GP2B 3C9CA 3W15A 4BCCA 4CC9A 2YNNA 5TDHB 4UM9A 2CE9A 5HQGA 4ERZA 3DDUA 1E5TA 2PM9B 2W18A 2WQ8A 3NVQA 2OIZA 3VH0A 2Q7QA 1T2XA 3F3GA 1L5GA 4JHPC 3O4GA 4J0WA 3EMHA 1JV2A 4JD2C 4IA9A 5THAA 4QL1A 5AJAA 3NIFA 5CYKA 1RI6A 2H9NA 3RFGA 2H6NA 5EMMB 4CY3A 5FFOA 4HDJA 4TZ4A 4FAVD 2OVPB 3IURA 5GMKn 5EMLB 3EI4B 3V5WB 5E6UA 2P9UC 3K27A 4CI8A 5HE0B 1MDAH 4A7JA 3FGBA 3PXWD 3UVMA 5HE3B 3V4VA 3AL9A 4NENA 4CY2A 2GNQA 2OK4A 3AL8B 5FFGA 4ZOYA 3K72A 2BBKH 2I0SA 4XEIC 3JAMg 3I8EA 3UVKA 4EWRA 3QHYB 4GZ8A 2H6KA 3EWEA 1QNIA 4MMXA 4O45A 4L1MA 4QAMA 4Y5RD 3U4YA 2YMUA 2AGYA 3A0FA 4LG8A 1JMXB 1U8CA 4H5JA 2CN2A 2IUPA 2AH0A 5EARA 3V7DB 3IIWA 1K32A 3KRWB 5M5UA 4Z7QA 2HU7A 4PXWA 4RE6A 5FXYA 1U4CA 4FA4D 2H13A 4O9DA 3EI1A 5I5JA 3OL2A 3QI0A 2J55H 4CZYA 5HYNB 3JZNA 3IULA 3SCYA 3EG6A 4GGDA 2H68A 3I7HA 2H9LA 4H5IA 3JRPA 1BPOA 1C9LA 2HXCA 3SXTD 4BUJC 4A08B 2HJBA 4GMBA 5B4WA 2OVQB 2CE8A 2TRCB 4GM3A 3AH8B 4D6VA 1ERJA 2AGXA 3O4JA 4GM9A 2UZYB 4G55A 1H2WA 3SHFA 4E5ZA 5IC7A 5CXBA 4CY1A 1FWXA 2O9KA 5K1CC 3ZDZA 4FB1D 5CXCA 1O6FA 4RE5A 3DSMA 3I2NA 3SFZA 4QRJA 3SMRA 1XKSA 4A11B 4JHNA 3IJCA 3ZDXA 1K8KC 4J84A 3I7NA 2B5MA 3BG0A 1MG3A 3C5MA 3NIGA 2P9SC 4UI9R 2BCJB 3CFVA 3MZLA 3JZHA 4J79A 3KRXB 3J80g 4BP8A 1L0QA 4GGCA 4ZOVA 1N6EA 3O4HA 2AGZA 2EBSA 2IAAA 2EIBA 4O02A 3OL2B 2HYEA 2EIDA 2P9PC 1JJUB 4L3HD 3E0CA 4U1EI 1N6FA 2P9KC 1H2ZA 2AGWA 2VZ1A 3PE7A 4CY5A 4J73A 3DXMC 3MUOA 1GOFA 1JTDB 3SWSD 2I3TA 3CFSB 3UKUC 1MG2A 4YVDA 3BG1A 2QXVA 3B7FA 4LG9A 4LGNA 3VGZA 5CXBB 4FA5D 3VI4A 4BCBA 3JROA 3F3FA 3EI2A 5EMJB 5CXCB 3PVWB 4CZXA 4WK2A 3IKOA 3EQ8A 1JMZB 4BCDA 4PSWB 4OZUA 1H2XA 2GC7A 1QFMA 3IVMA 1PEVA 1VZ3A 3T3PA 3MVDK 3ODTA 3GFCA 1SHYB 3GREA 1Q47A 4ERQA 4JSNC 3ULEC 2I3SA 4R7AB 5GXHA 5FKQA 3OKYA 1E8NA 3IUJA 5FQDA 2AH1A 3P4FA 4J77A 3RN0D 2IWFA 4BH6A 4D9SA 4CI1A 4A2LA 5FA5B 2XL2A 5EM2A 4X63B 2Z2NA 4CZVA 2IWKA 5HE2B 3IIYA 1O6GA 5FKRA 3IUMA 3N0DA 4G1EA 2G9AA 3C75H 4X3EA 4Z7OA 4OWRA 2QZPA 4CI3A 4FHLA 3FM0A 3MMYA 4G1MA 4A0BA 3L4MD 4K3ID 3ZE2A 1VE7A 5C2VB 3PXTD 1YFQA 2VDNA 1A12A 4MMZA 4E54A 4J86A 2AQ5A 2HJ4A 5CYKB 2HESX 3AFCA 1PBYB 2HKMA 2P9NC 4QQEA 2P9LC 1NR0A 3SLED 3K6SA 4Z7NA 4XYHA 2IURA 5TF2A 5GXIA 3SBPA 4IRZA 3OKTA 3I7LA 2Z2OA 4PNKB 1VZ2A 3IJEA 2VC2A 1VE6A 5IJ8E 3I7OA 4DNWA 3SN6B 4J0XA 4WJKA 3I7KA 3SBRA 4K3JB 4GQBB 5I5MA 4KFMB 5AMSA 5FLXg 4O3UB 3UVLA 5M5TA 5IT9g 1XIPA 4U7AA 3ZWLB 2XU7A 2VDPA 2EICA 4GGAA 3KCIA 4AMZA 4D0KA 3BWSA 3RRMC 2VDKA 5C2WB 3RMZD 4WK0A 5KDOB 4NAAA 4A09A 4JXMA 5HE1B 2JKXA 3PXSD 5FKTA 3SBQA 1N6DA 4AOWA 4I79A 3RLMD 3L4OD 2IUQA 2H3XA 5C92A 4GQ2P 3RN1D 4PBYA 3EI4A 5M5VA 3RSEC 2XE4A 2PM6B 3EU7A 3EI1B 3UVOA 2B5NA 2XDWA 5AFU3 1U2VC 3MUNA 3UVNA 1A0RB 3ZE1A 3T3MA 4JSVC 4FAND 4AN1A 4E54B
chains in the Genus database with same CATH topology
3AL8A 2YNOA 4L1QD 4ESGA 4AEZA 3HFQA 3N0EA 3SVWD 2OK6A 4PSXB 2CO0C 4L3GD 4X60B 4E5ZB 3VA6A 5EALA 2CN3A 5EAPA 2I0RA 4Z8LA 3PVUB 4J82A 4MK0B 5K19A 5IGOA 2GC4A 1NEXB 5H1MA 4N14A 4ERYA 4FA1D 2H9PA 1GOTB 2HKRA 1P22A 2OJYA 4A08A 3NVNA 2YBAA 2UZXB 5SXMA 4A09B 2AGLA 3J81g 4J8BA 1GXRA 2J57G 3UKRC 3C99A 3ORVD 3PSCB 3OTTA 2J56H 4GM8A 3DWLC 4JSPC 3JB9L 4QT8A 2XL3A 4O1QD 4A11A 4JSXC 1OMWB 4GQ1A 3RFHA 4ZN4A 2B4EA 4J87A 2YB8B 5C9ZB 5EAMA 4A0AA 2CO0A 2B5LA 3EI3A 3SJLD 3MXXA 1SQ9A 4X61B 4CI2A 1B9XA 3EI2B 2YNPA 2PBIB 4J78A 3NVXA 4ES0A 3UR4A 2P9IC 4IMMA 4JT6C 2I0TA 1TYQC 4JT5C 2QC5A 4J81A 4A2MA 3FRXA 1R5MA 2OVRB 4FWWA 2H6QA 4Y7RA 3DM0A 2PM9A 1PGUA 4ZOZA 2G99A 3OKYB 3PSLA 3I89A 5IGQA 3OW8A 2Z2PA 3V9FA 2CNXA 3I8CA 4L9OA 5TEEA 5I5IA 5A2Qg 5EM2B 4O3TB 4G56B 3MKSB 5EMKB 4NSXA 1TBGA 1XHMA 3CIKB 3MKQA 2XYIA 3MZKA 2H14A 3DXKC 3IJ1A 1S4UX 3OKWA 2H47A 3I7PA 5JWZA 4A0BB 3F3PA 5FKSA 1JOFA 2IUVA 4BL0A 2H9MA 4A0AB 4XYIA 3JPXA 4ZOXA 3EI3B 1B9YA 5H17A 1OLZA 3K26A 5H14A 4FA9D 1PI6A 3IJ0A 4PC0A 4J8GA 1GG2B 2PM7B 5TEFA 2MTAH 3JZGA 1VYHC 1SQJA 4PBZA 5GSAA 5IJ7E 1GP2B 3C9CA 3W15A 4CC9A 2YNNA 5TDHB 2CE9A 5HQGA 4ERZA 2PM9B 2W18A 3NVQA 2OIZA 3VH0A 2Q7QA 3F3GA 4J0WA 3EMHA 4JD2C 4IA9A 5THAA 4QL1A 5AJAA 5CYKA 1RI6A 2H9NA 3RFGA 2H6NA 5EMMB 4CY3A 4HDJA 4TZ4A 4FAVD 2OVPB 5GMKn 5EMLB 3EI4B 3V5WB 2P9UC 3K27A 4CI8A 5HE0B 1MDAH 4A7JA 3FGBA 3PXWD 3UVMA 5HE3B 3AL9A 4CY2A 2GNQA 2OK4A 3AL8B 4ZOYA 2BBKH 2I0SA 4XEIC 3JAMg 3I8EA 3UVKA 4EWRA 4GZ8A 2H6KA 3EWEA 1QNIA 4O45A 4Y5RD 3U4YA 2YMUA 2AGYA 3A0FA 4LG8A 1JMXB 4H5JA 2CN2A 2IUPA 2AH0A 5EARA 3V7DB 3IIWA 1K32A 3KRWB 4PXWA 5FXYA 1U4CA 4FA4D 2H13A 4O9DA 3EI1A 5I5JA 3OL2A 2J55H 4CZYA 5HYNB 3JZNA 3SCYA 3EG6A 4GGDA 2H68A 3I7HA 2H9LA 4H5IA 3JRPA 2HXCA 3SXTD 4BUJC 4A08B 2HJBA 4GMBA 5B4WA 2OVQB 2CE8A 2TRCB 4GM3A 3AH8B 4D6VA 2AGXA 1ERJA 4GM9A 2UZYB 3SHFA 4E5ZA 5IC7A 5CXBA 4CY1A 1FWXA 2O9KA 5K1CC 4FB1D 5CXCA 3DSMA 3I2NA 3SFZA 4QRJA 3SMRA 1XKSA 4A11B 3IJCA 1K8KC 4J84A 3I7NA 2B5MA 3BG0A 1MG3A 3C5MA 2P9SC 4UI9R 2BCJB 3CFVA 3MZLA 3JZHA 4J79A 3KRXB 3J80g 1L0QA 4GGCA 4ZOVA 1N6EA 2AGZA 2EBSA 2IAAA 3OL2B 2HYEA 2P9PC 1JJUB 4L3HD 3E0CA 4U1EI 1N6FA 2P9KC 2AGWA 3PE7A 4CY5A 4J73A 3DXMC 3SWSD 2I3TA 3CFSB 3UKUC 1MG2A 4YVDA 3BG1A 2QXVA 3B7FA 4LG9A 4LGNA 3VGZA 5CXBB 4FA5D 3JROA 3F3FA 3EI2A 5EMJB 5CXCB 3PVWB 4CZXA 3IKOA 1JMZB 4PSWB 4OZUA 2GC7A 1PEVA 3ODTA 3GFCA 1SHYB 3GREA 1Q47A 4ERQA 4JSNC 3ULEC 2I3SA 4R7AB 5GXHA 5FKQA 3OKYA 5FQDA 2AH1A 3P4FA 4J77A 3RN0D 2IWFA 4BH6A 4CI1A 4A2LA 5FA5B 2XL2A 5EM2A 4X63B 2Z2NA 4CZVA 2IWKA 5HE2B 3IIYA 5FKRA 3N0DA 4X3EA 2G9AA 3C75H 4CI3A 4OWRA 4FHLA 3FM0A 3MMYA 4A0BA 3L4MD 4K3ID 5C2VB 3PXTD 1YFQA 4E54A 4J86A 2AQ5A 2HJ4A 5CYKB 2HESX 3AFCA 1PBYB 2HKMA 2P9NC 4QQEA 2P9LC 1NR0A 3SLED 4XYHA 2IURA 5TF2A 5GXIA 3SBPA 3OKTA 3I7LA 2Z2OA 4PNKB 5IJ8E 3I7OA 3SN6B 4J0XA 3I7KA 3SBRA 4K3JB 4GQBB 5I5MA 4KFMB 5AMSA 5FLXg 4O3UB 3UVLA 5IT9g 1XIPA 4U7AA 3ZWLB 2XU7A 4GGAA 4D0KA 3BWSA 3RRMC 5C2WB 3RMZD 5KDOB 4A09A 4JXMA 5HE1B 3PXSD 5FKTA 4AOWA 3SBQA 1N6DA 4I79A 3RLMD 3L4OD 2IUQA 2H3XA 4GQ2P 3RN1D 4PBYA 3EI4A 3RSEC 2PM6B 3EU7A 3EI1B 3UVOA 2B5NA 5AFU3 1U2VC 3UVNA 1A0RB 4JSVC 4FAND 4E54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL8 A;  2YNO A;  4L1Q D;  4ESG A;  4AEZ A;  3HFQ A;  3N0E A;  3SVW D;  2OK6 A;  4PSX B;  2CO0 C;  4L3G D;  4X60 B;  4E5Z B;  3VA6 A;  5EAL A;  2CN3 A;  5EAP A;  2I0R A;  4Z8L A;  3PVU B;  4J82 A;  4MK0 B;  5K19 A;  5IGO A;  2GC4 A;  1NEX B;  5H1M A;  4N14 A;  4ERY A;  4FA1 D;  2H9P A;  1GOT B;  2HKR A;  1P22 A;  2OJY A;  4A08 A;  3NVN A;  2YBA A;  2UZX B;  5SXM A;  4A09 B;  2AGL A;  3J81 g;  4J8B A;  1GXR A;  2J57 G;  3UKR C;  3C99 A;  3ORV D;  3PSC B;  3OTT A;  2J56 H;  4GM8 A;  3DWL C;  4JSP C;  3JB9 L;  4QT8 A;  2XL3 A;  4O1Q D;  4A11 A;  4JSX C;  1OMW B;  4GQ1 A;  3RFH A;  4ZN4 A;  2B4E A;  4J87 A;  2YB8 B;  5C9Z B;  5EAM A;  4A0A A;  2CO0 A;  2B5L A;  3EI3 A;  3SJL D;  3MXX A;  1SQ9 A;  4X61 B;  4CI2 A;  1B9X A;  3EI2 B;  2YNP A;  2PBI B;  4J78 A;  3NVX A;  4ES0 A;  3UR4 A;  2P9I C;  4IMM A;  4JT6 C;  2I0T A;  1TYQ C;  4JT5 C;  2QC5 A;  4J81 A;  4A2M A;  3FRX A;  1R5M A;  2OVR B;  4FWW A;  2H6Q A;  4Y7R A;  3DM0 A;  2PM9 A;  1PGU A;  4ZOZ A;  2G99 A;  3OKY B;  3PSL A;  3I89 A;  5IGQ A;  3OW8 A;  2Z2P A;  3V9F A;  2CNX A;  3I8C A;  4L9O A;  5TEE A;  5I5I A;  5A2Q g;  5EM2 B;  4O3T B;  4G56 B;  3MKS B;  5EMK B;  4NSX A;  1TBG A;  1XHM A;  3CIK B;  3MKQ A;  2XYI A;  3MZK A;  2H14 A;  3DXK C;  3IJ1 A;  1S4U X;  3OKW A;  2H47 A;  3I7P A;  5JWZ A;  4A0B B;  3F3P A;  5FKS A;  1JOF A;  2IUV A;  4BL0 A;  2H9M A;  4A0A B;  4XYI A;  3JPX A;  4ZOX A;  3EI3 B;  1B9Y A;  5H17 A;  1OLZ A;  3K26 A;  5H14 A;  4FA9 D;  1PI6 A;  3IJ0 A;  4PC0 A;  4J8G A;  1GG2 B;  2PM7 B;  5TEF A;  2MTA H;  3JZG A;  1VYH C;  1SQJ A;  4PBZ A;  5GSA A;  5IJ7 E;  1GP2 B;  3C9C A;  3W15 A;  4CC9 A;  2YNN A;  5TDH B;  2CE9 A;  5HQG A;  4ERZ A;  2PM9 B;  2W18 A;  3NVQ A;  2OIZ A;  3VH0 A;  2Q7Q A;  3F3G A;  4J0W A;  3EMH A;  4JD2 C;  4IA9 A;  5THA A;  4QL1 A;  5AJA A;  5CYK A;  1RI6 A;  2H9N A;  3RFG A;  2H6N A;  5EMM B;  4CY3 A;  4HDJ A;  4TZ4 A;  4FAV D;  2OVP B;  5GMK n;  5EML B;  3EI4 B;  3V5W B;  2P9U C;  3K27 A;  4CI8 A;  5HE0 B;  1MDA H;  4A7J A;  3FGB A;  3PXW D;  3UVM A;  5HE3 B;  3AL9 A;  4CY2 A;  2GNQ A;  2OK4 A;  3AL8 B;  4ZOY A;  2BBK H;  2I0S A;  4XEI C;  3JAM g;  3I8E A;  3UVK A;  4EWR A;  4GZ8 A;  2H6K A;  3EWE A;  1QNI A;  4O45 A;  4Y5R D;  3U4Y A;  2YMU A;  2AGY A;  3A0F A;  4LG8 A;  1JMX B;  4H5J A;  2CN2 A;  2IUP A;  2AH0 A;  5EAR A;  3V7D B;  3IIW A;  1K32 A;  3KRW B;  4PXW A;  5FXY A;  1U4C A;  4FA4 D;  2H13 A;  4O9D A;  3EI1 A;  5I5J A;  3OL2 A;  2J55 H;  4CZY A;  5HYN B;  3JZN A;  3SCY A;  3EG6 A;  4GGD A;  2H68 A;  3I7H A;  2H9L A;  4H5I A;  3JRP A;  2HXC A;  3SXT D;  4BUJ C;  4A08 B;  2HJB A;  4GMB A;  5B4W A;  2OVQ B;  2CE8 A;  2TRC B;  4GM3 A;  3AH8 B;  4D6V A;  2AGX A;  1ERJ A;  4GM9 A;  2UZY B;  3SHF A;  4E5Z A;  5IC7 A;  5CXB A;  4CY1 A;  1FWX A;  2O9K A;  5K1C C;  4FB1 D;  5CXC A;  3DSM A;  3I2N A;  3SFZ A;  4QRJ A;  3SMR A;  1XKS A;  4A11 B;  3IJC A;  1K8K C;  4J84 A;  3I7N A;  2B5M A;  3BG0 A;  1MG3 A;  3C5M A;  2P9S C;  4UI9 R;  2BCJ B;  3CFV A;  3MZL A;  3JZH A;  4J79 A;  3KRX B;  3J80 g;  1L0Q A;  4GGC A;  4ZOV A;  1N6E A;  2AGZ A;  2EBS A;  2IAA A;  3OL2 B;  2HYE A;  2P9P C;  1JJU B;  4L3H D;  3E0C A;  4U1E I;  1N6F A;  2P9K C;  2AGW A;  3PE7 A;  4CY5 A;  4J73 A;  3DXM C;  3SWS D;  2I3T A;  3CFS B;  3UKU C;  1MG2 A;  4YVD A;  3BG1 A;  2QXV A;  3B7F A;  4LG9 A;  4LGN A;  3VGZ A;  5CXB B;  4FA5 D;  3JRO A;  3F3F A;  3EI2 A;  5EMJ B;  5CXC B;  3PVW B;  4CZX A;  3IKO A;  1JMZ B;  4PSW B;  4OZU A;  2GC7 A;  1PEV A;  3ODT A;  3GFC A;  1SHY B;  3GRE A;  1Q47 A;  4ERQ A;  4JSN C;  3ULE C;  2I3S A;  4R7A B;  5GXH A;  5FKQ A;  3OKY A;  5FQD A;  2AH1 A;  3P4F A;  4J77 A;  3RN0 D;  2IWF A;  4BH6 A;  4CI1 A;  4A2L A;  5FA5 B;  2XL2 A;  5EM2 A;  4X63 B;  2Z2N A;  4CZV A;  2IWK A;  5HE2 B;  3IIY A;  5FKR A;  3N0D A;  4X3E A;  2G9A A;  3C75 H;  4CI3 A;  4OWR A;  4FHL A;  3FM0 A;  3MMY A;  4A0B A;  3L4M D;  4K3I D;  5C2V B;  3PXT D;  1YFQ A;  4E54 A;  4J86 A;  2AQ5 A;  2HJ4 A;  5CYK B;  2HES X;  3AFC A;  1PBY B;  2HKM A;  2P9N C;  4QQE A;  2P9L C;  1NR0 A;  3SLE D;  4XYH A;  2IUR A;  5TF2 A;  5GXI A;  3SBP A;  3OKT A;  3I7L A;  2Z2O A;  4PNK B;  5IJ8 E;  3I7O A;  3SN6 B;  4J0X A;  3I7K A;  3SBR A;  4K3J B;  4GQB B;  5I5M A;  4KFM B;  5AMS A;  5FLX g;  4O3U B;  3UVL A;  5IT9 g;  1XIP A;  4U7A A;  3ZWL B;  2XU7 A;  4GGA A;  4D0K A;  3BWS A;  3RRM C;  5C2W B;  3RMZ D;  5KDO B;  4A09 A;  4JXM A;  5HE1 B;  3PXS D;  5FKT A;  4AOW A;  3SBQ A;  1N6D A;  4I79 A;  3RLM D;  3L4O D;  2IUQ A;  2H3X A;  4GQ2 P;  3RN1 D;  4PBY A;  3EI4 A;  3RSE C;  2PM6 B;  3EU7 A;  3EI1 B;  3UVO A;  2B5N A;  5AFU 3;  1U2V C;  3UVN A;  1A0R B;  4JSV C;  4FAN D;  4E54 B; 
#chains in the Genus database with same CATH topology
 1K3I A;  2EIE A;  3AL8 A;  2YNO A;  4L1Q D;  4ESG A;  4AEZ A;  3HFQ A;  3N0E A;  1UOP A;  3SVW D;  2OK6 A;  4MMY A;  4PSX B;  2CO0 C;  4L3G D;  4X60 B;  4O2W A;  2VDR A;  5EAL A;  2CN3 A;  2VZ3 A;  3VA6 A;  4E5Z B;  5EAP A;  1H2Y A;  2I0R A;  4Z8L A;  3PVU B;  2XZG A;  4J82 A;  4MK0 B;  5K19 A;  5IGO A;  2GC4 A;  3FCU A;  1NEX B;  5H1M A;  4N14 A;  4ERY A;  4FA1 D;  2H9P A;  3EQ7 A;  1GOT B;  2HKR A;  1P22 A;  2OJY A;  4NBM A;  4A08 A;  3NVN A;  2YBA A;  2UZX B;  1M1X A;  5SXM A;  4A09 B;  2AGL A;  3J81 g;  2VDO A;  4J8B A;  1GXR A;  2J57 G;  3UKR C;  3GC3 B;  3C99 A;  3ORV D;  2HU5 A;  2VDQ A;  3PSC B;  1UTC A;  3OF7 A;  3OTT A;  2VDM A;  2J56 H;  4GM8 A;  3DWL C;  4JSP C;  3JB9 L;  4QT8 A;  2XL3 A;  4O1Q D;  4A11 A;  4JSX C;  5M5S A;  1OMW B;  4GQ1 A;  4AMY A;  3RFH A;  4ZN4 A;  3K71 A;  2B4E A;  4J87 A;  4AX4 A;  2YB8 B;  2HU8 A;  5C9Z B;  5EAM A;  4A0A A;  2CO0 A;  2B5L A;  3EI3 A;  3GD1 I;  1UOO A;  5M61 A;  3SJL D;  5C86 A;  1UOQ A;  1I2M B;  3MXX A;  1SQ9 A;  4X61 B;  4CI2 A;  3EQ9 A;  4BP9 A;  1B9X A;  3EI2 B;  1C9I A;  5E6R A;  2YNP A;  3NID A;  5M5R A;  2PBI B;  4J78 A;  3NVX A;  4ES0 A;  4DNV A;  3IUQ A;  3UR4 A;  2P9I C;  4IMM A;  4JT6 C;  2I0T A;  5E6S A;  1TYQ C;  1YR2 A;  4JT5 C;  2QC5 A;  4AN0 A;  4J81 A;  3ZE0 A;  4A2M A;  3FRX A;  1R5M A;  2OVR B;  4FWW A;  2H6Q A;  4Y7R A;  3DM0 A;  2PM9 A;  1PGU A;  4ZOZ A;  4NC4 A;  2G99 A;  3OKY B;  3VI3 A;  3PSL A;  3I89 A;  5IGQ A;  3OW8 A;  2Z2P A;  3V4P A;  3V9F A;  2CNX A;  3I8C A;  1QFS A;  4L9O A;  5TEE A;  5I5I A;  3O4I A;  5A2Q g;  5EM2 B;  4O3T B;  4G56 B;  1GOG A;  3MKS B;  5EMK B;  4NSX A;  1TBG A;  1XHM A;  1GOH A;  3CIK B;  4WK4 A;  1TYE A;  3MKQ A;  2XYI A;  3MZK A;  2H14 A;  3DXK C;  1E8M A;  3IJ1 A;  1S4U X;  4DNU A;  3OKW A;  2H47 A;  3I7P A;  5JWZ A;  4A0B B;  3F3P A;  3IUN A;  5FKS A;  1JOF A;  2IUV A;  4BL0 A;  2H9M A;  2BKL A;  4A0A B;  4XYI A;  3JPX A;  4ZOX A;  3EI3 B;  1B9Y A;  5H17 A;  2VDL A;  1OLZ A;  3FCS A;  3K26 A;  5H14 A;  4FA9 D;  2QR5 A;  4UM8 A;  1PI6 A;  3IJ0 A;  3ZDY A;  4PC0 A;  4J8G A;  1GG2 B;  2PM7 B;  5TEF A;  2MTA H;  3JZG A;  1VYH C;  1SQJ A;  4PBZ A;  5GSA A;  5HDB A;  5IJ7 E;  1GP2 B;  3C9C A;  3W15 A;  4BCC A;  4CC9 A;  2YNN A;  5TDH B;  4UM9 A;  2CE9 A;  5HQG A;  4ERZ A;  3DDU A;  1E5T A;  2PM9 B;  2W18 A;  2WQ8 A;  3NVQ A;  2OIZ A;  3VH0 A;  2Q7Q A;  1T2X A;  3F3G A;  1L5G A;  4JHP C;  3O4G A;  4J0W A;  3EMH A;  1JV2 A;  4JD2 C;  4IA9 A;  5THA A;  4QL1 A;  5AJA A;  3NIF A;  5CYK A;  1RI6 A;  2H9N A;  3RFG A;  2H6N A;  5EMM B;  4CY3 A;  5FFO A;  4HDJ A;  4TZ4 A;  4FAV D;  2OVP B;  3IUR A;  5GMK n;  5EML B;  3EI4 B;  3V5W B;  5E6U A;  2P9U C;  3K27 A;  4CI8 A;  5HE0 B;  1MDA H;  4A7J A;  3FGB A;  3PXW D;  3UVM A;  5HE3 B;  3V4V A;  3AL9 A;  4NEN A;  4CY2 A;  2GNQ A;  2OK4 A;  3AL8 B;  5FFG A;  4ZOY A;  3K72 A;  2BBK H;  2I0S A;  4XEI C;  3JAM g;  3I8E A;  3UVK A;  4EWR A;  3QHY B;  4GZ8 A;  2H6K A;  3EWE A;  1QNI A;  4MMX A;  4O45 A;  4L1M A;  4QAM A;  4Y5R D;  3U4Y A;  2YMU A;  2AGY A;  3A0F A;  4LG8 A;  1JMX B;  1U8C A;  4H5J A;  2CN2 A;  2IUP A;  2AH0 A;  5EAR A;  3V7D B;  3IIW A;  1K32 A;  3KRW B;  5M5U A;  4Z7Q A;  2HU7 A;  4PXW A;  4RE6 A;  5FXY A;  1U4C A;  4FA4 D;  2H13 A;  4O9D A;  3EI1 A;  5I5J A;  3OL2 A;  3QI0 A;  2J55 H;  4CZY A;  5HYN B;  3JZN A;  3IUL A;  3SCY A;  3EG6 A;  4GGD A;  2H68 A;  3I7H A;  2H9L A;  4H5I A;  3JRP A;  1BPO A;  1C9L A;  2HXC A;  3SXT D;  4BUJ C;  4A08 B;  2HJB A;  4GMB A;  5B4W A;  2OVQ B;  2CE8 A;  2TRC B;  4GM3 A;  3AH8 B;  4D6V A;  1ERJ A;  2AGX A;  3O4J A;  4GM9 A;  2UZY B;  4G55 A;  1H2W A;  3SHF A;  4E5Z A;  5IC7 A;  5CXB A;  4CY1 A;  1FWX A;  2O9K A;  5K1C C;  3ZDZ A;  4FB1 D;  5CXC A;  1O6F A;  4RE5 A;  3DSM A;  3I2N A;  3SFZ A;  4QRJ A;  3SMR A;  1XKS A;  4A11 B;  4JHN A;  3IJC A;  3ZDX A;  1K8K C;  4J84 A;  3I7N A;  2B5M A;  3BG0 A;  1MG3 A;  3C5M A;  3NIG A;  2P9S C;  4UI9 R;  2BCJ B;  3CFV A;  3MZL A;  3JZH A;  4J79 A;  3KRX B;  3J80 g;  4BP8 A;  1L0Q A;  4GGC A;  4ZOV A;  1N6E A;  3O4H A;  2AGZ A;  2EBS A;  2IAA A;  2EIB A;  4O02 A;  3OL2 B;  2HYE A;  2EID A;  2P9P C;  1JJU B;  4L3H D;  3E0C A;  4U1E I;  1N6F A;  2P9K C;  1H2Z A;  2AGW A;  2VZ1 A;  3PE7 A;  4CY5 A;  4J73 A;  3DXM C;  3MUO A;  1GOF A;  1JTD B;  3SWS D;  2I3T A;  3CFS B;  3UKU C;  1MG2 A;  4YVD A;  3BG1 A;  2QXV A;  3B7F A;  4LG9 A;  4LGN A;  3VGZ A;  5CXB B;  4FA5 D;  3VI4 A;  4BCB A;  3JRO A;  3F3F A;  3EI2 A;  5EMJ B;  5CXC B;  3PVW B;  4CZX A;  4WK2 A;  3IKO A;  3EQ8 A;  1JMZ B;  4BCD A;  4PSW B;  4OZU A;  1H2X A;  2GC7 A;  1QFM A;  3IVM A;  1PEV A;  1VZ3 A;  3T3P A;  3MVD K;  3ODT A;  3GFC A;  1SHY B;  3GRE A;  1Q47 A;  4ERQ A;  4JSN C;  3ULE C;  2I3S A;  4R7A B;  5GXH A;  5FKQ A;  3OKY A;  1E8N A;  3IUJ A;  5FQD A;  2AH1 A;  3P4F A;  4J77 A;  3RN0 D;  2IWF A;  4BH6 A;  4D9S A;  4CI1 A;  4A2L A;  5FA5 B;  2XL2 A;  5EM2 A;  4X63 B;  2Z2N A;  4CZV A;  2IWK A;  5HE2 B;  3IIY A;  1O6G A;  5FKR A;  3IUM A;  3N0D A;  4G1E A;  2G9A A;  3C75 H;  4X3E A;  4Z7O A;  4OWR A;  2QZP A;  4CI3 A;  4FHL A;  3FM0 A;  3MMY A;  4G1M A;  4A0B A;  3L4M D;  4K3I D;  3ZE2 A;  1VE7 A;  5C2V B;  3PXT D;  1YFQ A;  2VDN A;  1A12 A;  4MMZ A;  4E54 A;  4J86 A;  2AQ5 A;  2HJ4 A;  5CYK B;  2HES X;  3AFC A;  1PBY B;  2HKM A;  2P9N C;  4QQE A;  2P9L C;  1NR0 A;  3SLE D;  3K6S A;  4Z7N A;  4XYH A;  2IUR A;  5TF2 A;  5GXI A;  3SBP A;  4IRZ A;  3OKT A;  3I7L A;  2Z2O A;  4PNK B;  1VZ2 A;  3IJE A;  2VC2 A;  1VE6 A;  5IJ8 E;  3I7O A;  4DNW A;  3SN6 B;  4J0X A;  4WJK A;  3I7K A;  3SBR A;  4K3J B;  4GQB B;  5I5M A;  4KFM B;  5AMS A;  5FLX g;  4O3U B;  3UVL A;  5M5T A;  5IT9 g;  1XIP A;  4U7A A;  3ZWL B;  2XU7 A;  2VDP A;  2EIC A;  4GGA A;  3KCI A;  4AMZ A;  4D0K A;  3BWS A;  3RRM C;  2VDK A;  5C2W B;  3RMZ D;  4WK0 A;  5KDO B;  4NAA A;  4A09 A;  4JXM A;  5HE1 B;  2JKX A;  3PXS D;  5FKT A;  3SBQ A;  1N6D A;  4AOW A;  4I79 A;  3RLM D;  3L4O D;  2IUQ A;  2H3X A;  5C92 A;  4GQ2 P;  3RN1 D;  4PBY A;  3EI4 A;  5M5V A;  3RSE C;  2XE4 A;  2PM6 B;  3EU7 A;  3EI1 B;  3UVO A;  2B5N A;  2XDW A;  5AFU 3;  1U2V C;  3MUN A;  3UVN A;  1A0R B;  3ZE1 A;  3T3M A;  4JSV C;  4FAN D;  4AN1 A;  4E54 B; 
#chains in the Genus database with same CATH homology
 3AL8 A;  2YNO A;  4L1Q D;  4ESG A;  4AEZ A;  3HFQ A;  3N0E A;  3SVW D;  2OK6 A;  4PSX B;  2CO0 C;  4L3G D;  4X60 B;  4E5Z B;  3VA6 A;  5EAL A;  2CN3 A;  5EAP A;  2I0R A;  4Z8L A;  3PVU B;  4J82 A;  4MK0 B;  5K19 A;  5IGO A;  2GC4 A;  1NEX B;  5H1M A;  4N14 A;  4ERY A;  4FA1 D;  2H9P A;  1GOT B;  2HKR A;  1P22 A;  2OJY A;  4A08 A;  3NVN A;  2YBA A;  2UZX B;  5SXM A;  4A09 B;  2AGL A;  3J81 g;  4J8B A;  1GXR A;  2J57 G;  3UKR C;  3C99 A;  3ORV D;  3PSC B;  3OTT A;  2J56 H;  4GM8 A;  3DWL C;  4JSP C;  3JB9 L;  4QT8 A;  2XL3 A;  4O1Q D;  4A11 A;  4JSX C;  1OMW B;  4GQ1 A;  3RFH A;  4ZN4 A;  2B4E A;  4J87 A;  2YB8 B;  5C9Z B;  5EAM A;  4A0A A;  2CO0 A;  2B5L A;  3EI3 A;  3SJL D;  3MXX A;  1SQ9 A;  4X61 B;  4CI2 A;  1B9X A;  3EI2 B;  2YNP A;  2PBI B;  4J78 A;  3NVX A;  4ES0 A;  3UR4 A;  2P9I C;  4IMM A;  4JT6 C;  2I0T A;  1TYQ C;  4JT5 C;  2QC5 A;  4J81 A;  4A2M A;  3FRX A;  1R5M A;  2OVR B;  4FWW A;  2H6Q A;  4Y7R A;  3DM0 A;  2PM9 A;  1PGU A;  4ZOZ A;  2G99 A;  3OKY B;  3PSL A;  3I89 A;  5IGQ A;  3OW8 A;  2Z2P A;  3V9F A;  2CNX A;  3I8C A;  4L9O A;  5TEE A;  5I5I A;  5A2Q g;  5EM2 B;  4O3T B;  4G56 B;  3MKS B;  5EMK B;  4NSX A;  1TBG A;  1XHM A;  3CIK B;  3MKQ A;  2XYI A;  3MZK A;  2H14 A;  3DXK C;  3IJ1 A;  1S4U X;  3OKW A;  2H47 A;  3I7P A;  5JWZ A;  4A0B B;  3F3P A;  5FKS A;  1JOF A;  2IUV A;  4BL0 A;  2H9M A;  4A0A B;  4XYI A;  3JPX A;  4ZOX A;  3EI3 B;  1B9Y A;  5H17 A;  1OLZ A;  3K26 A;  5H14 A;  4FA9 D;  1PI6 A;  3IJ0 A;  4PC0 A;  4J8G A;  1GG2 B;  2PM7 B;  5TEF A;  2MTA H;  3JZG A;  1VYH C;  1SQJ A;  4PBZ A;  5GSA A;  5IJ7 E;  1GP2 B;  3C9C A;  3W15 A;  4CC9 A;  2YNN A;  5TDH B;  2CE9 A;  5HQG A;  4ERZ A;  2PM9 B;  2W18 A;  3NVQ A;  2OIZ A;  3VH0 A;  2Q7Q A;  3F3G A;  4J0W A;  3EMH A;  4JD2 C;  4IA9 A;  5THA A;  4QL1 A;  5AJA A;  5CYK A;  1RI6 A;  2H9N A;  3RFG A;  2H6N A;  5EMM B;  4CY3 A;  4HDJ A;  4TZ4 A;  4FAV D;  2OVP B;  5GMK n;  5EML B;  3EI4 B;  3V5W B;  2P9U C;  3K27 A;  4CI8 A;  5HE0 B;  1MDA H;  4A7J A;  3FGB A;  3PXW D;  3UVM A;  5HE3 B;  3AL9 A;  4CY2 A;  2GNQ A;  2OK4 A;  3AL8 B;  4ZOY A;  2BBK H;  2I0S A;  4XEI C;  3JAM g;  3I8E A;  3UVK A;  4EWR A;  4GZ8 A;  2H6K A;  3EWE A;  1QNI A;  4O45 A;  4Y5R D;  3U4Y A;  2YMU A;  2AGY A;  3A0F A;  4LG8 A;  1JMX B;  4H5J A;  2CN2 A;  2IUP A;  2AH0 A;  5EAR A;  3V7D B;  3IIW A;  1K32 A;  3KRW B;  4PXW A;  5FXY A;  1U4C A;  4FA4 D;  2H13 A;  4O9D A;  3EI1 A;  5I5J A;  3OL2 A;  2J55 H;  4CZY A;  5HYN B;  3JZN A;  3SCY A;  3EG6 A;  4GGD A;  2H68 A;  3I7H A;  2H9L A;  4H5I A;  3JRP A;  2HXC A;  3SXT D;  4BUJ C;  4A08 B;  2HJB A;  4GMB A;  5B4W A;  2OVQ B;  2CE8 A;  2TRC B;  4GM3 A;  3AH8 B;  4D6V A;  2AGX A;  1ERJ A;  4GM9 A;  2UZY B;  3SHF A;  4E5Z A;  5IC7 A;  5CXB A;  4CY1 A;  1FWX A;  2O9K A;  5K1C C;  4FB1 D;  5CXC A;  3DSM A;  3I2N A;  3SFZ A;  4QRJ A;  3SMR A;  1XKS A;  4A11 B;  3IJC A;  1K8K C;  4J84 A;  3I7N A;  2B5M A;  3BG0 A;  1MG3 A;  3C5M A;  2P9S C;  4UI9 R;  2BCJ B;  3CFV A;  3MZL A;  3JZH A;  4J79 A;  3KRX B;  3J80 g;  1L0Q A;  4GGC A;  4ZOV A;  1N6E A;  2AGZ A;  2EBS A;  2IAA A;  3OL2 B;  2HYE A;  2P9P C;  1JJU B;  4L3H D;  3E0C A;  4U1E I;  1N6F A;  2P9K C;  2AGW A;  3PE7 A;  4CY5 A;  4J73 A;  3DXM C;  3SWS D;  2I3T A;  3CFS B;  3UKU C;  1MG2 A;  4YVD A;  3BG1 A;  2QXV A;  3B7F A;  4LG9 A;  4LGN A;  3VGZ A;  5CXB B;  4FA5 D;  3JRO A;  3F3F A;  3EI2 A;  5EMJ B;  5CXC B;  3PVW B;  4CZX A;  3IKO A;  1JMZ B;  4PSW B;  4OZU A;  2GC7 A;  1PEV A;  3ODT A;  3GFC A;  1SHY B;  3GRE A;  1Q47 A;  4ERQ A;  4JSN C;  3ULE C;  2I3S A;  4R7A B;  5GXH A;  5FKQ A;  3OKY A;  5FQD A;  2AH1 A;  3P4F A;  4J77 A;  3RN0 D;  2IWF A;  4BH6 A;  4CI1 A;  4A2L A;  5FA5 B;  2XL2 A;  5EM2 A;  4X63 B;  2Z2N A;  4CZV A;  2IWK A;  5HE2 B;  3IIY A;  5FKR A;  3N0D A;  4X3E A;  2G9A A;  3C75 H;  4CI3 A;  4OWR A;  4FHL A;  3FM0 A;  3MMY A;  4A0B A;  3L4M D;  4K3I D;  5C2V B;  3PXT D;  1YFQ A;  4E54 A;  4J86 A;  2AQ5 A;  2HJ4 A;  5CYK B;  2HES X;  3AFC A;  1PBY B;  2HKM A;  2P9N C;  4QQE A;  2P9L C;  1NR0 A;  3SLE D;  4XYH A;  2IUR A;  5TF2 A;  5GXI A;  3SBP A;  3OKT A;  3I7L A;  2Z2O A;  4PNK B;  5IJ8 E;  3I7O A;  3SN6 B;  4J0X A;  3I7K A;  3SBR A;  4K3J B;  4GQB B;  5I5M A;  4KFM B;  5AMS A;  5FLX g;  4O3U B;  3UVL A;  5IT9 g;  1XIP A;  4U7A A;  3ZWL B;  2XU7 A;  4GGA A;  4D0K A;  3BWS A;  3RRM C;  5C2W B;  3RMZ D;  5KDO B;  4A09 A;  4JXM A;  5HE1 B;  3PXS D;  5FKT A;  4AOW A;  3SBQ A;  1N6D A;  4I79 A;  3RLM D;  3L4O D;  2IUQ A;  2H3X A;  4GQ2 P;  3RN1 D;  4PBY A;  3EI4 A;  3RSE C;  2PM6 B;  3EU7 A;  3EI1 B;  3UVO A;  2B5N A;  5AFU 3;  1U2V C;  3UVN A;  1A0R B;  4JSV C;  4FAN D;  4E54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...