4JT6C

Structure of mtordeltan-mlst8-pi-103 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords mTOR
total genus 70
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jt6C01
2H6QA 3IJ1A 3V7DB 3CIKB 1XHMA 4E54A 2IWKA 4PXWA 3I2NA 1VYHC 2AQ5A 2IWFA 5FXYA 3SBQA 3N0EA 2CE9A 5THAA 4J86A 2P9NC 3UVOA 5CXCA 2CO0C 5I5MA 2CO0A 2H13A 1PI6A 4AOWA 4BH6A 2I0TA 3K27A 4CI3A 5JWZA 4EWRA 2IUVA 3J80g 3UKRC 1SHYB 4E5ZA 5A2Qg 5EAPA 2Q7QA 3MXXA 5C2VB 2H3XA 2I3TA 1TBGA 4FB1D 3C9CA 4A11B 5CXBB 3OKWA 2CE8A 5FQDA 2HESX 4A09B 3SBRA 3RN1D 3EI4B 5AMSA 2EBSA 4GM9A 2Z2PA 2XU7A 2Z2OA 3U4YA 1Q47A 3PXSD 5HE0B 2AGXA 3EWEA 4L9OA 1K32A 2H47A 3PSLA 3HFQA 3PVUB 1N6FA 5IC7A 3DWLC 4OWRA 2HYEA 4J79A 4O3UB 5IJ8E 3A0FA 3EMHA 4ZN4A 3IIYA 4XEIC 2HKRA 2I3SA 3DXKC 5B4WA 3ZWLB 1PBYB 1P22A 2CNXA 2GNQA 2P9UC 4ZOZA 4JSNC 3SHFA 2PM9B 4HDJA 2UZXB 5TF2A 4GGAA 4X63B 2H68A 4GQ1A 4FA4D 5EMLB 3KRXB 4JSXC 5EMKB 2YNNA 1PGUA 1TYQC 3SCYA 2YBAA 4PNKB 3BG0A 2Z2NA 4I79A 4J73A 4CY5A 4A0AA 2P9IC 3OTTA 1N6EA 5C9ZB 4A2MA 4N14A 2OIZA 2G99A 3SWSD 4R7AB 3EI4A 2HJBA 4L3HD 5TEEA 2IUPA 4QRJA 3L4MD 2OVQB 4A11A 3F3PA 4H5JA 4FAND 3RN0D 4KFMB 2QXVA 3RMZD 1U4CA 4O45A 5SXMA 4CI8A 5EMMB 4Y7RA 4J78A 4J0WA 5KDOB 3BG1A 3PVWB 2OJYA 3I8EA 4J81A 4ERZA 3CFVA 3UVLA 5AFU3 4D0KA 2AGLA 2PM9A 5C2WB 3SMRA 4A08A 5FKTA 2B4EA 3JZGA 1OLZA 3UR4A 2W18A 4FA1D 4JSVC 1NR0A 2QC5A 4CZXA 3MZLA 4GGDA 2B5NA 3FM0A 3W15A 4Y5RD 3EG6A 5FKQA 2I0SA 3C99A 4ESGA 3F3FA 4G56B 3I8CA 3JZNA 5FKSA 4ERQA 5HYNB 5IGQA 4CY3A 2PBIB 5EM2B 4D6VA 4QL1A 2XYIA 2IURA 3RFHA 4E5ZB 3N0DA 3AL8A 3RRMC 1L0QA 2H9LA 4X61B 1XIPA 1R5MA 3SJLD 3J81g 4GGCA 2YNPA 4X60B 5CXBA 5HQGA 1U2VC 3NVQA 3BWSA 1FWXA 4K3ID 2I0RA 4LG8A 3IJCA 3I7HA 4ERYA 4A7JA 4J87A 1SQ9A 2GC7A 5EMJB 4U1EI 5IGOA 3DSMA 3FRXA 3C5MA 4MK0B 3I7OA 4OZUA 4LGNA 2YNOA 2UZYB 2BBKH 1N6DA 2OK4A 4ZOVA 4O3TB 3F3GA 2J56H 3IKOA 4JXMA 3IIWA 2P9LC 3GREA 3C75H 2P9KC 2J57G 2XL3A 3P4FA 3PSCB 4GQ2P 4U7AA 1XKSA 4J84A 3UVMA 4CZYA 3JRPA 4NSXA 2IUQA 1K8KC 2H6NA 3UKUC 3JZHA 4IMMA 3JROA 3I7LA 3SFZA 1RI6A 3FGBA 3ODTA 4L1QD 2H9NA 4CY1A 3RSEC 1NEXB 1JJUB 4J8BA 5IJ7E 4ES0A 5EAMA 3NVXA 4FHLA 4QQEA 4J8GA 1S4UX 3AL8B 2AGWA 4PC0A 4IA9A 2HXCA 2H9MA 3EI3B 5FA5B 5HE1B 4UI9R 1PEVA 3V5WB 1GP2B 4QT8A 4CZVA 4JD2C 2OVPB 3IJ0A 4PSWB 3GFCA 1JMZB 2PM6B 2XL2A 4JT6C 3OL2B 3OL2A 4GMBA 5GSAA 2AH0A 3EU7A 5GXHA 3E0CA 3VA6A 1JMXB 5TDHB 4X3EA 3UVNA 2YMUA 3EI3A 2MTAH 2H9PA 5EARA 3UVKA 4BUJC 2AGYA 3I7KA 1OMWB 4PBZA 5H17A 5H1MA 4FAVD 4CI1A 4XYIA 3MKSB 4CY2A 3PXTD 5CXCB 4A09A 4XYHA 3RFGA 3OKTA 2PM7B 1MG3A 4A0AB 5IT9g 4TZ4A 4O9DA 4FA9D 1JOFA 5K19A 3AL9A 3I7NA 5TEFA 1GXRA 3OW8A 3MMYA 2CN2A 4K3JB 4GQBB 2P9PC 4J82A 2J55H 4GM8A 3DM0A 4FA5D 4LG9A 5FLXg 3JB9L 3PE7A 2H6KA 4PBYA 4E54B 4GM3A 1B9XA 3MKQA 4JT5C 3I89A 3DXMC 2HKMA 2P9SC 4JSPC 4CC9A 3JAMg 3EI2A 5EALA 5H14A 4J77A 4ZOXA 1A0RB 2H14A 3SXTD 3VH0A 5HE3B 5CYKA 3ULEC 3EI1A 1SQJA 3AFCA 3VGZA 3MZKA 2IAAA 2G9AA 3OKYA 4H5IA 2B5MA 4Z8LA 3RLMD 2B5LA 3SN6B 5FKRA 3SBPA 3OKYB 5K1CC 4ZOYA 5GXIA 1MG2A 3KRWB 3ORVD 4L3GD 4GZ8A 1YFQA 1MDAH 3SVWD 2YB8B 5CYKB 3CFSB 2TRCB 3PXWD 3JPXA 4A2LA 5AJAA 2AH1A 1GG2B 3I7PA 5GMKn 4J0XA 5I5IA 3EI2B 3AH8B 2CN3A 5EM2A 3NVNA 4YVDA 1QNIA 1ERJA 2O9KA 5HE2B 2GC4A 3EI1B 2OVRB 4A08B 2OK6A 3SLED 3B7FA 2BCJB 4PSXB 4CI2A 1GOTB 2AGZA 1B9YA 3K26A 4FWWA 3V9FA 4AEZA 4BL0A 4O1QD 2HJ4A 4A0BB 5I5JA 3L4OD 4A0BA
chains in the Genus database with same CATH superfamily
2H6QA 3IJ1A 3V7DB 3CIKB 1XHMA 4E54A 4AMZA 1UTCA 2IWKA 4PXWA 3I2NA 5M5TA 1VYHC 2AQ5A 2IWFA 4NBMA 5FXYA 3SBQA 1H2XA 3N0EA 2CE9A 1JV2A 5THAA 4J86A 4D9SA 2P9NC 1TYEA 3UVOA 5CXCA 2CO0C 5I5MA 2CO0A 2H13A 4RE6A 1PI6A 4AOWA 3IJEA 4BH6A 2I0TA 3K27A 4CI3A 5JWZA 4EWRA 2IUVA 3J80g 3UKRC 1SHYB 4E5ZA 5A2Qg 3VI3A 3V4PA 5EAPA 1GOFA 2Q7QA 3MXXA 5E6RA 5C2VB 2H3XA 2I3TA 1T2XA 1TBGA 2VZ3A 3C9CA 4A11B 4FB1D 3IUJA 5CXBB 3OKWA 2CE8A 5FQDA 1GOGA 2HESX 4A09B 3SBRA 3RN1D 3EI4B 5AMSA 2EBSA 4GM9A 2VDLA 2Z2PA 2XU7A 2Z2OA 3U4YA 1Q47A 3PXSD 5HE0B 2AGXA 3EWEA 4L9OA 1K32A 2H47A 3PSLA 4BCBA 3HFQA 3PVUB 1N6FA 5IC7A 3DWLC 4WJKA 4OWRA 2HYEA 4J79A 4O3UB 5IJ8E 1UOOA 1U8CA 5M5RA 3A0FA 3EMHA 3IUNA 4Z7NA 4ZN4A 3IIYA 4XEIC 2HKRA 2I3SA 3DXKC 5B4WA 3ZWLB 1PBYB 1P22A 2CNXA 2GNQA 2P9UC 4ZOZA 4UM8A 1E8MA 3IULA 4JSNC 3SHFA 2PM9B 4IRZA 4HDJA 2UZXB 5TF2A 4GGAA 4WK0A 4X63B 2BKLA 2H68A 2VDRA 4GQ1A 4FA4D 5M61A 4L1MA 5EMLB 3K71A 3KRXB 4JSXC 5EMKB 2YNNA 1PGUA 1TYQC 3SCYA 3ZE1A 5C92A 4DNUA 2YBAA 4PNKB 3BG0A 2Z2NA 4I79A 4J73A 4CY5A 2VZ1A 4A0AA 3MUOA 1VE6A 2P9IC 3OTTA 4RE5A 1N6EA 5C9ZB 4A2MA 2OIZA 4N14A 2G99A 3SWSD 3O4HA 4R7AB 3EI4A 3MVDK 2HJBA 4L3HD 5TEEA 2IUPA 4QRJA 3L4MD 2OVQB 4A11A 3FCSA 3F3PA 4H5JA 4FAND 2VC2A 3NIGA 4KFMB 3RN0D 2QXVA 3RMZD 3QI0A 1U4CA 1C9LA 3FCUA 4O45A 5SXMA 5EMMB 4Y7RA 4CI8A 4J78A 5M5SA 4J0WA 5KDOB 1K3IA 3BG1A 2XE4A 2OJYA 3PVWB 3I8EA 4J81A 4ERZA 3CFVA 3UVLA 5AFU3 4D0KA 2AGLA 4AN0A 2PM9A 5C2WB 3SMRA 1QFSA 4A08A 4WK2A 1VE7A 2B4EA 3JZGA 5FKTA 1OLZA 2WQ8A 4JHNA 3UR4A 2W18A 1M1XA 4FA1D 4JSVC 5E6SA 1NR0A 2QC5A 4CZXA 3MZLA 4GGDA 2B5NA 3FM0A 4O02A 3IUMA 3W15A 4Y5RD 3EG6A 5FKQA 4QAMA 2I0SA 3C99A 4ESGA 3F3FA 4G56B 3I8CA 3JZNA 5FKSA 1GOHA 4NENA 4ERQA 5HYNB 5IGQA 4CY3A 2PBIB 5EM2B 3OF7A 4D6VA 5C86A 4QL1A 2XYIA 1C9IA 2IURA 3RFHA 1VZ2A 4O2WA 3VI4A 4E5ZB 2EIDA 3N0DA 4UM9A 3AL8A 1O6FA 3RRMC 1L0QA 2H9LA 3NIFA 4X61B 1XIPA 1R5MA 3O4JA 3SJLD 4AN1A 3J81g 4GGCA 2VDNA 2YNPA 4X60B 5CXBA 5HQGA 4G1MA 1U2VC 3NVQA 3BWSA 1FWXA 4K3ID 2I0RA 4LG8A 3IJCA 3GD1I 3I7HA 4ERYA 2HU7A 4A7JA 4J87A 1SQ9A 2GC7A 5EMJB 3GC3B 4U1EI 5IGOA 3DSMA 3FRXA 3EQ9A 3C5MA 3IUQA 2VDKA 4MK0B 3I7OA 4MMXA 4OZUA 4LGNA 2YNOA 2UZYB 2BBKH 1N6DA 2OK4A 2VDOA 4ZOVA 4O3TB 3F3GA 2J56H 3IKOA 1A12A 5FFGA 4JXMA 3IIWA 3O4GA 2P9LC 3GREA 3C75H 2P9KC 2J57G 2XL3A 3P4FA 3PSCB 4GQ2P 4U7AA 1XKSA 4J84A 3UVMA 4CZYA 1UOPA 3JRPA 2EICA 4NSXA 2IUQA 1K8KC 2H6NA 1JTDB 3UKUC 3JZHA 4IMMA 3JROA 3I7LA 3SFZA 1RI6A 3FGBA 3ODTA 4L1QD 2H9NA 3EQ7A 3RSEC 1NEXB 1JJUB 4J8BA 4CY1A 4ES0A 5EAMA 4AMYA 5IJ7E 3NVXA 4FHLA 2XZGA 4QQEA 4J8GA 1S4UX 3AL8B 2AGWA 4PC0A 3KCIA 5E6UA 1O6GA 4IA9A 2HXCA 2H9MA 1H2ZA 3EI3B 3ZDZA 1L5GA 4DNVA 5FA5B 2JKXA 5HE1B 4UI9R 1H2YA 1PEVA 3IURA 3V5WB 1GP2B 4QT8A 4CZVA 4JD2C 2OVPB 3IJ0A 4PSWB 3GFCA 1JMZB 2PM6B 2XL2A 4JT6C 4JHPC 3OL2B 3T3PA 3ZDXA 3OL2A 5M5UA 4GMBA 5GSAA 2AH0A 3EU7A 4MMYA 5GXHA 3E0CA 3VA6A 2VDMA 4BP8A 1JMXB 5TDHB 4X3EA 4G55A 3T3MA 3UVNA 1E5TA 2YMUA 2QZPA 1UOQA 3EI3A 2MTAH 2H9PA 1H2WA 5EARA 3UVKA 4BUJC 2AGYA 3I7KA 1OMWB 3EQ8A 4PBZA 2HU5A 5H17A 5H1MA 4FAVD 4CI1A 4XYIA 3MKSB 4CY2A 3PXTD 1I2MB 5CXCB 4A09A 4AX4A 4XYHA 3RFGA 3OKTA 2PM7B 4MMZA 1MG3A 4A0AB 5IT9g 5FFOA 4TZ4A 4O9DA 2EIBA 4FA9D 1JOFA 3V4VA 5K19A 3AL9A 3I7NA 2HU8A 1GXRA 2QR5A 3OW8A 5TEFA 3MMYA 2CN2A 4K3JB 1BPOA 4GQBB 2P9PC 4J82A 2J55H 4GM8A 3DM0A 3ZDYA 4FA5D 1E8NA 4LG9A 5FLXg 3JB9L 3PE7A 2H6KA 4PBYA 4NAAA 4E54B 4GM3A 1B9XA 4WK4A 3MKQA 4JT5C 3I89A 3DXMC 2HKMA 2P9SC 4JSPC 4CC9A 3JAMg 3EI2A 5EALA 5H14A 4J77A 3DDUA 1A0RB 2H14A 4ZOXA 2VDQA 3SXTD 3VH0A 5HE3B 5CYKA 3ULEC 1VZ3A 4BCCA 3IVMA 3EI1A 1SQJA 3AFCA 3VGZA 1YR2A 3MZKA 2IAAA 2G9AA 3OKYA 4H5IA 2B5MA 4Z8LA 3RLMD 4DNWA 2B5LA 5M5VA 2EIEA 3SN6B 3K72A 5FKRA 3SBPA 3OKYB 5K1CC 4ZOYA 5GXIA 1MG2A 3KRWB 3ZE2A 3ORVD 4G1EA 4L3GD 3NIDA 4GZ8A 1YFQA 1MDAH 3SVWD 4Z7OA 3K6SA 5HDBA 2YB8B 5CYKB 3CFSB 2TRCB 4BP9A 3PXWD 3JPXA 3MUNA 4A2LA 1QFMA 5AJAA 2AH1A 1GG2B 3I7PA 5GMKn 4J0XA 5I5IA 3EI2B 3AH8B 2CN3A 5EM2A 3NVNA 2VDPA 4YVDA 1QNIA 1ERJA 2O9KA 4NC4A 5HE2B 4BCDA 2GC4A 3ZE0A 3EI1B 3QHYB 2OVRB 4A08B 2OK6A 3SLED 3B7FA 2BCJB 4PSXB 4CI2A 1GOTB 2AGZA 4FWWA 1B9YA 2XDWA 3K26A 3V9FA 4AEZA 4O1QD 4BL0A 2HJ4A 4Z7QA 4A0BB 5I5JA 3L4OD 3O4IA 4A0BA
chains in the Genus database with same CATH topology
2H6QA 3IJ1A 3V7DB 3CIKB 1XHMA 4E54A 2IWKA 4PXWA 3I2NA 1VYHC 2AQ5A 2IWFA 5FXYA 3SBQA 3N0EA 2CE9A 5THAA 4J86A 2P9NC 3UVOA 5CXCA 2CO0C 5I5MA 2CO0A 2H13A 1PI6A 4AOWA 4BH6A 2I0TA 3K27A 4CI3A 5JWZA 4EWRA 2IUVA 3J80g 3UKRC 1SHYB 4E5ZA 5A2Qg 5EAPA 2Q7QA 3MXXA 5C2VB 2H3XA 2I3TA 1TBGA 4FB1D 3C9CA 4A11B 5CXBB 3OKWA 2CE8A 5FQDA 2HESX 4A09B 3SBRA 3RN1D 3EI4B 5AMSA 2EBSA 4GM9A 2Z2PA 2XU7A 2Z2OA 3U4YA 1Q47A 3PXSD 5HE0B 2AGXA 3EWEA 4L9OA 1K32A 2H47A 3PSLA 3HFQA 3PVUB 1N6FA 5IC7A 3DWLC 4OWRA 2HYEA 4J79A 4O3UB 5IJ8E 3A0FA 3EMHA 4ZN4A 3IIYA 4XEIC 2HKRA 2I3SA 3DXKC 5B4WA 3ZWLB 1PBYB 1P22A 2CNXA 2GNQA 2P9UC 4ZOZA 4JSNC 3SHFA 2PM9B 4HDJA 2UZXB 5TF2A 4GGAA 4X63B 2H68A 4GQ1A 4FA4D 5EMLB 3KRXB 4JSXC 5EMKB 2YNNA 1PGUA 1TYQC 3SCYA 2YBAA 4PNKB 3BG0A 2Z2NA 4I79A 4J73A 4CY5A 4A0AA 2P9IC 3OTTA 1N6EA 5C9ZB 4A2MA 4N14A 2OIZA 2G99A 3SWSD 4R7AB 3EI4A 2HJBA 4L3HD 5TEEA 2IUPA 4QRJA 3L4MD 2OVQB 4A11A 3F3PA 4H5JA 4FAND 3RN0D 4KFMB 2QXVA 3RMZD 1U4CA 4O45A 5SXMA 4CI8A 5EMMB 4Y7RA 4J78A 4J0WA 5KDOB 3BG1A 3PVWB 2OJYA 3I8EA 4J81A 4ERZA 3CFVA 3UVLA 5AFU3 4D0KA 2AGLA 2PM9A 5C2WB 3SMRA 4A08A 5FKTA 2B4EA 3JZGA 1OLZA 3UR4A 2W18A 4FA1D 4JSVC 1NR0A 2QC5A 4CZXA 3MZLA 4GGDA 2B5NA 3FM0A 3W15A 4Y5RD 3EG6A 5FKQA 2I0SA 3C99A 4ESGA 3F3FA 4G56B 3I8CA 3JZNA 5FKSA 4ERQA 5HYNB 5IGQA 4CY3A 2PBIB 5EM2B 4D6VA 4QL1A 2XYIA 2IURA 3RFHA 4E5ZB 3N0DA 3AL8A 3RRMC 1L0QA 2H9LA 4X61B 1XIPA 1R5MA 3SJLD 3J81g 4GGCA 2YNPA 4X60B 5CXBA 5HQGA 1U2VC 3NVQA 3BWSA 1FWXA 4K3ID 2I0RA 4LG8A 3IJCA 3I7HA 4ERYA 4A7JA 4J87A 1SQ9A 2GC7A 5EMJB 4U1EI 5IGOA 3DSMA 3FRXA 3C5MA 4MK0B 3I7OA 4OZUA 4LGNA 2YNOA 2UZYB 2BBKH 1N6DA 2OK4A 4ZOVA 4O3TB 3F3GA 2J56H 3IKOA 4JXMA 3IIWA 2P9LC 3GREA 3C75H 2P9KC 2J57G 2XL3A 3P4FA 3PSCB 4GQ2P 4U7AA 1XKSA 4J84A 3UVMA 4CZYA 3JRPA 4NSXA 2IUQA 1K8KC 2H6NA 3UKUC 3JZHA 4IMMA 3JROA 3I7LA 3SFZA 1RI6A 3FGBA 3ODTA 4L1QD 2H9NA 4CY1A 3RSEC 1NEXB 1JJUB 4J8BA 5IJ7E 4ES0A 5EAMA 3NVXA 4FHLA 4QQEA 4J8GA 1S4UX 3AL8B 2AGWA 4PC0A 4IA9A 2HXCA 2H9MA 3EI3B 5FA5B 5HE1B 4UI9R 1PEVA 3V5WB 1GP2B 4QT8A 4CZVA 4JD2C 2OVPB 3IJ0A 4PSWB 3GFCA 1JMZB 2PM6B 2XL2A 4JT6C 3OL2B 3OL2A 4GMBA 5GSAA 2AH0A 3EU7A 5GXHA 3E0CA 3VA6A 1JMXB 5TDHB 4X3EA 3UVNA 2YMUA 3EI3A 2MTAH 2H9PA 5EARA 3UVKA 4BUJC 2AGYA 3I7KA 1OMWB 4PBZA 5H17A 5H1MA 4FAVD 4CI1A 4XYIA 3MKSB 4CY2A 3PXTD 5CXCB 4A09A 4XYHA 3RFGA 3OKTA 2PM7B 1MG3A 4A0AB 5IT9g 4TZ4A 4O9DA 4FA9D 1JOFA 5K19A 3AL9A 3I7NA 5TEFA 1GXRA 3OW8A 3MMYA 2CN2A 4K3JB 4GQBB 2P9PC 4J82A 2J55H 4GM8A 3DM0A 4FA5D 4LG9A 5FLXg 3JB9L 3PE7A 2H6KA 4PBYA 4E54B 4GM3A 1B9XA 3MKQA 4JT5C 3I89A 3DXMC 2HKMA 2P9SC 4JSPC 4CC9A 3JAMg 3EI2A 5EALA 5H14A 4J77A 4ZOXA 1A0RB 2H14A 3SXTD 3VH0A 5HE3B 5CYKA 3ULEC 3EI1A 1SQJA 3AFCA 3VGZA 3MZKA 2IAAA 2G9AA 3OKYA 4H5IA 2B5MA 4Z8LA 3RLMD 2B5LA 3SN6B 5FKRA 3SBPA 3OKYB 5K1CC 4ZOYA 5GXIA 1MG2A 3KRWB 3ORVD 4L3GD 4GZ8A 1YFQA 1MDAH 3SVWD 2YB8B 5CYKB 3CFSB 2TRCB 3PXWD 3JPXA 4A2LA 5AJAA 2AH1A 1GG2B 3I7PA 5GMKn 4J0XA 5I5IA 3EI2B 3AH8B 2CN3A 5EM2A 3NVNA 4YVDA 1QNIA 1ERJA 2O9KA 5HE2B 2GC4A 3EI1B 2OVRB 4A08B 2OK6A 3SLED 3B7FA 2BCJB 4PSXB 4CI2A 1GOTB 2AGZA 1B9YA 3K26A 4FWWA 3V9FA 4AEZA 4BL0A 4O1QD 2HJ4A 4A0BB 5I5JA 3L4OD 4A0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6Q A;  3IJ1 A;  3V7D B;  3CIK B;  1XHM A;  4E54 A;  2IWK A;  4PXW A;  3I2N A;  1VYH C;  2AQ5 A;  2IWF A;  5FXY A;  3SBQ A;  3N0E A;  2CE9 A;  5THA A;  4J86 A;  2P9N C;  3UVO A;  5CXC A;  2CO0 C;  5I5M A;  2CO0 A;  2H13 A;  1PI6 A;  4AOW A;  4BH6 A;  2I0T A;  3K27 A;  4CI3 A;  5JWZ A;  4EWR A;  2IUV A;  3J80 g;  3UKR C;  1SHY B;  4E5Z A;  5A2Q g;  5EAP A;  2Q7Q A;  3MXX A;  5C2V B;  2H3X A;  2I3T A;  1TBG A;  4FB1 D;  3C9C A;  4A11 B;  5CXB B;  3OKW A;  2CE8 A;  5FQD A;  2HES X;  4A09 B;  3SBR A;  3RN1 D;  3EI4 B;  5AMS A;  2EBS A;  4GM9 A;  2Z2P A;  2XU7 A;  2Z2O A;  3U4Y A;  1Q47 A;  3PXS D;  5HE0 B;  2AGX A;  3EWE A;  4L9O A;  1K32 A;  2H47 A;  3PSL A;  3HFQ A;  3PVU B;  1N6F A;  5IC7 A;  3DWL C;  4OWR A;  2HYE A;  4J79 A;  4O3U B;  5IJ8 E;  3A0F A;  3EMH A;  4ZN4 A;  3IIY A;  4XEI C;  2HKR A;  2I3S A;  3DXK C;  5B4W A;  3ZWL B;  1PBY B;  1P22 A;  2CNX A;  2GNQ A;  2P9U C;  4ZOZ A;  4JSN C;  3SHF A;  2PM9 B;  4HDJ A;  2UZX B;  5TF2 A;  4GGA A;  4X63 B;  2H68 A;  4GQ1 A;  4FA4 D;  5EML B;  3KRX B;  4JSX C;  5EMK B;  2YNN A;  1PGU A;  1TYQ C;  3SCY A;  2YBA A;  4PNK B;  3BG0 A;  2Z2N A;  4I79 A;  4J73 A;  4CY5 A;  4A0A A;  2P9I C;  3OTT A;  1N6E A;  5C9Z B;  4A2M A;  4N14 A;  2OIZ A;  2G99 A;  3SWS D;  4R7A B;  3EI4 A;  2HJB A;  4L3H D;  5TEE A;  2IUP A;  4QRJ A;  3L4M D;  2OVQ B;  4A11 A;  3F3P A;  4H5J A;  4FAN D;  3RN0 D;  4KFM B;  2QXV A;  3RMZ D;  1U4C A;  4O45 A;  5SXM A;  4CI8 A;  5EMM B;  4Y7R A;  4J78 A;  4J0W A;  5KDO B;  3BG1 A;  3PVW B;  2OJY A;  3I8E A;  4J81 A;  4ERZ A;  3CFV A;  3UVL A;  5AFU 3;  4D0K A;  2AGL A;  2PM9 A;  5C2W B;  3SMR A;  4A08 A;  5FKT A;  2B4E A;  3JZG A;  1OLZ A;  3UR4 A;  2W18 A;  4FA1 D;  4JSV C;  1NR0 A;  2QC5 A;  4CZX A;  3MZL A;  4GGD A;  2B5N A;  3FM0 A;  3W15 A;  4Y5R D;  3EG6 A;  5FKQ A;  2I0S A;  3C99 A;  4ESG A;  3F3F A;  4G56 B;  3I8C A;  3JZN A;  5FKS A;  4ERQ A;  5HYN B;  5IGQ A;  4CY3 A;  2PBI B;  5EM2 B;  4D6V A;  4QL1 A;  2XYI A;  2IUR A;  3RFH A;  4E5Z B;  3N0D A;  3AL8 A;  3RRM C;  1L0Q A;  2H9L A;  4X61 B;  1XIP A;  1R5M A;  3SJL D;  3J81 g;  4GGC A;  2YNP A;  4X60 B;  5CXB A;  5HQG A;  1U2V C;  3NVQ A;  3BWS A;  1FWX A;  4K3I D;  2I0R A;  4LG8 A;  3IJC A;  3I7H A;  4ERY A;  4A7J A;  4J87 A;  1SQ9 A;  2GC7 A;  5EMJ B;  4U1E I;  5IGO A;  3DSM A;  3FRX A;  3C5M A;  4MK0 B;  3I7O A;  4OZU A;  4LGN A;  2YNO A;  2UZY B;  2BBK H;  1N6D A;  2OK4 A;  4ZOV A;  4O3T B;  3F3G A;  2J56 H;  3IKO A;  4JXM A;  3IIW A;  2P9L C;  3GRE A;  3C75 H;  2P9K C;  2J57 G;  2XL3 A;  3P4F A;  3PSC B;  4GQ2 P;  4U7A A;  1XKS A;  4J84 A;  3UVM A;  4CZY A;  3JRP A;  4NSX A;  2IUQ A;  1K8K C;  2H6N A;  3UKU C;  3JZH A;  4IMM A;  3JRO A;  3I7L A;  3SFZ A;  1RI6 A;  3FGB A;  3ODT A;  4L1Q D;  2H9N A;  4CY1 A;  3RSE C;  1NEX B;  1JJU B;  4J8B A;  5IJ7 E;  4ES0 A;  5EAM A;  3NVX A;  4FHL A;  4QQE A;  4J8G A;  1S4U X;  3AL8 B;  2AGW A;  4PC0 A;  4IA9 A;  2HXC A;  2H9M A;  3EI3 B;  5FA5 B;  5HE1 B;  4UI9 R;  1PEV A;  3V5W B;  1GP2 B;  4QT8 A;  4CZV A;  4JD2 C;  2OVP B;  3IJ0 A;  4PSW B;  3GFC A;  1JMZ B;  2PM6 B;  2XL2 A;  4JT6 C;  3OL2 B;  3OL2 A;  4GMB A;  5GSA A;  2AH0 A;  3EU7 A;  5GXH A;  3E0C A;  3VA6 A;  1JMX B;  5TDH B;  4X3E A;  3UVN A;  2YMU A;  3EI3 A;  2MTA H;  2H9P A;  5EAR A;  3UVK A;  4BUJ C;  2AGY A;  3I7K A;  1OMW B;  4PBZ A;  5H17 A;  5H1M A;  4FAV D;  4CI1 A;  4XYI A;  3MKS B;  4CY2 A;  3PXT D;  5CXC B;  4A09 A;  4XYH A;  3RFG A;  3OKT A;  2PM7 B;  1MG3 A;  4A0A B;  5IT9 g;  4TZ4 A;  4O9D A;  4FA9 D;  1JOF A;  5K19 A;  3AL9 A;  3I7N A;  5TEF A;  1GXR A;  3OW8 A;  3MMY A;  2CN2 A;  4K3J B;  4GQB B;  2P9P C;  4J82 A;  2J55 H;  4GM8 A;  3DM0 A;  4FA5 D;  4LG9 A;  5FLX g;  3JB9 L;  3PE7 A;  2H6K A;  4PBY A;  4E54 B;  4GM3 A;  1B9X A;  3MKQ A;  4JT5 C;  3I89 A;  3DXM C;  2HKM A;  2P9S C;  4JSP C;  4CC9 A;  3JAM g;  3EI2 A;  5EAL A;  5H14 A;  4J77 A;  4ZOX A;  1A0R B;  2H14 A;  3SXT D;  3VH0 A;  5HE3 B;  5CYK A;  3ULE C;  3EI1 A;  1SQJ A;  3AFC A;  3VGZ A;  3MZK A;  2IAA A;  2G9A A;  3OKY A;  4H5I A;  2B5M A;  4Z8L A;  3RLM D;  2B5L A;  3SN6 B;  5FKR A;  3SBP A;  3OKY B;  5K1C C;  4ZOY A;  5GXI A;  1MG2 A;  3KRW B;  3ORV D;  4L3G D;  4GZ8 A;  1YFQ A;  1MDA H;  3SVW D;  2YB8 B;  5CYK B;  3CFS B;  2TRC B;  3PXW D;  3JPX A;  4A2L A;  5AJA A;  2AH1 A;  1GG2 B;  3I7P A;  5GMK n;  4J0X A;  5I5I A;  3EI2 B;  3AH8 B;  2CN3 A;  5EM2 A;  3NVN A;  4YVD A;  1QNI A;  1ERJ A;  2O9K A;  5HE2 B;  2GC4 A;  3EI1 B;  2OVR B;  4A08 B;  2OK6 A;  3SLE D;  3B7F A;  2BCJ B;  4PSX B;  4CI2 A;  1GOT B;  2AGZ A;  1B9Y A;  3K26 A;  4FWW A;  3V9F A;  4AEZ A;  4BL0 A;  4O1Q D;  2HJ4 A;  4A0B B;  5I5J A;  3L4O D;  4A0B A; 
#chains in the Genus database with same CATH topology
 2H6Q A;  3IJ1 A;  3V7D B;  3CIK B;  1XHM A;  4E54 A;  4AMZ A;  1UTC A;  2IWK A;  4PXW A;  3I2N A;  5M5T A;  1VYH C;  2AQ5 A;  2IWF A;  4NBM A;  5FXY A;  3SBQ A;  1H2X A;  3N0E A;  2CE9 A;  1JV2 A;  5THA A;  4J86 A;  4D9S A;  2P9N C;  1TYE A;  3UVO A;  5CXC A;  2CO0 C;  5I5M A;  2CO0 A;  2H13 A;  4RE6 A;  1PI6 A;  4AOW A;  3IJE A;  4BH6 A;  2I0T A;  3K27 A;  4CI3 A;  5JWZ A;  4EWR A;  2IUV A;  3J80 g;  3UKR C;  1SHY B;  4E5Z A;  5A2Q g;  3VI3 A;  3V4P A;  5EAP A;  1GOF A;  2Q7Q A;  3MXX A;  5E6R A;  5C2V B;  2H3X A;  2I3T A;  1T2X A;  1TBG A;  2VZ3 A;  3C9C A;  4A11 B;  4FB1 D;  3IUJ A;  5CXB B;  3OKW A;  2CE8 A;  5FQD A;  1GOG A;  2HES X;  4A09 B;  3SBR A;  3RN1 D;  3EI4 B;  5AMS A;  2EBS A;  4GM9 A;  2VDL A;  2Z2P A;  2XU7 A;  2Z2O A;  3U4Y A;  1Q47 A;  3PXS D;  5HE0 B;  2AGX A;  3EWE A;  4L9O A;  1K32 A;  2H47 A;  3PSL A;  4BCB A;  3HFQ A;  3PVU B;  1N6F A;  5IC7 A;  3DWL C;  4WJK A;  4OWR A;  2HYE A;  4J79 A;  4O3U B;  5IJ8 E;  1UOO A;  1U8C A;  5M5R A;  3A0F A;  3EMH A;  3IUN A;  4Z7N A;  4ZN4 A;  3IIY A;  4XEI C;  2HKR A;  2I3S A;  3DXK C;  5B4W A;  3ZWL B;  1PBY B;  1P22 A;  2CNX A;  2GNQ A;  2P9U C;  4ZOZ A;  4UM8 A;  1E8M A;  3IUL A;  4JSN C;  3SHF A;  2PM9 B;  4IRZ A;  4HDJ A;  2UZX B;  5TF2 A;  4GGA A;  4WK0 A;  4X63 B;  2BKL A;  2H68 A;  2VDR A;  4GQ1 A;  4FA4 D;  5M61 A;  4L1M A;  5EML B;  3K71 A;  3KRX B;  4JSX C;  5EMK B;  2YNN A;  1PGU A;  1TYQ C;  3SCY A;  3ZE1 A;  5C92 A;  4DNU A;  2YBA A;  4PNK B;  3BG0 A;  2Z2N A;  4I79 A;  4J73 A;  4CY5 A;  2VZ1 A;  4A0A A;  3MUO A;  1VE6 A;  2P9I C;  3OTT A;  4RE5 A;  1N6E A;  5C9Z B;  4A2M A;  2OIZ A;  4N14 A;  2G99 A;  3SWS D;  3O4H A;  4R7A B;  3EI4 A;  3MVD K;  2HJB A;  4L3H D;  5TEE A;  2IUP A;  4QRJ A;  3L4M D;  2OVQ B;  4A11 A;  3FCS A;  3F3P A;  4H5J A;  4FAN D;  2VC2 A;  3NIG A;  4KFM B;  3RN0 D;  2QXV A;  3RMZ D;  3QI0 A;  1U4C A;  1C9L A;  3FCU A;  4O45 A;  5SXM A;  5EMM B;  4Y7R A;  4CI8 A;  4J78 A;  5M5S A;  4J0W A;  5KDO B;  1K3I A;  3BG1 A;  2XE4 A;  2OJY A;  3PVW B;  3I8E A;  4J81 A;  4ERZ A;  3CFV A;  3UVL A;  5AFU 3;  4D0K A;  2AGL A;  4AN0 A;  2PM9 A;  5C2W B;  3SMR A;  1QFS A;  4A08 A;  4WK2 A;  1VE7 A;  2B4E A;  3JZG A;  5FKT A;  1OLZ A;  2WQ8 A;  4JHN A;  3UR4 A;  2W18 A;  1M1X A;  4FA1 D;  4JSV C;  5E6S A;  1NR0 A;  2QC5 A;  4CZX A;  3MZL A;  4GGD A;  2B5N A;  3FM0 A;  4O02 A;  3IUM A;  3W15 A;  4Y5R D;  3EG6 A;  5FKQ A;  4QAM A;  2I0S A;  3C99 A;  4ESG A;  3F3F A;  4G56 B;  3I8C A;  3JZN A;  5FKS A;  1GOH A;  4NEN A;  4ERQ A;  5HYN B;  5IGQ A;  4CY3 A;  2PBI B;  5EM2 B;  3OF7 A;  4D6V A;  5C86 A;  4QL1 A;  2XYI A;  1C9I A;  2IUR A;  3RFH A;  1VZ2 A;  4O2W A;  3VI4 A;  4E5Z B;  2EID A;  3N0D A;  4UM9 A;  3AL8 A;  1O6F A;  3RRM C;  1L0Q A;  2H9L A;  3NIF A;  4X61 B;  1XIP A;  1R5M A;  3O4J A;  3SJL D;  4AN1 A;  3J81 g;  4GGC A;  2VDN A;  2YNP A;  4X60 B;  5CXB A;  5HQG A;  4G1M A;  1U2V C;  3NVQ A;  3BWS A;  1FWX A;  4K3I D;  2I0R A;  4LG8 A;  3IJC A;  3GD1 I;  3I7H A;  4ERY A;  2HU7 A;  4A7J A;  4J87 A;  1SQ9 A;  2GC7 A;  5EMJ B;  3GC3 B;  4U1E I;  5IGO A;  3DSM A;  3FRX A;  3EQ9 A;  3C5M A;  3IUQ A;  2VDK A;  4MK0 B;  3I7O A;  4MMX A;  4OZU A;  4LGN A;  2YNO A;  2UZY B;  2BBK H;  1N6D A;  2OK4 A;  2VDO A;  4ZOV A;  4O3T B;  3F3G A;  2J56 H;  3IKO A;  1A12 A;  5FFG A;  4JXM A;  3IIW A;  3O4G A;  2P9L C;  3GRE A;  3C75 H;  2P9K C;  2J57 G;  2XL3 A;  3P4F A;  3PSC B;  4GQ2 P;  4U7A A;  1XKS A;  4J84 A;  3UVM A;  4CZY A;  1UOP A;  3JRP A;  2EIC A;  4NSX A;  2IUQ A;  1K8K C;  2H6N A;  1JTD B;  3UKU C;  3JZH A;  4IMM A;  3JRO A;  3I7L A;  3SFZ A;  1RI6 A;  3FGB A;  3ODT A;  4L1Q D;  2H9N A;  3EQ7 A;  3RSE C;  1NEX B;  1JJU B;  4J8B A;  4CY1 A;  4ES0 A;  5EAM A;  4AMY A;  5IJ7 E;  3NVX A;  4FHL A;  2XZG A;  4QQE A;  4J8G A;  1S4U X;  3AL8 B;  2AGW A;  4PC0 A;  3KCI A;  5E6U A;  1O6G A;  4IA9 A;  2HXC A;  2H9M A;  1H2Z A;  3EI3 B;  3ZDZ A;  1L5G A;  4DNV A;  5FA5 B;  2JKX A;  5HE1 B;  4UI9 R;  1H2Y A;  1PEV A;  3IUR A;  3V5W B;  1GP2 B;  4QT8 A;  4CZV A;  4JD2 C;  2OVP B;  3IJ0 A;  4PSW B;  3GFC A;  1JMZ B;  2PM6 B;  2XL2 A;  4JT6 C;  4JHP C;  3OL2 B;  3T3P A;  3ZDX A;  3OL2 A;  5M5U A;  4GMB A;  5GSA A;  2AH0 A;  3EU7 A;  4MMY A;  5GXH A;  3E0C A;  3VA6 A;  2VDM A;  4BP8 A;  1JMX B;  5TDH B;  4X3E A;  4G55 A;  3T3M A;  3UVN A;  1E5T A;  2YMU A;  2QZP A;  1UOQ A;  3EI3 A;  2MTA H;  2H9P A;  1H2W A;  5EAR A;  3UVK A;  4BUJ C;  2AGY A;  3I7K A;  1OMW B;  3EQ8 A;  4PBZ A;  2HU5 A;  5H17 A;  5H1M A;  4FAV D;  4CI1 A;  4XYI A;  3MKS B;  4CY2 A;  3PXT D;  1I2M B;  5CXC B;  4A09 A;  4AX4 A;  4XYH A;  3RFG A;  3OKT A;  2PM7 B;  4MMZ A;  1MG3 A;  4A0A B;  5IT9 g;  5FFO A;  4TZ4 A;  4O9D A;  2EIB A;  4FA9 D;  1JOF A;  3V4V A;  5K19 A;  3AL9 A;  3I7N A;  2HU8 A;  1GXR A;  2QR5 A;  3OW8 A;  5TEF A;  3MMY A;  2CN2 A;  4K3J B;  1BPO A;  4GQB B;  2P9P C;  4J82 A;  2J55 H;  4GM8 A;  3DM0 A;  3ZDY A;  4FA5 D;  1E8N A;  4LG9 A;  5FLX g;  3JB9 L;  3PE7 A;  2H6K A;  4PBY A;  4NAA A;  4E54 B;  4GM3 A;  1B9X A;  4WK4 A;  3MKQ A;  4JT5 C;  3I89 A;  3DXM C;  2HKM A;  2P9S C;  4JSP C;  4CC9 A;  3JAM g;  3EI2 A;  5EAL A;  5H14 A;  4J77 A;  3DDU A;  1A0R B;  2H14 A;  4ZOX A;  2VDQ A;  3SXT D;  3VH0 A;  5HE3 B;  5CYK A;  3ULE C;  1VZ3 A;  4BCC A;  3IVM A;  3EI1 A;  1SQJ A;  3AFC A;  3VGZ A;  1YR2 A;  3MZK A;  2IAA A;  2G9A A;  3OKY A;  4H5I A;  2B5M A;  4Z8L A;  3RLM D;  4DNW A;  2B5L A;  5M5V A;  2EIE A;  3SN6 B;  3K72 A;  5FKR A;  3SBP A;  3OKY B;  5K1C C;  4ZOY A;  5GXI A;  1MG2 A;  3KRW B;  3ZE2 A;  3ORV D;  4G1E A;  4L3G D;  3NID A;  4GZ8 A;  1YFQ A;  1MDA H;  3SVW D;  4Z7O A;  3K6S A;  5HDB A;  2YB8 B;  5CYK B;  3CFS B;  2TRC B;  4BP9 A;  3PXW D;  3JPX A;  3MUN A;  4A2L A;  1QFM A;  5AJA A;  2AH1 A;  1GG2 B;  3I7P A;  5GMK n;  4J0X A;  5I5I A;  3EI2 B;  3AH8 B;  2CN3 A;  5EM2 A;  3NVN A;  2VDP A;  4YVD A;  1QNI A;  1ERJ A;  2O9K A;  4NC4 A;  5HE2 B;  4BCD A;  2GC4 A;  3ZE0 A;  3EI1 B;  3QHY B;  2OVR B;  4A08 B;  2OK6 A;  3SLE D;  3B7F A;  2BCJ B;  4PSX B;  4CI2 A;  1GOT B;  2AGZ A;  4FWW A;  1B9Y A;  2XDW A;  3K26 A;  3V9F A;  4AEZ A;  4O1Q D;  4BL0 A;  2HJ4 A;  4Z7Q A;  4A0B B;  5I5J A;  3L4O D;  3O4I A;  4A0B A; 
#chains in the Genus database with same CATH homology
 2H6Q A;  3IJ1 A;  3V7D B;  3CIK B;  1XHM A;  4E54 A;  2IWK A;  4PXW A;  3I2N A;  1VYH C;  2AQ5 A;  2IWF A;  5FXY A;  3SBQ A;  3N0E A;  2CE9 A;  5THA A;  4J86 A;  2P9N C;  3UVO A;  5CXC A;  2CO0 C;  5I5M A;  2CO0 A;  2H13 A;  1PI6 A;  4AOW A;  4BH6 A;  2I0T A;  3K27 A;  4CI3 A;  5JWZ A;  4EWR A;  2IUV A;  3J80 g;  3UKR C;  1SHY B;  4E5Z A;  5A2Q g;  5EAP A;  2Q7Q A;  3MXX A;  5C2V B;  2H3X A;  2I3T A;  1TBG A;  4FB1 D;  3C9C A;  4A11 B;  5CXB B;  3OKW A;  2CE8 A;  5FQD A;  2HES X;  4A09 B;  3SBR A;  3RN1 D;  3EI4 B;  5AMS A;  2EBS A;  4GM9 A;  2Z2P A;  2XU7 A;  2Z2O A;  3U4Y A;  1Q47 A;  3PXS D;  5HE0 B;  2AGX A;  3EWE A;  4L9O A;  1K32 A;  2H47 A;  3PSL A;  3HFQ A;  3PVU B;  1N6F A;  5IC7 A;  3DWL C;  4OWR A;  2HYE A;  4J79 A;  4O3U B;  5IJ8 E;  3A0F A;  3EMH A;  4ZN4 A;  3IIY A;  4XEI C;  2HKR A;  2I3S A;  3DXK C;  5B4W A;  3ZWL B;  1PBY B;  1P22 A;  2CNX A;  2GNQ A;  2P9U C;  4ZOZ A;  4JSN C;  3SHF A;  2PM9 B;  4HDJ A;  2UZX B;  5TF2 A;  4GGA A;  4X63 B;  2H68 A;  4GQ1 A;  4FA4 D;  5EML B;  3KRX B;  4JSX C;  5EMK B;  2YNN A;  1PGU A;  1TYQ C;  3SCY A;  2YBA A;  4PNK B;  3BG0 A;  2Z2N A;  4I79 A;  4J73 A;  4CY5 A;  4A0A A;  2P9I C;  3OTT A;  1N6E A;  5C9Z B;  4A2M A;  4N14 A;  2OIZ A;  2G99 A;  3SWS D;  4R7A B;  3EI4 A;  2HJB A;  4L3H D;  5TEE A;  2IUP A;  4QRJ A;  3L4M D;  2OVQ B;  4A11 A;  3F3P A;  4H5J A;  4FAN D;  3RN0 D;  4KFM B;  2QXV A;  3RMZ D;  1U4C A;  4O45 A;  5SXM A;  4CI8 A;  5EMM B;  4Y7R A;  4J78 A;  4J0W A;  5KDO B;  3BG1 A;  3PVW B;  2OJY A;  3I8E A;  4J81 A;  4ERZ A;  3CFV A;  3UVL A;  5AFU 3;  4D0K A;  2AGL A;  2PM9 A;  5C2W B;  3SMR A;  4A08 A;  5FKT A;  2B4E A;  3JZG A;  1OLZ A;  3UR4 A;  2W18 A;  4FA1 D;  4JSV C;  1NR0 A;  2QC5 A;  4CZX A;  3MZL A;  4GGD A;  2B5N A;  3FM0 A;  3W15 A;  4Y5R D;  3EG6 A;  5FKQ A;  2I0S A;  3C99 A;  4ESG A;  3F3F A;  4G56 B;  3I8C A;  3JZN A;  5FKS A;  4ERQ A;  5HYN B;  5IGQ A;  4CY3 A;  2PBI B;  5EM2 B;  4D6V A;  4QL1 A;  2XYI A;  2IUR A;  3RFH A;  4E5Z B;  3N0D A;  3AL8 A;  3RRM C;  1L0Q A;  2H9L A;  4X61 B;  1XIP A;  1R5M A;  3SJL D;  3J81 g;  4GGC A;  2YNP A;  4X60 B;  5CXB A;  5HQG A;  1U2V C;  3NVQ A;  3BWS A;  1FWX A;  4K3I D;  2I0R A;  4LG8 A;  3IJC A;  3I7H A;  4ERY A;  4A7J A;  4J87 A;  1SQ9 A;  2GC7 A;  5EMJ B;  4U1E I;  5IGO A;  3DSM A;  3FRX A;  3C5M A;  4MK0 B;  3I7O A;  4OZU A;  4LGN A;  2YNO A;  2UZY B;  2BBK H;  1N6D A;  2OK4 A;  4ZOV A;  4O3T B;  3F3G A;  2J56 H;  3IKO A;  4JXM A;  3IIW A;  2P9L C;  3GRE A;  3C75 H;  2P9K C;  2J57 G;  2XL3 A;  3P4F A;  3PSC B;  4GQ2 P;  4U7A A;  1XKS A;  4J84 A;  3UVM A;  4CZY A;  3JRP A;  4NSX A;  2IUQ A;  1K8K C;  2H6N A;  3UKU C;  3JZH A;  4IMM A;  3JRO A;  3I7L A;  3SFZ A;  1RI6 A;  3FGB A;  3ODT A;  4L1Q D;  2H9N A;  4CY1 A;  3RSE C;  1NEX B;  1JJU B;  4J8B A;  5IJ7 E;  4ES0 A;  5EAM A;  3NVX A;  4FHL A;  4QQE A;  4J8G A;  1S4U X;  3AL8 B;  2AGW A;  4PC0 A;  4IA9 A;  2HXC A;  2H9M A;  3EI3 B;  5FA5 B;  5HE1 B;  4UI9 R;  1PEV A;  3V5W B;  1GP2 B;  4QT8 A;  4CZV A;  4JD2 C;  2OVP B;  3IJ0 A;  4PSW B;  3GFC A;  1JMZ B;  2PM6 B;  2XL2 A;  4JT6 C;  3OL2 B;  3OL2 A;  4GMB A;  5GSA A;  2AH0 A;  3EU7 A;  5GXH A;  3E0C A;  3VA6 A;  1JMX B;  5TDH B;  4X3E A;  3UVN A;  2YMU A;  3EI3 A;  2MTA H;  2H9P A;  5EAR A;  3UVK A;  4BUJ C;  2AGY A;  3I7K A;  1OMW B;  4PBZ A;  5H17 A;  5H1M A;  4FAV D;  4CI1 A;  4XYI A;  3MKS B;  4CY2 A;  3PXT D;  5CXC B;  4A09 A;  4XYH A;  3RFG A;  3OKT A;  2PM7 B;  1MG3 A;  4A0A B;  5IT9 g;  4TZ4 A;  4O9D A;  4FA9 D;  1JOF A;  5K19 A;  3AL9 A;  3I7N A;  5TEF A;  1GXR A;  3OW8 A;  3MMY A;  2CN2 A;  4K3J B;  4GQB B;  2P9P C;  4J82 A;  2J55 H;  4GM8 A;  3DM0 A;  4FA5 D;  4LG9 A;  5FLX g;  3JB9 L;  3PE7 A;  2H6K A;  4PBY A;  4E54 B;  4GM3 A;  1B9X A;  3MKQ A;  4JT5 C;  3I89 A;  3DXM C;  2HKM A;  2P9S C;  4JSP C;  4CC9 A;  3JAM g;  3EI2 A;  5EAL A;  5H14 A;  4J77 A;  4ZOX A;  1A0R B;  2H14 A;  3SXT D;  3VH0 A;  5HE3 B;  5CYK A;  3ULE C;  3EI1 A;  1SQJ A;  3AFC A;  3VGZ A;  3MZK A;  2IAA A;  2G9A A;  3OKY A;  4H5I A;  2B5M A;  4Z8L A;  3RLM D;  2B5L A;  3SN6 B;  5FKR A;  3SBP A;  3OKY B;  5K1C C;  4ZOY A;  5GXI A;  1MG2 A;  3KRW B;  3ORV D;  4L3G D;  4GZ8 A;  1YFQ A;  1MDA H;  3SVW D;  2YB8 B;  5CYK B;  3CFS B;  2TRC B;  3PXW D;  3JPX A;  4A2L A;  5AJA A;  2AH1 A;  1GG2 B;  3I7P A;  5GMK n;  4J0X A;  5I5I A;  3EI2 B;  3AH8 B;  2CN3 A;  5EM2 A;  3NVN A;  4YVD A;  1QNI A;  1ERJ A;  2O9K A;  5HE2 B;  2GC4 A;  3EI1 B;  2OVR B;  4A08 B;  2OK6 A;  3SLE D;  3B7F A;  2BCJ B;  4PSX B;  4CI2 A;  1GOT B;  2AGZ A;  1B9Y A;  3K26 A;  4FWW A;  3V9F A;  4AEZ A;  4BL0 A;  4O1Q D;  2HJ4 A;  4A0B B;  5I5J A;  3L4O D;  4A0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...