4JT6C

Structure of mtordeltan-mlst8-pi-103 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
317
structure length
317
Chain Sequence
b'VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jt6C01
2TRCB 2Q7QA 3SBRA 1S4UX 4AOWA 3SVWD 5I5MA 3EI1B 4D6VA 5TF2A 1QNIA 2I3TA 5C2WB 3I7LA 5SXMA 3B7FA 2CO0C 5A2Qg 2XL3A 4IA9A 2H13A 4D0KA 2H47A 3CFSB 3C9CA 5H17A 3PXSD 5EMMB 3AH8B 3OW8A 4TZ4A 3IJ1A 4CI8A 5EMJB 4A2LA 3GFCA 2HYEA 1YFQA 3JZGA 2P9SC 3JPXA 5CXCA 4J8BA 2H3XA 4ES0A 2GNQA 4H5IA 5HE1B 2OVQB 5EAMA 3NVQA 4A0BA 2CE8A 4OWRA 4L1QD 4BH6A 2YBAA 4CZXA 2HESX 4GGDA 3IIYA 3DSMA 5AJAA 3C5MA 3IJCA 4UI9R 5C2VB 4E54A 4U1EI 3N0EA 1L0QA 3DXKC 2OJYA 3KRXB 3UVNA 3EI3A 4MK0B 1B9XA 1SQ9A 5AMSA 2IURA 5FQDA 2O9KA 3I89A 4J79A 1N6EA 5K19A 4ZOVA 3RSEC 2YNOA 3MMYA 4J73A 4GM3A 4GGAA 1VYHC 2PM6B 4CC9A 3OL2B 4L3GD 3MKSB 1GP2B 3UKRC 2MTAH 3FGBA 5CXBA 4CY1A 3JB9L 3ZWLB 4GM9A 4CY5A 4FAND 4J0WA 4GGCA 3OKWA 4JSVC 3NVXA 4JT5C 2IUQA 1R5MA 5H1MA 3EI2A 2PM9A 3VGZA 4PBYA 2AH0A 2HKMA 3SBQA 4A08B 2AQ5A 4FA9D 3RFHA 4JSXC 3UVMA 3EI1A 4PNKB 2P9PC 5GSAA 4ERYA 4ZN4A 4JT6C 3I7OA 4A0AA 3MXXA 4J78A 5IJ8E 3SXTD 3I7HA 4XYHA 4OZUA 2PBIB 3N0DA 2J57G 1N6FA 5IGOA 3RN0D 2GC7A 5EMLB 3FM0A 4JSPC 2CN3A 2UZXB 3P4FA 4GQBB 3E0CA 1OMWB 2IWKA 4AEZA 5TDHB 3A0FA 5TEFA 3KRWB 2J55H 1SHYB 1PBYB 1JMZB 4XEIC 3RN1D 1U4CA 4ESGA 3J81g 2AGLA 4J87A 2YMUA 4PC0A 2QXVA 4YVDA 4NSXA 2H6QA 4JD2C 4E5ZB 1Q47A 1XIPA 3C75H 5FKTA 2Z2NA 3L4OD 1GOTB 2UZYB 2BBKH 3SN6B 5FKSA 3SMRA 4HDJA 1MG2A 3PE7A 2P9IC 5EM2B 4GZ8A 4LG9A 2B5NA 2AGXA 1K32A 2HKRA 4J8GA 4GMBA 5GMKn 2OIZA 3BG0A 3FRXA 3SWSD 4A11B 5CYKB 4BUJC 4QT8A 2CNXA 2XU7A 3MZLA 4N14A 4J84A 4CZYA 2AGZA 4FHLA 3EMHA 5I5IA 3OL2A 4LG8A 2HJBA 4J82A 5B4WA 2XL2A 4QL1A 3U4YA 5HE2B 4CY3A 5EMKB 3RRMC 3JRPA 5FKRA 4PBZA 2CE9A 3F3FA 5JWZA 2P9NC 4KFMB 4Y5RD 3PVWB 1ERJA 1MDAH 2I3SA 4A08A 3PXTD 5I5JA 4FAVD 1RI6A 5HE0B 4GQ2P 3JZNA 1GG2B 4Z8LA 3L4MD 2AGWA 4O9DA 3AFCA 3J80g 3BG1A 3MKQA 5FA5B 4J0XA 3RFGA 3V5WB 3VH0A 3OKYB 3SLED 4CZVA 4J81A 2QC5A 2YNPA 1NR0A 4X63B 3AL9A 4FA5D 2H14A 4QQEA 5KDOB 4FWWA 5IGQA 4O3UB 3EI4B 4ERZA 4A09B 4X3EA 4JSNC 2OK4A 4EWRA 2EBSA 1FWXA 2IAAA 5EARA 4CY2A 4X60B 2Z2OA 2P9UC 4L9OA 3EWEA 2B4EA 2BCJB 3BWSA 4QRJA 2CN2A 4E5ZA 3UVOA 1OLZA 2XYIA 3PVUB 3VA6A 2H9PA 4PXWA 2H68A 5HE3B 3UVLA 2PM7B 1PGUA 1N6DA 2I0RA 3UR4A 1PI6A 2P9LC 5EM2A 2I0TA 1XHMA 4R7AB 5IC7A 2AGYA 3K27A 3ODTA 3CIKB 1U2VC 5C9ZB 2I0SA 3RLMD 5THAA 5EAPA 4A11A 3AL8B 5CYKA 2YNNA 3PXWD 3SFZA 4A0AB 2B5MA 2HJ4A 4IMMA 2IUVA 1TBGA 3DXMC 3I2NA 2IWFA 2IUPA 5EALA 3SJLD 3MZKA 5GXIA 3OTTA 4U7AA 3JZHA 1P22A 4A2MA 5HQGA 5AFU3 2G99A 5FKQA 3K26A 4CI3A 4PSXB 3F3PA 2H9MA 3NVNA 5IT9g 2YB8B 3IJ0A 1K8KC 3I7NA 3SHFA 3ORVD 2Z2PA 4A7JA 3OKTA 1GXRA 2CO0A 2W18A 4GM8A 1JJUB 3DM0A 5CXCB 1JOFA 2H6NA 2G9AA 1PEVA 4K3ID 1XKSA 3W15A 4ZOZA 3I8CA 3EG6A 5TEEA 4FA4D 3UKUC 5GXHA 4FB1D 3PSCB 3OKYA 3UVKA 2OVRB 4H5JA 4A0BB 4BL0A 4JXMA 4G56B 4ZOXA 3V9FA 5FLXg 4LGNA 4PSWB 5K1CC 2H9LA 2J56H 2OK6A 4GQ1A 4O45A 3SCYA 3PSLA 2AH1A 2OVPB 4E54B 2GC4A 3EI4A 4J77A 4A09A 4L3HD 1B9YA 1SQJA 1NEXB 3EI3B 3GREA 5IJ7E 3I7KA 1A0RB 3C99A 4CI1A 5HYNB 3RMZD 4FA1D 4CI2A 4XYIA 4ERQA 4K3JB 3JROA 4J86A 3V7DB 4ZOYA 3CFVA 4I79A 3IIWA 2HXCA 5FXYA 3EU7A 4O1QD 2H6KA 3F3GA 5CXBB 3I7PA 5H14A 2B5LA 1JMXB 1MG3A 2P9KC 3AL8A 4Y7RA 4X61B 3IKOA 3JAMg 3EI2B 2H9NA 2PM9B 3ULEC 3HFQA 1TYQC 3I8EA 3SBPA 4O3TB 3DWLC
chains in the Genus database with same CATH superfamily
2TRCB 2Q7QA 3SBRA 1S4UX 4AOWA 3SVWD 5I5MA 3EI1B 4D6VA 5TF2A 1QNIA 2I3TA 4Z7OA 5C2WB 3I7LA 5SXMA 3B7FA 2CO0C 3FCUA 5A2Qg 2XL3A 4IA9A 2EIBA 2H13A 4D0KA 2H47A 3CFSB 3C9CA 5H17A 3PXSD 3EQ9A 3T3PA 5EMMB 3AH8B 3OW8A 4TZ4A 1VZ2A 3IJ1A 4CI8A 5EMJB 5E6SA 4A2LA 3GFCA 2HYEA 1YFQA 3JZGA 1L5GA 2P9SC 3JPXA 5CXCA 4J8BA 2H3XA 2HU8A 4WJKA 4ES0A 3NIFA 2GNQA 4H5IA 1H2XA 5HE1B 2OVQB 5EAMA 3NVQA 4A0BA 2CE8A 4OWRA 2HU5A 4L1QD 4BH6A 2YBAA 4CZXA 2HESX 3VI4A 4GGDA 3IIYA 1VE6A 3DSMA 5AJAA 3C5MA 2QR5A 3EQ8A 3IJCA 4UI9R 5C2VB 4E54A 4AX4A 4QAMA 4U1EI 3N0EA 1L0QA 3DXKC 2OJYA 3KRXB 3UVNA 3EI3A 4MK0B 1B9XA 1O6FA 1SQ9A 2IURA 5AMSA 1H2YA 5FQDA 2O9KA 3I89A 4J79A 1N6EA 4AN0A 5K19A 4ZOVA 3RSEC 2YNOA 3MMYA 4J73A 4GM3A 3IUQA 5FFGA 4GGAA 1VYHC 4G1MA 2PM6B 4CC9A 3OL2B 3VI3A 4L3GD 3MKSB 4AMZA 1A12A 1GP2B 2VDRA 3UKRC 2MTAH 3FGBA 5CXBA 1YR2A 1UOQA 4CY1A 3JB9L 3ZWLB 4GM9A 4CY5A 4FAND 4J0WA 4GGCA 3OKWA 4JSVC 2VDLA 3NVXA 4JT5C 4NC4A 2IUQA 1R5MA 3IUJA 5H1MA 3EI2A 5M5SA 2PM9A 3VGZA 4O02A 4PBYA 2AH0A 2HKMA 3SBQA 3V4PA 4A08B 2AQ5A 4MMXA 4FA9D 3RFHA 4JSXC 1BPOA 4Z7NA 3UVMA 3EI1A 2HU7A 4PNKB 2P9PC 5GSAA 3K71A 4ERYA 4ZN4A 4JT6C 3I7OA 4A0AA 3MXXA 4J78A 5IJ8E 3SXTD 3I7HA 4WK0A 4XYHA 4OZUA 2PBIB 3N0DA 2J57G 1N6FA 5IGOA 3RN0D 2GC7A 5EMLB 3FM0A 4JSPC 2CN3A 2UZXB 2VDKA 3P4FA 4GQBB 3E0CA 1OMWB 2QZPA 2IWKA 5HDBA 5TDHB 4AEZA 4BCDA 3A0FA 5TEFA 3V4VA 3KRWB 2J55H 1SHYB 1PBYB 5M5RA 4BCBA 1JMZB 4XEIC 3RN1D 1U4CA 1GOFA 4ESGA 3J81g 2AGLA 4J87A 2JKXA 2BKLA 2YMUA 4PC0A 2QXVA 4YVDA 4NSXA 2H6QA 4JD2C 4WK4A 1UOOA 4E5ZB 1Q47A 1XIPA 3C75H 5FKTA 3ZDZA 2EICA 3L4OD 2Z2NA 2VZ3A 1GOTB 2UZYB 2BBKH 3SN6B 5FKSA 3ZDXA 3SMRA 4HDJA 1MG2A 1VE7A 3ZE1A 3K72A 3PE7A 2P9IC 5EM2B 4GZ8A 4MMYA 4LG9A 3O4GA 2B5NA 2AGXA 1K32A 2HKRA 4J8GA 5M5VA 1M1XA 4GMBA 5GMKn 2OIZA 3BG0A 3FRXA 3SWSD 3IULA 4A11B 5CYKB 3IJEA 4BUJC 4G55A 4QT8A 3KCIA 2CNXA 2XU7A 3MZLA 4N14A 3NIDA 1VZ3A 4J84A 2AGZA 4CZYA 4FHLA 3DDUA 3EMHA 5I5IA 3OL2A 2EIEA 4LG8A 2HJBA 4J82A 5B4WA 2XL2A 4QL1A 2VDPA 3U4YA 5HE2B 4CY3A 5EMKB 3GC3B 3RRMC 3JRPA 4MMZA 5FKRA 4PBZA 2CE9A 3F3FA 3IUNA 5JWZA 2P9NC 3QHYB 3O4IA 4KFMB 4Y5RD 3PVWB 4O2WA 1ERJA 1MDAH 2I3SA 4A08A 3PXTD 5I5JA 4FAVD 1RI6A 5HE0B 4GQ2P 3JZNA 1GG2B 4Z8LA 2WQ8A 3L4MD 1H2ZA 2AGWA 3AFCA 4O9DA 3ZE0A 3J80g 4RE6A 1UTCA 3BG1A 3MKQA 5FA5B 4J0XA 3RFGA 3V5WB 3VH0A 1E8NA 3OKYB 2XZGA 4AMYA 3FCSA 3SLED 4CZVA 4J81A 2QC5A 2YNPA 1NR0A 4X63B 3AL9A 3QI0A 4L1MA 4IRZA 4FA5D 2H14A 4QQEA 5KDOB 4FWWA 3T3MA 4BCCA 5IGQA 3ZDYA 3ZE2A 4O3UB 3EI4B 4ERZA 4A09B 4X3EA 4JSNC 2OK4A 5E6RA 4BP8A 4EWRA 3GD1I 2EBSA 1FWXA 2IAAA 1QFSA 5EARA 4CY2A 4DNUA 4X60B 2Z2OA 5M61A 4NBMA 2P9UC 4L9OA 3EWEA 3IURA 2B4EA 2BCJB 4BP9A 1TYEA 3BWSA 4QRJA 2CN2A 4E5ZA 3UVOA 1OLZA 2EIDA 2XYIA 3PVUB 3VA6A 2H9PA 4PXWA 2H68A 5HE3B 3UVLA 2PM7B 1PGUA 1N6DA 2I0RA 3UR4A 1PI6A 2P9LC 4AN1A 5EM2A 2I0TA 2VDOA 1XHMA 4R7AB 5IC7A 5C86A 2AGYA 3K27A 3ODTA 3CIKB 1U2VC 5C9ZB 2I0SA 3RLMD 5THAA 5EAPA 4A11A 3AL8B 4Z7QA 5CYKA 1C9LA 2YNNA 3PXWD 3SFZA 4A0AB 2B5MA 2HJ4A 4IMMA 1U8CA 2IUVA 1TBGA 3MUOA 3DXMC 3I2NA 5M5UA 5C92A 3K6SA 2IWFA 2IUPA 1H2WA 5EALA 3SJLD 3MZKA 2VDQA 3OTTA 4JHPC 4U7AA 5GXIA 3JZHA 1P22A 4DNWA 4NAAA 4A2MA 5HQGA 5AFU3 2G99A 3IVMA 1C9IA 3K26A 5FKQA 4CI3A 4PSXB 2VC2A 3F3PA 4G1EA 2H9MA 1GOGA 3NVNA 5IT9g 3O4JA 2YB8B 3IJ0A 1K8KC 5E6UA 3I7NA 1E8MA 2VDNA 3SHFA 3ORVD 2Z2PA 4UM9A 1JTDB 4A7JA 4D9SA 3OKTA 1GXRA 2CO0A 2W18A 4GM8A 1JJUB 3DM0A 1I2MB 1JOFA 2H6NA 5CXCB 2G9AA 1PEVA 4K3ID 3OF7A 1XKSA 3W15A 4ZOZA 3I8CA 3EG6A 5TEEA 4FA4D 3UKUC 5GXHA 4FB1D 3PSCB 3OKYA 3UVKA 2OVRB 4H5JA 4A0BB 4BL0A 1K3IA 2XE4A 4JXMA 4G56B 4ZOXA 3V9FA 5FLXg 5M5TA 4LGNA 3MUNA 4PSWB 5K1CC 2H9LA 4NENA 2J56H 2OK6A 1GOHA 4GQ1A 4O45A 3PSLA 2AH1A 2OVPB 3SCYA 1JV2A 4E54B 4RE5A 2GC4A 3EI4A 4J77A 4A09A 4L3HD 1B9YA 1SQJA 1NEXB 3EI3B 3NIGA 2XDWA 3GREA 5IJ7E 4UM8A 4JHNA 3I7KA 1A0RB 3C99A 4CI1A 5HYNB 3RMZD 4FA1D 4DNVA 4CI2A 4XYIA 3IUMA 5FFOA 4ERQA 4K3JB 3JROA 4J86A 3V7DB 4ZOYA 3CFVA 4I79A 2VDMA 2VZ1A 3IIWA 1O6GA 1UOPA 2HXCA 5FXYA 3EU7A 4O1QD 2H6KA 4WK2A 3F3GA 5CXBB 1T2XA 3I7PA 5H14A 2B5LA 1E5TA 1JMXB 1MG3A 2P9KC 3AL8A 4Y7RA 4X61B 3MVDK 1QFMA 3EQ7A 3IKOA 3O4HA 3JAMg 3EI2B 2H9NA 2PM9B 3ULEC 3HFQA 1TYQC 3I8EA 3SBPA 4O3TB 3DWLC
chains in the Genus database with same CATH topology
2TRCB 2Q7QA 3SBRA 1S4UX 4AOWA 3SVWD 5I5MA 3EI1B 4D6VA 5TF2A 1QNIA 2I3TA 5C2WB 3I7LA 5SXMA 3B7FA 2CO0C 5A2Qg 2XL3A 4IA9A 2H13A 4D0KA 2H47A 3CFSB 3C9CA 5H17A 3PXSD 5EMMB 3AH8B 3OW8A 4TZ4A 3IJ1A 4CI8A 5EMJB 4A2LA 3GFCA 2HYEA 1YFQA 3JZGA 2P9SC 3JPXA 5CXCA 4J8BA 2H3XA 4ES0A 2GNQA 4H5IA 5HE1B 2OVQB 5EAMA 3NVQA 4A0BA 2CE8A 4OWRA 4L1QD 4BH6A 2YBAA 4CZXA 2HESX 4GGDA 3IIYA 3DSMA 5AJAA 3C5MA 3IJCA 4UI9R 5C2VB 4E54A 4U1EI 3N0EA 1L0QA 3DXKC 2OJYA 3KRXB 3UVNA 3EI3A 4MK0B 1B9XA 1SQ9A 5AMSA 2IURA 5FQDA 2O9KA 3I89A 4J79A 1N6EA 5K19A 4ZOVA 3RSEC 2YNOA 3MMYA 4J73A 4GM3A 4GGAA 1VYHC 2PM6B 4CC9A 3OL2B 4L3GD 3MKSB 1GP2B 3UKRC 2MTAH 3FGBA 5CXBA 4CY1A 3JB9L 3ZWLB 4GM9A 4CY5A 4FAND 4J0WA 4GGCA 3OKWA 4JSVC 3NVXA 4JT5C 2IUQA 1R5MA 5H1MA 3EI2A 2PM9A 3VGZA 4PBYA 2AH0A 2HKMA 3SBQA 4A08B 2AQ5A 4FA9D 3RFHA 4JSXC 3UVMA 3EI1A 4PNKB 2P9PC 5GSAA 4ERYA 4ZN4A 4JT6C 3I7OA 4A0AA 3MXXA 4J78A 5IJ8E 3SXTD 3I7HA 4XYHA 4OZUA 2PBIB 3N0DA 2J57G 1N6FA 5IGOA 3RN0D 2GC7A 5EMLB 3FM0A 4JSPC 2CN3A 2UZXB 3P4FA 4GQBB 3E0CA 1OMWB 2IWKA 4AEZA 5TDHB 3A0FA 5TEFA 3KRWB 2J55H 1SHYB 1PBYB 1JMZB 4XEIC 3RN1D 1U4CA 4ESGA 3J81g 2AGLA 4J87A 2YMUA 4PC0A 2QXVA 4YVDA 4NSXA 2H6QA 4JD2C 4E5ZB 1Q47A 1XIPA 3C75H 5FKTA 2Z2NA 3L4OD 1GOTB 2UZYB 2BBKH 3SN6B 5FKSA 3SMRA 4HDJA 1MG2A 3PE7A 2P9IC 5EM2B 4GZ8A 4LG9A 2B5NA 2AGXA 1K32A 2HKRA 4J8GA 4GMBA 5GMKn 2OIZA 3BG0A 3FRXA 3SWSD 4A11B 5CYKB 4BUJC 4QT8A 2CNXA 2XU7A 3MZLA 4N14A 4J84A 4CZYA 2AGZA 4FHLA 3EMHA 5I5IA 3OL2A 4LG8A 2HJBA 4J82A 5B4WA 2XL2A 4QL1A 3U4YA 5HE2B 4CY3A 5EMKB 3RRMC 3JRPA 5FKRA 4PBZA 2CE9A 3F3FA 5JWZA 2P9NC 4KFMB 4Y5RD 3PVWB 1ERJA 1MDAH 2I3SA 4A08A 3PXTD 5I5JA 4FAVD 1RI6A 5HE0B 4GQ2P 3JZNA 1GG2B 4Z8LA 3L4MD 2AGWA 4O9DA 3AFCA 3J80g 3BG1A 3MKQA 5FA5B 4J0XA 3RFGA 3V5WB 3VH0A 3OKYB 3SLED 4CZVA 4J81A 2QC5A 2YNPA 1NR0A 4X63B 3AL9A 4FA5D 2H14A 4QQEA 5KDOB 4FWWA 5IGQA 4O3UB 3EI4B 4ERZA 4A09B 4X3EA 4JSNC 2OK4A 4EWRA 2EBSA 1FWXA 2IAAA 5EARA 4CY2A 4X60B 2Z2OA 2P9UC 4L9OA 3EWEA 2B4EA 2BCJB 3BWSA 4QRJA 2CN2A 4E5ZA 3UVOA 1OLZA 2XYIA 3PVUB 3VA6A 2H9PA 4PXWA 2H68A 5HE3B 3UVLA 2PM7B 1PGUA 1N6DA 2I0RA 3UR4A 1PI6A 2P9LC 5EM2A 2I0TA 1XHMA 4R7AB 5IC7A 2AGYA 3K27A 3ODTA 3CIKB 1U2VC 5C9ZB 2I0SA 3RLMD 5THAA 5EAPA 4A11A 3AL8B 5CYKA 2YNNA 3PXWD 3SFZA 4A0AB 2B5MA 2HJ4A 4IMMA 2IUVA 1TBGA 3DXMC 3I2NA 2IWFA 2IUPA 5EALA 3SJLD 3MZKA 5GXIA 3OTTA 4U7AA 3JZHA 1P22A 4A2MA 5HQGA 5AFU3 2G99A 5FKQA 3K26A 4CI3A 4PSXB 3F3PA 2H9MA 3NVNA 5IT9g 2YB8B 3IJ0A 1K8KC 3I7NA 3SHFA 3ORVD 2Z2PA 4A7JA 3OKTA 1GXRA 2CO0A 2W18A 4GM8A 1JJUB 3DM0A 5CXCB 1JOFA 2H6NA 2G9AA 1PEVA 4K3ID 1XKSA 3W15A 4ZOZA 3I8CA 3EG6A 5TEEA 4FA4D 3UKUC 5GXHA 4FB1D 3PSCB 3OKYA 3UVKA 2OVRB 4H5JA 4A0BB 4BL0A 4JXMA 4G56B 4ZOXA 3V9FA 5FLXg 4LGNA 4PSWB 5K1CC 2H9LA 2J56H 2OK6A 4GQ1A 4O45A 3SCYA 3PSLA 2AH1A 2OVPB 4E54B 2GC4A 3EI4A 4J77A 4A09A 4L3HD 1B9YA 1SQJA 1NEXB 3EI3B 3GREA 5IJ7E 3I7KA 1A0RB 3C99A 4CI1A 5HYNB 3RMZD 4FA1D 4CI2A 4XYIA 4ERQA 4K3JB 3JROA 4J86A 3V7DB 4ZOYA 3CFVA 4I79A 3IIWA 2HXCA 5FXYA 3EU7A 4O1QD 2H6KA 3F3GA 5CXBB 3I7PA 5H14A 2B5LA 1JMXB 1MG3A 2P9KC 3AL8A 4Y7RA 4X61B 3IKOA 3JAMg 3EI2B 2H9NA 2PM9B 3ULEC 3HFQA 1TYQC 3I8EA 3SBPA 4O3TB 3DWLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TRC B;  2Q7Q A;  3SBR A;  1S4U X;  4AOW A;  3SVW D;  5I5M A;  3EI1 B;  4D6V A;  5TF2 A;  1QNI A;  2I3T A;  5C2W B;  3I7L A;  5SXM A;  3B7F A;  2CO0 C;  5A2Q g;  2XL3 A;  4IA9 A;  2H13 A;  4D0K A;  2H47 A;  3CFS B;  3C9C A;  5H17 A;  3PXS D;  5EMM B;  3AH8 B;  3OW8 A;  4TZ4 A;  3IJ1 A;  4CI8 A;  5EMJ B;  4A2L A;  3GFC A;  2HYE A;  1YFQ A;  3JZG A;  2P9S C;  3JPX A;  5CXC A;  4J8B A;  2H3X A;  4ES0 A;  2GNQ A;  4H5I A;  5HE1 B;  2OVQ B;  5EAM A;  3NVQ A;  4A0B A;  2CE8 A;  4OWR A;  4L1Q D;  4BH6 A;  2YBA A;  4CZX A;  2HES X;  4GGD A;  3IIY A;  3DSM A;  5AJA A;  3C5M A;  3IJC A;  4UI9 R;  5C2V B;  4E54 A;  4U1E I;  3N0E A;  1L0Q A;  3DXK C;  2OJY A;  3KRX B;  3UVN A;  3EI3 A;  4MK0 B;  1B9X A;  1SQ9 A;  5AMS A;  2IUR A;  5FQD A;  2O9K A;  3I89 A;  4J79 A;  1N6E A;  5K19 A;  4ZOV A;  3RSE C;  2YNO A;  3MMY A;  4J73 A;  4GM3 A;  4GGA A;  1VYH C;  2PM6 B;  4CC9 A;  3OL2 B;  4L3G D;  3MKS B;  1GP2 B;  3UKR C;  2MTA H;  3FGB A;  5CXB A;  4CY1 A;  3JB9 L;  3ZWL B;  4GM9 A;  4CY5 A;  4FAN D;  4J0W A;  4GGC A;  3OKW A;  4JSV C;  3NVX A;  4JT5 C;  2IUQ A;  1R5M A;  5H1M A;  3EI2 A;  2PM9 A;  3VGZ A;  4PBY A;  2AH0 A;  2HKM A;  3SBQ A;  4A08 B;  2AQ5 A;  4FA9 D;  3RFH A;  4JSX C;  3UVM A;  3EI1 A;  4PNK B;  2P9P C;  5GSA A;  4ERY A;  4ZN4 A;  4JT6 C;  3I7O A;  4A0A A;  3MXX A;  4J78 A;  5IJ8 E;  3SXT D;  3I7H A;  4XYH A;  4OZU A;  2PBI B;  3N0D A;  2J57 G;  1N6F A;  5IGO A;  3RN0 D;  2GC7 A;  5EML B;  3FM0 A;  4JSP C;  2CN3 A;  2UZX B;  3P4F A;  4GQB B;  3E0C A;  1OMW B;  2IWK A;  4AEZ A;  5TDH B;  3A0F A;  5TEF A;  3KRW B;  2J55 H;  1SHY B;  1PBY B;  1JMZ B;  4XEI C;  3RN1 D;  1U4C A;  4ESG A;  3J81 g;  2AGL A;  4J87 A;  2YMU A;  4PC0 A;  2QXV A;  4YVD A;  4NSX A;  2H6Q A;  4JD2 C;  4E5Z B;  1Q47 A;  1XIP A;  3C75 H;  5FKT A;  2Z2N A;  3L4O D;  1GOT B;  2UZY B;  2BBK H;  3SN6 B;  5FKS A;  3SMR A;  4HDJ A;  1MG2 A;  3PE7 A;  2P9I C;  5EM2 B;  4GZ8 A;  4LG9 A;  2B5N A;  2AGX A;  1K32 A;  2HKR A;  4J8G A;  4GMB A;  5GMK n;  2OIZ A;  3BG0 A;  3FRX A;  3SWS D;  4A11 B;  5CYK B;  4BUJ C;  4QT8 A;  2CNX A;  2XU7 A;  3MZL A;  4N14 A;  4J84 A;  4CZY A;  2AGZ A;  4FHL A;  3EMH A;  5I5I A;  3OL2 A;  4LG8 A;  2HJB A;  4J82 A;  5B4W A;  2XL2 A;  4QL1 A;  3U4Y A;  5HE2 B;  4CY3 A;  5EMK B;  3RRM C;  3JRP A;  5FKR A;  4PBZ A;  2CE9 A;  3F3F A;  5JWZ A;  2P9N C;  4KFM B;  4Y5R D;  3PVW B;  1ERJ A;  1MDA H;  2I3S A;  4A08 A;  3PXT D;  5I5J A;  4FAV D;  1RI6 A;  5HE0 B;  4GQ2 P;  3JZN A;  1GG2 B;  4Z8L A;  3L4M D;  2AGW A;  4O9D A;  3AFC A;  3J80 g;  3BG1 A;  3MKQ A;  5FA5 B;  4J0X A;  3RFG A;  3V5W B;  3VH0 A;  3OKY B;  3SLE D;  4CZV A;  4J81 A;  2QC5 A;  2YNP A;  1NR0 A;  4X63 B;  3AL9 A;  4FA5 D;  2H14 A;  4QQE A;  5KDO B;  4FWW A;  5IGQ A;  4O3U B;  3EI4 B;  4ERZ A;  4A09 B;  4X3E A;  4JSN C;  2OK4 A;  4EWR A;  2EBS A;  1FWX A;  2IAA A;  5EAR A;  4CY2 A;  4X60 B;  2Z2O A;  2P9U C;  4L9O A;  3EWE A;  2B4E A;  2BCJ B;  3BWS A;  4QRJ A;  2CN2 A;  4E5Z A;  3UVO A;  1OLZ A;  2XYI A;  3PVU B;  3VA6 A;  2H9P A;  4PXW A;  2H68 A;  5HE3 B;  3UVL A;  2PM7 B;  1PGU A;  1N6D A;  2I0R A;  3UR4 A;  1PI6 A;  2P9L C;  5EM2 A;  2I0T A;  1XHM A;  4R7A B;  5IC7 A;  2AGY A;  3K27 A;  3ODT A;  3CIK B;  1U2V C;  5C9Z B;  2I0S A;  3RLM D;  5THA A;  5EAP A;  4A11 A;  3AL8 B;  5CYK A;  2YNN A;  3PXW D;  3SFZ A;  4A0A B;  2B5M A;  2HJ4 A;  4IMM A;  2IUV A;  1TBG A;  3DXM C;  3I2N A;  2IWF A;  2IUP A;  5EAL A;  3SJL D;  3MZK A;  5GXI A;  3OTT A;  4U7A A;  3JZH A;  1P22 A;  4A2M A;  5HQG A;  5AFU 3;  2G99 A;  5FKQ A;  3K26 A;  4CI3 A;  4PSX B;  3F3P A;  2H9M A;  3NVN A;  5IT9 g;  2YB8 B;  3IJ0 A;  1K8K C;  3I7N A;  3SHF A;  3ORV D;  2Z2P A;  4A7J A;  3OKT A;  1GXR A;  2CO0 A;  2W18 A;  4GM8 A;  1JJU B;  3DM0 A;  5CXC B;  1JOF A;  2H6N A;  2G9A A;  1PEV A;  4K3I D;  1XKS A;  3W15 A;  4ZOZ A;  3I8C A;  3EG6 A;  5TEE A;  4FA4 D;  3UKU C;  5GXH A;  4FB1 D;  3PSC B;  3OKY A;  3UVK A;  2OVR B;  4H5J A;  4A0B B;  4BL0 A;  4JXM A;  4G56 B;  4ZOX A;  3V9F A;  5FLX g;  4LGN A;  4PSW B;  5K1C C;  2H9L A;  2J56 H;  2OK6 A;  4GQ1 A;  4O45 A;  3SCY A;  3PSL A;  2AH1 A;  2OVP B;  4E54 B;  2GC4 A;  3EI4 A;  4J77 A;  4A09 A;  4L3H D;  1B9Y A;  1SQJ A;  1NEX B;  3EI3 B;  3GRE A;  5IJ7 E;  3I7K A;  1A0R B;  3C99 A;  4CI1 A;  5HYN B;  3RMZ D;  4FA1 D;  4CI2 A;  4XYI A;  4ERQ A;  4K3J B;  3JRO A;  4J86 A;  3V7D B;  4ZOY A;  3CFV A;  4I79 A;  3IIW A;  2HXC A;  5FXY A;  3EU7 A;  4O1Q D;  2H6K A;  3F3G A;  5CXB B;  3I7P A;  5H14 A;  2B5L A;  1JMX B;  1MG3 A;  2P9K C;  3AL8 A;  4Y7R A;  4X61 B;  3IKO A;  3JAM g;  3EI2 B;  2H9N A;  2PM9 B;  3ULE C;  3HFQ A;  1TYQ C;  3I8E A;  3SBP A;  4O3T B;  3DWL C; 
#chains in the Genus database with same CATH topology
 2TRC B;  2Q7Q A;  3SBR A;  1S4U X;  4AOW A;  3SVW D;  5I5M A;  3EI1 B;  4D6V A;  5TF2 A;  1QNI A;  2I3T A;  4Z7O A;  5C2W B;  3I7L A;  5SXM A;  3B7F A;  2CO0 C;  3FCU A;  5A2Q g;  2XL3 A;  4IA9 A;  2EIB A;  2H13 A;  4D0K A;  2H47 A;  3CFS B;  3C9C A;  5H17 A;  3PXS D;  3EQ9 A;  3T3P A;  5EMM B;  3AH8 B;  3OW8 A;  4TZ4 A;  1VZ2 A;  3IJ1 A;  4CI8 A;  5EMJ B;  5E6S A;  4A2L A;  3GFC A;  2HYE A;  1YFQ A;  3JZG A;  1L5G A;  2P9S C;  3JPX A;  5CXC A;  4J8B A;  2H3X A;  2HU8 A;  4WJK A;  4ES0 A;  3NIF A;  2GNQ A;  4H5I A;  1H2X A;  5HE1 B;  2OVQ B;  5EAM A;  3NVQ A;  4A0B A;  2CE8 A;  4OWR A;  2HU5 A;  4L1Q D;  4BH6 A;  2YBA A;  4CZX A;  2HES X;  3VI4 A;  4GGD A;  3IIY A;  1VE6 A;  3DSM A;  5AJA A;  3C5M A;  2QR5 A;  3EQ8 A;  3IJC A;  4UI9 R;  5C2V B;  4E54 A;  4AX4 A;  4QAM A;  4U1E I;  3N0E A;  1L0Q A;  3DXK C;  2OJY A;  3KRX B;  3UVN A;  3EI3 A;  4MK0 B;  1B9X A;  1O6F A;  1SQ9 A;  2IUR A;  5AMS A;  1H2Y A;  5FQD A;  2O9K A;  3I89 A;  4J79 A;  1N6E A;  4AN0 A;  5K19 A;  4ZOV A;  3RSE C;  2YNO A;  3MMY A;  4J73 A;  4GM3 A;  3IUQ A;  5FFG A;  4GGA A;  1VYH C;  4G1M A;  2PM6 B;  4CC9 A;  3OL2 B;  3VI3 A;  4L3G D;  3MKS B;  4AMZ A;  1A12 A;  1GP2 B;  2VDR A;  3UKR C;  2MTA H;  3FGB A;  5CXB A;  1YR2 A;  1UOQ A;  4CY1 A;  3JB9 L;  3ZWL B;  4GM9 A;  4CY5 A;  4FAN D;  4J0W A;  4GGC A;  3OKW A;  4JSV C;  2VDL A;  3NVX A;  4JT5 C;  4NC4 A;  2IUQ A;  1R5M A;  3IUJ A;  5H1M A;  3EI2 A;  5M5S A;  2PM9 A;  3VGZ A;  4O02 A;  4PBY A;  2AH0 A;  2HKM A;  3SBQ A;  3V4P A;  4A08 B;  2AQ5 A;  4MMX A;  4FA9 D;  3RFH A;  4JSX C;  1BPO A;  4Z7N A;  3UVM A;  3EI1 A;  2HU7 A;  4PNK B;  2P9P C;  5GSA A;  3K71 A;  4ERY A;  4ZN4 A;  4JT6 C;  3I7O A;  4A0A A;  3MXX A;  4J78 A;  5IJ8 E;  3SXT D;  3I7H A;  4WK0 A;  4XYH A;  4OZU A;  2PBI B;  3N0D A;  2J57 G;  1N6F A;  5IGO A;  3RN0 D;  2GC7 A;  5EML B;  3FM0 A;  4JSP C;  2CN3 A;  2UZX B;  2VDK A;  3P4F A;  4GQB B;  3E0C A;  1OMW B;  2QZP A;  2IWK A;  5HDB A;  5TDH B;  4AEZ A;  4BCD A;  3A0F A;  5TEF A;  3V4V A;  3KRW B;  2J55 H;  1SHY B;  1PBY B;  5M5R A;  4BCB A;  1JMZ B;  4XEI C;  3RN1 D;  1U4C A;  1GOF A;  4ESG A;  3J81 g;  2AGL A;  4J87 A;  2JKX A;  2BKL A;  2YMU A;  4PC0 A;  2QXV A;  4YVD A;  4NSX A;  2H6Q A;  4JD2 C;  4WK4 A;  1UOO A;  4E5Z B;  1Q47 A;  1XIP A;  3C75 H;  5FKT A;  3ZDZ A;  2EIC A;  3L4O D;  2Z2N A;  2VZ3 A;  1GOT B;  2UZY B;  2BBK H;  3SN6 B;  5FKS A;  3ZDX A;  3SMR A;  4HDJ A;  1MG2 A;  1VE7 A;  3ZE1 A;  3K72 A;  3PE7 A;  2P9I C;  5EM2 B;  4GZ8 A;  4MMY A;  4LG9 A;  3O4G A;  2B5N A;  2AGX A;  1K32 A;  2HKR A;  4J8G A;  5M5V A;  1M1X A;  4GMB A;  5GMK n;  2OIZ A;  3BG0 A;  3FRX A;  3SWS D;  3IUL A;  4A11 B;  5CYK B;  3IJE A;  4BUJ C;  4G55 A;  4QT8 A;  3KCI A;  2CNX A;  2XU7 A;  3MZL A;  4N14 A;  3NID A;  1VZ3 A;  4J84 A;  2AGZ A;  4CZY A;  4FHL A;  3DDU A;  3EMH A;  5I5I A;  3OL2 A;  2EIE A;  4LG8 A;  2HJB A;  4J82 A;  5B4W A;  2XL2 A;  4QL1 A;  2VDP A;  3U4Y A;  5HE2 B;  4CY3 A;  5EMK B;  3GC3 B;  3RRM C;  3JRP A;  4MMZ A;  5FKR A;  4PBZ A;  2CE9 A;  3F3F A;  3IUN A;  5JWZ A;  2P9N C;  3QHY B;  3O4I A;  4KFM B;  4Y5R D;  3PVW B;  4O2W A;  1ERJ A;  1MDA H;  2I3S A;  4A08 A;  3PXT D;  5I5J A;  4FAV D;  1RI6 A;  5HE0 B;  4GQ2 P;  3JZN A;  1GG2 B;  4Z8L A;  2WQ8 A;  3L4M D;  1H2Z A;  2AGW A;  3AFC A;  4O9D A;  3ZE0 A;  3J80 g;  4RE6 A;  1UTC A;  3BG1 A;  3MKQ A;  5FA5 B;  4J0X A;  3RFG A;  3V5W B;  3VH0 A;  1E8N A;  3OKY B;  2XZG A;  4AMY A;  3FCS A;  3SLE D;  4CZV A;  4J81 A;  2QC5 A;  2YNP A;  1NR0 A;  4X63 B;  3AL9 A;  3QI0 A;  4L1M A;  4IRZ A;  4FA5 D;  2H14 A;  4QQE A;  5KDO B;  4FWW A;  3T3M A;  4BCC A;  5IGQ A;  3ZDY A;  3ZE2 A;  4O3U B;  3EI4 B;  4ERZ A;  4A09 B;  4X3E A;  4JSN C;  2OK4 A;  5E6R A;  4BP8 A;  4EWR A;  3GD1 I;  2EBS A;  1FWX A;  2IAA A;  1QFS A;  5EAR A;  4CY2 A;  4DNU A;  4X60 B;  2Z2O A;  5M61 A;  4NBM A;  2P9U C;  4L9O A;  3EWE A;  3IUR A;  2B4E A;  2BCJ B;  4BP9 A;  1TYE A;  3BWS A;  4QRJ A;  2CN2 A;  4E5Z A;  3UVO A;  1OLZ A;  2EID A;  2XYI A;  3PVU B;  3VA6 A;  2H9P A;  4PXW A;  2H68 A;  5HE3 B;  3UVL A;  2PM7 B;  1PGU A;  1N6D A;  2I0R A;  3UR4 A;  1PI6 A;  2P9L C;  4AN1 A;  5EM2 A;  2I0T A;  2VDO A;  1XHM A;  4R7A B;  5IC7 A;  5C86 A;  2AGY A;  3K27 A;  3ODT A;  3CIK B;  1U2V C;  5C9Z B;  2I0S A;  3RLM D;  5THA A;  5EAP A;  4A11 A;  3AL8 B;  4Z7Q A;  5CYK A;  1C9L A;  2YNN A;  3PXW D;  3SFZ A;  4A0A B;  2B5M A;  2HJ4 A;  4IMM A;  1U8C A;  2IUV A;  1TBG A;  3MUO A;  3DXM C;  3I2N A;  5M5U A;  5C92 A;  3K6S A;  2IWF A;  2IUP A;  1H2W A;  5EAL A;  3SJL D;  3MZK A;  2VDQ A;  3OTT A;  4JHP C;  4U7A A;  5GXI A;  3JZH A;  1P22 A;  4DNW A;  4NAA A;  4A2M A;  5HQG A;  5AFU 3;  2G99 A;  3IVM A;  1C9I A;  3K26 A;  5FKQ A;  4CI3 A;  4PSX B;  2VC2 A;  3F3P A;  4G1E A;  2H9M A;  1GOG A;  3NVN A;  5IT9 g;  3O4J A;  2YB8 B;  3IJ0 A;  1K8K C;  5E6U A;  3I7N A;  1E8M A;  2VDN A;  3SHF A;  3ORV D;  2Z2P A;  4UM9 A;  1JTD B;  4A7J A;  4D9S A;  3OKT A;  1GXR A;  2CO0 A;  2W18 A;  4GM8 A;  1JJU B;  3DM0 A;  1I2M B;  1JOF A;  2H6N A;  5CXC B;  2G9A A;  1PEV A;  4K3I D;  3OF7 A;  1XKS A;  3W15 A;  4ZOZ A;  3I8C A;  3EG6 A;  5TEE A;  4FA4 D;  3UKU C;  5GXH A;  4FB1 D;  3PSC B;  3OKY A;  3UVK A;  2OVR B;  4H5J A;  4A0B B;  4BL0 A;  1K3I A;  2XE4 A;  4JXM A;  4G56 B;  4ZOX A;  3V9F A;  5FLX g;  5M5T A;  4LGN A;  3MUN A;  4PSW B;  5K1C C;  2H9L A;  4NEN A;  2J56 H;  2OK6 A;  1GOH A;  4GQ1 A;  4O45 A;  3PSL A;  2AH1 A;  2OVP B;  3SCY A;  1JV2 A;  4E54 B;  4RE5 A;  2GC4 A;  3EI4 A;  4J77 A;  4A09 A;  4L3H D;  1B9Y A;  1SQJ A;  1NEX B;  3EI3 B;  3NIG A;  2XDW A;  3GRE A;  5IJ7 E;  4UM8 A;  4JHN A;  3I7K A;  1A0R B;  3C99 A;  4CI1 A;  5HYN B;  3RMZ D;  4FA1 D;  4DNV A;  4CI2 A;  4XYI A;  3IUM A;  5FFO A;  4ERQ A;  4K3J B;  3JRO A;  4J86 A;  3V7D B;  4ZOY A;  3CFV A;  4I79 A;  2VDM A;  2VZ1 A;  3IIW A;  1O6G A;  1UOP A;  2HXC A;  5FXY A;  3EU7 A;  4O1Q D;  2H6K A;  4WK2 A;  3F3G A;  5CXB B;  1T2X A;  3I7P A;  5H14 A;  2B5L A;  1E5T A;  1JMX B;  1MG3 A;  2P9K C;  3AL8 A;  4Y7R A;  4X61 B;  3MVD K;  1QFM A;  3EQ7 A;  3IKO A;  3O4H A;  3JAM g;  3EI2 B;  2H9N A;  2PM9 B;  3ULE C;  3HFQ A;  1TYQ C;  3I8E A;  3SBP A;  4O3T B;  3DWL C; 
#chains in the Genus database with same CATH homology
 2TRC B;  2Q7Q A;  3SBR A;  1S4U X;  4AOW A;  3SVW D;  5I5M A;  3EI1 B;  4D6V A;  5TF2 A;  1QNI A;  2I3T A;  5C2W B;  3I7L A;  5SXM A;  3B7F A;  2CO0 C;  5A2Q g;  2XL3 A;  4IA9 A;  2H13 A;  4D0K A;  2H47 A;  3CFS B;  3C9C A;  5H17 A;  3PXS D;  5EMM B;  3AH8 B;  3OW8 A;  4TZ4 A;  3IJ1 A;  4CI8 A;  5EMJ B;  4A2L A;  3GFC A;  2HYE A;  1YFQ A;  3JZG A;  2P9S C;  3JPX A;  5CXC A;  4J8B A;  2H3X A;  4ES0 A;  2GNQ A;  4H5I A;  5HE1 B;  2OVQ B;  5EAM A;  3NVQ A;  4A0B A;  2CE8 A;  4OWR A;  4L1Q D;  4BH6 A;  2YBA A;  4CZX A;  2HES X;  4GGD A;  3IIY A;  3DSM A;  5AJA A;  3C5M A;  3IJC A;  4UI9 R;  5C2V B;  4E54 A;  4U1E I;  3N0E A;  1L0Q A;  3DXK C;  2OJY A;  3KRX B;  3UVN A;  3EI3 A;  4MK0 B;  1B9X A;  1SQ9 A;  5AMS A;  2IUR A;  5FQD A;  2O9K A;  3I89 A;  4J79 A;  1N6E A;  5K19 A;  4ZOV A;  3RSE C;  2YNO A;  3MMY A;  4J73 A;  4GM3 A;  4GGA A;  1VYH C;  2PM6 B;  4CC9 A;  3OL2 B;  4L3G D;  3MKS B;  1GP2 B;  3UKR C;  2MTA H;  3FGB A;  5CXB A;  4CY1 A;  3JB9 L;  3ZWL B;  4GM9 A;  4CY5 A;  4FAN D;  4J0W A;  4GGC A;  3OKW A;  4JSV C;  3NVX A;  4JT5 C;  2IUQ A;  1R5M A;  5H1M A;  3EI2 A;  2PM9 A;  3VGZ A;  4PBY A;  2AH0 A;  2HKM A;  3SBQ A;  4A08 B;  2AQ5 A;  4FA9 D;  3RFH A;  4JSX C;  3UVM A;  3EI1 A;  4PNK B;  2P9P C;  5GSA A;  4ERY A;  4ZN4 A;  4JT6 C;  3I7O A;  4A0A A;  3MXX A;  4J78 A;  5IJ8 E;  3SXT D;  3I7H A;  4XYH A;  4OZU A;  2PBI B;  3N0D A;  2J57 G;  1N6F A;  5IGO A;  3RN0 D;  2GC7 A;  5EML B;  3FM0 A;  4JSP C;  2CN3 A;  2UZX B;  3P4F A;  4GQB B;  3E0C A;  1OMW B;  2IWK A;  4AEZ A;  5TDH B;  3A0F A;  5TEF A;  3KRW B;  2J55 H;  1SHY B;  1PBY B;  1JMZ B;  4XEI C;  3RN1 D;  1U4C A;  4ESG A;  3J81 g;  2AGL A;  4J87 A;  2YMU A;  4PC0 A;  2QXV A;  4YVD A;  4NSX A;  2H6Q A;  4JD2 C;  4E5Z B;  1Q47 A;  1XIP A;  3C75 H;  5FKT A;  2Z2N A;  3L4O D;  1GOT B;  2UZY B;  2BBK H;  3SN6 B;  5FKS A;  3SMR A;  4HDJ A;  1MG2 A;  3PE7 A;  2P9I C;  5EM2 B;  4GZ8 A;  4LG9 A;  2B5N A;  2AGX A;  1K32 A;  2HKR A;  4J8G A;  4GMB A;  5GMK n;  2OIZ A;  3BG0 A;  3FRX A;  3SWS D;  4A11 B;  5CYK B;  4BUJ C;  4QT8 A;  2CNX A;  2XU7 A;  3MZL A;  4N14 A;  4J84 A;  4CZY A;  2AGZ A;  4FHL A;  3EMH A;  5I5I A;  3OL2 A;  4LG8 A;  2HJB A;  4J82 A;  5B4W A;  2XL2 A;  4QL1 A;  3U4Y A;  5HE2 B;  4CY3 A;  5EMK B;  3RRM C;  3JRP A;  5FKR A;  4PBZ A;  2CE9 A;  3F3F A;  5JWZ A;  2P9N C;  4KFM B;  4Y5R D;  3PVW B;  1ERJ A;  1MDA H;  2I3S A;  4A08 A;  3PXT D;  5I5J A;  4FAV D;  1RI6 A;  5HE0 B;  4GQ2 P;  3JZN A;  1GG2 B;  4Z8L A;  3L4M D;  2AGW A;  4O9D A;  3AFC A;  3J80 g;  3BG1 A;  3MKQ A;  5FA5 B;  4J0X A;  3RFG A;  3V5W B;  3VH0 A;  3OKY B;  3SLE D;  4CZV A;  4J81 A;  2QC5 A;  2YNP A;  1NR0 A;  4X63 B;  3AL9 A;  4FA5 D;  2H14 A;  4QQE A;  5KDO B;  4FWW A;  5IGQ A;  4O3U B;  3EI4 B;  4ERZ A;  4A09 B;  4X3E A;  4JSN C;  2OK4 A;  4EWR A;  2EBS A;  1FWX A;  2IAA A;  5EAR A;  4CY2 A;  4X60 B;  2Z2O A;  2P9U C;  4L9O A;  3EWE A;  2B4E A;  2BCJ B;  3BWS A;  4QRJ A;  2CN2 A;  4E5Z A;  3UVO A;  1OLZ A;  2XYI A;  3PVU B;  3VA6 A;  2H9P A;  4PXW A;  2H68 A;  5HE3 B;  3UVL A;  2PM7 B;  1PGU A;  1N6D A;  2I0R A;  3UR4 A;  1PI6 A;  2P9L C;  5EM2 A;  2I0T A;  1XHM A;  4R7A B;  5IC7 A;  2AGY A;  3K27 A;  3ODT A;  3CIK B;  1U2V C;  5C9Z B;  2I0S A;  3RLM D;  5THA A;  5EAP A;  4A11 A;  3AL8 B;  5CYK A;  2YNN A;  3PXW D;  3SFZ A;  4A0A B;  2B5M A;  2HJ4 A;  4IMM A;  2IUV A;  1TBG A;  3DXM C;  3I2N A;  2IWF A;  2IUP A;  5EAL A;  3SJL D;  3MZK A;  5GXI A;  3OTT A;  4U7A A;  3JZH A;  1P22 A;  4A2M A;  5HQG A;  5AFU 3;  2G99 A;  5FKQ A;  3K26 A;  4CI3 A;  4PSX B;  3F3P A;  2H9M A;  3NVN A;  5IT9 g;  2YB8 B;  3IJ0 A;  1K8K C;  3I7N A;  3SHF A;  3ORV D;  2Z2P A;  4A7J A;  3OKT A;  1GXR A;  2CO0 A;  2W18 A;  4GM8 A;  1JJU B;  3DM0 A;  5CXC B;  1JOF A;  2H6N A;  2G9A A;  1PEV A;  4K3I D;  1XKS A;  3W15 A;  4ZOZ A;  3I8C A;  3EG6 A;  5TEE A;  4FA4 D;  3UKU C;  5GXH A;  4FB1 D;  3PSC B;  3OKY A;  3UVK A;  2OVR B;  4H5J A;  4A0B B;  4BL0 A;  4JXM A;  4G56 B;  4ZOX A;  3V9F A;  5FLX g;  4LGN A;  4PSW B;  5K1C C;  2H9L A;  2J56 H;  2OK6 A;  4GQ1 A;  4O45 A;  3SCY A;  3PSL A;  2AH1 A;  2OVP B;  4E54 B;  2GC4 A;  3EI4 A;  4J77 A;  4A09 A;  4L3H D;  1B9Y A;  1SQJ A;  1NEX B;  3EI3 B;  3GRE A;  5IJ7 E;  3I7K A;  1A0R B;  3C99 A;  4CI1 A;  5HYN B;  3RMZ D;  4FA1 D;  4CI2 A;  4XYI A;  4ERQ A;  4K3J B;  3JRO A;  4J86 A;  3V7D B;  4ZOY A;  3CFV A;  4I79 A;  3IIW A;  2HXC A;  5FXY A;  3EU7 A;  4O1Q D;  2H6K A;  3F3G A;  5CXB B;  3I7P A;  5H14 A;  2B5L A;  1JMX B;  1MG3 A;  2P9K C;  3AL8 A;  4Y7R A;  4X61 B;  3IKO A;  3JAM g;  3EI2 B;  2H9N A;  2PM9 B;  3ULE C;  3HFQ A;  1TYQ C;  3I8E A;  3SBP A;  4O3T B;  3DWL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...