4JTKA

Crystal structure of r117q mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
277
structure length
252
Chain Sequence
b'MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLAQQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQTRGRRAQALDLALAGMATRLAGLFLELHLLEDFLIRIKALDDLIKSQPIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Examining the Role of Intersubunit Contacts in Catalysis by 3-Deoxy-d-manno-octulosonate 8-Phosphate Synthase.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 87
structure length 252
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtkA00
1KV5A 1K3UA 5EYWA 1JCLA 1HO4A 4CLMA 1IXOA 3ZWTA 1JCNA 1JCYA 5EL1A 3UY7A 1F05A 3CWNA 4PFMA 3DZ1A 4IQLA 1XM3A 1G69A 1M6JA 3DHDA 1UB3A 3A22A 1SZEA 4DELA 2QDHA 4ICNA 1ZY9A 4LRSA 1W31A 3FOKA 1H7PA 3UWZA 3DBPA 4LV9A 1BKSA 3LTSA 3CLMA 1ZFJA 4JTJA 1E51A 4Q4KA 5AB3A 4PL2A 4HNUA 1OABA 4LS0A 2VENA 3NGJA 3R5EA 5AOUA 2ISVA 4RKAA 5CPMA 4TU1A 2H6RA 3LV5A 1VCFA 2NUWA 1I2RA 1YDVA 4WOZA 4O8RA 1TRDA 4KFOA 3DKLA 3BLEA 3W2JA 3W71A 3QYQA 4JX4A 2OX1A 4NVTA 2TSYA 4ADUA 1FX6A 3W7KA 2PE4A 1SU5A 1Z41A 3M5ZA 3WK3A 2G97A 3C61A 3W7CA 4KFNA 4LS1A 3R12A 1ZCOA 4MYXA 3EKZA 3P8IA 4WUIA 5TBOA 3USBA 1Q6OA 3IGXA 1QNVA 2Y62A 2E6DA 3GDKA 3W88A 2B7PA 4A3UA 3N9SA 5DCBA 3PR2A 5AC6A 1CI1A 1TCDA 3KAOA 3P5YA 3SFKA 3F1QA 2GVJA 3QPYA 1SSGA 2ZRUA 2QCCA 1FWRA 3EWZA 2A0NA 2Q3RA 4OWGA 4MY1A 3BPWA 4BFAA 4O18A 1M7OA 4OU1A 1YXDA 4XZ9A 2V30A 4JYFA 2Y7FA 4O1CA 1XI3A 3O6YX 3KVMA 1DV7A 1DORA 5F4SA 4GUHA 3CEPA 1T96A 3IV3A 4LY8A 4K8EA 5I3IA 4O1BA 4U4MA 1G6CA 3W1UA 1KM1A 4Z1AA 3TUUA 4M19A 3TW6A 1GTEA 4JIPA 3NQFA 4ZQNA 5K4ZA 3NQEA 4MZ1A 3TV8A 2RDTA 2P10A 4JS3A 3W2NA 2DZVA 4UNKA 5AHMA 3G22A 4WY0F 4XBKA 1AL8A 3DFPA 3PC0A 3QW4B 3M9YA 2NX9A 1W5QA 2YZRA 2Y85A 4BF9A 1OYAA 3DH7A 3LCFA 4RK8A 3TJXA 2E5BA 4MFDA 4IGHA 3W7GA 4HHPA 2ISWA 4OQVA 2Y88A 2NV2A 2E09A 2H3BA 4JTUA 1GPWA 3RLVA 2VC6A 2PRLA 5F2LA 3CEUA 3NM3A 3IGUA 4M6VA 2CW6A 4IXXA 2RFGA 4A2SA 1UASA 2ZCGA 1UCWA 4P2VA 5F1UA 2DZUA 1R2RA 5TQLA 3N9RA 2QCFA 1FCVA 3LCXA 2DJXA 3LHZA 2DZWA 4TX9A 4LW7A 1TV5A 3T40A 4MIMA 3RF9A 1SSDA 1MXSA 4ORMA 3TXVA 2ZRWA 4BI6A 4E38A 2D73A 3P60A 4IMDA 3LGEA 5CPLA 1LOSA 4O4WA 4K36A 3VE7A 3B05A 1ZALA 2AAMA 1M7PA 1FDYA 3TSBA 4O0KA 5BOOA 3O05A 3PUEA 3G0SA 1SFLA 4XQ6A 5J5DA 4EOUA 5EKYA 1LRTA 3G3DA 4MJZA 3G1SA 3S9YA 3TH6A 3HGOA 1FBAA 4JTTA 4RX0A 1KFCA 3BG3A 2EGZA 1GEQA 5CPNA 5D03A 1Q6QA 2NXIA 3GYEA 1EB3A 1EWEA 1ICSA 3W1NA 3HOJA 1TV7A 1RV8A 4DBEA 4LT9A 5AYYA 3SECA 1K7EA 1ICQA 1JCMP 1W3NA 4ORIA 3S5OA 2VFIA 1H7XA 4EIVA 5I3FA 4LVAA 3HGRA 3JS3A 4TMCA 1LLWA 2Z6IA 5I3JA 2RDWA 2V81A 4GC4A 4XKYB 2QUUA 1KFBA 3CPRA 3B06A 1R2TA 5J5RA 4QISA 3QEZA 2CLKA 4IOTA 3DFNA 2QCDA 1O95A 3HG2A 1ONRA 5KITA 2WNZA 3W7IA 3B8DA 3HPXA 4GFSA 2GOUA 5D32A 4PODA 1KLZA 1V7YA 4NJHA 1RZMA 3GB6A 3W07A 4E2BA 5DN1A 4YXGA 2J9ZA 1HL2A 2QDGA 2A7NA 3UZ5A 4JR5A 2RKXA 3O07A 4OHQA 2BLEA 3OHIA 1X1OA 3EWYA 1DJQA 4FX8A 1PHWA 2E6AA 1VCVA 2NWRA 3W86A 5G1TA 2NXHA 4DXVA 3TMLA 4FNUA 1W3TA 3NG3A 2VKZG 3W22A 1GWJA 2NLIA 3SJ3A 3MWAA 4UFJA 4K8HA 2X1UA 3EWUA 4GXMA 3C2VA 4LNYA 3STGA 4OT7A 1TB3A 2YYUA 1KTBA 1PIIA 4IMCA 3FA5A 1OG0A 5DLCA 4UXDA 5CZJA 4LV4A 3OVRA 3ATZA 2WOQA 2CLFA 3E49A 2H3DA 1H7NA 4UMCA 3L68A 3EX6A 2V5LA 1TJRA 4I7WA 2DZSA 3N2MA 3TA6A 3KX6A 5G2HA 1B9BA 5BRBA 1OFRA 2ALDA 3RLUA 4ADTA 3NQ7A 3PUOA 5EPDA 1TPUA 4AF0A 2QJIA 1DL3A 1H51A 1JRCA 1XKYA 4ADSA 4XTDA 5T26A 4K37A 3TCEA 3UWQA 1XUZA 3W7EA 1AW5A 1GTHA 1I2NA 1BTMA 2ZFAA 4X22A 3W75A 1H62A 3W1QA 4XTIA 1X7FA 3MHFA 5ABTA 5LNWA 1TSIA 2YFNA 1GJPA 4Z0JA 1QFEA 4LC6A 2O7QA 1RVGA 3QQ0A 1WBHA 5FF7A 4O1DA 5E93A 1OHLA 3PBYA 1GYLA 4BK9A 5C55A 3HPSA 2OT1A 2ZTJA 1H50A 1VRDA 1EPXA 4ZQPA 1VHNA 5DCDA 4CCEA 1P1XA 3DFQA 3P80A 3MUXA 5AYZA 2J9YA 1C9DA 3WJXA 1Q3NA 1QCWA 1G4TA 3U8GA 1O4UA 4Y8FA 3GNDA 4JTHA 2NUYA 1LBMA 1SPQA 5D38A 2F7FA 4CCDA 5G1YA 4Z1CA 3LCWA 2PURA 1W37A 2G5WA 3UQNA 3PS7A 4I7UA 3DXIA 1ZENA 1BWLA 2FLIA 3PB0A 4DF1A 3NQMA 1WYIA 1SUXA 3CC1A 1XUUA 1I2QA 5H91A 3V1PA 4K7YA 5CG7A 3H53A 3W2MA 4WJEA 2I9EA 4QSHA 3TNOA 2YDAA 3R8RA 2FPTA 1ZAHA 1TTIA 2Y7DA 5CZTA 3HGSA 1WV2A 4M6PA 2YW3A 3O8AA 5HUPA 3DHFA 3QC3A 4AWUA 1S5VA 4Y90A 1H63A 3L0KA 2V8ZA 2OCZA 2WJZA 1N7KA 2PC4A 2ABBA 4X3ZA 5BMWA 4JX5A 4Q32A 3W1XA 3NQ8A 1YDOA 2ZZ1A 1RQBA 3QMSA 3I68A 4NU7A 3DI1A 3VFLA 3TQVA 4S2BA 3S5YA 4LVBA 2ZA2A 4FX7A 3T7VA 4UTMA 2B4GA 1QR7A 4N02A 4NUWA 3LB0A 5LNRA 2V2CA 3QMRA 5HMSA 3SIZA 1A5BA 3TE9A 1T0OA 5C6MA 1GVRA 4K39A 3BO9A 3MBFA 4RCXA 1S5WA 2A2IA 3UPBA 3C2EA 4GUIA 3TFCA 4O53A 3KHJA 5DXYA 3CB8A 2BWGA 4ALDA 4FNSA 2H8XA 3PG8A 3Q58A 3SI9A 3B03A 4QM1A 4L4LA 1XBVA 3G0XA 4N9CA 5FF4A 1D3GA 5G5IA 2YFOA 3MI2A 4UR8A 1KBIA 3A5FA 2P0OA 1DOSA 2A1YA 5F2MA 1F6KA 2PRMA 5BNKA 4WXZA 3W1LA 4JTKA 4X2RA 3NYZA 5LNUA 1FCQA 1N55A 4POCA 3LOTA 3MI6A 3T4CA 4FIQA 4IUOA 4P61A 4JNMA 3DFOA 3KOFA 2ZZ4A 1OFBA 4H3DA 4AMAA 4JYDA 1MEHA 1CX9A 2B7QA 2QKFA 2Q8ZA 5F2IA 3N2XA 5G4EA 4MY9A 3PSWA 1QO2A 4N6EA 4QIUA 1ME9A 4LS2A 1H61A 2A5HA 2RDUA 2V9DA 5HWNA 1DQWA 1B3OA 2Z0IA 4O52A 5CSSA 3KRUA 2W79A 3Q2DA 2V5BA 3M1ZA 2GJLA 3NZ1A 2YW4A 4EWND 5C54A 5D02A 2BSLA 4QQ3A 3OBKA 2ZA1A 1KW1A 2QUTA 1TIMA 3T55A 2ATMA 1SW3A 1IIGA 3LI1A 1YYAA 4FF7A 2AGKA 1QOQA 2ZTKA 3CWOX 3LCIA 3PSVA 2FJKA 3NAVA 4MVAA 2JKEA 3O6DA 1EUAA 1I4NA 2DU2A 5L9FA 4WY0A 1KTCA 2G95A 1Z48A 2WNQA 2VEIA 2VFHA 3LX9A 4HT3A 1DHPA 3EX1A 4NZJA 3BGGA 1KM6A 5CKSA 4FNPA 4UNLA 3VNDA 1YTEA 1XBXA 3ZFHA 3P74A 3W1RA 3W87A 4GUJA 3G1XA 3V75A 1YTDA 2JBMA 1NF7A 4G1KA 3N14A 3WFAA 1EUNA 3HJZA 2RHGA 3QJAA 2HS6A 3C3NA 1T8XA 2QJHA 3NL6A 3UYCA 3S8HA 1FWSA 1OYCA 1IXNA 4CNPA 2QCLA 3G8RA 4CQ8A 4M6QA 3QRHA 1OF8A 4UTLA 1OK6A 1QAPA 1JQVA 2C19A 4JDYA 4NNCA 4K7VA 3O16A 1O94A 3EWBX 3KFTA 2EF9A 2WSRA 1SQ7A 3W7LA 1SO3A 1JUEA 1KFJA 4N2YA 1EWDA 4BWLC 2VOMA 3G18A 4HNNA 1C29A 2XFWA 4DPQA 5EY5A 1Z44A 3GKFA 1UJPA 3W1TA 4JICA 3DENA 2GVGA 3GAYA 3BLFA 4DPPA 1PS9A 4UTWA 3P84A 3NNTA 1ME8A 1Q6RA 2V0TA 1QPQA 2BTMA 5AFDA 1LCOA 4DQWA 2YGYA 3S1WA 1LBFA 1FY6A 1R2SA 3NQDA 4RZ5A 4R33A 2A7PA 1LZOA 3A24A 1CW2A 4Q33A 3MYPA 3GXPA 1HTIA 1ZAJA 3KRSA 3OVPA 2CZDA 4LUIA 4NQ1A 1SW7A 2ISSA 4UTHA 1WX0A 2WQPA 2NX3A 2RH9A 2ZZ3A 3LCLA 3PF3A 4Y6GA 1H7WA 2XN2A 4S2CA 2C3ZA 1QPNA 5K2ZA 1VH7A 2Z1BA 3I65A 1JCXA 2QJGA 1WAUA 4JTIA 4RLIA 3QH2A 3CQ0A 8TIMA 1FXPA 4WZHA 3YPIA 1K03A 5DBTA 3GX9A 3NM1A 3DFSA 3FLUA 3FYPA 2H8ZA 1DKWA 2C13A 4JIQA 1OFDA 4IJBA 2GUUA 4IWWA 4R34A 3A9IA 3HIJA 3FKRA 3NPXA 5KZEA 5I3KA 1Q6LA 1X8FA 1W8SA 2GVLA 4CNOA 3PULA 1EP1A 4CNNA 1O5KA 4JDBA 4O28A 2A6NA 1F7BA 3LHVA 3TIMA 1W5NA 1R46A 3B0PA 3RK8A 4CQ9A 3BG5A 1VYPX 4KFPA 6ALDA 2VELA 3LBMA 2YSWA 1XDLA 3CHVA 3ATYA 2QCDB 4GBUA 1OFPA 1MSSA 2ZZ2A 3C6CA 5BMXA 4O15A 4MZ8A 4ZQRA 3W23A 3QSRA 3F4NA 2ZQ0A 2WO5A 3STEA 1OFEA 3FFSA 3RU6A 4IPIA 1FCBA 3PBVA 3BV4A 1AG1O 2YX0A 1G7VA 2VFEA 2VEPA 4KWWA 3DFTA 5DY2A 3HG4A 2A6LA 1L6YA 3LHYA 1ALDA 4FO4A 3MO7A 2VFDA 2HS8A 2JGQA 4L4MA 3BK0A 2E5CA 4BI5A 4NNAA 5LSMA 1YLVA 4JTEA 2CLIA 4E2DA 3U2OA 3UXAA 5CSRA 4WQ6A 3E02A 1ZAIA 3N34A 3G1VA 3W73A 1OJXA 3WK0A 3FJ6A 2ATSA 5K9CA 4JTLA 1W5PA 5HUOA 2EKCA 1OYBA 3W74A 4Y96A 4J9JA 1DQXA 2HSAA 5FEXA 3TXZA 4AHPA 3TU9A 2J88A 4XUGA 1RQHA 3EKLA 3ZWSA 3HMJG 1KFLA 4GUGA 3G1HA 2DJLA 3DKJA 1SFJA 4K38A 3PB2A 4AF0B 3P81A 1X1ZA 2HMCA 2ZZ7A 3W70A 1D3HA 3EX2A 3L67A 1QDSA 2VFGA 3L2IA 4WXYA 4O10A 4AB4A 1TTQA 1VQTA 3FEMA 3C0JA 4UTKA 5KMYA 3P7YA 5D30A 4HPJA 4NJJA 3LERA 2C15A 2BXVA 3MP4A 1PE1A 3O06A 1VCGA 4MOZA 4YCOA 2Q8LA 2C14A 1TPB1 4GNJA 4O19A 1NVMA 3IIPA 4GUFA 3T78A 1NEYA 3WK2A 1GQNA 1QPRA 1PCKA 3PG9A 3BVJA 3W7RA 3W7PA 3TQKA 4PCFA 2WV8A 3T44A 2VFFA 2WKJA 1H7OA 1XC4A 1TTJA 1IXQA 1A50A 3P61A 3IIVA 2QCMA 6TIMA 1J5TA 1F2JA 5HULA 2QEZA 5AN7A 2R14A 3NDOA 3W2LA 1UUOA 3NL5A 4OV4A 3ELFA 3GVGA 3UXDA 1JVNA 2QCNA 1HUVA 2C6QA 3LTYA 1TO3A 3K30A 3PBWA 4MY8A 4Y9AA 2CU0A 4FIRA 2FB3A 3W7OA 4Z0SA 3S1VA 1WDWA 2ZRYA 3IIXA 2DZTA 4O50A 4EF9A 2Z6JA 1TQJA 3L21A 1UBSA 2Y61A 2NXGA 1G4EA 5KTLA 1QMLA 1XCFA 3F03K 4MJMA 1J2WA 1IF2A 2ZBTA 2TPSA 4TR9A 3NPUA 2GQ8A 4PEKA 4PL1A 1H1YA 4WD0A 1TPEA 1K8YA 4OV9A 1RPXA 2QAPA 3OEXA 3STCA 1W56A 3FKKA 2UV8G 1Y0EA 4JEQA 2TYSA 5D33A 3WJSA 1TYGA 1FDZA 5EBUA 5K9XA 2J27A 2DP3A 4DO4A 2CFFA 5IBXA 1MZHA 5LZLA 3BARA 3FIGA 1VYRA 4JYEA 5D2VA 3NQCA 3TSMA 3IRDA 1ML1A 1SZFA 2J6XA 4N4QA 4H4IA 2V2DA 2B7NA 3QFEA 3LV6A 1HO1A 3W72A 1KA9F 1M5WA 2WSYA 1GVQA 3TROA 3UWVA 1K7XA 1TTPA 2X1TA 2VXNA 1F6PA 2QCGA 4QITA 3C8FA 1LOLA 5AYXA 3MP3A 5F4WA 1P0NA 2A85A 2FDSA 3L5MA 3LRMA 1TRIA 1LP6A 3KVKA 2Z2UA 3GIYA 2OMAA 4UR7A 4QJ1A 3UNDA 2QR6A 2R94A 3MHUA 3W2UA 1TJPA 3GR8A 5HJLA 1KM4A 3A23A 2QUVA 4A2RA 5LNSA 1VZWA 2EPHA 4O4VA 4D2JA 1K02A 3G3MA 4PTNA 1QWGA 2KZHA 5LHEA 1QPOA 1EA0A 1A5AA 2VEKA 4UFMA 1V5XA 1S5TA 3TMQA 1XBZA 3EEGA 4O16A 1NFBA 3I6RA 2OZ0A 4UTUA 5BW6A 3PUDA 4UTTA 3W2KA 3LDVA 2LLEA 4OGZA 2A4AA 1OX4A 1BEUA 1LBLA 1RQEA 4AWTA 1TV8A 4AXKA 3FJLA 5K4XA 1XBYA 2B0MA 3SR7A 5D04C 4EVZA 5EMUA 2PRHA 4AHQA 4NX0A 1MO0A 3QF0A 3M16A 2Y89A 2NZLA 1RR2A 3LTPA 1F76A 5G2WA 3TDFA 3IVUA 4A29A 3S42A 3GLCA 3E0IA 1THFD 3KVLA 2O7SA 2GPTA 4DEFA 2FFCA 3NOEA 5SWUA 3MMTA 4O14A 4YLWA 2R8WA 3LLDA 1O5XA 4ZQMA 4GRSA 1B4EA 1VLWA 4JD4A 1G7UA 3MYOA 4WY0B 1GYNA 4I7VA 3MBDA 1A5SA 3HG5A 5K9DA 1YPIA 1L2UA 4LVDA 3W1PA 3ABSA 1KV8A 3M5YA 4LWWA 1KFEA 2YR1A 4FNQA 3CU2A 4UMAA 7TIMA 3HQ1A 4UCGA 2OJPA 4AH7A 3THQA 3RFAA 5D09A 1PVNA 1GG0A 1TPFA 3B04A 3NO5A 3NVTA 4ZVJA 3W6YA 5DXXA 2E1DA 4TO8A 4MYAA 4ONVA 5AC7A 4KWVA 4FXSA 3MI3A 4JXCA 3O1NA 2CLLA 5A5WA 5I3GA 1AW1A 2ZRXA 1YXYA 2E77A 3GNNA 3QZEA 5HR6A 1AK5A 5CPOA 2A21A 4H6KA 4RXFA 1ZJIA 5HINA 3QSTA 4LVGA 1EEPA 3LCHA 2CWNA 3NQ2A 1EIXA 3TKFA 3CIWA 4FNTA 3LXAA 3G1DA 4FNRA 1L6SA 5HR7A 1J4EA 4M5PA 5DCEA 1VHCA 4Z08A 4NJGA 3E96A 4E0CA 4AAJA 1L6WA 3VCRA 2E6FA 3INPA 2E68A 3GZ3A 1BWKA 1ZNNA 2ZA3A 2WNNA 1SZGA 4NX5A 1WBJA 3M41A 4AHOA 3PAJA 1KFKA 5KZMA 3W85A 2TMDA 1SO5A 2QAFA 3PVFA 3G1FA 5KSWA 1PV8A 1LTDA 1LOQA 4PC8A 3JRKA 2X16A 5FEZA 3SY5A 1PCWA 3EXTA 4LRTA 3C2OA 3C2RA 4R53A 2FTPA 1TREA 1I2OA 1KTNA 4NT0A 2YCEA 5F4XA 4CQAA 3F4WA 4IPJA 4JN6A 4O1AA 1ICPA 1GOXA 3MJYA 3CM4A 1P5BA 3B0UX 5FEWA 3S6DA 3MP5A 3IIOA 3BGJA 4UMBA 3UWWA 3O6CA 3M7WA 1JR1A 4RXGA 5F1VA 3CT7A 4NZFA 1W0MA 5DY3A 3S1UA 3S1XA 3FYOA 5D2WA 3GAKA 2C16A 3PY2A 4O54A 4IXHA 1FCUA 3I7QA 3ABOA 3LHWA 3UWUA 2C0AA 4MZYA 3UD6A 4ZMGA 1YTKA 1LM1A 1OK4A 2CLEA 4RZ4A 2I14A 1VR6A 2VEMA 3P5ZA 4W9TA 3O15A 5FESA 2J24A 4M7SA 4O11A 5C5YA 3QPZA 3THAA 1EP3A 3NQVA 1P0KA 3W1AA 3PM6A 3NL2A 4LC8A 3EXSA 3KRZA 1T99A 3A21A 3LXBA 5AHFA 3GR7A 3R89A 5F2GA 2DZXA 2X30A 3TX9A 3AO0A 3LM7A 5AHEA 3L0NA 1LORA 3KVJA 2TRSA 3L0GA 1VJIA 2Y70A 2CZ5A 1KM0A 3P8JA 2DZPA 2FB2A 3IEBA 3LBCA 3QQ1A 4NNBA 3BW3A 3L5LA 4HSNA 4IMFA 4O0ZA 4R7JA 4FXRA 1NF0A 4C1LA 4MKNA 4BR1A 2X1SA 3EXRA 3OIXA 4GJ1A 3SZ8A 2HTMA 3BG9A 4QNEA 2CZFA 1OX6A 5FEPA 1NSJA 3P82A 3ANYA 1H1ZA 4ZQOA 3TJLA 1OFQA 1PL9A 3WJZA 4B5NA 3G24A 2GJNA 4K6AA 5CZSA 3W9ZA 2YYTA 4AEOA 3WJWA 1TPH1 5LGZA 1Q45A 3FS2A 5GVJA 2WPBA 1FWNA 4A21A 5D2YA 3B0VC 3L66A 1YXCA 3N19B 1W54A 4OE7A 1AL7A 1KM5A 5FF0A 2E5DA 1LRNA 1FQ0A 5HNRA 3IVSA 3QM3A 4WOQA 3NZRA 4LVFA 3H54A 5D37A 4UC5A 1F73A 1G4PA 4NJIA 3W3OA 3IGSA 1TPWA 3HO8A 3LHUA 1W3IA 2X2GA 2ABAA 5D05A 4HSOA 4LU0A 4FHAA 2E6YA 3JR2A 4GWEA 3EX3A 2CLOA 3W1MA 4MLRA 1G67A 2CLMA 5L6UA 2NWSA 4BWLA 4N9DA 5KZDA 1OF6A 1XFBA 1VS1A 3VI2A 1TPDA 3HGJA 3TAOA 3R2GA 3M47A 4I9AA 4RJEA 4WX2A 1RD5A 1FDJA 5LHFA 4NJKA 1ME7A 4TMBA 5DELA 1FXQA 1TPC1 4JGDA 1EP2A 4FB7A 1FWWA 3UWYA 1YPFA 2WSQA 5H2ZA 1F74A 4O17A 4DF2A 1KBJA 2Y7EA 3BW4A 4GE8A 4RV8A 1G4SA 1R47A 4UIOA 3GXTA 4IX0A 4Z1BA 1NAL1 3GKAA 1QO5A 1WOBA 2DORA 1B57A 1KM3A 2CLHA 3STFA 5IBXC 2FQIA 4LTSA 1A5CA 1DJNA 4UFIA 1O60A 1IIHA 4LUJA 4NXSA 3VKJA 4Z1DA 3W7JA 5K7JA 1U5JA 3KXQA 3G8EA 1S3HA 3NL3A 4YWIA 1F5ZA 3A5VA 3P62A 1W5OA 4O12A 3M5XA 1LRQA 4UTIA 3EWWA 1KM2A 1K8ZA 1LLZA 2W0UA 2V82A 4A22A 1HFBA 5HWMA 3ABRA 4O13A 1P4CA 1OX5A 1B4KA 4PA8A 3SW6A 1JUBA 3LHTA 3W7DA 1VC4A 1A53A 1I2PA 3P67A 3I7SA 5CGQA 3OG3A 3SGUA 1WQ5A 5G4WA 5DBUA 3LRLA 4XBSA 5AC8A 4XKYA 2C18A 2NX1A 3TFXA 3DI0A 3BW2A 4MLJA 1MEIA 5KINA 3RNDA 5E0KA 5HQEA 2EHHA 2X1RA 1VGAA 1K7FA 4UTTC 4IMEA 3HG3A 2ZRZA 2BX7A 3B4UA 3SGZA 3UZJA 3TW7A 3GK0A 3NQGA 3S5ZA 1K8XA 3TAKA 1L9WA 3QMTA 1WOAA 4UFLA 4C1KA 1GVFA 1XXXA 1JULA 3E9AA 4N9EA 4N9BA 5LGXA 1FWTA 2CZEA 1AW2A 2B7OA 4HIBA 5FF2A 3M43A 3LI0A 4JX6A 3UPWA 4RZ6A 1W5MA 1GT8A 1TQXA 3Q37A 3HBLA 3TQ0A 1H5YA 3TC6A 3W7NA 5LKYA 2FIQA 2Y63A 2Y7GA 3G1YA 2YPIA 3NQAA 4OBTA 4UFHA 1SO4A 4BI7A 3W7MA 4N4PA 2XN0A 3M6YA 1X6UA 3M44A 1EX5A 1VYSX 1YDNA 4MUZA 3W83A 1Z42A 2W6RA 4O57A 4U28A 1VLIA 4JTGA 2ZZ6A 2QCEA 3EWXA 1OFOA 5CZ0A 3RMJA 4IMGA 2BZNA 5U4NA 3OA3A 2ZYFA 3UY8A 1JUKA 1OVDA 1YADA 1OX4B 2FPVA 3GDRA 2YXGA 3G1AA 5AHLA 2NV1A 4QAIA 4ZZ9A 4DBDA 1GVSA 5D2TA 5EA9A 1SZNA 5AHNA 4QNWA 1DBTA 4X9SA 3WK1A 4ZL1A 1GZGA 2XN1A 3O63A 2P1FA 3NXFA 4KKXA 4DO5A 4ML9A 3NA8A 3LLFA 3C56A 2I1OA 3ABQA 3ZS4A 3W7QA 1JJKA 3PWAA 2G96A 1GG1A 4S1FA 5E1QA 3GDTA 2A7RA 5LNVA 2J9XA 3TR2A 1XL9A 1U83A 5HWJA 1TPVA 3S0CA 2QF7A 4JTSA 2R91A 5U7SA 2EAWA 3OVQA 4JY8A 3D0CA 3W7HA 5IM51 3LCGA 1HG3A 4NXKA 4HN4A 1JQXA 1LROA 4M7TA 5A8GA 3IVTA 1FUYA 3GDLA 5D2XA 5MHBA 4UFKA 3NR0A 3WJYA 2JGYA 4MFEA 2F84A 2FPYA 3TC7A 2QCHA 3IIZA 3C2FA 3G0UA 3N3MA 1WXJA 3C4UA 3L9CA 3VE9A 1IXPA 1D9EA 4HKPA 4N6FA 1SO6A 1W1ZA 2H90A 2ZRVA 2C1HA 3L65A 1DVJA 1VPXA 3DGRA 2IQTA 4JY9A 4XWUA 4DO6A 1SW0A 3ZR4A 4AVFA 3TSDA 4YCPA 1N8FA 1GVOA 1WA3A 1TMHA 5FI8A 3LRKA 3MHGA 3M5VA 2AQWA 1AMKA 1XDMA 2V2HA 1I45A 1H60A 4JTFA 3LXCA 3Q94A 3AJXA 2JKPA 4YMZA 3I7RA 4FX6M 3M0ZA 1R30A 1IGSA 1PHQA 3EX4A 2ZDRA 4EF8A 4TIMA 4UUIA 1MEWA 3NPVA 2NUXA 1JRBA 1C8VA 1ZHAA 1SR9A 5I3HA 1UUMA 3BLIA 4IX2A 2Y6ZA 3MW7A 1I8JA 4AWSA 3NEVA 5FF3A 3L5AA 1OFAA 3R13A 4DF0A 3EB2A 3QW3A 4LOCA 2ZZ5A 2JKAA 4RR4A 5K3VA 1LDCA 1ADOA 1KLYA 4UTWC 3SSJA 3U6WA 4FEZA 2JK2A 3N73A 3GXNA 1JCJA 1LYXA 5AHIA 5G2IA 4PH6A 3S5NA 4UTJA 3TK7A 2GQAA 3HPZA 1QOPA 4HNTA 2OT0A 3NQ6A 3PBUA 3W76A 4HNVA 3DU0A 3DAQA 2Q3OA 3C52A 3CTLA 4ZQCA 3H55A 3CIXA 3HF3A 4YL2A 4MPQA 4CCCA 3HB9A 3W84A 3NPWA 4HPXA 3E12A 5TIMA 2PCQA 3GDMA 1H7RA 2GQ9A 5C2XA
chains in the Genus database with same CATH superfamily
1KV5A 3DHUA 1K3UA 4NP7A 2DT1A 1JCLA 3BAYA 3PZ9A 3ZWTA 1UQYA 1TV3A 1S2TA 3UY7A 1F05A 4FXFA 1XM3A 3DHDA 1UB3A 1V02E 2QDHA 3VOFA 4ICNA 2VGFA 4LRSA 1W31A 3FOKA 1H7PA 1JDEA 1W2VA 4LV9A 1O5QA 4PB3A 1BKSA 1WKDA 3CLMA 1ZFJA 4JTJA 3V0UA 2QVHA 1CB7B 5D9OA 4PSRA 4HNUA 1OABA 2Z7KA 3LLXA 4NZ3A 4DIAA 2VENA 5DX7A 3NGJA 3HURA 2ISVA 3TYCA 1QW7A 3OIHA 1OGGA 1U2YA 4HCLA 2NUWA 9XIAA 1I2RA 3URAA 3S46A 2QGYA 1UD6A 4HHMA 4KFOA 3BLEA 5C9WA 2OX1A 3CQIA 2PE4A 1SU5A 4PTVA 1C8YA 3M5ZA 2Z25A 1R9XA 3W7CA 4OECA 5C8BB 5TBOA 2QT3A 1WB0A 3UXKA 2WMJA 5DMYA 2E6DA 4XB3A 2GUBA 4KGLA 2B7PA 4A3UA 3WLKX 3N9SA 4RNFA 2HZGA 3KAOA 5A6JA 1UWSA 4WVXA 1SSGA 3WENA 4IG2A 4KEZA 1EDTA 4DUXA 4LEQA 1IR1A 2OZ8A 1RK6A 3B4YA 2Z2AA 4FOUA 1B5TA 1SMDA 1M7OA 2ASHA 1Q6DA 2VMFA 4O18A 3TCSA 5EFDA 4O1CA 3KVMA 2AKZA 3WDJA 4PUMA 2QV4A 1T96A 3IV3A 2Y0FA 1PZ3A 3RGTA 2YBTA 4K8EA 5I3IA 4O1BA 4U4MA 4KCTA 4EAYA 3W1UA 4Z1AA 5JBEA 2XFRA 3PZNA 3TW6A 3AISA 4OVXA 3MUIA 2HPMA 1E55A 3R25A 3TV8A 3CBWA 2P10A 1U1HA 3W2NA 2DZVA 4UNKA 3QBUA 4NF7A 3UGRA 3E1F1 3HN3A 4U3AA 2D69A 1UYQA 1S2VA 3G22A 4WY0F 4XBKA 2Q02A 3U5YA 1CENA 2NX9A 1CGVA 1AZ2A 5IRPA 4BF9A 1OYAA 3AIRA 3MUZ1 2L5HA 3B0YA 4MFDA 3QOKA 5GJMA 2Y88A 5ECUA 4AX6A 4JTUA 4S38A 3R94A 2PRLA 1HVQA 3CEUA 3NM3A 3IGUA 5F2LA 4E5TA 3TWBA 2HROA 2CW6A 4IXXA 4QCFA 1JG9A 2RFGA 1ZPTA 4A2SA 2ZCGA 2NSOA 4P2VA 1JPKA 3BC9A 5F1UA 2JFEX 4QHRA 1R2RA 3MZ2A 1FCVA 4BJHA 3TP4A 3F4VA 3QGKC 1Z3NA 3F5JA 3RF9A 4CU6A 3KDNA 4ORMA 3TXVA 2ZRWA 3MCNA 4BI6A 1XKJA 2GWNA 2V3EA 4Q4PA 1LOSA 1FDYA 1GKRA 2P5NA 2D0GA 2HE8A 4XQ6A 4EOUA 4TV6A 3FSTA 4WJ8A 1PUDA 3HGOA 2HPIA 2PF8A 3BG3A 1KKOA 1HKWA 3L2LA 3N4EA 5CPNA 5D03A 1Q6QA 2NXIA 3GYEA 3TNBA 1R3QA 1W8GA 4LBUA 4ZXLA 3MSDA 4JNZA 1JCMP 4ORIA 4TTGA 3WZ0E 3JS3A 1UW9A 4S3JA 4DXKA 1KFBA 4JCLA 4YYFA 4IOTA 2WNZA 4ZA0A 4J7RA 3HPXA 4PODA 3WBWA 4NJHA 3EA2A 4WJXA 1RZMA 2I5QA 4E2BA 5DN1A 2AL2A 2BS9A 4JEJA 1HGYA 3S2NA 1XLAA 4OHQA 4GVIA 4WDTA 2AMGA 2C91A 3LMYA 1SGJA 5G1TA 4DXVA 3NG3A 1MFUA 4ROQA 4K8HA 3GSMA 3M07A 4H9ZA 4GXMA 4QEEA 2IXUA 3STGA 3WQFA 2ANUA 1TB3A 5HMFA 1UD8A 1PIIA 1W32A 4AZCA 3RM8A 5DLCA 5TNVA 2O92A 4UXDA 5C2GA 3OVRA 3E49A 4AIUA 1RCXB 2F9RA 3CH0A 4W7WA 4B2DD 2PLJA 3KX6A 1B9BA 4C6JA 5BRBA 1JI2A 1EIBA 2E1WA 3NQ7A 4LCRA 3HV8A 4AF0A 5ABFB 1GW9A 1QNPA 2DW7A 1A47A 1V6WA 5T26A 3B8VA 2PLMA 5FIPA 1HVXA 1X7FA 1O68A 3MC5A 2WXDM 7REQA 4W4QA 1TSIA 2YFNA 1GJPA 4W93A 4W5UA 2XFFA 4IPNB 5FF7A 1XIFA 4AZGA 4O1DA 1LL4A 3PBYA 1MWOA 2VRKA 5C55A 5A6BA 1VRDA 3GXIA 4ZQPA 1GQKA 1P1XA 1K9EA 5AYZA 3MMUA 4I90A 2J9YA 3ARPA 3M0IA 2EO7A 3GU1A 5LIXX 1Q3NA 2WVSA 4WDXA 3UFYA 3U8GA 4A3YA 4JTHA 2GSEA 1LBMA 2XZ9A 1SPQA 3ONCA 4L6HA 3MMWA 1YE4A 2PURA 2G5WA 3UQNA 4I7UA 1ZENA 1BWLA 2FLIA 4DF1A 1JEZA 3DYMA 4OUEA 5D9NA 4XO6A 4B5UA 2I9EA 5CZTA 5D4YA 1EZWA 1QI5A 3LGGA 4Q4SA 4E2OA 4JTQA 3O8AA 1XPYA 3QC3A 4WF7A 1TUXA 3SN4A 1H63A 1PKNA 4AZ7A 1ADDA 4CNTA 2VI0A 4JX5A 5FACA 1BGAA 1K4GA 3W1XA 1RQBA 3RM9A 3DI1A 3VFLA 4J3UA 4S2BA 4QX4A 3DYPA 1W3JA 3T7VA 1JIBA 1QR7A 2B4GA 5I03A 5GJNA 6TAAA 2V2CA 3QY6A 5HMSA 5C7VA 3KP1A 1K8CA 3WD2A 3UVAA 4WDWA 1E0UA 4ZOEA 4ATLA 1H0GA 2Z1WA 3FSUA 1LL6A 3UPBA 4XBJA 4ML4A 4B5WA 1VIWA 3TFCA 2J79A 2BWGA 4H8NA 3IARA 1VAHA 3PZMA 4QM1A 3W4RA 4N9CA 1B54A 5G5IA 4UR8A 1V02A 4Z2HA 4XZWA 3OGRA 1X1NA 1DOSA 3T0DA 3LD5A 5BNKA 2Y2WA 1ENUA 4G1NA 4H2HA 3ZT5A 4POCA 3TJ4A 3D46A 5BU9A 2REQA 1XG3A 3IPWA 3M64A 3FHQA 4DLMA 1MEHA 1CX9A 2W92A 1A0CA 3CHFA 3S9ZA 5F2IA 4ERGA 2C7FA 3PSWA 4N6EA 4REQB 4QIUA 4ZEPA 4KQNA 3FGCA 5HWNA 4AY8A 4D72A 2EPKX 4QDPA 4O52A 4X9YA 2BVYA 5HJYA 4TX8A 3ONBA 1NH6A 4NL1A 2GJLA 3KBWA 3NZ1A 5C54A 2BSLA 2X0SA 3OBKA 2EKGA 1GVIA 2FMNA 1Q6FA 2BXZA 4QLJA 2OWXA 3VKCA 3O6DA 1EUAA 1W9UA 4QFUA 3KWXA 3ARVA 5L9FA 2G95A 1Z48A 8RUCA 3QFWA 2VEIA 3ID7A 5EMJA 1EQPA 4I5RA 3BGGA 3EB4A 2X0YA 4FNPA 1E6NA 3VIMA 4UNLA 1UWIA 3VNDA 4PUEA 4GI9A 3ZFHA 3LPPA 4GKTA 1QTWA 1IHIA 3W1RA 3ZJ7A 2ZXAA 4GUJA 2F2KA 3V75A 2X09A 4CU7A 4G1KA 3N14A 2J77A 3QJAA 4BF5A 2BV9A 5D9MA 1TX2A 1T8XA 1KC7A 1TMLA 3FEQA 4XZMX 3ZJ6A 5E0CA 3R10A 4Y9NA 4N0RA 1IXNA 4J35A 5BROA 1GEHA 2G4FA 3VAVA 1OF8A 2INFA 3G1RA 4JDYA 1U5HA 3LGDA 1UKQA 1JXJA 3W7LA 1DXFA 2BASA 2VOMA 1K1DA 3UGVA 4H00A 3M7SA 4JBRA 4A8IA 5CXPA 3E2SA 1UJPA 5J04A 2GVGA 4Y9PA 4JQAA 3P84A 2I9UA 3O0KA 1ME8A 4Q4QA 4R5EA 1N8IA 4F2TA 2X7VA 3P6LA 4AY1A 2E8ZA 1TMQA 3GTIA 4RZ5A 3NEHA 2EJAA 1CW2A 3MYPA 2H9AB 1HTIA 3OVPA 2CHNA 2RAGA 3H2MA 5FAGA 2CZDA 3MKKA 4UTHA 4H9MA 1WX0A 2XWEA 1SFTA 3ERPA 1HW6A 1SJDA 2XN2A 3KTSA 4S2CA 2C3ZA 4HZMA 4NZ4A 3GH7A 3R58A 3CQ0A 1FXPA 3UJSA 2HXUA 3VNIA 1XW8A 3GX9A 3FLUA 3UJRA 4R34A 2ZVIA 3KBJA 3N2CA 1W8SA 1P0EA 2XVKA 1O5KA 4JDBA 1V6TA 4O28A 2D22A 1MVYA 1W5NA 3B0PA 3WKZA 1W9BM 1S1RA 3B40A 3QXBA 4KFPA 6ALDA 3VYLA 4AISA 3CHVA 2QCDB 1OFPA 2KX9A 1BVWA 3VD3A 2J47A 3WNMA 5D9PA 5BMXA 1GORA 3F4NA 3NQBA 2UY2A 3SCOA 2YLAA 4B92A 2VEPA 4KWWA 4D6GA 2UWFA 3LHYA 1ALDA 2P53A 2GDQA 3G6LA 2JGQA 3LPGA 4A8NA 4C6LA 1FWBC 3CK5A 4NNAA 3KRBA 3TYDA 1YLVA 3OHMB 3VIGA 3UXAA 3IV8A 8XIMA 5A8PA 1CXLA 3QV9A 4JHOA 4MB1A 4LAUA 4QQUA 3T2QA 4JIRA 3ISIX 3DESA 4JTLA 3B9AA 3F5KA 3NSNA 4J9JA 1DQXA 4F3HA 4L1WA 2J88A 3L12A 1RQHA 5XIAA 4GVGA 3EKLA 3ZWSA 3LK6A 5FKYA 3G1HA 1Q2SA 1RHCA 1X1ZA 3H6OA 1T7LA 5JMUA 3OQ8A 2VFGA 1D2KA 3MQTA 3RCMA 3C5QA 3FEMA 4HPNA 3W81A 2ACUA 2J62A 4UTKA 5D30A 1WO2A 3CT2A 3CXOA 4NJJA 3LERA 4LUSA 4PEEA 1F8MA 4R9XA 1AH0A 1HKVA 4D6JA 4YCOA 1XH0A 3IAPA 4GNJA 4PGLA 3IIPA 3T78A 1NEYA 6PTDA 3TN5A 4EX4A 3EDFA 3JVAA 3PG9A 2QV5A 5HA7A 2FHBA 3W7RA 3A47A 3EMZA 5CAKA 1IXQA 4Q8NA 3UR5A 1J5TA 5HULA 3HPAA 4PMXA 2R14A 1P6CA 4DRSA 3NL5A 4J3WA 1L6GA 1J0IA 3ELFA 1XWYA 3IACA 3SCRA 2WMFA 1YPXA 1TO3A 4XAPA 5PTDA 4MY8A 2FB3A 4Z0SA 2NQJA 2ZRYA 4U31A 2PDYA 3IIXA 2HXTA 8XIAA 3EPNA 1U1JA 2Y8VA 1E3ZA 3FJNA 2Y61A 2WKLA 6XIMA 4EXBA 3F03K 1XINA 4H9TA 3E2RA 1JFHA 4HA4A 4TR9A 3CUGA 3ORWA 1OT1A 1TPEA 3MJMA 4GI8A 4OV9A 1BXBA 3UR8A 2QAPA 1N2VA 1B0IA 4MWAB 2IUZA 2UV8G 2UBPC 3MSYA 1YE6A 4JEQA 4ZODA 3EOEA 5RUBA 1XLMA 2DP3A 3WQEA 1YHTA 2FGZA 2CBVA 4HMEA 5GNXA 1MZHA 3BARA 3FIGA 1ZB5A 3TSMA 3GTXA 3IRDA 1XP3A 2YJQA 3PTDA 3WD1A 1P48A 5C9UA 4LCSA 5GNYA 7A3HA 2XGBA 3VDBA 2DVUA 1CECA 1TTPA 4BEQA 1F6PA 4MJ2A 5F4WA 3VZZA 3LRMA 2A85A 1PIGA 4DVOA 4C6CA 4TXEA 1JPHA 5AKQA 3L4TA 3LEPA 4ICCX 2QR6A 5AZ1A 3FV9A 4GIAA 1JAEA 1KM4A 5G1MA 3A23A 1Q7QA 4O4VA 4D2JA 1K02A 4JIHA 2GOKA 2VZVA 1QBBA 2VEKA 1V5XA 3LPFA 4BQ2A 2Q09A 3H21A 4A8RA 5IHRA 4IJCA 3I6RA 2OZ0A 2BOGX 2VX6A 2VUYA 5FL1A 3LDVA 1HP4A 1BEUA 1RQEA 1EDGA 1BYBA 1TV8A 1DJHA 3SRDA 1OGBA 2YB1A 2QJNA 1XBYA 1B3ZA 1DWHM 2B0MA 1UPPA 5D04C 3W02A 3WH9A 3KDOA 3SUTA 3QF0A 2NZLA 2CKRA 2O9RA 3DECA 2ZKMX 3K8KA 3QKZA 5T9CE 3S42A 1PZ0A 4RNJA 3E0IA 3KVLA 2O7SA 2GPTA 4DEFA 1YX1A 2FFCA 3NOEA 3OQEA 2J13A 2CXEA 3P14A 1O5XA 3GUWA 4EPDC 5AVHA 1G7UA 1WZMA 3WQWA 4AIBA 1UMYA 3ZSSA 4IL0A 4WY0B 4AD0A 4XAFA 3MBDA 3HG5A 3MUAA 4X2PA 5K9DA 1VENA 3W1PA 3ABSA 3M5YA 4YJ5A 1Q2RA 1KFEA 2GK1A 4FNQA 4UMAA 2CBJA 4I9TA 4UOQA 1M68A 3E6EA 1MRAA 2OJPA 4Z1YA 4IFKB 4HCDA 1RBAA 5DXXA 4MUPA 1E6PA 3CS2A 1WXZA 1YNPA 4MYAA 4ONVA 5GJPA 1EPVA 1YW1A 3MI3A 4JXCA 3O1NA 1ZU8A 3BDKA 1DPMA 3VOCA 2BY2A 2NQHA 1QW8A 4AMCA 4KEMA 2PTXA 3W29A 3B8UA 4B3ZA 4RXFA 2ACQA 3GQYA 1W1B1 1E40A 1EEPA 3R11A 4PBGA 1K70A 2CWNA 2J4GA 4B9YA 3O2LA 1PKMA 1EC9A 1L6SA 1J4EA 2V5KA 1VHCA 2PGEA 1J0YA 4MB4A 4AAJA 1L6WA 4IG2B 2E68A 3BOLA 3GZ3A 1ZNNA 3S4TA 4NX5A 1O1ZA 1KFKA 5KZMA 2TMDA 4UQAA 1E0VA 1TJ2A 2X16A 5IHSA 5CSUA 4NZ5A 1I6NA 5I02A 1PCWA 1UD2A 3C2OA 3C2RA 3WMLA 2O9TA 2DVXA 1RXOB 2BFGA 2WVVB 4HTYA 3W53A 3A3HA 4JN6A 1IEIA 1GOXA 4M3PA 1E0WA 1P5BA 3STPA 5FEWA 1VBRA 2BVWA 3EWCA 3O6CA 3M7WA 2FZMA 3QV6A 4NZFA 3S1UA 3FYOA 1QK0A 1XIBA 3KZSA 4O54A 4IXHA 3MPGA 1XLKA 4JFWA 2VDIA 3UWUA 1TVLA 2C0AA 4MZYA 3UD6A 1WXYA 2WC3A 2CLEA 1P1MA 1VR6A 2OU4A 1ZCCA 4JAWA 4NSBA 3VGFA 3T8LA 4X63A 3BAWA 1PXGA 1P0KA 3PM6A 2ZC1A 3UW6A 3NL2A 2WSPA 5KEZA 2HEJA 3A21A 3GR7A 3R89A 1B9ZA 5F2GA 3WUGA 2X30A 3TX9A 3ZOAA 1GOKA 4G7EA 3FA3A 2A3LA 1B30A 2D3NA 1VJIA 5DRIA 1KM0A 3WH6A 2DZPA 3IS4A 4LSBA 4CQBA 2OG9A 3T07A 4HSNA 4IMFA 4R7JA 3XINA 4FXRA 3AYTA 2X1SA 3EXRA 3OIXA 3WQ5A 3ARYA 2DUXA 4PMJA 4U2YA 3BG9A 4QG9A 4K8GA 5FEPA 4GQGA 2PCEA 4KERA 4L9ZA 2PF0A 3AZTA 3URQA 4UOJA 3ANYA 3VX0A 1E72M 1B3XA 4B3KA 1K9DA 4PUNA 4AD1A 1TUFA 1JZ5A 2YDRA 4YS1A 1PL9A 3ZT6A 4B5NA 3G24A 5CZSA 3PPGA 3MMDA 2VC5A 3H2FA 4MAVA 1TPH1 3RO8A 3FS2A 2YCLA 4QJ5B 4A21A 1NTHA 1W3KA 1J0HA 1PKLA 1KXQA 1JGIA 1KM5A 4QCEA 5EMLA 3QM3A 1B2YA 4LQ1A 4UQBA 5D37A 2HK1A 1TPWA 2W27A 5LIWX 1E9IA 4HSOA 3LBOA 1R0MA 4WKFA 2DPEA 4U5KA 1EYWA 3KLLA 3EX3A 3N6QA 4NAEA 3A4AA 3H70A 3WEOA 1UH2A 4IIBA 4BWLA 2HVOA 1ISZA 1BYDA 1OF6A 1XFBA 3VI2A 1E6QM 1JL8A 4I9AA 4XSLA 1KRAC 2OFJA 4RJEA 4K1WA 2E4TA 2XIBA 4AD4A 1FTXA 2GGEA 5E5CA 1H2JA 1FXQA 3BV7A 4JGDA 4S39A 1AJ2A 3EOOA 4FB7A 3AMDA 1OZMA 5H2ZA 1F74A 4O17A 4DF2A 2I5GA 2CBIA 1ADSA 4AX7A 1NARA 4GE8A 1XRTA 1G4SA 1R47A 2BY1A 3GR4A 4J27A 3WN6A 2DORA 3DGBA 2WBGA 2FQIA 1O60A 1US3A 4PCPA 4LUJA 2XISA 3UESA 5EBAA 3VKJA 2ZC8A 1U5JA 5A2BA 2C0HA 4JKMA 2UY5A 1LLZA 4M51A 1AQFA 4O13A 3EDDA 2GJXB 4IZGA 1LT7A 4GZ7A 1A53A 2X0HA 3I7SA 3VM5A 5F7UA 1EQCA 1CGUA 3OG3A 3FCPA 1I9CB 4QE4A 1OADA 2QHAA 1IZKA 4GXWA 1S39A 5G4WA 5LXXA 5DBUA 1EBHA 4D9PA 3SO7A 4E8DA 4XKYA 4PTMA 1S38A 3DI0A 3BW2A 4JTDA 2EHHA 2X1RA 2V5DA 3SCUA 1BQGA 4IMEA 3TLLA 2V5CA 2ZRZA 1C92A 2E7FA 3V5CA 1FH7A 1LWHA 3M6DA 4N9EA 1WAWA 4N9BA 5IFPA 1XPGA 4AXNA 2WWDA 2V68A 2F6XA 1OC5A 3M43A 2WZMA 4UBPC 4RZ6A 1W5MA 1QASA 2WHJA 5BU6A 4ATWA 3BMWA 3TQ0A 3W7NA 1H5YA 3TC6A 4GPNA 2FIQA 2Y63A 2Y7GA 3G1YA 3GNOA 4LNCA 3WFLA 4UFHA 1SO4A 3W7MA 4GYFA 3BZJA 4HPHA 3JU2A 4MUZA 5HPCA 2YL5A 1Z42A 4B5VA 4U28A 4L4OA 1J0ZA 4JTGA 2ZZ6A 1RP8A 2VO5A 2NQZA 3QLLA 1HJUA 4IMGA 5U4NA 4E2VA 2RUSA 2ZYFA 3UY8A 1S5MA 3AS3A 1JUKA 1OVDA 1YADA 1WPCA 3UZWA 1DE5A 3G1AA 4DBDA 2EBNA 5D2TA 1SZNA 1PIFA 5IDZA 1HJXA 4X9SA 1IWPA 3F5LA 3KL3A 3NXFA 5HANA 3C56A 5HK4A 3CIVA 4XVDA 2HNEA 3PWAA 2JEQA 1GG1A 2YA1A 3WYZA 4GBDA 4LFYA 2HK0A 1E4IA 3UJEA 1XL9A 1U83A 3IUDA 3MUCA 3OVQA 3AYVA 4LALA 1UH3A 4KBXA 4Q7BA 3W7HA 5CPTA 3O0FA 3CGTA 4HBKA 3GDLA 2Y5JA 4L4PA 3UP8A 5MHBA 3N6JA 3NR0A 3OP2A 3WJYA 2JGYA 2FPYA 1LUCB 2EXOA 3IIZA 3IUIA 3TYAA 4HA0A 2PUZA 1VFSA 4X61A 3C4UA 3VE9A 4JQ1A 1IWBA 1BF6A 1PKYA 1SO6A 2BB0A 1GVEA 1TV2A 2H90A 3LQGA 3L65A 5I07A 1AD1A 4UZSA 4PE8A 3MTWA 1IYXA 1SW0A 3ZR4A 3TSDA 1POJA 5ABEA 1WA3A 3A9BA 3NZGA 2W62A 1M41A 1TMHA 5I5RA 3VK5A 4A3QA 1XRFA 2FVKA 1VBUA 1HXJA 2V2HA 4F9JA 1I45A 2JALA 4QTGA 3I7RA 2OO0A 1R30A 2ZDRA 4HK5A 3FW6A 2OEKA 1ZRQA 3NPVA 4W7VA 3WD0A 1IR2A 4V33A 1XIJA 3A12A 2HE5A 3PN8A 2D23A 4C5YA 3BLIA 1I8JA 3APTA 3IJ9A 1V51A 3VD5A 3ZSTA 4YYCA 3L5AA 3R13A 3R0KA 3RHGA 1XLLA 3QW3A 1UC5A 4M6UA 2VL4A 1QWKA 3GTHA 4CU8A 1KLYA 1A4MA 3HFTA 3N73A 1CDGA 1LYXA 1OSEA 4E3TA 4PH6A 1A0EA 3RX4A 4AIOA 2R9RA 3WL0A 3WDQA 1QOPA 4DWSD 1ZQ5A 2OT0A 3NQ6A 4HNVA 1KGWA 1XISA 2XIJA 3RX2A 3C52A 4DAFA 2VX5A 4MPQA 2WMGA 3OLIA 2VRJA 4PRRA 3CV7A 3VX1A 3PPCA 4GLEA 1C93A 3EKGA 1H7RA 3AS1A 3H4WA 4RPQA 5KETA 1VJZA 1JCNA 1JCYA 5EL1A 3CWNA 4PFMA 3KCOA 3DZ1A 4BKNA 2Q01A 4RE0A 2R1PA 2OVLA 6A3HA 2EG8A 4WLCA 1M6JA 4KWOA 4NYYA 3A22A 3SM0A 4DELA 3AU2A 1ZY9A 4PUUA 4W8BA 1VBHA 4Y9MA 3LTSA 4NASA 2BVDA 1GYMA 2XYLA 2IPWA 5AB3A 3SDOA 3CUHA 1A5MC 3R5EA 5AOUA 1HQTA 2GYIA 4TU1A 3VDAA 2ZOXA 2H6RA 1P6WA 1U22A 1XD1A 1TRDA 3W2JA 4WRHA 3QYQA 4NVTA 2TSYA 3UR2A 3W7KA 1Z41A 3C61A 2A3EA 2R6OA 1ISYA 4KFNA 3R12A 1ZCOA 4WUIA 3USBA 1H49A 2OQYA 2Y62A 1KQZA 1RA5A 4KT2A 3W88A 3AIWA 5DRCA 2DUZA 3KL5A 4EE9A 4FK9A 3F1QA 2GVJA 2ZRUA 2VHLA 2E67A 2V5JA 2QCCA 2O4MA 5I09A 4LAMA 4OWGA 2WHLA 1N8WA 4KESA 1XLBA 2BNJA 1PWLA 1XI3A 3O6YX 3KHDA 4MDOA 4U33A 1DORA 3GUGA 4NIRA 2VGBA 4GUHA 3AU6A 4B5SA 4FLQA 1EDQA 3UU0A 4FZIA 3SCPA 4RW5A 1OCBA 3C86A 4M19A 2XG9A 3NO3A 4JIPA 5K4ZA 4B3LA 2E25A 4MZ1A 3CQJA 4JS3A 5AHMA 4YU1A 1BTCA 2CXGA 2PP1A 4GG9A 3CWHA 4P8XA 3A6OA 2GWGA 2J7GA 3PC0A 3QW4B 3SEPA 2Y85A 3BANA 4AFYA 3LCFA 3DH7A 4IIHA 5FJUA 3TJXA 4GNVA 4H01A 1CZ1A 4IGHA 2ISWA 1TWWA 2NV2A 1CLXA 4XK2A 1E6SM 4PMRA 2VC6A 3RCNA 1E1FA 3SUVA 1G94A 1V0LA 1QJWA 4A3HA 5TQLA 2E0PA 1A3HA 1VBJA 4TX9A 4J28A 4LW7A 2Y4SA 2B81A 1SSDA 1MXSA 2CNCA 3UZYA 3I6TA 4EAMA 4O4WA 1E9YB 3B05A 1M7PA 3TVAA 3DG6A 5M3WA 3O05A 3T1GA 1ECEA 3V5OA 1LRTA 3A4XA 3G3DA 2QLYA 3TH6A 4JTTA 4HU8A 2EGZA 3GXDA 5B7YA 3NSXA 3BLLA 4V1XA 1UC4A 2Y8KA 3D3AA 4LT9A 5AYYA 2CKSA 1K7EA 4F4RA 1XYMA 2VFIA 1H7XA 3AYRA 5I3FA 4GCXA 3AJ7A 5DQPA 4TMCA 5C9XA 1LLWA 5I3JA 4GC4A 1U30A 4W87A 3T9PA 5J5RA 4QISA 3II1A 2VTFA 2CBUA 5B80A 3VKBA 3VD4A 3B8DA 3VNLA 1V0MA 2GOUA 4UQ9A 1KLZA 2PEVA 3OVGA 1O1HA 3NXLA 2A7NA 2BG5A 3UZ5A 3MDWA 4LX4A 4Y9OA 1V77A 4MJ4A 3GBDA 1BAGA 1MYRA 2BLEA 2VCAA 1AQMA 4IICA 1DJQA 4FX8A 3K13A 2WZTA 4X0VA 2IPGA 3V1HA 5I6SA 3TOPA 2FKPA 3H7RA 2NLIA 5GQBA 3MWAA 2J7BA 3GBEA 9XIMA 2X7WA 3EWUA 2IMRA 1XYAA 1H5VA 2O55A 2YYUA 3DFYA 4IMCA 3FA5A 1OG0A 3RN6A 5CZJA 3RAOA 3TN4A 2WOQA 2CLFA 5FJIA 1C91A 1H7NA 5CBJA 4UMCA 3EX6A 3AYSA 3PZIA 3N2MA 5G2HA 4FR1A 4IUGA 1OFRA 3RLUA 1HKIA 4F66A 3PUOA 1JGMA 1TPUA 3GO2A 1UWUA 3PZQA 4RNIA 1CXKA 4K37A 4LBRA 3UWQA 2XVPA 3LMZA 1AW5A 1I2NA 1ZGDA 4ACYA 4ICMA 4YTTA 4ZB5A 1NWUA 5A2AA 5I77A 4YTQA 1A49A 5ABTA 5LNWA 3G6MA 4QP0A 2E40A 4Z0JA 1CLKA 2O7QA 1LT8A 4AG0A 3VOHA 1WBHA 3APGA 3F7JA 5J8LA 3IJ8A 2X40A 1CEOA 5E93A 3UA4A 1DHKA 3QR0A 2HQAA 2ZTJA 4L6DA 4IF2A 3W01A 1H50A 1MUCA 1VP5A 1EPXA 3NDZA 3DFQA 4U10A 3TZFA 1UP2A 4C65A 2ADAA 1XQKA 2QULA 4BY3A 1QCWA 4QEHA 4XX6A 1G01A 3CZLA 1IT0A 4JOMA 4WR3A 2QDEA 4AVOA 3WF3A 2G41A 3ZVHB 5G1YA 2D2HA 4GMEA 1W37A 4GGHA 2V69A 3PP7A 4FOKA 1JD7A 3NQMA 4F0MA 4F0HA 4FOJA 1I2QA 5CG7A 3PHAA 3E5PA 2E9LA 2PU0A 2GSJA 3VDHA 3HGSA 3GRIA 2YW3A 4OUIA 5HUPA 3E2VA 3ICJA 1NFGA 4PMZA 1T6MA 3PBMA 1W1IE 1K4HA 3LSBA 4PMUA 1QHZA 2GGHA 1XRVA 1N7KA 4YVPA 5BMWA 4OOZA 1TKKA 4Q32A 1J2BA 1JDCA 1E6XM 3QMSA 3I68A 4NU7A 4A35A 3TQVA 1QVBA 4FX7A 4HCHA 4PCTA 4NUWA 3ITGA 3ZZ1A 1JZ8A 2D0HA 3QMRA 1A5BA 1T0OA 4C6EA 1DWAM 4K39A 1JD9A 1L8NA 1MW1A 2A2IA 3U2EA 3C2EA 4HOXA 5DXYA 3WELA 3FHAA 3UETA 3HU7A 1J79A 3SI9A 3EYPA 1D3GA 1V6VA 1XLJA 2YFOA 3SADA 1KBIA 1SZRA 4LF1A 1XIHA 3OLEA 3A5FA 4HA1A 2A1YA 4UNIA 1W1PA 3AXXA 4PB5A 2G4JA 1MW3A 4WXZA 4AVNA 3B0XA 3W1LA 3NYZA 4C7GA 5LNUA 1N55A 3LOTA 1DTUA 1E73M 4P61A 3HPFA 2DIJA 1OFBA 2WM1A 3AS2A 1PB0A 4AMAA 4JYDA 2B7QA 4XZIA 1GOQA 4JNYA 2Q8ZA 3UVIA 4CD5A 3GTFA 4Z2IA 4PRWA 2RDUA 2AQVA 4FP1A 1P7TB 1DQWA 2OQLA 3FVDA 1CNVA 3KRUA 2W79A 2PZ0A 1EHNA 1BXNA 4XD5A 1YMYA 1RCOB 3M1ZA 4BZYA 2UY4A 1MMFA 2J7FA 2WC7A 5D02A 2ZA1A 3R4IA 5A6MA 4DBUA 1IIGA 1ISXA 1AH4A 3UR7A 2YL8A 3CWOX 1DYSA 2FJKA 4MVAA 2JKEA 1XIGA 4KIRA 2OTDA 1MXGA 1U1UA 1CYGA 2WNQA 4HT3A 3EX1A 4M56A 3UYIA 2XVLA 4XSMA 2YXOA 4XD4A 1YNQA 5AC5A 2PI6A 4GQ0A 4IT1A 1A3XA 1IZCA 1R7OA 3O9NA 4ZSTA 5I3DA 2ACSA 3G1XA 3PPHA 1O5RA 2JBMA 1MFVA 3WG6A 3WFAA 1EUNA 1UP0A 1QOXA 2HS6A 4IP7A 5DMLA 2VQUA 2QJHA 3UYCA 3BUVA 2EPLX 3S8HA 1FWSA 2VDHA 2HDJA 5MKGA 1OYCA 2QCLA 4CQ8A 4M6QA 3Q65A 3V35A 4JQ3A 3WLMA 4GIEA 5AVNA 1QRQA 4UTLA 1OK6A 1QAPA 1S2WA 4DWDA 2C19A 2CHRA 3SUSA 2WSRA 1SQ7A 4KEUA 4YPJA 2XGIA 2F61A 4GA8A 1JUEA 3CHDA 4N2YA 1EWDA 4BWLC 5A6KA 4XD3A 4XO7A 2XFWA 1FP9A 2Y1HA 3GKFA 3W1TA 2V63A 3OODA 4S3BA 1C3FA 4UTWA 3VMPA 3WFZA 1D8CA 2YIHA 1ZBWA 4LYPA 1FWAC 3S1WA 1O66A 1UR2A 1LBFA 1FY6A 2PWHA 2IKGA 1HIZA 5C70A 1LZOA 3GXPA 1TFVA 1A5LC 2J7HA 5A6TC 4BCEA 2E3ZA 4GOAA 4IP4A 1XCWA 2WQPA 2ZZ3A 3LCLA 1E6ZA 2BP1A 1H7WA 1EGMA 3DFHA 4C6NA 1E1CA 4GVFA 1VH7A 2DSWA 3I65A 1JCXA 1XSIA 4JTIA 1E5NA 4RLIA 2PAJA 4LCQA 2NQ9A 3DX5A 1DJYA 1CCWB 4WZHA 3BZGA 1K03A 5DBTA 5CC3A 4S3DA 2C13A 3BL3A 3LS9A 3A9IA 3HIJA 4C6FA 3FKRA 3VIOA 5KZEA 1U5VA 1H1NA 1QHPA 4MHBA 2GVLA 1OWQA 3ARTA 4FLOA 1RALA 2A6NA 4TVDA 1CLVA 4CQ9A 1DJXA 1W3HA 2ZVRA 3CTTA 1UMLA 2A3AA 4WGXA 4LUTA 3SBFA 4R85A 1W91A 3NZQA 3S9IA 2GVYA 1GOIA 4ZQRA 1W1A1 3LU2A 2WHMA 4KWSA 3WUEA 3FFSA 3RU6A 4IPIA 2BODX 4JN7A 1FCBA 1DEDA 1G7VA 5DY2A 3HG4A 2A6LA 5I00A 4LB4A 4FO4A 1DIDA 2YA0A 5LSMA 3RJYA 3W38A 2CLIA 3U2OA 3ITTA 5CSRA 2OYKA 3WH7A 1ZAIA 3N34A 3G1VA 7ENLA 2DUAA 1KQYA 6XIAA 2WBKA 5HUOA 3W74A 4Y96A 2HSAA 5C7HA 4XUGA 2W67A 3CPUA 1GGOA 1M1BA 1TZ9A 5I79A 1DTNA 3MCMA 3MKVA 4L9YA 1FWGC 1WUEA 1D3HA 3ECQA 3EX2A 4I8YA 3GZAA 1QDSA 3L2IA 4WXYA 4O10A 4AB4A 1TTQA 4Q4RA 2PDHA 2PTYA 2OSWA 2PTDA 3SN0A 4CVUA 5KMYA 1VEMA 4IMAA 1DXIA 4HPJA 3ZJKA 2FZDA 1VBGA 2X1IA 1PE1A 1VCGA 4MOZA 4F0LA 3WF2A 1TPB1 2Y5EA 4LAKA 1NVMA 2G3FA 2V38A 4QRNA 1KO0A 4FALA 1L6FA 2CCRA 3VO0A 2WV8A 3T44A 3PJTA 1GOWA 1XC4A 2DSKA 1TTJA 2QCMA 6TIMA 2D0FA 4S3KA 5E09A 2VWSA 2QEZA 4B4FA 3VC5A 4OV4A 1JYVA 5HDRA 2GGGA 4E8GA 2C6QA 3LTYA 3K30A 2J8FA 3T0CA 1MQRA 4B90A 4FIRA 3UWEA 3L4WA 1ISWA 8A3HA 2YBUA 4O50A 2Z6JA 1XJBA 3WQVA 2HV5A 4HP5A 4Y8EA 1G4EA 1QMLA 1XCFA 1G0CA 4GQQA 4CKQA 5BWFA 2GQ8A 4PL1A 4HZ6A 4WD0A 4JKKA 4DHGA 1K8YA 2HBVA 1RPXA 1J96A 1VFHA 4LGXA 3ARWA 3FKKA 1D8WA 4OJYA 3ARZA 3BCJA 2EPMX 2WNWA 5EBUA 5K9XA 2OWWA 3SB0A 1TZ7A 4DO4A 2CFFA 5IBXA 1KBBA 1ONWA 4Q3MA 2W4XA 4F2UA 2I7GA 3UJ2A 3TYZA 5EU9A 4XV0A 1B90A 3W72A 1M5WA 3WLLA 3HQNA 2WSYA 1GVQA 3UWVA 2WJEA 2X1TA 2C1IA 2QCGA 2XIIA 3EPOA 3C8FA 4R3UA 5AYXA 3TYUA 2CERA 5M1TA 2FDSA 3L5MA 4D6HA 3PTQA 1LP6A 3GIYA 4Q8UA 4UR7A 3H8AA 1VKFA 3EB3A 3V16A 3UNDA 1E9LA 2R94A 4KCUA 2UY3A 1TJPA 3GR8A 2AGTA 5HJLA 3N2BA 3H23A 4E4UA 3KS5A 1ITXA 5LNSA 3DBNA 2EPHA 2V3DA 4OBRA 3OW1A 1QPOA 4RDYA 4CEXC 1V8EA 3REQB 1KGUA 1S5TA 1F61A 1R3SA 3D3FA 1XBZA 4IIDA 4UOZA 2WMIA 3AMGA 1BRLB 3WLNA 4ASTA 3HMCA 4UTUA 1V3LA 3PUDA 4UTTA 2NLYA 1FFRA 2YDQA 3GXMA 4KRUA 4PRTA 1LBLA 3MCOA 4Q8MA 3BLKA 4PUWA 4D8ZA 5K4XA 3W6LA 2WMKA 3SR7A 5EMUA 2PRHA 3U3HA 1MO0A 2Y89A 4RE3A 1R3YA 1QNRA 5G2WA 3TDFA 3GLCA 1THFD 3GHSA 2ZUTA 4MNKA 4M82A 3MMTA 4O14A 2R8WA 2PD5A 4Y7EA 4GRSA 1B4EA 5CSYA 1OIMA 4S3CA 3AC0A 1GUVA 1JF6A 4JZ5A 4LVDA 2D1ZA 5A6BD 3W37A 3HZ3A 4HU4A 4LWWA 4HYRA 3TW9A 1VFLA 1XYBA 4UCGA 1UBPC 3THQA 5D09A 4EK7A 1XX1A 1GG0A 3GM8A 1WDPA 5A8QA 1AA1B 1XHGA 1NDYA 3VFCA 2CLLA 5A5WA 3DYOA 3GVVA 1AW1A 2ZRXA 1AMYA 3RLGA 3R6IA 3QZEA 4H6RA 1E71M 3J7HA 3QHOA 3BLDA 3SCVA 2OXNA 2PDUA 3ABXA 3PPFA 4HOZA 4LVGA 3WQ6A 4N7QA 1VFTA 2ZUWA 3NQ2A 1W2PA 1EIXA 5C9ZA 3CIWA 3G1DA 4FNRA 5IOBA 4M5PA 5DCEA 1FA2A 2P76A 3T81A 4NJGA 3MKCA 1J01A 2FDMA 2PDMA 3VCRA 1D3CA 2DSUA 2E6FA 3INPA 1U33A 1BWKA 4PUJA 2WNNA 1EJXC 1UR9A 1XH1A 1CGTA 5DO8A 2VZUA 3PAJA 3LZ3A 1CPUA 1C8QA 1SO5A 2QAFA 4JQ4A 3WEZA 1E4LA 4PB4A 3R0DA 4DJFC 1NOFA 4PTDA 4O1EA 4QE5A 4LRTA 4L9XA 1AH3A 1I2OA 4NT0A 3VPLA 3F4WA 4IPJA 4ERIA 3CZ8A 3AIEA 3E0VA 3S6DA 2MANA 3UWWA 1JR1A 4J3VA 2I5IA 2VM8A 3PY2A 3UNTA 4NY2A 3LSCA 3ABZA 4ZMGA 1YTKA 3RIKA 3ITVA 3QTGA 4RZ4A 2I14A 3PZOA 2QF8A 3CZJA 4M7SA 4O11A 1JZ6A 3N15A 3THAA 3RPMA 1XRSA 4GZEA 1RJQA 3C3UA 1Q63A 2DQXA 5LIYX 4LC8A 3VA8A 2R1KA 5AHFA 3FXYA 3HJEA 2DZXA 3PUGA 2A79A 2FGBA 3AO0A 5AHEA 1ZJHA 1SR0A 2OGYA 1LORA 3KVJA 2TRSA 3L0GA 3UCCA 2J6VA 2Y70A 4IFOA 3QY8A 3LUTA 4DJEA 3P8JA 3EZ4A 4L65A 3PWGA 1H11A 1GVYA 2FB2A 1GJUA 1TX0A 3LBCA 3NVDA 4XZBA 3I3EA 3L5LA 3WBXA 2BOEX 1M3UA 5E9AA 3VGHA 3FX4A 4MKNA 4BR1A 2R1MA 4XD6A 4QNEA 2CZFA 3FXGA 1OX6A 4M1RA 2XSAA 4W86A 1H1ZA 2D2OA 5FA5A 2XTKA 1RH9A 4I6KA 3UF9A 4ZQOA 4C60A 3NTYA 3T6CA 1ITCA 2WCAA 2D24A 1EOMA 3W9ZA 2J7DA 2YYTA 3IJLA 4U5IA 1Q45A 3I10A 2QIIA 1UD4A 5CAHA 5D2YA 5ENLA 1AL7A 4MKVA 4GO9A 1LRNA 5HNRA 4WOQA 3VILA 3M0MA 1PX3A 1RVKA 1G4PA 3W3OA 1GQLA 2P88A 4EXQA 4RPPA 4QXIA 3LHUA 2ABAA 5D05A 2BMBA 1AQ0A 4LU0A 2PWGA 3POHA 3RILA 2Z28A 4ZB2A 4DY1A 2ZDSA 1HJVA 1JZ4A 3QY7A 1R3TA 2HRWA 2OGJA 3ALGA 3N25A 2NQ5A 4C6BA 3ZYZA 1JAKA 1EF3A 3NGFA 1VS1A 3EDEA 3AXIA 3R2GA 4GINA 4WX2A 3QZ6A 1RD5A 1FDJA 4H7VA 3VDGA 2D3LA 1ME7A 4L1XA 3ME3A 1QNSA 4F0RA 1EP2A 1RK5A 4PFHA 3IGHX 4A8LA 4AZBA 1YPFA 2IKIA 1KBJA 2WWCA 3JZEA 1CGWA 2PU1A 1Z89A 4Z1BA 3GKAA 1WOBA 1B3WA 1KM3A 2CLHA 3ITLA 1RD6A 3ZLFA 3D47A 3BJFA 4UFIA 1IIHA 1FWIC 4DWSC 2DT0A 4Z1DA 3WBEA 5K7JA 3KXQA 3KLKA 3S47A 4GY0A 3NL3A 1F5ZA 3A5VA 3P62A 1W5OA 4W8AA 1ZUAX 1POKA 2PDIA 2XPKA 1J12A 3RR1A 1KM2A 4MM1A 3TWAA 3IJIA 2ACRA 3V4BA 1GKQA 1ZJBA 3CV1A 1HFBA 1Q7MA 1JUBA 3LHTA 1E43A 3T8QA 1XLIA 2HBXA 1I2PA 3ZMRA 3FVMA 3SGUA 4EANA 2Z27A 3A3XA 3L4UA 1Y5WA 2GDVA 3BOFA 1K9TA 3TFXA 1OM0A 3WDPP 4W84A 3SQLA 1TJ0A 3S5SA 3OZPA 1V03A 4DWSB 2WKGA 1XLCA 2BX7A 2EPNA 4H9UA 5XIMA 3U4AA 1Y8BA 3VNJA 4K2SA 3NQGA 4HYWA 1K8XA 3TAKA 4FPSA 4C7FA 3E9AA 4J1OA 2BVTA 1FWTA 3LI0A 4JX6A 1K77A 3UPWA 2BGQA 2Y5SA 2PGRA 2XWDA 3Q37A 3VZYA 5LKYA 1OZQA 3AHXA 2XN0A 3M6YA 3OJGA 3N4FA 4KRTA 3H2EA 4LPCA 1VYSX 4H2CA 5A94A 1BVZA 1ITQA 1CXEA 3H4GA 1J8VA 4O57A 1VLIA 2DIKA 5CZ0A 3EWXA 1OFOA 3WDIA 3SY8A 3RMJA 1UJQA 4NG3A 3OA3A 4IH3A 3CUZA 4WCJA 2JQXA 1B3VA 1JDAA 3CL6A 1OX4B 1XLFA 4ATDA 1C7SA 5AHLA 4QAIA 4E4FA 4G7FA 2D2GA 1JZ7A 5CEWA 4WK9A 1DBTA 3VIHA 3TTYA 3GH5A 3WK1A 1JPIA 4FSAA 4AU0A 2I1OA 1R6WA 4DXXA 1JJKA 2WCGA 4H7ZA 1MW2A 5E1QA 3GDTA 5LNVA 3TR2A 4HD5A 5HWJA 1W6TA 2R91A 4QR6A 4C91A 1AZ1A 3AS0A 5M2FX 4QLKA 1Q6CA 3D0CA 4NAFB 2AL1A 2DVTA 4CGTA 4QDMA 5GPRA 1PX4A 1TWDA 2PS2A 1M04A 5A8GA 4TOQA 4PSPA 2PB1A 4UFKA 3BLPX 2F84A 1H4PA 1QXLA 4LEFA 2QCHA 1WXJA 1WKYA 1IXPA 4GYPC 4N6FA 3SCQA 1EO5A 1W1ZA 2WB5A 2C1HA 1GZ1A 3CV6A 3DGRA 2PTZA 4HMCA 4AVFA 3GH4A 1N8FA 2GZXA 3M5VA 2BY0A 1E5JA 1XDMA 4OOUA 1H60A 4C7DA 5CJMA 3UG3A 3AJXA 1J6OA 3EX4A 4TIMA 1MEWA 1C8VA 1SR9A 5I3HA 1W1TA 2P3EA 1UR4A 3WQDA 1OFAA 3OZOA 2WJFA 4ZBCA 3ARSA 4LOCA 3RITA 3PJWA 3EWDA 2JKAA 1X96A 1V08A 3WEMA 4UTWC 1E15A 1DIEA 5LXEA 2JK2A 2PDWA 3GXNA 1JCJA 5AHIA 5G2IA 3NWRA 3CMGA 5AYIA 4MWAE 1ZS2A 3PBUA 2EJ1A 2F6UA 3CTLA 1YDYA 4ZQCA 1PWMA 5I7GA 2R1NA 4YL2A 1X7IA 4PZVA 5CBIA 4Z42C 3HB9A 3W84A 3AXMA 4HPXA 1PSCA 5TIMA 1KD0A 4IGMA 4G6CA 1G9HA 3T0AA 3U0HA 3AHYA 5EYWA 2KAUC 4CLMA 2VCCA 3DC8A 2ZADA 4G56A 1G69A 4YTSA 3L4ZA 1SZEA 1OCQA 3SUUA 4BEUA 1ESWA 1RP9A 3UWZA 3CAKA 3DBPA 2ZE3A 1NIUA 1NOUA 1TIWA 1CT5A 1Y7VA 4C6DA 1TZZA 4Q4KA 3CPGA 1UOKA 5HNTA 3A4WA 1AVAA 2OOGA 3U48A 3LV5A 1OG6A 1OEPA 1OCNA 2XIQA 3GHRA 5CGTA 1YDVA 1VIZA 5JXQA 1UROA 1V79A 3RMEA 4O8RA 3SN1A 3W71A 4HMNA 4JX4A 3OO2A 3EOUA 3RJXA 3WK3A 1XD0A 3EA1A 3P8IA 5C0QA 4H9XA 3OA5A 3K1DA 2NT1A 4PMVA 1F4HA 1XICA 1GPFA 1RBOB 1E3XA 3PR2A 2RGMA 1W9VA 2XSXA 3T4WA 4QS6A 1B31A 3P5YA 1J0KA 1GHRA 1O12A 4QGCA 1FWRA 1TA3B 2A0NA 2CWXA 4LF2A 4XG1A 3GW3A 5FJPA 3KWSA 4BFAA 4XZ9A 2Y7FA 3WLHA 1FWDC 1DV7A 1HL9A 3CEPA 2NSXA 1RJPA 2ZUVA 3UG5A 4AIEA 4URIA 1G6CA 1KM1A 4GXPA 3FAXA 1GTEA 5E6ZA 3NQFA 3CMFA 1PDZA 4ZQNA 3NQEA 5A8MA 2CPUA 3TLQA 3B9NA 1UIOA 1AQHA 1DXEA 2QJJA 3T05A 4DM2A 3DFPA 2DZBA 3IWPA 2I56A 3M9YA 3HA1A 1W5QA 5EMMA 3GU9A 3ARUA 2E5BA 2PDCA 3EDJA 4CD7A 3W7GA 4HHPA 1J5SA 4OQVA 2FTYA 1HJSA 1KRMA 2WHKA 5BCAA 2Z1SA 2H3BA 1GPWA 2VR4A 4LYKA 1MNSA 3RLVA 4ES4A 3EOSA 4M6VA 3GC5A 1I0BA 3ITYA 4ROPA 1V4YA 1EHAA 3N9RA 1Z6KA 3QV8A 4S3FA 1R5YA 1RBLA 4NHVA 3W82A 2H9AA 1TV5A 3T40A 4MIMA 3M0VA 3CUXA 3WUFA 4E38A 2D73A 4H1ZA 1MUMA 3LGEA 4BHYA 3VE7A 4MF4A 1ODUA 1ZALA 2AAMA 2ODOA 5BOOA 5H6HA 3URBA 3M4HA 5J5DA 1EYEA 2Z4GA 5EKYA 3VUPA 3KEHA 3GC4A 1KFCA 4KCVA 1LWJA 3VIKA 4GCAA 3AIVA 1EB3A 3ARXA 1ICSA 3EMCA 3KS6A 3HOJA 1YBQB 1TV7A 3R0UA 5C71A 2Z7GA 4MSSA 3WQCA 3QR3A 4FF5A 3BH4A 5JUVA 1V6YA 1W1YA 1MI3A 3M0LA 2XH7A 3S5OA 3N29A 5A3HA 1PBGA 3SCWA 1NDVA 4LVAA 1KXTA 2DT3A 4B15A 2Z6IA 4I9JA 2DH3A 3TOYA 5FSEC 3CPRA 3B06A 3AHTA 2CLKA 1WCGA 3DFNA 4PULA 2QCDA 2TAAA 3SCSA 5EGRA 5KITA 3W7IA 4GFSA 5D32A 1WDSA 1AUSL 1V7YA 2VZTA 1R38A 3B9DA 3GB6A 3PFMA 4YXGA 1PJ9A 2QDGA 3O07A 1UR0A 3OHIA 3C0QA 3EWYA 4JQ2A 1EC8A 4OBSA 4AEEA 1VCVA 2NWRA 2BHYA 2XUCA 1GOOA 3BSGA 3PJUA 4FNUA 1W3TA 2VKZG 3QZAA 4ZE5A 3KTXA 2JF6A 3NIYA 2X1UA 3VD9A 3C2VA 3B8TA 1IT8A 3WX7A 5REQB 1KTBA 1JPMA 1R3VA 3PFRA 5CQ1A 3U9IA 4FA3A 4LV4A 3IK4A 3ATZA 2H3DA 1TJRA 4I7WA 2DZSA 1XS2A 3E74A 2ALDA 1ODZA 2VWTA 5BRPA 2EG6A 2QJIA 1DL3A 1JRCA 1XKYA 4UR9A 3H2CA 4QBXA 1C7TA 3TCEA 3W7EA 1X98A 1BTMA 3U7VA 1EF2A 3W1QA 4XTIA 3MHFA 1K6AA 2VGGA 4D6FA 1E1EA 5AZ0A 1QFEA 3GWQA 3SY1A 3V5FA 4LC6A 2QDDA 1RVGA 4RE2A 1XC6A 2QNEA 1TWSA 3EBVA 4BK9A 4HJWA 3DC0A 2QPXA 1JYNA 1HP5A 2QW5A 4LYRA 5DCDA 4CCEA 1BYCA 3MSGA 2VZSA 3P80A 3MUXA 3MV11 3TJIA 1XH2A 4KMQA 1G4TA 1IWAA 4Y8FA 2NUYA 2J8GA 1KXHA 3TTOA 1QU4A 5EFFA 2F7FA 4CCDA 4HQVA 4C6PA 3PS7A 4DX3A 3PB0A 1WYIA 3CC1A 1XUUA 5H91A 3V1PA 4K7YA 4YTRA 2YCKX 3H53A 1Q6GA 3W2MA 3LM3A 4QSHA 1K6WA 2YDAA 4HNLA 3R8RA 2FPTA 2ZIDA 2Y7DA 3BQ6A 3C8NA 1EC7A 4M6PA 5TF0A 1RAKA 2YB4A 3DHFA 3P0WA 1S5VA 1JNEA 4Y90A 4NRRA 1EGVA 2NT0A 2W9MA 3L0KA 3W24A 3KBNA 2WJZA 4MWAA 5HBFA 4FS9A 2PC4A 2ABBA 3RX3A 3PZVA 4HJFA 1EBGA 1WDDA 3AHVA 4KH2A 4LVBA 2ZA2A 3VNMA 3DHPA 1V93A 4N02A 3A3WA 3BQ5A 5LNRA 4RE4A 2QPSA 3CJPA 3TE9A 5C6MA 4G9PA 1GVRA 3MBFA 2DIEA 4RCXA 4JFVA 2BHZA 4HK6A 3WLSA 2DSVA 4GUIA 4O53A 2JE8A 4L6OA 2IQ0A 4KCWA 1UQZA 2H8XA 1DIOA 3PG8A 2QYGA 3B03A 3AHZA 1XBVA 1BD0A 1QBAA 5FF4A 4Q7NA 3N11A 1OC7A 2QUMA 2VP8A 2P0OA 5EB8A 3Q67A 5F2MA 2POZA 2PRMA 3GFZA 3WLQA 3CZKA 4JTKA 5LA0A 2RGLA 2OB3A 5JH1A 5BYWA 3MI6A 5HATA 4IUOA 3EMQA 2VUNA 2ZX7A 4Q4OA 4LANA 1O6IA 4H3DA 3QQWA 3SURA 2QKFA 3TTEA 3WY1A 2VC7A 1FHUA 3RG6A 4HN8A 4MY9A 1ME9A 4F2BA 2A5HA 1R86A 5HNNA 5CSSA 2V5BA 3WNKA 4MNMA 2DEPA 4EWND 3LENA 4QQ3A 1P6BA 3AZRA 1MNZA 2ZX6A 1BHGA 1TIMA 3T55A 2ATMA 1DWFM 5HMDA 1EXPA 4FF7A 2AGKA 3MZNA 3LCIA 1XYLA 2YOCA 3PSVA 3E5BA 3NAVA 2CZVA 4M0XA 3RR4A 3A4JA 1FP8A 1ZP3A 5HQMA 2DU2A 3RYSA 2PGWA 4WY0A 1KTCA 4W89A 2VFHA 3LX9A 1PO9A 4G5DA 1DHPA 4S3EA 3CQKA 3T0TA 1KM6A 4Q8OA 5CLTA 1YTEA 3QYSA 1XBXA 3SCTA 4GABA 2PWEA 5I78A 1EJ7L 1YTDA 2Q8XA 4IFKA 4H6EA 4O0QA 4KRZA 3QHNA 1BKHA 1JI1A 4Z2JA 2IQDA 3NL6A 1V3MA 3AAMA 4AUBA 4DBSA 3G8RA 3FN9A 3QRHA 2FHFA 2OR2A 1JQVA 4NNCA 1R8LA 4K7VA 1YQ2A 1O94A 3O16A 3KFTA 4LBSA 5LYRA 1SO3A 1TR1A 3CZGA 1JCTA 7XIMA 2Y8UA 3DIPA 4DPQA 1CWYA 5EY5A 3BJTA 2X42A 3FDKA 4F40A 1V7AA 5IXEA 2WLYA 3BLFA 1S2UA 3LNMA 1Z32X 5AFDA 1LCOA 3B8SA 1NWTA 2X2YA 3R8GA 4DQWA 3T42A 1R2SA 4GNKB 2VD9A 3PTKA 5DFAA 4F8XA 4R33A 4XZNX 3A24A 2WVVA 3UG8A 3QHMA 3RRXA 3KRSA 3S3GA 1SJAA 4HU0A 3I3BA 2YZ5A 2DW6A 1GCYA 4UB9A 2DGAA 1HX0A 4LUIA 1A3WA 1SW7A 2ISSA 1GHSA 1V3IA 4PCSA 1XYFA 5ABHA 1OD0A 2RH9A 3PF3A 4Y6GA 2FZ8A 2WVUA 1QPNA 3USZA 2Z1BA 4EKJA 4W85A 2HNHA 2QJGA 1W9PA 3QH2A 8TIMA 3LN3A 2HISA 5FJTA 4QDWA 3DFSA 1DJWA 2H8ZA 5B7ZA 4JIQA 1OFDA 1HF6A 4IWWA 3NPXA 5I3KA 1W9XA 4CNOA 4IJRA 5HOSA 2VCBA 3VKDA 3I4EA 4JHMA 1EZ2A 3UZZA 3RK8A 3OZYA 4E8CA 4V2XA 1Q8AA 2VELA 3LBMA 2YSWA 1A5OC 4F0SA 3ATYA 3B9OA 1MSSA 4LY4A 1XIIA 2ZZ2A 3QGVA 5HXMA 4O15A 1EJSC 4MZ8A 3W23A 5CC7A 1EGZA 2ZQ0A 3STEA 1VFUA 1GJWA 3BV4A 4HVXA 1AG1O 3VIFA 2AL2B 2QUNA 4XKMA 2ISFA 1OT2A 3G2GA 3MO7A 2HS8A 3SRHA 4Z2LA 4L4MA 3CASA 3WMSA 4BI5A 4ZO8A 4ILSA 3MY9A 1QI3A 2XH0A 4E2DA 1W9DM 4IISA 3IJ7A 3KL0A 4WQ6A 3W73A 5KZ6A 3UERA 3FJ6A 5K9CA 1W5PA 4AZCB 2EKCA 3OG2A 3B9EA 3UT0A 4DUVA 4Q8WA 2ICSA 5FEXA 1X97A 4AHPA 3W0KA 4B4HA 3HMJG 1W3LA 3DKJA 4K38A 4AF0B 3P81A 2W91A 1WKEA 3W70A 3L67A 2VYOA 3TN3A