4JTLA

Crystal structure of f139g mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
277
structure length
250
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQGLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLELHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Examining the Role of Intersubunit Contacts in Catalysis by 3-Deoxy-d-manno-octulosonate 8-Phosphate Synthase.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 80
structure length 250
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtlA00
1WAUA 1G4TA 4YL2A 2C19A 1TQXA 2D73A 1UUMA 3NPWA 5CZTA 1G69A 3Q37A 2DJLA 4GNJA 2WSQA 4JX5A 5AHFA 3UZ5A 1BKSA 1NAL1 2FJKA 3NVTA 1ZAIA 3PBVA 1AK5A 3ZFHA 3M47A 1NFBA 1TPC1 1TJPA 2CZFA 3I65A 2TRSA 3L68A 4HSOA 3LGEA 2FDSA 4NQ1A 4A2SA 1WBJA 2A1YA 4TU1A 3MW7A 3DFTA 5G2HA 4MZ1A 5FEZA 3C2EA 4IMGA 1T8XA 4N6EA 3C56A 3M0ZA 4IPIA 4OQVA 1LRQA 4MFDA 2OT0A 4LC6A 3TR2A 5DCEA 1TRDA 1W5OA 4TO8A 3QPYA 4IMCA 2C3ZA 4JICA 3CLMA 3O8AA 1KBJA 3G1XA 1H63A 4WOQA 1N7KA 2GJNA 4HN4A 5LNVA 1ALDA 1OFRA 1VPXA 3IGUA 4NXSA 1D3HA 1U5JA 4EF8A 3LB0A 4UFIA 4JX6A 4FNTA 4LUIA 1KTCA 1QPQA 4GRSA 5HULA 4ZL1A 3QPZA 4PEKA 5F2IA 1AL7A 2J9YA 3G1HA 5FEWA 5D04C 5KITA 3NGJA 4N02A 5D09A 1KA9F 2TPSA 1U83A 3LHYA 3H54A 3TK7A 4DPQA 5CPNA 1YYAA 4O54A 4M6QA 1QWGA 4RXGA 4HPJA 1TTPA 3VI2A 3L0KA 3D0CA 4KKXA 1I8JA 2BXVA 3G1YA 2ZZ1A 3QRHA 5HUOA 3KVLA 4O15A 3RMJA 1KFBA 2NX1A 3CPRA 2ISVA 2O7QA 3SFKA 4AAJA 5BW6A 3ABOA 5I3KA 1IIHA 2V2HA 3B04A 4WXZA 5HWMA 3EWXA 3TE9A 1K02A 4IQLA 2FFCA 1FWSA 1SFJA 3P74A 3TC7A 3EB2A 1B4KA 1H1ZA 3GR7A 5FI8A 4MZ8A 2FIQA 4N4PA 4MY1A 4RK8A 3CIWA 4Q33A 2KZHA 3R8RA 3FIGA 4IJBA 2CZEA 4FF7A 2ZA1A 3EWZA 2Y7FA 1H60A 4K7YA 3W22A 1T99A 2ZBTA 3LTYA 1RQEA 4YMZA 1M5WA 2YFNA 1F74A 1JVNA 3F03K 3DENA 3FFSA 4OT7A 3EKZA 2PRMA 2WQPA 3W70A 1LRTA 4FX8A 1LZOA 1TIMA 4LVAA 1P1XA 2HMCA 4LTSA 2Z1BA 4UFHA 1LBLA 2Z2UA 3M5YA 4OU1A 4RZ6A 3GYEA 2CLFA 3SIZA 4JTLA 3WJYA 5I3IA 3GXNA 4MVAA 3TX9A 3W1LA 1JRBA 3S1UA 3IGXA 4BWLC 3PM6A 2VEPA 2E6DA 1OFBA 3GDMA 1QCWA 1VCGA 1X1OA 3UPWA 3H53A 1JR1A 2RDWA 1KM3A 2CWNA 1MSSA 1SPQA 3IIOA 3P84A 4XZ9A 3DFQA 3DFNA 3S5OA 3I68A 3TXZA 1OFAA 4HIBA 2LLEA 1GEQA 1YADA 4BI6A 1DL3A 3SECA 3HOJA 2OX1A 4XKYA 1VHNA 2DZUA 4QNEA 4WY0F 3LBMA 3SI9A 5BMXA 2OCZA 2QF7A 1ICSA 2QUVA 3P62A 1FUYA 3HPZA 3CEUA 1DV7A 3IV3A 1SO6A 4FEZA 4RJEA 4UMCA 4W9TA 5D2TA 4LV9A 5FEXA 3STGA 4PTNA 2YX0A 2GPTA 1Q6OA 2J9XA 3MYOA 3GNNA 2V2DA 3GZ3A 2UV8G 2E6AA 1WOBA 1EP3A 3U8GA 1N55A 1P0KA 1JCXA 4IGHA 3UXDA 1YDVA 2HTMA 3EWYA 3E96A 3PVFA 3GDLA 2QCFA 1W3NA 1YPIA 3NO5A 3L21A 4CQ8A 4NX0A 1HO1A 4M7TA 3INPA 3MUXA 2ZFAA 5LZLA 3WK3A 2Q8LA 4M19A 3M41A 3P67A 1SZNA 3LM7A 3B05A 1OHLA 3UY8A 5G4WA 3A5FA 2C13A 1SW3A 1MZHA 3W7IA 1D3GA 3BPWA 3ZR4A 3TW6A 3GDTA 5A5WA 3LX9A 3WK2A 3G1AA 4HT3A 1TTQA 4S2BA 2QDHA 4UTTC 2H8XA 4M6PA 3PSVA 4UNKA 1R2RA 3LHTA 2J88A 2Z6IA 3CT7A 3TROA 2ZRXA 2ZRWA 3PUEA 1LP6A 3DHDA 3BK0A 2ABAA 5HJLA 3QM3A 4I9AA 1FWRA 1XDMA 4OGZA 3L5AA 1Q45A 2Z0IA 5T26A 2RDUA 3BW2A 4JIQA 1V5XA 2V82A 3O6CA 5A8GA 3FJ6A 1SW0A 4QISA 3CTLA 5G1TA 1G7UA 1YDOA 2Y89A 5F4SA 1FX6A 2QCDB 1I2QA 4GUIA 4RXFA 4AF0B 4A29A 5DY3A 4NZJA 3IGSA 4UFKA 3W87A 4AEOA 1EUNA 3GXPA 5AYXA 4GUFA 3C2OA 2YSWA 4FXSA 1WBHA 3P8IA 3USBA 3P8JA 1O5KA 1ZALA 3MBFA 4LVFA 2VEKA 5FF2A 5H91A 4UTWC 5AN7A 4P2VA 5D33A 3W1PA 2JKPA 1TREA 2H8ZA 4FNQA 4O14A 3UD6A 2GQ9A 1JUBA 3NEVA 1JCNA 5I3GA 3MWAA 3QMSA 4OV9A 5F1UA 2V0TA 3W85A 2OJPA 2ZRUA 2XN1A 4JTFA 3IIVA 3MMTA 5LGXA 1RQBA 1OF8A 5C2XA 4I7VA 1TV8A 1W56A 2NX3A 3W1RA 3P81A 2Y88A 3LHWA 4JX4A 4WY0B 3G8RA 3W71A 1XUZA 2V5BA 1PS9A 2VENA 3WFAA 1O60A 3KRZA 3TCEA 3W74A 1OFQA 2DZVA 2XFWA 3B4UA 3EX4A 4Z1AA 2JKEA 1JULA 4HKPA 4Q32A 1XXXA 1IXQA 4JY8A 2QCGA 2EHHA 2NWSA 1IGSA 4JR5A 2Y7DA 1PCKA 5TBOA 3WK1A 3CU2A 3OVPA 2C18A 5I3HA 4N2YA 1CX9A 2VKZG 4AWTA 4DF1A 1G4PA 1WV2A 4NJGA 1OX6A 4RV8A 5E0KA 3RLVA 1CI1A 3HG4A 4Z1DA 4MLJA 5HUPA 4ZQMA 3QYQA 1GG0A 3IVSA 4FNPA 4MUZA 1TPUA 3M16A 1LM1A 1VYRA 2YFOA 3F4WA 2BWGA 3EX6A 1K7XA 4M6VA 3C61A 4UMAA 4GUHA 3T40A 1GYLA 1OYAA 3QSTA 3UWZA 1L6YA 5KZDA 1OG0A 3LCHA 2QAFA 4Y9AA 4DBDA 3RLUA 1SW7A 4ZQPA 3A24A 1TPWA 2WSRA 2CLOA 3S42A 2PC4A 4UR7A 1XCFA 1FXQA 2VC6A 4Z1BA 3EX1A 3TA6A 4KFOA 1HFBA 3UWUA 1SSDA 1ZY9A 5AB3A 4O8RA 3W07A 3QH2A 1TPH1 3S0CA 1Z44A 1PCWA 5U7SA 2CZ5A 6TIMA 5L9FA 4NXKA 1O5XA 4UTJA 3L5LA 2YW4A 5MHBA 1C9DA 2DZPA 3C0JA 1GVFA 5J5DA 3NQVA 4LOCA 4CCDA 4MJMA 1VH7A 4NJHA 3NQ8A 2G96A 4XBSA 2PE4A 4MY8A 1OF6A 3BW3A 1G7VA 2DZXA 3W23A 3TV8A 4WD0A 5LHFA 8TIMA 4A3UA 1VLWA 1KFKA 4CNOA 4GWEA 3P61A 1BWKA 4ADUA 1OFOA 3TFXA 3T55A 3UQNA 1KM0A 2DP3A 2WNZA 5FESA 3SJ3A 1V7YA 3OG3A 1OJXA 3ELFA 3TSMA 1LDCA 4UFLA 4IX2A 3GB6A 2WO5A 3OA3A 2A7RA 2W79A 3BW4A 3PBYA 4Q4KA 3BG3A 3LLFA 3LHVA 3F1QA 3O63A 3GVGA 4ZZ9A 4ZVJA 4R53A 2GQAA 1LOSA 1PVNA 3N73A 3NG3A 3HGOA 3MI6A 1DJNA 3GR8A 4FIRA 1I2NA 4L4LA 2YXGA 2CLHA 4GE8A 3LOTA 1RD5A 2W0UA 4R33A 1F6PA 3MJYA 3PSWA 1EP1A 4LS2A 5U4NA 3RU6A 5KZMA 3R13A 2G5WA 1QAPA 4LNYA 4JTGA 1KW1A 1SU5A 3O15A 2NUWA 2QUUA 4O1CA 3SR7A 4MPQA 4AF0A 4OV4A 1LCOA 1W31A 4NNCA 3W7NA 2E1DA 3GDRA 4JY9A 1KBIA 4NT0A 1DQWA 4K39A 3RF9A 3ABQA 2ABBA 2WV8A 4WUIA 1X1ZA 3TSBA 4QITA 2CU0A 4N9BA 1SSGA 2VFDA 5EL1A 3S1WA 3SSJA 1Q6LA 1QDSA 3C2VA 4JNMA 3LRKA 3PY2A 1AL8A 1KFJA 3IVUA 4K38A 1F2JA 1X6UA 4AMAA 4LVDA 3NZ1A 4BR1A 4BFAA 3CHVA 4AWUA 3O07A 3W76A 3W75A 3I6RA 3Q58A 3TJXA 1QR7A 2VFEA 1G4EA 3CIXA 4FIQA 4LVBA 4IMEA 2A7NA 3V75A 3W2KA 2XN0A 3TMLA 2PRHA 2B7OA 2GVGA 1RV8A 4JD4A 3BVJA 3G0SA 1FDJA 1H7WA 3VCRA 5D2XA 2QCCA 1K8ZA 3BLEA 1LBMA 4FNRA 2ZYFA 1ZJIA 3TNOA 3LV6A 2YYTA 1F6KA 3PWAA 3WJSA 3W1AA 3TW7A 3KVKA 3QEZA 3THAA 2A85A 1OX4B 1YXCA 3B0PA 5LSMA 2WKJA 3BGJA 2RDTA 5TIMA 1W3IA 3UXAA 4XTDA 4WZHA 3NPVA 4MYAA 2CLLA 3S8HA 2ZRVA 4JTIA 3JR2A 1ML1A 3PAJA 1B3OA 3TH6A 1JCMP 3R12A 5G1YA 3W7PA 3B0UX 1EB3A 1YDNA 4JTEA 2B7QA 1VHCA 1ZHAA 5HINA 2Y6ZA 2X1RA 1TSIA 5CZ0A 1GVOA 4DQWA 1R30A 2BSLA 4JN6A 1FDYA 3NQDA 2VEMA 1K7FA 3W1TA 5D03A 1KM1A 2CLMA 1WX0A 5D38A 1MXSA 2QCLA 1RQHA 1H7XA 5K9DA 3LI1A 1G6CA 3LRMA 3ZWSA 3HMJG 5D30A 3LTPA 3W1MA 5G4EA 4CLMA 3W2LA 1BTMA 1QO5A 3MO7A 3UY7A 3FA5A 4O19A 1C8VA 4C1LA 4UC5A 4UTUA 1SFLA 3P5ZA 3W3OA 2ZRZA 3I7SA 4I7WA 3QJAA 4XBKA 3W1UA 1HG3A 1Q6RA 2Y85A 4JTKA 4LC8A 2G97A 5D2YA 1YPFA 4X9SA 4UNLA 3CWOX 2WPBA 1FCQA 2QR6A 3W86A 1ICQA 5CKSA 5HR7A 1S5TA 3P82A 3KOFA 3CQ0A 2B4GA 2FQIA 2GOUA 2RKXA 3NA8A 2RHGA 3MP3A 4CCEA 3W88A 1CW2A 4WJEA 1QPOA 3GLCA 3W7EA 4KFPA 1LYXA 3KAOA 4IXHA 4O57A 2Y70A 3S1VA 4JTUA 4UFMA 3TKFA 1D9EA 1C29A 2E6FA 2PURA 3G22A 1SZFA 1O94A 5CPOA 3W84A 5LNRA 5C54A 1QNVA 2TMDA 3GKFA 2E5BA 3Q2DA 3TJLA 4AWSA 2RFGA 1FWTA 2ZDRA 1F76A 1QO2A 5D37A 3EX2A 1EX5A 3LRLA 3ANYA 3PS7A 4MJZA 1ZNNA 4FO4A 4CNNA 1I4NA 3HJZA 5AHLA 2YYUA 3QF0A 5EMUA 1H7PA 2DJXA 4DO5A 4E38A 4JTSA 2NLIA 1XBVA 1X7FA 3LLDA 3UNDA 3W2UA 1SZGA 1JCJA 4L4MA 1GPWA 1H51A 1R46A 2B0MA 3PC0A 1A50A 2IQTA 1MEHA 4YLWA 1WOAA 4OBTA 4UMBA 2NXHA 5D2VA 3LCXA 4MYXA 2C6QA 1YTEA 1VCVA 1IXPA 3QZEA 4QAIA 4FB7A 2GJLA 4XQ6A 1W5NA 2F84A 1GTHA 4TR9A 4WXYA 3WK0A 1W1ZA 1DJQA 3A9IA 5CG7A 2XN2A 4JS3A 3W7LA 3NL5A 2V8ZA 3HB9A 3G3MA 2YCEA 4RX0A 4GFSA 1OYBA 1ME8A 4HNUA 5J5RA 2ISWA 1DOSA 2YW3A 3RNDA 3QQ0A 4LT9A 1O95A 3DI0A 5AOUA 1DQXA 1EUAA 4Y8FA 3IEBA 3HG5A 1VZWA 1XBXA 4O0ZA 1DKWA 1FCVA 3N19B 3M7WA 1M7OA 3HGJA 4XTIA 1YXYA 1OX4A 2NUYA 2DU2A 1GTEA 5AHIA 4CQ9A 1P4CA 3OEXA 2ZA2A 1EA0A 1L6SA 2QCHA 1P0NA 1L6WA 3IIXA 5KINA 4O4VA 1ME9A 3FYPA 1VYSX 1OX5A 1JUEA 4UTHA 4Z0SA 3IRDA 3IIPA 6ALDA 3MYPA 1FCUA 1T0OA 5F1VA 2GVLA 4LW7A 1KM2A 3NQFA 3S5ZA 4ZQNA 4NU7A 2FPYA 1QPNA 5DBTA 3W2JA 1YTDA 3GAKA 5GVJA 3ZS4A 2C14A 5G2IA 4U28A 4PC8A 1AW5A 3E02A 3VNDA 4U4MA 2H3BA 2H3DA 1S5VA 3L0GA 1VLIA 3W7OA 3G8EA 1PHQA 3UWWA 4ALDA 4LV4A 2BZNA 1RPXA 3L2IA 1TV7A 1WA3A 3CWNA 3GAYA 2JGQA 4X3ZA 1DBTA 3NZRA 1BWLA 3O06A 3QQ1A 1Q3NA 1W5QA 4EF9A 3NPUA 4TX9A 1ZFJA 4PH6A 2GUUA 3G3DA 1JUKA 2GVJA 1QOQA 3QW4B 4GXMA 1XBZA 3NOEA 2QJIA 5F4XA 5KZEA 1I2RA 5K7JA 3EXTA 4O1AA 1NF7A 7TIMA 2VFGA 2ZQ0A 1YTKA 2Y7EA 5K2ZA 3DZ1A 2P10A 1W0MA 3RK8A 2QCMA 2VOMA 5AYYA 1XFBA 3LERA 4YCPA 1KLZA 3HG2A 2HS8A 3JRKA 2V30A 2E5DA 3DXIA 3C4UA 5G5IA 3R89A 3KVMA 4UTMA 4N6FA 1TPFA 1VR6A 3G0UA 1TQJA 5FF4A 1H61A 3W7HA 4D2JA 1W5MA 1JQXA 4JTTA 3T4CA 2ZZ6A 4RR4A 4Z08A 2Q8ZA 3F4NA 5K4ZA 1PV8A 4WQ6A 4GUGA 2HSAA 1Z41A 5K9CA 3E0IA 4ZQRA 2AGKA 4O53A 1KLYA 3HQ1A 3V1PA 2A4AA 4AB4A 1UJPA 2X30A 3TSDA 3BO9A 3LBCA 1ZENA 2E68A 1K3UA 3EXRA 1XBYA 3UWQA 4EVZA 5IM51 1KM6A 3C2FA 5DCDA 4K8HA 4HPXA 4YWIA 3M5ZA 4BK9A 4MY9A 5HWNA 1W54A 1N8FA 3A23A 4ONVA 4FX6M 3LTSA 1B57A 1F7BA 1H1YA 4TMCA 3G1SA 5C55A 1FCBA 1RZMA 3HIJA 1TJRA 1SO5A 5C6MA 1KFEA 5DELA 3TIMA 1O4UA 3NQCA 4AH7A 1AW1A 2VELA 3PUOA 1XM3A 3K30A 2EPHA 5FF7A 1Y0EA 1VYPX 1TPB1 2WJZA 3MHUA 4ORMA 3NAVA 5BOOA 1FWWA 3ABSA 4DEFA 5F2MA 4DF0A 2ATMA 3BARA 2DZWA 5KSWA 2FPTA 4KWVA 1Z48A 4C1KA 3HGRA 3EWBX 5CZJA 3DU0A 3IIZA 4JGDA 1NVMA 5EPDA 2ZTKA 2CW6A 2J27A 4R34A 1TV5A 3FEMA 1XL9A 1J2WA 5EYWA 3M5VA 4H6KA 5IBXA 3A21A 3GNDA 3PB2A 3PB0A 4ORIA 4O1DA 3RFAA 3DBPA 1GZGA 2VXNA 2EGZA 1BEUA 3LHUA 2V81A 4I7UA 3HGSA 3PG9A 1F73A 3SW6A 5LHEA 4RKAA 2AAMA 2FPVA 3M1ZA 3LXBA 1XUUA 1F05A 2QCDA 5H2ZA 3IVTA 3TQ0A 3W7KA 1QFEA 3G1VA 5AHNA 1PIIA 5K9XA 4RCXA 1VS1A 3SGZA 2ATSA 2QUTA 2YR1A 4N4QA 3T44A 1I2OA 3G1FA 3NQEA 3THQA 3OHIA 4QSHA 5AYZA 3G1DA 5CSRA 2E5CA 2JKAA 3S6DA 1J4EA 1H7RA 4GJ1A 3BG5A 1OFPA 5C5YA 5AC6A 2B7PA 3TAKA 3TAOA 1TTJA 3GKAA 3W7MA 4HNTA 4E2BA 4O13A 5DXXA 2CLEA 3R2GA 2PRLA 3L67A 5HNRA 3NR0A 1THFD 5SWUA 1EWEA 2NV1A 1JQVA 4KWWA 3DFSA 4JTHA 3FOKA 4AHPA 5CPMA 5G2WA 4FNUA 2Y7GA 2WOQA 4WY0A 3TUUA 1TPEA 4EOUA 2NXGA 1LROA 1SZEA 4GUJA 4R7JA 3C52A 4QQ3A 3LCGA 4IUOA 2WSYA 3S5NA 2OZ0A 5K4XA 1TO3A 4UTIA 3WJZA 4JYDA 4HNNA 4MOZA 4JXCA 3KXQA 2Z6JA 3UWVA 1QOPA 1S5WA 3P5YA 4NJIA 5BNKA 3QW3A 2TSYA 4O11A 3FYOA 2A21A 2NX9A 4O0KA 3I7RA 1EPXA 2A7PA 4IMDA 5LNUA 1FDZA 3QMRA 1H7OA 5FF3A 4A2RA 1A5BA 1W5PA 4B5NA 3TU9A 1A5AA 1UB3A 4LVGA 2YPIA 5DBUA 1UUOA 2QCEA 3BLIA 1HL2A 3DI1A 4POCA 2EF9A 2E77A 3W9ZA 1TRIA 3S5YA 1W3TA 4IOTA 2J9ZA 1ADOA 4LUJA 2ALDA 2NV2A 2YDAA 3NL6A 5DY2A 3W7CA 3LDVA 1GVQA 2V2CA 4RZ4A 3GDKA 3M9YA 1K8YA 2ZRYA 1RVGA 1B4EA 4IPJA 1LRNA 4UIOA 3JS3A 2R8WA 4O16A 4E0CA 4LS0A 3AJXA 3OBKA 2X1TA 4PFMA 3SGUA 2P0OA 3H55A 5BRBA 3O1NA 3VE9A 4PL2A 3NM3A 4O12A 1W8SA 2ZZ5A 3DHFA 1KM5A 3W72A 1E51A 2NXIA 3S1XA 3CEPA 3C3NA 1K03A 4BI7A 2CFFA 2JBMA 4JTJA 3W7JA 4NZFA 4BWLA 1TYGA 5CGQA 1OYCA 3Q94A 4EIVA 3E9AA 4O28A 5I3JA 2G95A 3VFLA 2J6XA 1LLZA 1W37A 3TQKA 1EIXA 2C15A 2PCQA 4XWUA 1XI3A 3M6YA 1SR9A 4G1KA 2YZRA 4MLRA 4DO4A 2V9DA 2X2GA 4Z0JA 3DGRA 4ADSA 1ZCOA 2VFHA 3W2MA 3N14A 1HUVA 1XC4A 1NSJA 4X2RA 5DN1A 1LORA 2YGYA 3W1QA 1FQ0A 1KFLA 2CZDA 3PULA 2Y63A 1UBSA 2I9EA 5AHMA 1SO3A 5D05A 3N3MA 3B8DA 4Y6GA 3B06A 1R2TA 1A5CA 3HG3A 1HO4A 2V5LA 3KX6A 1RR2A 3OIXA 1K8XA 1LOLA 3ATZA 1ME7A 3L5MA 1WQ5A 4S2CA 4FHAA 3EKLA 1A53A 5D02A 2OT1A 5K3VA 3M5XA 3B03A 3LCIA 1S3HA 3CB8A 4EWND 3O6DA 5CPLA 3TXVA 3KHJA 3KRSA 2VEIA 5FEPA 1JCYA 3DH7A 1VCFA 3QMTA 2Q3OA 3GX9A 5EBUA 2TYSA 4LY8A 2W6RA 3FKKA 1VC4A 2R94A 4O10A 2BX7A 1ZAHA 4AHOA 5HMSA 2ZZ3A 4CCCA 4N9EA 2A0NA 4HNVA 3ZWTA 1KM4A 4ZQOA 4UCGA 1PE1A 2DZSA 1IXNA 2DORA 3NNTA 2ZZ4A 5F2LA 3STCA 2BLEA 4E2DA 5ABTA 5EKYA 4O52A 4PODA 1X8FA 2QCNA 4NX5A 1WYIA 1SUXA 2A2IA 3EX3A 1MO0A 4UTTA 5F4WA 3W83A 3QSRA 4K37A 3ATYA 4O1BA 1TTIA 5DLCA 1JRCA 3EWWA 4M5PA 3NQ6A 1KTBA 4K7VA 3G24A 4OWGA 2A6NA 3LCWA 4ADTA 3OVQA 4QJ1A 1OK4A 4P61A 3MI3A 2QAPA 1PL9A 5LNWA 3DFOA 3SY5A 4NVTA 1JCLA 4TIMA 3MI2A 2GQ8A 3NQMA 4A21A 3L9CA 1QPRA 3NPXA 3LHZA 4MZYA 1GYNA 3PUDA 3KRUA 4LRTA 3P60A 4H4IA 4BI5A 4Y90A 2R14A 4QIUA 1LTDA 4K36A 2FTPA 3KFTA 1H50A 2RH9A 4JEQA 4RZ5A 1ICPA 1YLVA 2DZTA 4UR8A 3VE7A 1EP2A 2ZTJA 3FLUA 5D32A 2QJGA 5BMWA 1LBFA 5KMYA 1NF0A 4DXVA 1A5SA 4MIMA 2X16A 5F2GA 2NZLA 1H7NA 1OK6A 2ZZ7A 4UTWA 1GVRA 4IMFA 4M7SA 4O50A 4N9CA 3HBLA 1Z42A 1DHPA 2E09A 3LXAA 3L66A 4ML9A 3UWYA 1GQNA 1IIGA 4UTKA 1G4SA 3LV5A 3STFA 3TC6A 1GWJA 3O16A 1TPDA 1DORA 3M44A 2C1HA 1I2PA 3C8FA 5E1QA 2C0AA 4OHQA 3C6CA 1OFEA 3HO8A 2BTMA 2QDGA 4AVFA 2ISSA 2H90A 5CSSA 3CM4A 1XDLA 4NNBA 5EY5A 3FJLA 5E93A 4X22A 3MP4A 5TQLA 3NQGA 4DO6A 1KTNA 4OE7A 3NQAA 1EWDA 3N2XA 1G67A 2EAWA 1WXJA 2VFIA 3B0VC 4RLIA 4O18A 2ZZ2A 2VFFA 4PL1A 4QM1A 4Y96A 1Q6QA 3GXTA 1JJKA 4NJJA 3NDOA 4AXKA 3W1NA 4K8EA 1M7PA 1IXOA 2JK2A 3A5VA 3LCLA 4CNPA 3HPSA 3TMQA 1AG1O 1YXDA 3UPBA 1MEWA 4N9DA 5LKYA 3W7QA 1L9WA 4DELA 4HHPA 1F5ZA 3SZ8A 1TB3A 2ZA3A 1FBAA 2NUXA 1VJIA 2X1SA 4O4WA 3E49A 3MBDA 4LS1A 5AFDA 4UFJA 3T78A 4IWWA 4HSNA 2HS6A 4NNAA 1FXPA 3EEGA 1QMLA 5AHEA 3NQ7A 3QFEA 3BLFA 4O17A 4Z1CA 2Y62A 1M6JA 3L0NA 4PCFA 3BV4A 1L2UA 5D2WA 1GOXA 5DCBA 1AMKA 3EWUA 4NJKA 2F7FA 4J9JA 4MKNA 3N2MA 4DBEA 4ICNA 3NL3A 3TFCA 3NXFA 1P5BA 5AC7A 3FKRA 1XKYA 2FB2A 4FXRA 4AHQA 5CZSA 1ONRA 4FNSA 2I1OA 3NM1A 3ABRA 1MEIA 3BG9A 3C2RA 3O6YX 1B9BA 2X1UA 4YCOA 3MHFA 3KVJA 1TPVA 2R91A 3PBUA 1KFCA 3QC3A 4H3DA 1UASA 1H5YA 3U6WA 3PR2A 2ZCGA 2A5HA 5HR6A 1GJPA 3EXSA 3A22A 3WJWA 3MHGA 1OFDA 3W1XA 4LRSA 2C16A 1SO4A 1GG1A 1PHWA 2WNQA 3E12A 3PF3A 2OMAA 5L6UA 1GT8A 3DAQA 1GVSA 5LGZA 3N9SA 2H6RA 3DFPA 4UXDA 4BF9A 4QNWA 3CC1A 1T96A 1OVDA 4ZMGA 2E6YA 3L65A 4DPPA 5KTLA 4WOZA 1J5TA 2AQWA 1EEPA 3M43A 1K7EA 3P80A 3VKJA 4WX2A 1OABA 3W73A 3HPXA 1IF2A 4JDBA 1KV5A 3W7GA 3AO0A 3I7QA 3LCFA 4FX7A 4GC4A 4JDYA 3UYCA 4PA8A 1KV8A 2FB3A 4TMBA 1VRDA 4JIPA 1DVJA 3TQVA 3GK0A 2I14A 2CLIA 1TMHA 3DKJA 4CQAA 3BGGA 1TCDA 2Y61A 4LWWA 3NL2A 5HWJA 2CLKA 4UTLA 4A22A 5EA9A 5FF0A 3PG8A 1VQTA 5I3FA 5DXYA 1LLWA 1WDWA 4KFNA 3N9RA 1H62A 4XUGA 3G0XA 3NQ2A 4S1FA 3W7DA 1UCWA 3U2OA 2B7NA 3PBWA 3STEA 3P7YA 2QEZA 4LU0A 3LXCA 4XKYB 4MFEA 1ZAJA 2Q3RA 2QJHA 3OVRA 4K6AA 3R5EA 3DKLA 2FLIA 5LNSA 2J24A 3TDFA 3T7VA 1R47A 1FY6A 4GBUA 3MP5A 5HQEA 1SQ7A 2EKCA 3YPIA 1NEYA 2QKFA 4JYEA 3W7RA 1LOQA 3NYZA 4YXGA 5IBXC 3HF3A 3S9YA 2JGYA 4ZQCA 3LI0A 4NUWA 2P1FA 1FWNA 4IXXA 4DF2A 3G18A 3WJXA 3O05A 3UZJA 2NWRA 5AC8A 2WNNA 3FS2A 4IX0A 4UUIA 1VGAA 3N34A 4JYFA 1R2SA 3GIYA 1HTIA 1AW2A 3W2NA 1I45A 2A6LA 3W6YA 2O7SA
chains in the Genus database with same CATH superfamily
4A6GA 3NPWA 2G4FA 1G69A 2XSBA 4O1FA 1GK8A 3GD6A 3QY7A 3NVTA 3ARVA 3M47A 3CWHA 1H41A 1TPC1 1TJPA 2W3ZA 1BG4A 1XV8A 4Y9OA 3L68A 4KT2A 4XUYA 3H23A 3MT1A 4A2SA 4QRNA 4PMNA 3E5PA 2PF0A 3DFTA 3M07A 1J93A 5BXRA 3C2EA 2BBFA 2ZIDA 4N6EA 2BVTA 3C56A 3WDHA 2D24A 4R7OA 1LRQA 4MFDA 3H2FA 1TRDA 1VIZA 2GDQA 1NQKA 4B5UA 3ARRA 4OTKA 1W5OA 1GKPA 2QNEA 3GM8A 3MV11 1ECEA 1KBJA 3HFYA 1PTGA 4W84A 1HJVA 2GJNA 1B0IA 2DUXA 2DH3A 3NIYA 1OFRA 3NWRA 4NXSA 3RR1A 1QHOA 4EF8A 2YBTA 1Q7QA 2XVLA 4LUIA 5T9BG 3QPZA 4PEKA 3GXDA 5C8BB 1P0EA 2YCKX 5D09A 3LHYA 4PMZA 3H54A 3QZAA 2XWEA 4AD3A 1QWGA 4LSBA 2BXVA 2O56A 3QRHA 3H7UA 4GVIA 2NX1A 3DYOA 3BURA 3MMDA 2BY3A 3I3BA 4FOJA 1DJGA 3B04A 1J0ZA 5HWMA 3TYUA 3SQMA 2X8RA 4IQLA 2H9AB 2XSXA 3DHUA 1SFJA 3P74A 3GR7A 4MZ8A 1IWBA 4MY1A 3BMXA 1KRCC 3R8RA 4J1OA 4D72A 3D46A 3RUBL 3PNUA 2QJMA 4CNUA 4K7YA 1T99A 1F07A 4Q4PA 2QZRA 1M5WA 4JFWA 2YFNA 3WBWA 3DENA 4RE2A 3FFSA 3MSDA 4AY8A 3J7HA 3W70A 4B9ZA 2WC7A 1LRTA 3VNKA 5CH9A 1LZOA 4GACA 1TIMA 4YJ5A 1JXKA 4LTSA 3U48A 3GYEA 3SIZA 3TNBA 5I3IA 1J0IA 4IHCA 4DYEA 3S1UA 4BWLC 3PM6A 3K4DA 1ISYA 3AISA 2XH2A 1PJ9A 4QLKA 5FJPA 3UPWA 2G8ZA 3QLLA 3XISA 3UFYA 1JR1A 3IACA 5DT7A 1MSSA 3P84A 1LT7A 6A3HA 3TXZA 4RW5A 4DZ5A 1YKWA 3SUSA 3N04A 4HIBA 4DM1A 1EJ7L 1PYMA 3SECA 4XKYA 2DZUA 1TV4A 2QUVA 1VFSA 3LPFA 3TYCA 1B1YA 4UMCA 5HNTA 1HKIA 2PLKA 2YX0A 4QSFA 4HVXA 1Q6OA 2WSKA 2V2DA 4BQ2A 2E6AA 4QJ3B 3VD3A 1VPQA 3SY1A 1YDVA 3PVFA 3GDLA 1YPIA 3L21A 3D3FA 3C0SA 2BOEX 4M81A 4NX0A 1OSEA 1XH1A 4NZ1A 1ECQA 4M19A 3WH5A 3P67A 1SZNA 3UY8A 5G4WA 3RGTA 2C13A 3LENA 2PU0A 1MZHA 1TZZA 4J3SA 4LF1A 3WLRA 2OSWA 3GDTA 4IF2A 3WK2A 3T05A 1MDLA 4HT3A 4S2BA 2QDHA 1R2RA 4LPCA 3LHTA 1FWAC 2WJEA 1KGUA 2J88A 3T9PA 3HQPA 4HNOA 1EH9A 3R94A 3BK0A 4XD6A 3RDKA 5HJLA 1FWRA 1XDMA 3TR9A 1Q45A 2Z0IA 2CC0A 2Y2WA 4IPPA 4ROQA 4DUOA 2DVXA 4H7VA 3ECQA 3KZSA 4KCWA 1SW0A 2GWNA 3H7RA 3GHTA 3AMKA 4W85A 2Y89A 2VX7A 4HYWA 1A4MA 1I2QA 4GUIA 5EMKA 3S2CA 4AF0B 1IZKA 4E8GA 4QG8A 3VIGA 3U4AA 1KKOA 2WJDA 4PCPA 1WBHA 5E6YA 1FWDC 2VEKA 1UH4A 3VDBA 3FYYA 5AN7A 1K9DA 5D33A 1US2A 2H8ZA 2GQ9A 1JUBA 3W85A 3MA8A 4J3XA 3CV1A 1ZGDA 3MMTA 4FR6A 1RK6A 4MADA 1D8CA 4GCXA 1W56A 4ROPA 2EJ1A 2Y88A 2OSYA 4PUWA 4WY0B 4U5IA 1XUZA 2VENA 1FVPA 5A8MA 4HA4A 4PR4A 3KRZA 3AMGA 4ZA0A 1J0HA 3B4UA 1DTUA 1HKJA 4HJWA 3GTIA 4Q32A 3RILA 4A3RA 1V02E 1HZYA 2RUSA 2NWSA 1IGSA 1WO2A 5DMYA 3W26A 1L8PA 1Y8BA 1T5AA 2CITA 4KEVA 4RV8A 4IL2A 1CI1A 3S6TA 4CGTA 2WJFA 1GG0A 3MKVA 3WMSA 5JU6A 3M16A 3U0HA 2J77A 4FPSA 3GNPA 4OOUA 4UMAA 4GUHA 1GYLA 3UWZA 3I3EA 1MNZA 3GFXA 3ZT7A 3CBWA 1OG0A 4Y9AA 2QAFA 3GQYA 1UKQA 2WVUA 3RLUA 3WDPP 2XWDA 3A24A 2WSRA 2YOCA 4EWJA 5EMJA 1RAKA 2E9LA 5A95A 1FXQA 4Z1BA 4C5YA 3Q67A 1UH2A 4O8RA 1R9YA 3QH2A 1TPH1 1CGTA 2Z00A 3CO8A 3AZSA 1Q6GA 1Z44A 3G1RA 2DVUA 5L9FA 4NXKA 1O5XA 3IJ7A 1OGBA 1C9DA 3JZEA 4LOCA 3EPOA 1YDYA 1Q66A 4WVXA 4ECLA 2YCLA 2P0IA 3SCUA 3TV8A 1SYTA 4CNOA 4ZTYA 1BWKA 1OC7A 2YA2A 3HZ3A 3VOCA 3UQNA 1KM0A 1P43A 2DP3A 2WNZA 4I5RA 5FESA 3ELFA 3TSMA 3GB6A 3GIQA 2WO5A 3OA3A 3BLKA 4NI3A 2OXNA 3SJNA 3L4VA 4Q4KA 2UWFA 4QDPA 1UD2A 3F1QA 4Q8QA 4ZZ9A 3MY9A 1UA7A 3T0AA 2P3ZA 2ZX9A 1LOSA 5I79A 1DWJM 4NG3A 2Z2AA 1DJNA 3GR8A 3KDNA 4FIRA 4Q8NA 1I2NA 3T0BA 2YXGA 4F0HA 3DOPA 1RD5A 2W0UA 4GKLA 4ZSTA 3WIJA 1EDTA 4AU0A 4RW3A 5I2UA 4LS2A 3RU6A 4LNYA 5HA7A 4A35A 1QNSA 3O15A 1EL3A 2NQ5A 2FGLA 2EPMX 4CNTA 4IMAA 4AF0A 2R1NA 4WDUA 4EXQA 3PP7A 1KBIA 4NZ5A 4WUIA 3KBWA 1E70M 2V5DA 5HJYA 2VFDA 3WNKA 3P0XA 2HV5A 2C8NA 3VNJA 1XF0A 3C2VA 3PY2A 1AL8A 3VMNA 4G56A 4PUKA 1X6UA 2OG9A 3UZXA 3CZ8A 3NZ1A 4PB5A 2D1ZA 1EQPA 3BJSA 4BR1A 3B40A 5LIXX 1NELA 3CHVA 2GGGA 2HCVA 4BQ3A 3I3DA 1DJHA 4PBEA 4EANA 2J79A 1RY8A 3L7RA 3TMLA 3GTHA 3IUDA 1FDJA 3MPGA 5D2XA 2OU4A 2QCCA 1K8ZA 2CXGA 4FNRA 4DWSD 3VGHA 3TYZA 2Z7KA 3U5UA 4V1YA 3CV2A 3XINA 1VAHA 5BWFA 1ITQA 1US0A 3TW7A 3KVKA 3QEZA 4J35A 3OLGA 1XD0A 1YXCA 4XO6A 3BGJA 3WNPA 4Q3MA 3EWDA 4MYAA 4F0KA 4CEXC 3AMLA 3V4BA 5G1YA 3W7PA 3B0UX 3R4IA 4JTEA 1VHCA 2FYMA 5IDZA 5HINA 4M29A 3B8WA 3KBJA 3SSZA 4PZVA 2GZXA 1HL9A 3GG8A 4PUJA 1AMYA 1G1YA 4JN6A 3HMCA 2Y4SA 4K2SA 3CL7A 4W8BA 5D03A 5CPTA 1IEIA 1KM1A 1WX0A 1RY0A 1HKVA 2WNWA 1OGGA 2HXUA 3THCA 1IR1A 1ZBVA 5G4EA 1J10A 2HRWA 1GKRA 3W53A 1FWCC 3MO7A 4GO8A 1E4NA 5BXTA 1IEXA 4NZ3A 4REQB 1YEYA 4UC5A 2GJRA 3QV8A 4DX3A 2ZRZA 4XBKA 1Z69A 2PLJA 2Z25A 3R10A 1Q6RA 4JTKA 4MB1A 1FCQA 1ICQA 3E0WA 1M68A 3AUJA 3UJFA 1M53A 3KOFA 1B3ZA 2FQIA 3NVDA 7ODCA 2RHGA 3OZYA 4CCEA 1E6XM 1WXZA 3KAOA 3ANUA 4IXHA 3OB8A 1WPCA 1E5JA 3SO7A 1OM0A 1C29A 1R3QA 2E6FA 5JIPA 3W84A 2O9RA 2PDBA 2VGFA 4Z2GA 3TOPA 2V63A 5E6ZA 1EX5A 1UKTA 2DT0A 2Z1XA 1BD0A 1D2KA 3AHXA 5C9RA 3VDHA 1W2VA 4YTRA 4QLLA 1E0XA 2CBUA 4P7OA 3R6IA 5LIUX 4FP1A 3LLDA 1EOKA 3UNDA 2YB1A 3WF1A 4D6HA 3F4VA 1JCJA 4CUCA 1R46A 4CQCA 3E2SA 3QXBA 3REQB 2IQTA 1SJBA 4YLWA 2MNRA 1WOAA 2NXHA 3WEZA 4EKJA 1MQPA 3LCXA 1QK0A 3WQ5A 5E70A 3QZEA 2J4GA 4WDWA 4B15A 2V67A 2F84A 3A9IA 5CG7A 4DZAA 1DHKA 5DEZA 4QBXA 4E4PA 2JIEA 3SIMA 3NL5A 4HCDA 2PDGA 4RX0A 5A6SA 3WQFA 2AL1A 1O5RA 4GFSA 1EPVA 3R8HA 2V5JA 2GFTA 5H8MA 3HV9A 1F8IA 2ISWA 3PWIA 3ZXWA 1DOSA 2OQLA 2VEGA 3QQ0A 4UCFA 1XLEA 1O95A 3DI0A 1EUAA 2DDXA 5DMMA 2ZUNA 1XBXA 4PMVA 1V0MA 3HGJA 1GOOA 1QW8A 4H2CA 5AHIA 2IKGA 1P4CA 2DIJA 1W1TA 1O1ZA 2ZC8A 1KRMA 1P0NA 2QDEA 2PD9A 1ME9A 3WQEA 3VK5A 4UTHA 6ALDA 2XFYA 4QFUA 2XPKA 4BHYA 1C92A 1DWAM 7PTDA 5CZKA 4F66A 1YTDA 2WZIA 1FP9A 3I10A 3TYAA 4I9JA 3OPSA 5IHSA 3VNDA 4F0LA 4C6JA 2XZ9A 3QR3A 4GI4A 3G8EA 2BDQA 3UWWA 3S83A 1VJSA 4LANA 1TV7A 3G6LA 2UZ9A 1C8XA 2GYIA 2JGQA 2VJXA 8A3HA 2O0TA 3QQ1A 1Q3NA 4TTUA 4REQA 4LUTB 3A3WA 1EIBA 1JUKA 2GVJA 1QOQA 1WXYA 5C9ZA 3N2BA 4LEFA 3N2CA 1XBZA 3NOEA 1R6WA 1A5OC 1CCWB 5KZEA 1I2RA 3SM0A 4DO7A 5K7JA 2ZUWA 2DV0A 2HXTA 3NEHA 3SCVA 2POTA 2ZQ0A 1YTKA 1E5NA 5K2ZA 1XYCA 4QS6A 3RK8A 2QCMA 5AYYA 5BWAA 2WK2A 1UWRA 4EX4A 5BCAA 2HS8A 5TNVA 2ZUVA 3KVMA 1JYXA 1FP8A 4N6FA 2PU1A 3H21A 2PWUA 1VR6A 3G0UA 1JAKA 3HN3A 1M9HA 1H0GA 4JTTA 3M7SA 4Z08A 4AZCA 5IRPA 3F4NA 5K4ZA 1EJVC 4GUGA 1XGEA 4EPBC 1SMAA 2PODA 2R1KA 4ZE5A 5HATA 2A4AA 1MXGA 1C90A 4AB4A 4S39A 4JZ5A 1B31A 3B8UA 2CKRA 2BVYA 2E68A 3N15A 1K3UA 4GBDA 1TELA 2OGYA 1UWQA 3TCSA 4K8HA 2WC3A 3M5ZA 5HWNA 1W54A 1XLKA 4JIHA 3POHA 1RP8A 3BJFA 4GKTA 4Q8UA 2ZE0A 1V6XA 1FCBA 5HBFA 2DSVA 3HIJA 3U5YA 5J8LA 1ZBWA 3OODA 1KFEA 2DEPA 1RJRA 4V28A 3REQA 3T07A 3PUOA 1UZ1A 4S3BA 1R3YA 1U33A 4CEUC 2WB5A 1H09A 1TPB1 2WJZA 2J7DA 5BOOA 4EP8C 1M01A 5F2MA 4F2BA 4M1RA 4YHGA 2PDCA 1UR2A 1Z48A 3HGRA 3EWBX 1OZMA 3IIZA 5EPDA 3MKCA 2BGSA 3VCNA 1J8VA 1U5HA 3SURA 5EYWA 4ZOBA 5M1TA 5IBXA 3DG6A 3GNDA 3R7MA 2IPWA 3LLXA 2VXNA 4IQJA 1V6WA 1A49A 3L2LA 4W87A 3DIPA 3SBFA 1TZ7A 4RKAA 3A3XA 3V0TA 3M1ZA 3T42A 2QCDA 3ARWA 1QFEA 1UKOA 1JIBA 5AHNA 3SQSA 1PIIA 3U7VA 1E0VA 2ATSA 4CD5A 2YR1A 3MS8A 3NQEA 3THQA 1XLFA 3OHIA 1S2AA 5KETA 4MNMA 2X42A 4B16A 3ITYA 1N2VA 1UPPA 3G1DA 2JKAA 3S6DA 2E3ZA 1OFPA 1V0KA 4E2BA 2PWHA 5DXXA 4S3FA 4PRRA 3L67A 5A6BD 2Q71A 4UQBA 4C7GA 2IPGA 5CPQA 2A3AA 1BLIA 1WZAA 2Y7GA 2WOQA 1VBRA 1R86A 1J2BA 3TUUA 1Y65A 3CPUA 4B5TA 1TCMA 4JEJA 4QLJA 4FLRA 4BQ5A 5EB8A 4S3DA 4LUTA 2WSYA 1E9ZB 1CZ1A 5K4XA 4L7ZA 1TO3A 4JYDA 4HNNA 4MOZA 1EKOA 8CGTA 3H4XA 2Z6JA 3UVAA 2ANUA 4X63A 2NQJA 3WNLA 1IE7C 5HMEA 5BNKA 1PUDA 4H9MA 1P48A 1UR0A 5JXQA 2A21A 3H8AA 4O0KA 3W02A 4IMDA 5LNUA 3QMRA 4HCLA 2IQDA 4A2RA 1V77A 1UD6A 3UETA 1W5PA 4U5KA 4B5NA 3TU9A 1UB3A 2AKMA 3E1F1 4POCA 1ZCCA 3RMEA 3WQVA 5I0DA 3S5YA 2W4XA 2OWCA 2J9ZA 3VGDA 3KOXA 4QR6A 2I7GA 1K8YA 2ZRYA 4IPJA 4HMNA 2D23A 3M0LA 4A3QA 2IMRA 1VEOA 3KRBA 3H2OA 3VE9A 5C0QA 5BYWA 5BXSA 3AHYA 4AX6A 4TVUA 2NXIA 1YIXA 3C3NA 2CFFA 1TYGA 4EIVA 3Q94A 5AKQA 3LMYA 2BMBA 2Y8VA 1CXKA 3VFLA 4L80A 3WNMA 1MQRA 2J6XA 5CG0A 1SR9A 5I23A 1XLJA 4QGCA 4ADSA 2VFHA 1CGVA 3CIVA 5BOEA 3ABZA 1OY0A 3PZUA 2GJPA 3CS2A 1KWKA 5B7YA 2Y63A 3B8DA 4Y6GA 1R2TA 3HG3A 5EFDA 1DJWA 1RR2A 5DO8A 2Y8KA 1LOLA 2PWEA 5ABGA 3A4AA 4XZNX 4S2CA 3KTSA 3EKLA 5D02A 5K3VA 3THUA 5C7VA 4AY1A 1FTXA 4KWUA 3PJTA 3O6DA 1ZZMA 3KHJA 2VEIA 1RHCA 3KRSA 5FEPA 1VCFA 3UF9A 1AH4A 2Q3OA 4LY8A 3FKKA 5CPSA 4F0SA 1UG6A 2VX5A 3RXZA 3I6EA 3W29A 4B5SA 3K4WA 4N9EA 4YTSA 1KM4A 3WDRA 3HU7A 2DZSA 4ZXOA 1DWIM 5F2LA 2BLEA 1QNRA 3FGCA 4J2MA 2X0SA 5LXXA 1V93A 4E2DA 5ABTA 4PODA 3W28A 1QOXA 1VBJA 4B5VA 1MO0A 3BAJA 3ATYA 4J5NA 4O1BA 5DLCA 3LQLA 2GJXB 1VKFA 2VTFA 4C6DA 3AC0A 3LCWA 3NDZA 1AQ0A 1MDRA 1TJ1A 4QJ1A 1QXLA 4BKNA 2YCIX 1HN1A 2PD5A 2WMHA 1Q7ZA 3CUZA 4PTMA 1N8IA 2W63A 2P8CA 2R1LA 1TIWA 2GSHA 4A21A 4UOJA 3KS5A 1R38A 2JF7A 3VMOA 4QG9A 3KRUA 1GKQA 3WLKX 3O9NA 3ZT5A 3B8TA 3AZTA 3S9IA 1PEZA 1Z6KA 3NSXA 1U5VA 3TTOA 2FTPA 3KFTA 4JEQA 2Z1SA 1ICPA 4L5ZA 4JAWA 2DZTA 4UR8A 3VE7A 1TR1A 2XH0A 2NQLA 1LBFA 4IIFA 4DXVA 4MIMA 1H7NA 1MNSA 4HU8A 1GVRA 2CXEA 2CPUA 4N9CA 1B9ZA 4JNZA 4IFOA 4UTKA 1G4SA 3TC6A 2Z24A 1TPDA 2HNHA 4J3WA 5KEZA 3M44A 1I2PA 1OFEA 1YE6A 3WF4A 5HQLA 3CM4A 4E2OA 1JYVA 4NNBA 1MW2A 4WGHA 1EZ2A 4X22A 5TQLA 1S46A 3TLLA 4WKHA 1I1XA 2RAGA 4RLIA 1UBPC 4PL1A 4QM1A 5FIPA 3B9DA 2ZDSA 1EC8A 1J79A 1ZBCA 3NDOA 4MG4A 4AXKA 3W1NA 1IXOA 2JK2A 2PTXA 3UJSA 3HPSA 5FACA 3TMQA 4DJDA 3OJGA 2HPMA 3MQTA 1F5ZA 4PRWA 2XU2A 4EAYA 1V7AA 3Q45A 2X1SA 4LBRA 3MBDA 4ERAA 1GQIA 2VGBA 1RK5A 3CHEA 1UA3A 3KBSA 2MUCA 4M80A 4KESA 4WKAA 3EEGA 4Z1CA 1A3HA 1PWLA 3O3RA 3BV4A 2OX4A 4JKLA 1AMKA 2EPLX 5I07A 3VGFA 4NJKA 4JNYA 5M17A 5CJ5A 1ZBKA 1LJYA 3NXFA 2PTWA 3MMUA 3CK5A 5EMMA 3FKRA 4DNMA 4AHQA 5CZSA 4DZHA 1ONRA 3P3BA 2FZ9A 3ABRA 3BG9A 1B9BA 2X1UA 3G2GA 1E72M 3U6WA 4Q4OA 3VIMA 3VZYA 2ZCGA 3EGJA 3HM7A 3WJWA 3ZLGA 1XP3A 2IKIA 1KFWA 2XFRA 2WNQA 3E12A 2E40A 2VRQA 3DAQA 4GINA 1GVSA 3SCWA 1JAEA 2J7BA 3CC1A 2A3LA 2AQWA 1EEPA 1VF8A 3LQGA 4YWSA 2AQVA 2XIBA 3VC5A 1IF2A 3MSYA 2VHLA 3P2VA 3UYCA 4NP7A 4TMBA 2I14A 4AEFA 4IIEA 3BGGA 2GJXA 2Y61A 3GUGA 3LK6A 5HWJA 2CLKA 1Z7AA 5FF0A 1IQ8A 1EGMA 1QRQA 4LF2A 3VIFA 3G0XA 1O66A 3GR4A 2WHLA 4K1GA 3VX0A 1UH3A 4Q6JA 1PX3A 1LQAA 4WSJA 2FLIA 3U57A 4N7QA 1FY6A 2NSOA 2OWXA 3MP5A 5HQEA 3PANA 1FWGC 2EKCA 2F38A 1V6YA 3W00A 4IGSA 3NYZA 1UOKA 2JGYA 3VKKA 1QT1A 3LI0A 2FMOA 1F61A 5DFAA 1ENUA 1FWNA 3C0LA 1GHRA 3UZJA 3P0WA 3EA3A 3N9KA 1R2SA 3LSBA 1HTIA 3PJXA 2A6LA 4GX8A 2RJHA 3DFHA 1WAUA 5C7HA 3HJEA 2WCSA 2DJLA 2O4MA 2WSQA 1UIPA 3KTXA 3ZSTA 1PIGA 3UZ5A 4G5DA 3ICJA 4DY1A 1BKSA 1NAL1 3CZLA 3PBVA 9XIAA 3BZGA 1QBBA 5D4YA 2FDSA 1DP0A 1WBJA 3MW7A 4FF5A 1TG7A 2E9BA 4FR1A 4MZ1A 2D2GA 5GPRA 1K6WA 1T8XA 4OQVA 1V6VA 3BQ6A 2B81A 4LC6A 4GNKB 3SCQA 2NSXA 1QI3A 3QPYA 4IMCA 2VQTA 4JICA 3BCJA 2OO6A 3G1XA 1B5TA 1Z3NA 4HN4A 3H2EA 3PZ9A 6PTDA 5JVLA 1U5JA 3WH6A 4JX6A 4GFIA 2VUYA 3IUIA 1KTCA 1QPQA 3N4AA 1Q6DA 4GXPA 4PTVA 3SN1A 5KITA 3NGJA 4U33A 4A8RA 3M0VA 4D8LA 1XPGA 2P88A 5CPNA 2ZUMA 1EJWC 4M6QA 1A0EA 4DJFC 2XDFA 2C7FA 4RXGA 1EC9A 1TTPA 3OZMA 3GSMA 4CCZA 1WP6A 3G1YA 2PSNA 3WD3A 3KVLA 4GH1A 3CPRA 2ISVA 2O7QA 2VZOA 2WZHA 3WENA 1IIHA 2J47A 3N18A 2WANA 4WXZA 3VPLA 3EWXA 3VIOA 3V36A 1EBGA 5FSDC 3EB2A 1F6YA 4GOAA 3WMCA 4F0RA 3RAOA 2RGLA 5I03A 4IJBA 3SEPA 4FF7A 2G3NA 4G9PA 4HD5A 4OIFA 4ZFCA 3EOEA 1T40A 2Y7FA 1BG9A 4XISA 3UYIA 3IK2A 1AFSA 2VOTA 2ZBTA 3LTYA 1JDCA 4YMZA 3ERPA 2BXYA 3L4XA 2CHRA 1F74A 4WF7A 1RUSA 3WF0A 1NOUA 2BHYA 1W1B1 3FX4A 4L6OA 1XS2A 4FX8A 1E6NA 2YLLA 3VA8A 4IIDA 3V35A 2HBVA 2AMGA 4AZ5A 2Z1BA 1LBLA 4PBFA 1O6IA 1IT8A 1FHLA 3TX9A 1JRBA 2WAGA 3DHPA 1VCGA 2OZTA 3QLDA 1BQGA 4TVDA 3ZVIA 1AZ1A 2CWNA 1E40A 1V08A 4H2HA 4ASTA 2B31A 1OFAA 1S2WA 3L4UA 1GEQA 1YADA 4BI6A 1NJJA 3K4AA 5FCZA 3HV8A 1V4YA 2OX1A 4QNEA 4WY0F 3B9AA 4M6UA 4MGGA 1ZP3A 1JXJA 2X09A 1PBGA 1FUYA 1WDPA 3HPZA 3BAIA 5CQ1A 3O0FA 4FOKA 1IV8A 4W9TA 3VUSA 3TN6A 5FEXA 4DWSB 2GPTA 4XB3A 1TUXA 2HISA 3MYOA 3WUEA 3GZ3A 2UV8G 4AZGA 1WOBA 3IV8A 3N6HA 4EPKA 3BLDA 3CHDA 4IGHA 1W32A 3B0YA 3BOXA 5GJNA 4CQ8A 4HQVA 1ELSA 4LYRA 3RRXA 2ZFAA 3TQPA 5CC5A 4NF7A 1QHZA 1VB9A 2VDHA 4I5XA 1MRAA 1RBAA 2G3JA 2KX9A 2ZX6A 3UU0A 1K8CA 3AIVA 2VYOA 2BFGA 3LUTA 1I1WA 2C1IA 4UTTC 3URAA 3VKAA 2H8XA 1LP6A 4Q8MA 2HDJA 2J8FA 2REQA 1OD8A 1HP4A 2HPIA 4JPGA 3L5AA 2YL6A 2OFJA 4XX6A 5T26A 3DUGA 4Q22A 3LZ3A 3O6CA 1BAGA 5A8GA 3FJ6A 2R1MA 3M0HA 3TOYA 5AECA 4QISA 2PP1A 3CTLA 5MF5A 1XLBA 2YJQA 2EG7A 4JBRA 4GK8A 4LAUA 5DY3A 2WCGA 4UFKA 3CH9A 4W93A 2PLCA 2V3DA 3URNA 3W87A 1EUNA 1X39A 2QYGA 1T8QA 3GXPA 5AYXA 1PKMA 3C2OA 2XGIA 2YSWA 2FH8A 1DYSA 1A0DA 3MBFA 4LVFA 4V2XA 2FZBA 3FHQA 4P2VA 4NL1A 3W1PA 2OKTA 1RJQA 2JKPA 1TREA 4O14A 3UD6A 3NEVA 1JCNA 2WLYA 2D0GA 4NHVA 3KLLA 4OV9A 4LH8A 2BHZA 4KRUA 2WCAA 2ZRUA 4HU4A 3WQOA 3IIVA 4DJED 1RQBA 1OF8A 3RJYA 2WMGA 3LHWA 3UBPC 2I5QA 3CL8A 2V5BA 2ICSA 4XZLX 1O60A 3TCEA 1OFQA 5C70A 2DZVA 4YU1A 3EMZA 3EX4A 3DESA 3ZMRA 1WNOA 3PZQA 1IXQA 4MNJA 5HDRA 1WUFA 1S2VA 4ENLA 4QE5A 2VD9A 3GS6A 3BTNA 3CU2A 5I3HA 1CX9A 4NJGA 3RLVA 3SCTA 3IS4A 4CNSA 3EA2A 1HF6A 4MLJA 4ZQMA 1R7AA 2WSPA 1TPUA 1WUEA 2ZX5A 3F4WA 2BWGA 2BS9A 1K7XA 3EX6A 4M6VA 3FXYA 2ODOA 4AVNA 3QSTA 2VCCA 4D6FA 3S5SA 1POJA 4DBDA 1SW7A 1I0DA 1EXBA 1JYWA 1UMYA 2VC6A 3TA6A 1HFBA 1ZLPA 3WQ4A 4JL2A 3UWUA 4JHMA 2XZ7A 4AUBA 1JI1A 5HJXA 1M7JA 4DWSA 1YX1A 2Y5JA 3KLKA 1GORA 2UY2A 2ZXQA 5B7ZA 4YNGA 4UTJA 3MMWA 3L5LA 5MHBA 2DZPA 1GVFA 4MB4A 4QEEA 2G3IA 3EMCA 4CCDA 4YVPA 1BXBA 4MJMA 4NJHA 4XBSA 2XVKA 4PUMA 4MY8A 1OF6A 1A5UA 1G7VA 3TW9A 4WD0A 4NIRA 2XIJA 5EBAA 4GC3A 8TIMA 4A3UA 3S2JA 4NRSA 1OFOA 3T55A 4YTTA 2FVMA 3FAWA 3WQDA 4UFLA 4IX2A 4Q4SA 3W27A 4AZHA 2A7RA 4DUXA 1B30A 5I02A 2J6VA 3BW4A 2JFEX 3APYA 1V0NA 3LLFA 4MDPA 3O63A 4ZVJA 1DXFA 4R53A 1GEHA 3RHGA 1DJZA 3N73A 5AC5A 3HGOA 1ZL1A 1IEWA 4JFVA 2VRJA 4GE8A 3LOTA 1U1UA 4R33A 1F6PA 3MJYA 2NVCA 7A3HA 3PSWA 5U4NA 1HIZA 3R13A 4D6EA 1DJIA 1BGGA 1QU4A 2OEJA 2QUUA 4XZWA 4O1CA 3A3HA 4NAEB 3SR7A 1CECA 1LCOA 1GJUA 4OJYA 1OGSA 2ZKMX 5LA0A 1J0JA 4JY9A 2DT2A 3ABQA 3K1DA 2ABBA 2WV8A 4ES4A 4QITA 3GY1A 3OU8A 4N9BA 4YIWA 3OA5A 4XAFA 3K8MA 3IJ9A 1E6RA 3S1WA 4FXFA 3LRKA 3GXMA 3AIUA 1KFJA 1JL8A 1F2JA 4MF4A 4HHMA 3BAXA 3PJUA 2YDRA 4LVDA 4N42A 4QAWA 1W17A 1RCXB 2ZXAA 2FZNA 4BFAA 4AWUA 3O07A 4MJ2A 3W75A 2WVVB 3I6RA 3WLNA 3TJXA 1JZ8A 4IICA 4PSPA 2VFEA 1G4EA 3CIXA 4AD2A 3LG3A 2XN0A 1A4LA 2PRHA 1IHIA 3G0SA 1H7WA 1EOMA 3BLEA 1LBMA 2I17A 4AEEA 2XIIA 4CN6A 1TWIA 3LV6A 4IP7A 1PDYA 3FCPA 2VRKA 4HNCA 3W1AA 4HMEA 5I09A 2WKJA 4B3KA 1W3IA 1XICA 2ZXDA 1E4IA 2OLSA 4WZHA 3S8HA 1ML1A 3MCNA 1WDQA 3MDUA 1LT8A 3QV7A 3TH6A 4P8XA 1TZ9A 4Q7BA 1O7AA 3NJ3A 1B3XA 4ZFMA 4PE8A 3WLJA 1XH0A 1BHGA 2Y6ZA 4GY7A 1EBHA 5CZ0A 3UR2A 2PGWA 3ARXA 3BWWA 1BWVA 1XLCA 1LG1A 1C93A 4W86A 5HOSA 5CC7A 4W8LA 1S1RA 1Y5VA 3AIWA 4JL1A 1D3CA 3M6DA 2CESA 1GQKA 2QLYA 5K9DA 3LRMA 4H83A 3LTPA 3W1MA 4CN1A 5H8PA 3UG4A 2CEQA 4CLMA 1A5MC 5A2CA 9RUBA 2VR4A 5E9AA 1RP9A 1GVIA 4DVOA 4XD4A 2EPNA 3U3HA 5A6TC 3A47A 4KW2A 2C79A 2CLPA 3QJAA 3FJNA 4AIBA 1XG4A 3GTFA 2DGAA 2Y85A 4LC8A 5D2YA 1BQCA 1MUCA 2G97A 5BZAA 4AG0A 4UNLA 2QR6A 2FVLA 1S39A 5CKSA 3AI0A 3GVWA 5HR7A 4S3JA 3CQ0A 1O68A 3FSUA 4J3ZA 4D6JA 2Z4GA 1XD1A 4JCMA 2GOUA 3NA8A 4A8LA 4UQAA 1DE5A 1V3IA 4GYFA 1Y5XA 1TVPA 4WJEA 4ZR8A 3PZNA 3W7EA 4KFPA 3B9EA 3RM4A 2Y70A 3SUWA 4GIEA 3VDGA 4JTUA 2VZUA 4UFMA 1ITCA 3QOKA 4OUIA 2PURA 3G22A 1AH0A 3VUPA 5LNRA 4L9XA 2SFPA 2WKLA 4DAIA 2TMDA 2P50A 3GKFA 1ZRQA 2Y8UA 2RFGA 4DLFA 1FWTA 1QO2A 3OYZA 2VX4A 1GOMA 3LM3A 3T2PA 3ANYA 1ZS2A 3PS7A 4MJZA 4FO4A 1I4NA 1AJ0A 1GQLA 4C1NB 3QF0A 2GK1B 5EMUA 1H7PA 2QUMA 4DO5A 4HA3A 4F9JA 5DMLA 1PZ3A 2X2YA 4NAEA 5CJNA 2XHYA 3W2UA 3GYCA 4L4MA 3GG0A 4C6IA 4B4FA 1H51A 3KTCA 3NO3A 3GBDA 3AXHA 1WKFA 3CLWA 3VMPA 1AZ2A 4PMYA 2QUNA 1WDSA 3ES7A 4AYGA 4FB7A 1GTHA 3JVAA 4FOUA 4TR9A 1DJQA 3PTQA 3B8IA 4JS3A 3W7LA 2V8ZA 2WVVA 3G3MA 4ICCX 5A6LA 3ZVHB 1OYBA 1ME8A 3AMDA 1W9VA 1AUSL 3GXIA 1XSKA 5CSUA 6XIAA 4GLEA 4HA1A 5LA1A 2QMKA 1ITXA 4D71A 1XIIA 5FOOA 1QI0A 3M7WA 4XTIA 4C90A 1PAMA 1R85A 4Z42C 3B8VA 1EXPA 2ZA2A 3S3GA 2JF6A 1KCZA 5KINA 3WDJA 1FRBA 3FYPA 1VYSX 1H1NA 3GC2A 4XD3A 3IRDA 3IIPA 5HK4A 3BGAA 3MYPA 2ASHA 1E4MM 1T0OA 3C3UA 4GIAA 3WG6A 2OO0A 4JTAA 5DBTA 3SB0A 3GAKA 5FSEC 2FHFA 3ZS4A 2C14A 1DWGM 4PC8A 3UVIA 3WUFA 2H3BA 4UNIA 5FJIA 2H3DA 5FKYA 3CYJA 1GQJA 1S5VA 3T8LA 3ZJ6A 1TA3A 3D6NA 1VLIA 2CWXA 4KGJA 1YNQA 3L2IA 2BY1A 4PMDA 4KIEA 3R1ZA 3ZSSA 2R9RA 1DBTA 4C6KA 1BWLA 3O06A 3RX3A 3UERA 3AMCA 3FDKA 4EF9A 4TX9A 4AW7A 1TWZA 3CPGA 2QJIA 1RLDA 2AQOA 3QHOA 3VOGA 4O1AA 4Y9MA 2VFGA 3H26A 4L9YA 3VGBA 1SGJA 1JDDA 3BAKA 2R6OA 3DZ1A 1OEPA 1YQ2A 2P10A 1J0KA 3CUXA 1W0MA 1W91A 2VOMA 1YE4A 2ZX8A 1KLZA 3NTYA 4QCEA 2E5DA 4LXFA 2Z7GA 3SCRA 3VKCA 1EQCA 1GVYA 3W7HA 5HXMA 1V3JA 3AHTA 2ZZ6A 1YRRA 4HOWA 4PGLA 4WQ6A 4AY7A 5LYRA 5K9CA 1VEPA 3E0IA 3GU2A 5A6BA 1U1HA 3GBEA 4P7LA 3POCA 4X0VA 3RLGA 3AZRA 7REQA 4BS0A 4DWDA 3OBEA 1W9UA 4P7QA 2E67A 2F61A 2OYMA 2OOGA 4X0NA 4RNIA 5DCDA 4BK9A 1OCNA 1UR1A 4C65A 2F6KA 4ONVA 3AIQA 4FX6M 2GK1A 4EPEC 2TAAA 1F7BA 3CZGA 1R7OA 2DSKA 4TMCA 2NVAA 1CLVA 3LPGA 5E5CA 3CL6A 1SO5A 2NT0A 4M0XA 3TIMA 1O4UA 3NQCA 1JD9A 2PBOA 1SFTA 5FF7A 4L61A 2ALRA 3LA4A 3AXMA 2Z1KA 5HNUA 3N4EA 4GABA 3W81A 3MHUA 4ORMA 1FFRA 1EDQA 1NP0A 1FWWA 4RPPA 1KNWA 4DEFA 4FSAA 1R0MA 3FK4A 5EU9A 5D8WA 4HZ7A 2PTZA 1PO9A 1FWFC 5FJJA 4C1KA 4IGNA 1OIFA 2FMNA 3RX2A 2PP0A 3DU0A 1NVMA 1TJ0A 3WFZA 1K4GA 4KF1A 2YZ5A 4H8HA 1XL9A 2IQ0A 4XZHA 3FDGA 1K77A 3WLHA 3ZVHA 3M0MA 1S2TA 3BAWA 1ONWA 3PB2A 3PB0A 4ORIA 4O1DA 1SZRA 3RFAA 3DBPA 3EKGA 3WLLA 3MVIA 2EGZA 1XRTA 4ZE4A 2GDUA 1F73A 4Z2JA 1SMDA 2OSXA 4H7CA 3LXBA 4DN1A 4ACZB 1JNDA 1F05A 2G3FA 4W88A 2I9UA 3W7KA 4ZCWA 1GYMA 4ERGA 4PCNA 4U31A 3SRDA 5CC6A 2J75A 4W5ZA 2PPGA 1DEDA 1A0CA 3T44A 1I2OA 3G1FA 5CAKA 1NY1A 5AYZA 5JBFA 2L5HA 4R85A 1H7RA 4GJ1A 1SM9A 3OHMB 5C5YA 3AWOA 2B7PA 3TAOA 1MFUA 3GKAA 4L4OA 5CEWA 4QX4A 4HN8A 4P7RA 3M46A 4HOXA 5D9OA 3UA3A 3F2CA 4KCUA 3DFSA 4JTHA 2PUZA 3QGKC 2DFAA 5G2WA 3CAQA 4FZIA 4Q4RA 4AMCA 4EOUA 4TVCA 4GUJA 1SZEA 3AYTA 2VNCA 4OUEA 3AOFA 3UWEA 4KIRA 5AYIA 3KCLA 4R7JA 4L6HA 3T4WA 3QC0A 3LCGA 4IUOA 1CBGA 1UIOA 2OZ0A 3WSUA 3WJZA 3RPDA 4MNKA 1J96A 3GO2A 3UWVA 1QOPA 2J8GA 1PPIA 2ISFA 3OQ8A 3EBVA 3PZOA 4HMCA 4L1WA 2NQZA 3BV7A 5FL0A 4KETA 2ZWYA 1JZ4A 3GFZA 3EOOA 4YYCA 1A5BA 4KH2A 3H7VA 4HK5A 1P7TB 5JBEA 5DQPA 3TLQA 2PDKA 4LVGA 2YPIA 4RE0A 4I5UA 1PX8A 4GISA 1Q6EA 5DBUA 1UUOA 3LU2A 3OBAA 4M82A 2EF9A 2E77A 2WMJA 3H2MA 3W9ZA 4RE3A 1UR3M 1WZLA 3CZEA 3WF3A 3TONA 1J18A 4HOZA 1E9YB 2ALDA 4CD7A 2ISDA 4OKDA 4HB7A 4RZ4A 4WSHA 3M9YA 2WKGA 3GHSA 1QJWA 1LRNA 4I9TA 3JS3A 5RUBA 3OBKA 2X1TA 3TN5A 3H55A 5BRBA 3M64A 4YTUA 3UZWA 2CKSA 5FJRA 3IANA 3OLDA 1E9IA 4GIYA 1W8SA 5KZ6A 3W72A 1K03A 3RLHA 4BI7A 4XZIA 3GNOA 4IFRA 1Q4NX 4J3VA 1LLZA 3TQKA 3AROA 4XWUA 2PCQA 3M6YA 2QJNA 4ZXLA 4MLRA 3GU9A 5MKGB 4DO4A 1NDVA 2BASA 4X2RA 3H12A 3WNNA 2YGYA 1FQ0A 1KFLA 1UZHA 4NSBA 3IAPA 1SO3A 3SUVA 1LL4A 4S3AA 3LD5A 3KX6A 1A5CA 1XG3A 1HO4A 5I78A 3AU6A 3BCDA 3L5MA 2WW5A 1WQ5A 1PIFA 3C8NA 1KCLA 4AWEA 4I8DA 1N8WA 3M5XA 3LS9A 3B03A 2OWWA 3U9IA 4US6A 2Z1VA 5M5DA 2BOFX 4HYRA 3UR5A 2W6RA 2F8QA 4LBUA 4ACZA 3VIPA 3WUBA 3RG6A 4W8AA 2BX7A 5JMUA 3MANA 5AVHA 2WVSA 1FA2A 2FZMA 4NAFB 4HNVA 4ZQOA 1ODZA 3UGVA 1LWJA 2PCEA 3S2NA 3STCA 4H8UA 3LN3A 2BNJA 4L9ZA 1NOWA 4O52A 1XIMA 1X8FA 5CBBA 2QCNA 4OZOA 1FWEC 3H4WA 2YCLB 3EX3A 4QS5A 4HU3A 4GI6A 3K1GA 3WH7A 2FTWA 4WGXA 4K37A 1XLLA 2VCAA 3RX4A 1JRCA 4AX7A 1O5QA 1E0TA 1GOKA 1C9WA 4IQDA 3NQ6A 4OWGA 2A6NA 4K8GA 5D9NA 4P7NA 3SUUA 2CYGA 2QAPA 1WAWA 4MJ4A 2BOGX 4L6DA 1JCLA 2OQHA 4E8DA 2GQ8A 3L9CA 3NPXA 3LHZA 3SCNA 1GYNA 1R3TA 4LRTA 4CD4A 4H4IA 4BI5A 5I24A 4S23A 3MJMA 1L0PA 3DC8A 4RZ5A 2JEPA 4KEZA 4UQCA 3ZLHA 4XAGA 3RCYA 1NF0A 1A5SA 1OK6A 1ESWA 1R3VA 4UTWA 2ACRA 4M7SA 5FD0A 3BDKA 3HBLA 4NRRA 3T09A 1DHPA 3L66A 1GQNA 1IIGA 3WD4A 5GJPA 3STFA 3LV5A 1XYZA 2NV9A 3O16A 2GGIA 1DORA 3E0FA 3RU8X 2C1HA 1P7TA 5E1QA 2PDXA 4K3ZA 3UJRA 3HO8A 2QDGA 4AVFA 3OQEA 5EY5A 2IXUA 3VNYA 1J5SA 1EWDA 4EPDC 2EAWA 4KWSA 5IFTA 3B0VC 4V27A 1HKMA 3RR4A 4O18A 2VFFA 4ZO9A 1I75A 4NJJA 1OC6A 1V3MA 5HQMA 3OG2A 5T8GA 3CMFA 1MEWA 4AVOA 4N9DA 4FMVA 3WZ0E 1L9WA 5PTDA 3N1AA 3SZ8A 1TB3A 1ZP4A 1ODUA 1FBAA 3AIEA 4GI9A 6REQB 2CHOA 4IWWA 2EO7A 4NNAA 4S3CA 1Y5WA 4L1GA 1QMLA 3AQUA 3LGDA 5MKGA 1GW1A 1TWDA 4J3UA 5HMDA 1L2UA 1Q8AA 5DCBA 1GOXA 1E1CB 2W66A 2GVEA 2EG6A 4HPHA 3EWUA 1KKRA 4JN8A 3M0JA 4J9JA 3ZYZA 3WD1A 4DBEA 3N11A 2QV4A 5AC7A 1FWJC 3MB9A 3DG3A 4NASA 1TX0A 1XKYA 4FXRA 2G0WA 2J13A 1CB7B 4FNSA 1KGWA 1VFTA 4GGBA 3C2RA 1X98A 3MHFA 3KVJA 3PBUA 2R91A 1P0DA 1Q6FA 1OFDA 1ZTVA 3W1XA 4LRSA 1SO4A 2PZNA 4DI9A 2V5KA 1GT8A 3V18A 4GQQA 5LGZA 4GY1A 1IEVA 3URBA 1QHPA 3DFPA 4QNWA 4NAFA 4ZMGA 3L65A 3VZXA 2XM1A 4WOZA 3BE7A 1OIMA 3M43A 1A47A 3VKJA 3W38A 2PEVA 1KV5A 1SJAA 3CXOA 3W7GA 4FX7A 4JDYA 1KV8A 4GJIA 3DERA 4GVGA 1VRDA 2ZC1A 4JIPA 1TMHA 3KS6A 4CQAA 1RSCA 4LWWA 3QOMA 4F40A 1AJ2A 5CGTA 3PG8A 3P14A 1V8EA 2Z28A 3PZTA 3DG7A 4S1FA 3EDJA 4RNJA 2X7VA 1JPMA 2QVNA 3PBWA 3P7YA 3WDIA 3EEZA 4LU0A 1TKKA 1O1HA 4WR3A 3AYSA 2Q3RA 2QJHA 5LNSA 3WO8A 4KBXA 8RUCA 3T7VA 1R47A 2GGJA 4US5A 4YYFA 2BVDA 1J0YA 1JF6A 3UR7A 3W7RA 1LOQA 4M56A 5IBXC 1N82A 3HF3A 2YDSA 1EJUC 4ZQCA 1ZQ5A 4WDXA 1BFNA 3ME3A 3WJXA 2WNNA 4IX0A 2CHNA 3E38A 3CV6A 2QJJA 4JYFA 3GIYA 2X7WA 4ZO6A 2VR5A 4YL2A 2C19A 2WZEA 4L1XA 2D73A 3PBGA 4GNJA 2V38A 1PZ2A 4RV3A 5AHFA 2F2HA 2FJKA 1ZAIA 3ZFHA 4H8VA 4JIIX 4JIRA 1NFBA 5EGRA 1HJXA 3H22A 3I65A 4AIUA 1A5NC 3ES8A 1DJYA 3LGEA 4NQ1A 2A1YA 4TU1A 3ARTA 1W9BM 4D6DA 5G2HA 3WD2A 4IMGA 4ZSUA 5AC4A 1ZUAX 2OT0A 3EOSA 1XDJA 4Q7NA 3TR2A 5AY7A 1KR0A 1UWIA 1WKYA 2PP3A 1RBOB 3CLMA 2GWGA 3O8AA 4NYUA 1H63A 3HQOA 2OYLA 4J28A 1KCKA 1KO0A 1VPXA 1OT2A 3KL3A 1D3HA 4S3KA 4H9XA 4JTRA 4UFIA 4Z1YA 4A4AA 4HPGA 3WN6A 3IAQA 6REQA 5F2IA 3G1HA 5D04C 3QKZA 4GXWA 4XIAA 2TPSA 3TK7A 4DPQA 1YYAA 2IW0A 3VXGA 3WBYA 3ZOAA 1IYXA 1E1CA 3OTRA 3VI2A 3L0KA 4I6VA 4KKXA 1I8JA 2W91A 1VJZA 2X40A 3VINA 1EX1A 2VC9A 4GA8A 5JBDA 3TP4A 4KRTA 1CT5A 5A6AA 3ZZ1A 4AAJA 3W4RA 5BW6A 5I3KA 1JFXA 4XK2A 5JH2A 3TE9A 1W1A1 1NWUA 1F9CA 1K02A 3MUAA 1SFSA 5IDIA 2FFCA 1FWSA 1UKSA 5DT5A 3TC7A 1B4KA 3RITA 2BY2A 1QI5A 2QXWA 4AD5A 1Q2SA 2KAUC 3CIWA 4Q33A 4ZO7A 2WM0A 3FIGA 1VIWA 1F3XA 4J3TA 2CZEA 1QVBA 5A8OA 2FHBA 1ISVA 1BF2A 2PDNA 1IZJA 2W61A 4EAMA 3F03K 2CBJA 1UQZA 2OELA 2G37A 2GGHA 3EKZA 2PRMA 4L65A 2Q09A 1XQKA 4LVAA 2D2JA 1P1XA 1HJQA 4UR9A 4UFHA 2Z2UA 3M5YA 3PHAA 1JG9A 2CLFA 4C6QA 4JTLA 3WJYA 4NY2A 3GXNA 3W1LA 1TFVA 2QQ6A 2VEPA 3WUGA 1OFBA 3GDMA 1QCWA 3TTEA 3APGA 2RDWA 1SPQA 3IIOA 4H1ZA 4AQLA 4XZ9A 1TV2A 3DFNA 3S5OA 3I68A 3WBEA 4Z2IA 3EDDA 4JTQA 3JZUA 2LLEA 1XCWA 1XLIA 2INFA 3W0KA 1DL3A 2WMIB 4AZCB 1K9EA 1P6BA 3SI9A 5BMXA 4DJEA 2OZ3A 3U2EA 1LF1A 3MV01 3ZR6A 3ZLFA 4LFYA 1DV7A 2DSUA 5D2TA 6ENLA 1A3WA 3STGA 4PTNA 1E6SM 4CU6A 2QV5A 4DYJA 1CEOA 2J9XA 2R1PA 5TF0A 3GNNA 4S3EA 2POZA 4TOQA 2Z27A 3U8GA 1JCXA 1AD1A 3SRFA 3UXDA 2HTMA 3EWYA 3NO5A 1ZSXA 1HO1A 3DYPA 4HJFA 1XSJA 3INPA 3MUXA 5LZLA 3WK3A 3SGGA 2YL8A 3M41A 3B05A 3A5FA 4H19A 3FN9A 1SW3A 3T81A 1I9CB 3W7IA 3CZKA 3BSMA 3F4DA 1D3GA 4TX8A 1KQZA 1XQLA 3ZR4A 5IFPA 3UW6A 5XINA 2CNCA 3AXXA 1TTQA 3F5JA 3VD4A 3PSVA 3UZZA 2ZE3A 2Z6IA 3TROA 4DYKA 3KWSA 3PUEA 4BEQA 3DHDA 3MSRA 2ABAA 2PWDA 4IISA 3QM3A 1S2CA 3AAMA 3AICA 2RDUA 3TTSA 4H9ZA 3VVGA 1V5XA 2V82A 1UWSA 1XWYA 1JDFA 4B90A 3APTA 4ZB5A 5G1TA 4F4RA 3N6QA 5F4SA 1B3YA 1F4HA 3LEPA 1GCYA 2QCDB 1EFZA 1E15A 4YVXA 3KW3A 2EPKX 1CGXA 3MUZ1 4Q8OA 1QATA 3S2LA 5CBJA 4FXSA 1CGYA 3P8IA 3CGTA 3OLEA 2WVTA 1O5KA 1ZALA 2QULA 3P8JA 1HKWA 4LB3A 2VGGA 5H91A 2X41A 2NVDA 3UPMA 4FNQA 8XIAA 1DTNA 1ONEA 1UR9A 2HROA 5F1UA 2XN1A 4JQ4A 4JTFA 2PDUA 5T91A 4R5EA 5C2XA 4I7VA 2NX3A 4F48A 3RPMA 3P81A 2XISA 4FA3A 4JX4A 4KEUA 3RCNA 4LUSA 3UT0A 3CUJA 3IJLA 3W71A 3WQPA 4X9YA 3WFAA 1E4LA 4RE4A 1JD7A 1C91A 4Q8PA 4J2PA 2XFWA 4Z1AA 4G6CA 1JULA 4LBSA 1XXXA 1RA5A 4JY8A 2X1IA 2QCGA 4JR5A 2YXOA 2Y7DA 4GQGA 4DJDC 5XIAA 3AIRA 1VFUA 5C9XA 3N29A 3WK1A 1ZJBA 1I6NA 2VKZG 4AWTA 4B5WA 4DF1A 1OT1A 3WQ8A 5FAJA 2G3MA 3H2CA 3V16A 1GZ1A 4BF7A 1UMLA 4JFSA 5HUPA 4E8CA 5FAGA 3IVSA 4FNPA 1E0WA 3U4FA 2PC8A 4DUVA 2VO5A 3T40A 1OYAA 4IT1A 3L4WA 2WMIA 3EDFA 5JH1A 3F7JA 2JE8A 1EJSC 4ZQPA 1TPWA 2CLOA 3S42A 2OTDA 3Q4DA 1XCFA 4KFOA 3EDKA 3ZJ8A 1AD4A 1ZY9A 2QGHA 5AB3A 3W07A 5M03A 1OINA 3S0CA 2OPJA 4MB3A 5U7SA 2CZ5A 4IGMA 5A1AA 2O9OA 7ENLA 6TIMA 1ZU8A 4KS0A 2YW4A 3DCPA 3H6OA 4DBWA 3C0JA 4C6LA 5J5DA 3UNTA 1CXEA 1VH7A 1SR0A 2G96A 3JU2A 2PE4A 3UXIA 4EE9A 1JZ5A 2XYLA 3VDAA 3BW3A 3E2VA 2DZXA 5I3DA 2VD8A 1NDZA 1UUQA 1C7SA 2GUBA 2OYKA 3T0CA 2VWTA 4P5UA 4Q8VA 1KFKA 1UP0A 4GWEA 3P61A 4ADUA 3IJDA 3TFXA 1BYCA 1JDAA 1QNQA 4PCSA 3TN3A 2VZTA 1TVNA 3CUFA 1QPKA 2W79A 1A80A 3PBYA 3PBMA 3BG3A 3IARA 4MB5A 4BF5A 3KCJA 3LHVA 4A8NA 4Q8TA 2ZUSA 4LCRA 3E6EA 2GQAA 1PVNA 1G01A 3VKDA 3NG3A 5DF0A 3MI6A 2DSWA 2CLHA 2ACSA 2WYSA 3OGVA 1R9XA 5IXEA 1BKHA 5M3WA 1IWAA 3MUIA 5I00A 1EP1A 2G5WA 4BCEA 2F2KA 4JTGA 1KW1A 2BB0A 2NUWA 1JEZA 5TAOA 4MPQA 4NNCA 4G7FA 4WCJA 2E1DA 2YL5A 4MWAA 3GDRA 3SN0A 4NT0A 1DQWA 4QHRA 2PDHA 1X1ZA 3TSBA 2CU0A 3QTGA 4C6FA 3FGCB 3CYVA 3EPMA 1RCQA 3WLTA 4ATWA 2WWCA 1E56A 1CNVA 3UCDA 3M0KA 3SSJA 4H04A 3MZ2A 1Q6LA 4JNMA 1VBUA 1AH3A 3IVUA 3IPWA 4K38A 3VNLA 2RDXA 1BRLA 3JW7A 3GHRA 3W76A 4FI4A 4PEEA 5GJMA 3DX5A 3GH4A 2GUYA 4IMEA 2HNEA 2A7NA 3TJ4A 2E4TA 1MZRA 3WCZA 1JI2A 2EJAA 1V3KA 4KEMA 1RV8A 3BVJA 1G5AA 3VCRA 2Y0FA 2ZYFA 1ZJIA 4NYYA 4U2YA 1F6KA 3PWAA 1VFLA 2HE5A 1D7FA 1QI4A 3K2GA 2VMFA 2A85A 1OX4B 5LSMA 4QCFA 3UXAA 3MWCA 3NPVA 2CLLA 2ZRVA 4JTIA 1TVLA 3JR2A 3PAJA 1B3OA 3R12A 4PMJA 3WY1A 1YDNA 2B7QA 1OQFA 4J4KA 4ATDA 2X1RA 1TSIA 2YKKA 1CYGA 4C6CA 2VZVA 3CNYA 1GVOA 3OOQA 4DQWA 4PMQA 4IFKB 2BSLA 1FDYA 3PZVA 3K8LA 2VEMA 3FV9A 1X7IA 1K7FA 3R11A 1B90A 2OGJA 4IM4A 3WEOA 2D20A 3NCOA 3UXKA 1VPYA 3ABXA 4DRSA 2ZICA 3GH5A 1G6CA 4HZMA 3ZWSA 4UQEA 5D30A 1W1PA 5B80A 1RJPA 3PPFA 2VT0A 4YHEA 4PUEA 1QO5A 3O7UA 4XAYA 4DBSA 2E1WA 1W6TA 5AZ0A 3W3OA 1OADA 3W1UA 2DZAA 1HG3A 2YIHA 3GRIA 3W6MA 2G50A 3AS2A 3WDQA 3WQ6A 4X9SA 3KOYA 3BH4A 3UR8A 3E0LA 4DAFA 1UKPA 3V7PA 3DC0A 2B4GA 4O0QA 2AAAA 1B3WA 3S9ZA 2WWDA 3MP3A 3COTA 3W88A 1CW2A 3L4YA 1REQA 1QPOA 5C2CA 5H1WA 5HPCA 4O57A 3G5EA 3STPA 1EHAA 4GIRA 1XINA 4GH3A 3TKFA 2INEA 3R0UA 2YBUA 1W1VA 1XX1A 3A12A 1O94A 3UZYA 1XIHA 5C54A 2HVNA 3PPHA 2E5BA 3R0KA 3OLIA 3OVGA 3Q2DA 4RNHA 5D9PA 4DM2A 4C6PA 5D37A 3EX2A 4W5UA 4HCHA 2GSEA 3LRLA 3A6OA 3N25A 1ZNNA 4CNNA 3GFYA 1QK2A 3HJZA 5AHLA 3S2MA 5A69A 3WL1A 4U10A 3ITVA 2OLAA 3WF2A 4JTSA 1C8YA 2NLIA 5BOFA 1XBVA 3WLMA 4DUWA 3AYRA 1SZGA 1MW1A 1GPWA 4IG2B 1HT6A 2WMFA 3AHVA 1X96A 4MYXA 2C6QA 3ZIZA 4GZJA 1T6MA 4O1EA 1GW9A 4F8XA 3LSCA 1NFPA 3N12A 1W5NA 4WXYA 1W1ZA 1RH9A 1J6PA 3GNRA 1DPMA 3HB9A 1MQQA 4LQ1A 1XGZA 1XIDA 1HNYA 1HKKA 2DVTA 2J8TA 3BZJA 3CAVA 4XZMX 1NU5A 2YW3A 3RNDA 1XIFA 2X05A 3QY6A 4FS9A 5LIYX 3FXGA 4R9OA 5F7UA 7CGTA 5AOUA 4OECA 4Y8FA 3VIIA 2WZTA 3VOJA 1XIGA 3C5QA 3HG5A 1VZWA 1FCVA 2O9TA 3RJXA 3N19B 3WLIA 1M7OA 1RD6A 3ARZA 4GY0A 1YXYA 1OX4A 2NUYA 1ISWA 2WM1A 4CQ9A 1UZ4A 4R88A 4W4QA 3OEXA 1EA0A