4JTKA

Crystal structure of r117q mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
277
structure length
252
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLAQQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQTRGRRAQALDLALAGMATRLAGLFLELHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Examining the Role of Intersubunit Contacts in Catalysis by 3-Deoxy-d-manno-octulosonate 8-Phosphate Synthase.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
total genus 87
structure length 252
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtkA00
4FHAA 5EA9A 1KBJA 4Y8FA 3HOJA 3MUXA 4A3UA 2QCLA 2Q8LA 5LNWA 3ABQA 1G7UA 1Z41A 5CKSA 3GKFA 1EB3A 3NPWA 5G2WA 5FEWA 2FPYA 3R2GA 4A2SA 1FWTA 4AF0A 3LRKA 1JCLA 4JYFA 3GYEA 1VRDA 1OHLA 5D03A 1EPXA 3GDRA 1J5TA 5AHMA 1A53A 2J9YA 5A5WA 1W37A 4I7UA 4JS3A 3O06A 3ABOA 2V9DA 3GZ3A 4GUGA 3ZR4A 4O8RA 4HN4A 3BW3A 4RZ4A 1YDVA 3AJXA 2ISVA 1DQXA 4DELA 4NT0A 1LCOA 3F1QA 2J6XA 4QSHA 3STEA 3GB6A 3I65A 3DGRA 4WOQA 4FNPA 2CLKA 1OK4A 3AO0A 4O1CA 5DELA 5K9DA 3G1HA 4AAJA 2TRSA 1TTQA 5C55A 5E0KA 2ABBA 3HO8A 2YSWA 2YW4A 3M1ZA 4ADUA 3LXBA 3NM3A 4UFIA 1I2PA 1JJKA 2H8XA 4UTMA 3S9YA 1R47A 2OMAA 3S5OA 3G0XA 1O5KA 1XKYA 2YYUA 3I68A 1TPUA 3GXPA 2QCGA 5CSRA 3USBA 1W5NA 2R91A 4YL2A 4ML9A 4XTDA 1RR2A 2CLHA 4GFSA 1HFBA 2A0NA 3MYPA 2GQ8A 5F2IA 2X16A 3QMSA 5EL1A 1GVRA 2RHGA 2H3DA 4LC8A 1BWKA 3G1FA 2X1TA 2CU0A 2WJZA 3KFTA 1IIHA 3P5YA 3TIMA 1G4EA 3VE9A 3KRUA 3NXFA 3QFEA 1LORA 5CPNA 4DPPA 1AW2A 3OVRA 4LS2A 5AHLA 2IQTA 2J24A 4PH6A 3YPIA 4AEOA 4IOTA 2VXNA 1G6CA 1H1ZA 3LDVA 3BGGA 1UUOA 2I9EA 3LI1A 4LUIA 3QF0A 1K3UA 4FF7A 2GVJA 5BMXA 1C29A 2QCDA 5LNVA 1G69A 3UZJA 3SJ3A 1PCKA 3LHYA 4PCFA 3W2KA 3G0SA 3DKJA 3MYOA 3W1RA 5FF7A 3W84A 5D09A 1QPRA 3FYPA 3NG3A 2ZRWA 1G4TA 3O16A 4Z0JA 2DJXA 2V82A 3WJSA 4PL1A 2RFGA 3BG9A 5DBTA 3W1MA 3O6DA 5DCEA 3JR2A 1AW5A 1F6PA 3H54A 2FJKA 3HJZA 4K8EA 3IIPA 1KFJA 4PODA 1W5OA 3W7KA 4K36A 3G1XA 5LSMA 4KFOA 4O54A 3RLUA 1SSGA 4JTGA 2ZRXA 4ICNA 2ZTKA 1HO1A 3PVFA 3NO5A 4UFKA 3W7JA 3ZFHA 2Y89A 2CLLA 2DZSA 2QF7A 5L6UA 2QCDB 5IBXA 3TXVA 5CZSA 1EP3A 3TW7A 5D02A 1A5AA 2PRHA 1GVOA 3CM4A 3EWWA 3P81A 3HGOA 5AYZA 3TV8A 3C2RA 2Y7GA 2ZRUA 1I4NA 3OG3A 4X9SA 4E0CA 2W6RA 3W86A 4KFPA 1KBIA 5CSSA 4N6FA 1VCVA 5HUOA 4TIMA 3NQEA 4UR8A 3W1AA 3O63A 1H61A 5LZLA 4LS0A 4XUGA 2J9ZA 3TNOA 5ABTA 4N9BA 1Q6OA 1QO5A 3CC1A 5DCDA 3W7GA 5AC8A 3QSTA 3W71A 3EX1A 1NF0A 1TSIA 1I2RA 4IMFA 1OYBA 3UWUA 2J27A 3STFA 4S1FA 5F2LA 2Q3RA 4MFDA 4OV9A 4CQAA 1K8ZA 5F4XA 1FY6A 3FIGA 3L65A 5K3VA 1O94A 1HUVA 1PHWA 2NXGA 3LHWA 4HPJA 4UXDA 1PL9A 3O6YX 1SW0A 3B03A 4BI6A 5AC7A 3W7IA 2GQ9A 3I7SA 3TFXA 3N19B 1EWEA 3SY5A 3CHVA 1SO3A 5EPDA 2F7FA 3GKAA 3C8FA 1VHCA 1WXJA 3HQ1A 2PRMA 2EPHA 4XKYA 3L0NA 3TKFA 3NQ6A 6ALDA 5LKYA 2ZA2A 2AGKA 2VC6A 3KRSA 4DF0A 3EX6A 1X1ZA 3D0CA 3W7OA 3TQKA 3QZEA 3EWXA 1S3HA 2P0OA 1SZEA 3HGSA 1H50A 2HS8A 4JYDA 1GTEA 4ALDA 1WV2A 3G1YA 3PC0A 1R46A 2FB3A 3W7DA 3OEXA 1MSSA 4JD4A 1H62A 5DXYA 3TDFA 1Y0EA 3C52A 1LOLA 3DBPA 2ATSA 5CPOA 3GVGA 3PG9A 4H4IA 3LTSA 2VFEA 5EMUA 3PBUA 3NQ8A 1TV7A 2C1HA 3WJXA 2Y70A 3MHFA 1KA9F 4FX7A 2OCZA 4GUFA 3HG3A 3HGJA 3PWAA 2NWSA 4LT9A 1LRTA 4IMDA 4ADSA 3G1DA 3TA6A 2Z1BA 3NEVA 2QDHA 2KZHA 1V5XA 4GJ1A 3PAJA 3Q94A 3LBMA 3W85A 3SECA 4Q33A 2VELA 3UXAA 3E9AA 1T8XA 2QAFA 2H6RA 3TU9A 1SO5A 1SU5A 3TH6A 1LLZA 2WKJA 5I3IA 5KZMA 4UTUA 3HB9A 2JKPA 4PA8A 4DQWA 4PEKA 2E6YA 2WNZA 4TMBA 2G96A 4NU7A 2ZZ5A 1WQ5A 3P82A 2X1UA 5HULA 3NL3A 2B4GA 3U2OA 1F7BA 1XUUA 5BMWA 1CI1A 1HL2A 3W1XA 5HJLA 4BWLA 2VEIA 3JS3A 3O6CA 3KX6A 1DBTA 1F74A 2BSLA 3GAYA 5U4NA 3LXAA 2V2DA 4JGDA 4AVFA 1WDWA 2H8ZA 5D2YA 3RF9A 1BWLA 3P80A 4NNAA 4WOZA 1XDMA 1K8YA 4J9JA 4R7JA 3W72A 1DV7A 2A21A 3W6YA 3TFCA 5K4ZA 4EOUA 2NUXA 1FDYA 1A5CA 5T26A 2YCEA 1N7KA 1LZOA 3LOTA 3NL5A 4UTHA 4GNJA 1VC4A 1QR7A 3N3MA 1F05A 1XM3A 5J5RA 3DU0A 2E09A 4FX6M 4E2BA 5LGZA 3P8IA 3BLEA 2ISWA 4ZL1A 4FNUA 4BI5A 3THAA 3EXTA 4BWLC 3TK7A 2ZCGA 3LCGA 1TCDA 4K7VA 3P74A 2CLEA 1TJPA 3LCFA 4POCA 1UCWA 1XL9A 1ZY9A 4RZ6A 4GXMA 2Y6ZA 3OIXA 3RU6A 3W88A 1H60A 1RD5A 2QCHA 4FXSA 4O12A 1NAL1 3BK0A 2ZZ1A 4XKYB 1QWGA 3CU2A 1EUNA 4CNNA 4JY8A 1LOSA 2DZTA 3B0VC 4PTNA 2CZDA 2P1FA 3R8RA 3UWWA 3M43A 3LGEA 4LV4A 1S5TA 1LDCA 3GNNA 2ZFAA 1W8SA 3DFPA 4OE7A 4Z0SA 5HWMA 2PC4A 1PE1A 4WQ6A 3G24A 4LS1A 3T7VA 3BV4A 3DFSA 4OQVA 4N6EA 4NNCA 5CGQA 3W7QA 3STGA 5G5IA 2VENA 4Q4KA 2E5DA 3P84A 4CLMA 4O18A 3UPBA 2DZWA 3NQDA 4MVAA 4JX6A 1L6SA 1CW2A 3FS2A 1F76A 2WSYA 4TO8A 4ZMGA 8TIMA 3L0KA 4HNVA 3LB0A 2Z0IA 1YXYA 3LCLA 3W2JA 2J88A 2OZ0A 3S5ZA 3A5VA 2A2IA 1YLVA 4HIBA 1O5XA 3G1VA 1GYLA 3BG3A 3MP5A 2ZYFA 3N14A 3QH2A 1RQBA 1R2RA 1N55A 3LV6A 1OFOA 1KV5A 5FF4A 1HG3A 1X6UA 3CIXA 1R2SA 3SIZA 3C2EA 3EX2A 3G18A 1VPXA 3UY7A 3MP3A 1TPH1 2ZRVA 3NQMA 4O0KA 2VEKA 4TX9A 3UD6A 2OT0A 3LERA 4IXXA 3FKKA 4A22A 4MPQA 3O05A 3OBKA 4GUIA 3QQ0A 4JTSA 4RK8A 2XFWA 4JTLA 2V2CA 3QSRA 3T4CA 1FBAA 2QR6A 3EKZA 4ONVA 1KTCA 4JX5A 4Z1DA 1YDOA 5HQEA 4HSNA 4ZVJA 4O4VA 1VLIA 5I3KA 5AHFA 4NXKA 5HWJA 1LM1A 4RV8A 1EEPA 3A9IA 3M5VA 1FWRA 1VCGA 3LTPA 1AW1A 1RZMA 1KFBA 5FEZA 1JUEA 2FB2A 3C61A 2Z6JA 3PSWA 5G1YA 4UCGA 4ZQOA 3TJLA 2VFDA 3L67A 1RQEA 3NQ7A 3M44A 1X7FA 1H7NA 4UNKA 5D04C 1JCMP 2FPVA 2CFFA 3HBLA 2ALDA 3HF3A 5DY3A 1ZENA 4OBTA 3W7EA 4UTTA 1EUAA 4I7VA 4LVAA 3LM7A 4R53A 4NVTA 3E0IA 2C13A 4OT7A 3MP4A 2VFGA 4O52A 2Y7FA 3QW3A 2X30A 2DU2A 2RKXA 1YDNA 3T44A 4O1DA 3SW6A 4TU1A 3CT7A 3HGRA 1LBFA 3UWYA 4LU0A 1F6KA 3IGUA 3B8DA 1ICSA 3H53A 3IIVA 5C54A 4O10A 1V7YA 1S5VA 5KINA 3C2FA 3C3NA 1NFBA 2Y62A 4AH7A 1IF2A 2GOUA 3SR7A 3MHUA 1DJQA 3TJXA 1JRCA 1TPVA 4EVZA 1JCYA 1LBMA 3KVKA 1CX9A 2AQWA 3LCIA 1ICQA 4DO4A 2WO5A 1AG1O 2C16A 2CZEA 3THQA 2BWGA 4R33A 3R5EA 5D33A 1JCNA 3INPA 3I7RA 4O19A 3UWZA 2WV8A 3ATYA 3IIXA 3W1TA 3RFAA 3SFKA 5KTLA 3KOFA 3LHUA 3DXIA 4NQ1A 2QUTA 2ZZ4A 4JTFA 3Q37A 1KM1A 1GZGA 3M41A 1FCUA 1TTJA 5G4EA 3C2VA 3M6YA 1OX4B 3NZ1A 4FIRA 3A21A 1L9WA 4CQ9A 2V0TA 3DHFA 3LI0A 1JQXA 3TUUA 1DOSA 3W2UA 3G1AA 3I7QA 3CEUA 4HHPA 1JUBA 4Z08A 5EY5A 1W5QA 2C18A 3T40A 3IVTA 4WUIA 3P7YA 2QCEA 3HPZA 4EIVA 1QDSA 1TTIA 1LOQA 5LNSA 2FPTA 4DO5A 4NXSA 1B9BA 4MZ8A 4HNNA 1GWJA 3UPWA 4AHPA 4AF0B 5AHIA 1D3GA 1VR6A 1PVNA 4NJGA 3TE9A 3NL6A 4M5PA 1A50A 3NQVA 3S1VA 4UUIA 1ME7A 3TXZA 1Z42A 3KVLA 5F2MA 1XI3A 1WAUA 4H3DA 4BFAA 4ZZ9A 4FEZA 4YXGA 1OABA 3TR2A 5DN1A 5K2ZA 1KFLA 5DLCA 1YYAA 3BVJA 3UZ5A 3NA8A 3LCWA 5IBXC 3W7PA 3WK3A 3M7WA 3QPZA 2R8WA 3P8JA 1PHQA 3UQNA 5AN7A 1VS1A 4S2CA 3W7CA 1OK6A 5I3GA 2ZZ6A 3QEZA 3V75A 3EX3A 4JY9A 2CLMA 3W1NA 1QAPA 2A7PA 1OFRA 3DHDA 4IUOA 3EEGA 4G1KA 3O1NA 3LXCA 3EXRA 5D38A 4JTJA 2NLIA 3E12A 3IV3A 3N2XA 2DJLA 4MZ1A 2YFNA 4O28A 3W2MA 3PY2A 1TREA 1W54A 3NPXA 3T55A 1VQTA 3H55A 4AWUA 4HNUA 2FFCA 4X22A 3UXDA 4IXHA 4X2RA 2PE4A 1FX6A 1THFD 3GNDA 4LC6A 3G1SA 4XBKA 2JGYA 4XZ9A 2E6FA 3B06A 4FX8A 3LCHA 3GX9A 2G5WA 3C2OA 2NWRA 1TV8A 3UWVA 1GTHA 4MY8A 2DZVA 3IIZA 1MEIA 1VLWA 1Q6LA 4JN6A 4QIUA 4UFLA 4Z1BA 1RQHA 2V81A 3U8GA 5KSWA 1VYPX 1M7OA 4WD0A 2H90A 3O8AA 1KW1A 2YZRA 3P60A 5CPMA 5C5YA 1ALDA 3DI0A 1ZHAA 4JIQA 1YTDA 3FJ6A 5L9FA 3BARA 3G22A 5MHBA 4AXKA 1TO3A 3ATZA 5I3JA 4A29A 5HNRA 2BZNA 1GPWA 4RR4A 4LRSA 3TSBA 4ZQCA 4O16A 3SI9A 3C4UA 4UTLA 2JKEA 3L66A 4O14A 4BF9A 2B7PA 4HSOA 3LLDA 4ZQMA 2DZUA 1SZFA 2VFFA 4BR1A 1FXQA 3CIWA 3DFQA 2V2HA 4XTIA 4LOCA 1F73A 3WJYA 2X1RA 1K02A 3HG4A 3MW7A 1G4PA 4WZHA 3BLFA 1Q3NA 2E6AA 1TYGA 2TMDA 2QCNA 4NJKA 3TROA 3B0UX 4Z1CA 3ABRA 5KZDA 3B04A 2FTPA 1Z48A 4O53A 4B5NA 3BPWA 4RKAA 4NX5A 5H2ZA 3T78A 2QUUA 3NL2A 2I1OA 4MKNA 3PB0A 3KAOA 3OA3A 1WA3A 2B7OA 2WQPA 4RX0A 4MYXA 3W1QA 3LV5A 3LCXA 2NXHA 2GVLA 3PB2A 1VJIA 5FF3A 1OFAA 2WPBA 1TQXA 4PL2A 1XBVA 3EWBX 4MIMA 2H3BA 2QAPA 3CEPA 4EF9A 3C56A 3BW4A 4MOZA 4UC5A 3EX4A 1IXPA 3TQVA 2YYTA 3FLUA 2PCQA 1D9EA 2TSYA 1P0KA 3TC6A 4K39A 1SZNA 4CCCA 3N9SA 1JCJA 1H1YA 3N34A 3N73A 2YX0A 5HMSA 3WK0A 4LWWA 3EXSA 4UTTC 5G4WA 4FNTA 1ZAHA 1MEWA 4NJJA 5F1VA 1O4UA 5U7SA 2A5HA 3ZS4A 5HWNA 3BO9A 3NQGA 1M5WA 4MLJA 4AMAA 1XDLA 3E96A 1ZALA 3M5XA 3KRZA 1GG1A 1H7RA 1OYAA 2R94A 4UMCA 2JKAA 2BTMA 1OG0A 4MFEA 3OHIA 3S6DA 2O7SA 1W0MA 4QISA 4NUWA 5AFDA 4P61A 1OX6A 1PIIA 1YPIA 4QAIA 3VCRA 2OT1A 5DXXA 4JX4A 3ABSA 5J5DA 1H5YA 2J9XA 4O15A 1EA0A 3DZ1A 4HNTA 1KM0A 1ME9A 5F1UA 1KM3A 2QJIA 5LHEA 5EYWA 3IIOA 4LRTA 3I6RA 3W7NA 4DXVA 1TMHA 3N2MA 5HR7A 2A6LA 1OYCA 3RMJA 2B7NA 4N9EA 3W70A 2C14A 4PFMA 1IGSA 4E38A 5D05A 1F5ZA 1VGAA 2AAMA 3NZRA 1ZFJA 2CLIA 3IRDA 4BK9A 3NGJA 1JQVA 3GXNA 2CWNA 3CLMA 1TJRA 1OVDA 3LHTA 3W2LA 1EP2A 1XCFA 2RH9A 1OF6A 2ZBTA 2ZZ3A 3G0UA 3OVPA 4M6QA 3LX9A 1H7PA 2XN0A 2I14A 3NM1A 1OFBA 3FOKA 4EF8A 4K38A 2Y7DA 4RXFA 3NR0A 1I45A 1SSDA 3DFTA 5LHFA 2JK2A 4YCPA 1X1OA 1W5PA 4UR7A 4WY0A 3S5NA 3HG2A 3W22A 3PSVA 5BOOA 1VYRA 2NV1A 3F4NA 2FDSA 2A85A 3TW6A 4LVFA 4N9DA 4NNBA 4OV4A 5FEXA 1DJNA 3R13A 5KMYA 5F4SA 4N9CA 4K6AA 1GVFA 1YXDA 4UFJA 5FEPA 1KM5A 3G3DA 1QCWA 2GJLA 5CZJA 2VKZG 1S5WA 4JTKA 3MI6A 3EWYA 1GG0A 3TMQA 4M7SA 4RCXA 1W56A 4RJEA 3TCEA 4O0ZA 2FIQA 4LVDA 3SZ8A 2GQAA 1KM4A 3GR8A 3VKJA 2E5BA 1NSJA 4FO4A 2YPIA 3W7LA 3W9ZA 2W0UA 2XN2A 1SO4A 5DCBA 5FF0A 3S1UA 1FCQA 1ADOA 3HPSA 3WK1A 1RPXA 4UTIA 1WYIA 3R89A 1YPFA 3GDKA 3F03K 1DORA 3A23A 3GDMA 3PUEA 2D73A 5IM51 3TAKA 3P5ZA 1J4EA 1JR1A 1P4CA 3C6CA 2Y7EA 1JULA 3K30A 1QFEA 1FQ0A 3BG5A 3DFOA 1K7FA 1KLYA 1LBLA 1TPDA 1VYSX 4LUJA 4ZQPA 5TIMA 1OFEA 2EF9A 2E1DA 3L21A 2CW6A 2ZRZA 4UTWC 1U5JA 4I9AA 3NAVA 5D32A 1Q45A 1ML1A 4CNOA 1SUXA 2ZDRA 1QOQA 4IMGA 1JUKA 3L2IA 3MBDA 2E77A 4QJ1A 4UTKA 1PV8A 5CZTA 1AL8A 3TX9A 3O07A 1SO6A 1UASA 1W1ZA 1B3OA 3CPRA 3CWNA 1L6YA 1R2TA 5AHNA 3M5YA 1G7VA 5CPLA 5D30A 3EWZA 4NX0A 5BRBA 2NZLA 3LRLA 3DENA 1AL7A 3DKLA 5KZEA 1ONRA 2C19A 2QDGA 4UTJA 3KVMA 3VE7A 1GVQA 1QOPA 3G8RA 2UV8G 4DO6A 5KITA 3TSDA 4OGZA 3DH7A 3CWOX 2XN1A 1VCFA 1DKWA 1XFBA 2C6QA 2WOQA 4AHOA 1ZJIA 1MXSA 3QC3A 2WSRA 3S0CA 3W74A 4UIOA 3EB2A 3F4WA 1XC4A 3GDLA 4WX2A 4C1LA 1M6JA 1FCVA 3L5LA 2YXGA 4IX0A 3W73A 1BTMA 3FFSA 1TPFA 4JTTA 2A4AA 3FJLA 1H7WA 5AC6A 1TQJA 5AOUA 2WSQA 1B4EA 3L0GA 4WJEA 2V30A 3UY8A 1KFEA 1FXPA 4BI7A 3W7RA 1XBYA 4N02A 4FIQA 3BLIA 3IGXA 3C0JA 1NF7A 3BW2A 4O13A 4JIPA 3EWUA 4IGHA 4MZYA 3LRMA 5AYYA 4JTEA 3ZWSA 4K8HA 5D2XA 3QMRA 4GE8A 1I2OA 4Y9AA 1DVJA 1DQWA 3HMJG 4UMAA 1MEHA 4IWWA 4DF2A 1QNVA 1UBSA 1TPWA 4Y96A 2A6NA 1D3HA 3W1UA 4YCOA 2ISSA 2DZXA 3HPXA 3PS7A 2Q3OA 2X1SA 1ZAJA 5E93A 1OX4A 1K7XA 2ZTJA 1GQNA 4O50A 1FUYA 4A21A 3GDTA 4JNMA 4KWWA 1SFJA 3Q58A 4UNLA 5E1QA 2QJHA 1W31A 2QJGA 3UYCA 4WXYA 4CNPA 3VNDA 1OFDA 1MZHA 3SGUA 2C3ZA 1KM6A 1ME8A 2ZZ7A 2B0MA 4AHQA 2BLEA 1WBJA 3NOEA 1IIGA 1PS9A 2VFIA 1TV5A 4RLIA 5D2VA 1QPQA 5TBOA 3SGZA 3MWAA 5AHEA 3QMTA 3LHZA 4N4PA 3B0PA 3NVTA 5C6MA 3QPYA 1U83A 3DAQA 2ZA3A 1K7EA 7TIMA 3WJZA 3B05A 4NZJA 4YMZA 1H7XA 4DBEA 1T99A 5FF2A 4QITA 4JICA 4FXRA 1Q6QA 1TPEA 1FDZA 3E49A 4WXZA 4H6KA 1FWNA 3W83A 3PBYA 4LV9A 4JDYA 4EWND 1T0OA 4S2BA 4O17A 3NPVA 5F2GA 1NVMA 2VEPA 1W5MA 3HIJA 1O60A 3L5MA 4GC4A 1XXXA 4DEFA 4MUZA 1UJPA 3M0ZA 4U4MA 1E51A 4LNYA 2YW3A 3O15A 4M6VA 1YTEA 1I2NA 3QW4B 1B4KA 5A8GA 2V5LA 1C8VA 4O57A 5F4WA 3CQ0A 5K7JA 3GLCA 1R30A 4UTWA 3MJYA 1T96A 2ZZ2A 2NX3A 3V1PA 2WNQA 1FCBA 4KKXA 4M19A 5D37A 1FWWA 3M9YA 3E02A 3P61A 4WY0F 3WK2A 4MY9A 4LTSA 3NPUA 2HS6A 5CZ0A 1GT8A 2Y61A 1IXOA 1KLZA 1M7PA 3W87A 4IPIA 2QKFA 4LVGA 4HKPA 3PG8A 3ZWTA 5H91A 1H7OA 2P10A 1WX0A 1C9DA 1A5BA 2OJPA 1L6WA 1TPB1 1TTPA 5BNKA 4K7YA 3NQCA 3WJWA 4DPQA 5D2TA 2YDAA 4LW7A 4OU1A 2NUWA 1YADA 4HT3A 5EBUA 2A7NA 4MLRA 3S8HA 3TAOA 1EX5A 3NYZA 3G3MA 1GYNA 2W79A 4NJHA 3RK8A 4C1KA 3PM6A 4LY8A 3TSMA 4GBUA 1RV8A 3GK0A 2DORA 2OX1A 2QUVA 3M16A 2CZ5A 3W07A 1OF8A 1HO4A 3ELFA 3STCA 4TMCA 1LP6A 1QPOA 2V8ZA 1EP1A 3QM3A 1DHPA 4DF1A 2O7QA 6TIMA 4M6PA 3P67A 5G1TA 3MI3A 5CG7A 1QMLA 1XUZA 1ZCOA 1K03A 3W3OA 1ZNNA 1A5SA 3GAKA 2QCMA 2BXVA 4MJMA 4N4QA 3PBVA 1SW3A 1ZAIA 1OFPA 2EGZA 1LYXA 3CTLA 3MBFA 2Z6IA 2ABAA 2QCFA 2GJNA 4KWVA 5HR6A 1AMKA 2C15A 2QCCA 4P2VA 5SWUA 1PCWA 1VZWA 2EAWA 4MYAA 4JR5A 3JRKA 4L4LA 2CLFA 3QJAA 2FLIA 2NXIA 1GVSA 1LTDA 2EHHA 3IEBA 4GRSA 4ZQNA 1P5BA 4NJIA 1TRDA 5G2HA 1WBHA 2G95A 1FWSA 2ZA1A 4Y90A 2F84A 1UB3A 4DBDA 5HUPA 1DL3A 4CQ8A 5DBUA 4MY1A 3NQ2A 3N9RA 1EIXA 2PRLA 1QO2A 4W9TA 3W1LA 4ORIA 4PC8A 2NX1A 5LGXA 3QRHA 1JVNA 3W1PA 1I2QA 3ANYA 1WOAA 4JYEA 4KFNA 4I7WA 3S1XA 2RDTA 2NV2A 1KFKA 3S1WA 4JEQA 3P62A 1TRIA 2CZFA 4A2RA 1O95A 3VFLA 4L4MA 3FA5A 4QQ3A 3CB8A 1P0NA 1SW7A 3NNTA 4CCDA 1WOBA 1SFLA 2YGYA 1LLWA 2A1YA 4Y6GA 2WNNA 3MMTA 4O11A 2DP3A 3LBCA 2G97A 4HPXA 1JRBA 3RNDA 5I3FA 3NQFA 1K8XA 5C2XA 4GUJA 1H63A 4GUHA 2ZQ0A 2V5BA 4K37A 4IQLA 3PR2A 3TQ0A 1GJPA 5DY2A 3A5FA 2EKCA 3IVUA 1AK5A 4AWTA 3A24A 4QM1A 3PULA 4Z1AA 2X2GA 2FQIA 4IMCA 3M5ZA 2LLEA 1GEQA 3U6WA 4UFHA 4TR9A 3HG5A 4ORMA 5TQLA 1KTNA 1LRNA 1KM2A 5I3HA 2VFHA 5G2IA 3S5YA 4NZFA 3UNDA 4E2DA 1Z44A 5FESA 4RZ5A 2TYSA 4IX2A 1KV8A 3LHVA 1SPQA 1P1XA 1H51A 2HTMA 2NUYA 5BW6A 3FEMA 3IGSA 1YTKA 2GVGA 3PUOA 2RDWA 2QEZA 2BX7A 2VEMA 4ADTA 1MO0A 2PURA 3IVSA 1OX5A 2CLOA 4AWSA 1TB3A 4FNSA 2RDUA 4JTUA 5FI8A 4XQ6A 1UUMA 2TPSA 4FNRA 1I8JA 4GWEA 1VH7A 3UWQA 1TPC1 1Q6RA 3NDOA 3FYOA 3LTYA 1ICPA 3PF3A 2Y63A 4QNEA 3QQ1A 5D2WA 1LRQA 4U28A 2E5CA 1BKSA 3SSJA 1SR9A 1X8FA 4FNQA 3L68A 1SZGA 5EKYA 3LLFA 4FB7A 1IXNA 4MJZA 4OHQA 3EKLA 4UFMA 3DFNA 4QNWA 4XBSA 3NQAA 3A22A 3DI1A 1SQ7A 1XBXA 4O1AA 2NX9A 2Y85A 3KVJA 4IJBA 1KTBA 4XWUA 1B57A 3MI2A 1EWDA 3BGJA 4N2YA 2GUUA 4YLWA 3RLVA 2A7RA 2Y88A 3L9CA 4JDBA 1G67A 2HMCA 4JTHA 1J2WA 3S42A 1BEUA 5AYXA 3TMLA 2JBMA 2JGQA 5HINA 1LROA 3FKRA 2Z2UA 5GVJA 5LNUA 5LNRA 3G8EA 4R34A 1YXCA 4OWGA 3W76A 3OVQA 1W3TA 2DZPA 5K4XA 1N8FA 3B4UA 2C0AA 2Q8ZA 4WY0B 4CCEA 1NEYA 1TIMA 5AB3A 1RVGA 3M47A 3PUDA 3KXQA 3VI2A 3R12A 3WFAA 3GIYA 1F2JA 2R14A 3L5AA 3W7MA 2B7QA 3GXTA 2E68A 5K9CA 3QYQA 1G4SA 1L2UA 4JXCA 3PBWA 1IXQA 4YWIA 4O1BA 2ATMA 3GR7A 2GPTA 3MHGA 1W3IA 2YFOA 3W2NA 2VOMA 2YR1A 1W3NA 4RXGA 2E6DA 4M7TA 3W23A 4AB4A 1VHNA 4IPJA 2ZRYA 1GOXA 4LVBA 4UMBA 1OJXA 4D2JA 3MO7A 4ZQRA 1JCXA 1QPNA 3W75A 1KFCA 3Q2DA 4Q32A 3TC7A 3KHJA 1HTIA 2HSAA 1FDJA 4JTIA 1XBZA 4O4WA 4IMEA 4X3ZA 3W7HA 1OFQA 5K9XA
chains in the Genus database with same CATH superfamily
4FHAA 4N7QA 1RH9A 2QCLA 5LNWA 3ABQA 1A4MA 3ARSA 1T41A 1TX2A 5C71A 2WNWA 4JFTA 4B9YA 4J3SA 4A2SA 1VRDA 4D1IA 1EPXA 4MKSA 2DV0A 2J9YA 5A5WA 4IJRA 3H22A 4GH1A 3RLGA 3UCDA 4HN4A 4E4PA 4RZ4A 6PTDA 2VD9A 1LCOA 1KGUA 4HSHA 3F1QA 2J6XA 3GR4A 2E1WA 2J7FA 4B5WA 4WOQA 1EO7A 2PDNA 2CLKA 5DELA 4AAJA 3UGVA 2ZADA 5E0KA 5BYWA 1V3HA 4OBRA 3LXBA 8A3HA 1TWZA 3BAYA 1K8CA 2E4TA 1AFSA 2BV9A 3N04A 1PKMA 2R9RA 2R1NA 3QC0A 2QCGA 3OG2A 2R91A 3SN0A 4IHCA 2NQ9A 1RR2A 3AZTA 2GQ8A 3MYPA 4NRRA 4V1XA 3QMSA 3I3DA 2ZX8A 5FL1A 5EMLA 3G1FA 5E9XA 1RCXB 1CXHA 1PIGA 1MYRA 2YDQA 2G3JA 2WVUA 1FH9A 5FJPA 4DPPA 3MZ2A 3OVRA 4L6OA 2VXNA 1H1ZA 2QW5A 3IRSA 1B3YA 5ABFA 2I9EA 1ODZA 3QF0A 2GK1B 4ZFMA 1G69A 1UBPC 3LD5A 3W2KA 2PTXA 3MYOA 3W1RA 2ISDA 2YJQA 3W84A 2DJXA 3HA1A 1XSKA 3GBDA 1AW5A 3O6AA 2FJKA 3HJZA 4HHHA 5PTDA 2X0SA 1GJWA 3W7KA 1HF6A 5LSMA 2DUAA 4O54A 2EJ1A 3WNKA 3VC5A 3AOFA 1PWMA 1V4YA 4ICNA 2XDFA 2ZTKA 4GO9A 1QPKA 4LAUA 4LQ1A 3V5OA 2CLLA 4I9JA 3RX3A 2QF7A 2CLPA 2QCDB 4A8LA 3PZIA 1VPQA 1DIKA 3EWWA 1JL8A 2VNCA 5LIKX 3TV8A 4GGHA 3H2NA 2Y7GA 2ZRUA 3T42A 1OGBA 3KDNA 2QVHA 5CJNA 4E0CA 4J28A 2W6RA 1RP8A 2G4FA 3W86A 1KBIA 2A3CA 5CSSA 5HUOA 4TIMA 4UR8A 2WXDM 3TYAA 4PMOA 3O63A 4WEVX 3T4WA 2CESA 3OZYA 4N9BA 2WWDA 1QO5A 4Q8PA 4IF2A 5DCDA 2R82A 5AC8A 2PLMA 4S38A 3MY9A 3GC2A 2PD9A 2I9UA 3WMBA 2J27A 1V08A 2VMFA 1EKOA 4EKJA 2YL5A 3NFUA 4MFDA 5FIPA 4CQAA 2ZX6A 1PHWA 1EC9A 2NXGA 2E8ZA 1JCTA 1EWEA 3VA8A 3BANA 1E6XM 3CHVA 2W92A 4IL2A 5EPDA 3GKAA 2CNCA 1JYNA 2PRMA 4GI4A 3SY1A 5A6JA 1HJVA 1E72M 2I7GA 6ALDA 2ZA2A 4LF1A 5T9BG 4DF0A 4ROPA 1RHCA 3D0CA 2I5GA 4GZ7A 2PTWA 1GEHA 1GGOA 3OPSA 1OC5A 3B9NA 4C6PA 3EWXA 1SZEA 3HGSA 3SCOA 1KCKA 2HS8A 4NAFB 4LY4A 1WV2A 3PC0A 2IPFA 3ERPA 3VIMA 1MSSA 4UQCA 1H62A 2WKGA 3P6LA 3ARYA 3GVGA 2BY2A 1TJ2A 1TV7A 2C1HA 2Y70A 1SJDA 3PAOA 5JIWA 1RK5A 4AEFA 4PMYA 1CXFA 2NWSA 4UR9A 2XINA 3G1DA 3NEVA 3WBWA 4GYKA 1M41A 1XWYA 4U3AA 2KZHA 1V5XA 4GG9A 3PAJA 4PUDA 3Q94A 3LBMA 4K68A 4Q33A 3CXOA 1GW9A 4K1GA 2CWXA 3E9AA 4F9JA 4IG2A 3TC3A 1W9VA 3ALFA 3GRIA 4CD5A 1H0IA 2BOGX 1CB2A 4DLMA 4UTUA 3QY7A 2Y0FA 2WVSA 4PA8A 4PEKA 3WENA 3MMUA 4ES4A 4TMBA 4A35A 3TZNA 4AQLA 5XIAA 1V0KA 3H6OA 3ITLA 3NL3A 1CI1A 1HL2A 3CAKA 1XPYA 3CUJA 3JS3A 3WF2A 1F74A 1V7AA 2MANA 3LS9A 3AS0A 3VIKA 5AZ1A 3LXAA 1MUMA 2H8ZA 2E25A 4D6JA 4LYQA 2QGHA 3W72A 3WQCA 3EWDA 1DV7A 2CHNA 3W6YA 5K4ZA 3EA2A 3T9PA 3LOTA 4NI8A 3NL5A 3EKGA 4O1EA 4U33A 2E8YA 4HTYA 2V5DA 1QR7A 3LMYA 3BOLA 4FX6M 3V7PA 3EXTA 4Q6XA 4D6HA 3CHEA 2ZCGA 4D9PA 3LCGA 2D69A 2WYSA 2J47A 1TCDA 1TJPA 3QN3A 2XZ7A 4I6KA 1CTNA 2Q71A 3RX2A 3RU6A 3W88A 5CC7A 1H60A 4XKYB 3CU2A 4QLLA 4Z17A 1JG9A 4IICA 1U22A 3SCQA 3MDUA 3F5LA 4PTNA 2CZDA 4KQNA 3R8RA 4HOXA 1N2VA 1Q63A 4WSHA 3M43A 3LGEA 2X40A 4QAWA 1W91A 2ZFAA 1N8IA 3SBFA 2NQZA 3CQIA 3WUFA 1LL4A 3IPWA 3G24A 4PTVA 3VD9A 1BSLA 3VX0A 1V03A 1E4MM 3R79A 3UJRA 4NNCA 4X60A 3W7QA 4GXPA 4Q4KA 2FZBA 1J9YA 3CQHA 1AQMA 3B9OA 5I09A 3P84A 4NF7A 3UPBA 4L1GA 4MVAA 4B3ZA 4JX6A 3VZZA 1UR1A 1L6SA 3W53A 3GHRA 2XFFA 8TIMA 4GIYA 4KRUA 1BTCA 1YXYA 1OD0A 3BCFA 3S5ZA 5I5RA 3A5VA 4CEXC 1RVKA 4ZE5A 1XPGA 3IARA 1EF2A 4D71A 3LV6A 1OFOA 1UMYA 4J4KA 4EX4A 3ITOA 4DHGA 2IQ0A 2ZUUA 3SIZA 3G18A 1EGVA 3AMGA 3MP3A 2OKTA 4M0XA 4O0KA 3UD6A 3FKKA 1X39A 5H8MA 1W9XA 2FZ8A 5CSYA 2WVTA 2V2CA 3H26A 4PMZA 3ITGA 1UD6A 1Z3NA 4ONVA 1KTCA 4JX5A 1JYWA 1YDOA 2OQHA 2Z26A 3EZ4A 3TZFA 2EO7A 4GQBA 3RPDA 1AH4A 3URBA 4RV8A 1ONXA 1S2WA 1T6MA 1VCGA 3LTPA 4HOZA 1JUEA 3VILA 2NQJA 3P0WA 2I56A 1XHGA 4UCGA 4ZQOA 3TJLA 3QZAA 4K3ZA 2ZX9A 4UNKA 4LYRA 4TOQA 3V35A 3ZMRA 4R9OA 3KWSA 4UQAA 3NIYA 3VTRA 2PLKA 3BMVA 4HPNA 1UPMB 4RE4A 4OT7A 2C13A 2VI0A 3B9AA 2E7FA 1P0DA 2D1ZA 4RPPA 3T44A 3HGRA 3PNZA 5FD0A 3ZLFA 3GYCA 1LBFA 2IKHA 3CJPA 3COTA 1F6KA 2KX9A 1ICSA 1BYAA 1PKNA 3IIVA 4O10A 1XIMA 5ABHA 1NFBA 2BFGA 5HBFA 2GOUA 1RSCA 5EMYA 3SR7A 1E0WA 4JEJA 1ITCA 1JCYA 1LBMA 1P6CA 2AQWA 3LCIA 1ICQA 1JFXA 3FGCA 1TVPA 1GOMA 2C16A 4L1WA 2I57A 3WLNA 3E2SA 1JCNA 1GUVA 1T7LA 4O19A 1UWUA 3IIXA 3L4WA 3RFAA 2VO5A 4XD4A 2BVYA 3WLLA 4Q22A 3AHXA 3GY1A 5C9RA 4JTFA 2GZXA 5G4EA 5I6SA 1OX4B 1WKEA 2EPKX 3PBMA 3DHFA 3QZ6A 2AQOA 1V6VA 5G1MA 3TUUA 1DOSA 3W2UA 1BD0A 4DX3A 4IP5A 1DJWA 3DEQA 4GKTA 1CLVA 4C91A 1GK8A 1VFSA 5C7HA 3VD3A 4WGHA 4CD7A 4J3XA 2VQTA 1AQHA 3GG1A 3AQUA 4XBJA 3BTNA 3GTIA 4F0SA 4DO5A 4BY3A 1EYWA 4MZ8A 5EGRA 3UPWA 4B92A 4AF0B 3TE9A 5D9NA 4M5PA 4UUIA 2CEQA 3NWRA 4H3DA 3OHMB 3T2QA 4ZZ9A 4QDWA 4FEZA 4HHMA 4C1NA 1OABA 3TLQA 2P76A 3UZ5A 3LCWA 3W7PA 5E9AA 3M7WA 3KBWA 1PHQA 1S5MA 3JZUA 3GW3A 4ASTA 2DVTA 7PTDA 3ZM8A 2ZZ6A 5AC5A 3WQ4A 5HQMA 2A7PA 4HK6A 1OFRA 4PCNA 3DHDA 4IUOA 3EEGA 1TA3A 3USZA 5HOSA 4JTJA 3L4YA 1WB0A 4DYKA 4UOJA 2PS2A 4O28A 3W2MA 4JKKA 1TVNA 3MDWA 1W54A 1OCBA 2HJPA 1VQTA 5TAOA 4HNUA 9XIAA 3UXDA 5I78A 4IXHA 3CV1A 1CGWA 3DFYA 1FX6A 4XZ9A 4WSJA 3B06A 3VNJA 3QGVA 3ID7A 2G5WA 3H21A 1TV8A 3D3AA 3N3TA 2DZVA 1YRRA 3IIZA 3PZGA 3LSBA 4JN6A 2VX6A 2XFRA 3MVTA 5KSWA 4WD0A 2QDDA 4B5VA 3E2QA 3O8AA 2YZRA 1JZ5A 5C5YA 1ALDA 3WNNA 1VD6A 1ZHAA 4JIQA 3KL5A 1HKMA 1YTDA 3FJ6A 5H8UA 3LPGA 2CBIA 2W5FA 2ZC1A 4GABA 4AXKA 2ACRA 2W62A 1UZHA 5I3JA 2PWVA 4B5TA 1ITQA 2BZNA 4H9VA 3N9KA 2V3EA 4LRSA 4RR4A 4DJEA 3QV7A 2AL2B 4FP1A 3TSBA 1QOXA 3VX1A 4O16A 2JKEA 1ISYA 4ZSTA 1UZ1A 3LLDA 2FTYA 3EA3A 4A8RA 2L5HA 4BR1A 2P53A 2HBVA 4MAZA 3ZR5A 5AECA 2X1RA 3HG4A 3H24A 3CYJA 4WZHA 1WUEA 3WQPA 3WNMA 1XYBA 1CNVA 3POCA 1TYGA 2BY0A 1UC5A 1C9WA 5KZDA 3B04A 2VRQA 5B7ZA 1P6WA 2V5KA 2WZMA 4MKNA 2I1OA 1UHVA 3KAOA 3E0FA 4P7QA 1XGZA 2XU2A 2YCJA 3CASA 2D20A 2ON3A 3RR1A 3LCXA 3O9NA 2EKGA 3CO4A 3GHSA 4Q4QA 2GVLA 5FF3A 4B3KA 5FCZA 1OFAA 4EF9A 3CAQA 3BH4A 3BW4A 3WH8A 1IYXA 1WKFA 1KWKA 3EX4A 1IXPA 1PXGA 3WYZA 2GJRA 2PCQA 1E0VA 2F2KA 1BQCA 3PTMA 1ONWA 4IFOA 3VCNA 1H1YA 1EC8A 3L4TA 1YNYA 5AYIA 2VZVA 4NJJA 1GOKA 4PTMA 1TG7A 1WXYA 4IGMA 4PMDA 1SVDA 4J1OA 2WHLA 3VMPA 1ZGDA 2JKAA 3OHIA 1P7TA 4J3VA 3S6DA 4D72A 4MWAB 4QISA 5AFDA 1OX6A 3H12A 3A4XA 4MDPA 4JX4A 5J5DA 1R9YA 4YTSA 1CB7B 5GPRA 4AZ6A 4O15A 2HNEA 2J78A 2WZHA 4NG3A 1ME9A 5LXXA 2RJHA 1V6TA 3N25A 3RRXA 5HR7A 1OYCA 5AY7A 2B7NA 3MKVA 3RMJA 4YPJA 3V5FA 1ECEA 5D05A 2POTA 1KRMA 5CJ5A 2CLIA 3IRDA 3FNDA 3PWIA 4GKLA 1EF3A 1JQVA 1BYDA 1R9ZA 1RA0A 3WDIA 4DNHA 3N12A 1XCFA 4Z2LA 2RH9A 1G1YA 1OF6A 5T8GA 3B4YA 4H7CA 2WC3A 2D3LA 1EXBA 2OWXA 3UCQA 1LQ0A 3U4AA 3GTFA 3S5NA 4RDYA 4AY1A 3PSVA 2HVNA 4RE2A 3EEZA 1AMYA 4LVFA 4N9DA 4OV4A 3NSMA 1TMQA 2R6OA 4AY8A 5F4SA 3IJLA 1CXKA 2VVSA 1GVFA 1TUXA 2XSAA 4UFJA 2DUZA 3G3DA 1QCWA 1V02E 3K13A 4GMEA 5DX7A 1ZRQA 3MI6A 3LK6A 1GG0A 1JPDX 1VBUA 3KE0A 3RM8A 4LNCA 1KR1A 4IH3A 4LVDA 2GQAA 3RPMA 1GZJA 1DXIA 3W9ZA 3OLEA 1ITUA 2JIEA 1SO4A 1UKOA 2FGLA 5DCBA 1DTNA 1F61A 1FCQA 3CUHA 4B16A 1TJ1A 1V3JA 6XIAA 1WYIA 5DRIA 3F03K 4H6EA 2DDXA 2D73A 3CH0A 1J0KA 1X8CA 1QFEA 1FQ0A 1S1RA 1TPDA 1LBLA 2BODX 4LUJA 1G94A 3TLLA 3T0DA 1Q8JA 3V36A 4M29A 4V1YA 2PU1A 4W87A 4I9AA 5D32A 3SB0A 2OGYA 4IMGA 4L9XA 3NXLA 2E77A 4UTKA 3TX9A 3O07A 1HGYA 1HJQA 2YBTA 4OUIA 5GNXA 1G7VA 5CPLA 4BA0A 4DZAA 3NDYA 3DENA 2QDGA 2YCLB 4LFYA 1QOPA 3HPAA 4Z42C 2F6KA 5KITA 4L61A 2OPJA 4OGZA 3GU2A 2XIJA 1XFBA 5FJIA 5C2CA 5IOBA 2WOQA 3AMKA 3MKKA 1IZJA 1MXSA 2ZUMA 4FZIA 1LUCB 2ZDSA 3KL0A 2VWSA 1XC4A 1W17A 4WX2A 4Y9MA 2GOKA 3M4HA 1OGSA 3ZYZA 4C6LA 2W4XA 3TTYA 4GYPA 2VJXA 5HAOA 3RRAA 1K6AA 1H7WA 3FJLA 2P8CA 5EBAA 3L0GA 3WLRA 4WJEA 3UY8A 1KFEA 4DVOA 1I6NA 1FXPA 2CBVA 5A8PA 3FVMA 4GJIA 4GH3A 3CQJA 2CERA 1SGJA 2ICSA 2DSKA 2PU0A 3R10A 2XUCA 3EOUA 2H9AA 4G5DA 2VP8A 3S2JA 5D2XA 4GE8A 1UR3M 3UNTA 1UBSA 1TWIA 1XLIA 1D3HA 4F9DA 1KFWA 2ZTJA 4JNMA 1UOZA 1RK6A 1SFJA 3K4DA 3M0XA 1QHZA 3GWQA 3N2CA 3OYXA 5E1QA 1FWIC 3KLKA 1W31A 2O56A 2HVMA 3VNDA 4EK7A 2D0FA 3VZXA 1CGTA 2CHRA 4R27A 4ICMA 3KM8A 1DWFM 1NFGA 3PFRA 4QHRA 5D2VA 1W6TA 3IK2A 3QMTA 5BWAA 3LHZA 4U10A 3NVTA 4P8UA 2VEFA 3AHTA 1K7EA 1RPKA 1MW0A 1K70A 1WZMA 5I7GA 1ADDA 2QF8A 4DBEA 4QITA 1Q6QA 5FL0A 3SCWA 1Q4NX 2XVLA 1FDZA 3PBYA 3HURA 4LV9A 3QGKC 4JDYA 4EWND 1T0OA 1QATA 4S2BA 4O17A 2YCLA 5CG0A 4LAMA 3L5MA 3W01A 1Q66A 4DEFA 4MUZA 2J7DA 2VGBA 4C6IA 3SCNA 2JIWA 3O15A 4M6VA 4KEUA 1YTEA 1C8VA 4O57A 3ONBA 2HVOA 3W25A 2ZZ2A 1FCBA 4KKXA 2B81A 4AXNA 1JDDA 4WY0F 3WQ5A 1VB9A 5CZ0A 4AIUA 4F3HA 2D3NA 1V6UA 1R3TA 1EJ7L 1C9DA 3VUPA 4CN4A 1BRLB 2OJPA 2D0HA 2GGHA 3KHDA 1L6WA 3RITA 3NQCA 2DT0A 3WF4A 4F2BA 1V02A 3TTSA 3ZZ1A 3S1GA 2FGBA 3GVQA 2ZUWA 2J66A 1VPYA 1LJYA 2GDQA 1KGWA 1RJQA 1R0MA 2BG5A 3UG3A 3TAOA 5T9CE 1Y5WA 3VDAA 1M9HA 3NYZA 5CSUA 2QUVA 3JUGA 3NO1A 3FK4A 2OGJA 4RNHA 1Z89A 4AWEA 1X96A 4AX7A 3S2NA 2VCBA 4GK8A 1BRLA 4TVCA 1QMLA 1ZCOA 1ZNNA 1A5SA 5D8WA 3M0IA 2QCMA 4ZFCA 1GW1A 1SW3A 3BICA 1ZAIA 4MM1A 4TV6A 2EGZA 1BYBA 2Z6IA 4KWVA 5HR6A 1K77A 1HIZA 1ZBCA 4C6BA 1UD3A 2PDFA 3OO2A 4ZEPA 1S3TC 1PCWA 4MYAA 4DUXA 3V0TA 4U3CA 1XF0A 1YBQA 3JZEA 2PA6A 4UB9A 2CLFA 4HZ7A 2FLIA 4QROA 3IEBA 3UG8A 5TD4A 4GRSA 3R58A 1YEYA 1CXIA 4HVXA 5G2HA 2G95A 1FHUA 2ZA1A 2FKPA 1MW3A 2F84A 4O1FA 4BQ4A 3PZTA 3VDHA 4LGXA 1E9IA 2PRLA 4URIA 3MCNA 3W1LA 3GDBA 2NX1A 1R3RA 3WQDA 2HQAA 3OOQA 3W1PA 3ANYA 1XQLA 4ZENA 4I7WA 3S1XA 3S1WA 4ZGYA 4JEQA 3RCMA 1IEVA 4WCJA 2CZFA 4A2RA 1O95A 3GH7A 2NVAA 2WLYA 3VFLA 4U31A 4HA0A 3SCRA 4S3EA 5I2UA 3M64A 4EE9A 4YIWA 2P3EA 1GKRA 1P0NA 2XFYA 3N6QA 1R86A 2YGYA 1KO0A 3ENLA 4Z2HA 1LLWA 2VEGA 3REQB 1BGAA 2DP3A 3RNDA 4F48A 4DJED 5I3FA 3NQFA 1PIFA 3I3EA 1K8XA 5CLWA 4DJFD 2GFTA 2ISFA 2VC7A 5I06A 2V5BA 1VFTA 1ESWA 3G1RA 3IVUA 5HNTA 3D6NA 3PULA 2X2GA 2FQIA 2Z7KA 4I3GA 3A64A 3M46A 4ORMA 5I07A 1FWGC 1EBHA 1HKJA 1KTNA 2DSVA 2WJDA 1UR2A 2VFHA 3E2RA 4E2DA 3O7UA 1BPLB 4GIAA 2NUYA 1W3HA 1YTKA 5C9UA 3HV8A 1UR4A 2BX7A 5DFAA 2WHJA 3CPUA 2PURA 4BF7A 1OX5A 1E9LA 2DIEA 4R5EA 5FI8A 4DWDA 4FNRA 2TODA 2QUNA 1ICPA 3ZVIA 4QNEA 3QQ1A 3S4TA 1XLLA 1LRQA 3SSJA 3VKCA 1X8FA 4FNQA 4PMVA 1VFMA 3L68A 3APYA 2HISA 3FDGA 3VNYA 3CZJA 4MJZA 4UFMA 4OBSA 2IQDA 2Z25A 2NX9A 2Y85A 2QLYA 2PDJA 1KTBA 3H70A 4DJDA 4GIEA 3WUBA 5BWFA 2GUUA 4YLWA 4GQGA 1FKWA 4YN5A 1OCNA 1CGXA 4QG6A 5GNZA 4LF2A 5A6KA 5DMLA 3BSGA 1HVQA 3SURA 1W9UA 2JGQA 1LROA 2WMFA 3VNKA 2WM1A 5LNUA 3C3UA 4Z2KA 3G77A 2Z28A 1XP3A 1W3TA 1XC6A 2VT0A 1PPIA 1NEYA 3GC5A 3M47A 3RO8A 2W67A 3MU7A 3A13A 1F2JA 4GVGA 2VZUA 3CYVA 2Q02A 5K9CA 3QYQA 4ZCWA 1UH4A 1G4SA 4QGCA 4ML4A 1B5TA 4DAFA 3HZ3A 4YWIA 4IISA 3EDJA 4O1BA 4H19A 4H7VA 4A3RA 1YE6A 3AXKA 3VK5A 3NTYA 1O66A 2PGEA 4QE5A 1FA2A 2ZRYA 1GOXA 4OTKA 3WNLA 3CO8A 3LENA 1EJWC 4BQ3A 1OJXA 1W1A1 1JCXA 1UWAA 3THUA 1QPNA 3UZZA 1KFCA 3PN8A 3UW6A 4V2XA 4AVOA 1J8VA 3B0YA 1FDJA 4JCMA 4O4WA 1O5QA 1IR2A 4X3ZA 1N8WA 1C8XA 4X9YA 1BXCA 3LNMA 2ADAA 4Y8FA 1UWIA 1YHTA 3MUXA 2V3DA 3VD4A 1DXFA 1G7UA 4UWMA 3WO8A 3GKFA 1WKYA 1E6ZA 5FEWA 4IPNB 3WEZA 3S9ZA 2C79A 5M03A 1POKA 3LG3A 4JYFA 1JYVA 1J5TA 4IQDA 4HCDA 4NAFA 4JS3A 1XYMA 4HJWA 4XX6A 1PDZA 3AISA 3AJXA 1DQXA 3STEA 5GJMA 4GHRA 3AYTA 3JVAA 2OEMA 4WJXA 1OK4A 4ECLA 5K9DA 4Y7EA 4NI3A 4AZGA 3U57A 4PMQA 3V1HA 4ADUA 3NM3A 4UFIA 3MANA 3NURA 1RALA 2PWGA 4UTMA 3S9YA 1R47A 2WBKA 1Q6DA 3DG3A 3W00A 2ACQA 2YYUA 4PMXA 1B1YA 3VFCA 1TPUA 3NZGA 2D2HA 3GXPA 2J25A 5CSRA 3USBA 4YL2A 4GFSA 2A0NA 5D9OA 3VGHA 1MNZA 3D46A 2I5IA 2RHGA 1MZRA 2FGZA 4PRWA 1Z9AA 2X1TA 4C6QA 2WJZA 3TIMA 4HQVA 3VE9A 3NEHA 3AAMA 1F3EA 3CH9A 2WJEA 2G3MA 1SFTA 1OB0A 1A0CA 2XIIA 4IOTA 1G6CA 1R85A 3LDVA 2VTFA 4H8NA 3APTA 3MSDA 4JN7A 2GVJA 1OWQA 3GTXA 1C29A 1H41A 2QIIA 2A3AA 2FVMA 3SJ3A 1PCKA 4PCFA 3BUVA 1EC7A 2RJGA 2HBXA 4WDWA 3WDJA 1QPRA 3NG3A 1R3QA 3WF0A 1XLMA 4OOUA 2V82A 3WH6A 3A4JA 3CLWA 3BG9A 5DBTA 4IP7A 4RE0A 3O6DA 3W1MA 3THDA 3JR2A 3H54A 3T6CA 3IIPA 5A95A 2HXUA 1DP0A 3G1XA 1B90A 3EOEA 4QQUA 1IGWA 4XISA 4WJ8A 2WSPA 1QNRA 4PR4A 3PVFA 3ZJ7A 3U2ZA 1Q6FA 4UTFA 3TXVA 3TW7A 5D02A 4ICCX 3IJQA 3HGOA 2PDIA 3SAZA 4L56A 4G6CA 4N6FA 4GQRA 1C8QA 4PZVA 3W1AA 2AMGA 5DO8A 5EMKA 2G8ZA 5LZLA 4LS0A 2J9ZA 5ABTA 3CC1A 4WR3A 1YE4A 2IPGA 3LQLA 4BCEA 5CLTA 3PZNA 3QSTA 4IMFA 1I2RA 3U3HA 3UWUA 4IUGA 3RG6A 4S1FA 5F2LA 1WDDA 2Q3RA 4TTUA 4FF5A 3MCMA 4JPGA 4ZB0A 4QE4A 1PL9A 5AC7A 3B9EA 1D7FA 3CHDA 3H2OA 3FA4A 1EJUC 1TFVA 5BXSA 1PTDA 1SO3A 1XD1A 1RA5A 4Q8TA 3ITVA 2R1KA 2DT3A 3HQ1A 4XKYA 3A3XA 2X42A 3NQ6A 5LKYA 3NDZA 4KEMA 3RHGA 1HKIA 1TA3B 2XVKA 2VC6A 3KRSA 2YCKX 4PB4A 2J75A 3C86A 3EPMA 3CV6A 3B8WA 1S3HA 4FLRA 4DJFA 1OZQA 3UU0A 3PZUA 2OR2A 4ALDA 2BB0A 1JEZA 1EO5A 3F4CA 4IFKA 1R46A 4LUSA 1IT0A 1GQJA 3TDFA 1K9DA 3C52A 3DBPA 1MXDA 2ATSA 3KBNA 2FVLA 3PG9A 4H4IA 5EMUA 1XIBA 4FSAA 1DIEA 3NQ8A 3WJXA 3GUGA 3MHFA 1BF2A 4FX7A 2OCZA 2VC5A 2WZIA 4LT9A 4PSRA 1LRTA 3G5EA 4R88A 3TA6A 2Z1BA 2QDHA 4M24A 4GJ1A 1XIJA 3HJEA 3SECA 3LGGA 2VELA 3B97A 1T8XA 3CS2A 2H6RA 4YYCA 1SO5A 2J4GA 3TH6A 1UKPA 1LLZA 3ONCA 2WKJA 3HB9A 3HMCA 3NYDA 4HNLA 3MJMA 3M0MA 4UQDA 2G96A 4NU7A 1WQ5A 3U2OA 1V6WA 2WC7A 3AIEA 3W1XA 1CXEA 4XUYA 1MQRA 5CPQA 1PJ9A 1DBTA 1ZP4A 5CJMA 3LZ3A 1D8CA 5U4NA 4JGDA 4AVFA 1DJZA 1HP4A 5D2YA 1QRQA 3NCOA 3BMWA 1BWLA 3OW1A 3VAVA 3BJFA 4R7JA 4DM2A 3DESA 1A5CA 3ZR6A 3U48A 1HP5A 1N7KA 4JQ1A 1AQFA 5H1WA 5GJNA 1E0UA 3RMEA 3GFXA 1MNSA 1VC4A 2PUZA 3N3MA 1F05A 5J5RA 4E2BA 2VC9A 2ISWA 1BQGA 5G4HC 4FNUA 2OZ8A 3WL0A 3BAWA 3THAA 3DC8A 1C7TA 4KBXA 1VBGA 1Q6CA 3C8NA 4JCLA 4XG1A 3F7JA 4HOWA 1DE5A 1UMLA 3O3RA 1XL9A 3DOPA 4W5ZA 1J79A 1OY0A 4O12A 3ARRA 2HEJA 3B0VC 2ZXQA 3UR8A 3GVWA 5DT5A 1CT5A 4MB1A 2PODA 3AIRA 1S5TA 4BZYA 3GNNA 1S1PA 1W8SA 4AX6A 4Z0SA 4KMQA 2XVNA 2XGIA 2F38A 4WQ6A 3FXGA 3T7VA 3URQA 4N6EA 1R38A 5CGQA 1UR9A 1JXKA 1OT2A 3STGA 1S2CA 1HZYA 1NP2A 4M1RA 4CLMA 3GZAA 3NQDA 1HGWA 1UD5A 5A94A 1CW2A 4C6KA 3UBPC 2XISA 1F76A 2WSYA 1PUDA 1XLDA 3M07A 4ZMGA 5IFPA 4HNVA 3GIPA 3LCLA 2J88A 5LA0A 2A2IA 3KLLA 3MSGA 1GYLA 4S23A 3BG3A 2J8GA 4QFUA 4LB3A 3QH2A 4CD4A 5FF4A 1M3UA 3CIXA 4M81A 1CWYA 1NQKA 3C2EA 1S39A 4HBKA 4RL3A 3IAQA 3UY7A 3O0FA 3N2TA 1WZAA 4GC3A 1TPH1 1XIFA 4E8GA 3NQMA 2VEKA 1JF5A 4IXXA 4YTUA 4A22A 4GUIA 2ZUNA 5DMNA 2XFWA 3GTNA 4JL2A 1FBAA 4KWUA 4ZOAA 3M0YA 2J74A 3S3GA 4HSNA 3AICA 1BG4A 1I60A 1VLIA 4O4VA 1KRBC 3WQ6A 5JUVA 5LXEA 5AHFA 5D4YA 5HWJA 1LM1A 1MRQA 3A9IA 3OGSA 1AW1A 1XH0A 1KFBA 3DCPA 2J6VA 3C61A 3PSWA 4ZO8A 1U5VA 4KRTA 1NDYA 3F2CA 2VFDA 6A3HA 1RQEA 1M03A 2VDHA 3ZVHA 1X7FA 1JCMP 5DY3A 1REQA 4OBTA 4LVAA 3RCYA 3E0IA 1PTGA 1R3WA 2VFGA 2Y7FA 2AGTA 3QW3A 2HZGA 4MB3A 4P5UA 1YNPA 4OECA 1A5MC 2X30A 3SO7A 4AIEA 4O1DA 3SW6A 3CT7A 1KWGA 3QR3A 1ZJBA 1E73M 1E4IA 3IGUA 3V18A 3B8DA 3H53A 3SEPA 1XQKA 5C54A 2R1MA 1CLKA 3OYZA 4OUEA 5KINA 4MHBA 3C3NA 1B0IA 1EHAA 2Y62A 2PEVA 1K4GA 3MHUA 1PWLA 3R8GA 1CX9A 4GQ0A 1J12A 4TTGA 4ATLA 4DO4A 2WO5A 4XZLX 1FP8A 2CZEA 3THQA 1ZUAX 2BWGA 3KBSA 1F07A 3R5EA 4WKFA 2IPWA 3W1TA 4B3LA 1ZSXA 3UESA 3LHUA 4EXAA 3T0AA 3VIGA 4UQBA 3RU8X 2P3ZA 1TTJA 3M6YA 4CQ9A 3C0QA 3GH5A 2V0TA 5BU6A 3WCZA 2CCRA 1LL7A 1E1CA 3DERA 4WGXA 1R3SA 3G1AA 3H4XA 3CEUA 4HHPA 3MVIA 1A49A 1JUBA 2XM1A 5EY5A 5CC3A 1MUCA 2VUYA 1LUCA 3SQLA 3T40A 3IVTA 4B91A 3NSNA 4WUIA 3P7YA 4XD3A 1TV4A 4LAZA 1SZRA 4EIVA 3S47A 5HNNA 4IFRA 2UBPC 5HNUA 3TYZA 2DSWA 3CAWA 3SRHA 4US5D 4AHPA 1VR6A 2UY3A 2WWCA 4W86A 4FALA 5A6MA 3S1VA 3K5XA 1H11A 3TXZA 1XI3A 4J7RA 3PTDA 4YXGA 1EBGA 3KCLA 1GORA 5DN1A 1KFLA 5DLCA 1YYAA 3BVJA 1J10A 3TCSA 3WK3A 2VX4A 1ISWA 3LEPA 3QPZA 2R8WA 2CBJA 4WIWA 3UQNA 1RCOB 5AN7A 2E28A 3W7CA 3QEZA 1J6OA 1KRAC 2WCGA 4DZHA 3QGAC 9RUBA 4CNUA 3EYPA 3ZVHB 4G1KA 3LXCA 3DDMA 1E6SM 3E12A 2YFNA 4AFYA 1W3KA 5J8LA 3W29A 4QJ4B 1QK0A 4F0HA 1GOWA 3NPXA 4Q8OA 2PDKA 3HFTA 1AD4A 4AWUA 4JNZA 1GONA 4PB5A 3FGCB 4QP0A 1U30A 1AZ1A 1THFD 2JGYA 3LCHA 3GX9A 1GVEA 2NWRA 1GTHA 2XGBA 4MY8A 1UG6A 1RQHA 3U8GA 1B9ZA 1Z32X 4LAOA 2H90A 2PTZA 3HV9A 2PDUA 3P60A 3TN3A 1E0XA 5CPMA 1FKXA 5LYRA 3QTPA 1UJQA 3LGDA 3BARA 3G22A 4P7RA 5MHBA 1EL3A 2V6AA 1TO3A 1WXZA 4A29A 5A1AA 3SRFA 4MWAA 5HNRA 4HCLA 4PFHA 4FOJA 3U7BA 3K8KA 4KPLA 1NU5A 7XIMA 4UTLA 1GVYA 4O14A 4G7EA 5CBIA 4HSOA 4MAVA 1JXJA 4ZQMA 5LA1A 1J96A 1OBAA 3FA3A 4RNFA 4XZWA 3CIWA 5JQ9A 1K02A 4TVUA 1E1EA 1G4PA 2GVYA 3QXBA 2ZX7A 3BLFA 3CIVA 2E6AA 1C91A 3GVRA 2GGJA 5REQA 5CBJA 4DXXA 4S3GA 1Q4WA 5H8PA 4Z1CA 3ABRA 3T2PA 2Z1KA 1B3XA 5HPOA 4DO7A 1Z48A 2DH2A 4B5NA 4FLOA 4NX5A 1W1PA 5E0CA 1ADSA 3PB0A 1WPCA 4DUOA 1H09A 2WQPA 2D0GA 4MYXA 2OOGA 3MZNA 4BEQA 3W1QA 4DAIA 2NXHA 5I77A 3MV01 5A8NA 1VJIA 1HJUA 1XGEA 3KOYA 2OKOA 3EWBX 3CEPA 3WELA 2CXGA 3C56A 2BASA 2YYTA 1D9EA 2TAAA 3CL7A 4K39A 3N73A 1X6LA 3EXSA 4UTTC 5G4WA 4FNTA 3QR0A 3MC5A 3WLQA 3KS6A 5F1VA 3DYOA 2A5HA 4PCTA 1KQYA 2OZTA 1E6PA 3BO9A 2V69A 3RO6A 1UROA 4LCSA 1ZALA 3WBXA 3KRZA 1GG1A 3Q45A 1VEOA 3E2VA 2EQDA 5E70A 1OG0A 4DM1A 4BJHA 4LALA 2O7SA 1W0MA 3NOYA 4QS5A 1X38A 4XZMX 2VRJA 3TJIA 4P61A 3CT2A 1PIIA 4QAIA 3M7SA 5DXXA 1H5YA 4US6A 1QNOA 3KL3A 4HNTA 5EYWA 3IIOA 3BLDA 2GSHA 2I5QA 1TMHA 1WZLA 4N9EA 3W70A 4PFMA 2GJXA 4IFKB 3VIOA 1EDQA 3NZRA 3DYMA 1OIMA 2CZVA 2BOEX 3ARUA 5E0FA 4M1BA 3UJSA 1XYAA 2BMBA 4KCVA 1EP2A 3OVPA 2ZBTA 4TXEA 4HK7A 4W89A 3R11A 4J3WA 3KBMA 3FOKA 1E0TA 4K38A 4N0RA 4IMAA 5DANA 4JHOA 5LHFA 4YCPA 4LPCA 1X1OA 4RW3A 1W5PA 3W22A 5BOOA 3F4NA 5CC5A 3PHAA 4YTRA 2P8BA 1RXOB 3AXMA 4FLQA 3BL3A 3GXFA 3EBVA 1QW9A 4W7VA 3IJIA 4MSSA 3P3BA 1BVZA 1Y5VA 4TX8A 1V93A 1KM5A 5CZJA 2VKZG 4W8BA 1U1UA 4PTXA 1MUWA 4JTKA 3EWYA 3T0BA 4I9MA 3OJGA 5HPCA 4RJEA 3TCEA 4BKNA 3UR7A 4O0ZA 3SZ8A 1E3XA 3NJ3A 3VKJA 2E5BA 1NSJA 3WLSA 2YPIA 3W7LA 1R7OA 1TJ0A 2PDCA 3DG7A 4C5ZA 1RLDA 1OADA 1V3MA 3HPSA 3WK1A 1YPFA 2E40A 1X97A 2BVWA 1GZ1A 1LT7A 4W7WA 1ZBKA 5IM51 1J4EA 3L2LA 1A47A 1P4CA 3PBGA 5M17A 1P7TB 1EX1A 4A05A 1VYSX 5TIMA 1XLCA 1NDWA 1UH2A 1OFEA 2CW6A 3RX4A 1UIOA 1XKJA 1EJTC 4UTWC 1I1XA 3NAVA 1QOQA 1T5AA 3BLOA 2WAGA 1SO6A 3CWNA 4L9YA 1XJBA 1L6YA 4GI9A 1RBOB 3EWZA 4NX0A 3TYUA 2NZLA 1A3XA 3LRLA 3DKLA 4MDOA 5KZEA 1ONRA 3WX7A 1OC6A 3VE7A 3M0KA 3WD1A 4YU1A 4ZOBA 4JIHA 1RLCL 3ARVA 3CWOX 3WQFA 1VCFA 1PX8A 2YDSA 1ZCCA 3F5KA 4AHOA 4ZTXA 3ORWA 2PAJA 4FR6A 3WF1A 2VVNA 1JZ4A 2WSRA 5C9ZA 3GG0A 1JI1A 3F4WA 1EPVA 4XZNX 3BGAA 1QHOA 4H9ZA 4C1LA 2DT2A 2ASHA 1DE6A 1C3FA 4IX0A 4ZXOA 4GNKB 1BSIA 4NILA 3RJXA 4LBUA 1TQJA 5AOUA 2WSQA 1UD2A 3G6MA 3VU2A 1B4EA 4R7WA 1J6PA 2QHAA 1XG3A 1XBYA 1QUMA 4N02A 2IKJA 2PFHA 4IP4A 3W37A 4O13A 3EWUA 4MZYA 3LRMA 1Q2RA 3KEHA 1QNPA 4JTEA 1UWRA 3QMRA 4W93A 1I2OA 4Y9AA 5CCZA 3AALA 1ZBWA 2YIHA 3HMJG 3CMGA 3HQOA 4UMAA 1MEHA 3A12A 4HK5A 2X8RA 3G2GA 4J3TA 4MNJA 4PULA 3W1UA 4YCOA 2HK1A 3TN6A 2EBNA 3PTKA 1ZAJA 1QASA 3IAPA 5E93A 1OX4A 1A5OC 1UWQA 3VKKA 1FUYA 4KWWA 1E6RA 4LXFA 3S9IA 1R5YA 2IKIA 4WLCA 3K4WA 3AHZA 4MNLA 4LEQA 1B31A 8XIAA 1MZHA 3SGUA 3TVAA 1KM6A 1ME8A 4H9XA 4M82A 4AHQA 3H2EA 1WBJA 1IIGA 1PS9A 1QI4A 4MPKA 5CQ1A 1REQB 4IGSA 1XLGA 3V4BA 3VM5A 2VZSA 3PPCA 3OODA 4RDZA 5I0DA 4N4PA 3DFHA 2HCVA 5C6MA 4AC1X 3QPYA 1U83A 3DAQA 3WJZA 1XCWA 4NZ1A 4MGGA 1T99A 4CU6A 5ECVA 4JICA 1C7SA 4CQDA 3E49A 2PDBA 5KZ6A 4JQ3A 4H6KA 3W83A 2G3FA 2MNRA 3PJUA 1IEWA 1EIBA 1NVMA 4FOUA 1XV8A 2VEPA 5C8BB 4JTCA 1OQFA 4HA3A 4XSLA 1O60A 4GC4A 5A8MA 4AZBA 1UJPA 3M0ZA 4U4MA 1P43A 1E51A 4LNYA 2YW3A 4V15A 4F4RA 2O9TA 5A8GA 2WZEA 2QMKA 3ES8A 4BHYA 5F4WA 3GLCA 5TNVA 3V1PA 5D37A 4DYEA 1FWWA 4R9XA 4K2SA 3WK2A 4H9TA 1CCWB 4LTSA 3QVQA 3NPUA 3QLLA 4IL0A 3V5CA 4MB4A 1GT8A 1KLZA 3W87A 2QKFA 4HKPA 3ZWTA 2PWEA 3VNMA 5H91A 1W1YA 3SJNA 4EPBC 1WX0A 3W26A 3CK5A 1QNSA 1RY8A 3GHTA 1TPB1 4AZIA 3IGHX 3EDFA 3TONA 1B54A 2YXOA 3IUIA 2VZOA 1US3A 3PZ9A 2QVNA 3BDKA 4DI8A 4OU1A 5I02A 3N2OA 2A7NA 5I3DA 1XYCA 1EX5A 4E5TA 3G3MA 4KWSA 4JQ2A 3TSMA 7REQA 4F40A 4Q4MA 4JN8A 2GJPA 3U2CA 1OF8A 1HO4A 2OYLA 1QPOA 3QM3A 1TWDA 6TIMA 1NOUA 5JBEA 1UKQA 1XYZA 1E9YB 1U1HA 3MI3A 5CG7A 1XUZA 4QEEA 4S3JA 5JMUA 2BXVA 1RBLA 4N4QA 3PBVA 3UR5A 1OFPA 5F7UA 1BF6A 3CTLA 2ABAA 3AU6A 2QCFA 2AL1A 2C15A 2XH2A 2OLSA 2PF0A 4Q8MA 3KP0A 4LCRA 4E8DA 3TW9A 3QJAA 1GVSA 4D8AA 1Q8AA 2VGIA 2FZNA 1F9CA 1TVLA 4DJFC 1P5BA 3QV8A 4NJIA 3I10A 5LIXX 1WBHA 1LQAA 3UP8A 4Y90A 4CNTA 1UB3A 4DBDA 4CQ8A 1J11A 1UIPA 4PUEA 3FY1A 4MY1A 3N6JA 1CZ1A 4GYPC 1PZ2A 1JVNA 2NVCA 3PANA 4LSBA 1UYQA 2OO0A 2YOCA 4XZBA 1TRIA 3WH7A 4QQ3A 3CB8A 5E6YA 3KP1A 4TV5A 2E67A 3EWCA 1WOBA 1SFLA 2PDHA 2F8QA 4LUTB 3CQKA 3SQMA 2WNNA 4P7NA 3LBCA 4HPXA 4C65A 3LA4A 3AWOA 4GUJA 2ZQ0A 3PZOA 4M56A 4L7ZA 2D2GA 4K37A 4MJ2A 3SUUA 5DY2A 1J2BA 3JW7A 4OVXA 2FDMA 3SUVA 4Z1AA 1FVPA 1PYFA 3DX5A 1UA7A 2QMJA 3WDPP 4KS0A 2Z1VA 1VJZA 2LLEA 1GEQA 3U6WA 5BXPA 2HK0A 5I3HA 3S5YA 2C1IA 2TYSA 3ZJ6A 1P1XA 4Q4SA 5BW6A 1KB3A 2GVGA 2RDWA 4IIEA 5KETA 2VEMA 1P0BA 2D2OA 1MO0A 1VEPA 3IVSA 4GZJA 1OM0A 1TB3A 4FNSA 2RDUA 4JTUA 3CMJA 2TPSA 4S3BA 2XIMA 1NWUA 5LA2A 3FYOA 3LTYA 1HNYA 4J27A 3O0KA 4X61A 3VIFA 3WDRA 3HN3A 3H7VA 2JEPA 5JXQA 1VFUA 5A69A 5HJYA 1F3WA 4B5XA 3LLFA 3CV2A 3QHNA 1IXNA 1VENA 1JZ8A 3ZT5A 1EGMA 3NQAA 4ERAA 4O1AA 3KVJA 3WLIA 5I03A 2DH3A 1EWDA 3BGJA 1E1CB 3RLVA 1B30A 1G67A 5EU9A 1SM9A 3S42A 1N82A 4Y8EA 4KESA 3WLOA 4L9ZA 4LBRA 1W1VA 4KEZA 2PP1A 5LNRA 4DI9A 4R34A 3AIUA 4DXKA 1YXCA 4OWGA 4XVDA 4LUSB 1WCGA 1N8FA 4B15A 4WY0B 1XX1A 4WDTA 5AB3A 3C0SA 3VI2A 3R12A 3W38A 1L6FA 3WLPA 1SJBA 3MMDA 2E68A 3WQEA 4AYSA 5A2BA 4GOAA 3N4AA 4QJ3B 2NVDA 1ISZA 3VDCA 4JXCA 1KBKA 1ZB5A 1A5UA 2ATMA 4AVNA 3BOFA 3S83A 3W2NA 2YR1A 1JAEA 5IRPA 4M7TA 4HYWA 4AB4A 1VHNA 4IPJA 4UMBA 2JFEX 4D2JA 3GNRA 2VR2A 4C6CA 4GCXA 5I00A 4D6FA 3ALGA 3Q2DA 3SADA 1XLJA 4Q32A 2WMIB 4HNOA 5EFDA 1JDAA 4JTIA 4ZOEA 4GLEA 3W7HA 1P1MA 3WFLA 2HE8A 1NWTA 2POZA 1UQYA 1CLXA 4LX4A 2FVKA 2GVEA 1KBJA 3OBAA 4A3UA 2GUBA 3HU7A 2IW0A 2DW6A 2PD5A 1Z41A 1V6XA 5CKSA 3IJ7A 1EB3A 1FWJC 1W8GA 2DVUA 3R2GA 3WNPA 4D6DA 1Z7AA 4AF0A 3CUGA 3LRKA 3VPLA 3AZSA 1JCLA 2FMNA 3BURA 4I7UA 2WB5A 2YKKA 4GZEA 3QYSA 3QHOA 3ABOA 3GZ3A 4GUGA 1YW1A 3ZR4A 4L64A 3OZMA 4NT0A 1BLIA 3UFYA 4QSHA 3GB6A 2IXUA 3DGRA 1VEMA 5B80A 4FNPA 3AO0A 3G1HA 1M65A 4NAEB 1UZDA 1CYGA 3IJ6A 4JFWA 1PB0A 5C55A 2ABBA 2YSWA 4GYFA 4B90A 3M1ZA 3QV9A 1M04A 1JJKA 2HPMA 1BGGA 2BGSA 2OVLA 1OCJA 2OMAA 3G0XA 1XKYA 7CGTA 4KGLA 4KCUA 2WJFA 1W5NA 1BVNP 2GK1A 2GUYA 5F2IA 3CGTA 1QT1A 2X16A 5EL1A 3LM3A 4EPKA 1O1ZA 1BWKA 2CU0A 1MW2A 3E6EA 3SUTA 1IIHA 3P5YA 3RN6A 3KRUA 1JDEA 5CPNA 1LORA 4LS2A 3H8AA 2IQTA 3DBNA 3YPIA 4AEOA 3B8VA 1J0YA 1UUOA 1FWDC 2QV4A 1I1WA 3FDKA 2INZA 4KIRA 4WVXA 1K3UA 5I24A 4FF7A 3NUKA 2X09A 2R1PA 2QCDA 3SUWA 4D6EA 5LNVA 1WNOA 3OA5A 2YB4A 3DKJA 4F2TA 1PZ1A 4CCZA 4BQ5A 5D09A 4ZO6A 2Y8VA 2ZRWA 1G4TA 4LBSA 3O16A 3AUOA 4HU0A 4LB4A 5CGMA 1AUSL 5DCEA 4HGXA 2A79A 1H0GA 2EG7A 2XIBA 4PODA 2PWHA 1W5OA 2ZXBA 4B2DA 4K36A 4KFOA 1W9DM 3RLUA 4JTGA 3GH4A 2ZRXA 4S3DA 1OSEA 1GVIA 1HO1A 2C1GA 3AXXA 3NO5A 3MMWA 3W7JA 3MTWA 6XIMA 5L6UA 5IBXA 1QI5A 5CZSA 1EP3A 3APGA 3W6MA 1A5AA 5XINA 3CM4A 3GW0A 2VGGA 4TX6A 1PO9A 1SFSA 1Z6KA 3C2RA 3VOGA 2FHFA 4AZ7A 1XLBA 2PDXA 4S3KA 4PRTA 1KQZA 2GJXB 2CPUA 1XRFA 2NQHA 5HXMA 3R7MA 3UVIA 2DQXA 4U5KA 1J0HA 3WKZA 2OEJA 1Q6OA 4Y9NA 3B8TA 3W7GA 1AH0A 1AODA 1EEXA 3EX1A 1TSIA 1NF0A 1W2PA 1OYBA 4F79A 1QI0A 1P0EA 3STFA 5A6BA 1HKVA 4OV9A 1A4LA 1K8ZA 5F4XA 1FY6A 1NDZA 3L65A 5AVHA 1O94A 3GNOA 5REQB 4JL1A 4AEEA 3O6YX 3ITTA 2GQ9A 3DN5A 3N18A 4PTWA 2X7WA 3TFXA 4X0VA 2PDMA 4DYJA 1QXLA 2PTYA 4WRHA 2F7FA 1UPPA 3C8FA 4C60A 1VHCA 1WXJA 2A3HA 2DZBA 2Y24A 3L0NA 3TKFA 1TV3A 1P6BA 4HA1A 2AGKA 3BE7A 2J7EA 3EX6A 4GZIA 3W7OA 3TQKA 2F6XA 5AZ0A 1TV2A 3B8IA 4DJDC 3IWPA 1ZPTA 1IWPA 2E0PA 2PLCA 1H50A 1YPXA 2C91A 4Q8WA 3G1YA 3E0LA 4LYKA 3EDEA 2FB3A 4PRRA 3OEXA 4I8DA 1DJYA 3VIPA 2CBUA 1LOLA 5CPOA 4U2YA 3GM8A 1GOQA 2VFEA 3PBUA 1VBJA 1KA9F 3WIJA 3HG3A 4QX4A 1Q2SA 3ARZA 1H49A 2VHLA 3KOWA 4INFA 4ADSA 1M53A 1JDCA 2YLLA 3W85A 2E9LA 2OZ3A 3UXAA 2BOFX 3BJSA 2EJAA 2QAFA 3TU9A 1KXHA 3TQPA 5HJXA 5I3IA 2JKPA 1VFLA 3VO0A 1EOMA 3W82A 3ARXA 4DQWA 2E6YA 2WNZA 3WDQA 3GG8A 4NYUA 1SMAA 2ZZ5A 2X1UA 2HRWA 1YDYA 1F7BA 1XUUA 1XIIA 1JD7A 1EYEA 2DT1A 3I4KA 4KEVA 4YJ5A 3KX6A 1UWSA 2PCEA 2Y8KA 2BSLA 3ARQA 1YQ2A 2V2DA 3LN3A 3L4UA 1IT8A 3IUDA 4NNAA 3AMCA 1EFZA 1XDMA 4I90A 4M8UA 3WQWA 4J9JA 3N2BA 3TFCA 3G6LA 3KZPA 2NUXA 2HNHA 1LZOA 2JF7A 4UTHA 4AIOA 3I3BA 4PMJA 2DIJA 4GNJA 1XM3A 1GOOA 3P8IA 3GNXA 5H6HA 3BLEA 4OIFA 4ZL1A 1E15A 5BXRA 4BI5A 1M7XA 4G56A 4PBGA 2W91A 4GX8A 3TN5A 4QSFA 4H7ZA 1J0IA 4K7VA 3P74A 2CLEA 3LCFA 3S2LA 1ZY9A 4RZ6A 3OIXA 3ARWA 1RD5A 4FXSA 1OC7A 1NAL1 3BK0A 2ZZ1A 3PPHA 1QWGA 2HV5A 1EUNA 4CNNA 3D5HA 1LOSA 2DZTA 5JH2A 2P1FA 3N15A 1TWSA 1FH8A 3KZSA 3V16A 4LV4A 1LDCA 5HWMA 1KBLA 1PE1A 1EZ2A 3ITXA 5C9WA 4LS1A 4HMDA 2E9MA 2V5JA 1XIHA 4REQA 1JNDA 4DBSA 4HPHA 2V5CA 4NHVA 5G5IA 3ZJ8A 2VENA 2Z4GA 2E5DA 2FTWA 4BQ2A 2E3ZA 3MSYA 4O18A 1DHKA 2DZWA 3STPA 5IHSA 4KERA 3H2CA 5I79A 2DUXA 3L0KA 4K8GA 3LB0A 1XFCA 2OZ0A 4MF4A 3P0XA 4S3FA 1RD6A 1YLVA 1ZJAA 4GVIA 1O5XA 2ZICA 3N14A 1RQBA 1R2RA 1N55A 1UW9A 1HG3A 1LWJA 1X6UA 1RAKA 4PMNA 3ARPA 1FFQA 1TMLA 1VPXA 2G3NA 3TP4A 2ZRVA 4RDVA 4G8TA 1HKKA 2NQ5A 3A9BA 3OBKA 3U2EA 4A8IA 4JTSA 1L2QA 2J79A 3AS1A 3EKZA 4Z1DA 4AMCA 1IT7A 2QJJA 1VJSA 1XH2A 4Q4PA 4NZCA 2C0HA 4NXKA 1TR9A 4PEEA 1VBHA 1PX4A 4ZO7A 1Q7QA 1XYLA 2FB2A 5G1YA 2Z6JA 4L4PA 1ISXA 3B0XA 1EJSC 2XWDA 3L67A 4H2CA 3M44A 4P7OA 2VWTA 3VNZA 4F0RA 4GVHA 3N11A 2CFFA 3HBLA 4QR6A 2ALDA 3HF3A 3VOCA 4LCQA 1DYSA 4R53A 4M51A 4L80A 3HQNA 4NVTA 3QBUA 3MP4A 1YKWA 4O52A 1NJJA 2XIQA 5HATA 2RKXA 3GU1A 1KBBA 3A3HA 2V63A 2QV5A 4OFCA 3T2OA 1V7YA 1S5VA 3TJ4A 3NSXA 5TF0A 4CVUA 3E0VA 1K4HA 3GU9A 3ZO9A 3TJXA 2O92A 4AZ5A 1TPVA 4EVZA 4PUWA 4UBPC 1AG1O 1K9TA 3SQSA 1UC4A 4LAKA 4PBFA 5D33A 1QTWA 5E5CA 3INPA 3BQ5A 3BAJA 3FX4A 3SFKA 3VGBA 5KTLA 3VUSA 2G3IA 3DXIA 4NQ1A 4HA4A 2QUTA 2ZZ4A 3AXIA 3ITYA 1KM1A 3C2VA 4EWJA 3V0UA 3A21A 1JQXA 3WLJA 4GY7A 1SJCA 3H7UA 1QI2A 4WKAA 1PAMA 4YVPA 3S6TA 1FHDA 3I7QA 4CD8A 4Z08A 3QKEA 1W5QA 2BP1A 1LLOA 4YWSA 3BAIA 3GFYA 1NTHA 5FJRA 4UNIA 1TTIA 1LOQA 5LNSA 2FPTA 3T07A 3K2GA 1B9BA 4HNNA 1GWJA 4HCHA 1B3ZA 5AHIA 4HPGA 3NL6A 3REQA 3DHUA 1A50A 3KBJA 1ZL1A 2JALA 2VL4A 5F2MA 1WAUA 4NZ4A 4H8UA 4BFAA 4H9UA 1HJXA 1Q5MA 3P2VA 3TR2A 5K2ZA 4PSPA 1VF8A 2CKSA 5IBXC 3AROA 1JIBA 3P8JA 4NRSA 1VS1A 1OK6A 5I3GA 3LU2A 4M80A 4PUJA 3V75A 3HTWA 2GDVA 3GSMA 3U5UA 1RUSA 2XJ7A 3SN4A 3W1NA 1LT8A 3TN4A 4ZODA 1CBGA 1EQPA 1JPIA 3O1NA 1OZMA 4HHLA 3FV9A 3IV3A 3N2XA 5BCAA 1NELA 3MS8A 2Z1XA 3PY2A 1JYXA 1TREA 4DWSC 3T55A 4IPLA 1FWHC 4B4HA 2FFCA 3N6HA 3EDDA 2PE4A 2QPXA 3GNDA 4LC6A 3SCSA 2PP0A 3G1SA 4M6UA 3DUGA 3VDGA 3C2OA 3Q4DA 4CVWA 3UWVA 1GPFA 2QPSA 4GGBA 4LUTA 2XGZA 3QLDA 1MEIA 1VLWA 4QIUA 3TOYA 2V81A 1M7OA 1ISVA 2PWDA 3VABA 3FXYA 3DI0A 1UH3A 3F5JA 1K1DA 3SY8A 1MVYA 1F8MA 2INEA 3CZGA 3UF9A 1W3JA 1HL9A 3ATZA 3S46A 1MW1A 3RLHA 1DWAM 4DUWA 3WZ0E 2NSOA 1KC7A 3C4UA 3EDKA 3L66A 2O9PA 3UEQA 2VCCA 3VM7A 2J13A 2VFFA 1FXQA 2ZX5A 1RJPA 3QPEA 3DFQA 2V2HA 4W4QA 2OSXA 4XTIA 4LOCA 1F73A 3WJYA 5ENLA 3S2CA 4ZO9A 1M1BA 2VR4A 2TMDA 3PJXA 2QCNA 4CN1A 3TROA 1KCLA 3B0UX 1XISA 3IV8A 2IS7A 1VRXA 1YIXA 2D2JA 4O53A 1G01A 3BPWA 4RKAA 4YYFA 2QUUA 3NL2A 3PTQA 2PSNA 4NY2A 4D8LA 1JAKA 3EA1A 1WA3A 2B7OA 5DT7A 1EJRC 4PN2A 1ZTVA 4H6QA 1XLHA 2WPBA 1TQXA 4PL2A 5MKGA 2QAPA 4F8XA 4UC5A 4GNVA </