4JTKA

Crystal structure of r117q mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
277
structure length
252
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLAQQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQTRGRRAQALDLALAGMATRLAGLFLELHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Examining the Role of Intersubunit Contacts in Catalysis by 3-Deoxy-d-manno-octulosonate 8-Phosphate Synthase.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 87
structure length 252
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtkA00
4WY0B 4C1KA 4FF7A 1O95A 4O1CA 3NQEA 4MFEA 2GVLA 1N7KA 1QDSA 5AHMA 1ZNNA 3HIJA 1W37A 3N9RA 1AW5A 4WXYA 4IOTA 1QFEA 3DXIA 3W7HA 1GOXA 1QCWA 2E5CA 4M6VA 3PUOA 5HR7A 2JGQA 3GB6A 4LW7A 1XKYA 3W84A 2WSRA 2X30A 5FEWA 3L66A 4MVAA 1FBAA 1KFLA 3TDFA 5CPLA 1OF8A 4JTGA 1VQTA 1KM4A 4M7SA 1B9BA 3SFKA 5LNSA 3DI1A 1XBXA 4AAJA 2FJKA 3DFPA 4ALDA 3S1WA 3S8HA 3TJXA 4H6KA 1QAPA 4LT9A 3S5NA 4EOUA 2PRHA 2V2DA 3NL6A 3LTSA 2ZA2A 2VFDA 3GIYA 3R8RA 2O7SA 3B03A 1O94A 3M6YA 2V2CA 4CNPA 3Q58A 3T78A 5G2HA 3LHYA 2TYSA 4AH7A 3CIXA 1XDLA 3W7MA 4XQ6A 5CPOA 3EEGA 3PBYA 5KMYA 3B05A 5LNWA 5HULA 1Q6QA 3CPRA 3QQ0A 5LGXA 3M16A 3UY7A 4BK9A 5AN7A 5K4XA 5EA9A 1VYRA 3PULA 1XFBA 2J27A 3KRSA 4N2YA 5D30A 1TYGA 2PURA 5AC8A 2R8WA 3WJSA 2NLIA 1TTIA 4AXKA 1FWSA 1TPH1 3QZEA 4JTLA 4NU7A 3MW7A 1YPIA 2OZ0A 1DKWA 2YFOA 1EP2A 5AOUA 3G8RA 1IXOA 2NUYA 4UXDA 2QAPA 3E49A 4BFAA 1TV7A 1VPXA 1XC4A 1VRDA 2TMDA 1RD5A 1FDZA 3P81A 4HHPA 2AQWA 4IMCA 2NV1A 4EF9A 3B8DA 2OCZA 1KBIA 3FIGA 5DBTA 4QQ3A 1VCVA 4R34A 5G1TA 2GOUA 3C4UA 1OFPA 1Q45A 1R46A 2QUTA 2W6RA 3EWBX 2VOMA 3L2IA 2ZRUA 1G6CA 3RFAA 1NEYA 3TROA 2YSWA 3PBVA 2XN0A 1LRNA 3HF3A 1J4EA 1UBSA 3DFSA 5L6UA 5L9FA 3FKRA 3OBKA 1WV2A 2WKJA 1JRCA 3P74A 3NR0A 4JYDA 1YTKA 3RLUA 3O8AA 1XBVA 2ZDRA 4FEZA 2WQPA 1MEHA 2ZZ3A 4DPPA 3N9SA 1QPRA 5KZMA 1LP6A 4FX8A 3HOJA 3DFOA 3HO8A 3UPBA 1UB3A 2ZZ7A 3NL5A 4GC4A 4P61A 2Z0IA 1PHQA 4DPQA 3G1HA 1G4SA 5DY3A 3N19B 2QCGA 2GQ9A 5F4WA 3DI0A 5K9CA 1EP1A 1RVGA 3HGSA 3BVJA 4UFIA 1OFEA 5K9DA 2Y7FA 1R2RA 2WO5A 4O12A 4O11A 5TQLA 2ALDA 6ALDA 3BGGA 3M9YA 2J9XA 2ZTKA 4N9BA 1DBTA 4FO4A 4GE8A 2YW4A 1D3HA 4JTSA 3W1QA 1TTQA 2QCDB 3KOFA 3W7QA 3GDLA 3OG3A 3OVPA 1JCXA 3GX9A 1KA9F 1NF0A 3W73A 2CLFA 1YDOA 4WZHA 3UWUA 1H62A 5HUOA 3W72A 3W83A 1N8FA 5SWUA 4LVAA 1ME7A 3TX9A 3USBA 1SW0A 3SIZA 3EXTA 5G4EA 1M7OA 1A53A 2W0UA 3LCFA 3S5YA 1PCWA 1K8ZA 2WNNA 3DBPA 2GJNA 1JUKA 1GVSA 3GDTA 5K7JA 4NXKA 5EY5A 4PA8A 2CZEA 2WPBA 1TJRA 3BK0A 4D2JA 3WJWA 4MZ1A 2ISVA 5CG7A 2YX0A 1Z44A 4NJKA 2ATMA 4CNNA 5F2MA 3G1DA 3TA6A 3KVMA 2GQ8A 5A8GA 3FJ6A 3TXVA 5EL1A 2PRMA 1YDVA 2A7PA 4NNAA 1B57A 3NQ2A 4MZYA 4O1AA 1H7PA 3MMTA 2FQIA 3NQAA 2FIQA 1JCJA 3QRHA 1K02A 4IUOA 3NA8A 4LS1A 1O4UA 5F2LA 1G7UA 4YL2A 2VFEA 4DO5A 2X1UA 1O60A 1XBYA 3HJZA 3NQCA 3DAQA 3I6RA 3U8GA 3BLEA 3JR2A 2BSLA 1VGAA 2B7PA 3LERA 2OT1A 1OFAA 2FB3A 4AWTA 3OA3A 1Q6LA 1GPWA 4GUIA 3HG2A 4DBEA 3QPZA 3L0NA 2ZZ6A 5LHEA 4TU1A 3JRKA 4LV9A 3IV3A 3G1VA 1KLZA 1ML1A 1L2UA 2LLEA 2ZZ5A 3ZWSA 3TQKA 3ELFA 3W88A 4Y9AA 1TJPA 1JUEA 4JX4A 2OX1A 5ABTA 4L4MA 1R30A 1G4PA 1H61A 2Z2UA 2H3BA 3Q2DA 2NUWA 2QAFA 3G1XA 3MYOA 3GNNA 3MHFA 1TQXA 1KM0A 3I7RA 3A5FA 1AL7A 4IMDA 3ABOA 4X22A 1YTDA 3FFSA 1W5MA 2X16A 4MJZA 4K6AA 4Z1BA 4WJEA 3MUXA 2X1RA 4JTUA 1SO4A 4N6EA 1JJKA 4IPIA 1LOSA 3UD6A 1EB3A 1WA3A 3O1NA 1S3HA 3DZ1A 4MLRA 1YADA 1OX5A 3INPA 3T55A 2X1SA 4QJ1A 3LTYA 2NX1A 1ALDA 4O8RA 1H7NA 1ICQA 3L5LA 4ZQMA 3NNTA 3LBMA 5FF2A 3IIPA 3W7IA 1ZAHA 3M5YA 4QM1A 5D37A 3SSJA 2Y62A 3DFQA 4MKNA 3UPWA 1M7PA 1FCBA 3BG3A 3B04A 4LTSA 4UFLA 2A1YA 3HQ1A 1P0KA 5IBXA 4A29A 3LHZA 1N55A 4DBDA 3QFEA 4N6FA 4RJEA 5CSRA 1K03A 4ADTA 1KM2A 3P84A 1A5CA 1TPVA 1OG0A 1P0NA 3KAOA 3UWQA 4XWUA 1ZJIA 3C2OA 3TC7A 1HO1A 2E77A 4JTJA 5HJLA 1EX5A 6TIMA 4MY9A 2BWGA 1J2WA 3EWUA 3L67A 5C54A 1DHPA 4K8EA 4O0KA 4AMAA 1LLWA 3WK1A 3NPWA 3PSVA 1H50A 3TNOA 1KM6A 3TH6A 1VR6A 3A5VA 4A21A 3ABQA 2F7FA 3CLMA 5C55A 4K8HA 3NM1A 2JKEA 3SGUA 3ZWTA 5AYYA 3CTLA 1EWDA 3LCGA 4JTEA 4UTIA 4UFJA 4Z1AA 4MZ8A 1H51A 3K30A 1M5WA 5KZDA 4BWLA 3NQ8A 3QM3A 4NZJA 2QUUA 4AWUA 3HMJG 3VE9A 1O5KA 1F6KA 1DV7A 5AYZA 3E9AA 3ATZA 4GXMA 4JTFA 4EF8A 2XN1A 3STGA 3TMLA 3DH7A 1ZFJA 4MY1A 1VLWA 3GXTA 3TMQA 2I1OA 2UV8G 1DJQA 3KXQA 5I3GA 2NXIA 3U2OA 3HGJA 3R2GA 3M43A 3M1ZA 4E38A 3I65A 3C2RA 4CCCA 1SPQA 2ZRVA 5F1VA 2DZXA 1S5VA 1OFQA 4NXSA 1YLVA 3G18A 4BI5A 1GEQA 3FYOA 2B7NA 3QC3A 3T7VA 5TIMA 4O28A 4AF0B 2E68A 1UJPA 4G1KA 2J6XA 5CPNA 4N9DA 2JKAA 3FYPA 1RZMA 4UNLA 3BW2A 2RKXA 4LNYA 3MP4A 4JTIA 2FPYA 1HFBA 1PS9A 1W3NA 2QCEA 1P1XA 4AHPA 4OWGA 5LKYA 1I2RA 4RZ6A 1C29A 1AMKA 4WOZA 2YGYA 3DHFA 3THAA 4DF0A 4UFMA 3S1UA 3C52A 1X8FA 4X9SA 5D2YA 4E2BA 4JICA 4IXHA 3C2EA 3IGSA 3TW6A 1YXDA 3FS2A 1DVJA 4QIUA 3LHWA 5U4NA 3IVUA 4LVFA 3W1MA 2E6AA 4JGDA 2EGZA 2BZNA 1GTEA 3A22A 2H6RA 5CPMA 3G1SA 4PC8A 1XCFA 4K38A 1GZGA 1SO3A 1U83A 3CQ0A 4S2BA 3UZJA 4LU0A 2RHGA 2PC4A 3A23A 4YLWA 3C3NA 2QCMA 3B0UX 3LCHA 2YW3A 4XZ9A 2BLEA 3C56A 1K8XA 2A6NA 1ICSA 4CLMA 5FF3A 3W2KA 4ADUA 4LRSA 1Z48A 3CT7A 5IM51 5H2ZA 3W7NA 5HMSA 4XTDA 4UTMA 4NJJA 2VENA 1WXJA 5G1YA 3UXAA 1BTMA 4M7TA 5J5DA 4JDBA 3P5YA 3I7SA 4R33A 4OV4A 1IXPA 3LXAA 1LRQA 1DQXA 1JCYA 5HR6A 5C5YA 4IMGA 3GKAA 2QJHA 2VEPA 4TMCA 1GG0A 3W7LA 5HINA 4NT0A 3WK0A 1F5ZA 2F84A 4RV8A 3PR2A 1X7FA 3SY5A 1F76A 2TRSA 5BMXA 3EWZA 2X2GA 3W1LA 5BNKA 3OHIA 4S1FA 3TXZA 1MEWA 1VLIA 3V75A 4I7WA 1XM3A 4NZFA 5C6MA 1LM1A 4GRSA 1TREA 3O63A 1SFLA 4OQVA 2Z6JA 4HNUA 3IIZA 1JUBA 3W7OA 5FF0A 5D03A 4PFMA 3HPZA 3M47A 1IXQA 2P0OA 3ZR4A 3QPYA 3L0GA 4FX7A 2V8ZA 1ZENA 2GQAA 2B0MA 1WAUA 5LNVA 1Y0EA 3LX9A 3M0ZA 1GTHA 1JULA 4JX5A 2HS8A 4WXZA 3TV8A 5FI8A 4WX2A 2WSQA 2GUUA 2BTMA 1JRBA 3CWOX 4M6PA 5HNRA 4N9CA 4IPJA 3HBLA 1UCWA 3WFAA 2WJZA 5KTLA 4UTHA 3NOEA 3TKFA 5K3VA 1F73A 1SQ7A 4QSHA 1TSIA 1B3OA 4O53A 4O15A 3C2FA 3W1AA 3LCWA 1EUAA 4POCA 1AL8A 3ATYA 3TU9A 3OVQA 1KFEA 4NJHA 2GVJA 2QCHA 2A2IA 1KM3A 4O4VA 4WD0A 1LBMA 2A7RA 1X1ZA 2CFFA 3GXPA 3R5EA 4JXCA 4JYEA 4JX6A 4ZQOA 3W85A 2QDHA 1W31A 1MSSA 3PBWA 1RPXA 4UTLA 5D32A 2DZTA 4MFDA 4IGHA 3UNDA 4ZVJA 1QPQA 2C14A 3GYEA 1PE1A 4N4PA 1YYAA 3PWAA 4I9AA 3FEMA 3LRLA 5G2IA 4HSNA 1KFKA 4OT7A 2ISWA 2J9YA 1TPFA 4RXGA 3R12A 3FOKA 1LLZA 3LBCA 2E09A 4GUHA 1SFJA 2DZPA 4JIQA 3KVLA 4JIPA 3KVJA 3L68A 4O10A 2FFCA 1VCFA 3H54A 4JD4A 5BW6A 3TQVA 3NL2A 2EAWA 1OX4A 2QEZA 3W2JA 2CLOA 3PM6A 1FDYA 2WV8A 2C16A 4PCFA 2R14A 2BXVA 1VHCA 3GAKA 1J5TA 3LXCA 4DXVA 4MLJA 1W3IA 4OBTA 4JS3A 4O4WA 3C8FA 5G4WA 4HIBA 3LV6A 4FNTA 3IVSA 2YDAA 4LV4A 4DF2A 4QNWA 1ME8A 2FB2A 3BW3A 2E6FA 2H8ZA 4RLIA 3IVTA 2C0AA 3QQ1A 3W7PA 4PODA 4ML9A 2Y61A 4N4QA 5DXXA 4IXXA 3W2UA 2IQTA 4MYXA 1CX9A 2WNZA 4U4MA 2FPVA 3RLVA 1CI1A 1FUYA 3EX4A 1U5JA 5FESA 3LHUA 3LXBA 3F4NA 5IBXC 2HMCA 1YPFA 3EB2A 2ZA1A 1OJXA 3HG4A 3G1AA 2RDUA 2DZWA 3W70A 5KZEA 4BF9A 2CW6A 1Z42A 2AGKA 4EIVA 2R91A 2YXGA 1XUUA 2YFNA 2Y6ZA 2NWRA 4M6QA 2J24A 7TIMA 3YPIA 3BG5A 4FIQA 4HNNA 2QR6A 1GJPA 5K2ZA 1SW7A 1LOLA 3Q37A 1QWGA 2CWNA 3PB2A 3SZ8A 3O6YX 5D2XA 2WNQA 4E2DA 3MHGA 1FCVA 3MYPA 3W22A 1VC4A 1E51A 3G0UA 3SECA 1RQEA 3IIXA 5CZJA 3TW7A 2QF7A 3BV4A 3NEVA 4BWLC 5LZLA 4J9JA 4EWND 2ZFAA 1F7BA 1GWJA 3PG9A 3W2MA 2Q3OA 4HNTA 3G3MA 4TR9A 2VEMA 3S0CA 4UTTA 1TPB1 3EX2A 5F2GA 3L21A 1UASA 1TO3A 4ORMA 2WSYA 4DEFA 3PC0A 3SI9A 3H53A 1G67A 4NUWA 3S1VA 3UY8A 1W0MA 4UR8A 2VEKA 3AO0A 4AF0A 2CU0A 1QPOA 2DZUA 1ONRA 2ISSA 1QR7A 3DU0A 5EMUA 2YZRA 1HO4A 5F4XA 1FDJA 5DCBA 5F1UA 4HSOA 4LWWA 2KZHA 3P61A 1FCUA 4LVGA 3L5AA 2A4AA 4JTKA 3VFLA 5E1QA 1QOQA 4LUJA 3BGJA 1I45A 1SZEA 2EKCA 1FXPA 3TUUA 5CZSA 3G3DA 4GJ1A 3W7KA 1VYPX 1SW3A 3I7QA 1I4NA 1KBJA 4A3UA 3GXNA 3NQGA 3P62A 3TK7A 1MZHA 1DOSA 5DCDA 2AAMA 1OK4A 4LY8A 5I3KA 3S9YA 1F6PA 1L6WA 3QJAA 2C3ZA 4LS0A 4Y96A 4O1BA 1SZGA 3M44A 1I2OA 3TFCA 2DJXA 1WBHA 5FEXA 3B0PA 2C6QA 1LBFA 3VKJA 3PG8A 4ZQCA 3DKLA 4WY0A 3GR7A 3W07A 4QITA 3UWVA 2J9ZA 2DJLA 3RU6A 3GNDA 4RCXA 5TBOA 4NJIA 2V81A 2OJPA 2V0TA 1K7FA 2DORA 1VH7A 3H55A 5EKYA 5MHBA 2Q8LA 1GT8A 2ZZ1A 2E6DA 1F2JA 3UWYA 3NVTA 4QNEA 2ATSA 2Q3RA 4O17A 1YDNA 3EWXA 5AHLA 1H60A 1FWWA 1CW2A 1A5AA 3MP5A 3W75A 3QSRA 3T44A 2I14A 3MWAA 1H1ZA 4A22A 4TIMA 3W87A 3PY2A 2HTMA 4YXGA 2W79A 1TV8A 3TAKA 4RX0A 2FLIA 3IRDA 4K37A 5D2TA 4OU1A 1OHLA 1XI3A 2ZRXA 3WK3A 1TPEA 3G8EA 3KX6A 3QW4B 3EXRA 5E0KA 3W1XA 1GYNA 2ZZ2A 5FEZA 2YPIA 2VFFA 3OEXA 4CNOA 2YYTA 3N2XA 4IQLA 2C13A 1THFD 5CKSA 1XXXA 3QEZA 3PVFA 3GK0A 2ABAA 2BX7A 1QO2A 4Z1DA 4FNRA 5GVJA 1FX6A 5DELA 4ZQRA 5LNRA 2H3DA 5DCEA 1FWTA 4IX2A 4UTUA 3G0XA 3LLDA 1JCNA 3LRMA 1Z41A 2VFGA 4YMZA 3N34A 3NPXA 4BI7A 1G4TA 4NNCA 2YYUA 2Y85A 2Y7EA 3EWYA 4UMCA 1NFBA 1O5XA 3SR7A 1K7EA 1I2QA 2Y63A 5C2XA 3M5VA 1IIHA 3BG9A 1PIIA 1ZAJA 1DL3A 5D09A 2DZSA 3LI1A 3IEBA 3T4CA 4I7VA 5D04C 4Z0JA 4CQ9A 4Y90A 1LRTA 1XL9A 1YXCA 3AJXA 1TPC1 1FY6A 4AVFA 2ZRYA 3HG3A 1K7XA 2QCNA 4JYFA 5FEPA 1LOQA 1G69A 4JY9A 4K7YA 5D2VA 3L65A 1V5XA 1LTDA 3P60A 4DQWA 1IGSA 4FNQA 3DGRA 1TTJA 3ZFHA 3UXDA 3O06A 4OHQA 3L5MA 4UNKA 1OFDA 3OIXA 3I68A 5DY2A 2NV2A 4O14A 3N3MA 1W5QA 3LCXA 2D73A 1DQWA 3TE9A 1WQ5A 1SR9A 1GG1A 3MP3A 1H1YA 4LRTA 3WJYA 4L4LA 3B4UA 1LCOA 3DHDA 3W86A 2VXNA 2Y70A 4JEQA 4M19A 3D0CA 1LZOA 2E5BA 1GVOA 2GPTA 3HPXA 3NXFA 2H8XA 3NGJA 4H4IA 1LORA 4JN6A 4FHAA 3P7YA 1I2PA 4FIRA 4ZZ9A 4R53A 2E1DA 2Q8ZA 3CWNA 5LHFA 3O6DA 2A5HA 4R7JA 1ME9A 4NVTA 3PF3A 2CZ5A 3PBUA 5FF4A 4K36A 4FB7A 5AYXA 1OFRA 1WYIA 1C9DA 2P10A 2VFIA 3BARA 1ICPA 1RQBA 3GDKA 3W23A 1FXQA 3G1YA 3N2MA 3DKJA 1GVRA 3UZ5A 2VELA 4DELA 4XKYB 3CHVA 4NJGA 3STEA 3MBFA 3IIVA 4XBSA 5AHIA 1B4KA 3STFA 3PUDA 3S42A 2C18A 2G97A 1S5TA 1OFOA 5HUPA 3SJ3A 2PE4A 3RK8A 3GDMA 1BKSA 3NG3A 5BRBA 5DLCA 4RZ5A 2CLMA 2QCDA 3NZ1A 1VJIA 4RR4A 4BI6A 4X3ZA 3TC6A 4A2RA 4LOCA 1L6SA 1OYBA 1W3TA 3P80A 2R94A 2TPSA 5HWNA 1TTPA 3GR8A 2XFWA 1GVFA 4IMEA 5AFDA 3CC1A 3O16A 3EWWA 5D38A 1JCMP 2NX9A 3G22A 4AEOA 4KWVA 4HPXA 4O50A 1SU5A 2RDWA 3P8IA 1KTBA 4O54A 2C19A 3NM3A 1UUOA 3L0KA 3PAJA 1JCLA 2JBMA 3M5ZA 4B5NA 3S1XA 3W7CA 1M6JA 4AB4A 4E0CA 3QW3A 4TO8A 3TSMA 3ANYA 1EPXA 4MY8A 3LHTA 1AK5A 3M7WA 3V1PA 3TQ0A 4N9EA 1FQ0A 3RNDA 4Z08A 4HT3A 5I3FA 4UCGA 3U6WA 4K7VA 3S5ZA 4LC8A 2EF9A 3LV5A 3TSDA 2RFGA 1KFBA 4ONVA 3PSWA 1UUMA 2CLKA 4FXRA 3EX3A 1ADOA 1PV8A 3QH2A 1H5YA 2QCLA 3EKLA 2VEIA 3EKZA 1VZWA 2QDGA 1W5OA 2CLHA 2HS6A 4DO6A 1EEPA 3LHVA 1OF6A 3GLCA 1PVNA 4A2SA 3DFNA 3O05A 1ZAIA 1QNVA 3ABSA 2V9DA 5BOOA 2VKZG 3NPVA 1AW1A 1EWEA 3R13A 2V2HA 1LROA 3BW4A 4Q33A 5LSMA 3E96A 2A7NA 1R2TA 3IGUA 3KHJA 4UTTC 3KFTA 3QMRA 3WJXA 3MI6A 1KV5A 3GKFA 5KITA 2B7OA 3L9CA 2Y89A 1TQJA 4CCEA 4YWIA 1L6YA 4UTJA 1W5PA 5K9XA 3C0JA 1SUXA 4GUJA 5EBUA 1OABA 1T96A 2NX3A 4AHQA 1D3GA 2I9EA 1PHWA 4IMFA 1I2NA 1I8JA 5AHEA 1D9EA 3CU2A 3HB9A 4C1LA 3W71A 2FTPA 3O15A 2NWSA 4UTWA 3F03K 3P8JA 3LCLA 2CLLA 3NQDA 5D2WA 1W56A 3W1UA 1TCDA 3LLFA 3E12A 3W1TA 2FPTA 2QUVA 4JDYA 4P2VA 3STCA 4H3DA 4ICNA 2YCEA 4HKPA 5F4SA 2C15A 5D05A 2VFHA 2CLEA 2A21A 2QCCA 2QKFA 1LYXA 4Z0SA 4IWWA 1G7VA 1TPDA 1EUNA 2OT0A 3ZS4A 1H63A 3HPSA 2RDTA 4TMBA 4CQAA 1MO0A 5CZ0A 5I3IA 4LVDA 4OE7A 4LC6A 1EIXA 3PS7A 5AHFA 4PL2A 4PH6A 4MOZA 4NNBA 1IXNA 3KRZA 3W1RA 3NZRA 5K4ZA 2PCQA 4OV9A 3W76A 1OYCA 2VC6A 5T26A 4RK8A 2G96A 4IX0A 2ZBTA 5DBUA 1PL9A 1YTEA 3IGXA 3RMJA 3RF9A 3M5XA 4Y6GA 5CZTA 4FNPA 1K8YA 2NXGA 3GDRA 2ZA3A 1WOAA 4YCOA 1PCKA 1SO5A 3TAOA 4UMBA 5KINA 2C1HA 4KKXA 4XTIA 3O6CA 4MUZA 5H91A 1AG1O 3G1FA 4FX6M 4LVBA 3W74A 3LGEA 2FDSA 1MEIA 4HNVA 1JQXA 3SGZA 1B4EA 4O52A 2B7QA 2Z1BA 3P82A 1A5SA 3W3OA 4Q32A 4W9TA 4WUIA 2DU2A 3VCRA 1SZNA 3MI3A 2QJIA 2NZLA 4RXFA 4PEKA 4GFSA 2HSAA 3BPWA 1QO5A 4BR1A 2EPHA 4O0ZA 3F4WA 3CEPA 3QSTA 1TV5A 3UYCA 3QMTA 3LI0A 3HGRA 3KVKA 3FJLA 3WJZA 3W9ZA 2QCFA 4IJBA 1QMLA 3SW6A 2V30A 1VHNA 3PUEA 2ZTJA 3QYQA 4O13A 1T8XA 2O7QA 1P4CA 1S5WA 1KM1A 1A5BA 3N73A 4KFPA 4UFKA 1NAL1 4UFHA 1KTCA 1HL2A 1XUZA 3TR2A 1FCQA 3UWWA 1R47A 2A6LA 3CB8A 4N02A 3TFXA 1GVQA 3VNDA 4U28A 3S6DA 4QISA 4I7UA 3GVGA 3W1NA 1H7RA 4KWWA 1LDCA 1BWLA 1XDMA 2DZVA 4QAIA 4XBKA 1TIMA 5F2IA 1C8VA 3LDVA 2ZYFA 1HG3A 2NUXA 2Y7GA 3HG5A 5AC7A 1TPUA 3THQA 3W7EA 1ZCOA 1A50A 3KRUA 1EA0A 3NQFA 2XN2A 5LGZA 4MIMA 3FA5A 4Z1CA 1GYLA 1BWKA 4RZ4A 4TX9A 3T40A 3MJYA 2V82A 4UC5A 5E93A 2GVGA 4O18A 3QMSA 1SO6A 4MJMA 1H7XA 1TPWA 5LNUA 1IF2A 4XKYA 5HQEA 4ZMGA 2JKPA 4YCPA 3C61A 2TSYA 3LCIA 1RQHA 1NF7A 2G95A 3FLUA 3UQNA 4WY0F 5D02A 2DP3A 1G4EA 4NX0A 5KSWA 3BO9A 3MBDA 2NXHA 4GUGA 1KFCA 1T99A 1F05A 1KM5A 1OX4B 1WBJA 3HGOA 4AHOA 5CSSA 3JS3A 4K39A 4RKAA 3LB0A 2E5DA 3W1PA 5I3JA 4S2CA 4HPJA 1KFJA 4NX5A 5DN1A 1H7OA 4LS2A 5AC6A 1OK6A 4DF1A 1WOBA 5G2WA 1JVNA 2B4GA 3FKKA 3LOTA 1NSJA 4FNSA 2E6YA 3NQVA 3W7GA 1NVMA 5EPDA 2QJGA 2RH9A 1VYSX 2X1TA 1GQNA 3WK2A 1HTIA 4FNUA 3S5OA 1W1ZA 3N14A 4O1DA 3A24A 1F74A 3NQ6A 5CGQA 5I3HA 4KFNA 4JTHA 1X1OA 1VS1A 3W6YA 3Q94A 4GWEA 1DORA 1SSDA 1TB3A 5U7SA 5HWJA 3DFTA 3TSBA 4JY8A 1YXYA 5BMWA 4CQ8A 4WOQA 1EP3A 2CZDA 5A5WA 1DJNA 1JR1A 1LBLA 1W5NA 3A9IA 5D33A 2GJLA 2H90A 1T0OA 1ZHAA 1WX0A 1TRIA 3LRKA 1R2SA 1FWNA 4ZL1A 2ABBA 3P67A 4FXSA 3E0IA 1QPNA 2JK2A 4WQ6A 4DO4A 3TCEA 2ZQ0A 2OMAA 1WDWA 2CLIA 4MYAA 4UUIA 3VE7A 3MHUA 4UTKA 2Y7DA 1XBZA 1ZALA 4Y8FA 3BLFA 1FWRA 3NQMA 4AWSA 3W2NA 1Q3NA 5G5IA 2A0NA 2EHHA 1TRDA 4UIOA 2J88A 2A85A 3E02A 3PB0A 4MPQA 3NQ7A 2WOQA 1OX6A 2V5BA 2Z6IA 4NQ1A 2G5WA 1TMHA 4ORIA 1QOPA 3O07A 4JNMA 4HN4A 1KV8A 3A21A 4ZQNA 1JQVA 3W2LA 5FF7A 3LTPA 3R89A 3NAVA 2ZZ4A 3UWZA 5DXYA 4XUGA 3W7DA 1X6UA 4PTNA 4X2RA 3NL3A 2ZCGA 1Q6RA 3LM7A 3EXSA 3B06A 2CZFA 4UMAA 4Q4KA 1W54A 1RV8A 1SSGA 1MXSA 3G24A 3P5ZA 4LUIA 4UR7A 3W7RA 1BEUA 5AHNA 5AB3A 3DENA 1P5BA 1VCGA 3F1QA 1W8SA 1OFBA 4OGZA 3GAYA 8TIMA 3MO7A 4ADSA 4GUFA 2PRLA 3BLIA 1KTNA 1AW2A 3MI2A 1KLYA 4JR5A 3TIMA 1ZY9A 3NO5A 3C6CA 1OYAA 2V5LA 1KW1A 4O16A 3B0VC 4CCDA 3CM4A 3ABRA 1OVDA 1Q6OA 4JTTA 2Y88A 3NYZA 1L9WA 3TJLA 4EVZA 4O19A 4ZQPA 3W7JA 4GNJA 3EX6A 5HWMA 3OVRA 1K3UA 4M5PA 3M41A 3EX1A 3NPUA 2ZRWA 4KFOA 3IIOA 4UTWC 3G0SA 2YR1A 2JGYA 1RR2A 2ZRZA 3CEUA 1IIGA 1SZFA 1HUVA 4O57A 3NDOA 4PL1A 5EYWA 4GBUA 5J5RA 3C2VA 3VI2A 1V7YA 3GZ3A 1H7WA 3QF0A 3CIWA 2P1FA
chains in the Genus database with same CATH superfamily
4FF7A 2BY1A 4O1CA 3NQEA 3GRIA 4ZO7A 3E1F1 4J3SA 1QDSA 3Q65A 5AHMA 1ZNNA 1LT8A 1W37A 3AUJA 1KGXA 1R8LA 1E6SM 3N9RA 1L6FA 1AW5A 4C6KA 3W7HA 1BVWA 1TWZA 5CAKA 2OEJA 2XUCA 1QHOA 4JBRA 3MANA 4IIEA 3GB6A 4DXKA 1JDCA 5ENLA 1DWAM 5I00A 4GVHA 4XIMA 1OF8A 3WH8A 5AVNA 2L5HA 3VFCA 1BG9A 1BWVA 4ERIA 1B9BA 3VA8A 3SFKA 5LNSA 1XBXA 1H3GA 5I7GA 3BLPX 4ALDA 4C6OA 3REQB 2GDUA 1R3TA 1WDPA 5LA2A 3B9AA 1R3QA 3PANA 2PWDA 2YDRA 4PUUA 1AVAA 2O7SA 2NLYA 3PZVA 4XAGA 1FH9A 5FJTA 4B2DA 1FWCC 2G3IA 2V3DA 3AZSA 2A3AA 3U9IA 4E4PA 4JHMA 3W7MA 4BEUA 4XQ6A 3LLXA 4AZHA 3TJIA 1Q6QA 3H24A 1JNDA 2VOTA 1K8CA 1C3FA 5EA9A 5K4XA 4W89A 1XFBA 2HV5A 4ZODA 7A3HA 4PTWA 3QZEA 1ZJHA 4QJ3B 3DN5A 2HE5A 2ANUA 4AD4A 1IXOA 1OT1A 1R86A 2NUYA 3CHFA 4IJRA 4UXDA 4C91A 4BFAA 3WUBA 1VPXA 3CAQA 1OGSA 2TMDA 1FDZA 3P81A 2E8YA 4IMCA 1M7XA 1ZGDA 1IEXA 3UJFA 4H01A 1NOFA 2VDGA 2UY4A 4PRTA 5I24A 1XYBA 1R46A 2AAAA 2X7VA 4NAFB 3VD5A 4XZHA 2DSWA 3WDPP 3VVGA 3TYBA 2BOGX 3TROA 2YBUA 3JU2A 1LRNA 3HF3A 2X09A 2FH8A 3W29A 4MAZA 4K1GA 2AL2A 3R8HA 4MJ4A 4JYDA 3O8AA 4H9ZA 2WQPA 2VX6A 1M53A 1Q5MA 1UP2A 1KXHA 4DZAA 5KZMA 1LP6A 4PSPA 2PDBA 1S2VA 3O2LA 1UR8A 1TELA 3PFRA 5JUVA 3IANA 1G4SA 1GZ1A 3N19B 4BA0A 2GQ9A 5F4WA 1RVGA 3GNPA 2FVLA 1Y8BA 2BB0A 2PBGA 2Y7FA 1V77A 1R2RA 1IGWA 2WO5A 4O11A 4MNLA 6ALDA 1KWGA 1PO9A 3E5PA 1DXIA 3FHQA 4I8DA 4GE8A 3W1QA 1TTQA 4AWEA 3KOFA 2DH2A 3W7QA 1GKPA 5FAGA 3VXGA 3OVPA 1JCXA 1OY0A 3UZWA 3W73A 1M68A 1X1NA 3ALGA 3S46A 3W83A 1N8FA 2PGEA 1FFQA 3AIUA 4U33A 5SWUA 3FK4A 1DIEA 3S5YA 4LAKA 1K8ZA 2RGMA 5HQMA 2GJNA 2EPMX 1QWKA 1M65A 3CASA 5K7JA 2Q02A 4PA8A 2CZEA 5EB8A 4WKFA 4D2JA 3PZQA 4MZ1A 3FAXA 2ISVA 2DT2A 3UWEA 3FCPA 4NJKA 4M81A 1US0A 1BQGA 2WZHA 2FTWA 4A3HA 5A8GA 4GBDA 4ZB2A 2D3NA 3ARVA 3T0DA 4O1AA 2Z26A 2OSWA 1H7PA 4HU3A 2FQIA 1K02A 2QNEA 1QJWA 4GQQA 2PDGA 4JTQA 4CCZA 1XBYA 3NQCA 4RE3A 3MDWA 3I6RA 3BLEA 2BSLA 2XVGA 3LERA 1Q6LA 3HG2A 2ZZ6A 1E72M 4TU1A 4LV9A 3AHYA 3FXYA 2ONEA 1KLZA 4QS6A 1L2UA 3II1A 2ZZ5A 3IAPA 3H2OA 1J79A 1YBQB 3MS8A 4YNGA 3KBNA 4A4AA 4KPLA 2DW6A 3VIPA 2R1LA 1H61A 2H3BA 3CQJA 2QAFA 3MYOA 2XZ7A 3GNNA 4LUSB 1TQXA 2J7FA 3CYJA 1AL7A 3N1AA 3OGSA 3ABOA 4IHCA 4PMOA 3VIIA 4MJZA 2W4XA 1H4PA 4QRNA 4X63A 3VDHA 4WJEA 1SO4A 1WA3A 3O1NA 4FOKA 1K9TA 3DZ1A 4MLRA 1YADA 4HOZA 4WCJA 1MQRA 5LA1A 2X1SA 4QJ1A 3LTYA 1ALDA 3GUWA 3KOXA 1UMLA 3MT1A 3B3DA 4Q4OA 5HATA 3NNTA 3IIPA 3W7IA 4XZBA 4MKNA 1V0NA 1M7PA 4ZA0A 4UFLA 2HK1A 2XWEA 1QK0A 2BY0A 2OWCA 3SRFA 3TA9A 3LHZA 2ACQA 2D0GA 4LY4A 5E6ZA 4N6FA 5CSRA 1A5CA 3VOGA 2XJ7A 4DI8A 4CGTA 1Y5XA 1NQKA 3TC7A 2VNCA 2FZMA 4J28A 3WQVA 1R3SA 1EX5A 4MPKA 2BWGA 2QPXA 2EPLX 5C54A 4HCDA 4AMAA 1LLWA 3PSVA 2ZUUA 3ALFA 1W9UA 4INFA 1E4LA 2F7FA 3CLMA 2X7WA 4QGCA 3NM1A 2JKEA 5C2GA 3U48A 3SGUA 1YDYA 4U3CA 1O5QA 3MZNA 1JZ4A 4UQ9A 4DUXA 1EWDA 2PP0A 3LCGA 2P3EA 4HYWA 4Z1AA 1W1A1 4GOAA 1XLAA 3QR1A 1E1CA 4BWLA 3NQ8A 3QM3A 4NZJA 1KD0A 1DTUA 4UQEA 4AWUA 3DDMA 1QW7A 1F6KA 3AI0A 1Q65A 3E9AA 3ATZA 3WH5A 4O8AA 2XN1A 4BEQA 5EU9A 1VLWA 1UD8A 3SSZA 5CPTA 2J66A 5BOFA 4WDTA 1DHKA 2NXIA 3R2GA 3V36A 4XD4A 4CCCA 1SPQA 6XIMA 5F1VA 3UGRA 2EPKX 5JBDA 1AZ2A 1YLVA 4D6HA 3G2GA 3CIVA 4US5A 3QC3A 3WFZA 2PLCA 5TIMA 5LIWX 3EA2A 1IQ8A 1UJPA 4NAFA 1E4MM 2OR2A 4G1KA 2J6XA 4N9DA 4NG3A 2BVTA 4Q7IA 1HJVA 3IJ6A 4E4UA 4LNYA 2EPNA 3S6OA 5BXTA 1H5VA 1PS9A 2F2KA 4W4QA 4RZ6A 1AMKA 2YGYA 1O7AA 2HPMA 2XHYA 4DF0A 2BASA 2DSUA 2DZAA 3C52A 4HB7A 1Q6FA 4NZ4A 1P6BA 2CITA 4IIFA 4IXHA 1V3HA 2PDUA 1W1YA 3WELA 3FS2A 1X6NA 4MWAC 4LYRA 3G1SA 2VURA 3MMUA 3BDKA 1KKRA 1VFFA 2VC5A 3MVIA 3C3NA 1G94A 3B0UX 1W3KA 5A6JA 1EJWC 1ZS2A 5FSDC 1RJPA 4CLMA 3LPPA 3QKZA 3FV9A 5FF3A 4LRSA 5H2ZA 1EF3A 5HMSA 3WQ5A 4XTDA 1XQLA 1B90A 2NW0A 1J0YA 4NJJA 2QZRA 1BTMA 4M7TA 5J5DA 3PJUA 4JDBA 2WCSA 3OQEA 4C6NA 1JCYA 3S2JA 5HR6A 3HFTA 4IMGA 1L8NA 1W17A 3CL8A 4XSLA 1GG0A 3W7LA 2CKSA 3KW3A 4B9ZA 4JPGA 1F5ZA 4XD5A 4RV8A 3SY5A 2TRSA 4JTAA 1EJUC 3OHIA 1NQ6A 4W7WA 4I6KA 1VLIA 4WEVX 1LM1A 2R6OA 4HZMA 1TREA 4IG2A 3IV8A 3O63A 3T4WA 4OQVA 1DTNA 4HNUA 4U2YA 1UHVA 2R1KA 1RAKA 2PDPA 1CCWB 1IXQA 2P0OA 3GTNA 3ZR4A 1AD4A 3L0GA 3LEPA 3AHXA 1S2UA 1C9WA 1ZENA 2B0MA 1WAUA 5EBAA 3KZSA 1MWOA 4WXZA 3CUGA 4DYEA 5FI8A 2WSQA 4ATLA 2UBPC 4TX6A 1FA2A 5HNRA 3CMGA 4H19A 5KTLA 4JOMA 3QKEA 1F73A 2VRJA 3H4WA 4MAVA 2WAGA 4O15A 3O9NA 3WQPA 1R3YA 3SFWA 3KE0A 4NJHA 3R94A 3BJSA 1LBMA 3BZJA 1MDRA 2CBVA 3CPGA 2CFFA 3GXPA 1E1EA 1U2YA 4LYQA 1YBQA 2XG9A 1O1ZA 3WO8A 3PZGA 5D32A 1LWIA 3U5YA 4ZVJA 2XGIA 3EBVA 2C14A 1MFVA 3GYEA 1MFUA 4Q7NA 4LUSA 1BRLB 3PZTA 1BGAA 5G2IA 5IFTA 1BG4A 4HSNA 4XBJA 2ZUTA 1KFKA 4DNHA 2J9YA 3B9OA 4PE8A 6TAAA 3R6IA 1SFJA 4GUHA 4WLCA 5C0QA 4JIPA 3KVJA 3PWGA 3ITXA 2FFCA 1VCFA 1E5NA 1VP5A 3TQVA 3NL2A 4WGHA 1A3XA 3W2JA 2HZGA 3TW9A 3QQWA 3FW6A 5FIPA 3AWNA 2C16A 3NVDA 2BXVA 1VHCA 3SUVA 5DX7A 2QJMA 4MLJA 5A6LA 1EKOA 4O4WA 3C8FA 1CECA 5TD4A 5G4WA 4JQAA 2YDAA 2PGRA 3WLNA 4D6JA 3EPOA 5DMNA 2J7CA 4RLIA 1JFXA 5C7VA 5CC3A 3QV6A 3AU2A 1RCOB 1A0EA 1VPYA 4D1JA 3MKKA 2WNZA 1VBUA 2FPVA 1KRBC 4Q8MA 2VJXA 3EX4A 4GPNA 3SADA 3LHUA 7XIMA 1AA1B 3CV2A 2HCVA 3W6MA 1YPFA 3EB2A 1OJXA 1B1YA 2VL4A 2C1IA 2VCAA 1S5MA 3W70A 1Q6GA 4W87A 2XWDA 4BF9A 5AZ0A 5H1WA 1W6TA 2PD5A 4EIVA 1SZRA 2GLKA 3VIMA 4MB1A 2C79A 2NWRA 4B4FA 1IWBA 3ARUA 1CXEA 3PJTA 3KBVA 3TTYA 4B9YA 3A4XA 2OYMA 3DG3A 1QWGA 3SZ8A 3K8LA 3DFYA 3ZIZA 3B8VA 1RQEA 3IIXA 2QF7A 3UF9A 3GTHA 3NEVA 4EWND 4PMVA 4HNTA 1UZHA 3G3MA 4WR3A 1SJBA 3IGHX 4HMEA 1UASA 5E9AA 2WSYA 3FSTA 2PGFA 4H00A 4M0XA 5BRPA 1ISWA 1XS2A 1W0MA 3S1GA 4RNIA 2IUZA 5A1AA 3B9EA 4C6PA 1ONRA 3WF2A 4IJCA 2HNEA 2RUSA 2YZRA 1FWJC 2QYGA 4HYRA 4ICMA 3XINA 1LJYA 4R9OA 5D9OA 2C0HA 4LUJA 4CVUA 3M0MA 1P0BA 2CBUA 2DVUA 3CO4A 2NQLA 1FXPA 3R4IA 4AC1X 1XSKA 2XVLA 4P7LA 3OIHA 3I7QA 2RJHA 1I4NA 3TK7A 1DOSA 1AZ1A 2JEQA 4IGMA 4LY8A 2QW5A 3N9KA 3CL6A 4LS0A 4CQBA 2CZVA 3HQPA 3M44A 2DJXA 3ID7A 4JQ2A 4AX6A 1EQPA 3B0PA 2WJEA 3PG8A 4ZQCA 4DUWA 4XZMX 2DJLA 3GVWA 1N82A 3IJ8A 5EKYA 1FHLA 2Q8LA 2VTFA 2POZA 3CQIA 3E0WA 4XZWA 3N2OA 1F2JA 2PUZA 1JXJA 1QOXA 3NVTA 4ZOCA 4QNEA 1B2YA 1KXQA 2Q3RA 3F5LA 1H60A 1CW2A 3TTOA 3A4AA 3WH6A 4CN1A 2VCCA 4A22A 4JN7A 4H1ZA 4TIMA 5C2CA 2PDJA 5CGTA 4RX0A 2FLIA 4K37A 2BVDA 1V02A 4M80A 3G8EA 2X40A 5E0KA 2ZZ2A 1NU5A 4CNOA 2YYTA 3A13A 6PTDA 1THFD 1XXXA 4CD6A 5HQLA 1TCMA 1Q4WA 4Z1DA 5DELA 4ZQRA 1FWTA 3G0XA 2DH3A 5D8ZA 3I4KA 3LRMA 4G1NA 1HKKA 4YMZA 3N34A 4CUCA 3WLMA 4R5EA 4Q8PA 4NNCA 4U5IA 5A6MA 1K7EA 3CL7A 5C2XA 3CYVA 1RXOB 3VNJA 4DJEC 2EO7A 1EJ7L 5B80A 3JZEA 4Z2IA 3ME3A 2WM1A 4Y90A 2C91A 3AJXA 1XL9A 1TPC1 4F8XA 2VGIA 3HG3A 1R9YA 1UD4A 2QCNA 3A64A 5FEPA 1PBGA 2X41A 4XD6A 5D2VA 1PJ9A 1LTDA 1YHTA 4AISA 4FNQA 3DGRA 5FKYA 3AC0A 3J7HA 4O14A 1I0DA 1I6NA 3LD5A 1SR9A 1E6NA 3MP3A 4LRTA 3K2GA 2Z1SA 2BY2A 1FHDA 4JEQA 2D2HA 3GU1A 5DF0A 1OCJA 3V4BA 2GPTA 4I5UA 4LF1A 3HPXA 5ABGA 4LUYA 3NXFA 1KR1A 1CNVA 1LORA 3P7YA 3CWNA 5LHFA 3O6DA 4IFOA 1BYCA 4C6FA 3PF3A 2CZ5A 1GOQA 4JFUA 2GK1B 3BARA 4KERA 2O9OA 3W23A 1IZCA 2VUYA 4H04A 4L9ZA 1FKWA 4NJGA 3OGVA 4B5SA 3STEA 4DIAA 3RIKA 4QDMA 5AHIA 3W26A 4H41A 4ZEPA 2Y5SA 3GFYA 1S5TA 1F3WA 3RK8A 1WDQA 3W01A 3PAOA 1NWSA 1YKWA 1S3TC 3W24A 3NZ1A 1VJIA 2OQLA 4DYJA 4WSJA 4V27A 4AZIA 3TC6A 1QRQA 4LOCA 3S2LA 4GX9A 1HKMA 5HMDA 3HQOA 2XFWA 3BGAA 4YJ5A 2WZTA 3LMYA 3WQOA 3WLJA 3I10A 4JTDA 4A3QA 3PAJA 1JCLA 4XZLX 3TLQA 3M5ZA 3CUZA 4UB9A 5A8NA 4B5NA 1M6JA 1V3KA 4E0CA 3P0XA 3QW3A 2WBGA 1ITXA 4K3ZA 5I03A 3UJRA 5JBEA 3A3WA 3V1PA 4Z08A 4IFKB 5JH2A 3U6WA 3UT0A 2JQXA 1HP4A 3A6OA 2OFJA 2F38A 4DWSD 2EF9A 4W8AA 3AMLA 1MUMA 3E6EA 3PSWA 2CLKA 4JIEA 4L80A 4PMRA 1PV8A 4U31A 2BGQA 2QCLA 3EKZA 2CHRA 1VZWA 4GX8A 2QDGA 1ZUAX 2VQTA 4US6A 2HS6A 4DO6A 1EEPA 1O5RA 2XH2A 1LQAA 1OB0A 3N15A 1V0MA 4QG9A 3NPVA 2BS9A 4Q33A 3UCDA 5LSMA 3OZYA 3IGUA 3KHJA 4UOZA 3KFTA 2CIPA 5KITA 3EWDA 4GVFA 3VGHA 3MSDA 4CCEA 7TAAA 1L6YA 1W5PA 3LUTA 5EBUA 4M29A 1Z8AA 2NX3A 4AHQA 1D3GA 3QZAA 3CHEA 2I9EA 3D3AA 4CQCA 4IMFA 1I2NA 1I8JA 5HNUA 4C1LA 3ZT7A 2FTPA 1J96A 3O15A 3AWOA 1RPKA 2NWSA 1GOOA 2GSEA 3OYZA 3LCLA 3PFMA 2WC4A 4IFRA 5D2WA 1UC4A 3W1UA 3E12A 2QUVA 4OTKA 4DWSC 4F0HA 5FJUA 1WO2A 4HKPA 5F4SA 3T8LA 3KOWA 2VFHA 2Y2WA 3A47A 2A21A 2VUNA 1BSIA 3AISA 4QX4A 1R9ZA 2OT0A 3C0LA 3ZS4A 4DZHA 2Z00A 3MWCA 4U2ZA 4JNYA 1OIMA 5BXSA 3OTRA 4TMBA 3TTEA 1VAHA 2VGGA 1J8VA 4P8WA 3WNOA 4Q6XA 2VCBA 1HX0A 3LSCA 3PS7A 1Z69A 4XK2A 1IXNA 5CZKA 1OYCA 2CHOA 1DXFA 2OGYA 2VC6A 2HPIA 1AJ0A 4S3CA 1X97A 2J7GA 1KO0A 2DGAA 4Y6GA 4FNPA 1A5NC 2ZA3A 2X0SA 5T8GA 3U4FA 5H91A 1AG1O 3W74A 1KGWA 3SGZA 3H4GA 1C8YA 3NSXA 1K9FA 1QATA 1NDZA 4LCSA 4PMZA 1BF6A 2DU2A 2VMFA 2QJIA 3WYZA 3CO8A 5JBFA 3UG3A 1LQ2A 1JDFA 1IEIA 2FGZA 4GFSA 2HSAA 4UQDA 3WD3A 3OZPA 1HJUA 4K2SA 2EPHA 2XH0A 3CEPA 3QSTA 3LI0A 3HGRA 4DN1A 2C71A 1NFPA 4IJBA 4GMEA 1FWDC 5I0DA 1A49A 4Q22A 4D8AA 4JIIX 3RYSA 2HJPA 3LPOA 3GIQA 1ELSA 1T8XA 2O7QA 5LYRA 1A5BA 3OYXA 1D8WA 5CLTA 1NAL1 4PULA 1KTCA 1HL2A 3TR2A 2G50A 2VD8A 2W63A 2Y4SA 3UWWA 2Q6ZA 1XPGA 4HD5A 4GI9A 1KGUA 1V3IA 3GH7A 4U28A 2WKGA 2XSBA 1PX8A 3IJLA 2OWWA 3W1NA 1XIJA 1F4HA 1LDCA 3CB3A 3H12A 1XDMA 1XX1A 2V5KA 3BSMA 3RO6A 4QAIA 3S9IA 3RCMA 1KBLA 3FSUA 1HVXA 4NY2A 4MKSA 4D8ZA 3UW6A 1O6IA 1HGWA 1RUSA 3THQA 3W7EA 4B90A 4C6LA 4IGNA 1ZCOA 1Q8AA 5I5RA 3CS2A 2XN2A 5HOSA 3FA5A 4PUNA 1EIBA 2GK1A 1D3CA 1C91A 2QT3A 3T40A 4L56A 1EOMA 2VX5A 3EPMA 1SO6A 4W88A 1TPWA 3WMSA 4ZMGA 4YCPA 3C61A 3XISA 4P7OA 3WENA 3RDKA 2PDXA 5D02A 1G4EA 1E6PA 3BO9A 3MBDA 2WMFA 1T99A 1XPYA 3ARZA 1OX4B 3JS3A 3VC6A 1PDZA 8RUCA 4Q8QA 5KEZA 4D6FA 2X1IA 4IMAA 4JQ4A 2WZIA 3V0TA 1H7OA 1WOBA 2B4GA 3W7GA 3NQVA 3AXKA 1POJA 5EPDA 1XIDA 1VYSX 2X1TA 1BTCA 3WK2A 2JF7A 5IXEA 3O0FA 3ICJA 3M07A 3ONCA 4O1DA 3F2CA 4GNVA 1W32A 2D3LA 5CGQA 5HJXA 7REQB 1VS1A 1UIPA 3SRHA 1MXDA 3FA3A 2PDWA 3IUDA 1DORA 3V7PA 3TSBA 2VQUA 4O1FA 4WOQA 1EP3A 2PDNA 4HOWA 1YX1A 3DERA 1T0OA 1EDTA 2Y24A 1US2A 4QXIA 3TVAA 1FWNA 4ZL1A 2PP1A 1XIMA 3P67A 4FXSA 3E0IA 4JCMA 3LBOA 4WQ6A 4DO4A 3TCEA 3WBYA 1FWEC 2CLIA 4MYAA 1QNOA 4ERGA 2OKTA 2HNHA 1GVEA 2VR4A 1ZALA 3MV11 1FWRA 4IF2A 3KTCA 5FAJA 3EDJA 2YL5A 2XSXA 4M82A 3GNXA 3W2NA 1BFNA 1KR0A 1W1B1 2A0NA 4YYFA 5LXXA 1CWYA 1OX6A 3UERA 2Z6IA 4RE4A 2W27A 1UR9A 1JD9A 4ORIA 3O07A 4JNMA 1XYLA 3SRDA 4ZQNA 3IAQA 3T6CA 3R89A 5FACA 5FCZA 2C1GA 3C0SA 4XUGA 4HZ6A 3ZYZA 4PTNA 3NL3A 3V1HA 4YVVA 3RX2A 2ZCGA 1Q6RA 4EAMA 3W02A 1W54A 1SSGA 4J27A 3VIFA 2ZWYA 1AH3A 3E38A 4LPCA 4QQUA 1OFBA 4OGZA 4DBUA 2DQWA 4AY8A 5A69A 1IWPA 1KTNA 1AW2A 2D0HA 3WY1A 1QVBA 2H9AB 2YLLA 4JR5A 3TIMA 4GCAA 3ABRA 1TWSA 2Y88A 4H2CA 1EDQA 3QV8A 1E15A 1GOKA 4PTDA 3S6TA 1FWBC 5HWMA 3POHA 2CXEA 1Z6KA 3K8KA 4DWSB 4UR9A 3EX1A 3BMVA 4UTWC 5A2BA 4GC3A 1J0ZA 3MUZ1 3CEUA 1FTXA 3H2NA 1LL4A 4O57A 2YCKX 1HQTA 3L4VA 2GVYA 3SN1A 1QU4A 4WDXA 4WY0B 4C1KA 3QY8A 3N12A 3HZ3A 1EXBA 1N7KA 1GQLA 2DSKA 4V15A 1DWIM 4XB3A 5XIAA 1C8QA 4WXYA 2O4QA 1QCWA 3PUOA 2F6KA 3F4VA 4LW7A 3L4ZA 2WW5A 2WSRA 4MVAA 1KFLA 2Z29A 1QHPA 5DO8A 1ISXA 5CPLA 4JTGA 1RP9A 1OCQA 1W1VA 3WLOA 4IQEA 4AAJA 3DFPA 4NIRA 3S8HA 4AD5A 5DT5A 4NL1A 3TJXA 3P6LA 2PRHA 3LTSA 5CBBA 2ZA2A 2VFDA 1L6GA 1KXVA 3KCJA 4J7RA 4HK6A 3R8RA 3B03A 2ADAA 2V2CA 2ZE0A 3T78A 3LHYA 1OM0A 4FLSA 3B05A 2ZUMA 3RR4A 5HULA 2VZVA 1N2VA 1PEZA 2IPGA 3TTQA 5LGXA 3VMOA 1TZZA 4BK9A 2BXYA 4DJDC 2E25A 2J27A 3NDZA 2PURA 1E71M 5AC8A 2NLIA 2OPJA 2VDHA 1TTIA 1RCXB 1FWSA 3P0WA 2CBIA 4OZOA 4JTLA 4NU7A 1TWIA 5HBFA 1DKWA 4FR1A 3G8RA 5M5DA 3UXKA 4TTUA 5A6TC 1YNYA 4FP1A 5H8PA 3E49A 1XC4A 1OD0A 3WL0A 1RD5A 4HHPA 2FDMA 2AQWA 2GOKA 1GOWA 2A3CA 4EF9A 4D9PA 2INEA 3BL3A 5DBTA 2DT1A 4QQ3A 2AMXA 4PRWA 4R34A 3WMBA 2GOUA 1OFPA 3WLSA 3SEPA 5I6SA 2W6RA 3EWBX 2ZRUA 4HA0A 3RFAA 3CZJA 4FOJA 3TYZA 4HCLA 4U10A 4YU1A 3PBMA 3V18A 3DFSA 5L6UA 3G1RA 2J7BA 5L9FA 1WV2A 1JRCA 4FEZA 3NYDA 5HDRA 3FNDA 4FX8A 1ENUA 3DFOA 1HJQA 5BROA 2ZZ7A 2VD9A 1UIOA 1OGGA 1C7SA 1PHQA 1AH4A 4DPQA 4IP5A 4AU0A 5DY3A 3SBFA 2Z28A 3VU2A 3E3HA 3IUHA 3DI0A 5K9CA 3HGSA 3BVJA 1OFEA 1QK2A 4O12A 3WD1A 2Y8KA 5TQLA 3W82A 3M9YA 3BUVA 2J9XA 2ZTKA 4AFYA 2PBOA 1BKHA 3B40A 1DBTA 3H2AA 2QHAA 1XLDA 1J12A 2YW4A 1D3HA 3RX3A 4JAWA 2G3FA 1RCQA 4I9TA 7REQA 1KC7A 3PTDA 3MSRA 3CHDA 3OG3A 2HXUA 1NF0A 3GX9A 5BU6A 2E67A 2CLFA 1PDYA 1H62A 5HUOA 4U3AA 1CGYA 1T7LA 3K5XA 1PTAA 3WF4A 2WC3A 1OC6A 3USBA 4AYGA 1SW0A 1U5HA 1QHZA 4H9XA 3SIZA 1M7OA 1A53A 1V0LA 2W0UA 1CEOA 3DBPA 4V1XA 1JUKA 1GVSA 3KP1A 4NXKA 3EB4A 3BK0A 3WJWA 2QQ6A 1JDAA 2QVHA 2YX0A 1E0TA 1XSIA 4YTRA 3I6EA 5F2MA 3PTKA 3TA6A 2WHMA 3AYVA 3TXVA 4DJFD 3SM0A 3V5OA 4DAFA 5BWFA 2JEPA 2HBXA 1XRTA 4GYPC 1YDVA 2A7PA 3NQ2A 4KCVA 3DG7A 3CV6A 2G3JA 4P8XA 1FFRA 5BWAA 3QRHA 5D9MA 4ENLA 1Q7MA 4IUOA 1YIXA 3ZSTA 3NA8A 3XIMA 5J04A 4XISA 2E3ZA 1O4UA 5F2LA 1TV2A 1G7UA 2VFEA 5IDZA 4MUPA 3C0QA 3DAQA 3CNYA 1QNPA 1EH9A 2FB3A 4AWTA 1V4YA 2X05A 2ZADA 3T42A 3QPZA 3JRKA 1FWGC 4OUEA 2LLEA 1F3XA 3WFLA 3SCPA 1X6LA 1XINA 1M41A 2H9AA 5ABTA 4L4MA 1ZP4A 3H2MA 2Z2UA 2WLYA 5FJPA 2NUWA 3MHFA 1TA3B 3I7RA 1G9HA 3GTXA 4TX8A 1V3JA 3CAKA 1C7TA 1YTDA 3KLKA 1W5MA 4H8VA 4K6AA 3T2OA 4Z1BA 3MUXA 1PIFA 3VC5A 1BXCA 1OWQA 4L9YA 3UD6A 2HWGA 1S3HA 3QPEA 4HZ8A 3T55A 2ZKMX 2O0TA 1B9ZA 2NX1A 4W5UA 1WDSA 4O8RA 4B2DD 1PKNA 1EYEA 4C7FA 3F4CA 2YB1A 1GKQA 5FF2A 3LBMA 2PDQA 4YS1A 3M5YA 4KWOA 4QM1A 2ZXAA 3DFQA 1GUVA 3UPWA 3DFHA 4GXPA 3H22A 1KCXA 1P0KA 5IBXA 3BICA 4DBDA 2MNRA 4ML4A 1Q7ZA 3UU0A 1EGZA 1UP3A 5H8UA 2WVVB 1TPVA 3UWQA 5CBIA 3C2OA 4A05A 2YXXA 1ZJAA 5CLWA 4MY9A 3THUA 4K8EA 4O0KA 3WK1A 3NPWA 1H50A 3TNOA 1KM6A 3TH6A 2PLJA 4F2BA 2VT0A 2ZUVA 3ABQA 1XLIA 4IT1A 3ZWTA 3UYIA 3WQDA 3W0KA 3ZZ1A 1H0GA 4F4RA 4WVXA 3WUGA 3K30A 2E28A 1F3EA 4WKHA 5HMFA 3HMJG 1O5KA 4TQTA 1DV7A 1JPMA 1CLVA 4NP7A 1UYQA 4JTFA 2JIWA 1WUFA 4DLMA 3STGA 2D22A 4UQBA 1ZFJA 2WSKA 1P1MA 3FGCB 1DJQA 1W1IE 4ACYA 2J77A 4E38A 2DSVA 4IQJA 3M7SA 2DZXA 2CESA 1Z7AA 3G18A 3FYOA 1TMQA 2JALA 4BF5A 3U4AA 2YCIX 2HQAA 3N4AA 1QNQA 5CPNA 1PTGA 2FPYA 5EMMA 4V1YA 2QCEA 1HW6A 4I90A 3VIKA 5DMYA 5LKYA 1C29A 4NYUA 1JNEA 4XVDA 3THAA 1J2BA 4UFMA 3COTA 3VOHA 3OO2A 4X9SA 3S3GA 3C2EA 1NDWA 4PBEA 4QIUA 5U4NA 2E6AA 4JGDA 2H6RA 5DT7A 2YA2A 4RV3A 3WEMA 4PMJA 2IPWA 3SCSA 1U83A 2J62A 2BOEX 3CQ0A 3OJGA 4MM1A 4LU0A 2X0YA 2RHGA 2PC4A 3A23A 3QV7A 1XGZA 4C6CA 4XUYA 3LCHA 2NT1A 2YW3A 2BLEA 1AQ0A 4PEEA 5IM51 3L4WA 3W7NA 4JIRA 3W81A 2J79A 1VF8A 5CJNA 3LQLA 3LMZA 3EKGA 3T9PA 3P5YA 5HXMA 1LRQA 2PDKA 1WKEA 4IICA 3PZOA 5C5YA 3MMWA 4TUFA 3QXBA 4LNCA 4L4PA 2F84A 1HKIA 1G1YA 3VD9A 3LM3A 1F76A 3KWXA 2X2GA 1UA7A 4S1FA 3WBAA 1NY1A 3TXZA 1MEWA 4TVDA 4I7WA 1XM3A 5C6MA 4GRSA 1SFLA 2Z6JA 4QSFA 1RALA 4F9DA 1JUBA 2FZDA 3TN4A 3HPZA 3M47A 1K9DA 3K8MA 3D46A 3M0ZA 1GTHA 1JULA 2DDXA 2HS8A 4JX5A 3PBGA 3TV8A 2PSNA 4WX2A 1ZZMA 3UNTA 3VOJA 5IOBA 2MANA 3WCZA 4C1NA 4N9CA 4IPJA 4HHHA 3UESA 2HVNA 5K3VA 3W27A 3GVVA 1C93A 1SQ7A 4QSHA 4QDWA 1B3OA 3KS5A 2IS7A 4O53A 3VCNA 4HCHA 1T5AA 2J74A 4HHLA 3ATYA 5T91A 1JZ3A 3TU9A 2XM2A 2A2IA 4XX6A 1LUCA 1G0CA 1MXGA 2DUAA 3R5EA 2W62A 3B97A 4AZCA 4ZQOA 3ZVHB 2R1PA 3E5BA 1W31A 3KBMA 1RPXA 2DZTA 3RM8A 3UNDA 1QPQA 1YYAA 5CSUA 3SJNA 5A95A 3PWAA 4I9AA 3GYCA 4AEFA 2XYLA 3FEMA 1OZQA 3LRLA 3FOKA 1LLZA 3Q4DA 4JIQA 4I9JA 5HAOA 3MV01 4GQRA 3CPUA 1XKJA 2PDLA 2EAWA 2QEZA 3BLOA 3B0XA 3UJ2A 3CV7A 1UJQA 2V6AA 3LXCA 1M04A 4JS3A 4F3HA 2C8NA 3MSGA 1RA0A 4B5XA 3UG4A 1BLIA 4ZTXA 4TV5A 2FB2A 3WKZA 2E6FA 2C0AA 5CAHA 4HMDA 1YW1A 3W7PA 4PODA 2Y61A 1CX9A 2Y8UA 3RLVA 4PUWA 1FUYA 4CU6A 3QHMA 1U5JA 5FESA 3UXLA 1TG7A 1R3WA 3DC8A 3D3FA 2PDCA 1VKFA 3G1AA 5CG0A 4US5D 1XC6A 3GU2A 2E40A 2YXOA 1A47A 2VWTA 2XIJA 4K8GA 1W2PA 1IE7C 3AXXA 4J3ZA 2R91A 2YXGA 2OLHA 5JIPA 2PTDA 4HA3A 1JZ5A 3SUSA 2J24A 3YPIA 1EJXC 4FIQA 2GJXA 1VFLA 4QS5A 2PDMA 2CWNA 2TAAA 3PB2A 3O6YX 5D2XA 1M1BA 3POCA 3GM8A 1OC5A 5JXQA 4A35A 1VC4A 3SECA 3U57A 4S3BA 3KCLA 4Z2KA 3TWBA 3SB0A 3P3BA 3FGCA 3VKKA 4BWLC 1A0DA 5LZLA 4MWAE 1F7BA 3PG9A 3W2MA 4AVNA 3TYCA 2PWHA 1ZJBA 3EYPA 1JGMA 2BHYA 5F2GA 4ORMA 3W6LA 3H53A 4EKJA 3TOYA 3UR2A 3V5FA 5GQBA 3S1VA 3UY8A 2Z2AA 3AO0A 1QPOA 4YTSA 2YBTA 1I0BA 3ARXA 3DU0A 1FDJA 5DCBA 4OUIA 1IT0A 2ACSA 3VFLA 4G6CA 2OYKA 2BMBA 3WF1A 1SZEA 1XISA 2DT0A 3TUUA 3UJEA 2NT0A 4GY1A 3W7KA 4KEZA 1VYPX 1X38A 1SW3A 1KBJA 3P62A 3TQPA 1K6WA 5DCDA 2AAMA 5I3KA 5GNYA 4DX3A 2IPFA 4HBKA 4O1BA 4PBFA 3R10A 5FEXA 1DWHM 1EXPA 3VKJA 3DKLA 1ITCA 4GZEA 4QITA 3QGKC 3TTSA 3GNDA 4DB7A 1PKYA 2V0TA 1GVIA 1J0HA 3H55A 4X2PA 2W92A 1N8WA 3APTA 5A8MA 2V3GA 2E6DA 1JPIA 3UZYA 5JVLA 2CBJA 4CNUA 2ATSA 1EOKA 3L4UA 3KOZA 4C60A 3ZLHA 5AHLA 2SFPA 1WXYA 1F9CA 3W75A 1H1ZA 3W87A 2GGIA 3NIYA 1YEYA 1TV8A 4H9UA 3IRDA 5D2TA 4FPSA 3QW4B 1K6AA 3P2VA 4UQCA 4HPHA 3GE7A 3OEXA 3NZPA 4X9YA 1RHCA 8XIMA 4IQLA 1AUSL 1BXBA 3ITOA 5CKSA 5FA5A 4FA3A 4LBUA 1ZU8A 4IX2A 2OGJA 3EMZA 3LLDA 2NQJA 3VM5A 4G7EB 2Z1WA 3F7JA 4C6EA 1P6WA 2YYUA 2E8ZA 2Y7EA 4ZFMA 3SR7A 2X2YA 1KCZA 1Y5WA 1IIHA 3BG9A 2DZSA 3E2RA 2VZSA 3EOLA 3LI1A 3M0KA 4I7VA 4Z0JA 1FY6A 3R0UA 4HNOA 5CCZA 3A3XA 4AVFA 1KBKA 5EFFA 1K7XA 4Q4QA 1G5AA 1VPQA 4MG4A 1VRXA 4UQAA 3L65A 3W4RA 4DQWA 1VFMA 3Q45A 1FHUA 4OHQA 2F8QA 2NV2A 1BPLB 3N3MA 1W5QA 3ZVHA 5CEWA 4KT2A 1EX1A 3TE9A 4NI3A 4B3KA 2WCAA 4NILA 1XGDA 4M1RA 4M8UA 4M19A 1CPUA 3D0CA 3IJIA 1UROA 1MW3A 3H2FA 5AYIA 3SUWA 1WZAA 3MTWA 3BWWA 4H4IA 1S2WA 4JN6A 4FHAA 1I2PA 4GINA 4FIRA 4ZZ9A 3OLDA 3BOFA 2Q8ZA 4R7JA 5A6KA 1HL8A 5CGMA 3PBUA 3UA4A 2HEJA 4DJFA 2E1WA 3IACA 5AYXA 2P10A 3BAKA 4PB5A 5A6SA 2RJGA 2XIQA 1RQBA 4LALA 4R27A 1XICA 3VOFA 4IP4A 1S38A 1UWRA 1E9ZB 2V67A 3DKJA 1GORA 3PUGA 1UR1A 3QVQA 4XKYB 3CHVA 4HTBA 3V35A 5C7HA 1WAWA 3EA3A 3STFA 4S38A 2C18A 1T41A 4EPBC 5HUPA 2PE4A 4ZB0A 3WDJA 1W3JA 2QPSA 2NQ5A 5BRBA 2GUYA 1JIBA 4RZ5A 2PB1A 2QCDA 3N29A 4Q4MA 4IIBA 2FHBA 1S2TA 2WXDM 4BI6A 5BRQA 1UH2A 1L6SA 3KHDA 1OYBA 3P80A 2TPSA 3H7RA 4N42A 3CC1A 3SURA 3EOOA 1JCMP 3AHVA 2NX9A 4QR6A 3EGJA 3G22A 5FJRA 4AEOA 4HPXA 1SU5A 3P8IA 1KTBA 2QV5A 3VX0A 1ITQA 3NM3A 3L0KA 1YNQA 4YTTA 3S1XA 3UR8A 3W7CA 2INFA 2IPJA 2Q8XA 1AK5A 4IH3A 4J40A 4UCGA 3NDYA 1GZJA 3M0JA 5ABFA 7ODCA 1EQCA 2RFGA 1CDGA 3P14A 4ONVA 4S3KA 3I3DA 4YPJA 1E1CB 3EKLA 2VEIA 3N2TA 4LCQA 1PB0A 1GK8A 2CLHA 4PUDA 3LA4A 3RU8X 4AUBA 1OF6A 3S83A 1PVNA 3N2CA 1GQIA 2YDQA 1ZAIA 5HNNA 3RG6A 1TWDA 3VIOA 5LIKX 1LROA 3E96A 1J6PA 4NZ3A 1V3MA 3BLDA 1HKWA 3CZ8A 4PMQA 1KV5A 3GKFA 1A5OC 3MI6A 1QW9A 3SAZA 4Y9MA 3IWPA 4CN6A 1V79A 3L9CA 2PEVA 3MCNA 2XFFA 5K9XA 3WQCA 3HURA 1DWJM 1OABA 3CAVA 1MRAA 1E4NA 2DFAA 1PHWA 1OGBA 2CETA 3MB9A 5I02A 2Y5EA 1D9EA 3HB9A 4I9MA 4F66A 1BYBA 4ES4A 3AS1A 1Q2SA 2I5IA 2PODA 1DWGM 4G7FA 3LLFA 3W1TA 2FPTA 4CD5A 4P2VA 4H3DA 3HPFA 3W53A 4ICNA 2YCEA 5GJNA 2C15A 4Q8OA 1OZMA 2PGWA 1LYXA 4IWWA 1EUNA 1XLLA 5TNVA 1UR2A 2V3EA 1MO0A 1SM9A 3SCQA 4HNCA 1TE6A 4MOZA 4NNBA 2PS2A 1W9PA 3BLLA 3W1RA 5K4ZA 3ISIX 4OV9A 1WDRA 1QXLA 4IX0A 2ZBTA 5DBUA 2OTDA 1W1PA 4OVXA 1EPVA 3KL0A 2PFHA 3RF9A 3DC0A 4MSSA 3CHCA 3ARWA 4D6IA 4YCOA 4GA8A 2GWNA 3TAOA 1ADDA 1IR2A 5KINA 2C1HA 3WLIA 4MUZA 3VDCA 1X8CA 3G1FA 3RJXA 3E74A 3HTWA 4G7EA 4PFHA 1JQXA 3PPHA 4O52A 2B7QA 2Z1BA 1CLXA 4Q32A 4W9TA 2VEGA 3WQ6A 3AS2A 1Z89A 3UVAA 1SZNA 2OWXA 2NZLA 4PEKA 4QCFA 3GBEA 3BPWA 4O0ZA 3C2YA 5A2CA 1TV5A 3UYCA 3LENA 3KVKA 3FJLA 2Z1VA 3WJZA 4IG2B 4MMWA 3W9ZA 3VKCA 2XVKA 1CGWA 1QMLA 3SW6A 2V30A 4DI9A 3LK6A 3WBWA 5DFAA 1UC5A 1JGIA 4KFPA 1UWUA 4PTVA 1MMFA 3ZLFA 1HKJA 5REQA 4YN5A 3K1GA 3E0VA 3PZIA 4BY3A 3S6DA 4QISA 1X7IA 2VZUA 3T8QA 2OU4A 1H7RA 4QEEA 3WD0A 1IR1A 5M03A 2HVMA 3CXOA 4H6QA 3VNYA 2ACRA 4AIBA 3EA1A 4OKDA 3WLHA 1RH9A 1RBOB 3VPLA 1R7OA 2ZYFA 2NUXA 1R7AA 1TPUA 4C6MA 3T09A 1EA0A 3V3WA 5JMUA 1J0IA 3FJ4A 4Z1CA 1XQKA 3BH4A 4TX9A 4UC5A 3PZ9A 5KZ6A 3TN6A 5E93A 2QJJA 4O18A 3GSMA 4ASTA 1H7XA 4EPEC 1IF2A 4XKYA 5HQEA 5IDIA 4KIEA 3A4WA 3LCIA 3KP0A 2G95A 2WMIA 3FLUA 3WQFA 2DP3A 4F2TA 2QXWA 1E3ZA 4UTFA 1MZRA 3HGOA 4AHOA 3IJ7A 1US3A 4K39A 3GBDA 1J11A 3LB0A 1T8QA 4YHEA 1ZL1A 2E5DA 4S2CA 3RILA 2PAJA 1MQPA 5ECUA 3VKDA 2QGYA 1OK6A 4DF1A 5G2WA 1JVNA 6REQA 1NSJA 2E6YA 1H49A 4D6EA 4LYPA 1EZWA 3VM7A 2RDXA 1C8XA 4XZNX 5A6BA 3TYAA 4BQ3A 3N14A 4AY7A 3VD4A 3SRKA 1A4LA 1OQFA 1GNXA 3NQ6A 4J2MA 4KFNA 1X1OA 1E70M 4RDVA 1X96A 3Q94A 4GWEA 3QY6A 5U7SA 1B30A 2CC0A 1PZ2A 4Q4PA 4CQ8A 5IHSA 5EMJA 1JZ6A 4ZENA 1JR1A 1LBLA 1W5NA 3RLGA 1Q85A 1DJGA 3A9IA 3VMNA 6XIAA 3DECA 1ESWA 1RVKA 1WX0A 2OG9A 1W9DM 2AL1A 3LRKA 2ABBA 1JL8A 2JFEX 3ES8A 1F8IA 2DUXA 1LL7A 3BC9A 4V2XA 3SCOA 1VIZA 2ZQ0A 2OMAA 4UUIA 2UY2A 3VE7A 3F5JA 2EG7A 2Y7DA 4D8LA 3ECQA 4LEQA 4L4OA 1OIFA 3MUY1 3AZTA 5E70A 5G5IA 2J88A 3E02A 2FGLA 4NQ1A 4F0KA 1FWFC 5CQ1A 1J01A 1TMHA 3MJMA 2AKMA 4Y8EA 3N25A 1JQVA 1QW8A 3NAVA 4S23A 4QHRA 2PF0A 3B8IA 3EDEA 3W7DA 1X6UA 4X2RA 1UZ1A 3B06A 4UMAA 4CEXC 1MXSA 5IFPA 4MADA 5MKGA 1YRRA 1CIUA 4UR7A 4MNJA 5AHNA 3DENA 2ZXQA 1P5BA 1VCGA 4LX4A 3IK4A 3JW7A 8TIMA 2PRLA 3BLIA 3JUGA 4GG9A 4UZSA 1JDDA 1U22A 2I16A 3AYRA 4M6UA 4KCTA 1RP8A 2CHNA 4DBWA 3NO5A 3C6CA 1OYAA 1UQZA 4CCDA 1Q6OA 1L9WA 3DCPA 4O19A 3W7JA 2FGBA 1XLCA 3EX6A 4PTMA 1BF2A 3OVRA 1K3UA 4PCNA 1WKDA 2G4FA 2ZRWA 3APYA 1GHSA 2GGJA 3ZO9A 3STPA 3M0VA 1EGVA 1IIGA 1SZFA 4ZFCA 1YNPA 4Z42C 3VI2A 1V7YA 3GZ3A 1H7WA 2P1FA 1B3YA 2BBFA 3CQHA 3UA3A 3K1DA 5AYBA 4MFEA 4LCRA 3BTNA 2VGFA 1XLFA 3HIJA 3AMKA 2OX4A 4RL3A 4IOTA 1GOXA 2WMGA 4M6VA 5DMMA 1OINA 5HR7A 1E40A 4CN4A 2ZVIA 5FEWA 1KQYA 1E0WA 3O3RA 4G8TA 2VO5A 1VQTA 1KM4A 1EF2A 1GW1A 2ON3A 3WQEA 1PIGA 3BMXA 3DI1A 2XZ9A 1QAPA 4EOUA 1SMDA 3EEZA 2V2DA 3NL6A 4KCUA 2OOFA 4GYJA 4ZO9A 4GLEA 3GIYA 1SFSA 3DX5A 5BXPA 5XIMA 4CNPA 1GKRA 3S5SA 1GYMA 4ICCX 3CIXA 5CPOA 3W38A 3AS3A 3EEGA 4L1WA 4L64A 3PBYA 5KMYA 3E2SA 2ZICA 3CPRA 3QQ0A 3M16A 5AN7A 1M7JA 2FVMA 1VYRA 3PULA 3UG5A 4N2YA 1TYGA 3WJSA 3R0KA 3E2QA 4ROQA 4WRHA 4AVOA 1TPH1 3TZNA 4JHZA 1Q63A 3BQ6A 3ZT5A 4QG6A 4HZ7A 1YPIA 2OZ0A 1FWAC 1I60A 3AJ7A 1D8CA 1CXFA 4AEEA 4OFCA 4GK8A 5CPQA 1F3TA 2DQXA 1KBIA 3BZGA 1VCVA 4HMCA 5G1TA 1EC7A 2G37A 1DIKA 2VOMA 1WXZA 4J4KA 1G6CA 2WHKA 2YSWA 1J10A 2XN0A 3LU2A 1NTHA 3VGBA 4GXWA 1J4EA 1EHNA 1XYCA 2Q71A 2FKPA 3FKRA 3QBUA 1TVPA 3P74A 3NR0A 4GQ0A 1YTKA 3UETA 1XBVA 2AQVA 4RNJA 1DJYA 1MEHA 1EJTC 4MB5A 2WC7A 3HV8A 4ROPA 3M46A 2ZZ3A 4DPPA 4XD3A 5A8OA 4NAEA 3N9SA 1QPRA 3ANUA 3HFYA 2GJPA 1R9XA 4KEVA 3GZAA 3HO8A 4GQBA 3UPBA 3NL5A 2JIEA 4P61A 3SQLA 3N17A 5EFDA 2OLSA 2Z27A 1L2QA 1PKLA 3NXLA 1Z32X 1GQJA 3VIJA 3G1HA 4WJ8A 3U2EA 1KB3A 4LB4A 3GG0A 3GW3A 4X0NA 4B91A 3E0LA 4UFIA 5K9DA 3VOCA 1U1JA 3BGGA 2POTA 2FMNA 4N9BA 5DRIA 4BF7A 4FO4A 1R3VA 1MUCA 4O0QA 4KGJA 3ENLA 3GDLA 1KA9F 1YDOA 3VGEA 4WZHA 2VM8A 3UWUA 2QF8A 4LVAA 1TJ1A 3TX9A 4E8CA 1ISVA 3G6MA 4LBSA 5G4EA 5I06A 3THCA 1BGGA 1NJJA 2XINA 4EP8C 2OSXA 2J8GA 3VTRA 3GDTA 1GPFA 3M0LA 5EY5A 2FTYA 2WPBA 4DZIA 3MUCA 5CG7A 2J4GA 4HMNA 4Y2WA 4JFWA 4DJDA 1Z44A 4CNNA 3NUKA 3KVMA 5JIWA 1VJZA 5E5CA 2V5JA 3T05A 2O9RA 2GQ8A 3FJ6A 2E9BA 4GGHA 3QR3A 4KRTA 4RE0A 3VIGA 4BHYA 4YYCA 2Z4GA 1B57A 5LIYX 3RCYA 3ABXA 4JL2A 3NQBA 4KQNA 3MMTA 6ENLA 3NQAA 2EQDA 3B9DA 2FIQA 1I1XA 2G41A 1XG3A 1JCJA 3SIMA 4QE5A 1XF0A 4LS1A 5JH1A 2GUBA 4W8BA 4FOUA 3ZSSA 2X1UA 4NSBA 2R9RA 1FRBA 3U8GA 1JZ2A 4ZBCA 1VGAA 3NZGA 1GPWA 3GXDA 5BYWA 1SJAA 5H6HA 5CBJA 3LYEA 3G1VA 4IL2A 7CGTA 2XSAA 3ZWSA 4FF5A 4BQ5A 4J35A 3W88A 5FL0A 1TJPA 5LXEA 3APGA 2OX1A 3U0HA 1R30A 1C90A 1G4PA 3Q2DA 4FXFA 3G1XA 3WSUA 4F79A 2PC8A 3VUPA 3A5FA 4IMDA 3PN8A 4Q6JA 4X22A 3L2LA 3FFSA 2X16A 1F61A 4AQLA 1CZ1A 2FZ8A 4JTUA 4N6EA 1LOSA 1EB3A 3ARRA 4ZCWA 4IPPA 1KBBA 1UUQA 1Z9AA 1OX5A 5BU9A 3INPA 4AD1A 4RNHA 1E9YB 1A5KC 1V6UA 3S9ZA 4E4FA 1H7NA 1ICQA 3L5LA 3UVIA 4F48A 4ZQMA 1ZAHA 3VD7A 1I9CB 5D37A 3SSJA 3PZUA 2WWDA 2X0HA 3BG3A 3PHAA 2IKJA 4LTSA 4B4HA 3HQ1A 3QLDA 4CU7A 2WMKA 4C6QA 1K03A 1VBHA 2QUNA 2IXVA 1OG0A 3WBEA 1P0NA 3KAOA 2IKGA 4MDOA 1ZJIA 4A8LA 2YL9A 3OOQA 2E77A 4DUOA 4JTJA 5HJLA 1XLHA 3WIJA 1H41A 3DHUA 1UWIA 3EWUA 4LANA 4GI8A 3KCOA 5GJMA 1S2AA 3CUJA 4J5NA 4AZGA 1OCNA 4K8HA 1E56A 4JTRA 5RUBA 4GYPA 5AYYA 4B5WA 3CTLA 5XINA 1ITUA 2WBKA 4UTIA 4UFJA 3BJFA 3PNZA 2BV9A 4OBRA 2E9LA 3LY0A 4IQDA 1EA9C 3GFXA 1NIUA 1GOMA 2QUUA 2QS8A 5I78A 3VDAA 3VE9A 5JQ9A 4XVEA 5A8PA 4MB4A 1UG6A 2NVAA 1UWAA 2AGTA 3ANVA 3DH7A 1E43A 3TMLA 3VNZA 4MY1A 1QI5A 3BCJA 3GXTA 5CJ5A 2OELA 3GHRA 3U2OA 3HGJA 2VP8A 3M1ZA 1F6YA 3I65A 3NCOA 1ODZA 1QT1A 4NXSA 4R7WA 4BI5A 1GEQA 4R7OA 2ZUSA 1HF6A 1AJZA 3LGGA 4GD0A 2E68A 1VIWA 2WM0A 4FK9A 3CZEA 4LYKA 2XIMA 1E55A 4LXFA 1W1TA 2OEKA 4NHVA 4UNLA 2PI6A 3BW2A 1BD0A 1CGUA 2RKXA 4QE1A 1HFBA 4AHPA 1Q8JA 1I2RA 1XD0A 4ZE5A 3H6OA 3DHFA 3NSMA 3EOEA 3S1UA 1X8FA 1TX2A 2X42A 5D2YA 3VNLA 3DIPA 2PA6A 3IGSA 1HKVA 3LHWA 2ODOA 4LVFA 3W1MA 1M01A 4GO9A 2PWUA 1BAGA 1GTEA 3A22A 4X61A 1AODA 2VX7A 2XU2A 2W91A 3H7VA 4H2HA 2HISA 2YBVA 1MUWA 3UZJA 4S3AA 3AIVA 4YLWA 2ZDSA 3UP8A 1RJRA 4ZGYA 3VNIA 2UZ9A 4GJIA 2XFRA 1ICSA 3MZ2A 4L9XA 1ZBVA 4KEUA 4ADUA 1UWTA 1L8PA 1Z48A 3B8WA 3CT7A 1DJWA 2J6VA 4UTMA 2CEQA 4AYSA 3CUFA 4Y7EA 1WXJA 3UXAA 4RUBA 3I7SA 3OB8A 2J8TA 4OV4A 1XD1A 2YA1A 2ESCA 3F5KA 1DQXA 1HXJA 5C8BB 4Q4RA 2QJHA 1E6QM 1HNYA 2FHCA 5HINA 3N6JA 3WK0A 8XIAA 4X0VA 3BXWA 3PR2A 1X7FA 3KDOA 5BMXA 3EWZA 5BNKA 4JKLA 3K13A 2EG8A 3N6QA 3AROA 1OC7A 4YVPA 3IIZA 4IM4A 4F0SA 1SYTA 5D03A 4PFMA 1TUFA 1ECEA 1Y65A 2R82A 4RZBA 2QULA 4FX7A 3GWQA 1TR9A 2V8ZA 2BXZA 1Y0EA 3LX9A 5E0FA 3TCSA 3UR7A 4KCWA 2GJRA 3SCRA 4XAYA 4H9TA 3CWOX 4AD0A 5FSEC 4M6PA 3WEOA 3NGFA 5FJOA 3WFAA 2PTXA 2B81A 2PWEA 2GZXA 3QGVA 1ZSXA 3ITGA 1XR2A 4B16A 4IGSA 2NVDA 4N0RA 6CGTA 4HOXA 3NZQA 4L7ZA 1EUAA 1ADSA 4POCA 4GFIA 4HVXA 1KFEA 2GVJA 2ZUWA 3KTXA 2A7RA 3PJWA 4JXCA 4AZBA 4D72A 3L12A 1UKQA 3W85A 3AHZA 3WLLA 4LF2A 1DIDA 3PBWA 3VINA 1DEDA 1W91A 4YIWA 1PE1A 4GI6A 3AOFA 4HK5A 3R0DA 3L2MA 1XG4A 1TWWA 2WCGA 1TPFA 2IXUA 3R12A 3LBCA 4QFUA 1UD2A 3IJ9A 3KVLA 3L68A 4W5ZA 1VB9A 3H54A 4JD4A 5BW6A 1ZLPA 4WDUA 2P88A 1I1WA 3PM6A 1ZCCA 4DYKA 2WV8A 4PSRA 4PCFA 5ABEA 3FDGA 4TV6A 1J5TA 3CV1A 1RY0A 4FNTA 5A94A 4LV4A 4QNWA 1ME8A 1EJVC 3BW3A 2PZ0A 3IVTA 4XAZA 2PWGA 4H7CA 4UWMA 3ITLA 1VENA 3WDQA 3QQ1A 4MF4A 1XSJA 1MRQA 3UCCA 5DXXA 1CXHA 4IXXA 2IQTA 4PUEA 4MYXA 1CI1A 2DVXA 3SCNA 1NWUA 3SCUA 3N2BA 5IBXC 4KWSA 2HMCA 2QDEA 1RD6A 2WYSA 2CW6A 1Z42A 3RX4A 2AGKA 3SY8A 3KLLA 4WKAA 2YFNA 4A8RA 1GHRA 3FJNA 7TIMA 2NSOA 4H8UA 5K2ZA 4Z1YA 3NEHA 5A2AA 4XG1A 2WNQA 3RRXA 4E2DA 4P5UA 3MHGA 1FCVA 3GR4A 3HJEA 3MYPA 3W22A 4I6VA 1E51A 2WK2A 3GC2A 4GIAA 1CGTA 5CZJA 4WIWA 3TW7A 3BV4A 3ES7A 4R88A 4J9JA 1GWJA 2WZMA 4Q8NA 1XW8A 4UTTA 1TX0A 3EX2A 4FLOA 4J1OA 3L21A 1TO3A 3PC0A 3SI9A 2YJQA 4ATDA 1J93A 5J8LA 4UR8A 2DIKA 2VEKA 1MYRA 1BVNP 1TVNA 2CU0A 1NDYA 2DZUA 3RPMA 1UOKA 3EDDA 1HN1A 5EMYA 5EGRA 3MQTA 4K1WA 2IKIA 3FX4A 2J8FA 5F1UA 2WZEA 4LWWA 2KZHA 3P61A 1FCUA 1FH8A 3AU6A 1ZBKA 4LVGA 3L5AA 4LAMA 5E1QA 1EC9A 1QOQA 2Y0FA 3BGJA 3KBJA 1GJWA 3F2DA 5CZSA 3HV9A 4AW7A 3ARYA 2REQB 4M24A 4WK9A 3L4YA 1MZHA 1OK4A 4IIHA 2PMQA 1UKOA 3OZOA 3S9YA 1F6PA 1L6WA 4UBPC 5HMEA 3QJAA 2PDIA 1SZGA 2V69A 1KWKA 1I2OA 3TFCA 4PYSA 3WNKA 1WBHA 3PPGA 2C6QA 4GGBA 3CH9A 3RR1A 4GIYA 3RU6A