4JTKA

Crystal structure of r117q mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
277
structure length
252
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLAQQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQTRGRRAQALDLALAGMATRLAGLFLELHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Examining the Role of Intersubunit Contacts in Catalysis by 3-Deoxy-d-manno-octulosonate 8-Phosphate Synthase.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
total genus 87
structure length 252
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtkA00
5CKSA 4N9DA 4DQWA 1I2RA 2CLOA 3E12A 4JTHA 1VJIA 1CI1A 2CW6A 3I7QA 2X1RA 4O15A 3DFSA 2QCFA 4I7VA 1TPC1 1H51A 3QRHA 3GXPA 1JRBA 1SW3A 2BWGA 4QISA 4MPQA 4MYXA 3W71A 1KM5A 4YCOA 1IXOA 2G96A 4NJJA 2CLFA 3PR2A 2Y6ZA 2NX9A 1FWRA 3C6CA 4DXVA 1UBSA 1IIGA 3KVLA 1GZGA 2VELA 2W79A 2KZHA 2Y7DA 4R34A 1K02A 3W7HA 2OT0A 5AYXA 2DU2A 2ZYFA 3DGRA 2BXVA 2Y70A 2G97A 4GUFA 1OK4A 1C8VA 4O1AA 1HFBA 3PM6A 4JEQA 3I7SA 4KWVA 3JRKA 3MYOA 4NNAA 2E68A 2QCGA 5FI8A 4ADTA 4GXMA 4AF0A 2C14A 3ATYA 1WXJA 1G67A 4QNWA 3W7OA 2GUUA 1JCXA 1FQ0A 5EBUA 4RXGA 2ISVA 3H53A 1F6KA 4ZQNA 2AQWA 4UMAA 1FXPA 2QAFA 5TIMA 5LKYA 1OX6A 4GUJA 3VCRA 4IXHA 3NPVA 4JIPA 1XDLA 3VNDA 2ZRVA 1B3OA 1NAL1 3STFA 1TPEA 1PV8A 1ZNNA 4WQ6A 1KM6A 4AEOA 1FX6A 1SO3A 3W74A 5FESA 3B04A 1HO4A 4XKYA 3USBA 3TFCA 2VOMA 3CLMA 3FJ6A 1JUEA 3EWUA 4A21A 2DJXA 2RH9A 4E0CA 1MEHA 5G4WA 5E93A 3P60A 3LXBA 3W88A 1UJPA 1JUBA 1N55A 5D37A 2R8WA 1TRIA 3L66A 1GTHA 2V82A 5DN1A 3HPXA 3TKFA 5F4SA 4ML9A 1GVRA 2GOUA 5CZTA 4CCDA 1KFEA 1GYLA 3W7GA 1O5XA 3PUOA 4BF9A 5DLCA 5D2XA 2HS8A 3C0JA 1C9DA 1G4SA 3G1SA 4HNTA 4RZ4A 2CLIA 2EHHA 4PL2A 4RXFA 4FNRA 5AHIA 3P74A 2XFWA 3T4CA 1W5OA 1QOQA 3DU0A 1Q45A 4IMDA 3CPRA 5CGQA 4H6KA 4BWLA 5LNWA 3QEZA 3UY7A 2X16A 1DL3A 1VRDA 5FEXA 2C6QA 1WX0A 4ZQRA 2JKAA 5F2MA 4XUGA 1VS1A 3UWQA 1SPQA 3FKKA 4O19A 3SW6A 1RZMA 3SR7A 3BK0A 5FEPA 3S42A 3EWYA 4P2VA 1LZOA 2C16A 2VEMA 5CPOA 3BG9A 3G1FA 3SZ8A 3I7RA 4LVFA 3TA6A 5LHFA 1TSIA 4DEFA 3DKJA 2HMCA 3LERA 1F7BA 1QDSA 3RMJA 4FIRA 4N4PA 2WNQA 2GVJA 3T40A 2ZA2A 1WYIA 5HWNA 1QNVA 4O53A 1ICSA 4BI6A 5LNVA 1OX4A 1Q6QA 4LUJA 3NYZA 4AHOA 3BGJA 5EYWA 3VE9A 3BPWA 3S1XA 3NZ1A 3W73A 4LS1A 5LZLA 1SR9A 3W9ZA 3TMQA 1ZY9A 1OG0A 4UFJA 5D2WA 4IMCA 3STEA 1KFJA 3GR7A 1Q6LA 4HNNA 4P61A 1AL7A 4YCPA 3H55A 4O17A 3THAA 3W6YA 1K8XA 5D2YA 4UTUA 1W54A 4GFSA 1K8ZA 3KRSA 2QCEA 5FF7A 2QCCA 1OHLA 3MI3A 4IX0A 3D0CA 1VLIA 4Z1BA 5ABTA 4WOQA 3T78A 3UXAA 1QPRA 1QPNA 3EX3A 3FIGA 3O8AA 3TW7A 3ZFHA 1PHWA 2QCDA 4JX4A 4G1KA 1B9BA 1SW7A 3LGEA 3LRKA 1G69A 1H7OA 2H90A 4UTWA 5CSRA 1OFQA 3NL2A 2C19A 1I45A 3NL3A 1G4PA 1H1YA 3PSVA 1TV7A 1WBHA 3QW3A 1O95A 4KFOA 1NF7A 3P84A 4FXSA 1TJRA 3FJLA 3LCIA 4E2DA 1BWLA 3M47A 2V9DA 3C2OA 3UQNA 3EKZA 2VC6A 4AB4A 1W5QA 2PURA 3NNTA 4OBTA 5J5DA 1GVFA 1W3TA 4ZVJA 1LDCA 2WKJA 5HR6A 2NXIA 5K4XA 3W07A 2F84A 5CZSA 1VHNA 1GVSA 2H3BA 2ISWA 4OV9A 1NSJA 1I2QA 4NNCA 1JQVA 3W85A 4YLWA 2A7NA 2QF7A 2Y63A 2J6XA 3T7VA 2ALDA 5LSMA 1ME8A 3TUUA 3QSRA 3NQAA 3DFTA 4WD0A 5L6UA 2PE4A 4K7YA 1KM4A 1X6UA 2E6DA 3JS3A 2XN2A 4M19A 2QUVA 1XDMA 4YL2A 4E38A 1OK6A 2BX7A 3KRUA 3HG4A 4WOZA 1VQTA 3HF3A 4FF7A 4U4MA 4Z1DA 4HKPA 1MEIA 3WK0A 3FYPA 1SSDA 4H4IA 4J9JA 1AMKA 3Q37A 2NX3A 1BTMA 3GNDA 1OF6A 3IEBA 3L5LA 3GDRA 1Q6RA 2XN1A 4JTLA 1WDWA 3HGRA 3UXDA 4UCGA 1X8FA 4HT3A 2V8ZA 2I1OA 1WV2A 1XUUA 4MYAA 3G8RA 1F73A 1TTPA 4KFNA 1GVOA 4PTNA 4LVDA 3L68A 3P67A 4NZFA 3QQ0A 2VENA 2ABAA 2RFGA 3STCA 3M16A 2ZA3A 3NZRA 1KFLA 1H7WA 1AW5A 5CZJA 4IJBA 1G7UA 2FB2A 3S1UA 4X22A 3RLUA 3W23A 3DKLA 2Y7FA 3LTYA 2BZNA 2QCNA 1OABA 2NWRA 1Z42A 2V81A 3UY8A 4K38A 1XFBA 1TPFA 3CU2A 4Y9AA 4JTUA 2A1YA 4MIMA 1VGAA 3NL5A 5AYZA 4LS2A 3TMLA 1JCJA 4IXXA 5CPMA 5E0KA 4OE7A 3M44A 1MSSA 5G2HA 3KVMA 1WAUA 4N6EA 2DZUA 3W7MA 3LHTA 1FCQA 3TQ0A 3O06A 4N6FA 4M7TA 4R53A 2P0OA 1A50A 3W7IA 2ZTKA 4TO8A 4IX2A 3IVUA 4AWUA 4AVFA 4FX8A 1GYNA 1TPUA 3WK2A 4YWIA 3KHJA 4X3ZA 4L4LA 4O10A 4QQ3A 1M6JA 5H2ZA 5HJLA 1N7KA 3M7WA 1K7XA 1KM0A 3RU6A 3M0ZA 1W5PA 3DI0A 4NJIA 3EWZA 2FPTA 1ZENA 2ZZ3A 1SQ7A 3G1XA 1LCOA 4LRTA 1R2TA 4TR9A 5G1YA 1XBVA 3P5YA 3S5OA 3N2MA 2I14A 3P81A 3UD6A 2YPIA 1D9EA 1PE1A 3DI1A 1OYCA 3G22A 1VYPX 2NX1A 1SFLA 3RK8A 4FB7A 3WJSA 3CM4A 4RKAA 3S5YA 5FEWA 3BO9A 3W7DA 5DBUA 1L6SA 1AK5A 3HO8A 1IXNA 3LI0A 4XQ6A 3F4NA 3NL6A 3PC0A 4O28A 3W2UA 1ICPA 2E09A 1OFEA 3LHYA 2ZZ6A 1ME7A 2Y89A 3R13A 2WOQA 5HR7A 3W1NA 1H61A 2FTPA 1FBAA 5HWMA 5J5RA 3NQCA 2Q8LA 3DFNA 5K9CA 1EWEA 3CEPA 5KZEA 3KFTA 4O14A 4EVZA 2A7PA 4K39A 1W0MA 3CC1A 3C3NA 2ZRXA 3G8EA 5IBXC 3UPBA 3G24A 2FB3A 3TXVA 3W2NA 1EP1A 1F5ZA 3GX9A 4HIBA 3M9YA 3O1NA 2VEPA 3NAVA 1JRCA 2A4AA 5DY2A 1RR2A 2EAWA 3P82A 5FF0A 5K2ZA 4RJEA 4UTWC 3PBYA 4IPIA 5F2IA 1IF2A 4UC5A 4Y8FA 5D05A 4M6QA 4JY9A 4JTGA 4UTTC 1VCGA 3OIXA 2LLEA 3FFSA 4FX7A 4NQ1A 1P4CA 4Z08A 1LLWA 1VPXA 1A5SA 3ZWSA 2VFHA 4GE8A 3LHVA 2JGYA 3TCEA 1GWJA 3CIWA 1I8JA 3LV6A 3LCXA 5AOUA 4HSOA 1T8XA 5K9DA 1FCUA 1SZNA 3O15A 1P1XA 1EA0A 3GNNA 3EB2A 4OU1A 4JTFA 2B7QA 3MHFA 4MLRA 4UTLA 2GQ9A 4A22A 5G1TA 4FXRA 3E9AA 3BW2A 3TC6A 1XBYA 3GDTA 3F1QA 2QAPA 2WNNA 3O6CA 1KTCA 5GVJA 1P5BA 2X1UA 2E5BA 2J9XA 1WBJA 3DXIA 3NQEA 4O18A 2RKXA 4LVGA 2NUWA 4BK9A 5C55A 3SECA 3L5AA 3UYCA 4Z0SA 5D04C 2YXGA 3HGSA 1H7RA 2OT1A 3L2IA 4JD4A 3GXNA 3PS7A 1OYAA 1ADOA 6ALDA 2Q8ZA 3ABRA 1K03A 1TV5A 3C8FA 4ADUA 2CZFA 2QUUA 1W3IA 2YCEA 3QF0A 3MP4A 4RV8A 5D32A 4ZL1A 1YYAA 1OFBA 1NF0A 2CZEA 5TQLA 2DP3A 1JVNA 5KZDA 2G5WA 5I3JA 4FIQA 4BR1A 1J2WA 3NO5A 4PCFA 3WK1A 2WSYA 1BKSA 4A29A 5AN7A 1KM2A 1G7VA 1R30A 7TIMA 4IMGA 1DQWA 5KINA 1ICQA 3M5VA 2J9ZA 3FOKA 4O54A 4ALDA 1ZAHA 2ABBA 1EB3A 2NXHA 2ZRZA 3PB2A 4K8HA 1JUKA 1DBTA 5EMUA 3KAOA 1QO2A 3MO7A 2ZA1A 4O0ZA 3HIJA 1ZALA 4LNYA 4DO6A 2Y62A 4PODA 4LOCA 1VLWA 2ZFAA 4Q4KA 3W7RA 3W7CA 1DVJA 3UWYA 4NJKA 2NUYA 4NJGA 3LCWA 3UZJA 5BNKA 3EWWA 3EX4A 1ZHAA 4DF2A 4DPQA 1F05A 1LORA 4AWSA 3PG9A 1W8SA 5D30A 1K7FA 1L9WA 1KBIA 3KXQA 3W72A 5AB3A 3HGOA 3PWAA 5DELA 4LV9A 3NVTA 5DXXA 1DOSA 1V7YA 2E77A 3R5EA 5KSWA 4O1DA 3ZWTA 1H1ZA 5DCDA 3R8RA 1H62A 2ZCGA 2J9YA 4DBEA 4QM1A 5F4WA 2JK2A 4X9SA 5AHLA 4WY0F 3N3MA 4OGZA 4ICNA 4JTKA 3TXZA 4IGHA 1D3HA 3NPWA 4UMCA 4JTIA 5DCBA 1GTEA 3EX1A 3A23A 1YPIA 1NVMA 3MI2A 2TSYA 4NZJA 4FNSA 3UWZA 3S5NA 5G4EA 3MHUA 4DELA 1XC4A 1SZGA 4O16A 4NT0A 3ABSA 4XWUA 3W2KA 1NEYA 3SIZA 2TPSA 2A5HA 1S5WA 2F7FA 5HUOA 1W5MA 1UCWA 3EKLA 3O63A 1Z44A 4JY8A 1XXXA 2CLLA 3S5ZA 1O4UA 2WQPA 2R94A 1ZFJA 5BRBA 3VKJA 3NEVA 3RF9A 1B4KA 4JX5A 4MVAA 4WZHA 2QR6A 3I68A 4K36A 2ZRYA 4NX5A 3GYEA 2WSRA 4GJ1A 3RLVA 1JJKA 3SSJA 3IV3A 2E6AA 4CNNA 5BMXA 3JR2A 3TE9A 3YPIA 1OFOA 2YGYA 1LRNA 4NUWA 2TRSA 4ORIA 5F1VA 1GJPA 3NPUA 1GG1A 2ZRWA 4MOZA 1EX5A 3QZEA 2CZ5A 3CIXA 5D2TA 3GB6A 3NXFA 2X2GA 3NQ8A 4WX2A 3W2LA 5KZMA 2CWNA 1IXQA 2JKEA 5HNRA 1W3NA 3N9SA 3ELFA 3A22A 3QQ1A 5DXYA 4BI7A 2WV8A 4OWGA 1PHQA 4JYDA 2ZDRA 4O8RA 4C1LA 1T99A 1EIXA 4XKYB 4IUOA 4CCCA 1XKYA 3TH6A 1GG0A 4GWEA 3Q94A 3B4UA 3W7JA 5DBTA 1TJPA 1TTQA 4UUIA 3BG3A 3L21A 3GKAA 4CQAA 3IRDA 3W7KA 1A5BA 3UZ5A 1U83A 2DZTA 4FNUA 3ANYA 4CNPA 3S9YA 3HBLA 1TIMA 2P10A 3ZS4A 4U28A 2DZWA 1KTNA 2ZZ2A 4HNVA 4AHPA 4LW7A 5I3IA 4ZMGA 5MHBA 4Y6GA 3IIXA 3QH2A 1TRDA 4KKXA 3U2OA 1DHPA 2B7OA 1QR7A 3MUXA 4N9EA 2AAMA 3LB0A 4ZQOA 3R2GA 3M5ZA 4LC8A 3P7YA 4O1BA 4QJ1A 3CHVA 5CSSA 3QM3A 4ZZ9A 3R12A 3W86A 1MO0A 2Z0IA 4MFDA 3LHZA 1KLZA 3NQVA 2ZZ5A 1QOPA 3LXCA 3NQDA 2NUXA 1G4TA 2NLIA 4K8EA 4M6VA 1ML1A 3STGA 2EF9A 3UWUA 3DH7A 2C1HA 3G3MA 4GUIA 1RQBA 3EXTA 1G6CA 3MBDA 3NM3A 4TU1A 4PL1A 1CW2A 4JNMA 2H8XA 4PH6A 4NXKA 1IXPA 3B0UX 3KX6A 2GJLA 4JICA 1KM3A 4ADSA 3W76A 3G0XA 3M41A 2RDTA 1QFEA 1QWGA 2GQ8A 5F1UA 5HINA 1OFRA 3O07A 6TIMA 1FXQA 1GT8A 3W2JA 1YTKA 2XN0A 5G2WA 4Q32A 1KBJA 4UTMA 1M7OA 4FEZA 1RD5A 1ZAJA 5LNSA 3U8GA 3W1TA 4GC4A 3LV5A 4OQVA 3TR2A 3A21A 2GJNA 1S5VA 5K9XA 1PIIA 3NGJA 5DCEA 3OVRA 2X1TA 3UWVA 2WSQA 3S1VA 4CCEA 4D2JA 4RZ5A 1LRQA 1X1OA 2YYUA 1IGSA 1PCKA 3NR0A 4B5NA 5A8GA 4LT9A 3WJXA 4HPJA 2QJGA 4QIUA 1Q6OA 3B03A 1YLVA 2NXGA 1L6YA 5AHFA 3LLFA 4ZQPA 4RLIA 5LGXA 1TMHA 4CQ8A 1ZCOA 3M1ZA 5BOOA 1JR1A 2JGQA 2VKZG 1TPDA 2GVLA 3LX9A 3I65A 4MJZA 4UNLA 3BARA 5F2GA 3PUEA 3N14A 1RV8A 1FDZA 1PL9A 4GRSA 1TREA 1BWKA 2OX1A 2YDAA 5CPLA 1LOSA 2GQAA 3C2EA 3OHIA 3TJXA 3HB9A 2B7PA 4JS3A 4IMFA 4PC8A 3L67A 4RZ6A 4XTIA 5I3HA 1Z41A 3U6WA 2E1DA 1XBXA 1F74A 4MJMA 3WK3A 3NQ7A 3PSWA 1VC4A 2QDHA 3SY5A 3DBPA 3KRZA 1QO5A 1TQXA 4FNTA 4UIOA 3LBMA 3W83A 5IM51 4JTTA 2Z6IA 3HG2A 4UR7A 2NV1A 3P62A 3HQ1A 3PBWA 1YPFA 2O7QA 2DORA 3HGJA 4H3DA 4MY9A 3CTLA 4NJHA 2ZZ4A 1EWDA 1I2NA 3K30A 5D38A 2VFIA 3OEXA 2OMAA 4WXYA 3MWAA 4LRSA 5HWJA 1R2SA 1TCDA 5A5WA 1LBMA 3LCFA 3NDOA 1B4EA 5I3GA 3W22A 1KFBA 4EIVA 3G1HA 4UTTA 4LY8A 1JCYA 2DZXA 3TX9A 5C6MA 2C0AA 4Y96A 3G3DA 3A5VA 3T55A 1XM3A 1R47A 2QCDB 1D3GA 1KTBA 2NV2A 1ALDA 3QJAA 5K3VA 2C13A 3G1YA 2FPVA 1QMLA 2Z6JA 2E5CA 1VHCA 5I3FA 4XZ9A 1LRTA 1MEWA 1YXYA 2QJHA 3TC7A 5FEZA 1R2RA 2Q3RA 1AG1O 1LROA 3PBVA 4O12A 1QCWA 1Y0EA 5DY3A 3TFXA 4IMEA 1UASA 4R33A 1HO1A 4JN6A 4RR4A 1JCMP 8TIMA 2V2HA 2Z2UA 1TPH1 2FJKA 3DFPA 2I9EA 2W6RA 1FWSA 2TMDA 1KFKA 4JTSA 4BWLC 4EWND 1QPQA 3WJWA 2PRHA 4UNKA 2WNZA 1SZFA 4JGDA 3VE7A 1AL8A 1SU5A 3LTPA 5U4NA 4IOTA 4POCA 1KW1A 3EWBX 5C5YA 2V2DA 3VI2A 2J24A 3MHGA 5FF3A 1FDJA 3WJYA 3QYQA 3NQFA 3T44A 3DFOA 5AHMA 2ZTJA 1F2JA 2DJLA 3LLDA 1MZHA 2CLMA 2QEZA 1OF8A 1DV7A 2A6LA 4UTHA 3GVGA 3CQ0A 2UV8G 2ZQ0A 3W1UA 1W37A 4ONVA 4IQLA 3QFEA 4O57A 1OX5A 3N73A 4NNBA 4QITA 2WJZA 1A53A 4GUGA 5EY5A 3B0PA 1OX4B 3ABQA 2D73A 1UB3A 1YDVA 1EPXA 5E1QA 2VEIA 1U5JA 1YADA 3IVSA 1J4EA 5AHEA 2Z1BA 2H6RA 2OZ0A 1YDNA 3TV8A 4N02A 3S8HA 4AWTA 4O4VA 2YFOA 1IIHA 3EWXA 2YYTA 4L4MA 4UXDA 3BLFA 1A5CA 2A2IA 2JKPA 3G1VA 5FF4A 3KOFA 1YTEA 3TAKA 1LOLA 3IIOA 2CZDA 4XBSA 5FF2A 4PEKA 3A24A 3OA3A 1VYRA 4UFHA 3W7NA 2J88A 1W1ZA 3V1PA 2V5LA 1EP3A 2FIQA 3AJXA 5G5IA 3LHUA 1HUVA 5EA9A 4Q33A 2EKCA 2Q3OA 1Z48A 1LP6A 1DKWA 1J5TA 4LWWA 1SW0A 3NPXA 1M5WA 3THQA 2RDUA 4M5PA 2H3DA 1GEQA 3G1AA 4S2CA 3BG5A 2V5BA 4JYEA 5HMSA 5EPDA 3RNDA 5T26A 3EX6A 3L0KA 1LBLA 1FY6A 2YW3A 4LVAA 3W1LA 3UNDA 2X1SA 3A9IA 1VR6A 2JBMA 2AGKA 2W0UA 1KM1A 2J27A 3N34A 3PG8A 3W7LA 4A2SA 3GDKA 4NVTA 2VFDA 1RQEA 1VH7A 1PCWA 2VEKA 3DAQA 2VFEA 4QAIA 2Y61A 2A85A 3FEMA 1GVQA 1DQXA 3TAOA 3FYOA 3UWWA 4LTSA 2YR1A 1V5XA 3G1DA 1Q3NA 3ABOA 1TQJA 4R7JA 3OVPA 5AHNA 3OG3A 2HTMA 3UPWA 4EOUA 3GK0A 3W2MA 3G18A 2HSAA 4KFPA 2BTMA 1FCBA 3W84A 5AC6A 4PFMA 1GPWA 1TYGA 1FWNA 1YTDA 3W87A 3C56A 3W1AA 2ATMA 3WFAA 3KVKA 3EX2A 1KV5A 4UTIA 2B0MA 3BW4A 1XUZA 5LGZA 3GXTA 3W1XA 1FCVA 2CU0A 2QUTA 4S2BA 3BLIA 3LBCA 4NU7A 1H60A 3GAYA 2BSLA 1XL9A 1TTIA 3IIVA 3TIMA 4JX6A 3IGSA 1K8YA 3MW7A 5AYYA 1S3HA 3M6YA 1FUYA 4LC6A 2X30A 3TK7A 2Y7GA 4Z1CA 1C29A 1JULA 1L2UA 3NG3A 4RCXA 4DF0A 1S5TA 4TMCA 3O16A 1X7FA 3EXSA 1WOAA 2VXNA 4OV4A 4AH7A 4NXSA 3AO0A 3LHWA 1I2PA 5HUPA 3B05A 3QW4B 1X1ZA 1EP2A 1CX9A 3MMTA 1SUXA 5K4ZA 3TQVA 3L65A 1ME9A 3OBKA 3F03K 4WJEA 1PVNA 2OCZA 3P80A 4NX0A 3DFQA 3HPSA 1P0NA 5D33A 3O6YX 3PB0A 4IPJA 4KWWA 2E6YA 4UFKA 1YXCA 1JQXA 3SGUA 3GR8A 3IIPA 3KVJA 4OHQA 2VFGA 1VZWA 1O94A 1H63A 1TV8A 3LI1A 4WY0B 4FHAA 4GUHA 4HN4A 3SGZA 2QCHA 3CWOX 4MKNA 1LTDA 2H8ZA 3L0NA 4X2RA 5K7JA 2O7SA 3E96A 3LOTA 3QPYA 3E49A 2A7RA 3W1QA 3S0CA 5D02A 1KV8A 3HG5A 3PVFA 2YW4A 4UTJA 1VCFA 3L9CA 3SI9A 2TYSA 4TIMA 3FKRA 3L5MA 1RVGA 1H7XA 2V2CA 3GIYA 3BVJA 4MUZA 2DZVA 1H5YA 1TTJA 4N4QA 3QMSA 3S6DA 1ZJIA 1VCVA 3W1RA 4AF0B 4JIQA 3C61A 2V30A 4BFAA 3W1MA 3TU9A 3C2RA 2DZSA 1L6WA 5EL1A 4Z1AA 1KA9F 3PAJA 1T96A 4JYFA 1RQHA 2FQIA 1JCLA 3PF3A 4ORMA 4CQ9A 4LVBA 3W7PA 3HOJA 3M5YA 1H50A 2RDWA 4N9BA 4N2YA 4UTKA 4FNQA 2NZLA 3Q2DA 3VFLA 5H91A 4AHQA 3P8JA 4RK8A 1UUMA 4JDYA 4A3UA 3LXAA 5BW6A 1TPB1 1KLYA 2QCMA 1RPXA 2PCQA 3W3OA 1SO6A 1YXDA 3M43A 4LV4A 1H7PA 4W9TA 3NOEA 1WOBA 3N9RA 4WY0A 5TBOA 1FWTA 1OJXA 2ZZ1A 3NA8A 4ZQCA 1A5AA 3GAKA 3CEUA 3NQMA 2BLEA 3E0IA 4O1CA 4HNUA 1LYXA 3E02A 2EPHA 5LHEA 1QAPA 1O60A 5KITA 2QJIA 2C3ZA 1EEPA 2YFNA 4JXCA 2ISSA 5AFDA 1O5KA 4PA8A 3DENA 3BLEA 3P5ZA 3EEGA 2CFFA 1H7NA 1W31A 1TB3A 4K6AA 2OJPA 4CLMA 3N2XA 3WJZA 1W56A 1SFJA 4YXGA 3NQ6A 1ZAIA 3MP5A 3B06A 3S1WA 1LBFA 1THFD 4QSHA 3C52A 2Y7EA 3QPZA 4QNEA 3TW6A 4JTEA 2ZRUA 3IVTA 1YDOA 4ZQMA 2PC4A 4UFIA 4JTJA 1SZEA 1DJNA 3OVQA 5C54A 2G95A 2A21A 2PRMA 3MBFA 3C2VA 4TMBA 1I2OA 3CB8A 3ZR4A 2B4GA 3G0UA 3QSTA 4HHPA 2QDGA 4MZYA 3DZ1A 1HTIA 3NQGA 1T0OA 1F6PA 1N8FA 3GDMA 2C15A 3L0GA 1AW2A 4BI5A 2ZBTA 4UMBA 4MZ1A 4JR5A 2YX0A 3TJLA 5C2XA 2E6FA 4LUIA 3MI6A 1HG3A 3LRLA 3PULA 4MY8A 2FFCA 4RX0A 5IBXA 2P1FA 4WXZA 1TO3A 4GBUA 2CLKA 1I4NA 2FDSA 1K7EA 4N9CA 4AAJA 5KMYA 5CG7A 2EGZA 2NWSA 5EKYA 3HPZA 3IGUA 3TSBA 4M7SA 1SSGA 2B7NA 4I7WA 3HG3A 4C1KA 5L9FA 4MY1A 1OFPA 1AW1A 2A0NA 1TPVA 4XBKA 3W1PA 1B57A 4UR8A 3BGGA 3O6DA 2PRLA 4HPXA 3RFAA 3GZ3A 3W75A 4DBDA 4FO4A 1LLZA 5D09A 3PBUA 1R46A 2CLHA 2E5DA 2Y88A 3IGXA 4O52A 1EUNA 4Y90A 1EUAA 4XTDA 3CWNA 1HL2A 1WA3A 4UFLA 4I7UA 3HMJG 1DORA 1KFCA 3R89A 1NFBA 1OFAA 1XBZA 2R14A 2ZZ7A 1JCNA 4TX9A 1GOXA 4MLJA 1WQ5A 2IQTA 4JDBA 4DPPA 4I9AA 3A5FA 4DO4A 3SFKA 4O4WA 2WO5A 3ATZA 1PS9A 1OVDA 3LCLA 3W7QA 5HULA 5SWUA 3FA5A 4K37A 3C2FA 3BW3A 1MXSA 3CT7A 3NM1A 3MP3A 4AXKA 2FLIA 3B8DA 3PY2A 5BMWA 4A2RA 4IWWA 1UUOA 5CZ0A 2R91A 3P8IA 3BV4A 2CLEA 4HSNA 4Z0JA 3V75A 5D2VA 3C4UA 1OYBA 2VFFA 3LCGA 2WPBA 1XCFA 3NQ2A 1M7PA 4GNJA 1VYSX 5AC8A 2HS6A 3LCHA 1BEUA 3H54A 2YSWA 2Y85A 3LTSA 3TQKA 1OFDA 3TSMA 5LNRA 4O13A 3TROA 2FPYA 4DO5A 1LM1A 4LS0A 5F2LA 2QCLA 3O05A 4M6PA 3SJ3A 4EF9A 3M5XA 1DJQA 5CPNA 3W7EA 3TDFA 1E51A 4AMAA 1GQNA 1G4EA 3TSDA 1W5NA 2A6NA 4S1FA 5KTLA 1K3UA 4WUIA 3DHDA 4YMZA 3QMTA 5F4XA 1SO5A 1F76A 3FS2A 3P61A 5AC7A 3DHFA 3LM7A 3QMRA 5D03A 3TNOA 2ATSA 3MJYA 1P0KA 3I6RA 4O50A 3B0VC 1ONRA 3INPA 1XI3A 5HQEA 3Q58A 2RHGA 1QPOA 2C18A 3MYPA 1LOQA 3F4WA 4O0KA 5U7SA 4LU0A 1TPWA 4OT7A 3LRMA 5G2IA 1SO4A 2GPTA 3GKFA 2QKFA 3FLUA 1FWWA 4MFEA 5I3KA 3PUDA 4CNOA 3G0SA 1FDYA 4E2BA 3N19B 4FX6M 4O11A 3EXRA 4K7VA 2YZRA 5LNUA 3QC3A 4UFMA 3IIZA 3GLCA 4FNPA 2GVGA 3W70A 4MZ8A 2DZPA 4DF1A 4EF8A 3GDLA 2V0TA 3HJZA 3LDVA
chains in the Genus database with same CATH superfamily
4J3WA 3WH6A 1DXEA 3R58A 4GO9A 1JZ8A 3QBUA 2DGAA 1QNPA 3GG7A 3KOXA 1JRBA 4LH8A 4QISA 1BYDA 1GOKA 4MYXA 1KM5A 4YCOA 1WCGA 3ZSSA 4U5IA 1XD0A 3PR2A 4MJ4A 1FWRA 1FA2A 4BS0A 1GZGA 2W79A 4R34A 4XVDA 2OT0A 5AYXA 3K4WA 3DGRA 2BXVA 3ALFA 2Y70A 2G97A 5JBFA 4Q8UA 1HFBA 3PM6A 5M1TA 3I7SA 2E68A 2QCGA 1RCXB 5FI8A 4ADTA 1KCXA 1HVXA 3W7OA 1J0IA 3AICA 4RXGA 5I07A 3MMWA 4C6BA 2IPJA 4GG9A 2G3JA 1FXPA 1UR0A 3BV7A 1C7TA 3UR7A 5LKYA 1TV2A 4GUJA 2W67A 1XDLA 1PJ9A 4XISA 1MQRA 2Y8KA 3GNPA 1PV8A 3S47A 1KM6A 3BANA 3ZLGA 4AEOA 2GZXA 4AW7A 3W74A 4XZHA 5FESA 1HO4A 2VEGA 5HDRA 3TFCA 1RJPA 3EWUA 3LYEA 3LY0A 4XB3A 1UA3A 4E0CA 1MEHA 3P60A 5XIMA 3L66A 1IEIA 4M3PA 1O66A 2GLKA 1GVRA 2GOUA 1B31A 1LUCA 1E4MM 3VNYA 1XIMA 4GISA 5DLCA 5D2XA 4OZOA 3BGAA 2CLIA 4FNRA 4DNMA 2PD9A 1RD6A 3CPRA 5CGQA 1C8YA 4H6KA 5LNWA 2A3LA 1SZRA 3UY7A 3AHTA 3WQPA 4LUSA 1F3TA 1R7AA 2JKAA 2HCVA 1XLMA 4XUGA 3HPFA 4KESA 4O19A 3B9DA 1OB0A 1RZMA 2OGYA 3NTYA 4Z2HA 4P2VA 1C3FA 4S3KA 2C16A 1DWGM 1U1JA 4LVFA 1TSIA 4MDPA 1PSCA 3KP1A 5ENLA 3LERA 1M9HA 3AALA 3UESA 1SFTA 3PPFA 5IFPA 3K4DA 3NQBA 4N4PA 1W9VA 3BLKA 2J47A 1ICSA 5LNVA 4ZBCA 4F9JA 4HK5A 2WXDM 1Q6QA 4LUJA 1MQQA 4ILSA 3BGJA 3PZMA 3NZ1A 3W73A 1X6NA 3MWCA 4AD3A 2WANA 3W25A 1LT8A 1K9DA 2QF8A 1OG0A 5CPQA 1SJBA 5HMEA 4L9YA 4C7DA 4P61A 3GNOA 4O17A 3W6YA 5D2YA 3CTTA 1KWKA 1W54A 3KRSA 2QCEA 3P0XA 2QCCA 2ZXQA 4TV6A 1VLIA 5ABTA 4WOQA 1QPRA 3TTEA 4AD5A 1QPNA 3OLIA 3EX3A 3AS3A 3LRKA 1IV8A 1UD3A 4UTWA 4R3UA 1NP0A 4EAYA 4CD4A 1UWTA 4F79A 3LNMA 3KL5A 4HVXA 3W53A 2OLSA 1O95A 4PUEA 3P84A 4RPPA 4P7LA 4QLKA 2DZBA 3ITOA 4F0LA 4RDZA 1CNVA 2NLYA 4I8DA 1QPKA 5BOFA 1IYXA 1PTGA 1W5QA 4DXXA 2XISA 2NXIA 3W07A 2F84A 5DF0A 1WDPA 1VHNA 1NSJA 2GDVA 2R1MA 1JQVA 4ZB2A 1EDGA 3UG5A 2A7NA 2Y63A 3VCCA 3AUOA 4LANA 3TUUA 2OSYA 2D2OA 4WD0A 1EBGA 1CENA 3S5SA 3GTHA 1X6UA 5FJUA 3JS3A 1GW1A 4YL2A 3KBNA 1Q6EA 4AD1A 4E38A 2BX7A 3MT1A 1G9HA 4FF7A 4U2ZA 4KRZA 4IMAA 4B15A 5CC5A 1XH2A 2PLJA 5EMYA 2JIWA 1P6CA 3C5QA 1V3MA 3WK0A 3FYPA 3U2ZA 1Z3NA 1UOKA 2VR4A 1AMKA 5ABFB 1XIEA 2F8QA 3VKDA 3GDRA 4NZ5A 1Q6RA 2YXXA 4ZOEA 4PUKA 3UXDA 2PU0A 3TYUA 2C1IA 2WVSA 5CGMA 1CXLA 3G8RA 1TTPA 4PTNA 4LVDA 3L68A 1JPDX 4NZFA 3QQ0A 4V33A 2VENA 3ZZ1A 1US2A 5B7ZA 1R3QA 2RFGA 3STCA 3M16A 4YJ5A 1KFLA 3RUBL 2FB2A 3S1UA 4X22A 2Y7FA 3LTYA 1H41A 1S2AA 2V5CA 2V81A 2ACSA 4KPLA 3TTOA 3FW6A 1ZRQA 4K1WA 3R94A 3S4TA 4S38A 1V4YA 1VGAA 3NL5A 4LS2A 1JCJA 2WM1A 3N12A 4ZO7A 1X97A 1UP3A 4B5WA 3HFYA 2X7WA 3GQYA 3LHTA 5GNZA 2E4TA 4M8UA 3O06A 3N11A 4NRRA 1TWIA 3W7IA 5C7VA 3OODA 4IX2A 3AIQA 3SUTA 3WLSA 4AWUA 1Y5XA 3PPGA 4MKVA 4KF1A 3PZOA 4L4LA 1VFTA 2OWCA 4A8RA 1ECEA 4FMVA 3NOYA 4IL2A 1SQ7A 4XUYA 1XBVA 5CBJA 4PMJA 2UY2A 3N2MA 2I14A 3P81A 4ZENA 2YPIA 3SUSA 4C6OA 3LPPA 1D9EA 1SJCA 4AC7C 3G22A 4DM1A 4JOMA 1SFLA 3WJSA 5I00A 2DT3A 4GFIA 3S5YA 5FEWA 2Y8UA 4H7CA 3GVWA 1XICA 5KEZA 4LYQA 3PC0A 3IANA 3AUJA 2CXGA 1RY0A 3LHYA 2C0HA 7ODCA 2BODX 1ME7A 2XU2A 2Y89A 2WOQA 5HR7A 3B4YA 2FTPA 2BB0A 5DX7A 3DIPA 1ZGDA 2Q8LA 2ZIDA 3KEHA 3EAUA 2ZRXA 3MSRA 5IBXC 1BVZA 1RA0A 3UPBA 3OZOA 4AZCA 3S9IA 1Z8AA 1R8LA 4HCHA 3AIUA 3POCA 3RAOA 2DIEA 2VEPA 1JRCA 1RR2A 2EAWA 3ZJ6A 1IEQA 2WVTA 4PMOA 3TR9A 4YYCA 1H11A 1J18A 4UC5A 1H0IA 2WW5A 3FCPA 1OCNA 3SN4A 1E1CB 3PFMA 3GC4A 1P6BA 3CNYA 2HVNA 3OTRA 1G1YA 4X63A 3VDHA 3EWDA 3NEHA 2R1KA 1EGMA 1A3XA 2JGYA 3WD4A 1FHLA 3CAVA 1HJWA 4U33A 1GWJA 1XC6A 1I8JA 3VOCA 2KAUC 4F0MA 4HSOA 4UQ9A 1OCQA 1PYFA 4ZXOA 1FCUA 1GUVA 3H70A 4J2PA 4GO8A 4OU1A 2CHNA 2DH2A 3VIOA 2IQ0A 4WVXA 1EZ2A 5G1TA 4FXRA 3S2CA 1EO7A 3E9AA 2GYIA 3L23A 1T41A 3T8LA 2V5DA 1JXKA 3WDRA 4B5TA 5DO8A 2AGTA 3VAVA 3F1QA 2QAPA 2WNNA 3ONCA 3CQIA 3O6CA 1E6XM 1ZZMA 2Z00A 4B9YA 4URIA 1EOMA 5BRQA 3CV2A 5ABFA 2RKXA 3NFUA 4LVGA 2NUWA 4BK9A 4J1OA 2JF7A 3LA4A 3UYCA 1DE6A 3PJUA 2YXGA 4Q8WA 3E74A 2REQB 5HBFA 3PS7A 2JALA 3GHSA 3ABRA 2PODA 4I9TA 1HP4A 1ZUAX 2QUUA 3BAIA 1XCXA 2P76A 3V5CA 4B3LA 5TQLA 3UG4A 4RL3A 3LNPA 5I3JA 4N42A 4BR1A 3GG1A 4PCFA 1NFGA 3UETA 2WSYA 4LUYA 5AN7A 3CL6A 1G7VA 1NDYA 2YBTA 3MVIA 1DQWA 1I9CB 2YL8A 1ZAHA 2NVCA 1EB3A 2GDUA 3PB2A 2GK1B 1JUKA 5EMUA 1AUSL 1MQPA 4R9XA 3AIBA 1QO2A 3HIJA 1ZALA 3QV9A 4PODA 5LIUX 1VLWA 2ZFAA 3TWAA 1J12A 1DVJA 3VOHA 4ZE4A 1LG2A 1JIBA 5HNTA 3VMPA 3LCWA 1D7FA 3TLLA 3UZWA 1O5QA 3V18A 4AISA 2FZDA 7TAAA 4MPKA 3PG9A 5D30A 4BF5A 1R3RA 2X0YA 4CNSA 3GH5A 4YWSA 3NVTA 2E77A 1OM0A 5KSWA 3GW0A 1DQUA 1H1ZA 5DCDA 2ZCGA 5HXMA 3FNDA 5CQ1A 4V1XA 4WY0F 3N3MA 2XIQA 1XR2A 1ZTVA 1WE5A 5DCBA 1GTEA 5JU6A 1YPIA 1LLOA 3ARQA 2HVOA 2TSYA 4FNSA 4XZBA 3BAJA 3AIRA 3C86A 5I02A 4DUOA 4NT0A 1HF6A 2UY4A 1D7KA 4W85A 4V1YA 4QX4A 3SIZA 1IZJA 4QDPA 1TR1A 4IZGA 5DQPA 1UCWA 3O63A 1Z44A 4IJRA 2Z26A 4JY8A 3GY1A 2ALRA 4RE2A 1QNRA 4LGXA 1ZFJA 4HHHA 3VKJA 7XIMA 4B90A 1AH0A 4DY1A 3NEVA 3RF9A 4QE1A 2IW0A 3UU0A 4K36A 3BLDA 2OZTA 2ZRYA 4JIEA 4ML4A 3PNZA 3RLVA 1XX1A 4J35A 2ZOXA 2GGGA 1CGXA 3IV3A 4CNNA 3CHEA 5A8NA 3YPIA 4DB7A 4PN2A 2YGYA 3UCQA 4NUWA 1VD6A 5AY7A 3BLLA 2ZRWA 1FHVA 2CZ5A 5D2TA 3NXFA 5KZMA 3NQ8A 2WAGA 2DVUA 3IGHX 3E3HA 5HNRA 3E38A 5DXYA 2YDRA 4RDVA 3TP4A 2ZDRA 4GQGA 4O8RA 4FK9A 4C1LA 3SAZA 1SM9A 4IUOA 1W1VA 5ABGA 3K13A 3W7JA 3M0IA 1TJPA 4A05A 3L21A 3IRDA 3UZ5A 1RXOB 4OKDA 4H41A 3GM8A 5T8GA 4HOXA 3ANYA 4CNPA 3S9YA 3ZS4A 4U28A 2DZWA 1KTNA 2C8NA 1VBJA 2CC0A 4LW7A 4AHPA 5AYIA 4BQ4A 7CGTA 1RCQA 5MHBA 2DQWA 2DW7A 1J10A 1QR7A 2AAMA 1WKDA 3P7YA 2WMIB 1FVPA 3CHVA 3RX4A 5CSSA 1OADA 4WR3A 4ZZ9A 4TV5A 2VZOA 3OZYA 3NQVA 3F5KA 3G77A 4F66A 2ANUA 2NUXA 3TVAA 4HTBA 4HA0A 1CTNA 5CH9A 1J5SA 1ML1A 6CGTA 3T08A 1VPYA 2CESA 5J8LA 2C1HA 1RQBA 1H2JA 4A3HA 2R1LA 4UZUA 3FSUA 3MBDA 5JXQA 2WBKA 5EFFA 1BXNA 4ZFMA 4ADSA 3G0XA 4E6MA 1BSLA 1TFVA 1TZ9A 1B3XA 1XYLA 1QWGA 4YVPA 1OFRA 3FAXA 4A4AA 1FXQA 5G2WA 1OD8A 4JFWA 2WHLA 4FEZA 3W1TA 4KCUA 4OQVA 3GTFA 3VKKA 1E0VA 1S5VA 3NGJA 7REQB 5DCEA 2J62A 1DIDA 2O4MA 3OVRA 3W4RA 2ZE0A 2NQJA 5IDZA 2V5JA 1IZCA 1OT1A 3NR0A 1IGSA 1NDWA 1R85A 1EJSC 1HNYA 1Q6OA 1PO9A 4XSLA 1GGOA 1YLVA 4CQCA 4RLIA 2C79A 3CWHA 3N04A 1TMHA 3DDMA 1JFHA 1K4GA 4MJZA 3T42A 4MKSA 5JBDA 1XGZA 3RX2A 1UR1A 3VNLA 1TVLA 4CN6A 3H26A 1WDQA 2GWGA 3HB9A 1TR9A 4GVHA 4JS3A 4IMFA 4JAWA 3B9NA 4PZVA 3OZPA 1F74A 3NQ7A 3VXGA 3HV8A 3CZGA 2RJGA 2D20A 3MUCA 3H2EA 4D8ZA 4YTRA 4PMUA 4Q8MA 3SN0A 3FDKA 1TE6A 5IM51 4XX6A 1HJVA 3F5LA 2NV1A 4LFYA 5FA5A 5CPSA 3P62A 3HQ1A 4MWAC 2CHRA 4PEEA 3ANVA 3DN5A 2WHJA 2O7QA 3RHGA 3HGJA 4MWAB 4MY9A 2HPMA 4NAEB 3CTLA 4NJHA 3WQWA 2HEJA 3B8IA 3GDBA 3ZIZA 4UCFA 3MKCA 4WXYA 3WLMA 5BXSA 3ARTA 3ZJKA 1I6NA 3MC5A 1LBMA 2YB4A 2RGLA 5I3GA 5A8PA 4ERGA 1TX2A 2ZC8A 1JCYA 2DZXA 3BTNA 1UH3A 3G3DA 4DUVA 3A5VA 3I3DA 3WLRA 5I7GA 1XM3A 4EWJA 2YA1A 2QCDB 2VVSA 3AU6A 2NV2A 4BJHA 2C13A 4EK7A 2FPVA 1QMLA 2D22A 3KM8A 5FEZA 1A5NC 1R2RA 4ZSTA 5XINA 1AG1O 1TA3A 1QCWA 1PX3A 1MUMA 3TFXA 4R33A 1UASA 1JCMP 4JTAA 4AY1A 2Z2UA 2YCJA 4U2YA 1FWSA 1N2VA 4JTSA 4BWLC 3A13A 3NIYA 4M56A 3S2LA 1QPQA 3RCMA 3WJWA 2IPWA 2EKGA 3LUTA 4NKCA 2YL9A 1SU5A 3LTPA 4KEMA 2CBIA 4IOTA 2GJXA 4GPNA 4O1EA 3RILA 1VP5A 1EX1A 2NSOA 1BPLB 5AHMA 2D0FA 2ZTJA 2CCRA 1DWFM 1MZHA 2QEZA 4G56A 1DIOA 1K77A 1EGVA 2A6LA 2DUZA 1Q63A 3N1AA 1UQYA 4XZNX 3KBVA 4LJ3A 1W37A 3AXXA 5JBEA 1OX5A 5EY5A 3B0PA 1OX4B 2XGZA 2D73A 1UB3A 4NYUA 3DHPA 4NRSA 3VIFA 2VD8A 3RCYA 3JU2A 1EDTA 1U5JA 3SM0A 4B92A 1C7SA 3UEQA 3S8HA 2DW6A 4DJFD 2F2KA 5XIAA 2YYTA 2I5QA 3QPEA 4HA1A 1A5CA 3W02A 3G1VA 1YTEA 4K68A 1ISYA 1K1DA 4H2HA 2PSNA 4PEKA 4B4HA 4W4QA 4UFHA 4D6CA 2BBFA 3H7RA 3VA8A 5CJNA 3AFBA 5LA2A 3LHUA 5ABEA 2BHUA 9XIAA 1Q7MA 4Q33A 5I03A 2QVHA 2G3MA 6TAAA 2HJPA 4LWWA 3VK5A 1SW0A 1S2UA 5CPTA 4MNMA 2BV9A 3QV8A 2V5BA 1PXGA 1FY6A 1XIFA 5A69A 3ARPA 1VR6A 3WF2A 3BMWA 4ZODA 5E09A 4Q7NA 3SCRA 2D0GA 4AEEA 3E5BA 4QAIA 1AZ2A 4ENLA 2Y61A 1TA3B 4HP5A 1XIGA 2YR1A 1V5XA 3M0LA 3G1DA 3QYSA 4MJ2A 1HW6A 1TQJA 4C6CA 5AHNA 1JI1A 2MUCA 1R38A 4IQDA 4M6UA 3CPUA 4PTXA 3SCUA 1FCBA 4NZCA 5AC6A 4PFMA 1GPWA 3C56A 1EOKA 5CGTA 3O3RA 4LAOA 4NAFA 2ATMA 1KV5A 3WKZA 3BW4A 2EO7A 4HK6A 4I5XA 1Q7QA 3U5UA 3HQPA 3EMQA 2ASHA 3EKGA 4GVIA 1XLJA 2XVGA 2QUTA 3RJYA 3BLIA 3ALGA 4C6IA 4CKQA 4DJEC 3IIVA 4GY7A 1K8YA 3MW7A 1W9BM 4G8TA 3WUBA 4ZOBA 1FUYA 2P3EA 5DEZA 1C29A 1RLCL 3QR3A 3HV9A 4DF0A 4ICMA 5B7YA 1X7FA 1WOAA 4X9YA 2VXNA 2E28A 1A4LA 3AROA 3BOFA 1RA5A 3B05A 5GJNA 3QY6A 3NCOA 3F03K 1QRQA 2TODA 3B0YA 4W84A 3PB0A 4KWWA 3ZYZA 1YXCA 4GHRA 4NIRA 3GR8A 3IIPA 4WF7A 4H2CA 1VZWA 1N82A 1TV8A 4XZMX 3SGZA 1ZJBA 3CWOX 4C6MA 4DBSA 4MKNA 3D5HA 1DWJM 1DJZA 1QUMA 3T9PA 3FGCA 3VCNA 2YA0A 3QLLA 2E67A 2EG6A 1OD0A 5D02A 4KETA 3AWNA 1E6SM 1TWZA 1VCFA 1YNYA 3L5MA 2A3BA 2OLAA 4N4QA 5ECVA 1TTJA 3QMSA 4IIFA 3S6DA 3VM5A 3C61A 3PZGA 2WNWA 1XPGA 1X38A 3W1MA 3TU9A 1V3LA 3GVVA 1JDDA 4F2TA 3C0QA 1XSIA 4JYFA 3AAMA 4LYRA 3VZYA 4ORMA 1ZBKA 1ZP3A 4LVBA 3H7UA 3M5YA 2HQAA 3OYZA 4N2YA 4Y7EA 4FNQA 1LWJA 4RK8A 1UUMA 2I9UA 4Q8PA 3RITA 5E9XA 4YS1A 2DPEA 2WWDA 4S3FA 1O12A 4NY2A 4M1RA 1WOBA 2O9OA 1XLDA 1A5AA 4GYJA 1CGWA 2E7FA 3ITLA 1JL8A 3NQMA 5D9PA 3HZ3A 3E0IA 1X39A 3RR1A 1W3JA 4P7OA 1LYXA 3DESA 5LHEA 1QAPA 1QI4A 3EDFA 5KITA 1W9UA 1EEPA 2YFNA 6REQA 2WPGA 2ISSA 1U1HA 4JXCA 1XDJA 4PA8A 3VKAA 3P5ZA 4DJEA 1H7NA 1TB3A 4K6AA 4OBRA 4CLMA 1W56A 1SFJA 4YXGA 3VGBA 3NQ6A 1ZAIA 4L6DA 3MP5A 3RM8A 1Q2SA 2DUXA 3FY1A 1MVYA 2IKHA 5BWFA 1A49A 3WMBA 1YDOA 3TYZA 2PC4A 4JTJA 3ZT7A 3I10A 4U5KA 1CGUA 4HYVA 4Q4RA 4PTDA 1TVPA 1EJWC 3CYJA 2J7FA 4ROPA 3ZR4A 3ONBA 5C9WA 1V79A 3CV7A 4HZMA 3OQEA 4MZYA 3NQGA 2EQDA 1B3ZA 3GDMA 1AW2A 4GI4A 2ZBTA 4BY3A 5ECUA 4JR5A 1PPIA 1QWKA 3TJLA 5FL1A 2QPSA 2E6FA 4GBDA 3MI6A 1OEPA 3LRLA 4RX0A 3L4ZA 1F3XA 1UIOA 3KBWA 4HGXA 4GBUA 2XZ9A 3I4KA 3OGVA 4TTUA 1K7EA 5KMYA 5CG7A 1W1TA 4MDOA 5L9FA 4MY1A 4K2SA 2A0NA 1TPVA 3O6DA 3MCMA 3BAWA 4DBDA 4Y8EA 5A8OA 3PANA 4JQ2A 5BOEA 2VR5A 4GMEA 3WD3A 3PBUA 2CLHA 2E5DA 4BKNA 1J2BA 2Z24A 3UZZA 3BSMA 1U5VA 3ITCA 4XTDA 2WB5A 3S6TA 1WA3A 2PLKA 4YVXA 1DORA 1J11A 1B1YA 2R14A 3CUFA 3KBJA 2ZZ7A 1GOXA 1QJWA 1KR1A 4Q4PA 3E0FA 1WQ5A 2IQTA 4DPPA 4ZXLA 3WEMA 3A5FA 3OA5A 2GDQA 4LBSA 1PS9A 3LCLA 5SWUA 3FA5A 1W9XA 1CGVA 2QNEA 4AXKA 1KRCC 3GXDA 3R43A 4W5ZA 4QJ3B 1R86A 4CD7A 1H3GA 1VB9A 5CZ0A 1E1CA 3GU1A 4JQAA 5CJ5A 4C6QA 2CLEA 4HSNA 3Q45A 4B5SA 1V6VA 4DJDD 3AS2A 1XCFA 1NQ6A 4GCXA 1X1NA 3G6LA 1VYSX 4MWAE 3UXLA 4UTFA 3WQCA 2Y85A 4AIEA 4O13A 2VCAA 1F4AA 5CSYA 1TZ7A 5F2LA 4QROA 3B3DA 2B81A 1V3KA 4EF9A 3UGRA 1ISWA 4A3QA 9CGTA 3VD9A 5CPNA 2OGJA 1E51A 1GQNA 1Y5VA 4RE4A 5KTLA 1K3UA 3QMTA 3KDNA 4LB3A 1B3VA 3QMRA 1CECA 1AJ0A 2ATSA 1P0KA 3A3XA 3FGCB 4KGLA 3OU8A 2GJXB 1TV3A 5HQEA 1QK0A 3Q58A 3K2GA 1R3VA 2RHGA 3OGRA 3H2MA 3MYPA 3F4WA 1QASA 4IL0A 4OT7A 2VX6A 3OOQA 3T8QA 1FWWA 5I3KA 3MJMA 1FDYA 4CNUA 4FX6M 3WUEA 2HRWA 4O11A 5FACA 4K7VA 5LNUA 3TNBA 3GLCA 4DNHA 8XIMA 5DMNA 5IDIA 2OQLA 4JTDA 1V0MA 4NASA 4NZ4A 3SIMA 4EF8A 3UQNA 2OFJA 4JBRA 3LDVA 4MUPA 4IJCA 3CS2A 1CI1A 3GVRA 4P8WA 4EP8C 4LF1A 5H8UA 2QCFA 1H51A 1SJAA 1IEWA 4HU4A 3IARA 4M80A 2BWGA 1GVIA 3DG7A 3SY8A 1GKRA 2FHCA 5HANA 1IXOA 2YXOA 4NJJA 1TUXA 3DC8A 1UBSA 1EJXC 3KVLA 2Y2WA 4X61A 4C6PA 2SFPA 2ZUMA 5H8MA 4K8GA 3AYSA 2ZWYA 2VD9A 3BMVA 2PTDA 5FAJA 2HXUA 2V68A 4OBSA 2YDQA 2GUBA 4NP7A 3EPMA 4F9DA 4JEQA 2BVYA 3JRKA 4B2DD 2Q6ZA 2PGEA 4GK8A 3VIIA 2OQYA 2C14A 4U10A 3M6DA 1JCXA 1H0GA 3U2EA 3MTWA 4UMAA 3FEQA 5C0QA 1QT1A 4H6RA 4AZGA 1X96A 5TIMA 3VGHA 3VIJA 3VCRA 1SFSA 3NPVA 1GQIA 3VNDA 2ZRVA 2VX4A 4B3KA 1TPEA 1FX6A 1OGSA 3IJQA 4XKYA 3ARVA 3CLMA 3FJ6A 2WZEA 2DJXA 2RH9A 1CPUA 3W88A 3B9OA 1UJPA 4GYFA 1W1IE 1N55A 3WLQA 2BOGX 2PWHA 2R8WA 1JZ3A 1XYBA 2PLMA 2V82A 2YCKX 3QKEA 5F4SA 1SMDA 4KGJA 5CZTA 3HJEA 5M3WA 3W7GA 2HVMA 1EA9C 1O5XA 3PUOA 3M64A 1E6RA 4OJYA 5BRPA 4G5DA 5GJPA 4R5EA 1C9DA 4PL2A 4XZLX 1RCOB 2OTDA 1Q45A 1YQ2A 1ZB5A 1U5HA 3O0KA 1IWPA 2X16A 1VRDA 1WX0A 3VD5A 4ZQRA 3ZJ7A 2V3DA 1TX0A 3POHA 5A6LA 1VS1A 3UWQA 1SPQA 3KS6A 3P0WA 3TW9A 3BK0A 1E55A 5FEPA 3EWYA 1LZOA 3B8UA 2VEMA 1E3XA 3SZ8A 3BCDA 5AECA 3I7RA 3WLOA 3HA1A 5M03A 4HOWA 4GI9A 1VFLA 1LUCB 4FIRA 4GGBA 2GVJA 4Z2KA 5HWNA 1RK5A 1QNVA 3VOGA 4JHZA 1TUFA 4KMQA 4AHOA 1IEVA 5LZLA 4LS1A 1SR9A 1BGGA 3TMQA 4QLJA 3EMZA 5D2WA 4IMCA 3STEA 4C5YA 2VX5A 2DH3A 4FLQA 4EAMA 1XYMA 3MO4A 3W6MA 4YCPA 4ZO9A 4DJFA 1K8XA 3CUHA 4GY1A 4QS5A 5LA0A 5FIPA 1MZRA 4IX0A 3MI3A 3KZSA 3G2GA 3B9AA 1UZ1A 1BF6A 4LAUA 1C9WA 4CN4A 2VNCA 3SQSA 3TW7A 4M0XA 4ZSUA 3EB3A 4I9MA 1B9BA 1VBUA 1G69A 3PWIA 5D8ZA 4QP0A 5JIPA 1I45A 1G4PA 1H1YA 3MPGA 1TV7A 1RH9A 3QW3A 4JTQA 1V3HA 4KFOA 8CGTA 1NF7A 4GD0A 3IJIA 4PMYA 1NOUA 4ATWA 1WP6A 2BY3A 3RRAA 1TJRA 3LCIA 2JE8A 4D6EA 4E2DA 3M47A 3IJ6A 1KD0A 3C2OA 1ZBVA 1XG4A 4AB4A 3LENA 2PURA 4OBTA 2PWFA 5J5DA 1F8IA 1UH4A 1YEYA 1W3TA 1LDCA 2WKJA 4AX7A 1QW9A 4JQ4A 5K4XA 2V69A 3WLTA 4WDTA 2AQOA 4HQVA 4BQ5A 2HISA 2ONEA 4OV9A 3WQ8A 1I2QA 4H9ZA 1VJZA 3CAQA 3RU8X 2HNHA 4YLWA 2QF7A 2J6XA 3WN6A 3BC9A 4NI3A 1AQFA 4E8GA 1NP2A 2CETA 5L6UA 4MGGA 4MNJA 4I3GA 4K7YA 1IWAA 1KM4A 1J8VA 1SGJA 3L4YA 1IR1A 1HJQA 2QUVA 1XDMA 1BFNA 1OK6A 1RJQA 3HF3A 4H8NA 1M68A 3QTGA 2VZSA 4DLFA 1US0A 3I3EA 4H4IA 2P88A 4US5A 1BTMA 2C71A 3GNDA 3IEBA 2Z1VA 2EPMX 1GQLA 2XN1A 1WDWA 3SN1A 3HGRA 2PFHA 1X8FA 1K70A 2V8ZA 1M3UA 4JFTA 4AYGA 5REQB 4C1NB 4XAZA 3QR1A 1CLKA 3VKBA 2ABAA 1W3HA 5C9UA 4Y9NA 4IJBA 1HKWA 1W9PA 3RLUA 3W23A 3DKLA 1UWRA 2QCNA 2XIMA 5D9OA 3TJ4A 3FA3A 4TX8A 5EFDA 2GJRA 5CEWA 4Y9AA 4JTUA 2A1YA 2H9AA 3LN3A 3NXLA 1Z89A 2GGJA 3OYXA 5AYZA 3B9EA 3TMLA 4GNVA 4YTTA 5CPMA 4W7UA 4AC1X 1RBOB 2VOTA 2CZVA 4D9PA 3KVMA 1A3WA 1WAUA 3W7MA 3EDDA 3TQ0A 4J3TA 3A4WA 1A50A 1JG9A 1UKOA 5GNYA 4AVFA 4FX8A 1TPUA 4F40A 3VFCA 1ONXA 3WK2A 4MB3A 1PZ3A 3NYDA 4O10A 4QQ3A 5H2ZA 1NY1A 3M7WA 1K7XA 1W5PA 3DI0A 2ZE3A 4PUNA 2ZZ3A 3G1XA 5HMDA 1B2YA 1FWGC 5G1YA 3EMCA 2F2HA 3BMXA 3P5YA 3PPHA 4JKKA 2WHMA 1UZDA 1F4HA 4J7RA 1OYCA 1VYPX 2NX1A 5FD0A 2FDMA 4HU0A 1HKVA 1EJ7L 1AK5A 4XKMA 2WMJA 2X0SA 4DJDA 3HO8A 3L2MA 4OTKA 5BROA 5GNXA 2E09A 4NYYA 1EC7A 2PDYA 1E9IA 4DYKA 2OELA 3W1NA 2X0HA 1H61A 2IKIA 3CQJA 3N29A 1FBAA 5HWMA 1C91A 1UR4A 3AHVA 5K9CA 4A6GA 1WZAA 3T0BA 5TNVA 3CLWA 4O14A 4KT2A 2WJDA 3G8EA 2ADAA 4E8CA 3C8NA 1F5ZA 3M9YA 2PDIA 4FOUA 1JDFA 2O55A 4ZTXA 5A2AA 4QAWA 4Z2LA 3U7VA 2IQDA 3PBYA 4IPIA 5D05A 4R7WA 1WKYA 4WDXA 3ARWA 3K1GA 4ATLA 3OIXA 3DHUA 1POKA 4FX7A 1P4CA 4NL1A 4Z08A 1E1EA 4US5D 3ZWSA 2VFHA 3CIWA 4JN8A 1E1FA 1HN1A 1G5AA 1MW2A 1EXPA 1SZNA 3O15A 3T0TA 4WDUA 3H12A 3CB3A 3GBDA 1QI3A 4C6KA 4UTLA 2QT3A 2GQ9A 2J77A 4A22A 4KIRA 4UB9A 1DWHM 5CG0A 3WLHA 1FFQA 3WEOA 3OGSA 2AOSA 3BW2A 5IOBA 5E9AA 3CUJA 1CWYA 1O1ZA 4DYEA 1DE5A 2YL6A 4AXNA 4QEEA 1P5BA 2X1UA 3NQEA 3OLGA 3ZR6A 5HQMA 4XD6A 1LQ0A 3MA8A 4YHGA 3SECA 3KLKA 4Z0SA 4P7RA 3N13A 3L4XA 3CYVA 3J7HA 1OYAA 2Q8ZA 1K03A 1K9FA 3SCTA 1W3IA 1L0PA 4RV8A 2ZX9A 4H7VA 5D32A 4ZL1A 5T91A 3DFYA 1ODUA 3G6MA 4D6FA 2XHYA 3NO5A 1UR3M 1JF5A 4WK9A 3OJGA 3WQDA 5KINA 3FOKA 3ANUA 2YLLA 2DT0A 2NXHA 1WO2A 4K8HA 3AISA 3VO0A 3ZXWA 2ZA1A 4QTGA 3T0CA 4LNYA 1B3YA 3W00A 4Q4KA 3W7RA 3EB4A 5DMLA 1BYCA 3URAA 1CXHA 3PUGA 5E0CA 3UJ2A 4MB5A 4NJKA 3SY1A 4NJGA 1UC4A 2VWSA 1GONA 4V2XA 1LQAA 3R6IA 2W4XA 3EX4A 1UWAA 4DPQA 3H2NA 2VGGA 1L9WA 1FKWA 3GHUA 3KXQA 1SMAA 3W72A 5AB3A 2DDXA 1HL8A 3HGOA 3PWAA 4LV9A 5DXXA 4ECLA 2J9YA 4DBEA 4QM1A 3BCJA 1OQFA 4LCSA 4GZJA 4IQEA 4IGHA 4L80A 3MDUA 2Y4SA 1NVMA 3DX5A 3MI2A 4Q7IA 1V03A 3S5NA 1V0LA 4XAGA 3M0JA 3QGVA 1GQJA 4O16A 1XRFA 2YDSA 1NEYA 3CUGA 3GC2A 1Q4WA 2F7FA 4IIHA 5HUOA 2VO5A 4D6GA 1N8WA 1XXXA 1S5MA 2Y8VA 2EPKX 3W27A 2WQPA 2R94A 3RM4A 3WBEA 4AMCA 1I1XA 3FJ4A 4LUSB 4MVAA 4QXIA 1JZ5A 2QR6A 1OC7A 1GZJA 3CUXA 2XSBA 3GYEA 4GJ1A 2FHBA 3VDCA 3UJRA 1NARA 4JCLA 3SSJA 4PBFA 1DXIA 3VOJA 2OPJA 5BMXA 3KS5A 3EPNA 1CXEA 1QHOA 4ORIA 1GJPA 3CXOA 3NPUA 4UZSA 1RK6A 2PZ0A 4MOZA 3CIXA 3W2LA 2XM1A 2EBNA 4HYRA 2BS9A 1IXQA 2PDKA 4F8XA 5RUBA 1W3NA 2J66A 2XUCA 3ZVHB 4BI7A 1YBQA 1QVBA 3APTA 4UOZA 3FX4A 3MKKA 1VBRA 4C65A 1S38A 2IMRA 2HXTA 1GG0A 3B4UA 4TVDA 2PGRA 1J01A 3BG3A 2QXWA 3SQMA 3D46A 4CQAA 3PZTA 3AI0A 1U83A 1DEDA 4AZCB 5C9ZA 2MNRA 2P10A 7ENLA 1GKQA 1NQKA 4ZMGA 4Y6GA 3QH2A 3LB0A 4LC8A 1QU4A 4O1BA 1LT7A 4H6EA 1DJHA 1S39A 1M65A 3R12A 1MO0A 2Z0IA 1KCZA 3NQDA 4L65A 2CYGA 2E25A 1G4TA 1YNQA 1REQB 2X1IA 4M6VA 3AXMA 1A4MA 4GUIA 1EZWA 3TA9A 4MSSA 3VUPA 1R0MA 3NM3A 4TU1A 1XLIA 3W0KA 3M07A 4DZAA 1IXPA 3EOLA 2GJLA 1BSIA 3W76A 4W8BA 4J2MA 3CO4A 1GT8A 2P0IA 4B5UA 2F6UA 1RD5A 2IKGA 2GJNA 4GH1A 1ITCA 3KE0A 4PRRA 1V3IA 5HA7A 3E5PA 3QV6A 2X1TA 3UWVA 1YRRA 4B5NA 3HMCA 4MB1A 4GA8A 3TYDA 3WJXA 3VNJA 1L6YA 3WD2A 5AHFA 4AG0A 3S2NA 1ZCOA 5BOOA 1JR1A 1TKKA 1TPDA 2GVLA 3WH8A 3LX9A 2Z25A 1ZQ5A 2R24A 3BARA 3N14A 1RV8A 2G4FA 3K8KA 1FDZA 3FHQA 1PL9A 2PAJA 3ZR5A 5CC3A 3UFYA 3TYCA 1G94A 3OHIA 1P0DA 3TJXA 1EHNA 1XLEA 4XTIA 5I3HA 3LZ5A 4C1NA 5BU9A 1SJDA 4JCMA 3W29A 2GGEA 3N6QA 2DUAA 2XVNA 1AMYA 3BAYA 3KRZA 3AIEA 1QW7A 2I17A 4G7FA 1V93A 4UIOA 5FOOA 2WC3A 2V67A 2Z6IA 3RCNA 4ACZB 4UR7A 4E4PA 2ZXAA 3PBWA 2DORA 2VQUA 4F0SA 5CC7A 5EMJA 3T6CA 2ZZ4A 1EWDA 3K30A 4FXJA 5MF5A 3FN9A 3CGTA 3L2LA 2J13A 2GQ3A 3V5FA 1R2SA 1TCDA 2J78A 3LCFA 1B4EA 2C7FA 3PNUA 3W22A 1KFBA 2PTWA 3G1RA 3EEZA 4EIVA 3LS9A 2OYKA 3OO2A 3TX9A 5C6MA 4IHCA 4GJJA 1FOBA 4S3JA 1XIBA 2ISDA 3FDGA 3T55A 2WMHA 3ES8A 2W27A 2NW0A 4CCZA 1UR8A 5K3VA 5G4HC 2DV0A 3WDQA 3N2OA 4K3ZA 1XRVA 2ZUVA 2J7HA 3IWPA 4RDWA 1CEOA 1Y0EA 5I78A 4RR4A 3JZUA 4M24A 1TPH1 2I9EA 4D8AA 1YNPA 4XAFA 1P48A 4O8AA 4ZB0A 1RAKA 2PRHA 4UNKA 1TELA 1SZFA 3V1HA 5CXPA 4P8XA 4LEQA 3R4IA 1U2YA 1Y7VA 2D24A 3AMDA 5U4NA 4POCA 3RN6A 3NSXA 1K8CA 5C5YA 2V2DA 3VI2A 2J24A 3W82A 4U3AA 3UP8A 1OGGA 5IHRA 3SUUA 4KEVA 2FVKA 3T44A 3DFOA 3H22A 3MUZ1 2DJLA 2HK1A 3WEZA 1OF8A 1NU5A 4NZ3A 3WQVA 1KNWA 3GVGA 3CQ0A 3S1GA 2ZQ0A 3PTQA 4XO6A 3AOFA 4O57A 5E0FA 4GUGA 2XPKA 4NG3A 5C70A 4QG9A 3H21A 3SCPA 4JEJA 3IVSA 1A3HA 1J4EA 2Z1BA 4HZ7A 4Q8VA 1YDNA 3AS1A 4O4VA 4HSHA 1IIHA 3EWXA 1PZ0A 2VYOA 3V0UA 3MV01 4L4MA 1KCKA 4O1FA 1CDGA 1GJUA 2A2IA 1UWSA 1BRLA 1U1UA 2P8CA 1LOLA 2CZDA 4XBSA 5I24A 1C8QA 5FF2A 3VTRA 3H8AA 4S3GA 3V3WA 3DUGA 4WIWA 2BXYA 4WSKA 3OA3A 3VMNA 4P8VA 1OIFA 3GNXA 4XVEA 3V1PA 1Q85A 2V5LA 1EP3A 3AJXA 1YW1A 5G5IA 1HUVA 1Q6GA 1CXKA 4C6NA 5EA9A 2Q3OA 3QY7A 3IS4A 4KERA 1BLIA 1J5TA 1PKLA 4P8UA 3THQA 1LF1A 2H3DA 3VIPA 3K1DA 3BG5A 4JYEA 5HMSA 3MV11 3UW6A 2AQVA 3RNDA 3L0KA 2YW3A 2X1SA 4UQAA 3AC0A 3CT2A 3KOWA 4R88A 2W0UA 1GPFA 2J27A 2HK0A 3W7LA 1EBHA 4QCEA 1GYMA 1XP3A 3GDKA 4PBGA 1JD7A 1PCWA 1Q5MA 3FA4A 3TAOA 3FYOA 3TN4A 1I1WA 3AZTA 3SO7A 3IK2A 4EOUA 2OU4A 3M0XA 3WFZA 5DRIA 4PCPA 3W2MA 3VDBA 1FH9A 4LQ1A 3W84A 1DWAM 1QI2A 1PX4A 3W1AA 2GSHA 4L6HA 3EX2A 3FV9A 4YTUA 4UTIA 3BXWA 2B0MA 1XUZA 1HKIA 5LGZA 3GXTA 1DP0A 1GNXA 2CU0A 1FWDC 4S2BA 1IWBA 3LBCA 4NU7A 1H60A 2Z1XA 3H2AA 3L7RA 5HJXA 3BZJA 3GAYA 1XL9A 1MW3A 4WSHA 3VYLA 1QNOA 3TIMA 3IGSA 2WVVB 3OB8A 8RUCA 3M6YA 4QFUA 3DG3A 4HU8A 2Y7GA 3RR4A 1J0JA 1L2UA 3EGJA 3NG3A 3SFWA 2FGZA 3O16A 2P53A 4U31A 4AH7A 3AMCA 3AO0A 3U9IA 1VENA 3RO6A 3ARZA 1I2PA 2WWCA 3NVDA 2XIBA 1CX9A 3MMTA 1ME9A 2RDXA 2OODA 4H8UA 1AZ1A 2VCBA 1PVNA 4JPGA 3VILA 3P80A 1BGAA 3HPSA 1P0NA 4GH3A 5D33A 1YIXA 4IPJA 1UD2A 1K4HA 4H1ZA 1HVQA 3IAQA 4HCDA 2OWXA 1JDEA 1WKFA 4LB4A 1NDVA 3LI1A 4XD5A 1TMLA 2ZKMX 4XD3A 4US6A 4MG4A 5FJRA 1MW1A 1NTHA 2H8ZA 1XYCA 4IUGA 2O7SA 3E96A 1K6WA 4PRWA 3ME3A 3CPGA 1KV8A 3L9CA 3SI9A 2TYSA 4WSJA 1RVGA 2V2CA 4MUZA 2DZVA 4EXBA 3MKVA 2OSWA 1VCVA 3IJLA 4JIQA 1S1RA 2V30A 2G41A 4BFAA 3C2RA 1FWFC 1GORA 4ZR8A 4LY4A 1RQHA 2FQIA 1JCLA 3PF3A 3KUMA 4DAFA 1W32A 1H50A 5FKYA 4CD6A 2ISFA 4QEHA 4YHEA 2NZLA 2PDGA 3EA3A 4AHQA 3DC0A 2QS8A 4JDYA 4A3UA 1E43A 2QGHA 4QE4A 1XYFA 1TPB1 5BZAA 2QJMA 5DMMA 1RPXA 2D23A 3I6EA 3TN3A 4E8DA 4IF2A 4L5ZA 6XIMA 3AHYA 3RDKA 4PBEA 3ZM8A 1FWTA 2V6AA 3NA8A 1E0WA 4FP1A 2X2YA 2BLEA 4O1CA 1PTAA 4HNUA 3B0XA 4PB4A 3VIGA 3GH4A 3GTIA 1QOXA 3E02A 1KBLA 1LL4A 1XRTA 5AFDA 5C2GA 1O5KA 3DENA 2Q01A 3BLEA 1BHGA 2BNJA 1ADDA 3LPOA 2OJPA 3N2XA 1WZLA 3RYSA 3CJPA 1HL9A 3S1WA 1THFD 1Y8BA 3NO1A 3QPZA 4JTEA 2ZUNA 5CBIA 3IVTA 4FR6A 4E3TA 4GCAA 1UG6A 4JNYA 4HB7A 4PUJA 1DJNA 4UWMA 3GR4A 1KXQA 2XSXA 4EE9A 3QVQA 5EB8A 5HNNA 3ZT5A 2PRMA 1ZPTA 1XGDA 3MBFA 1BWVA 4JFSA 4TMBA 1I2OA 3H24A 3G0UA 4HHPA 1E9ZB 1OCBA 1HTIA 1Z7AA 3UJEA 4DX3A 3QHMA 1T0OA 3WL1A 1F6PA 1N8FA 3H23A 2C15A 5C8BB 1PB0A 4AZ7A 4MZ1A 1Q65A 2Q8XA 4KIEA 5C2XA 3PULA 2X40A 5IBXA 2JEQA 3CZLA 3RM9A 2E40A 4Y9OA 1FWJC 1TO3A 3WQEA 1I4NA 2BG5A 3WDPP 3I3BA 2X8RA 5EKYA 3IGUA 3TSBA 4TXEA 4M7SA 1XWYA 4UQBA 3HG3A 4I7WA 4DHGA 3LGDA 4TUFA 1WZMA 2Y0FA 3BAKA 2WMGA 3LLXA 3V0SA 1AW1A 3PWGA 3WBXA 3GO2A 3BGGA 3V16A 2DT1A 2YCLA 2PRLA 3CZJA 5LYRA 4W93A 3GG8A 5BU6A 3MDWA 4J3UA 2G3FA 1XLHA 2ESCA 4GIEA 2Y88A 4XIMA 1IZKA 3REQA 3QHOA 3QGAC 1RHCA 4L61A 3ENLA 4Y90A 1EUAA 2WC7A 1MYRA 2D2GA 4UFLA 4I7UA 4L1GA 3F4VA 4AD0A 1JCNA 1V6TA 4MLJA 4A35A 4LALA 2NQ9A 2HWGA 3LEPA 4JDBA 2ZUTA 5C71A 3R11A 4AU0A 2XZ7A 4DO4A 3SFKA 2Z28A 3V36A 4B5XA 1LL7A 2WMIA 1Q13A 3BOXA 1C93A 3LBOA 4HYWA 1TWWA 4DZHA 4K37A 1KXHA 2WM0A 3KL0A 2WZMA 3E0WA 2X41A 3P14A 1BXBA 4J3VA 2J6VA 1RUSA 3W24A 5BMWA 2F38A 1GW9A 4A2RA 4LUTB 4H6QA 4ACYA 3OW1A 4Q6XA 1H5VA 5DT5A 1QTWA 4UR9A 2VI0A 1R5YA 2VFFA 4KWOA 1F61A 3NQ2A 1A5UA 1M7PA 4PGLA 4GNJA 2OEKA 3GS6A 5MKGA 5AC8A 4C6DA 3H54A 2GSJA 4FLSA 3KOZA 1US3A 3D6NA 4DWSC 1ZLPA 1YBQB 1XGEA 2BY0A 4DWSB 3V35A 4A8IA 4ERIA 1JPIA 4LS0A 3WBAA 4L7ZA 3SJ3A 1JNDA 4GI6A 3W7EA 3TDFA 5AZ1A 3TSDA 3BLOA 2A6NA 1UD8A 1UC5A 4WUIA 5TAOA 3DHDA 5F4XA 1SO5A 5T9CE 1F76A 3WLLA 3FS2A 3P61A 3RGTA 4H19A 5CAHA 3DHFA 3LM7A 3MJYA 1KKRA 3I6RA 3B0VC 1BAGA 1PX8A 1ONRA 1XSKA 1XI3A 3WQ5A 3P6LA 2QLYA 5U7SA 4LU0A 3UJSA 1R9YA 2GPTA 1RBLA 3GKFA 3VIHA 1PBGA 5F7UA 1WZKA 3A47A 3RMEA 1FHUA 3G0SA 2WVUA 4E2BA 1E71M 3EXRA 1AA1B 2XGBA 3N17A 4DF1A 4LUTA 3TN5A 5I6SA 1Z9AA 3HJZA 4N9DA 1ENUA 2OYLA 4J4KA 1UH2A 2ZUWA 4FSAA 3I7QA 1BQGA 1JPHA 3DFSA 3PAOA 1BQCA 1OT2A 1O5RA 4RE3A 1XLGA 4GIYA 1SW3A 2QDEA 3MS8A 2ODOA 1FWBC 2Y6ZA 2NX9A 4W86A 3C6CA 1UPMB 1IIGA 3WLIA 1XINA 3F4DA 1UKTA 3W7HA 1IE7C 1VFMA 2ZYFA 5EMKA 2HE8A 1ZBCA 3WDJA 4D6IA 4GUFA 4JIRA 5AVHA 1OK4A 1C8VA 1UWQA 4KWVA 4CVUA 1ITUA 1A0DA 3T1GA 1IT0A 2D69A 2RJHA 2I56A 4AF0A 2PF8A 4HBKA 3ATYA 4ZA0A 1TWDA 2GUUA 3N2BA 4JIHA 4CEXC 1FWAC 4KWUA 4ZQNA 1HQTA 2AQWA 1ZJAA 3CL7A 3PP7A 4M51A 3PTDA 2QAFA 1NWRA 3GHTA 1MUCA 3WNKA 4OUEA 1PKNA 4QLLA 1VEPA 2PA6A 4J5NA 3GC5A 2VC7A 4LSBA 5DT7A 1E0XA 3B04A 2FKPA 1VFSA 3USBA 4BEUA 1JUEA 4B2DA 3EOSA 3JZEA 1JUBA 1TRIA 4PB5A 5DN1A 3TKFA 4I5RA 3UXIA 4QE5A 4FXFA 4W89A 1NWSA 1C90A 1NDZA 2UY5A 4A3RA 4C6EA 4BF9A 3C0JA 1G4SA 4RZ4A 2VHLA 2EHHA 3KBSA 3W28A 4RXFA 2FFIA 3P74A 2XFWA 5AHIA 3T4CA 1QOQA 3DU0A 1FWHC 1GK8A 3SRHA 1DL3A 4H9MA 2C6QA 3SUWA 2DIJA 3B8TA 3UVAA 5F2MA 1K9TA 2AMGA 3ARRA 1QW8A 3PK7A 3R8GA 3WH7A 4YPJA 2Z1KA 3BG9A 3G1FA 3ZVIA 5LHFA 3V4BA 4DEFA 2AL2B 1H09A 3DKJA 1XLLA 3EA2A 3VKCA 1F7BA 2VGBA 1QDSA 2XVLA 1A47A 5A6BD 3MY9A 2J8GA 2OZ3A 5H1WA 1Q7ZA 4O53A 1OX4A 4HJWA 5EYWA 3S1XA 4J3ZA 4Z42C 3W9ZA 1ZY9A 3HPAA 3A4AA 3NZGA 5JIWA 1OY0A 1KFJA 1E5NA 3GR7A 1Q6LA 1TJ0A 1B90A 4HNNA 1XIIA 3H55A 3THAA 4Y9MA 4UTUA 2A3HA 2BFGA 4IGSA 1K8ZA 5EGRA 3T2QA 1J0ZA 2ZX7A 5FF7A 4QQUA 4Q8TA 1OHLA 4DUXA 3D0CA 4Z1BA 2NVAA 4DZIA 1AVAA 2PDPA 4MADA 3T78A 4RPQA 4REQB 3FIGA 3O8AA 3R8HA 1PHWA 1Q8JA 3VNKA 1E73M 4Q7BA 1R3YA 1H7OA 3VZXA 2W92A 5CSRA 1EH9A 2OEMA 3N18A 3NL3A 1WBHA 5FJOA 3C2YA 3WENA 2J7BA 4FXSA 4C5ZA 2WJEA 1AFSA 2PTXA 3GXIA 4QS6A 1ADSA 2V9DA 4ZOCA 3KP0A 2VC6A 3CBWA 3O6AA 4J3SA 2Z2AA 4Q4SA 3GRIA 2QIIA 3T05A 5HR6A 1XYAA 4DM2A 5CZSA 5I2UA 2H3BA 1Y65A 4GQRA 2ISWA 2PWUA 3F7JA 1ELSA 1FWIC 3W85A 4RNJA 4EPDC 3CAKA 2ALDA 1JZ6A 2PDNA 1ME8A 2QIWA 3DFTA 2UZ9A 2X42A 2D3LA 2E6DA 2W66A 4QG8A 2XN2A 4M19A 3HM7A 3CH0A 4WOZA 3HG4A 2PZNA 3M0YA 4ASTA 4IFRA 1EL3A 4HKPA 4AX6A 3NZPA 3UWEA 4IP5A 1SSDA 4ZE5A 4JHMA 3Q37A 3UA3A 1S1PA 1EIBA 1MXDA 1W2PA 2HDJA 3A9BA 3GU2A 1JPKA 1RY8A 2I1OA 2E8YA 4GY0A 1XUUA 3MMUA 3H4XA 4KFNA 1GVOA 1JAKA 3NO3A 3BURA 3NZRA 1H7WA 1AW5A 2NVDA 5C2CA 5CC6A 4G7EB 4GI8A 3DBNA 4ZB5A 2IUZA 3AWOA 2VWTA 1Z42A 3WNOA 4IH3A 1MFUA 4K38A 1ECQA 3L4WA 2QMJA 1ZSXA 2PDHA 1XQKA 2WLZA 4HTYA 4IXXA 1VIWA 1MSSA 5G2HA 4FOJA 4P7NA 2NQLA 1FCQA 1P6WA 2V3GA 1E0UA 2E8ZA 2O9RA 3VD4A 4N6FA 3F4CA 3E6EA 4M7TA 2ZTKA 1R6WA 3KWSA 1WXZA 2XDFA 1PWLA 3GNRA 3IACA 4RV3A 4W87A 4X3ZA 2DY3A 2DEPA 3M0ZA 1E15A 5LXXA 3EWZA 2DQXA 2YZ5A 2FPTA 3CMFA 5FJIA 2FH8A 4IISA 4LRTA 1R2TA 1HT6A 5FJPA 3MZNA 4TR9A 3E2SA 3FSTA 3UD6A 3EOOA 4J40A 3DI1A 1P0BA 1TVNA 3RK8A 4FB7A 2AKMA 3CM4A 1VFUA 4I9JA 2FZBA 1KRAC 1PEZA 3BO9A 3W7DA 4Z1YA 3U5YA 1L6SA 4FLOA 3CHCA 4D6JA 3LI0A 3F4NA 2QW5A 1B0IA 5AC4A 3SRKA 3W2UA 1BYAA 3OLDA 1ICPA 3LK6A 3S83A 4A8LA 1E0TA 3R13A 3PJWA 3WDHA 3GFZA 3FVDA 2WK2A 1OZQA 4A8NA 4R85A 1EWEA 1ONWA 5J04A 3CEPA 3WCZA 3SRFA 3S9ZA 2A7PA 4K39A 1CXIA 1Q6FA 3C3NA 2JEPA 1ODZA 4AVNA 3U7BA 1WNOA 1WB0A 1GVEA 3W2NA 3GX9A 4HIBA 1QK2A 1XF0A 3O1NA 3NAVA 3JVAA 3C0SA 4F2UA 2PTYA 5DY2A 1WUEA 2GGHA 4DN1A 3P82A 4RJEA 4UTWC 4KRTA 3VC5A 1XQLA 4AVOA 1TMQA 5AZ0A 4JTGA 4UTTC 1MXGA 5A6AA 4F0RA 2LLEA 3RG6A 4HZ8A 4NQ1A 2HV5A 1VPXA 2BOEX 1JGIA 3ARYA 4IQJA 3MZ2A 3LHVA 1DWIM 3Q65A 3TCEA 3LV6A 2FZNA 2BY2A 5AOUA 1OC5A 4PUDA 1T8XA 3G5EA 3FVMA 3AYTA 1P1XA 2E9LA 3BLPX 2WZTA 1KB3A 1TG7A 1WKEA 3NUKA 1X7IA 2B7QA 3MHFA 3IV8A 4MLRA 4RZBA 1S2WA 5A6JA 2RGMA 2YB1A 3TC6A 4MTVA 2FGBA 4WGHA 1XBYA 3AQUA 3E2VA 1JAEA 4GX8A 4WRHA 2ZVRA 1KTCA 2PS2A 2UY3A 2E5BA 2J9XA 1WBJA 4JFUA 4CNTA 1EYWA 3GXMA 3L5AA 2Z4GA 3UT0A 1E4LA 3PZUA 3WX7A 5D04C 3WUFA 3HGSA 2XJ7A 1H7RA 4L64A 1EJRC 1ZJHA 2PDFA 3L2IA 4JD4A 1JCTA 3GXNA 4DJDC 1ADOA 3APGA 3VOIA 1RBAA 2ACQA 1TV5A 1HXJA 4ADUA 1XYZA 3A4XA 2CZFA 1MDLA 2DVTA 1PIFA 2VGIA 2YCEA 3QF0A 4Q8OA 1E72M 3MP4A 3PZNA 2GWNA 1FRBA 4XAYA 1YYAA 1OFBA 2CZEA 3RO8A 1ISXA 1HJSA 2DP3A 1JVNA 1XJBA 4FIQA 3WK1A 4S3DA 5E6YA 3AXIA 3E2RA 4A29A 1E6PA 1KM2A 1R30A 2XH4A 3UCCA 4IMGA 1ICQA 1MNSA 3M5VA 4C6FA 3SCVA 4O54A 4ALDA 2ABBA 2ZRZA 3PBGA 3BOLA 1DBTA 1XH0A 1ONEA 3KAOA 5CLWA 1QI0A 2ZADA 4DO6A 3TEVA 1VEMA 1CB2A 4LOCA 3W7CA 3T81A 3UWYA 5HATA 5LIWX 4DI8A 3EBVA 1HIZA 3UZJA 1LG1A 2PI6A 3AIWA 5CCZA 4DF2A 4D8LA 4KBXA 2VUYA 4AWSA 4H04A 5E70A 3ARSA 1K7FA 1UD4A 3WY1A 5DELA 1DOSA 5A6TC 3ZWTA 3WQGA 3R8RA 1H62A 3M0MA 5F4WA 4AFYA 4X9SA 1CXFA 5C9XA 4NILA 5AHLA 3MVTA 1TJ1A 4F4RA 5FSEC 4JTKA 3TXZA 1N8IA 5PTDA 1FH8A 1OBAA 2FYMA 4JTIA 4UMCA 3EX1A 3A23A 3NGFA 4UQDA 1KGUA 4HMNA 3EDJA 4DELA 1VFHA 1XC4A 1SZGA 3ABSA 4XWUA 3BAXA 4S39A 5AVNA 1S5WA 2VC5A 2W62A 1W5MA 3DYOA 3RIKA 3EKLA 3GXFA 4AY8A 3URQA 4HA3A 2FMNA 2CLLA 3SJNA 2QUNA 4RW5A 2PEVA 3S5ZA 3SEPA 1O4UA 5BRBA 3UXKA 2WZIA 5FAGA 4JX5A 4PTWA 1ZU8A 3I68A 4BF7A 3B8SA 5FJTA 4PSRA 1PIGA 2IXVA 1JJKA 4ATDA 3PZ9A 2OKOA 3UERA 2E6AA 1MRAA 4I5UA 3JR2A 4MWAD 3TE9A 3TOPA 1OFOA 1LRNA 3CV1A 2HBVA 3OPSA 3H4WA 2PD5A 3WQ4A 1S2CA 1GG1A 2NQHA 1EX5A 3QZEA 3S6OA 3VNIA 3GB6A 1JZ7A 2X2GA 4PFHA 2OOGA 2RAGA 2JKEA 2FZ8A 4Y2WA 4B9ZA 3N9SA 5IXEA 3ELFA 1ZL1A 4I8YA 5GQBA 1PHQA 4JYDA 3A3WA 4L1WA 1T99A </