4JT6C

Structure of mtordeltan-mlst8-pi-103 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jt6C01
1PGUA 4CC9A 2GC4A 3SHFA 1PBYB 2H9NA 2AQ5A 3F3PA 3RFGA 2OK4A 4A09B 2IAAA 4O9DA 4FA5D 3EI1B 2BCJB 2HXCA 4JT6C 1QNIA 2AH1A 4K3ID 2BBKH 4BUJC 2AGYA 4ESGA 4GZ8A 2XL2A 2B4EA 3FGBA 4E5ZA 4R7AB 3EWEA 5THAA 1K32A 1P22A 1JMXB 4GGDA 5CXCA 4GMBA 3UKRC 4ERQA 3I7OA 4G56B 4OWRA 4H5JA 5EAMA 1ERJA 4GQ1A 4CZXA 2P9IC 3V5WB 4ZOYA 3PVWB 3NVXA 2J57G 5FLXg 4ZN4A 4CY1A 2H6NA 1N6FA 2PM7B 1JJUB 3NVQA 3L4OD 2HJ4A 2IUVA 3AL8A 1JOFA 4PNKB 4E5ZB 4J0XA 4PBZA 4JSPC 4LGNA 3FM0A 4X3EA 3CIKB 4ZOZA 2OVRB 5AFU3 3UR4A 5CXCB 5AJAA 4J8BA 3NVNA 3JAMg 4FAND 2YNPA 3P4FA 3FRXA 2B5LA 3I7LA 3L4MD 2XU7A 3SBPA 4CY3A 2I3SA 3MKSB 5GXHA 3J80g 3BWSA 4GM3A 3F3FA 3N0DA 2IWFA 5SXMA 3AL8B 4A2MA 3RMZD 3ORVD 4A7JA 2P9UC 3IIYA 4QL1A 3PSLA 4PC0A 3I7PA 1FWXA 5IGQA 3SN6B 3SXTD 4FA4D 1S4UX 5HQGA 4U1EI 4TZ4A 5FA5B 5H1MA 4LG9A 1XIPA 2YNOA 3JZHA 1GP2B 2PM9A 4MK0B 4NSXA 4GM9A 2H6KA 1R5MA 3SWSD 3EI4B 1MDAH 4HDJA 4CI8A 1RI6A 4I79A 4Y5RD 2OVPB 4QT8A 5GMKn 3I8CA 3ULEC 5CXBB 3DM0A 4J82A 2H14A 3I89A 5GXIA 5C9ZB 3K26A 3EI2A 2TRCB 4J84A 2AH0A 3JROA 1GOTB 3UVNA 5H14A 5EM2A 3MMYA 5TDHB 3VGZA 5EMJB 5HE2B 2H9PA 4A0BB 4ERZA 5FXYA 2H9LA 2P9LC 3OTTA 1OLZA 4PXWA 3OKTA 2CN2A 3ZWLB 1U4CA 3UVKA 4ERYA 2CN3A 1NEXB 4ZOVA 5EMLB 2I0TA 4GGAA 4OZUA 3BG0A 3CFSB 3VA6A 5FKRA 1N6EA 3OW8A 5A2Qg 3J81g 2AGZA 2P9NC 3SLED 2G99A 4PBYA 2B5NA 2H6QA 2H13A 4GQBB 4PSWB 5HE0B 4ES0A 3EI2B 2OVQB 4O45A 4BH6A 2H3XA 3B7FA 1A0RB 5CYKA 2I3TA 5TEEA 4A2LA 2HKRA 5EARA 5FKQA 4J79A 1TBGA 2IUPA 5IGOA 4YVDA 4IA9A 2P9KC 2YMUA 3ODTA 4A0AA 3F3GA 4CI3A 3RN0D 3AFCA 2P9SC 4J8GA 4D6VA 4UI9R 3CFVA 3SMRA 5KDOB 4H5IA 2P9PC 5JWZA 1YFQA 1N6DA 2OJYA 3SBQA 1TYQC 4JT5C 3JZNA 3PE7A 2HKMA 4FAVD 5K19A 3I7HA 4GM8A 2YBAA 5IC7A 1SQ9A 4K3JB 5CYKB 1K8KC 3RFHA 2XL3A 4XYHA 5EALA 3I2NA 4O3UB 2H9MA 5HE3B 2B5MA 4Z8LA 1PEVA 3MKQA 5I5IA 3UVLA 3JB9L 5K1CC 3V7DB 3PXSD 5I5MA 4A0AB 1MG2A 4J0WA 5C2WB 4A08A 2PM6B 3C75H 3EI3A 2GNQA 3UVMA 4X60B 5FKTA 4CZVA 3KRXB 3PVUB 5EMKB 3SFZA 5C2VB 4U7AA 3DWLC 3C9CA 5I5JA 4CY2A 3BG1A 2YNNA 2AGWA 3K27A 3V9FA 4CY5A 1B9YA 2CE8A 3GREA 5H17A 3DXMC 2EBSA 1L0QA 2IURA 3EMHA 2Q7QA 3DSMA 3IKOA 3N0EA 4FA9D 3EU7A 2AGLA 2HJBA 2W18A 4D0KA 3OKWA 3MZKA 1Q47A 2Z2PA 3EI3B 4CI2A 4FB1D 2J55H 4JSXC 2PM9B 4XEIC 5HYNB 2Z2NA 3IJ1A 3SJLD 5HE1B 2Z2OA 3AL9A 1PI6A 4CZYA 3UKUC 4Y7RA 3I7NA 3E0CA 2CNXA 3JRPA 4FA1D 3MXXA 3KRWB 5EM2B 3C5MA 4JXMA 2UZYB 2IWKA 4GGCA 4JD2C 3UVOA 2XYIA 4BL0A 2O9KA 2CO0A 2UZXB 4X61B 5GSAA 1JMZB 4CI1A 3SBRA 3VH0A 1NR0A 1U2VC 3SVWD 3PSCB 5B4WA 4L3HD 4GQ2P 5TEFA 1MG3A 4E54A 1OMWB 3PXWD 1SQJA 3RN1D 2G9AA 4IMMA 3IIWA 5TF2A 3I8EA 5FKSA 4EWRA 5IJ7E 2J56H 4FWWA 5EMMB 2OK6A 3PXTD 1XKSA 3JZGA 3HFQA 3OKYA 3W15A 5IJ8E 3U4YA 3DXKC 2MTAH 2AGXA 2QXVA 3RRMC 3GFCA 3MZLA 2CE9A 3OL2A 4N14A 5AMSA 4LG8A 5EAPA 3IJ0A 1GG2B 3EI4A 4J86A 2HESX 1B9XA 4KFMB 4QRJA 4L1QD 5CXBA 2H47A 3C99A 4E54B 3JPXA 3AH8B 3A0FA 2IUQA 4A11A 4J81A 4L3GD 4X63B 4FHLA 2PBIB 3RSEC 3IJCA 2GC7A 3I7KA 4J77A 4JSNC 4PSXB 4XYIA 2I0SA 4A09A 3EI1A 4A0BA 3RLMD 3OKYB 4O3TB 2CO0C 2YB8B 2H68A 4JSVC 2I0RA 4J87A 4ZOXA 5FQDA 1GXRA 3OL2B 3SCYA 4L9OA 1XHMA 4QQEA 2QC5A 2HYEA 4J73A 3EG6A 5IT9g 4J78A 1VYHC 1SHYB 2OIZA 4AEZA 4A08B 4O1QD 4AOWA 4A11B
chains in the Genus database with same CATH superfamily
1QFMA 2VDMA 1PGUA 4CC9A 2GC4A 5M5SA 1H2ZA 3SHFA 1PBYB 2H9NA 2AQ5A 3F3PA 3RFGA 2BKLA 2OK4A 4A09B 2IAAA 4O9DA 4FA5D 3EI1B 2BCJB 3ZDXA 3O4IA 3EQ9A 5FFGA 2HXCA 4JT6C 4Z7OA 1QNIA 2AH1A 3IULA 2BBKH 4K3ID 4BUJC 2AGYA 4ESGA 4GZ8A 2XL2A 2B4EA 3FGBA 4E5ZA 4R7AB 2VDKA 3EWEA 4BP9A 5THAA 4MMZA 1K32A 1VE7A 1P22A 1JMXB 4GGDA 2VDLA 4NAAA 5CXCA 5M5UA 1YR2A 4GMBA 3UKRC 4ERQA 3I7OA 4RE5A 3KCIA 4G56B 4OWRA 4H5JA 5EAMA 3O4GA 3T3MA 1ERJA 2JKXA 4GQ1A 4MMXA 2P9IC 3V5WB 4CZXA 4ZOYA 3PVWB 3NVXA 2J57G 2XDWA 5FLXg 4ZN4A 4CY1A 2H6NA 1N6FA 2PM7B 1JJUB 2VZ1A 2VDQA 3NVQA 3L4OD 2HJ4A 2IUVA 3AL8A 1JOFA 4PNKB 4E5ZB 3MUOA 4J0XA 4PBZA 4JSPC 4LGNA 3FM0A 4BCDA 4X3EA 3CIKB 4ZOZA 2OVRB 2HU8A 5AFU3 3UR4A 5CXCB 5AJAA 4J8BA 3NVNA 3JAMg 4FAND 2YNPA 3P4FA 2VDOA 3EQ7A 3FRXA 2B5LA 3I7LA 3L4MD 1C9IA 2XU7A 5E6RA 3SBPA 3V4PA 4CY3A 2XZGA 2XE4A 2I3SA 3IUQA 2QZPA 3MKSB 5GXHA 3J80g 4DNUA 3BWSA 4GM3A 4O02A 3F3FA 3N0DA 2IWFA 5SXMA 3AL8B 4A2MA 3K71A 3RMZD 3ORVD 3K72A 4A7JA 2P9UC 3IIYA 4QL1A 3PSLA 4PC0A 3I7PA 1FWXA 5E6SA 5IGQA 3SN6B 3SXTD 4FA4D 1S4UX 5HQGA 4U1EI 4TZ4A 5FA5B 5H1MA 1A12A 1UTCA 5C92A 1QFSA 4LG9A 1XIPA 2YNOA 1U8CA 3JZHA 5HDBA 1GP2B 2PM9A 4AMZA 4MK0B 4NSXA 4GM9A 2H6KA 1R5MA 4MMYA 3SWSD 3EI4B 1MDAH 3NIGA 4HDJA 4CI8A 1RI6A 3OF7A 4I79A 2OVPB 1O6GA 4Y5RD 4QT8A 5GMKn 3I8CA 3ULEC 5CXBB 3DM0A 4J82A 2H14A 3I89A 5GXIA 1GOGA 3DDUA 5C9ZB 1T2XA 3K26A 3EI2A 2TRCB 4J84A 2AH0A 3JROA 1GOTB 3UVNA 1UOPA 5H14A 5EM2A 3MMYA 5TDHB 3VGZA 5EMJB 1VZ2A 2H9PA 5HE2B 4ERZA 4A0BB 5FXYA 2H9LA 1H2XA 2P9LC 3OTTA 1OLZA 1VZ3A 4PXWA 3OKTA 2CN2A 3ZWLB 1U4CA 3UVKA 4ERYA 2CN3A 1NEXB 4ZOVA 5EMLB 2I0TA 4GGAA 4OZUA 3BG0A 3CFSB 3VA6A 5FKRA 1N6EA 3OW8A 1H2WA 5A2Qg 3J81g 2AGZA 2P9NC 4WK4A 3SLED 2G99A 4PBYA 2B5NA 4QAMA 2H6QA 2H13A 4GQBB 4PSWB 5HE0B 4ES0A 3EI2B 2OVQB 4O45A 4D9SA 4BH6A 4G1EA 2H3XA 4NC4A 1K3IA 3B7FA 1A0RB 5CYKA 4JHNA 2I3TA 1O6FA 5TEEA 4A2LA 4WK2A 2HKRA 3QI0A 1H2YA 5EARA 5FKQA 4J79A 1TBGA 3T3PA 2IUPA 5IGOA 4YVDA 4IA9A 2P9KC 2QR5A 4RE6A 2YMUA 3ODTA 4A0AA 3F3GA 4CI3A 3MUNA 3RN0D 4Z7QA 3AFCA 2P9SC 4J8GA 1GOHA 4BCCA 2WQ8A 4D6VA 5M5TA 4UI9R 3CFVA 3SMRA 5KDOB 4H5IA 2P9PC 5JWZA 1YFQA 1N6DA 2OJYA 3SBQA 1TYQC 4JT5C 3IJEA 3JZNA 1L5GA 3PE7A 2VZ3A 5M5VA 2HKMA 4FAVD 5K19A 3NIFA 4NENA 3I7HA 4GM8A 2YBAA 4AX4A 5IC7A 1SQ9A 4K3JB 3IVMA 5CYKB 4JHPC 1K8KC 3RFHA 2XL3A 4XYHA 4BCBA 5EALA 3I2NA 3FCUA 4O3UB 2H9MA 1E8NA 4Z7NA 5HE3B 1UOQA 2B5MA 3EQ8A 4DNVA 4Z8LA 2HU5A 1PEVA 3MKQA 5C86A 5I5IA 3UVLA 3JB9L 5K1CC 3V7DB 4AN1A 3MVDK 3PXSD 5I5MA 3ZDZA 4A0AB 1MG2A 4J0WA 5C2WB 4A08A 5E6UA 2PM6B 3C75H 3EI3A 4AMYA 2GNQA 2EIBA 3UVMA 4X60B 5FKTA 4CZVA 3KRXB 3PVUB 1C9LA 5EMKB 3SFZA 5C2VB 4U7AA 4WK0A 1GOFA 3DWLC 3C9CA 3IUNA 5I5JA 4CY2A 3BG1A 2YNNA 1VE6A 2AGWA 3K27A 3V9FA 3ZDYA 4CY5A 1B9YA 2CE8A 3GREA 5H17A 3DXMC 2EBSA 1L0QA 2IURA 3EMHA 2Q7QA 3DSMA 5M61A 3IKOA 3N0EA 4FA9D 3EU7A 2AGLA 2HJBA 2W18A 4D0KA 3OKWA 2EICA 3MZKA 1Q47A 3ZE0A 2Z2PA 1E8MA 3EI3B 2EIDA 4IRZA 3QHYB 4CI2A 4FB1D 2J55H 4JSXC 2PM9B 3GC3B 3IURA 4XEIC 4DNWA 5HYNB 2EIEA 2HU7A 2Z2NA 3VI4A 3IJ1A 3SJLD 1UOOA 5HE1B 4AN0A 2Z2OA 3AL9A 1PI6A 4CZYA 3UKUC 4Y7RA 4UM8A 4G1MA 3ZE2A 3VI3A 3I7NA 3O4HA 3E0CA 1M1XA 2CNXA 3JRPA 4FA1D 3MXXA 1JTDB 3NIDA 3KRWB 5EM2B 3C5MA 4JXMA 3ZE1A 2UZYB 3O4JA 2IWKA 4GGCA 4JD2C 3UVOA 2VC2A 2XYIA 4BL0A 2O9KA 2CO0A 2UZXB 4X61B 3FCSA 5GSAA 1JMZB 4CI1A 3SBRA 3VH0A 1I2MB 1NR0A 1U2VC 3SVWD 3PSCB 5B4WA 4L3HD 4GQ2P 5TEFA 1MG3A 4E54A 1OMWB 4WJKA 3PXWD 1SQJA 3RN1D 2G9AA 1TYEA 4O2WA 4IMMA 3IIWA 2VDPA 5TF2A 4UM9A 3I8EA 5FKSA 4EWRA 5IJ7E 2J56H 4FWWA 5EMMB 2OK6A 3PXTD 1XKSA 3JZGA 3HFQA 3OKYA 3W15A 1JV2A 5IJ8E 3U4YA 3DXKC 2MTAH 2AGXA 2QXVA 3RRMC 3GFCA 5M5RA 3MZLA 2CE9A 3OL2A 4N14A 5AMSA 4LG8A 5EAPA 3IJ0A 1GG2B 3EI4A 4J86A 2VDNA 2HESX 1B9XA 3IUJA 4KFMB 4QRJA 4L1QD 5CXBA 2H47A 3C99A 4E54B 3JPXA 3AH8B 3A0FA 2IUQA 4A11A 4J81A 1E5TA 4L3GD 4X63B 4FHLA 2PBIB 3GD1I 5FFOA 3RSEC 3IJCA 2GC7A 3K6SA 3I7KA 4J77A 4JSNC 4PSXB 4XYIA 2I0SA 4BP8A 3IUMA 4A09A 3EI1A 4G55A 4A0BA 3RLMD 1BPOA 3OKYB 4O3TB 2CO0C 2YB8B 2H68A 4JSVC 3V4VA 2I0RA 4J87A 4ZOXA 5FQDA 1GXRA 3OL2B 3SCYA 4L9OA 1XHMA 2VDRA 4QQEA 2QC5A 2HYEA 4J73A 3EG6A 5IT9g 4J78A 1VYHC 1SHYB 2OIZA 4AEZA 4A08B 4NBMA 4L1MA 4O1QD 4AOWA 4A11B
chains in the Genus database with same CATH topology
1PGUA 4CC9A 2GC4A 3SHFA 1PBYB 2H9NA 2AQ5A 3F3PA 3RFGA 2OK4A 4A09B 2IAAA 4O9DA 4FA5D 3EI1B 2BCJB 2HXCA 4JT6C 1QNIA 2AH1A 4K3ID 2BBKH 4BUJC 2AGYA 4ESGA 4GZ8A 2XL2A 2B4EA 3FGBA 4E5ZA 4R7AB 3EWEA 5THAA 1K32A 1P22A 1JMXB 4GGDA 5CXCA 4GMBA 3UKRC 4ERQA 3I7OA 4G56B 4OWRA 4H5JA 5EAMA 1ERJA 4GQ1A 4CZXA 2P9IC 3V5WB 4ZOYA 3PVWB 3NVXA 2J57G 5FLXg 4ZN4A 4CY1A 2H6NA 1N6FA 2PM7B 1JJUB 3NVQA 3L4OD 2HJ4A 2IUVA 3AL8A 1JOFA 4PNKB 4E5ZB 4J0XA 4PBZA 4JSPC 4LGNA 3FM0A 4X3EA 3CIKB 4ZOZA 2OVRB 5AFU3 3UR4A 5CXCB 5AJAA 4J8BA 3NVNA 3JAMg 4FAND 2YNPA 3P4FA 3FRXA 2B5LA 3I7LA 3L4MD 2XU7A 3SBPA 4CY3A 2I3SA 3MKSB 5GXHA 3J80g 3BWSA 4GM3A 3F3FA 3N0DA 2IWFA 5SXMA 3AL8B 4A2MA 3RMZD 3ORVD 4A7JA 2P9UC 3IIYA 4QL1A 3PSLA 4PC0A 3I7PA 1FWXA 5IGQA 3SN6B 3SXTD 4FA4D 1S4UX 5HQGA 4U1EI 4TZ4A 5FA5B 5H1MA 4LG9A 1XIPA 2YNOA 3JZHA 1GP2B 2PM9A 4MK0B 4NSXA 4GM9A 2H6KA 1R5MA 3SWSD 3EI4B 1MDAH 4HDJA 4CI8A 1RI6A 4I79A 4Y5RD 2OVPB 4QT8A 5GMKn 3I8CA 3ULEC 5CXBB 3DM0A 4J82A 2H14A 3I89A 5GXIA 5C9ZB 3K26A 3EI2A 2TRCB 4J84A 2AH0A 3JROA 1GOTB 3UVNA 5H14A 5EM2A 3MMYA 5TDHB 3VGZA 5EMJB 5HE2B 2H9PA 4A0BB 4ERZA 5FXYA 2H9LA 2P9LC 3OTTA 1OLZA 4PXWA 3OKTA 2CN2A 3ZWLB 1U4CA 3UVKA 4ERYA 2CN3A 1NEXB 4ZOVA 5EMLB 2I0TA 4GGAA 4OZUA 3BG0A 3CFSB 3VA6A 5FKRA 1N6EA 3OW8A 5A2Qg 3J81g 2AGZA 2P9NC 3SLED 2G99A 4PBYA 2B5NA 2H6QA 2H13A 4GQBB 4PSWB 5HE0B 4ES0A 3EI2B 2OVQB 4O45A 4BH6A 2H3XA 3B7FA 1A0RB 5CYKA 2I3TA 5TEEA 4A2LA 2HKRA 5EARA 5FKQA 4J79A 1TBGA 2IUPA 5IGOA 4YVDA 4IA9A 2P9KC 2YMUA 3ODTA 4A0AA 3F3GA 4CI3A 3RN0D 3AFCA 2P9SC 4J8GA 4D6VA 4UI9R 3CFVA 3SMRA 5KDOB 4H5IA 2P9PC 5JWZA 1YFQA 1N6DA 2OJYA 3SBQA 1TYQC 4JT5C 3JZNA 3PE7A 2HKMA 4FAVD 5K19A 3I7HA 4GM8A 2YBAA 5IC7A 1SQ9A 4K3JB 5CYKB 1K8KC 3RFHA 2XL3A 4XYHA 5EALA 3I2NA 4O3UB 2H9MA 5HE3B 2B5MA 4Z8LA 1PEVA 3MKQA 5I5IA 3UVLA 3JB9L 5K1CC 3V7DB 3PXSD 5I5MA 4A0AB 1MG2A 4J0WA 5C2WB 4A08A 2PM6B 3C75H 3EI3A 2GNQA 3UVMA 4X60B 5FKTA 4CZVA 3KRXB 3PVUB 5EMKB 3SFZA 5C2VB 4U7AA 3DWLC 3C9CA 5I5JA 4CY2A 3BG1A 2YNNA 2AGWA 3K27A 3V9FA 4CY5A 1B9YA 2CE8A 3GREA 5H17A 3DXMC 2EBSA 1L0QA 2IURA 3EMHA 2Q7QA 3DSMA 3IKOA 3N0EA 4FA9D 3EU7A 2AGLA 2HJBA 2W18A 4D0KA 3OKWA 3MZKA 1Q47A 2Z2PA 3EI3B 4CI2A 4FB1D 2J55H 4JSXC 2PM9B 4XEIC 5HYNB 2Z2NA 3IJ1A 3SJLD 5HE1B 2Z2OA 3AL9A 1PI6A 4CZYA 3UKUC 4Y7RA 3I7NA 3E0CA 2CNXA 3JRPA 4FA1D 3MXXA 3KRWB 5EM2B 3C5MA 4JXMA 2UZYB 2IWKA 4GGCA 4JD2C 3UVOA 2XYIA 4BL0A 2O9KA 2CO0A 2UZXB 4X61B 5GSAA 1JMZB 4CI1A 3SBRA 3VH0A 1NR0A 1U2VC 3SVWD 3PSCB 5B4WA 4L3HD 4GQ2P 5TEFA 1MG3A 4E54A 1OMWB 3PXWD 1SQJA 3RN1D 2G9AA 4IMMA 3IIWA 5TF2A 3I8EA 5FKSA 4EWRA 5IJ7E 2J56H 4FWWA 5EMMB 2OK6A 3PXTD 1XKSA 3JZGA 3HFQA 3OKYA 3W15A 5IJ8E 3U4YA 3DXKC 2MTAH 2AGXA 2QXVA 3RRMC 3GFCA 3MZLA 2CE9A 3OL2A 4N14A 5AMSA 4LG8A 5EAPA 3IJ0A 1GG2B 3EI4A 4J86A 2HESX 1B9XA 4KFMB 4QRJA 4L1QD 5CXBA 2H47A 3C99A 4E54B 3JPXA 3AH8B 3A0FA 2IUQA 4A11A 4J81A 4L3GD 4X63B 4FHLA 2PBIB 3RSEC 3IJCA 2GC7A 3I7KA 4J77A 4JSNC 4PSXB 4XYIA 2I0SA 4A09A 3EI1A 4A0BA 3RLMD 3OKYB 4O3TB 2CO0C 2YB8B 2H68A 4JSVC 2I0RA 4J87A 4ZOXA 5FQDA 1GXRA 3OL2B 3SCYA 4L9OA 1XHMA 4QQEA 2QC5A 2HYEA 4J73A 3EG6A 5IT9g 4J78A 1VYHC 1SHYB 2OIZA 4AEZA 4A08B 4O1QD 4AOWA 4A11B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGU A;  4CC9 A;  2GC4 A;  3SHF A;  1PBY B;  2H9N A;  2AQ5 A;  3F3P A;  3RFG A;  2OK4 A;  4A09 B;  2IAA A;  4O9D A;  4FA5 D;  3EI1 B;  2BCJ B;  2HXC A;  4JT6 C;  1QNI A;  2AH1 A;  4K3I D;  2BBK H;  4BUJ C;  2AGY A;  4ESG A;  4GZ8 A;  2XL2 A;  2B4E A;  3FGB A;  4E5Z A;  4R7A B;  3EWE A;  5THA A;  1K32 A;  1P22 A;  1JMX B;  4GGD A;  5CXC A;  4GMB A;  3UKR C;  4ERQ A;  3I7O A;  4G56 B;  4OWR A;  4H5J A;  5EAM A;  1ERJ A;  4GQ1 A;  4CZX A;  2P9I C;  3V5W B;  4ZOY A;  3PVW B;  3NVX A;  2J57 G;  5FLX g;  4ZN4 A;  4CY1 A;  2H6N A;  1N6F A;  2PM7 B;  1JJU B;  3NVQ A;  3L4O D;  2HJ4 A;  2IUV A;  3AL8 A;  1JOF A;  4PNK B;  4E5Z B;  4J0X A;  4PBZ A;  4JSP C;  4LGN A;  3FM0 A;  4X3E A;  3CIK B;  4ZOZ A;  2OVR B;  5AFU 3;  3UR4 A;  5CXC B;  5AJA A;  4J8B A;  3NVN A;  3JAM g;  4FAN D;  2YNP A;  3P4F A;  3FRX A;  2B5L A;  3I7L A;  3L4M D;  2XU7 A;  3SBP A;  4CY3 A;  2I3S A;  3MKS B;  5GXH A;  3J80 g;  3BWS A;  4GM3 A;  3F3F A;  3N0D A;  2IWF A;  5SXM A;  3AL8 B;  4A2M A;  3RMZ D;  3ORV D;  4A7J A;  2P9U C;  3IIY A;  4QL1 A;  3PSL A;  4PC0 A;  3I7P A;  1FWX A;  5IGQ A;  3SN6 B;  3SXT D;  4FA4 D;  1S4U X;  5HQG A;  4U1E I;  4TZ4 A;  5FA5 B;  5H1M A;  4LG9 A;  1XIP A;  2YNO A;  3JZH A;  1GP2 B;  2PM9 A;  4MK0 B;  4NSX A;  4GM9 A;  2H6K A;  1R5M A;  3SWS D;  3EI4 B;  1MDA H;  4HDJ A;  4CI8 A;  1RI6 A;  4I79 A;  4Y5R D;  2OVP B;  4QT8 A;  5GMK n;  3I8C A;  3ULE C;  5CXB B;  3DM0 A;  4J82 A;  2H14 A;  3I89 A;  5GXI A;  5C9Z B;  3K26 A;  3EI2 A;  2TRC B;  4J84 A;  2AH0 A;  3JRO A;  1GOT B;  3UVN A;  5H14 A;  5EM2 A;  3MMY A;  5TDH B;  3VGZ A;  5EMJ B;  5HE2 B;  2H9P A;  4A0B B;  4ERZ A;  5FXY A;  2H9L A;  2P9L C;  3OTT A;  1OLZ A;  4PXW A;  3OKT A;  2CN2 A;  3ZWL B;  1U4C A;  3UVK A;  4ERY A;  2CN3 A;  1NEX B;  4ZOV A;  5EML B;  2I0T A;  4GGA A;  4OZU A;  3BG0 A;  3CFS B;  3VA6 A;  5FKR A;  1N6E A;  3OW8 A;  5A2Q g;  3J81 g;  2AGZ A;  2P9N C;  3SLE D;  2G99 A;  4PBY A;  2B5N A;  2H6Q A;  2H13 A;  4GQB B;  4PSW B;  5HE0 B;  4ES0 A;  3EI2 B;  2OVQ B;  4O45 A;  4BH6 A;  2H3X A;  3B7F A;  1A0R B;  5CYK A;  2I3T A;  5TEE A;  4A2L A;  2HKR A;  5EAR A;  5FKQ A;  4J79 A;  1TBG A;  2IUP A;  5IGO A;  4YVD A;  4IA9 A;  2P9K C;  2YMU A;  3ODT A;  4A0A A;  3F3G A;  4CI3 A;  3RN0 D;  3AFC A;  2P9S C;  4J8G A;  4D6V A;  4UI9 R;  3CFV A;  3SMR A;  5KDO B;  4H5I A;  2P9P C;  5JWZ A;  1YFQ A;  1N6D A;  2OJY A;  3SBQ A;  1TYQ C;  4JT5 C;  3JZN A;  3PE7 A;  2HKM A;  4FAV D;  5K19 A;  3I7H A;  4GM8 A;  2YBA A;  5IC7 A;  1SQ9 A;  4K3J B;  5CYK B;  1K8K C;  3RFH A;  2XL3 A;  4XYH A;  5EAL A;  3I2N A;  4O3U B;  2H9M A;  5HE3 B;  2B5M A;  4Z8L A;  1PEV A;  3MKQ A;  5I5I A;  3UVL A;  3JB9 L;  5K1C C;  3V7D B;  3PXS D;  5I5M A;  4A0A B;  1MG2 A;  4J0W A;  5C2W B;  4A08 A;  2PM6 B;  3C75 H;  3EI3 A;  2GNQ A;  3UVM A;  4X60 B;  5FKT A;  4CZV A;  3KRX B;  3PVU B;  5EMK B;  3SFZ A;  5C2V B;  4U7A A;  3DWL C;  3C9C A;  5I5J A;  4CY2 A;  3BG1 A;  2YNN A;  2AGW A;  3K27 A;  3V9F A;  4CY5 A;  1B9Y A;  2CE8 A;  3GRE A;  5H17 A;  3DXM C;  2EBS A;  1L0Q A;  2IUR A;  3EMH A;  2Q7Q A;  3DSM A;  3IKO A;  3N0E A;  4FA9 D;  3EU7 A;  2AGL A;  2HJB A;  2W18 A;  4D0K A;  3OKW A;  3MZK A;  1Q47 A;  2Z2P A;  3EI3 B;  4CI2 A;  4FB1 D;  2J55 H;  4JSX C;  2PM9 B;  4XEI C;  5HYN B;  2Z2N A;  3IJ1 A;  3SJL D;  5HE1 B;  2Z2O A;  3AL9 A;  1PI6 A;  4CZY A;  3UKU C;  4Y7R A;  3I7N A;  3E0C A;  2CNX A;  3JRP A;  4FA1 D;  3MXX A;  3KRW B;  5EM2 B;  3C5M A;  4JXM A;  2UZY B;  2IWK A;  4GGC A;  4JD2 C;  3UVO A;  2XYI A;  4BL0 A;  2O9K A;  2CO0 A;  2UZX B;  4X61 B;  5GSA A;  1JMZ B;  4CI1 A;  3SBR A;  3VH0 A;  1NR0 A;  1U2V C;  3SVW D;  3PSC B;  5B4W A;  4L3H D;  4GQ2 P;  5TEF A;  1MG3 A;  4E54 A;  1OMW B;  3PXW D;  1SQJ A;  3RN1 D;  2G9A A;  4IMM A;  3IIW A;  5TF2 A;  3I8E A;  5FKS A;  4EWR A;  5IJ7 E;  2J56 H;  4FWW A;  5EMM B;  2OK6 A;  3PXT D;  1XKS A;  3JZG A;  3HFQ A;  3OKY A;  3W15 A;  5IJ8 E;  3U4Y A;  3DXK C;  2MTA H;  2AGX A;  2QXV A;  3RRM C;  3GFC A;  3MZL A;  2CE9 A;  3OL2 A;  4N14 A;  5AMS A;  4LG8 A;  5EAP A;  3IJ0 A;  1GG2 B;  3EI4 A;  4J86 A;  2HES X;  1B9X A;  4KFM B;  4QRJ A;  4L1Q D;  5CXB A;  2H47 A;  3C99 A;  4E54 B;  3JPX A;  3AH8 B;  3A0F A;  2IUQ A;  4A11 A;  4J81 A;  4L3G D;  4X63 B;  4FHL A;  2PBI B;  3RSE C;  3IJC A;  2GC7 A;  3I7K A;  4J77 A;  4JSN C;  4PSX B;  4XYI A;  2I0S A;  4A09 A;  3EI1 A;  4A0B A;  3RLM D;  3OKY B;  4O3T B;  2CO0 C;  2YB8 B;  2H68 A;  4JSV C;  2I0R A;  4J87 A;  4ZOX A;  5FQD A;  1GXR A;  3OL2 B;  3SCY A;  4L9O A;  1XHM A;  4QQE A;  2QC5 A;  2HYE A;  4J73 A;  3EG6 A;  5IT9 g;  4J78 A;  1VYH C;  1SHY B;  2OIZ A;  4AEZ A;  4A08 B;  4O1Q D;  4AOW A;  4A11 B; 
#chains in the Genus database with same CATH topology
 1QFM A;  2VDM A;  1PGU A;  4CC9 A;  2GC4 A;  5M5S A;  1H2Z A;  3SHF A;  1PBY B;  2H9N A;  2AQ5 A;  3F3P A;  3RFG A;  2BKL A;  2OK4 A;  4A09 B;  2IAA A;  4O9D A;  4FA5 D;  3EI1 B;  2BCJ B;  3ZDX A;  3O4I A;  3EQ9 A;  5FFG A;  2HXC A;  4JT6 C;  4Z7O A;  1QNI A;  2AH1 A;  3IUL A;  2BBK H;  4K3I D;  4BUJ C;  2AGY A;  4ESG A;  4GZ8 A;  2XL2 A;  2B4E A;  3FGB A;  4E5Z A;  4R7A B;  2VDK A;  3EWE A;  4BP9 A;  5THA A;  4MMZ A;  1K32 A;  1VE7 A;  1P22 A;  1JMX B;  4GGD A;  2VDL A;  4NAA A;  5CXC A;  5M5U A;  1YR2 A;  4GMB A;  3UKR C;  4ERQ A;  3I7O A;  4RE5 A;  3KCI A;  4G56 B;  4OWR A;  4H5J A;  5EAM A;  3O4G A;  3T3M A;  1ERJ A;  2JKX A;  4GQ1 A;  4MMX A;  2P9I C;  3V5W B;  4CZX A;  4ZOY A;  3PVW B;  3NVX A;  2J57 G;  2XDW A;  5FLX g;  4ZN4 A;  4CY1 A;  2H6N A;  1N6F A;  2PM7 B;  1JJU B;  2VZ1 A;  2VDQ A;  3NVQ A;  3L4O D;  2HJ4 A;  2IUV A;  3AL8 A;  1JOF A;  4PNK B;  4E5Z B;  3MUO A;  4J0X A;  4PBZ A;  4JSP C;  4LGN A;  3FM0 A;  4BCD A;  4X3E A;  3CIK B;  4ZOZ A;  2OVR B;  2HU8 A;  5AFU 3;  3UR4 A;  5CXC B;  5AJA A;  4J8B A;  3NVN A;  3JAM g;  4FAN D;  2YNP A;  3P4F A;  2VDO A;  3EQ7 A;  3FRX A;  2B5L A;  3I7L A;  3L4M D;  1C9I A;  2XU7 A;  5E6R A;  3SBP A;  3V4P A;  4CY3 A;  2XZG A;  2XE4 A;  2I3S A;  3IUQ A;  2QZP A;  3MKS B;  5GXH A;  3J80 g;  4DNU A;  3BWS A;  4GM3 A;  4O02 A;  3F3F A;  3N0D A;  2IWF A;  5SXM A;  3AL8 B;  4A2M A;  3K71 A;  3RMZ D;  3ORV D;  3K72 A;  4A7J A;  2P9U C;  3IIY A;  4QL1 A;  3PSL A;  4PC0 A;  3I7P A;  1FWX A;  5E6S A;  5IGQ A;  3SN6 B;  3SXT D;  4FA4 D;  1S4U X;  5HQG A;  4U1E I;  4TZ4 A;  5FA5 B;  5H1M A;  1A12 A;  1UTC A;  5C92 A;  1QFS A;  4LG9 A;  1XIP A;  2YNO A;  1U8C A;  3JZH A;  5HDB A;  1GP2 B;  2PM9 A;  4AMZ A;  4MK0 B;  4NSX A;  4GM9 A;  2H6K A;  1R5M A;  4MMY A;  3SWS D;  3EI4 B;  1MDA H;  3NIG A;  4HDJ A;  4CI8 A;  1RI6 A;  3OF7 A;  4I79 A;  2OVP B;  1O6G A;  4Y5R D;  4QT8 A;  5GMK n;  3I8C A;  3ULE C;  5CXB B;  3DM0 A;  4J82 A;  2H14 A;  3I89 A;  5GXI A;  1GOG A;  3DDU A;  5C9Z B;  1T2X A;  3K26 A;  3EI2 A;  2TRC B;  4J84 A;  2AH0 A;  3JRO A;  1GOT B;  3UVN A;  1UOP A;  5H14 A;  5EM2 A;  3MMY A;  5TDH B;  3VGZ A;  5EMJ B;  1VZ2 A;  2H9P A;  5HE2 B;  4ERZ A;  4A0B B;  5FXY A;  2H9L A;  1H2X A;  2P9L C;  3OTT A;  1OLZ A;  1VZ3 A;  4PXW A;  3OKT A;  2CN2 A;  3ZWL B;  1U4C A;  3UVK A;  4ERY A;  2CN3 A;  1NEX B;  4ZOV A;  5EML B;  2I0T A;  4GGA A;  4OZU A;  3BG0 A;  3CFS B;  3VA6 A;  5FKR A;  1N6E A;  3OW8 A;  1H2W A;  5A2Q g;  3J81 g;  2AGZ A;  2P9N C;  4WK4 A;  3SLE D;  2G99 A;  4PBY A;  2B5N A;  4QAM A;  2H6Q A;  2H13 A;  4GQB B;  4PSW B;  5HE0 B;  4ES0 A;  3EI2 B;  2OVQ B;  4O45 A;  4D9S A;  4BH6 A;  4G1E A;  2H3X A;  4NC4 A;  1K3I A;  3B7F A;  1A0R B;  5CYK A;  4JHN A;  2I3T A;  1O6F A;  5TEE A;  4A2L A;  4WK2 A;  2HKR A;  3QI0 A;  1H2Y A;  5EAR A;  5FKQ A;  4J79 A;  1TBG A;  3T3P A;  2IUP A;  5IGO A;  4YVD A;  4IA9 A;  2P9K C;  2QR5 A;  4RE6 A;  2YMU A;  3ODT A;  4A0A A;  3F3G A;  4CI3 A;  3MUN A;  3RN0 D;  4Z7Q A;  3AFC A;  2P9S C;  4J8G A;  1GOH A;  4BCC A;  2WQ8 A;  4D6V A;  5M5T A;  4UI9 R;  3CFV A;  3SMR A;  5KDO B;  4H5I A;  2P9P C;  5JWZ A;  1YFQ A;  1N6D A;  2OJY A;  3SBQ A;  1TYQ C;  4JT5 C;  3IJE A;  3JZN A;  1L5G A;  3PE7 A;  2VZ3 A;  5M5V A;  2HKM A;  4FAV D;  5K19 A;  3NIF A;  4NEN A;  3I7H A;  4GM8 A;  2YBA A;  4AX4 A;  5IC7 A;  1SQ9 A;  4K3J B;  3IVM A;  5CYK B;  4JHP C;  1K8K C;  3RFH A;  2XL3 A;  4XYH A;  4BCB A;  5EAL A;  3I2N A;  3FCU A;  4O3U B;  2H9M A;  1E8N A;  4Z7N A;  5HE3 B;  1UOQ A;  2B5M A;  3EQ8 A;  4DNV A;  4Z8L A;  2HU5 A;  1PEV A;  3MKQ A;  5C86 A;  5I5I A;  3UVL A;  3JB9 L;  5K1C C;  3V7D B;  4AN1 A;  3MVD K;  3PXS D;  5I5M A;  3ZDZ A;  4A0A B;  1MG2 A;  4J0W A;  5C2W B;  4A08 A;  5E6U A;  2PM6 B;  3C75 H;  3EI3 A;  4AMY A;  2GNQ A;  2EIB A;  3UVM A;  4X60 B;  5FKT A;  4CZV A;  3KRX B;  3PVU B;  1C9L A;  5EMK B;  3SFZ A;  5C2V B;  4U7A A;  4WK0 A;  1GOF A;  3DWL C;  3C9C A;  3IUN A;  5I5J A;  4CY2 A;  3BG1 A;  2YNN A;  1VE6 A;  2AGW A;  3K27 A;  3V9F A;  3ZDY A;  4CY5 A;  1B9Y A;  2CE8 A;  3GRE A;  5H17 A;  3DXM C;  2EBS A;  1L0Q A;  2IUR A;  3EMH A;  2Q7Q A;  3DSM A;  5M61 A;  3IKO A;  3N0E A;  4FA9 D;  3EU7 A;  2AGL A;  2HJB A;  2W18 A;  4D0K A;  3OKW A;  2EIC A;  3MZK A;  1Q47 A;  3ZE0 A;  2Z2P A;  1E8M A;  3EI3 B;  2EID A;  4IRZ A;  3QHY B;  4CI2 A;  4FB1 D;  2J55 H;  4JSX C;  2PM9 B;  3GC3 B;  3IUR A;  4XEI C;  4DNW A;  5HYN B;  2EIE A;  2HU7 A;  2Z2N A;  3VI4 A;  3IJ1 A;  3SJL D;  1UOO A;  5HE1 B;  4AN0 A;  2Z2O A;  3AL9 A;  1PI6 A;  4CZY A;  3UKU C;  4Y7R A;  4UM8 A;  4G1M A;  3ZE2 A;  3VI3 A;  3I7N A;  3O4H A;  3E0C A;  1M1X A;  2CNX A;  3JRP A;  4FA1 D;  3MXX A;  1JTD B;  3NID A;  3KRW B;  5EM2 B;  3C5M A;  4JXM A;  3ZE1 A;  2UZY B;  3O4J A;  2IWK A;  4GGC A;  4JD2 C;  3UVO A;  2VC2 A;  2XYI A;  4BL0 A;  2O9K A;  2CO0 A;  2UZX B;  4X61 B;  3FCS A;  5GSA A;  1JMZ B;  4CI1 A;  3SBR A;  3VH0 A;  1I2M B;  1NR0 A;  1U2V C;  3SVW D;  3PSC B;  5B4W A;  4L3H D;  4GQ2 P;  5TEF A;  1MG3 A;  4E54 A;  1OMW B;  4WJK A;  3PXW D;  1SQJ A;  3RN1 D;  2G9A A;  1TYE A;  4O2W A;  4IMM A;  3IIW A;  2VDP A;  5TF2 A;  4UM9 A;  3I8E A;  5FKS A;  4EWR A;  5IJ7 E;  2J56 H;  4FWW A;  5EMM B;  2OK6 A;  3PXT D;  1XKS A;  3JZG A;  3HFQ A;  3OKY A;  3W15 A;  1JV2 A;  5IJ8 E;  3U4Y A;  3DXK C;  2MTA H;  2AGX A;  2QXV A;  3RRM C;  3GFC A;  5M5R A;  3MZL A;  2CE9 A;  3OL2 A;  4N14 A;  5AMS A;  4LG8 A;  5EAP A;  3IJ0 A;  1GG2 B;  3EI4 A;  4J86 A;  2VDN A;  2HES X;  1B9X A;  3IUJ A;  4KFM B;  4QRJ A;  4L1Q D;  5CXB A;  2H47 A;  3C99 A;  4E54 B;  3JPX A;  3AH8 B;  3A0F A;  2IUQ A;  4A11 A;  4J81 A;  1E5T A;  4L3G D;  4X63 B;  4FHL A;  2PBI B;  3GD1 I;  5FFO A;  3RSE C;  3IJC A;  2GC7 A;  3K6S A;  3I7K A;  4J77 A;  4JSN C;  4PSX B;  4XYI A;  2I0S A;  4BP8 A;  3IUM A;  4A09 A;  3EI1 A;  4G55 A;  4A0B A;  3RLM D;  1BPO A;  3OKY B;  4O3T B;  2CO0 C;  2YB8 B;  2H68 A;  4JSV C;  3V4V A;  2I0R A;  4J87 A;  4ZOX A;  5FQD A;  1GXR A;  3OL2 B;  3SCY A;  4L9O A;  1XHM A;  2VDR A;  4QQE A;  2QC5 A;  2HYE A;  4J73 A;  3EG6 A;  5IT9 g;  4J78 A;  1VYH C;  1SHY B;  2OIZ A;  4AEZ A;  4A08 B;  4NBM A;  4L1M A;  4O1Q D;  4AOW A;  4A11 B; 
#chains in the Genus database with same CATH homology
 1PGU A;  4CC9 A;  2GC4 A;  3SHF A;  1PBY B;  2H9N A;  2AQ5 A;  3F3P A;  3RFG A;  2OK4 A;  4A09 B;  2IAA A;  4O9D A;  4FA5 D;  3EI1 B;  2BCJ B;  2HXC A;  4JT6 C;  1QNI A;  2AH1 A;  4K3I D;  2BBK H;  4BUJ C;  2AGY A;  4ESG A;  4GZ8 A;  2XL2 A;  2B4E A;  3FGB A;  4E5Z A;  4R7A B;  3EWE A;  5THA A;  1K32 A;  1P22 A;  1JMX B;  4GGD A;  5CXC A;  4GMB A;  3UKR C;  4ERQ A;  3I7O A;  4G56 B;  4OWR A;  4H5J A;  5EAM A;  1ERJ A;  4GQ1 A;  4CZX A;  2P9I C;  3V5W B;  4ZOY A;  3PVW B;  3NVX A;  2J57 G;  5FLX g;  4ZN4 A;  4CY1 A;  2H6N A;  1N6F A;  2PM7 B;  1JJU B;  3NVQ A;  3L4O D;  2HJ4 A;  2IUV A;  3AL8 A;  1JOF A;  4PNK B;  4E5Z B;  4J0X A;  4PBZ A;  4JSP C;  4LGN A;  3FM0 A;  4X3E A;  3CIK B;  4ZOZ A;  2OVR B;  5AFU 3;  3UR4 A;  5CXC B;  5AJA A;  4J8B A;  3NVN A;  3JAM g;  4FAN D;  2YNP A;  3P4F A;  3FRX A;  2B5L A;  3I7L A;  3L4M D;  2XU7 A;  3SBP A;  4CY3 A;  2I3S A;  3MKS B;  5GXH A;  3J80 g;  3BWS A;  4GM3 A;  3F3F A;  3N0D A;  2IWF A;  5SXM A;  3AL8 B;  4A2M A;  3RMZ D;  3ORV D;  4A7J A;  2P9U C;  3IIY A;  4QL1 A;  3PSL A;  4PC0 A;  3I7P A;  1FWX A;  5IGQ A;  3SN6 B;  3SXT D;  4FA4 D;  1S4U X;  5HQG A;  4U1E I;  4TZ4 A;  5FA5 B;  5H1M A;  4LG9 A;  1XIP A;  2YNO A;  3JZH A;  1GP2 B;  2PM9 A;  4MK0 B;  4NSX A;  4GM9 A;  2H6K A;  1R5M A;  3SWS D;  3EI4 B;  1MDA H;  4HDJ A;  4CI8 A;  1RI6 A;  4I79 A;  4Y5R D;  2OVP B;  4QT8 A;  5GMK n;  3I8C A;  3ULE C;  5CXB B;  3DM0 A;  4J82 A;  2H14 A;  3I89 A;  5GXI A;  5C9Z B;  3K26 A;  3EI2 A;  2TRC B;  4J84 A;  2AH0 A;  3JRO A;  1GOT B;  3UVN A;  5H14 A;  5EM2 A;  3MMY A;  5TDH B;  3VGZ A;  5EMJ B;  5HE2 B;  2H9P A;  4A0B B;  4ERZ A;  5FXY A;  2H9L A;  2P9L C;  3OTT A;  1OLZ A;  4PXW A;  3OKT A;  2CN2 A;  3ZWL B;  1U4C A;  3UVK A;  4ERY A;  2CN3 A;  1NEX B;  4ZOV A;  5EML B;  2I0T A;  4GGA A;  4OZU A;  3BG0 A;  3CFS B;  3VA6 A;  5FKR A;  1N6E A;  3OW8 A;  5A2Q g;  3J81 g;  2AGZ A;  2P9N C;  3SLE D;  2G99 A;  4PBY A;  2B5N A;  2H6Q A;  2H13 A;  4GQB B;  4PSW B;  5HE0 B;  4ES0 A;  3EI2 B;  2OVQ B;  4O45 A;  4BH6 A;  2H3X A;  3B7F A;  1A0R B;  5CYK A;  2I3T A;  5TEE A;  4A2L A;  2HKR A;  5EAR A;  5FKQ A;  4J79 A;  1TBG A;  2IUP A;  5IGO A;  4YVD A;  4IA9 A;  2P9K C;  2YMU A;  3ODT A;  4A0A A;  3F3G A;  4CI3 A;  3RN0 D;  3AFC A;  2P9S C;  4J8G A;  4D6V A;  4UI9 R;  3CFV A;  3SMR A;  5KDO B;  4H5I A;  2P9P C;  5JWZ A;  1YFQ A;  1N6D A;  2OJY A;  3SBQ A;  1TYQ C;  4JT5 C;  3JZN A;  3PE7 A;  2HKM A;  4FAV D;  5K19 A;  3I7H A;  4GM8 A;  2YBA A;  5IC7 A;  1SQ9 A;  4K3J B;  5CYK B;  1K8K C;  3RFH A;  2XL3 A;  4XYH A;  5EAL A;  3I2N A;  4O3U B;  2H9M A;  5HE3 B;  2B5M A;  4Z8L A;  1PEV A;  3MKQ A;  5I5I A;  3UVL A;  3JB9 L;  5K1C C;  3V7D B;  3PXS D;  5I5M A;  4A0A B;  1MG2 A;  4J0W A;  5C2W B;  4A08 A;  2PM6 B;  3C75 H;  3EI3 A;  2GNQ A;  3UVM A;  4X60 B;  5FKT A;  4CZV A;  3KRX B;  3PVU B;  5EMK B;  3SFZ A;  5C2V B;  4U7A A;  3DWL C;  3C9C A;  5I5J A;  4CY2 A;  3BG1 A;  2YNN A;  2AGW A;  3K27 A;  3V9F A;  4CY5 A;  1B9Y A;  2CE8 A;  3GRE A;  5H17 A;  3DXM C;  2EBS A;  1L0Q A;  2IUR A;  3EMH A;  2Q7Q A;  3DSM A;  3IKO A;  3N0E A;  4FA9 D;  3EU7 A;  2AGL A;  2HJB A;  2W18 A;  4D0K A;  3OKW A;  3MZK A;  1Q47 A;  2Z2P A;  3EI3 B;  4CI2 A;  4FB1 D;  2J55 H;  4JSX C;  2PM9 B;  4XEI C;  5HYN B;  2Z2N A;  3IJ1 A;  3SJL D;  5HE1 B;  2Z2O A;  3AL9 A;  1PI6 A;  4CZY A;  3UKU C;  4Y7R A;  3I7N A;  3E0C A;  2CNX A;  3JRP A;  4FA1 D;  3MXX A;  3KRW B;  5EM2 B;  3C5M A;  4JXM A;  2UZY B;  2IWK A;  4GGC A;  4JD2 C;  3UVO A;  2XYI A;  4BL0 A;  2O9K A;  2CO0 A;  2UZX B;  4X61 B;  5GSA A;  1JMZ B;  4CI1 A;  3SBR A;  3VH0 A;  1NR0 A;  1U2V C;  3SVW D;  3PSC B;  5B4W A;  4L3H D;  4GQ2 P;  5TEF A;  1MG3 A;  4E54 A;  1OMW B;  3PXW D;  1SQJ A;  3RN1 D;  2G9A A;  4IMM A;  3IIW A;  5TF2 A;  3I8E A;  5FKS A;  4EWR A;  5IJ7 E;  2J56 H;  4FWW A;  5EMM B;  2OK6 A;  3PXT D;  1XKS A;  3JZG A;  3HFQ A;  3OKY A;  3W15 A;  5IJ8 E;  3U4Y A;  3DXK C;  2MTA H;  2AGX A;  2QXV A;  3RRM C;  3GFC A;  3MZL A;  2CE9 A;  3OL2 A;  4N14 A;  5AMS A;  4LG8 A;  5EAP A;  3IJ0 A;  1GG2 B;  3EI4 A;  4J86 A;  2HES X;  1B9X A;  4KFM B;  4QRJ A;  4L1Q D;  5CXB A;  2H47 A;  3C99 A;  4E54 B;  3JPX A;  3AH8 B;  3A0F A;  2IUQ A;  4A11 A;  4J81 A;  4L3G D;  4X63 B;  4FHL A;  2PBI B;  3RSE C;  3IJC A;  2GC7 A;  3I7K A;  4J77 A;  4JSN C;  4PSX B;  4XYI A;  2I0S A;  4A09 A;  3EI1 A;  4A0B A;  3RLM D;  3OKY B;  4O3T B;  2CO0 C;  2YB8 B;  2H68 A;  4JSV C;  2I0R A;  4J87 A;  4ZOX A;  5FQD A;  1GXR A;  3OL2 B;  3SCY A;  4L9O A;  1XHM A;  4QQE A;  2QC5 A;  2HYE A;  4J73 A;  3EG6 A;  5IT9 g;  4J78 A;  1VYH C;  1SHY B;  2OIZ A;  4AEZ A;  4A08 B;  4O1Q D;  4AOW A;  4A11 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...