4JT6C

Structure of mtordeltan-mlst8-pi-103 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
317
structure length
317
Chain Sequence
b'VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
molecule keywords mTOR
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jt6C01
2O9KA 3F3GA 1S4UX 3RSEC 5CXBA 4BUJC 4BL0A 5FKTA 3PVWB 3RFHA 4CY1A 4FB1D 3EMHA 3JZHA 1QNIA 3AFCA 5TEEA 4FAVD 3A0FA 4ES0A 4L9OA 1B9YA 2H9LA 4PBZA 3F3FA 3C75H 5IC7A 3BWSA 2CE9A 3CFVA 1SQ9A 4CY3A 3EI2A 2CN2A 4IA9A 4CZXA 2P9PC 2H3XA 3IIWA 4O3TB 1MG2A 3I7HA 3SMRA 3I8CA 1L0QA 4A11A 2G99A 2OK6A 1N6FA 4ZN4A 2EBSA 4J8GA 4A0AA 2XL3A 4GGCA 2J55H 2H14A 4X61B 5TEFA 3K26A 4CI1A 4ERZA 1JJUB 2AGXA 3RMZD 1PBYB 1YFQA 3MMYA 2CO0C 1PGUA 2IURA 3UVLA 5FKQA 2OVQB 5FKSA 4L3HD 5C9ZB 1P22A 5EAPA 3EWEA 3ODTA 1TBGA 1N6DA 4LG9A 4K3ID 2YBAA 3V9FA 5CYKB 3OKYB 5B4WA 3UVMA 5EAMA 4JSPC 4QRJA 2IAAA 3U4YA 2IUPA 2Z2PA 4GM8A 4O45A 2HKRA 3UVOA 3PSLA 3EI3A 2H13A 5CXCB 4H5JA 4E5ZB 2P9LC 3K27A 4PBYA 3UR4A 3OKWA 5C2VB 4PC0A 5HYNB 4A08A 5C2WB 2H47A 2I0TA 3AL8B 4ZOYA 1JMXB 4GMBA 3PSCB 4G56B 4IMMA 2IUQA 2H68A 4ESGA 4X3EA 1SQJA 5EMKB 2AQ5A 1VYHC 3EI4A 5HE3B 5K1CC 3E0CA 4FWWA 5I5IA 2YNNA 4J86A 3PVUB 2B5LA 2IWFA 3RLMD 3RN1D 3FGBA 4GQBB 2AH0A 1NEXB 2I0SA 2W18A 2OVPB 2AGYA 5EMMB 3RFGA 3AL9A 5HE2B 4A7JA 4FA5D 3ZWLB 5EM2B 2MTAH 4AOWA 4CC9A 5EMLB 2YNPA 3UKUC 3AH8B 4GM3A 3EI1B 2HYEA 4JSXC 5EALA 3HFQA 1GP2B 1A0RB 2I0RA 4JD2C 2BCJB 4FA1D 3J81g 5TDHB 4A0BB 3DXMC 4JT6C 4PSXB 3JROA 4K3JB 1U2VC 5IJ7E 3GFCA 2UZXB 1XIPA 3MKSB 4A2MA 2BBKH 3SVWD 4ERYA 4MK0B 1NR0A 2OJYA 3MZKA 4GQ1A 2GNQA 3OTTA 4ZOXA 2H9PA 3IIYA 4U7AA 5FXYA 2CO0A 2Z2NA 3UVNA 5EMJB 2PM6B 5FKRA 2Z2OA 2OK4A 5HE0B 2OIZA 2J57G 1OMWB 3PXSD 3NVXA 5IGQA 5FA5B 4LGNA 4XYIA 4N14A 2YNOA 4J73A 1K8KC 4D0KA 5CYKA 3OKYA 3SN6B 3CIKB 2B4EA 5I5JA 5IGOA 2CE8A 5AMSA 3SXTD 1JMZB 5JWZA 3IKOA 4ZOZA 3ORVD 4J81A 1MDAH 5CXCA 3CFSB 2AGWA 5IJ8E 4ZOVA 4QL1A 4E5ZA 3JAMg 1U4CA 3MKQA 3VGZA 4E54B 3KRXB 3AL8A 3GREA 4LG8A 4J0XA 1FWXA 3B7FA 3ULEC 5GMKn 3NVNA 2QXVA 3JPXA 4CZYA 4HDJA 3UVKA 4FAND 4GM9A 5AJAA 3I8EA 2CN3A 3SBPA 2OVRB 3PXTD 4Y7RA 5GXHA 4PXWA 5EM2A 4GGDA 3BG1A 3OL2B 4PNKB 1XHMA 5HQGA 3C99A 1MG3A 5GXIA 3W15A 2Q7QA 1PI6A 3KRWB 3OKTA 1GOTB 1B9XA 1N6EA 2P9SC 4I79A 4GQ2P 4O3UB 4A0BA 5H1MA 4A09B 3IJ1A 2P9UC 2XYIA 4KFMB 3V5WB 4PSWB 4J79A 5FQDA 2IUVA 3DSMA 3FRXA 4AEZA 2QC5A 2UZYB 4GZ8A 2XU7A 3J80g 2P9NC 2AGZA 3UKRC 2HJ4A 4Z8LA 4H5IA 2H6NA 4D6VA 3FM0A 3SJLD 1GG2B 3I7OA 3JZGA 3C9CA 4GGAA 4X63B 4CZVA 3L4OD 4CI8A 5GSAA 2PM9B 5HE1B 5K19A 1R5MA 4J82A 3PE7A 1K32A 5AFU3 4FA9D 4XYHA 5SXMA 2P9IC 5CXBB 2B5NA 3N0DA 4J77A 1SHYB 2YMUA 3SBQA 4J8BA 2HXCA 4QT8A 1JOFA 2HJBA 4CY2A 2I3TA 2AGLA 4CY5A 4O1QD 5EARA 3SWSD 4JT5C 3I7KA 2H9MA 4L3GD 2YB8B 2HKMA 3C5MA 5KDOB 3EI2B 4E54A 3SLED 2TRCB 2H9NA 3F3PA 4YVDA 2CNXA 4R7AB 5TF2A 2J56H 2H6KA 4J78A 3MZLA 4UI9R 3DWLC 4A11B 1ERJA 3BG0A 3SBRA 2H6QA 4A0AB 4XEIC 2GC4A 5A2Qg 2P9KC 5IT9g 3V7DB 4A2LA 1Q47A 4J87A 2I3SA 3I89A 3OL2A 4BH6A 4J84A 1RI6A 4QQEA 2GC7A 3VA6A 3PXWD 3IJ0A 2PM7B 4J0WA 4OZUA 3L4MD 4NSXA 2PBIB 2XL2A 1PEVA 3I2NA 4CI2A 3NVQA 4JSNC 4CI3A 3EI1A 5H17A 4A09A 3P4FA 3MXXA 5H14A 4TZ4A 3SFZA 1OLZA 3EI3B 1TYQC 3RRMC 3DM0A 3I7NA 3JRPA 4A08B 1XKSA 3IJCA 2G9AA 5THAA 3SCYA 4ERQA 3EG6A 4FHLA 3JZNA 2AH1A 4JXMA 4X60B 3EU7A 4OWRA 2B5MA 3SHFA 5FLXg 3EI4B 4Y5RD 3I7PA 4U1EI 5I5MA 3DXKC 3VH0A 4JSVC 3RN0D 2HESX 3JB9L 4O9DA 2IWKA 3N0EA 4EWRA 2PM9A 4L1QD 1GXRA 4FA4D 3I7LA 3OW8A
chains in the Genus database with same CATH superfamily
2O9KA 3F3GA 1S4UX 1GOHA 3RSEC 5CXBA 4BUJC 4BL0A 5FKTA 3PVWB 3RFHA 4CY1A 4FB1D 3JZHA 3EMHA 2VC2A 1QNIA 3AFCA 5TEEA 4FAVD 3A0FA 1O6GA 3K72A 4ES0A 4L9OA 1B9YA 2H9LA 4PBZA 4G55A 1VE7A 2XE4A 1U8CA 1E8NA 3F3FA 3C75H 5IC7A 2HU7A 1GOGA 2CE9A 3BWSA 3CFVA 1SQ9A 4CY3A 4Z7QA 3EI2A 4UM9A 2CN2A 4IA9A 4CZXA 2P9PC 2H3XA 3IIWA 4O3TB 1MG2A 3I7HA 1UOOA 3SMRA 3I8CA 1C9IA 1L0QA 4A11A 2G99A 2OK6A 4BP8A 1N6FA 4ZN4A 2EBSA 4J8GA 1YR2A 2XL3A 4A0AA 4GGCA 2J55H 2H14A 4X61B 4G1EA 5TEFA 1E5TA 3K26A 5M5RA 4AN1A 4CI1A 3IUMA 4ERZA 1JJUB 2AGXA 3RMZD 1PBYB 1YFQA 3MMYA 2CO0C 1PGUA 4MMZA 2IURA 3UVLA 3IUQA 5FKQA 2OVQB 5FKSA 4L3HD 1BPOA 5C9ZB 1P22A 2VDQA 5EAPA 3EWEA 3ODTA 1TBGA 1N6DA 4LG9A 4K3ID 4Z7OA 2YBAA 3V4PA 3V9FA 5CYKB 3OKYB 5B4WA 3UVMA 5M61A 3ZE0A 3O4GA 5EAMA 2JKXA 4JSPC 3IUJA 4QRJA 2IAAA 3U4YA 2IUPA 2Z2PA 4GM8A 1I2MB 4O45A 2HKRA 3UVOA 3PSLA 3EI3A 2H13A 5CXCB 2VDPA 4H5JA 4E5ZB 3FCSA 2P9LC 3K27A 4PBYA 3UR4A 3OKWA 5C2VB 4PC0A 4WK0A 5HYNB 4A08A 5C2WB 2H47A 2I0TA 3AL8B 4ZOYA 1JMXB 4GMBA 3PSCB 4G56B 4IMMA 2IUQA 2H68A 3GC3B 4ESGA 1H2XA 2BKLA 4X3EA 1SQJA 5EMKB 2AQ5A 1VYHC 3EI4A 5HE3B 5K1CC 3E0CA 3MVDK 4FWWA 5I5IA 2YNNA 4J86A 3VI3A 3PVUB 3T3PA 3O4JA 2B5LA 1VZ3A 2IWFA 3RLMD 3RN1D 3FGBA 4GQBB 2AH0A 1NEXB 2I0SA 1QFSA 2W18A 2OVPB 2AGYA 5M5TA 4BCCA 5EMMB 3RFGA 3AL9A 5HE2B 4A7JA 4FA5D 3ZWLB 5EM2B 2MTAH 4AOWA 4CC9A 5EMLB 2YNPA 3DDUA 3UKUC 3AH8B 4GM3A 3EI1B 2HYEA 4AMYA 4JSXC 5EALA 2VDMA 3HFQA 1GP2B 1A0RB 2I0RA 4JD2C 2BCJB 4FA1D 3J81g 5TDHB 4WK4A 4A0BB 3ZDZA 3DXMC 4JT6C 4PSXB 3JROA 4K3JB 1U2VC 5IJ7E 3GFCA 2UZXB 1XIPA 3MKSB 4A2MA 2BBKH 3SVWD 4ERYA 3EQ9A 4MK0B 1NR0A 4O2WA 2OJYA 4QAMA 3EQ8A 3MZKA 4GQ1A 2GNQA 3OTTA 4RE6A 4ZOXA 2H9PA 3IIYA 4U7AA 5FXYA 1E8MA 3K6SA 2CO0A 2Z2NA 3UVNA 5EMJB 2PM6B 2QR5A 5FKRA 2Z2OA 2OK4A 5HE0B 1UTCA 2OIZA 2J57G 1OMWB 3PXSD 3NVXA 4IRZA 5IGQA 5FA5B 4UM8A 2XDWA 3IJEA 4LGNA 4XYIA 4JHNA 4NENA 4N14A 2EIBA 2YNOA 4MMXA 4Z7NA 3EQ7A 4J73A 3ZE2A 1K8KC 4D0KA 5CYKA 3OKYA 3SN6B 3CIKB 2B4EA 4G1MA 2VDNA 4AN0A 5I5JA 5IGOA 2CE8A 3ZE1A 5AMSA 3SXTD 1JMZB 5JWZA 5E6SA 3IKOA 2VZ1A 4ZOZA 3ORVD 4J81A 1MDAH 5CXCA 3CFSB 2AGWA 5IJ8E 4ZOVA 4QL1A 4E5ZA 3JAMg 1U4CA 3MKQA 3VGZA 4E54B 5C86A 3KRXB 3AL8A 3GREA 1QFMA 4LG8A 4J0XA 5FFGA 3O4IA 1FWXA 3NIDA 3B7FA 3ULEC 5GMKn 3NVNA 2QXVA 3JPXA 4CZYA 4HDJA 3UVKA 4FAND 4GM9A 5AJAA 3I8EA 2CN3A 4D9SA 4BP9A 3SBPA 5E6RA 2OVRB 1K3IA 3PXTD 4MMYA 4Y7RA 1UOPA 5GXHA 4PXWA 3IVMA 1VZ2A 5EM2A 4GGDA 3BG1A 3OL2B 4PNKB 1XHMA 1H2ZA 5HQGA 3C99A 1MG3A 5GXIA 3W15A 3FCUA 2Q7QA 5E6UA 3KCIA 4AMZA 1H2YA 1PI6A 3IUNA 3KRWB 3OKTA 1GOTB 5FFOA 1B9XA 1N6EA 2P9SC 4I79A 2QZPA 3NIFA 4GQ2P 4O3UB 4A0BA 5H1MA 4A09B 3IJ1A 2P9UC 2XYIA 2EIDA 1A12A 1GOFA 4KFMB 2VDRA 3V5WB 4PSWB 4J79A 5FQDA 2IUVA 3DSMA 3FRXA 4AEZA 2QC5A 2UZYB 4GZ8A 2XU7A 4JHPC 3J80g 2P9NC 2AGZA 3UKRC 2HJ4A 4Z8LA 4H5IA 2H6NA 3O4HA 4D6VA 3FM0A 3SJLD 3GD1I 1GG2B 3I7OA 3JZGA 5M5SA 3C9CA 4GGAA 4X63B 3QI0A 4CZVA 3L4OD 4CI8A 5GSAA 2PM9B 5HE1B 5K19A 1R5MA 4J82A 3PE7A 1K32A 4BCDA 5AFU3 4FA9D 4XYHA 5SXMA 1TYEA 2P9IC 5CXBB 2B5NA 3N0DA 1O6FA 4J77A 1SHYB 1C9LA 2YMUA 3VI4A 2EICA 4NBMA 3SBQA 4J8BA 2HXCA 4QT8A 1JOFA 2HJBA 4CY2A 2I3TA 2AGLA 4RE5A 4CY5A 4O1QD 5EARA 3SWSD 4JT5C 3I7KA 2H9MA 4L3GD 2XZGA 2YB8B 2HKMA 2VZ3A 3C5MA 3MUOA 4DNVA 5KDOB 3EI2B 4E54A 3SLED 2TRCB 2H9NA 3F3PA 4YVDA 2CNXA 3IULA 4R7AB 5TF2A 2J56H 2H6KA 4J78A 3MZLA 4UI9R 2VDLA 4WJKA 3DWLC 4A11B 1ERJA 5C92A 3V4VA 1JV2A 3BG0A 1VE6A 3SBRA 2H6QA 4A0AB 4O02A 4XEIC 2GC4A 3OF7A 2HU5A 2P9KC 5A2Qg 4L1MA 5IT9g 4BCBA 3V7DB 4A2LA 1Q47A 3MUNA 4J87A 4DNUA 2I3SA 3I89A 3OL2A 4BH6A 4J84A 1RI6A 4QQEA 2GC7A 3VA6A 3PXWD 3IJ0A 5M5UA 2PM7B 4J0WA 4OZUA 3NIGA 4WK2A 3ZDXA 3L4MD 4NSXA 2PBIB 3QHYB 2XL2A 3K71A 1PEVA 3I2NA 4CI2A 4NC4A 3NVQA 4JSNC 5M5VA 2HU8A 4CI3A 1H2WA 3EI1A 5H17A 4A09A 3P4FA 3MXXA 5H14A 4TZ4A 3SFZA 1OLZA 3EI3B 1TYQC 3RRMC 4NAAA 1JTDB 3DM0A 3I7NA 3JRPA 3ZDYA 4A08B 1XKSA 3IJCA 2G9AA 2WQ8A 5THAA 3SCYA 3IURA 4ERQA 3EG6A 4FHLA 3JZNA 2VDOA 2AH1A 4JXMA 4X60B 3EU7A 4OWRA 2B5MA 3SHFA 5FLXg 3EI4B 4Y5RD 3I7PA 4U1EI 5I5MA 3DXKC 3VH0A 3T3MA 5HDBA 4JSVC 1UOQA 3RN0D 2HESX 1L5GA 3JB9L 4O9DA 4AX4A 4DNWA 1T2XA 2IWKA 3N0EA 2EIEA 2VDKA 4EWRA 2PM9A 4L1QD 1GXRA 4FA4D 3I7LA 3OW8A 1M1XA
chains in the Genus database with same CATH topology
2O9KA 3F3GA 1S4UX 3RSEC 5CXBA 4BUJC 4BL0A 5FKTA 3PVWB 3RFHA 4CY1A 4FB1D 3EMHA 3JZHA 1QNIA 3AFCA 5TEEA 4FAVD 3A0FA 4ES0A 4L9OA 1B9YA 2H9LA 4PBZA 3F3FA 3C75H 5IC7A 3BWSA 2CE9A 3CFVA 1SQ9A 4CY3A 3EI2A 2CN2A 4IA9A 4CZXA 2P9PC 2H3XA 3IIWA 4O3TB 1MG2A 3I7HA 3SMRA 3I8CA 1L0QA 4A11A 2G99A 2OK6A 1N6FA 4ZN4A 2EBSA 4J8GA 4A0AA 2XL3A 4GGCA 2J55H 2H14A 4X61B 5TEFA 3K26A 4CI1A 4ERZA 1JJUB 2AGXA 3RMZD 1PBYB 1YFQA 3MMYA 2CO0C 1PGUA 2IURA 3UVLA 5FKQA 2OVQB 5FKSA 4L3HD 5C9ZB 1P22A 5EAPA 3EWEA 3ODTA 1TBGA 1N6DA 4LG9A 4K3ID 2YBAA 3V9FA 5CYKB 3OKYB 5B4WA 3UVMA 5EAMA 4JSPC 4QRJA 2IAAA 3U4YA 2IUPA 2Z2PA 4GM8A 4O45A 2HKRA 3UVOA 3PSLA 3EI3A 2H13A 5CXCB 4H5JA 4E5ZB 2P9LC 3K27A 4PBYA 3UR4A 3OKWA 5C2VB 4PC0A 5HYNB 4A08A 5C2WB 2H47A 2I0TA 3AL8B 4ZOYA 1JMXB 4GMBA 3PSCB 4G56B 4IMMA 2IUQA 2H68A 4ESGA 4X3EA 1SQJA 5EMKB 2AQ5A 1VYHC 3EI4A 5HE3B 5K1CC 3E0CA 4FWWA 5I5IA 2YNNA 4J86A 3PVUB 2B5LA 2IWFA 3RLMD 3RN1D 3FGBA 4GQBB 2AH0A 1NEXB 2I0SA 2W18A 2OVPB 2AGYA 5EMMB 3RFGA 3AL9A 5HE2B 4A7JA 4FA5D 3ZWLB 5EM2B 2MTAH 4AOWA 4CC9A 5EMLB 2YNPA 3UKUC 3AH8B 4GM3A 3EI1B 2HYEA 4JSXC 5EALA 3HFQA 1GP2B 1A0RB 2I0RA 4JD2C 2BCJB 4FA1D 3J81g 5TDHB 4A0BB 3DXMC 4JT6C 4PSXB 3JROA 4K3JB 1U2VC 5IJ7E 3GFCA 2UZXB 1XIPA 3MKSB 4A2MA 2BBKH 3SVWD 4ERYA 4MK0B 1NR0A 2OJYA 3MZKA 4GQ1A 2GNQA 3OTTA 4ZOXA 2H9PA 3IIYA 4U7AA 5FXYA 2CO0A 2Z2NA 3UVNA 5EMJB 2PM6B 5FKRA 2Z2OA 2OK4A 5HE0B 2OIZA 2J57G 1OMWB 3PXSD 3NVXA 5IGQA 5FA5B 4LGNA 4XYIA 4N14A 2YNOA 4J73A 1K8KC 4D0KA 5CYKA 3OKYA 3SN6B 3CIKB 2B4EA 5I5JA 5IGOA 2CE8A 5AMSA 3SXTD 1JMZB 5JWZA 3IKOA 4ZOZA 3ORVD 4J81A 1MDAH 5CXCA 3CFSB 2AGWA 5IJ8E 4ZOVA 4QL1A 4E5ZA 3JAMg 1U4CA 3MKQA 3VGZA 4E54B 3KRXB 3AL8A 3GREA 4LG8A 4J0XA 1FWXA 3B7FA 3ULEC 5GMKn 3NVNA 2QXVA 3JPXA 4CZYA 4HDJA 3UVKA 4FAND 4GM9A 5AJAA 3I8EA 2CN3A 3SBPA 2OVRB 3PXTD 4Y7RA 5GXHA 4PXWA 5EM2A 4GGDA 3BG1A 3OL2B 4PNKB 1XHMA 5HQGA 3C99A 1MG3A 5GXIA 3W15A 2Q7QA 1PI6A 3KRWB 3OKTA 1GOTB 1B9XA 1N6EA 2P9SC 4I79A 4GQ2P 4O3UB 4A0BA 5H1MA 4A09B 3IJ1A 2P9UC 2XYIA 4KFMB 3V5WB 4PSWB 4J79A 5FQDA 2IUVA 3DSMA 3FRXA 4AEZA 2QC5A 2UZYB 4GZ8A 2XU7A 3J80g 2P9NC 2AGZA 3UKRC 2HJ4A 4Z8LA 4H5IA 2H6NA 4D6VA 3FM0A 3SJLD 1GG2B 3I7OA 3JZGA 3C9CA 4GGAA 4X63B 4CZVA 3L4OD 4CI8A 5GSAA 2PM9B 5HE1B 5K19A 1R5MA 4J82A 3PE7A 1K32A 5AFU3 4FA9D 4XYHA 5SXMA 2P9IC 5CXBB 2B5NA 3N0DA 4J77A 1SHYB 2YMUA 3SBQA 4J8BA 2HXCA 4QT8A 1JOFA 2HJBA 4CY2A 2I3TA 2AGLA 4CY5A 4O1QD 5EARA 3SWSD 4JT5C 3I7KA 2H9MA 4L3GD 2YB8B 2HKMA 3C5MA 5KDOB 3EI2B 4E54A 3SLED 2TRCB 2H9NA 3F3PA 4YVDA 2CNXA 4R7AB 5TF2A 2J56H 2H6KA 4J78A 3MZLA 4UI9R 3DWLC 4A11B 1ERJA 3BG0A 3SBRA 2H6QA 4A0AB 4XEIC 2GC4A 5A2Qg 2P9KC 5IT9g 3V7DB 4A2LA 1Q47A 4J87A 2I3SA 3I89A 3OL2A 4BH6A 4J84A 1RI6A 4QQEA 2GC7A 3VA6A 3PXWD 3IJ0A 2PM7B 4J0WA 4OZUA 3L4MD 4NSXA 2PBIB 2XL2A 1PEVA 3I2NA 4CI2A 3NVQA 4JSNC 4CI3A 3EI1A 5H17A 4A09A 3P4FA 3MXXA 5H14A 4TZ4A 3SFZA 1OLZA 3EI3B 1TYQC 3RRMC 3DM0A 3I7NA 3JRPA 4A08B 1XKSA 3IJCA 2G9AA 5THAA 3SCYA 4ERQA 3EG6A 4FHLA 3JZNA 2AH1A 4JXMA 4X60B 3EU7A 4OWRA 2B5MA 3SHFA 5FLXg 3EI4B 4Y5RD 3I7PA 4U1EI 5I5MA 3DXKC 3VH0A 4JSVC 3RN0D 2HESX 3JB9L 4O9DA 2IWKA 3N0EA 4EWRA 2PM9A 4L1QD 1GXRA 4FA4D 3I7LA 3OW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9K A;  3F3G A;  1S4U X;  3RSE C;  5CXB A;  4BUJ C;  4BL0 A;  5FKT A;  3PVW B;  3RFH A;  4CY1 A;  4FB1 D;  3EMH A;  3JZH A;  1QNI A;  3AFC A;  5TEE A;  4FAV D;  3A0F A;  4ES0 A;  4L9O A;  1B9Y A;  2H9L A;  4PBZ A;  3F3F A;  3C75 H;  5IC7 A;  3BWS A;  2CE9 A;  3CFV A;  1SQ9 A;  4CY3 A;  3EI2 A;  2CN2 A;  4IA9 A;  4CZX A;  2P9P C;  2H3X A;  3IIW A;  4O3T B;  1MG2 A;  3I7H A;  3SMR A;  3I8C A;  1L0Q A;  4A11 A;  2G99 A;  2OK6 A;  1N6F A;  4ZN4 A;  2EBS A;  4J8G A;  4A0A A;  2XL3 A;  4GGC A;  2J55 H;  2H14 A;  4X61 B;  5TEF A;  3K26 A;  4CI1 A;  4ERZ A;  1JJU B;  2AGX A;  3RMZ D;  1PBY B;  1YFQ A;  3MMY A;  2CO0 C;  1PGU A;  2IUR A;  3UVL A;  5FKQ A;  2OVQ B;  5FKS A;  4L3H D;  5C9Z B;  1P22 A;  5EAP A;  3EWE A;  3ODT A;  1TBG A;  1N6D A;  4LG9 A;  4K3I D;  2YBA A;  3V9F A;  5CYK B;  3OKY B;  5B4W A;  3UVM A;  5EAM A;  4JSP C;  4QRJ A;  2IAA A;  3U4Y A;  2IUP A;  2Z2P A;  4GM8 A;  4O45 A;  2HKR A;  3UVO A;  3PSL A;  3EI3 A;  2H13 A;  5CXC B;  4H5J A;  4E5Z B;  2P9L C;  3K27 A;  4PBY A;  3UR4 A;  3OKW A;  5C2V B;  4PC0 A;  5HYN B;  4A08 A;  5C2W B;  2H47 A;  2I0T A;  3AL8 B;  4ZOY A;  1JMX B;  4GMB A;  3PSC B;  4G56 B;  4IMM A;  2IUQ A;  2H68 A;  4ESG A;  4X3E A;  1SQJ A;  5EMK B;  2AQ5 A;  1VYH C;  3EI4 A;  5HE3 B;  5K1C C;  3E0C A;  4FWW A;  5I5I A;  2YNN A;  4J86 A;  3PVU B;  2B5L A;  2IWF A;  3RLM D;  3RN1 D;  3FGB A;  4GQB B;  2AH0 A;  1NEX B;  2I0S A;  2W18 A;  2OVP B;  2AGY A;  5EMM B;  3RFG A;  3AL9 A;  5HE2 B;  4A7J A;  4FA5 D;  3ZWL B;  5EM2 B;  2MTA H;  4AOW A;  4CC9 A;  5EML B;  2YNP A;  3UKU C;  3AH8 B;  4GM3 A;  3EI1 B;  2HYE A;  4JSX C;  5EAL A;  3HFQ A;  1GP2 B;  1A0R B;  2I0R A;  4JD2 C;  2BCJ B;  4FA1 D;  3J81 g;  5TDH B;  4A0B B;  3DXM C;  4JT6 C;  4PSX B;  3JRO A;  4K3J B;  1U2V C;  5IJ7 E;  3GFC A;  2UZX B;  1XIP A;  3MKS B;  4A2M A;  2BBK H;  3SVW D;  4ERY A;  4MK0 B;  1NR0 A;  2OJY A;  3MZK A;  4GQ1 A;  2GNQ A;  3OTT A;  4ZOX A;  2H9P A;  3IIY A;  4U7A A;  5FXY A;  2CO0 A;  2Z2N A;  3UVN A;  5EMJ B;  2PM6 B;  5FKR A;  2Z2O A;  2OK4 A;  5HE0 B;  2OIZ A;  2J57 G;  1OMW B;  3PXS D;  3NVX A;  5IGQ A;  5FA5 B;  4LGN A;  4XYI A;  4N14 A;  2YNO A;  4J73 A;  1K8K C;  4D0K A;  5CYK A;  3OKY A;  3SN6 B;  3CIK B;  2B4E A;  5I5J A;  5IGO A;  2CE8 A;  5AMS A;  3SXT D;  1JMZ B;  5JWZ A;  3IKO A;  4ZOZ A;  3ORV D;  4J81 A;  1MDA H;  5CXC A;  3CFS B;  2AGW A;  5IJ8 E;  4ZOV A;  4QL1 A;  4E5Z A;  3JAM g;  1U4C A;  3MKQ A;  3VGZ A;  4E54 B;  3KRX B;  3AL8 A;  3GRE A;  4LG8 A;  4J0X A;  1FWX A;  3B7F A;  3ULE C;  5GMK n;  3NVN A;  2QXV A;  3JPX A;  4CZY A;  4HDJ A;  3UVK A;  4FAN D;  4GM9 A;  5AJA A;  3I8E A;  2CN3 A;  3SBP A;  2OVR B;  3PXT D;  4Y7R A;  5GXH A;  4PXW A;  5EM2 A;  4GGD A;  3BG1 A;  3OL2 B;  4PNK B;  1XHM A;  5HQG A;  3C99 A;  1MG3 A;  5GXI A;  3W15 A;  2Q7Q A;  1PI6 A;  3KRW B;  3OKT A;  1GOT B;  1B9X A;  1N6E A;  2P9S C;  4I79 A;  4GQ2 P;  4O3U B;  4A0B A;  5H1M A;  4A09 B;  3IJ1 A;  2P9U C;  2XYI A;  4KFM B;  3V5W B;  4PSW B;  4J79 A;  5FQD A;  2IUV A;  3DSM A;  3FRX A;  4AEZ A;  2QC5 A;  2UZY B;  4GZ8 A;  2XU7 A;  3J80 g;  2P9N C;  2AGZ A;  3UKR C;  2HJ4 A;  4Z8L A;  4H5I A;  2H6N A;  4D6V A;  3FM0 A;  3SJL D;  1GG2 B;  3I7O A;  3JZG A;  3C9C A;  4GGA A;  4X63 B;  4CZV A;  3L4O D;  4CI8 A;  5GSA A;  2PM9 B;  5HE1 B;  5K19 A;  1R5M A;  4J82 A;  3PE7 A;  1K32 A;  5AFU 3;  4FA9 D;  4XYH A;  5SXM A;  2P9I C;  5CXB B;  2B5N A;  3N0D A;  4J77 A;  1SHY B;  2YMU A;  3SBQ A;  4J8B A;  2HXC A;  4QT8 A;  1JOF A;  2HJB A;  4CY2 A;  2I3T A;  2AGL A;  4CY5 A;  4O1Q D;  5EAR A;  3SWS D;  4JT5 C;  3I7K A;  2H9M A;  4L3G D;  2YB8 B;  2HKM A;  3C5M A;  5KDO B;  3EI2 B;  4E54 A;  3SLE D;  2TRC B;  2H9N A;  3F3P A;  4YVD A;  2CNX A;  4R7A B;  5TF2 A;  2J56 H;  2H6K A;  4J78 A;  3MZL A;  4UI9 R;  3DWL C;  4A11 B;  1ERJ A;  3BG0 A;  3SBR A;  2H6Q A;  4A0A B;  4XEI C;  2GC4 A;  5A2Q g;  2P9K C;  5IT9 g;  3V7D B;  4A2L A;  1Q47 A;  4J87 A;  2I3S A;  3I89 A;  3OL2 A;  4BH6 A;  4J84 A;  1RI6 A;  4QQE A;  2GC7 A;  3VA6 A;  3PXW D;  3IJ0 A;  2PM7 B;  4J0W A;  4OZU A;  3L4M D;  4NSX A;  2PBI B;  2XL2 A;  1PEV A;  3I2N A;  4CI2 A;  3NVQ A;  4JSN C;  4CI3 A;  3EI1 A;  5H17 A;  4A09 A;  3P4F A;  3MXX A;  5H14 A;  4TZ4 A;  3SFZ A;  1OLZ A;  3EI3 B;  1TYQ C;  3RRM C;  3DM0 A;  3I7N A;  3JRP A;  4A08 B;  1XKS A;  3IJC A;  2G9A A;  5THA A;  3SCY A;  4ERQ A;  3EG6 A;  4FHL A;  3JZN A;  2AH1 A;  4JXM A;  4X60 B;  3EU7 A;  4OWR A;  2B5M A;  3SHF A;  5FLX g;  3EI4 B;  4Y5R D;  3I7P A;  4U1E I;  5I5M A;  3DXK C;  3VH0 A;  4JSV C;  3RN0 D;  2HES X;  3JB9 L;  4O9D A;  2IWK A;  3N0E A;  4EWR A;  2PM9 A;  4L1Q D;  1GXR A;  4FA4 D;  3I7L A;  3OW8 A; 
#chains in the Genus database with same CATH topology
 2O9K A;  3F3G A;  1S4U X;  1GOH A;  3RSE C;  5CXB A;  4BUJ C;  4BL0 A;  5FKT A;  3PVW B;  3RFH A;  4CY1 A;  4FB1 D;  3JZH A;  3EMH A;  2VC2 A;  1QNI A;  3AFC A;  5TEE A;  4FAV D;  3A0F A;  1O6G A;  3K72 A;  4ES0 A;  4L9O A;  1B9Y A;  2H9L A;  4PBZ A;  4G55 A;  1VE7 A;  2XE4 A;  1U8C A;  1E8N A;  3F3F A;  3C75 H;  5IC7 A;  2HU7 A;  1GOG A;  2CE9 A;  3BWS A;  3CFV A;  1SQ9 A;  4CY3 A;  4Z7Q A;  3EI2 A;  4UM9 A;  2CN2 A;  4IA9 A;  4CZX A;  2P9P C;  2H3X A;  3IIW A;  4O3T B;  1MG2 A;  3I7H A;  1UOO A;  3SMR A;  3I8C A;  1C9I A;  1L0Q A;  4A11 A;  2G99 A;  2OK6 A;  4BP8 A;  1N6F A;  4ZN4 A;  2EBS A;  4J8G A;  1YR2 A;  2XL3 A;  4A0A A;  4GGC A;  2J55 H;  2H14 A;  4X61 B;  4G1E A;  5TEF A;  1E5T A;  3K26 A;  5M5R A;  4AN1 A;  4CI1 A;  3IUM A;  4ERZ A;  1JJU B;  2AGX A;  3RMZ D;  1PBY B;  1YFQ A;  3MMY A;  2CO0 C;  1PGU A;  4MMZ A;  2IUR A;  3UVL A;  3IUQ A;  5FKQ A;  2OVQ B;  5FKS A;  4L3H D;  1BPO A;  5C9Z B;  1P22 A;  2VDQ A;  5EAP A;  3EWE A;  3ODT A;  1TBG A;  1N6D A;  4LG9 A;  4K3I D;  4Z7O A;  2YBA A;  3V4P A;  3V9F A;  5CYK B;  3OKY B;  5B4W A;  3UVM A;  5M61 A;  3ZE0 A;  3O4G A;  5EAM A;  2JKX A;  4JSP C;  3IUJ A;  4QRJ A;  2IAA A;  3U4Y A;  2IUP A;  2Z2P A;  4GM8 A;  1I2M B;  4O45 A;  2HKR A;  3UVO A;  3PSL A;  3EI3 A;  2H13 A;  5CXC B;  2VDP A;  4H5J A;  4E5Z B;  3FCS A;  2P9L C;  3K27 A;  4PBY A;  3UR4 A;  3OKW A;  5C2V B;  4PC0 A;  4WK0 A;  5HYN B;  4A08 A;  5C2W B;  2H47 A;  2I0T A;  3AL8 B;  4ZOY A;  1JMX B;  4GMB A;  3PSC B;  4G56 B;  4IMM A;  2IUQ A;  2H68 A;  3GC3 B;  4ESG A;  1H2X A;  2BKL A;  4X3E A;  1SQJ A;  5EMK B;  2AQ5 A;  1VYH C;  3EI4 A;  5HE3 B;  5K1C C;  3E0C A;  3MVD K;  4FWW A;  5I5I A;  2YNN A;  4J86 A;  3VI3 A;  3PVU B;  3T3P A;  3O4J A;  2B5L A;  1VZ3 A;  2IWF A;  3RLM D;  3RN1 D;  3FGB A;  4GQB B;  2AH0 A;  1NEX B;  2I0S A;  1QFS A;  2W18 A;  2OVP B;  2AGY A;  5M5T A;  4BCC A;  5EMM B;  3RFG A;  3AL9 A;  5HE2 B;  4A7J A;  4FA5 D;  3ZWL B;  5EM2 B;  2MTA H;  4AOW A;  4CC9 A;  5EML B;  2YNP A;  3DDU A;  3UKU C;  3AH8 B;  4GM3 A;  3EI1 B;  2HYE A;  4AMY A;  4JSX C;  5EAL A;  2VDM A;  3HFQ A;  1GP2 B;  1A0R B;  2I0R A;  4JD2 C;  2BCJ B;  4FA1 D;  3J81 g;  5TDH B;  4WK4 A;  4A0B B;  3ZDZ A;  3DXM C;  4JT6 C;  4PSX B;  3JRO A;  4K3J B;  1U2V C;  5IJ7 E;  3GFC A;  2UZX B;  1XIP A;  3MKS B;  4A2M A;  2BBK H;  3SVW D;  4ERY A;  3EQ9 A;  4MK0 B;  1NR0 A;  4O2W A;  2OJY A;  4QAM A;  3EQ8 A;  3MZK A;  4GQ1 A;  2GNQ A;  3OTT A;  4RE6 A;  4ZOX A;  2H9P A;  3IIY A;  4U7A A;  5FXY A;  1E8M A;  3K6S A;  2CO0 A;  2Z2N A;  3UVN A;  5EMJ B;  2PM6 B;  2QR5 A;  5FKR A;  2Z2O A;  2OK4 A;  5HE0 B;  1UTC A;  2OIZ A;  2J57 G;  1OMW B;  3PXS D;  3NVX A;  4IRZ A;  5IGQ A;  5FA5 B;  4UM8 A;  2XDW A;  3IJE A;  4LGN A;  4XYI A;  4JHN A;  4NEN A;  4N14 A;  2EIB A;  2YNO A;  4MMX A;  4Z7N A;  3EQ7 A;  4J73 A;  3ZE2 A;  1K8K C;  4D0K A;  5CYK A;  3OKY A;  3SN6 B;  3CIK B;  2B4E A;  4G1M A;  2VDN A;  4AN0 A;  5I5J A;  5IGO A;  2CE8 A;  3ZE1 A;  5AMS A;  3SXT D;  1JMZ B;  5JWZ A;  5E6S A;  3IKO A;  2VZ1 A;  4ZOZ A;  3ORV D;  4J81 A;  1MDA H;  5CXC A;  3CFS B;  2AGW A;  5IJ8 E;  4ZOV A;  4QL1 A;  4E5Z A;  3JAM g;  1U4C A;  3MKQ A;  3VGZ A;  4E54 B;  5C86 A;  3KRX B;  3AL8 A;  3GRE A;  1QFM A;  4LG8 A;  4J0X A;  5FFG A;  3O4I A;  1FWX A;  3NID A;  3B7F A;  3ULE C;  5GMK n;  3NVN A;  2QXV A;  3JPX A;  4CZY A;  4HDJ A;  3UVK A;  4FAN D;  4GM9 A;  5AJA A;  3I8E A;  2CN3 A;  4D9S A;  4BP9 A;  3SBP A;  5E6R A;  2OVR B;  1K3I A;  3PXT D;  4MMY A;  4Y7R A;  1UOP A;  5GXH A;  4PXW A;  3IVM A;  1VZ2 A;  5EM2 A;  4GGD A;  3BG1 A;  3OL2 B;  4PNK B;  1XHM A;  1H2Z A;  5HQG A;  3C99 A;  1MG3 A;  5GXI A;  3W15 A;  3FCU A;  2Q7Q A;  5E6U A;  3KCI A;  4AMZ A;  1H2Y A;  1PI6 A;  3IUN A;  3KRW B;  3OKT A;  1GOT B;  5FFO A;  1B9X A;  1N6E A;  2P9S C;  4I79 A;  2QZP A;  3NIF A;  4GQ2 P;  4O3U B;  4A0B A;  5H1M A;  4A09 B;  3IJ1 A;  2P9U C;  2XYI A;  2EID A;  1A12 A;  1GOF A;  4KFM B;  2VDR A;  3V5W B;  4PSW B;  4J79 A;  5FQD A;  2IUV A;  3DSM A;  3FRX A;  4AEZ A;  2QC5 A;  2UZY B;  4GZ8 A;  2XU7 A;  4JHP C;  3J80 g;  2P9N C;  2AGZ A;  3UKR C;  2HJ4 A;  4Z8L A;  4H5I A;  2H6N A;  3O4H A;  4D6V A;  3FM0 A;  3SJL D;  3GD1 I;  1GG2 B;  3I7O A;  3JZG A;  5M5S A;  3C9C A;  4GGA A;  4X63 B;  3QI0 A;  4CZV A;  3L4O D;  4CI8 A;  5GSA A;  2PM9 B;  5HE1 B;  5K19 A;  1R5M A;  4J82 A;  3PE7 A;  1K32 A;  4BCD A;  5AFU 3;  4FA9 D;  4XYH A;  5SXM A;  1TYE A;  2P9I C;  5CXB B;  2B5N A;  3N0D A;  1O6F A;  4J77 A;  1SHY B;  1C9L A;  2YMU A;  3VI4 A;  2EIC A;  4NBM A;  3SBQ A;  4J8B A;  2HXC A;  4QT8 A;  1JOF A;  2HJB A;  4CY2 A;  2I3T A;  2AGL A;  4RE5 A;  4CY5 A;  4O1Q D;  5EAR A;  3SWS D;  4JT5 C;  3I7K A;  2H9M A;  4L3G D;  2XZG A;  2YB8 B;  2HKM A;  2VZ3 A;  3C5M A;  3MUO A;  4DNV A;  5KDO B;  3EI2 B;  4E54 A;  3SLE D;  2TRC B;  2H9N A;  3F3P A;  4YVD A;  2CNX A;  3IUL A;  4R7A B;  5TF2 A;  2J56 H;  2H6K A;  4J78 A;  3MZL A;  4UI9 R;  2VDL A;  4WJK A;  3DWL C;  4A11 B;  1ERJ A;  5C92 A;  3V4V A;  1JV2 A;  3BG0 A;  1VE6 A;  3SBR A;  2H6Q A;  4A0A B;  4O02 A;  4XEI C;  2GC4 A;  3OF7 A;  2HU5 A;  2P9K C;  5A2Q g;  4L1M A;  5IT9 g;  4BCB A;  3V7D B;  4A2L A;  1Q47 A;  3MUN A;  4J87 A;  4DNU A;  2I3S A;  3I89 A;  3OL2 A;  4BH6 A;  4J84 A;  1RI6 A;  4QQE A;  2GC7 A;  3VA6 A;  3PXW D;  3IJ0 A;  5M5U A;  2PM7 B;  4J0W A;  4OZU A;  3NIG A;  4WK2 A;  3ZDX A;  3L4M D;  4NSX A;  2PBI B;  3QHY B;  2XL2 A;  3K71 A;  1PEV A;  3I2N A;  4CI2 A;  4NC4 A;  3NVQ A;  4JSN C;  5M5V A;  2HU8 A;  4CI3 A;  1H2W A;  3EI1 A;  5H17 A;  4A09 A;  3P4F A;  3MXX A;  5H14 A;  4TZ4 A;  3SFZ A;  1OLZ A;  3EI3 B;  1TYQ C;  3RRM C;  4NAA A;  1JTD B;  3DM0 A;  3I7N A;  3JRP A;  3ZDY A;  4A08 B;  1XKS A;  3IJC A;  2G9A A;  2WQ8 A;  5THA A;  3SCY A;  3IUR A;  4ERQ A;  3EG6 A;  4FHL A;  3JZN A;  2VDO A;  2AH1 A;  4JXM A;  4X60 B;  3EU7 A;  4OWR A;  2B5M A;  3SHF A;  5FLX g;  3EI4 B;  4Y5R D;  3I7P A;  4U1E I;  5I5M A;  3DXK C;  3VH0 A;  3T3M A;  5HDB A;  4JSV C;  1UOQ A;  3RN0 D;  2HES X;  1L5G A;  3JB9 L;  4O9D A;  4AX4 A;  4DNW A;  1T2X A;  2IWK A;  3N0E A;  2EIE A;  2VDK A;  4EWR A;  2PM9 A;  4L1Q D;  1GXR A;  4FA4 D;  3I7L A;  3OW8 A;  1M1X A; 
#chains in the Genus database with same CATH homology
 2O9K A;  3F3G A;  1S4U X;  3RSE C;  5CXB A;  4BUJ C;  4BL0 A;  5FKT A;  3PVW B;  3RFH A;  4CY1 A;  4FB1 D;  3EMH A;  3JZH A;  1QNI A;  3AFC A;  5TEE A;  4FAV D;  3A0F A;  4ES0 A;  4L9O A;  1B9Y A;  2H9L A;  4PBZ A;  3F3F A;  3C75 H;  5IC7 A;  3BWS A;  2CE9 A;  3CFV A;  1SQ9 A;  4CY3 A;  3EI2 A;  2CN2 A;  4IA9 A;  4CZX A;  2P9P C;  2H3X A;  3IIW A;  4O3T B;  1MG2 A;  3I7H A;  3SMR A;  3I8C A;  1L0Q A;  4A11 A;  2G99 A;  2OK6 A;  1N6F A;  4ZN4 A;  2EBS A;  4J8G A;  4A0A A;  2XL3 A;  4GGC A;  2J55 H;  2H14 A;  4X61 B;  5TEF A;  3K26 A;  4CI1 A;  4ERZ A;  1JJU B;  2AGX A;  3RMZ D;  1PBY B;  1YFQ A;  3MMY A;  2CO0 C;  1PGU A;  2IUR A;  3UVL A;  5FKQ A;  2OVQ B;  5FKS A;  4L3H D;  5C9Z B;  1P22 A;  5EAP A;  3EWE A;  3ODT A;  1TBG A;  1N6D A;  4LG9 A;  4K3I D;  2YBA A;  3V9F A;  5CYK B;  3OKY B;  5B4W A;  3UVM A;  5EAM A;  4JSP C;  4QRJ A;  2IAA A;  3U4Y A;  2IUP A;  2Z2P A;  4GM8 A;  4O45 A;  2HKR A;  3UVO A;  3PSL A;  3EI3 A;  2H13 A;  5CXC B;  4H5J A;  4E5Z B;  2P9L C;  3K27 A;  4PBY A;  3UR4 A;  3OKW A;  5C2V B;  4PC0 A;  5HYN B;  4A08 A;  5C2W B;  2H47 A;  2I0T A;  3AL8 B;  4ZOY A;  1JMX B;  4GMB A;  3PSC B;  4G56 B;  4IMM A;  2IUQ A;  2H68 A;  4ESG A;  4X3E A;  1SQJ A;  5EMK B;  2AQ5 A;  1VYH C;  3EI4 A;  5HE3 B;  5K1C C;  3E0C A;  4FWW A;  5I5I A;  2YNN A;  4J86 A;  3PVU B;  2B5L A;  2IWF A;  3RLM D;  3RN1 D;  3FGB A;  4GQB B;  2AH0 A;  1NEX B;  2I0S A;  2W18 A;  2OVP B;  2AGY A;  5EMM B;  3RFG A;  3AL9 A;  5HE2 B;  4A7J A;  4FA5 D;  3ZWL B;  5EM2 B;  2MTA H;  4AOW A;  4CC9 A;  5EML B;  2YNP A;  3UKU C;  3AH8 B;  4GM3 A;  3EI1 B;  2HYE A;  4JSX C;  5EAL A;  3HFQ A;  1GP2 B;  1A0R B;  2I0R A;  4JD2 C;  2BCJ B;  4FA1 D;  3J81 g;  5TDH B;  4A0B B;  3DXM C;  4JT6 C;  4PSX B;  3JRO A;  4K3J B;  1U2V C;  5IJ7 E;  3GFC A;  2UZX B;  1XIP A;  3MKS B;  4A2M A;  2BBK H;  3SVW D;  4ERY A;  4MK0 B;  1NR0 A;  2OJY A;  3MZK A;  4GQ1 A;  2GNQ A;  3OTT A;  4ZOX A;  2H9P A;  3IIY A;  4U7A A;  5FXY A;  2CO0 A;  2Z2N A;  3UVN A;  5EMJ B;  2PM6 B;  5FKR A;  2Z2O A;  2OK4 A;  5HE0 B;  2OIZ A;  2J57 G;  1OMW B;  3PXS D;  3NVX A;  5IGQ A;  5FA5 B;  4LGN A;  4XYI A;  4N14 A;  2YNO A;  4J73 A;  1K8K C;  4D0K A;  5CYK A;  3OKY A;  3SN6 B;  3CIK B;  2B4E A;  5I5J A;  5IGO A;  2CE8 A;  5AMS A;  3SXT D;  1JMZ B;  5JWZ A;  3IKO A;  4ZOZ A;  3ORV D;  4J81 A;  1MDA H;  5CXC A;  3CFS B;  2AGW A;  5IJ8 E;  4ZOV A;  4QL1 A;  4E5Z A;  3JAM g;  1U4C A;  3MKQ A;  3VGZ A;  4E54 B;  3KRX B;  3AL8 A;  3GRE A;  4LG8 A;  4J0X A;  1FWX A;  3B7F A;  3ULE C;  5GMK n;  3NVN A;  2QXV A;  3JPX A;  4CZY A;  4HDJ A;  3UVK A;  4FAN D;  4GM9 A;  5AJA A;  3I8E A;  2CN3 A;  3SBP A;  2OVR B;  3PXT D;  4Y7R A;  5GXH A;  4PXW A;  5EM2 A;  4GGD A;  3BG1 A;  3OL2 B;  4PNK B;  1XHM A;  5HQG A;  3C99 A;  1MG3 A;  5GXI A;  3W15 A;  2Q7Q A;  1PI6 A;  3KRW B;  3OKT A;  1GOT B;  1B9X A;  1N6E A;  2P9S C;  4I79 A;  4GQ2 P;  4O3U B;  4A0B A;  5H1M A;  4A09 B;  3IJ1 A;  2P9U C;  2XYI A;  4KFM B;  3V5W B;  4PSW B;  4J79 A;  5FQD A;  2IUV A;  3DSM A;  3FRX A;  4AEZ A;  2QC5 A;  2UZY B;  4GZ8 A;  2XU7 A;  3J80 g;  2P9N C;  2AGZ A;  3UKR C;  2HJ4 A;  4Z8L A;  4H5I A;  2H6N A;  4D6V A;  3FM0 A;  3SJL D;  1GG2 B;  3I7O A;  3JZG A;  3C9C A;  4GGA A;  4X63 B;  4CZV A;  3L4O D;  4CI8 A;  5GSA A;  2PM9 B;  5HE1 B;  5K19 A;  1R5M A;  4J82 A;  3PE7 A;  1K32 A;  5AFU 3;  4FA9 D;  4XYH A;  5SXM A;  2P9I C;  5CXB B;  2B5N A;  3N0D A;  4J77 A;  1SHY B;  2YMU A;  3SBQ A;  4J8B A;  2HXC A;  4QT8 A;  1JOF A;  2HJB A;  4CY2 A;  2I3T A;  2AGL A;  4CY5 A;  4O1Q D;  5EAR A;  3SWS D;  4JT5 C;  3I7K A;  2H9M A;  4L3G D;  2YB8 B;  2HKM A;  3C5M A;  5KDO B;  3EI2 B;  4E54 A;  3SLE D;  2TRC B;  2H9N A;  3F3P A;  4YVD A;  2CNX A;  4R7A B;  5TF2 A;  2J56 H;  2H6K A;  4J78 A;  3MZL A;  4UI9 R;  3DWL C;  4A11 B;  1ERJ A;  3BG0 A;  3SBR A;  2H6Q A;  4A0A B;  4XEI C;  2GC4 A;  5A2Q g;  2P9K C;  5IT9 g;  3V7D B;  4A2L A;  1Q47 A;  4J87 A;  2I3S A;  3I89 A;  3OL2 A;  4BH6 A;  4J84 A;  1RI6 A;  4QQE A;  2GC7 A;  3VA6 A;  3PXW D;  3IJ0 A;  2PM7 B;  4J0W A;  4OZU A;  3L4M D;  4NSX A;  2PBI B;  2XL2 A;  1PEV A;  3I2N A;  4CI2 A;  3NVQ A;  4JSN C;  4CI3 A;  3EI1 A;  5H17 A;  4A09 A;  3P4F A;  3MXX A;  5H14 A;  4TZ4 A;  3SFZ A;  1OLZ A;  3EI3 B;  1TYQ C;  3RRM C;  3DM0 A;  3I7N A;  3JRP A;  4A08 B;  1XKS A;  3IJC A;  2G9A A;  5THA A;  3SCY A;  4ERQ A;  3EG6 A;  4FHL A;  3JZN A;  2AH1 A;  4JXM A;  4X60 B;  3EU7 A;  4OWR A;  2B5M A;  3SHF A;  5FLX g;  3EI4 B;  4Y5R D;  3I7P A;  4U1E I;  5I5M A;  3DXK C;  3VH0 A;  4JSV C;  3RN0 D;  2HES X;  3JB9 L;  4O9D A;  2IWK A;  3N0E A;  4EWR A;  2PM9 A;  4L1Q D;  1GXR A;  4FA4 D;  3I7L A;  3OW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...