4JTOA

Cysteine bound cysteine dioxygenase at ph 8.0 in the presence of cys and dithionite
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jtoA00
1J3QA 1JUHA 3H3UA 3QACA 4IEXA 1ZZ9A 1RGSA 3FFQA 1CAUB 2XKOA 4HVQA 1X8MA 1CAUA 1J59A 1VR3A 1OFNA 4ZU4A 4ZU5A 1O5UA 3C3VA 2Q0AA 4XF1A 5FCCA 1NE6A 3NW4A 4MX3A 3LA3A 4XFHA 1I6XA 3H1YA 4BYYA 4EROA 1O3TA 2XL9A 2CGPA 2PAKA 2IXKA 1CX4A 3SCGA 3SCHA 2O8QA 1EP0A 2CAVA 3LWCA 3H7YA 1DZTA 2GC3A 2V09A 4XF9A 1QY4A 3IWZA 4KU8A 5HI0A 4ONUA 2XKPA 2PA7A 4XFGA 2XLFA 3E97A 4AQ2A 5F1RA 2Q1ZB 1GQHA 4KL1A 4HMZA 1Q3EA 2EVXA 3CL1A 2ATFA 4Q0VA 3GYDA 3E5XA 5FLJA 2IXIA 2BNOA 4HZFA 5T3NA 2BNNA 2UY9A 4Q0QA 5LEJA 5JSRA 2OPKA 2O1QA 3M70A 5I0UA 1L3JA 4D7SA 2D5HA 5KBFA 3HT2A 4IEUA 5J48A 3ELNA 4R52A 2ZKLA 3RYRA 4LUMA 2OA2A 4I01A 4XF4A 2Z69A 5BUVA 4QGMA 2MNGA 5KHJA 1SQ4A 4IEZA 1OD5A 3CF6E 2ET1A 3ZDSA 5I0SA 1QXRA 4XFIA 2OZ6A 3JZVA 4A2UA 4L2NA 1QXJA 4JTNA 3EO6A 3IIAA 1YFXA 4H7LA 2B9UA 2VPVA 5C8WA 1H1IA 4UXAA 4O9GA 2PFWA 3KMHA 3OCPA 4DINB 1O5LA 2XHKA 2IC1A 1FI2A 1EPZA 4I09A 5KHKA 5CADA 1O3RA 2BEOA 1UCXA 3FX3A 4QM8A 4I2OA 5I8SA 2K9ZA 5JAXA 4N9HA 4E2SA 2XGXA 4Q29A 3WW2A 5KHHA 3TNQA 2BNMA 3MDPA 1ZVFA 4EV0A 1NXMA 2H6CA 1NE4A 1CAWA 4QGLA 4KWJA 5I93A 4HSLA 2IXLA 2MHFA 1J1LA 3OF1A 1SFNA 2QNKA 2VECA 3I7DA 3FZ3A 1YWKA 5FLIA 5I0TA 3ES4A 4XF3A 3E5UA 5CVRA 5KHIA 3S0MA 3QOPA 4TLFA 1UD1A 1YFYA 3IDBB 4EWAA 4KWLA 3GBFA 4MH0E 4Q0PA 1UIJA 3RPQA 3UKVA 5JSOA 4N9IA 4J1XA 1NZCA 5EZWA 4FAGA 4UBHA 4XFAA 1ZZCA 2QVSB 2Z2SB 3HQXA 3RDIA 1ZNPA 3DKWA 3B02A 2GC2A 2GZWA 4JTOA 3WW3A 4QGNA 1RUOA 3KCCA 4XEZA 4YNIA 2Q4SA 1Y9QA 3L2HA 3MYXA 3H8UA 1VJ2A 3VHRA 3EBRA 4X6QB 1VP6A 1Q5OA 2ZCWA 5JCTA 1O4TA 4JV4A 3LAGA 1XRUA 5E1RA 3OGJA 1O3QA 4QMAA 5EFUA 2XLAA 3U10A 2B5HA 3IDCB 2PHLA 2XLGA 1I5ZA 3EJKA 1X7NA 1UIKA 1NYWA 1IPKA 4X6RB 5CU1A 3S7IA 3CEWA 1RL3A 1Y3TA 3HIFA 4HN0A 3WW1A 1J3PA 5LEKA 3PNAA 1RTVA 3BB6A 2GH2A 4F8AA 2VQAA 4YRDA 2BYVE 1X8EA 3OTFA 2C0ZA 2D93A 3FWEA 3RNSA 1QWRA 3H7JA 4XETA 3ES1A 3HT1A 4IEOA 1RUNA 2I45A 4HVRA 3ROUA 1OI6A 2P17A 3RZZA 3NJZA 2GAUA 1ZZ6A 3BPZA 1ZX5A 5AVPA 4Z82A 4I3PA 3NL1A 4FAHA 3H1WA 4QX5A 1H1MA 4E2QA 1DGRA 1LRHA 1FXZA 1TQ5A 3UKNA 1G6NA 3H50A 1ZRFA 3RYKA 5BV6A 4MV2A 1PMIA 1O7FA 2UY8A 4MGIE 4UBGA 4EWEA 1ZZ7A 4IERA 4XFCA 1CAWB 2PYTA 1XE8A 3KSCA 5BY5A 4QM9A 1CAVB 1LR5A 5FPZA 1CAVA 5I8TA 4XF0A 3BCWA 1WLTA 1YFUA 1OMIA 4RD7A 5J3UA 1YFWA 5JSPA 4R8HA 3SMHA 5FDBA 3FHIB 1ZREA 4QXKA 3I59A 3EHKA 1FT9A 1ZZ8A 4LUKA 1LKNA 3CO2A 5FQ0A 1Q43A 2ET7A 3NVCA 2PTMA 3H9AA 1U12A 4MGYE 4ZU7A 2DCTA 4BIFA 1DZRA 2PHDA 3E6BA 3LZZA 4HSJA 2PAMA 2CAUA 2PAEA 1X82A 4AVAA 4LLOA 2KXLA 1YHFA 4MUVA 3PLQA 3ST7A 3DN7A 4P9GA 1DGWA 2HJIA 4PIZA 4LA3A 5FPXA 1EY2A 1ZRRA 1CGPA 4PIYA 3ETQA 1V70A 4I0AA 3S7EA 2XL7A 4BHPA 1YUDA 2PQQA 3BALA 5JR7B 3SHRA 4PJYA 1WGPA 3FE5A 4LTAA 3KGZA 4WVZA 4KWKA 3LA2A 3E6DA 2D40A 3WW4A 4B29A 4F7ZA 3D82A 3UKTA 5J7MA 2UYAA 1J3RA 3TNPB 4WBBA 4IEYA 1ZRDA 4IEPA 4I02A 4ORFA 2FMYA 3LOIA 2FQPA 2Q30A 3MZHA 3FJSA 2D5FA 3M3IA 2H6BA 4D7TA 1ZRCA 2WC2A 4OFGA 2QCSB 4AVCA 3OD0A 5FLHA 2IXHA 1IPJA 4HLTA 2OZJA 2EA7A 4HBNA 3USSA 4YSFA 1YLLA 4META 1SEFA 1RC6A 4E2GA 4FT8A 2QDRA 4L11A 2GC1A 4PIXA 2H0VA 4YARA 4AVBA 4MGZE 4HN1A 1ZZBA 4LA2A 2ETEA 2WFPA 4OLLA 5LRSA 3U11A 2QJVA 4HVOA 3EQEA 1UPIA 4J1WA 2HKXA 3MPBA 3NSTA 1O3SA 2EAAA 3SCFA 4XFBA 3R6SA 2IXCA 4MZUA 3I54A 4IEWA 3LA7A 3RYPA 3KGLA 1CAXB 4GULA 3BU7A 3D0JA 3DL3A 4EWDA 1CAXA 4XFFA 4IEVA 4CYDA 3O14A 3PVBB 2B8MA 2GU9A 2E9QA 5D1IA 4Q0UA 2UYBA 1HW5A 1XE7A 4LULA 5I8YA 4IEQA 1WA4A 3CJXA 3NKTA 5K8SA 4AQ6A 1J58A 4WZCA 5BXXA 4LEJA 4JVAA 5I0RA 2Y0OA 3CLPA 2GC0A 3E5QA 2BGCA 2K0GA 3N4MA 2MPFA 3ACLA 4AXOA 2F4PA 4FBFA 3I59B 4BH9A 1GQGA 3IBMA 5E16A 5BPXA 4KU7A 5C6CA 1PM7A 4Q0SA 4O9EA 5FQ0B 1EYBA 2IXJA 4I0BA 3H1MA 4MGKE 4K8FA 2N7GA 5KHGA 4NVPA 3H3ZA 3U0ZA 1UW8A 2CV6A 4IETA 3E6CC 1LB2A 4IESA 3SXWA 5I91A 4Z07A 4YYOA 5LRRA 3DV8A 3G7DA 3D0SA 2OYZA
chains in the Genus database with same CATH superfamily
2ZX2A 1JUHA 2RG4A 2VOVA 3MLJA 1PVC3 1GSLA 2VNVA 4QD2A 2XQXA 2BW8A 2VTXJ 5LA1A 2XKOA 1OURA 2GALA 2YZ4A 2ZGUA 1E57A 3FN9A 4LORA 4YM0A 4HVQA 4LKDA 2VZSA 4ZU5A 2XH6A 1F35A 1O5UA 2ARBA 3NAPA 2YXSA 4NIHA 4XF1A 1H0BA 3WR0A 4MX3A 3GXUA 3N9LA 5FXZA 5FZBA 3NV1A 1I6XA 2WO7A 1O3TA 3FL7A 2XL9A 2YPJA 1UL9A 2OIIA 4XIOA 1GU3A 3RZMA 1MS5A 2CNAA 2W5FA 3A0NA 3W5NA 2CAVA 3H7YA 1DZTA 2LROA 3VBHB 4FP2A 4WZFA 4YFZA 5FR3A 2W39A 3N9QA 2WL1A 3VBHC 5JIUA 2WS92 5EQUA 2FDFA 4XFGA 1YO8A 4RN5A 1SLAA 3CU7A 4Q1RA 4PDWC 3MW4A 3AKTA 4YZ5A 2C1FA 4M3CF 3PVEA 4HMZA 1ND3B 4A41A 4GWNA 3W20A 5JI7A 2VMHA 2AGSA 1AX0A 2VMDA 1DYOA 2EVXA 4LITA 1ZBA1 3M3CA 5JPNB 1TME2 2WR9A 2BRTA 4XDOA 2JDPA 3MIFA 5C5UA 5CFCB 1W0NA 4XXAA 3A7QA 4CDXA 2BGOA 3LD8A 1JZ6A 4YW5A 4HZFA 1JU4A 3KV9A 2ZEYA 4CXXA 2KD7A 4QX0A 4Q0QA 5JSRA 2OPKA 1ZRIA 4N90A 4XUQA 3M70A 5IVBA 5I0UA 3KV6A 3ZFGC 5LBFA 4BDVB 5FO9B 3NNGA 1L3JA 2V5DA 4ZY9A 3VDCA 3VD9A 2EXHA 4R9AA 3J8F1 3J7HA 4XBLA 1ZBE1 5FZ8A 1N3PA 4XHBA 3KHBA 1WW7A 4LUMA 4UWDA 1EV12 4I01A 3CNAA 2Z69A 3F95A 3O7OA 5FZGA 3ZPYA 1W6OB 4CXWA 4E27A 2VZUA 1NT0A 3OGRA 2R1BA 3FLPA 4OHWA 1RUC1 1OD5A 5DZFA 3L2YA 1LHVA 4OCTA 4Y4YA 2Z5WA 5FYSA 4CCCA 3X29B 2QE3A 5JZGC 3AMHA 4A2UA 1RUD2 2ZGSA 1QXJA 2YBPA 1YFXA 1ZBE3 4H7MA 1LHWA 1VRH3 4YFWA 5FXVA 3VHNA 4EN6B 4W6XA 3UNPA 2D44A 3SISA 3MPPG 1AL0G 1AX1A 5L7OA 3HJRA 1JXNA 2PFWA 1GNYA 1LHNA 5DZGA 4CZSA 4DINB 1JODA 3WHUA 2IC1A 2KA3A 3T2PA 4SBVA 2XBO1 5KHKA 1W2AX 3N9MA 1ASJ1 3NJYA 3VD5A 4LO4B 1RVF3 1GNZA 2QQOA 2BEOA 1QJY2 1UCXA 3FX3A 3T1LA 3RZLA 4I2OA 3LGRA 1W2TA 4XJWA 5I8SA 1R092 2QQLA 4LO8A 1ENRA 4CU9A 2A3WA 3WW2A 4E4HA 5CKQA 1UPSA 2BNMA 2DVDA 2VCAA 4Y1UA 3ZYGA 1C8M1 1ZVFA 1NXMA 4JQRA 3WT3A 3NV3A 4QQ2A 1XQNA 4OUEA 2XONA 5I93A 3KLSA 3RWNA 3SKJE 1PO21 2JG8B 2A6XA 4G9SB 2JXAA 2QNKA 3AZZA 5EV7A 1JUIA 1R082 3B3QE 3I7DA 5GZGA 2XJUA 4EN9B 1K45A 4GH4B 2G9ZA 2JDKA 1U5XA 1W8FA 3OOXA 3GJAA 1YWKA 4L97A 3T2QA 3ZPOA 1DGRN 1OA4A 3KD4A 4YZ3A 1RUF1 5CVRA 4BQ1A 5KHIA 3S0MA 3ZXDA 3QOPA 3KM5A 1UD1A 1W2NA 2LTNA 2X8KA 3VBUB 3VHOA 1XJAA 4L0PA 3GZAA 3E1F1 1HQWA 3GBFA 4WM8A 3CJIA 5KWRA 1OFSA 1OBNA 5A1LA 3PURA 3OG2A 3K3OA 2ZAAA 3WEZA 2D3RA 4BMBA 3UKVA 2NP0A 1AXYA 3RRDA 1S2BA 3BODA 4YM2A 2DTYA 4FAGA 5EJ3A 3NO8A 2YBSA 1LESA 4UBHA 2WWUA 3NAPB 3ZSJA 3RDIA 2Z2SB 4TN7A 3MFCA 4QXBA 1YEWA 2R7EB 1UWWA 4LQRA 4BPZA 2F17A 1HV0A 2G19A 3OEBA 4A6OA 5BNOA 2Z4FA 2VBBA 1COV2 1OLMA 3I2HA 2XJVA 1H8VA 4YNIA 2JDUA 4CP0A 2V4VA 2WT0A 3HNYM 4OMDA 4OI4A 2ZBJA 1OOPA 4AHXA 1VJ2A 3VHRA 5T5JA 2R072 4XDPA 2ZCWA 5KXCA 3ETPA 4H55A 3TAYA 2X5IA 2CY6A 3WCSA 4Q4V1 4COYA 2D3PA 2RMU1 2JD9A 1BKZA 2VZOA 2D6OX 4ES8A 2VBPA 4JQTA 1PZ7A 3UV9A 4BQ5A 2ZX0A 3AXEA 2XLAA 2B5HA 3ON7A 2BFUL 2P2KA 5CISA 2XLGA 2Y6HA 4A45A 1WCUA 4AFBA 4TXWA 4QX1A 2DBIA 4BU2A 2GN7A 1W6QA 4P9IA 1UNBA 4YVSC 4PHZA 4AGGA 1A78A 1PIV1 4C90A 1D4M1 1GZWB 4PI2A 4BISA 2BPA2 3JQXA 4OHZA 2AACA 4B4RA 1RL3A 3VKMA 3TN91 1GANA 2ENRA 2DFBA 2A6VA 1REDA 3OD4A 4M0NA 3WW1A 1WCQA 3T2OA 4UW3A 4IQPA 4WVVA 1OLQA 3HBKA 4F8AA 4FPEA 4NHYA 3M1HA 1GZ9A 2BYVE 3BTAA 4AFDA 1PM4A 1JZ2A 1JZ5A 3M3QA 3T1MA 3S30A 4FFGA 3DF0A 3ZSEA 3BOPA 2JE7A 4LHKA 3OTFA 4M00A 4MLOA 2D93A 1H2MA 4XUPA 1AR61 5FYYA 3GCXA 1DQ6A 2RV9A 3H7JA 4XETA 5A3MA 4CDWA 1XYPA 1N3OA 3A23A 3TN93 1CESA 1BZWA 2CU5A 1MEC2 2PHWA 2WS93 3UESA 1VIWB 3I8TA 2JE9A 5FZEA 4AEKA 2GDFA 2P17A 3CZJA 5GLVA 1BBT1 3RZZA 3GBGA 3KHCA 4PF1A 2GAUA 1NCRC 3AP4A 3C8XA 5K9YA 1ZX5A 2DCYA 3VUOA 3I2KA 1C57A 4CTEA 1R1A1 3GF6A 3OPZA 1TME3 2ZHKA 2CGOA 5LATA 4E2QA 1P8JA 1DGRA 2BU9A 3VL9A 4CCOA 3WP4A 3I3BA 1OVPA 4XUTA 5DDJ2 4CU8A 1AR63 4FVVA 4IE4A 1IPSA 5C71A 4QHBA 3O0VA 3TBDA 1VBD1 4OHYA 2ZHNA 3KT4A 1XNKA 4EWEA 3UT0A 2RJ2A 3PU8A 4IERA 3B00A 4XFCA 2ZTNA 5ANNA 2RE9A 1BBT3 4NHKA 4MXWA 3WVJA 4GWIA 3RG0A 4RSUA 5C9AC 5I8TA 4XF0A 2BV4A 2ZZJA 3IPVB 1YFUA 5A7SA 1R1A3 3DPRA 1BK0A 4RD7A 4XYXA 4DS0A 4TZDA 1A6CA 3MIHA 3RJ2X 1QH7A 3HN1A 1EV13 4D7YA 3J9SA 3WXPA 1PK6A 1W8OA 5LA2A 2V5YA 2RJLA 2W1QA 2WZEA 4OZXA 2WNVA 2Y6LA 3BI3A 1VBD3 5AC92 3I59A 1QMJA 2Q8CA 3O1RA 5AVAA 4AEDA 4JC1A 4XZPA 2B39A 1OSGA 4LUKA 4WM8B 2R32A 3WDWA 5JXGA 3S5AA 1NY71 5JOWA 5IAVA 4DUWA 5A6ZA 2Q1FA 1U12A 1AX2A 4P5YA 1BMV1 2EIGA 1QJU2 4M01A 3DEMA 4BIFA 1EAH1 1JHJA 1DZRA 1HRV1 2D6NA 2PHDA 3E6BA 3LZZA 1I1EA 4B1LA 4QX3A 4RR3C 1W2OA 2CAUA 2ZZQA 5H9RA 1UQXA 4BA6A 1HLCA 3ZXKA 5K0UA 1TNFA 4KQ7A 3ACIA 1AYN1 3HN3A 1UMZA 5C3OA 2VOKA 5GJ6A 1VBB1 1QJY3 3PLQA 1QKQA 2QQJA 2R062 2Z42A 4LR4A 4W50A 2OUHA 1PGL2 5FUIA 3VBFA 2DVFA 5JIAA 5FPXA 2VO5A 1OOPB 5T54A 4XW3A 1ZRRA 2HWB1 3THCA 4Q1PA 5A3TA 4MG2A 5JWPA 2X5IB 4CCNA 1I5PA 2R042 1QNYA 1WMEA 3AP9A 3ZFFC 3OGSA 5FYUA 3SC7X 3PUQA 1WGPA 1YJKA 4RQPC 2AEZA 4JKMA 5IVEA 2I74A 4FP3A 1K5MA 1NA1A 3NKGA 2OQ6A 2WWJA 1G9CA 4CXYA 1QJX1 2BUKA 3MGUA 5FZ6A 1TZOA 3AXDA 3LA2A 4BXSV 3PHMA 1QU0A 4MSVA 4I3GA 1XSQA 2ZEZA 4KG0A 4OHVA 3TNPB 4A3ZA 2OUJA 3JUUA 5EJZB 4BXFA 3AMNA 5IK7A 1D0HA 1WD4A 4ORFA 4QKBA 4CUCA 1HKDA 1QJEA 1JYNA 5FBJA 2FMYA 1HRI2 1OH3A 2PHXA 3L9JT 1XBFA 5DZEA 2PELA 2ARXA 3M3IA 3POSA 4D7TA 2AR6A 3ZR5A 2Q8OA 1QJX3 4OFGA 4Y1ZA 2F4LA 4DRVA 2D6KA 2GMEA 3CZUA 3DCQA 1S0EA 2OZJA 2W1UA 1FX5A 3Q8CA 1PO11 3HVDA 3USSA 2LS6A 1RC6A 1SEFA 1L7RA 1DU3D 1SLTA 2WLQA 4E2GA 1JZ8A 2WIIB 4FT8A 4LT5A 1COV3 1RHI1 4HK8A 1W9WA 3UYJA 2QFEA 4CDWB 4Y20A 2PLV1 4CDUB 4AVBA 1SBFA 4DY3A 3T4HB 5FJKA 5BNQA 2DU0A 2R073 4S2GA 5FP3A 5LB6A 2ZGQA 3EQEA 1A3KA 2DVGA 1GV9A 1GLHA 3F2ZA 2HKXA 4LBNA 4XABA 2A6ZA 4XFBA 1BVP1 3RJRA 3R6SA 1UMHA 4KNCA 2OW4A 4IEWA 4NHLA 4YW4A 2C6SA 2WO2A 1CAXB 2QZ3A 4EWDA 3USUA 1RHI3 1RUG2 3POJA 5FYMA 4LHNA 4Y5TA 4W8JA 3VBSA 2E31A 4ZXEA 3WDYA 1SFYA 3O14A 1PVC2 3POEA 4H2AA 1DBNA 2D97A 1G9BA 3P3NA 4MXWB 4QAWA 2UYBA 1HW5A 5AFBA 2Q8DA 1LJ7A 1FNZA 2EICA 2E7TA 2ZGPA 1KGYA 3CJXA 3R4SA 2P34A 3DPRB 4Y24A 4Z92B 3TRSB 3WSOA 2DVAA 1KFUL 5LK7B 5FRAA 2W94A 5I0RA 5FZOA 1PK6B 4HKLA 1JOBA 2XQRA 2Y0OA 3E5QA 2K0GA 3N36A 3UJQA 5F7UA 3VD4A 2PN5A 3ACLA 2J42A 4FBFA 3I59B 4TWTA 1GQGA 4AEDB 1PM7A 2RS31 5FWJA 2VUDA 5IATA 1FATA 2NQYA 1NAEA 5FZ3A 1AUYA 2IXJA 4LLFA 2VVDA 3VBOA 4AAXA 2J1TA 4L8QA 1CD3G 2N7GA 3VZMA 1UX6A 3GALA 3CQOA 4LOSA 5F32A 2CWSA 3GHNA 2YGLA 4HFSA 4NVPA 4QX7A 1MS3A 3JB4C 2YY1A 3AP5A 3ZXJA 4E4DX 1GICA 4I0WB 3DGTA 4IETA 1RUI1 5A3PA 3E6CC 2BQPA 1LB2A 3BU0A 1GP5A 1RITA 2JIJA 3K46A 1C28A 1FOD1 5HXMA 5IFPA 4Z07A 3CHXA 4DXRA 1MQTB 3AKRA 2YHJA 4QB1A 2G9FA 2X09A 2OYZA 5DDJ3 1MQTC 1J3QA 5GLZA 3H3UA 2HWE1 3VBFB 5HV4A 2VUJA 2NYYA 4IE6A 1UMIA 5A6XA 2XUEA 3FFQA 4W6WA 5E88A 5F2WA 1CAUB 1OT5A 2JDHA 1ZBA2 1AVBA 3FUOA 4YW2A 4ASLA 5FP8A 1VR3A 1OFNA 1RUI3 2OXBA 5CNAA 3LFMA 5H9QA 3WG3A 3WNMA 2WNEA 2XJPA 2Q0AA 1FOD3 1K5MB 1NA1B 1BEV1 3NW4A 4YLZA 3AL5A 2W1SA 1MZ6A 4XFHA 5FPBA 2ZGNA 2EIEA 1EPWA 1SDDB 2GP5A 4CSWA 2VTXA 3ZIXA 2WQ4A 2O8QA 1EP0A 2ORXA 3ZYBA 3LWCA 4XF9A 2GC3A 2V09A 4FPGA 1PZ9A 2PHUA 2ZGOA 4ARXA 3VBHA 5HI0A 4ONUA 3J8F2 4KG8A 1EUTA 5FY8A 3WQ1A 2XLFA 4P9LA 4PDWA 1ZBE2 1LHUA 5A6YA 3D3AA 1J1TA 2Q1ZB 3HMYA 5D2AA 5F1RA 1RUJ1 1Q3EA 3AFGA 5DMYA 1BEV3 1AR81 5A3UA 2DV9A 5LY1A 4Q5OA 4J6GA 4NRPA 2RM21 1W99A 1RUC2 3E5XA 2K46A 1W6PA 5FLJA 3TEYA 4RYDA 4XTMA 2IXIA 1H9PA 1E5HA 5T3NA 2BNNA 1S55A 2ZMLA 4MGSA 2VMCA 5BNNC 2R063 3ZFGA 3O1MA 1OUXA 4Y20B 4QPIC 2DUQA 4GKYA 3VKFC 1OXCA 4F83A 1OUSA 2D5HA 3MIDA 3OGVA 1XNCA 1SBEA 2BWCA 4WM7C 5A1AA 3AYCA 2VQ0A 3ZN4A 4PLNA 5J48A 5FPAA 1QQP1 1QJFA 3ELNA 2R043 2RM23 2ZKLA 3LPFA 4LBLA 3AM2A 5FP9A 2XBO2 5LA0A 1ASJ2 4K8RB 5A3WA 2GMMA 4QGMA 3THTA 5CEHA 2MNGA 4RA0A 1W8TA 4KBZA 5KHJA 4GWJA 1V6KA 1SQ4A 3J7LA 4AAPA 4P9JA 4AI1A 4E4ZA 1QOSA 4EE2A 3CF6E 3USUB 3VBSB 5I0SA 3RMYA 1C8M2 4L99A 2OZ6A 5CA6A 5JZGA 2CHHA 4INDA 4LO5B 5A7QA 4JKLA 1QF3A 2QKDA 1CJPA 4DFSA 1PO22 4AFMA 4JTNA 3EO6A 3IIAA 3POGA 3QH7A 4H7LA 5FYZA 1AR71 4K3UA 5FMOL 3VDAA 4OZOA 1HRI3 5FZLA 5C8WA 2WZR1 1XOYA 3WV6A 4O9GA 1LU2A 2ZS6B 3MFAA 3M2MA 1VBE1 5GLUA 3RS6A 3VKNA 1W6MA 4LHLA 5FUNA 1RUF2 1UOBA 2XHKA 5D21A 5FZOB 4IV1C 1HN0A 4I09A 1YQ6A 4C1WA 4COVA 1MS8A 2J1VA 2VULA 5GALA 2W87A 1XYOA 4CE8A 3ZSMA 2XJTA 3AMMA 4GKXA 4HKOA 5FY1A 2K9ZA 1REFA 4YW6A 2VZTA 4YW1A 3PVOA 4Q29A 5KHHA 4EV0A 1AZDA 1NE4A 1CAWA 1XU2A 2EF6A 2H6CA 3WG1A 2WZR3 4BM8A 1LOGA 1X33A 4XCBA 4OUMA 5JMOA 2IXLA 1J1LA 1JI6A 2D43A 1IG3A 1SFNA 1W03A 1W39A 1YJLA 2JG8A 2Y64A 3VDDB 1GWKA 5ABJC 3WNXA 1V0AA 2JDMA 2GP3A 4CPBA 2IVIB 2VG9A 5LW9A 3ES4A 2E63A 1LOCA 2BGPA 2JDZA 4ISRA 4XOGA 1GOHA 3EB7A 4IE7A 4XVHA 4YG0A 3M4FA 2P37A 3E5UA 4ZONA 5E6HA 5FMDA 1H9WA 5T5OA 4TLGA 4ZHNA 2E7QA 2VMIA 1OH4A 2RDSA 3IDBB 4N8MA 2Y33A 4RFT0 4UT5A 3RWKX 3VZNA 4YZ2A 1TG7A 4EWAA 5IK8A 2DBNA 4LPLA 1NCQC 1YCIA 2D7FA 4JDNA 3MUZ1 1ULFA 3D6EA 4Q4V2 1W28A 2RMU2 3POYA 1NZCA 1BHGA 2W92A 4ITCA 1U0AA 1ULPA 1F9KA 1QGLA 2X29A 2Z79A 1NOVA 4QKFA 4BK5A 4Y5SA 1ZZCA 1APNA 2QVSB 3HQXA 4LMFA 1ZNPA 2ZX4A 1CX1A 2VZ1A 4SLIA 3VHPA 1QH6A 2J1SA 2GZWA 5J09A 5DAVA 4FPJA 4P00B 5EHDA 1PIV2 4LHSA 4W6YA 3RZKA 1V6NA 3NNLA 1C1LA 1D4M2 3MW3A 4D6RA 5FFOC 3KCCA 2VGDA 3KT7A 4LBJA 5JMCA 3OPWA 3GHMA 1AYM1 1EUUA 2E53A 3R05A 4QHOA 1CN1A 3JXSA 3TN92 4COUA 1D2QA 2R1DA 3ATGA 5GM0A 3H8UA 4PDWB 3T4VA 4CDQC 4X6QB 4AYUA 2J1RA 5A32B 4UFMA 2ZEXA 2FZ1A 4FOWA 1L7LA 4LO7A 3OUJA 1XRUA 5CG8A 3J7MA 3AMPA 4UFJA 4B3NA 5FUPA 3WUCA 1H2KA 4QMAA 1JYWA 1W6PB 4XAAA 3U10A 3T08A 1AR62 4YVSA 4FOYA 2RS51 3KVBA 1NYWA 2VQUA 4DNYA 1LGBA 4DY5A 2WZPP 4X6RB 1MVQA 3O1PA 3IAQA 4XCAA 3ZFGB 1LTEA 1POV1 3MLKA 1ODMA 3S7IA 2RDRA 2WRAA 1GZWA 1BBT2 1KFXL 1XE0A 3B9IA 4K1YA 3AYDA 1VB2A 2L9LA 1HX6A 2YBKA 5LBBA 1LGCA 1R1A2 1ZBA3 4LBOA 5LEKA 1ULDA 3PNAA 4XJ9A 3MF9A 1WBLA 2VQAA 2YMZA 4H14A 4K7JA 2CGNA 4NWVA 4LXLA 4FTBA 5FY9A 3TEWA 4UFLA 2HH9A 2RS53 3PIJA 2ZGKA 3ITQA 1VBD2 4FQ4A 4O61A 1Q8OA 2QBXA 1LECA 1POV3 1GBGA 2ZX1A 5JZGB 2RVAA 4DQAA 4XC9A 1MS0A 3ES1A 3B5LB 1W8ZA 2VZRA 2DF7A 4AF9A 1ENQA 1VBC1 3J8F3 4IEOA 4HVRA 1ND2C 2RDQA 2VMEA 3ROUA 3AVSA 4E9KA 1CVNA 1NCRA 2R0HA 1QDCA 3I2GA 4QQOA 1ZZ6A 3WP6A 3U75A 1W6MB 4QPYA 1H1MA 3ZM8A 5IT6A 1UY2A 1Y43B 1RUC3 4QX8A 5FZAA 2X10A 3Q8AA 1FXZA 1TQ5A 3N35A 4PLMA 3UKNA 5EJ1B 3PJYA 1G6NA 2WNUC 5CFDC 3KF3A 5IVFA 4AHYA 2LUWA 3RYKA 2Y0IA 1NY72 2YU2A 2GNTA 3T0BA 5CZKA 4MV2A 1VBC3 2Y6JA 3PUSA 3CMGA 5L36A 3AYEA 3FFZA 1F4HA 1BMV2 3DECA 1DDLA 1XXNA 1W9TA 2WBKA 3JD71 1CAWB 1F5JA 1XE8A 2PYTA 1GYKA 2JB4A 1EAH2 1CAVB 1HRV2 1LR5A 4YGDA 1C5HA 2XHNA 5FPZA 2VZQA 5C9AA 2LALA 4LBMA 5FZ9A 1NQDA 1WLTA 2FDGA 2IFRA 1H6YA 1OMIA 3IPVA 4JGYC 4DB5A 5J3UA 4UW4A 2XBO3 5JSPA 4FOVA 2OKXA 1AYN2 1ASJ3 3H42B 4Q2FA 3W59A 3I2JA 3UGFA 1F31A 1VBB2 2WNOA 1YNAA 5FDBA 1OLME 4QXKA 1GUIA 2ORZA 1RINA 2WSUA 3R4DB 3EHKA 1FT9A 2HWB2 3KV5A 4KMQA 3CDZB 3DXUA 4COZA 3V0AA 1C8M3 3ABZA 5FZIA 1G86A 1LKNA 1SBDA 3CO2A 5IYYA 5ACA1 4U36A 2ET7A 3NVCA 4UW6A 2BFUS 1FV3A 2BWAA 1DLLA 1PO23 4YZ1A 3V0BA 4ZU7A 5DQ0A 4A42A 2DCTA 2WUHA 1I3HA 4UOJA 4RR3A 1OPMA 1CIYA 1Y4WA 1QJX2 2OPWA 3H8OA 1PMJX 4R4XA 1XYNA 4Z1VA 1Y7BA 4JGZC 2C4XA 2PHTA 3JB8A 4NIAA 3BIEA 2DDUA 4DEQA 5A7WA 3ORJA 1DYKA 1RUF3 1A8DA 4XJUA 3FBMA 4DEVA 1SFPA 2RS11 4HANA 3C7GA 1HB3A 2KXLA 2A5ZA 4L92A 1AXKA 3BGAA 3ST7A 4P9GA 2JX9A 3OBAA 3AB0A 5ACA3 4NIGA 1R64A 1URXA 3IMMA 5FZDA 3MW2A 4LKFA 1C4RA 4UFIA 5A3NA 1CGPA 4PQ9A 1V70A 4I0AA 4BHPA 3ZIWA 4FSJA 3LIGA 3ZFFA 2PQQA 3OYWA 2ZKNA 4OYUA 2AENA 2JG9B 2TEPA 2ZOEB 1U5ZA 3AK0A 4RQPA 4RGGA 5LA9A 4OQ9A 2YPDA 4AVSA 2HWC1 3ACHA 2G9GA 3PIGA 1POQA 2I2SA 2JG9C 1C1FA 2LRPA 3JCIA 5FYTA 2QQIA 1BVVA 1IZ3A 1PO12 3ZYIB 1VALA 2B45X 4PT6A 2D40A 2YC2A 3OB8A 1UOJA 2Y26A 4YVSB 4Y1YA 1RHI2 1UU4A 2RJKA 3IZOA 5J7MA 2UYAA 2YB7A 1JYTA 2ZHLA 2PLV2 1J3RA 5JOXA 4A7YA 3FLRA 3M3EA 4IEYA 1ZRDA 2DCKA 4ISQA 4M3CA 4CUGA 1SLLA 1K12A 3LOIA 3LQCA 2FQPA 4Q4V3 2QQMA 2RMU3 4URTA 3HBZA 2ADEA 2R30A 3VKLA 4NPRA 2MEV1 5KC6A 2WC2A 4B4PA 4H3WA 1XNTA 4C0HA 4OULA 1CPNA 2ZEWA 4AGVA 2IXHA 1VBA1 1X9TA 2EA7A 1UZWA 2BBVA 4NOTA 4D94A 1PIV3 4YGCA 2EXJA 4FPFA 3ME2A 3UETA 3PU3A 4CRQA 4CEWC 3VDBA 1D4M3 4K20A 5F5AA 1DQ5A 1DIWA 2QDRA 1FPN1 2GC1A 4XJZA 3O1VA 1CZTA 3BYWA 2DCJA 4FCAA 1CR7A 2R49A 4P9YA 5EP9A 5FP7A 2BBAA 4HN1A 4CDUA 3VB9A 2G1MA 3WQ0A 5J36A 2WYSA 4LA2A 4RS5C 5FZ7A 2ETEA 2WFPA 1DG6A 4XQWA 4B8EA 1BJQA 1NCRB 2MEV3 3CBNA 5FYBA 1F5FA 2QJVA 5FZMA 1F4AA 1JW6A 3AZYA 4LK6A 2P3JA 2FDJA 2V4AA 3U1XA 5FV3A 3RI8A 1O3SA 2TNFA 1VBA3 4JAAA 5JXJA 3SCFA 5A7NA 2E33A 3SKVA 1WUVA 4ASMB 3I54A 1VMJA 3LA7A 3RYPA 1OA2A 3VZOA 4AW7A 2RS32 4BLJA 5FMCA 2AYHA 4GULA 3WZ1A 3D0JA 3EMRA 1ST8A 3O5SA 1CAXA 2P4EA 4XFFA 3A4UA 1QOTA 4CYDA 4IE5A 2Y8KA 3PVBB 4DRRA 1XU1A 1UKRA 2JKXA 3FHQA 2GU9A 4FFHA 1DQ1A 2GSYA 2LM3A 2VE1A 4UYBA 5D1IA 4LULA 4RHV1 4EN0A 5C9AB 2QQKA 1FYUA 1S4CA 2HEYF 1IGOA 5FZFA 1KQRA 1PVXA 2VVFA 3PL0A 5FK8A 1RUI2 5K8SA 3AVRA 1X9PA 1YRZA 2VZVA 1DYPA 4FTEA 1FOD2 1CWPA 4WZCA 3KWVA 3C7FA 3LDRA 2TUNA 5BXXA 3WG2A 4AVVA 5JDBA 4JVAA 4D3WA 4LBQA 4Z2AA 3CLPA 2GC0A 4BQXA 2BGCA 4QKDA 3OBZA 4HK9A 4CP9A 5GZCA 2A73B 4BH9A 1D7PM 2TBVA 4YVWB 4N53B 2Y6KA 1MZ5A 5C6CA 3T2TA 5FIXA 2H0BA 3V0AB 2BVVA 4O9EA 1DQ2A 4N53C 4Y26A 1LGNA 2Y6GA 3N7MA 4RHV3 4YVWC 1UXXX 2W95A 1MZEA 2E32A 1AR91 4FPYA 4P14A 4ZS3A 3V0BB 2OVUA 3GBWA 3VZKA 2W46A 4AK3A 3H3ZA 1BEV2 4CEYC 2AEYA 4RR3B 2QZ2A 2WA3A 1AHSA 2K2SA 5M0TA 5LY2A 3J7NA 3VN4A 4CA9A 3UL2A 4A4AA 1RUH1 2ZX3A 4Q4Y1 2RR11 5A7WB 2OT7A 5I91A 4LNVA 3PTRB 2JIGA 3FBYA 5FO8B 1XC6A 4ZPIA 4DXSA 2AUYA 1MQTA 4AI3A 4PLOA 4FPCA 2RDNA 5DAQA 5JUVA 4JKKA 4AOCA 1X50A 1AL21 2QQWA 3LCPA 2Y34A 3CJIC 3JBG1 4HT1T 3ZXLA 3N9PA 5HBAA 1RUJ2 3WQBA 1S1AA 3JQWA 1ZZ9A 1RGSA 3N9OA 4IEXA 1SLBA 4Q8KA 2FDIA 3GCWA 3AKSA 1X8MA 1EAH3 1AR82 1HRV3 2NM1A 1CAUA 3I2FA 3OYWB 3ZFFB 5FTTC 4BCUA 4DPNA 3BTYA 2RM22 4KGQA 4N7UA 4RQPB 4ZU4A 1J59A 1RUH3 3TEXA 4Q4Y3 1CZVA 1ZA4A 1HB2A 2DUOA 3S5QA 3PMEA 3AZXA 1NE6A 3GZTB 5FCCA 2W9XA 3S57A 2VCMA 3LA3A 3T0DA 2YFUA 1AYN3 3H1YA 4BYYA 4EROA 4WVMB 5JXIA 1CX4A 1VBB3 5J96B 5BNOC 1AL23 2WDBA 3JBG3 4CVUA 2WO3A 4FPLA 4MHRA 2VNGA 1S0FA 2OS2A 2VMFA 2HWB3 2XKPA 4FI9A 2PA7A 4M3CB 4RGKA 2XDVA 3LSDA 2JKBA 4AQ2A 1QQP2 2YGMA 4XJAA 3MF6A 4KL1A 1ZA7A 3A21A 4MYEA 3VZLA 5L9RA 3CL1A 1DP0A 1PX4A 2D6LX 3MBWA 1H4GA 5SV5A 4XUOA 1Q8PA 3T0AA 2A75A 1R1ZA 3EXUA 2D98A 3N3HA 3I2DA 3HQRA 3SEPA 3J26N 4IV3C 4BQ3A 2WINB 3URFA 4CPBD 5IVVA 1T2XA 5BNNA 5LEJA 4P9XA 4P5HA 1AR72 4IGQA 1M4WA 1ZM1A 5C8CC 1SLCA 2ID4A 2R6QA 3CIHA 2KM2A 2WZR2 3TYJA 1POV0 3HT2A 4NN0A 5KBFA 3O1SA 3K4AA 4WM7A 1IS4A 1VBE2 5A3OA 2FDKA 4CCLA 3ZYJB 4D6SA 3B9CA 2XWBB 5LBEA 4R52A 3RYRA 2XR4A 4QQPA 2HLEA 1B35C 4COWA 2OA2A 4XF4A 4EZHA 4XQDA 5BUVA 3TWIA 2Q8EA 5C4WC 4AGRA 1PO13 5FXWA 4IEZA 4AI2A 5B4NA 2BVBA 2HYKA 1RUE1 1OA3A 5FPLA 4MGQA 4W4ZA 1NKGA 2NMNA 4XMIA 2JICA 4XFIA 3HEIA 2BP6A 2PLV3 4GD4A 4NJ4A 4ZXKA 3PUHA 3KQ4B 1LEMA 3JZVA 1C8NA 3IT8A 4L2NA 5F8PA 4HETA 4NUBA 2B9UA 3B94A 3BVCA 3WLUA 1KEXA 4UXAA 4MXVA 2ZHMA 2NLRA 3LEIA 2AZ5A 1BCXA 1GQPA 1JU3A 2YROA 3HAGA 3JU9A 4MOAA 5F6KA 4BQ4A 3IN9A 4IV1A 4LBQB 1FI2A 3NNMA 3BUCA 3WOGA 4RL7A 1G7YA 1OVSA 1RUE3 4E8DA 2DUPA 4YGBA 1H1AA 4CP9B 2DFCA 3MV01 5FXXA 2ZJCA 1RJ7A 2VBDA 3AKQA 3THDA 2J22A 1GZCA 4QM8A 1Y9GA 1YQ5A 5C7GA 1XNDA 2I07B 2WABA 3TB0A 3KQRA 3P6BA 2XGXA 3C2UA 4N9HA 4E2SA 2VH9A 4AQTA 1LOEA 5HCBA 1WCKA 3MDPA 3ZSKA 1TMF1 4YW7A 4QGLA 1KJRA 2CDOA 4JRLA 4JRAA 1SACA 3WNLA 3ZYRA 1MEC1 3HD8B 2J1UA 3PMSA 4HSLA 3ZOIA 2MHFA 5FOBB 4OI1A 5ABJA 4MHUA 4N43C 3KCXA 5HXVA 1DFQA 4TYSA 4X8PA 3FZ3A 3VDDA 2AH2A 2QUOA 1PGW1 4CUAA 3NRUA 5FLIA 5I0TA 3WP5A 5D8AC 5A1FA 3MIEA 1LHOA 1OQ1A 1JH5A 2HWF1 2WNVC 1H4HA 4TLFA 5TSWA 1AYM2 2RS33 1D4VB 4XMAA 1QJZA 4AR2A 4GAZA 3LEKA 1RXGA 2FMDA 3H8RA 4R4ZA 1NCQA 1UO9A 1TMF3 1E5SA 1SHWB 4MH0E 4Y1VA 1IQDC 5IUQA 3OUIA 5C3SA 4YM3A 3RPQA 3V65A 4N9IA 3O1OA 2XVLA 1HV1A 2A6WA 4J1XA 3POFA 1WW5A 5EZWA 3I4IA 1BYHA 2WT2A 1UU6A 4XFAA 2VD7A 2CDPA 1YIFA 3QCWA 3NWKA 1VAMA 3DKWA 4LE3A 5A7PA 4XURA 2GC2A 5T50A 2RS52 4Y22A 4XE9A 4Y4RA 5DG2A 5SV8A 2JJ6A 3FLTA 3HQUA 3J4UH 3MO4A 1Z7S1 3ENRA 3W9AA 4JTOA 4Z8BA 1JHNA 4LE4A 4PBOA 3ZKUA 2IVJA 5IVCA 1JZ3A 3I49A 4MADA 1RUOA 2HWE3 3H0OA 3AC0A 4QXCA 1KRIA 4A7KA 1PNGA 5DXDA 3B69A 3NNJA 3GZEA 4CDQA 3MYXA 3O12A 1XB9A 1IOAA 3K48A 5LASA 1VP6A 1RJ8A 3LSEA 4EN7B 1UF2C 1JOPA 3VBRC 2GNMA 1HB4A 4AFAA 5JCTA 5A32A 4DOUA 5L19A 3RZJA 3LAGA 3KS7A 2IFWA 4BE3A 1RMU1 3OGJA 5GZDA 4QDQA 1FNYA 4Q4W1 5EFUA 2WFF1 1BK1A 5T52A 4QPGC 2DCZA 4RGAA 1I5ZA 3EJKA 2VU9A 1IPKA 4O65A 5BNNB 1XSRA 1VBC2 4QPIB 2E26A 5CU1A 5L9BA 5FK7A 5FY0A 4HL0A 1OHFA 1ODNA 1Z0HA 2NN8A 3CEWA 3DYMA 1S0DA 4KBBA 2YYOA 1S0BA 2A3YA 3HOBA 1RUJ3 4PCRA 3HNMA 1W3XA 1Y3TA 2A3XA 3K3NA 3HIFA 4NAMA 1O59A 4WM7B 5LBCA 4AFCA 3IIIA 4QXHA 3HNBM 2GMPA 1J3PA 4BOWA 4ES9A 1AR83 1GZTA 5A3LA 4OQ8A 1HJGA 4UW5A 5BNPC 1U5YA 2GH2A 2ARAA 4GZ9A 2FD8A 1OF4A 2VUAA 3ZXGA 2C26A 1HIXA 2VOXA 3N7LA 1X8EA 4YRDA 4DXZA 4Z2WA 4XPVA 3D4KA 3LE0A 4HG6B 4XXPA 3ILNA 3WNOA 3WDTA 4V2WA 5A80A 5G05L 5EPAA 1LOFC 3K4ZA 2C0ZA 3JD72 3FWEA 5AC91 4Q26A 1MPXA 1QWRA 2O14A 2VW2A 4GJYA 3WDUA 1IS6A 1ND2A 2VMGA 4B7EA 5HPOA 1RUNA 3IM0A 4XTPA 1UZZA 1OI6A 3SLIA 1QQP3 4AEJA 4YG3A 3NJZA 2XOMA 3Q8BA 1WW6A 3KVAA 3BPZA 5C70A 4OMCA 2UWCA 5AVPA 3PTYA 2P3YA 4R9CA 1TE1B 1FAYA 3NL1A 4I3PA 4IV1B 4Y3OA 4FAHA 3H1WA 5JI9A 4GWMA 2HBUA 1YI7A 3LKJA 3POWA 2EAKA 2D3SA 3GDBA 2WNUA 1GR3A 4UI9L 3VV1A 1N1SA 3FHAA 3H50A 1ZRFA 5DAWA 1H8TC 1AJOA 5IW0A 4QX2A 5ACA2 5BV6A 4AI9A 1PMIA 1O7FA 1QEXA 2UWAA 3MUY1 1UYYA 3AYAA 4MO3M 1VAKA 1AR73 2XWJB 4UFHA 5BY5A 3G6JB 2JECA 5FP4A 3K2OA 1XNAA 1HDKA 2Y6FA 1CAVA 3HWJA 4RFRB 4XBNA 3WDXA 2W1WA 4XIKA 4E8CA 1VBE3 4CP2A 3A0KA 5ABJB 3W5MA 1Z78A 4JGYA 5GLTA 2RS12 1HN1A 2AC1A 1OKOA 4QPWA 5FKCA 1GP6A 4GB31 3W58A 1NXD1 1ZREA 2WAAA 3FHIB 3K51A 1Q8SA 2IWGB 5F3EA 1W0PA 1NCQB 3ZMOA 4LOTA 1MACA 5FQ0A 3MICA 5IFTA 1PVC1 2ZGRA 2XMLA 3VBOC 2PTMA 2VVEA 3H9AA 4AZZA 4BB3A 3ZX7A 4MGYE 1WA6X 4AE2A 1CQ9A 4C1XA 4ZS2A 2P3IA 2HWC2 4CU6A 3I3DA 3APBA 4NRQA 4BJ0A 2VXRA 4JGZA 1CONA 2PAMA 3ZFEC 2QQVA 4NPLA 2PAEA 3AZWA 3VD3A 4A6SA 1SMVA 4Y22B 4BK4A 1JZ7A 2FDHA 2DURA 4QQHA 4F3JA 3ZXFA 2JD4A 1W9SA 1RIRA 1NZIA 3IAPA 1ULOA 4I30A 4MUVA 5KR7A 3B93A 3DN7A 3RMXA 1QNWA 2EIBA 1DGWA 1D2SA 4PIZA 4LA3A 4CDQB 3AZVA 1LCLA 1QXPA 2Y60A 3T30A 3R0RA 4A3XA 4IUGA 2FBEA 2IZWA 1SPPA 3I3QA 4PIYA 3T09A 1PMHX 5IHRA 1QDOA 3ETQA 3ZVXA 3OPTA 3S7EA 1IKQA 2MEV2 2VOWA 3ILRA 3KZ4C 5T5PA 3BALA 2BZDA 5FMBA 5APAA 5JR7B 1LEDA 3SHRA 4PJYA 1CJDA 2ZA9A 3IDEA 3SNMA 1VBA2 2JG9A 3ACGA 2VUCA 1W6NB 3FE5A 4A7ZA 4K9SA 5KC5A 2HYXA 3KGZA 1REEA 3KT1A 2G4IA 4XUNA 3D82A 4NROA 1FPN2 3UK9A 5DUWA 2JENA 3LPGA 4LBQD 5ANQA 1AYM3 4WBBA 3PUIA 5IWFA 1HQNA 4NIIA 2P6CA 4CCJA 2HWD1 4IEPA 4I02A 2W2IA 4IW3A 4FO9A 3M8LA 5FKBA 2ZMKA 4NPMA 1PGSA 2Q30A 3BTZA 3MZHA 5FZ4A 5A33B 1UZVA 4BQYA 3FJSA 1O6UA 3QD6A 4L9BA 1ND3C 1PNFA 3SEEA 5IK4A 2V73A 1WCSA 2E6VA 2ZGMA 3V64A 1HXS1 4AVCA 4WVWA 3DUIA 3ZN6A 1ALYA 1ONAA 3C7HA 1UOGA 4HLTA 4QU1A 1FMD1 5CFCC 1DF0A 3K75B 4CEWA 1YLLA 4META 2XXZA 1W05A 2BJSA 2HWD3 4S2DA 1VRBA 4L11A 2ZMNA 4M0HA 4PIXA 1W90A 5JVVA 2H0VA 4RHV2 4S2FA 3OJBA 5F3CA 2ZAHA 4YARA 3O1TA 1ND2B 3O1UA 4FPOB 2WKKA 4RS5A 5IVYA 1N1VA 2VAUA 4K1ZA 1YC61 2WWSA 5DG1A 1VRH1 3U11A 4Y1XA 1GP4A 1HXS3 1DLCA 2A70A 3OBTA 4Q27A 4QT6A 1UPIA 5K7PA 1YYNA 1V9U1 4J1WA 5F3IA 3RI9A 3ZMNA 5C3PA 2EAAA 5I0DA 1VB4A 3SITA 2VQTA 1S0CA 3LB9A 1FMD3 1SCRA 2VTFA 5GZEA 4YM1A 4MZUA 4BMEA 2XJQA 3LDKA 1N47A 2A1XA 3AJZA 2WNUB 5CFDB 4UFKA 3BU7A 1RVF1 3DL3A 4NHMA 3I3MA 2YC4A 1OLRA 4K21A 5FJHA 3Q9OA 1U5IA 1AR92 2B8MA 2E9QA 1H2NA 3DXTA 2ZABA 3MLLA 4Q0UA 5I8YA 1XE7A 1UU5A 5EYXA 3PUAA 1N1YA 2P1BA 3NQHA 1V9U3 1WA4A 3NKTA 3SH3A 5JPMB 4JGYB 1RUH2 4AQ6A 5GKAC 4Q4Y2 2RR12 1JTZX 2VCCA 1WMDA 1J58A 4HONA 5FYIA 1KS4A 1YQCA 2P6HA 5CB7A 4IE0A 4LEJA 3NMBA 5FO7B 2WT1A 4HKWA 3B01A 3OBRA 4AXOA 1J83A 1AL22 2F4PA 2ILMA 4XAEA 3JBG2 1NX9A 1YXWA 2VM9A 4KU7A 3LEMA 5E16A 4BWOA 4LO6B 4YVWA 1E5RA 4N53A 2C5DA 3KCYA 3JD73 5FQ0B 1EYBA 2ZACA 4Y33A 2VCBA 4BIOA 4I0BA 3H1MA 4GALA 3SH4A 5KXBA 4Q4X1 1CPMA 3QBQA 4FPKA 4CEYA 1NLQA 2F6BA 4DIQA 2JG8C 4AI8A 3HPNA 4DUXA 4JGZB 2VJXA 2HBTA 5A6QA 3U78A 5FOJB 1LENA 4GH4C 1UN1A 4P02B 4V2VA 2D6MA 3AKPA 4N7IA 1MZFA 3FUQA 5LRRA 3DV8A 3O0WA 3G7DA 1WMXA 1UYZA 1ENSA 3NNFA 4CCDA 3VBUC 4FPHA 3QACA 4M3CE 2C9KA 5F5CA 4YGEA 5CAZA 1N1TA 1O8PA 1SPPB 3GM8A 4Q4X3 4NHXA 3U07A 1IQAA 1O91A 3N7JA 4Q8LA 1K3IA 4UF0A 4JX0A 4NAOA 4PI0A 3I97A 5DABA 3WCRA 3DYOA 1B09A 1KDMA 4FXKB 1H30A 1W8HA 5FYCA 3C3VA 4DO0A 2ARCA 4AVTA 3D5OA 5C5TA 3NAPC 2O0OA 2VY0A 1XPWA 5DPNA 5C3QA 3WNNA 3ZR6A 3C7EA 2RS13 1NUKA 4CP1A 2GH8A 2WJSA 4O7XA 2CGPA 3WF0A 2JDYA 2IXKA 2PAKA 4MVTA 2ES3A 3SCGA 1Q56A 3SCHA 3AP6A 4WVMA 1OQDA 4TTGA 4EZ4A 5FZKA 1QY4A 1JYCA 1WLWA 4XILA 3IWZA 4KU8A 3S6PA 3TOJA 2WAOA 3LOBA 2YG0A 3E97A 4KWUA 5FY4A 1JBCA 3WUDA 5JLVA 2YDEA 1GQHA 3LF7A 2C24A 1N3QA 4PBPA 3WQ7A 2OQ7A 5LCWL 1PZ8A 5C3RA 4G4FA 2HWC3 1HB1A 1V6MA 2ATFA 4Q0VA 1RXFA 4AL9A 1G9DA 1DHKB 2W68A 3GYDA 1VAVA 1SG3A 3ZN6B 4AWDA 5EIYB 1RUE2 4CDXB 2PXJA 5L9VA 2VW1A 4CEWB 2BNOA 4IV3A 4CDXC 4CCKA 3RVHA 3KB5A 1JZ4A 4OI2A 2UY9A 3WY6A 2VXJA 3NJVA 2O1QA 1YQ8A 4QWNA 5C8CA 5H9PA 3MI8A 4D7SA 4RS5B 1O4YA 1OD3A 2VW0A 2JE8A 2YFZA 2WS91 3POBA 4IEUA 5ISLA 1G8WA 1CIWA 2IUWA 2R16A 2GN3A 1B35A 2P3KA 1I9RA 3WNPA 4D69A 1DZQA 5AFEA 2PMWB 5C4WA 2YUEA 4YPJA 3WX5A 1RB8G 4M4RA 1W06A 4NO4A 1TME1 4NE9A 1KITA 5A70A 3IMNA 5B4XA 2ET1A 3ZDSA 3LIHA 2LW8A 2A7AA 2W08A 3K77A 1FPN3 1QXRA 1H6XA 1TMF2 5FYHA 1F2NA 3Q8EA 5FREA 2WA4A 2VPVA 2EALA 2ERFA 4GJZA 1H1IA 4NMIA 5L7OB 1AXZA 2QDNA 1PGW2 3VLBB 4B7KA 1YQ2A 2VNRA 5KXEA 5L7OC 2JB8A 3KMHA 2UU8A 3CKHA 3OCPA 1O5LA 1W3VA 2HWF2 4D0QA 3Q8FA 3INAA 1EPZA 1T6BX 1EV11 2BDRA 5CADA 3IDAA 4KGGA 5CKNA 1O3RA 5HCHA 2HEVF 3ZYPA 4W65A 2HWE2 1JYVA 1UYXA 5JXHA 5JAXA 2B9VA 2WN3A 5DN2A 2W52A 3TNQA 4EQVA 5J1XA 2JEMA 1ULCA 3WHTA 5FPUA 2FZ2A 3GZUC 3LDBA 3SQOA 5FZ1A 5FZHA 4JCKA 3BOWA 4KWJA 5GLWA 1F8VA 4CEYB 5F5IA 1RUD1 3PVNA 4NWWA 3OF1A 5CKMA 4GMP0 4N43A 5F3GA 2VECA 1VPHA 2X05A 5ERLA 2BTVC 3WG4A 1JYIA 2GNBA 1Z7S2 2VR4A 2WQZC 1S2KA 5D8AA 2W3JA 1TNRA 4QDSA 5LZ6A 1LNSA 1UY3A 1VE0A 4EN8B 1W9YA 1WW4A 4XF3A 5F9TA 3DYPA 3IKWA 1YFYA 4XHXA 1BQPA 2CYFA 4AG4A 5FBZA 1C5IA 2EIDA 3FC0A 3CJIB 1WLDA 1QJY1 3OGGA 4KWLA 4LIUA 1ENXA 1WBFA 1BLZA 4A44A 1S0JA 4JHZA 4WM8C 1AR93 3H3LA 4Q0PA 1R091 4LK7A 5IK5A 1UIJA 1RUD3 2QQUA 4U2AA 4UF0B 2UURA 3I2IA 5JSOA 1RMU2 3OEAA 2XJRA 4GA9A 4Q4W2 2E7AA 2WFF2 1RYYA 4EJRA 2RR13 1VMFA 3W21A 1LULA 4ET7A 3B02A 2FCUA 4YW3A 1IS5A 1DGLA 1R081 4FOQA 5FY7A 4C0BA 5BNOB 1VLNA 3WW3A 4S2HA 1US3A 4QGNA 4C8DA 2XB6C 1VMHA 2O8OA 4R9BA 4XEZA 2W47A 1GOGA 1NG0A 1R093 1V6IA 1Y9QA 2Q4SA 3L2HA 3DKQA 3N9NA 4LBKA 5JOZA 1JMUB 1KDKA 1OOPC 3EBRA 4AQSA 4OUSA 1Q5OA 4WV8A 3VBRA 1DCSA 2X5IC 1O4TA 4JV4A 1G9FA 5E1RA 3RFRA 3ZXAC 2ZGLA 3QH6A 4IGPA 2EXKA 1R083 4P9WA 5FZCA 2WLPA 1O3QA 1UKGA 1FV2A 4QPGA 5F37A 3WF1A 3IDCB 1TVGA 2PHLA 1W6QB 4LKSA 1W8WA 1X7NA 1SLIA 4FFIA 1HJFA 1UIKA 1MS1A 4IV3B 5J98B 3ZLIA 4IXLA 4FTSA 2RHPA 5FYVA 1E5IA 1OPOA 5C8CB 3MHZA 4QPIA 1COV1 4PF5A 5C33A 1ZYBA 4ZZ5A 4AEMA 2Q1MA 5H9SA 1LOAA 4C91A 4NRMA 2W91A 1WKYA 2AREA 4HN0A 2XJSA 3PDQA 2SLIA 1UY1A 1GWMA 2R071 4HOOA 3U14A 1B35B 5BNPA 1RTVA 1A34A 3B7MA 3BB6A 2WQ8A 4XACA 2YV8A 1QOOA 5C4WB 1NQJA 4FFFA 1X36A 4D8MA 2D6PA 5L73A 3TEZA 4HPKA 3V56A 3BIWE 2B46X 1UZYA 2XG3A 1UYPA 1LOFA 5A7OA 3MIGA 5EXOA 4OI0A 3WP3A 3RNSA 5FPVA 2YC0A 3P1IA 5E8AA 3HT1A 4CDWC 1AJKA 1C3HA 2QTWB 2I45A 2XVGA 4CDUC 4XQ4A 1LAJA 2J1AA 1DQ0A 3AP7A 3VZJA 2DWRA 2NPIA 4LJHA 1V6JA 1SCSA 4Z82A 4IDZA 4G3YC 4GB32 1YIPA 4QX5A 1JOJA 3WF2A 1LRHA 2ZXQA 1KS5A 2E51A 3U4XA 2A6YA 4YWAA 4ATEA 3MV11 3KSCA 4Y5Z0 4OVEA 1H8TA 4TSVA 2CL2A 3OSDA 2UY8A 4MGIE 1GFF2 4UBGA 1ZZ7A 5CYYA 1WCDJ 2A71A 2J7MA 3N7KA 4XBQA 1KJLA 4QM9A 4K6BA 3O0XA 4ZKTB 4R9DA 5GZFA 3LFIA 1S0GA 3BCWA 3BPSA 1KXGA 4N43B 5DAPA 2DU1A 2BOJA 3QLQA 3DPRC 1YFWA 3ECQA 4LKEA 4UAPA 4BLIA 2CWMA 1GNHA 5D8AB 1WD3A 4IL7A 3OY8A 3ALQA 4AI0A 2YU1A 4CUBA 4CU7A 2WNVB 5F2SA 3U37A 3ZSLA 1PK6C 2BERA 4DMIA 3BTXA 4DUVA 1IG0A 4R8HA 3SMHA 3VD7A 3M7AA 4DXTA 2VC9A 1OC1A 2UWBA 3MIBA 5T55A 1G9AA 1QHDA 3RSJA 1ZZ8A 4M4PA 1ACCA 3R4UA 5DDJ1 3A22A 1S2EA 5IJRA 4AEDC 2XVKA 2BOIA 4E4SA 1V6LA 1KD7A 5IAXA 4D6QA 1LU1A 1Q43A 4BZ4A 3GJBA 1M06G 4GXLA 4XDQA 1MEC3 1S0IA 3AX4A 3ACFA 3RZGA 3UGHA 2HEWF 2ZGTA 2JDNA 1SDWA 5HCAA 2SBAA 3ZFEA 4HSJA 3WF4A 3PJQA 2ADDA 1IKPA 5FY5A 5K0UB 1TEIA 1MVEA 2HWF3 1X82A 4JDMA 3THPA 5K0UC 4AVAA 4LLOA 1V00A 4JDOA 5F5QA 1O4ZA 2NMOA 2WZ8A 1D0GA 5F6LB 1YHFA 1GKBA 2HWD2 1W8UA 3LEGA 2HJIA 3VBFC 3GNEA 2FCVA 3GGLA 5EWSA 1EY2A 1A8MA 1W2UA 1JYXA 3RQ0A 3ZO0B 4EYUA 4KI5M 3WDVA 3VBRB 1JN2P 2XL7A 3P3PA 2FHRA 1YUDA 1WZXA 3ZKYA 1HXS2 4PQQA 1IS3A 2VL4A 1QJU1 2W0XA 4XZUG 3UJOA 1FMD2 4LTAA 4QPGB 1K5MC 1NA1C 1YI9A 4BQWA 1UY0A 1W6NA 1Z7S3 2VZ3A 4WVZA 4KWKA 1K42A 3E6DA 3WW4A 1OKQA 4B29A 4F7ZA 5BYNA 2JDAA 3UKTA 2JWPA 4JZRA 5FMOS 1STMA 3UGGA 1MR5A 4HXCA 4NR1A 3T3YA 3ZYFA 4QB6A 2R0FA 4LIVA 2P5BA 2R061 1PGL1 3I2OA 5T5LA 1VRH2 1J84A 4CCMA 4OHXA 1DQ4A 5CBLA 3ASIA 1V9U2 1QJU3 1ULEA 3WF3A 1ND3A 5BNPB 5DUUA 2D5FA 5A33A 5IVJA 1RMU3 2H6BA 3AJYA 1ZRCA 1AF9A 1MS9A 2OX0A 3NV4A 2R041 4Q4W3 1WMFA 2V72A 2WFF3 4QKNA 4MGTA 2QCSB 2C9AA 4HPKB 4YG6A 2XUMA 1HQLA 3OD0A 4GQ7A 1GWLA 1RVF2 1NLSA 1IPJA 2WN2A 3KV4A 5FLHA 5G04L 5K4LA 4B1MA 5CFCA 3WNKA 2WSVA 3ILFA 1QIQA 4HBNA 2ZPXA 3BN6A 5KXDA 3AFKA 3ZDVA 4YSFA 4JHTA 1BXHA 1L7QA 5CG9A 5FAXA 2CSGA 2DTWA 4NIDA 5DAXA 4AHWA 2Y38A 3VL8A 2NZ9A 4MGZE 5F39A 3BKZA 5JR2A 1ZZBA 2GNDA 5J37A 2QQPA 4QDRA 4GIQA 4OLLA 5DUVA 4B4QA 5LRSA 5CIRA 2KR2A 3RZHA 1Q8VA 1HRI1 4FQZA 4HVOA 4ARYA 1UX7A 3POIA 4QB2A 3RGBA 4URAA 4DZGA 3MPBA 3NSTA 1CZSA 1K5JA 2WYFA 5EYYA 5LWBA 1W6OA 3ZN5A 3D8CA 3AMQA 3H8XA 1H2LA 2IXCA 5HCFA 2J1EA 3NJXA 2B42B 1UAIA 1WLCA 1WWYA 2EXIA 3HR9A 3SH5A 1F15A 1IHMA 3IB3A 3KGLA 5JOYA 1UXZA 1H8TB 5CFDA 4ASKA 3U4SA 5AC93 3M3OA 3VBSC 1PX3A 4IEVA 3FMGA 4QHZA 3OUHA 1UY4A 1O8SA 4Q4X2 1LODA 4IGOA 2PQSA 4GMP1 3ZYHA 3AL6A 4J25A 4IEQA 4QQLA 2VOTA 1PHMA 1ULGA 2PHRA 2DYCA 2QQNA 2VNOA 4YZ4A 3C7OA 2B4KA 4X8NA 1LOBA 1W04A 3OY8B 4AHZA 5DUXA 1Q8QA 1T6GC 3VKOA 1MS4A 2DVBA 4V1PA 3N4MA 5B2GB 1OF3A 2MPFA 2WO1A 3KF5A 5FWEA 4K40A 4ATFA 3IBMA 5BPXA 1SZBA 4FXGB 1DGWX 4Q0SA 3WINE 4P08A 3MEPA 5FZ0A 1RUG1 1GMMA 2B7YA 2FCTA 2Q5TA 4KH9A 3VBOB 3ZXEA 1JS9A 4GMP3 5E89A 1W9FA 1W8NA 4BQ2A 2X53S 4MGKE 4K8FA 3I3EA 4CCEA 1UOFA 5KHGA 2VZPA 3U0ZA 1UW8A 1W0OA 1US2A 3NV2A 2CV6A 3ZFEB 5HV0A 1OQEA 2CTVA 3VDDC 1Y9MA 4GH4A 4IESA 5LK5A 3SXWA 3WD5A 4GB33 1GOFA 2PHFA 3EYPA 4YYOA 1XNBA 3K4DA 4QU2A 1NLRA 4XJ8A 3VBUA 3P5BA 4ZZ8A 3D0SA 3VGIA 2XPJA 1V6OA 1UZ0A 1RUG3
chains in the Genus database with same CATH topology
2ZX2A 1JUHA 2VOVA 3MLJA 1PVC3 1GSLA 4QD2A 2BW8A 2XKOA 2GALA 2ZGUA 2YZ4A 4YM0A 1E57A 4HVQA 4ZU5A 2XH6A 1O5UA 2ARBA 3NAPA 2YXSA 4XF1A 1H0BA 3WR0A 4MX3A 3NV1A 1I6XA 1O3TA 2XL9A 2YPJA 1UL9A 2OIIA 4XIOA 1MS5A 2CNAA 3A0NA 2CAVA 3H7YA 1DZTA 3VBHB 4FP2A 4WZFA 4YFZA 2W39A 2WL1A 3VBHC 5JIUA 2WS92 4XFGA 1YO8A 1SLAA 3CU7A 4Q1RA 4PDWC 3MW4A 3AKTA 4YZ5A 2C1FA 4M3CF 3PVEA 4HMZA 1ND3B 4GWNA 5JI7A 2VMHA 2AGSA 1AX0A 2EVXA 1ZBA1 3M3CA 5JPNB 1TME2 3MIFA 5CFCB 4XXAA 4CDXA 4YW5A 4HZFA 4Q0QA 5JSRA 2OPKA 4N90A 3M70A 5I0UA 3ZFGC 5FO9B 1L3JA 2EXHA 4R9AA 3J8F1 4XBLA 1ZBE1 1N3PA 4XHBA 1WW7A 4LUMA 1EV12 4I01A 3CNAA 2Z69A 3O7OA 3ZPYA 1W6OB 4E27A 2R1BA 3FLPA 4OHWA 1RUC1 1OD5A 5DZFA 3L2YA 1LHVA 4Y4YA 2Z5WA 3X29B 2QE3A 5JZGC 3AMHA 4A2UA 1RUD2 2ZGSA 1QXJA 1YFXA 1ZBE3 4H7MA 1LHWA 1VRH3 4YFWA 3VHNA 4EN6B 4W6XA 2D44A 3SISA 3MPPG 1AL0G 1AX1A 5L7OA 1JXNA 2PFWA 1LHNA 5DZGA 4CZSA 4DINB 3WHUA 2IC1A 2KA3A 4SBVA 2XBO1 5KHKA 1ASJ1 4LO4B 1RVF3 1GNZA 2BEOA 1QJY2 1UCXA 3FX3A 3T1LA 4I2OA 3LGRA 4XJWA 5I8SA 1R092 4LO8A 1ENRA 2A3WA 3WW2A 1UPSA 2BNMA 2DVDA 4Y1UA 3ZYGA 1C8M1 1ZVFA 1NXMA 4JQRA 3WT3A 3NV3A 4QQ2A 1XQNA 5I93A 3KLSA 3RWNA 1PO21 2JG8B 2A6XA 4G9SB 2JXAA 2QNKA 3AZZA 5EV7A 1JUIA 1R082 3B3QE 3I7DA 5GZGA 2XJUA 4EN9B 4GH4B 1U5XA 4L97A 1YWKA 1DGRN 1OA4A 3KD4A 4YZ3A 1RUF1 5CVRA 4BQ1A 5KHIA 3S0MA 3ZXDA 3QOPA 3KM5A 1UD1A 2LTNA 2X8KA 3VBUB 3VHOA 3GZAA 1HQWA 3GBFA 4WM8A 3CJIA 5KWRA 1OFSA 2ZAAA 2D3RA 4BMBA 3UKVA 2NP0A 1AXYA 3RRDA 1S2BA 3BODA 4YM2A 2DTYA 4FAGA 5EJ3A 3NO8A 1LESA 4UBHA 3ZSJA 3NAPB 3RDIA 2Z2SB 3MFCA 4BPZA 1HV0A 5BNOA 1COV2 2XJVA 1H8VA 4YNIA 4CP0A 2WT0A 4OI4A 2ZBJA 1OOPA 4AHXA 1VJ2A 3VHRA 5T5JA 2R072 2ZCWA 5KXCA 4H55A 3TAYA 2X5IA 2CY6A 3WCSA 4Q4V1 4COYA 2D3PA 2RMU1 1BKZA 2D6OX 4ES8A 1PZ7A 3UV9A 2ZX0A 3AXEA 2XLAA 2B5HA 2BFUL 2P2KA 2XLGA 4AFBA 2GN7A 1W6QA 4P9IA 4YVSC 4AGGA 1A78A 1PIV1 4C90A 1D4M1 1GZWB 2BPA2 3JQXA 4OHZA 4B4RA 1RL3A 3VKMA 3TN91 1GANA 2ENRA 2DFBA 2A6VA 1REDA 3OD4A 4M0NA 3WW1A 4UW3A 4IQPA 4WVVA 1OLQA 4F8AA 4FPEA 3M1HA 1GZ9A 2BYVE 3BTAA 4AFDA 3M3QA 3T1MA 3S30A 3DF0A 3ZSEA 3BOPA 2JE7A 4LHKA 3OTFA 4M00A 4MLOA 2D93A 1H2MA 1AR61 1DQ6A 3H7JA 4XETA 5A3MA 4CDWA 1XYPA 1N3OA 3TN93 1CESA 2WS93 1BZWA 1MEC2 2PHWA 4AEKA 1VIWB 3I8TA 2JE9A 2GDFA 2P17A 5GLVA 1BBT1 3RZZA 3GBGA 2GAUA 1NCRC 3AP4A 3VUOA 5K9YA 1ZX5A 2DCYA 1C57A 4CTEA 1R1A1 3GF6A 3OPZA 1TME3 2ZHKA 2CGOA 4E2QA 1DGRA 3VL9A 3WP4A 5DDJ2 1AR63 4FVVA 4QHBA 3O0VA 3TBDA 1VBD1 4OHYA 2ZHNA 3KT4A 1XNKA 4EWEA 4IERA 3B00A 4XFCA 2ZTNA 2RE9A 1BBT3 4NHKA 4MXWA 3WVJA 3RG0A 4RSUA 5C9AC 5I8TA 4XF0A 2ZZJA 3IPVB 1YFUA 1R1A3 3DPRA 4RD7A 4XYXA 4DS0A 4TZDA 1A6CA 3MIHA 3RJ2X 1QH7A 3HN1A 1EV13 4D7YA 3J9SA 3WXPA 1PK6A 2V5YA 2RJLA 4OZXA 2WNVA 1VBD3 3I59A 1QMJA 5AVAA 4AEDA 4JC1A 4XZPA 2B39A 1OSGA 4LUKA 4WM8B 2R32A 3WDWA 1NY71 5JOWA 1U12A 1AX2A 1BMV1 2EIGA 1QJU2 4M01A 4BIFA 1EAH1 1HRV1 1DZRA 2D6NA 2PHDA 3E6BA 3LZZA 1I1EA 4RR3C 2CAUA 2ZZQA 4BA6A 1HLCA 3ZXKA 5K0UA 1TNFA 4KQ7A 1AYN1 1UMZA 2VOKA 5GJ6A 1VBB1 1QJY3 3PLQA 1QKQA 2R062 2Z42A 4LR4A 1PGL2 2OUHA 3VBFA 2DVFA 5JIAA 5FPXA 1OOPB 5T54A 4XW3A 1ZRRA 2HWB1 4Q1PA 5JWPA 2X5IB 2R042 1QNYA 1WMEA 3AP9A 3ZFFC 1WGPA 1YJKA 4RQPC 2I74A 4FP3A 1K5MA 1NA1A 3NKGA 1G9CA 1QJX1 2BUKA 3MGUA 3AXDA 3LA2A 3PHMA 1QU0A 4MSVA 4I3GA 4KG0A 4OHVA 3TNPB 2OUJA 3JUUA 3AMNA 5IK7A 1D0HA 1WD4A 4ORFA 1HKDA 2FMYA 1HRI2 2PHXA 3L9JT 5DZEA 2PELA 2ARXA 3M3IA 3POSA 4D7TA 2AR6A 2Q8OA 1QJX3 4OFGA 4Y1ZA 4DRVA 2D6KA 2GMEA 1S0EA 2OZJA 1FX5A 1PO11 3USSA 1RC6A 1SEFA 4E2GA 1DU3D 1SLTA 2WLQA 4LT5A 2WIIB 4FT8A 1COV3 1RHI1 4HK8A 4CDWB 2QFEA 4Y20A 2PLV1 4CDUB 4AVBA 1SBFA 4DY3A 5BNQA 2DU0A 2R073 4S2GA 2ZGQA 3EQEA 1A3KA 2DVGA 1GV9A 1GLHA 4LBNA 2HKXA 2A6ZA 4XFBA 1BVP1 3RJRA 3R6SA 4KNCA 2OW4A 4IEWA 4NHLA 4YW4A 1CAXB 2QZ3A 4EWDA 3USUA 1RHI3 1RUG2 3VBSA 4LHNA 3WDYA 1SFYA 3O14A 1PVC2 1DBNA 2D97A 1G9BA 3P3NA 4MXWB 2UYBA 1HW5A 5AFBA 1LJ7A 1FNZA 2E7TA 2ZGPA 3CJXA 3R4SA 2P34A 3DPRB 4Y24A 4Z92B 3TRSB 2DVAA 1KFUL 5LK7B 5FRAA 5I0RA 1PK6B 4HKLA 2Y0OA 3E5QA 2K0GA 3N36A 3UJQA 2PN5A 3ACLA 4FBFA 3I59B 4TWTA 1GQGA 4AEDB 1PM7A 2RS31 1FATA 2NQYA 1AUYA 2IXJA 4LLFA 2VVDA 3VBOA 4L8QA 1CD3G 2N7GA 3VZMA 1UX6A 3GALA 2CWSA 3GHNA 2YGLA 4HFSA 4NVPA 1MS3A 3JB4C 2YY1A 3AP5A 3ZXJA 4E4DX 1GICA 4I0WB 3DGTA 4IETA 1RUI1 3E6CC 1LB2A 2BQPA 1RITA 1C28A 1FOD1 4Z07A 1MQTB 3AKRA 2YHJA 2G9FA 2OYZA 5DDJ3 1MQTC 1J3QA 5GLZA 3H3UA 2HWE1 3VBFB 2VUJA 2NYYA 3FFQA 4W6WA 5E88A 1CAUB 1ZBA2 1AVBA 3FUOA 4YW2A 4ASLA 1VR3A 1OFNA 1RUI3 5CNAA 5H9QA 3WG3A 2WNEA 2XJPA 2Q0AA 1FOD3 1K5MB 1NA1B 1BEV1 3NW4A 4YLZA 1MZ6A 4XFHA 2ZGNA 1EPWA 3ZIXA 2WQ4A 2O8QA 1EP0A 3LWCA 4XF9A 2GC3A 2V09A 4FPGA 1PZ9A 2PHUA 2ZGOA 3VBHA 5HI0A 4ONUA 3J8F2 4KG8A 3WQ1A 2XLFA 4P9LA 4PDWA 1ZBE2 1LHUA 5F1RA 1J1TA 2Q1ZB 3HMYA 1RUJ1 1Q3EA 3AFGA 1BEV3 1AR81 2DV9A 4J6GA 2RM21 1RUC2 3E5XA 1W6PA 5FLJA 4XTMA 2IXIA 1H9PA 5T3NA 2BNNA 1S55A 2ZMLA 5BNNC 2R063 3ZFGA 4Y20B 4QPIC 2DUQA 4GKYA 3VKFC 4F83A 2D5HA 3MIDA 1XNCA 1SBEA 2BWCA 4WM7C 3AYCA 2VQ0A 3ZN4A 4PLNA 5J48A 1QQP1 4LBLA 3ELNA 2R043 2RM23 2ZKLA 3AM2A 2XBO2 1ASJ2 2GMMA 4QGMA 3THTA 2MNGA 4RA0A 5KHJA 1V6KA 1SQ4A 4E4ZA 4P9JA 4AI1A 1QOSA 3CF6E 3USUB 3VBSB 5I0SA 3RMYA 1C8M2 4L99A 2OZ6A 5CA6A 5JZGA 4INDA 4LO5B 1QF3A 2QKDA 1CJPA 4DFSA 1PO22 4AFMA 4JTNA 3EO6A 3IIAA 3QH7A 4H7LA 1AR71 4K3UA 5FMOL 5C8WA 1HRI3 2WZR1 3WV6A 4O9GA 1LU2A 2ZS6B 3MFAA 3M2MA 1VBE1 5GLUA 3RS6A 3VKNA 1W6MA 4LHLA 1RUF2 2XHKA 4IV1C 4I09A 4C1WA 4COVA 1MS8A 2VULA 5GALA 1XYOA 3ZSMA 2XJTA 3AMMA 4GKXA 4HKOA 2K9ZA 1REFA 4YW1A 3PVOA 4Q29A 5KHHA 4EV0A 1AZDA 1NE4A 1CAWA 1XU2A 2EF6A 2H6CA 3WG1A 2WZR3 4BM8A 1LOGA 1X33A 4OUMA 2IXLA 1J1LA 2D43A 1SFNA 1W39A 1YJLA 2JG8A 5ABJC 3VDDB 3WNXA 2VG9A 3ES4A 2E63A 1LOCA 2JDZA 4ISRA 4XOGA 4YG0A 3M4FA 2P37A 3E5UA 1H9WA 5T5OA 2E7QA 2VMIA 3IDBB 4RFT0 4YZ2A 3VZNA 4EWAA 5IK8A 1NCQC 1YCIA 2D7FA 4JDNA 1ULFA 3D6EA 4Q4V2 2RMU2 3POYA 1NZCA 4ITCA 1U0AA 2Z79A 1F9KA 1QGLA 2X29A 1NOVA 1ZZCA 1APNA 2QVSB 3HQXA 1ZNPA 2ZX4A 4SLIA 3VHPA 1QH6A 2GZWA 5J09A 4FPJA 1PIV2 4W6YA 1V6NA 1C1LA 1D4M2 3MW3A 5FFOC 3KCCA 2VGDA 3KT7A 4LBJA 5JMCA 3GHMA 1AYM1 2E53A 3R05A 1CN1A 4COUA 3TN92 1D2QA 2R1DA 3ATGA 5GM0A 3H8UA 4PDWB 4CDQC 4X6QB 4AYUA 5A32B 2FZ1A 4FOWA 4LO7A 5CG8A 1XRUA 3AMPA 4B3NA 3WUCA 1H2KA 4QMAA 1W6PB 3U10A 1AR62 4YVSA 4FOYA 2RS51 1NYWA 4DNYA 1LGBA 4DY5A 2WZPP 4X6RB 1MVQA 3ZFGB 1LTEA 1POV1 3MLKA 3S7IA 1GZWA 1BBT2 1KFXL 3B9IA 4K1YA 3AYDA 1VB2A 1HX6A 1LGCA 1R1A2 1ZBA3 4LBOA 5LEKA 1ULDA 3PNAA 4XJ9A 3MF9A 1WBLA 2VQAA 2YMZA 4H14A 4K7JA 2CGNA 4NWVA 4FTBA 2RS53 2ZGKA 1VBD2 4FQ4A 1Q8OA 1LECA 1POV3 1GBGA 2ZX1A 5JZGB 4DQAA 1MS0A 3ES1A 3B5LB 2DF7A 4AF9A 1ENQA 1VBC1 3J8F3 4IEOA 4HVRA 1ND2C 3ROUA 4E9KA 1CVNA 1NCRA 2R0HA 1QDCA 3WP6A 4QQOA 1ZZ6A 1W6MB 4QPYA 1H1MA 5IT6A 1Y43B 1RUC3 1FXZA 1TQ5A 3N35A 4PLMA 3UKNA 3PJYA 1G6NA 2WNUC 5CFDC 4AHYA 2LUWA 3RYKA 2Y0IA 1NY72 2GNTA 4MV2A 1VBC3 5L36A 3AYEA 3FFZA 1BMV2 1DDLA 1XXNA 3JD71 2PYTA 1CAWB 1F5JA 1XE8A 1GYKA 3KSCA 1EAH2 1CAVB 1HRV2 1LR5A 4YGDA 1C5HA 5FPZA 5C9AA 2LALA 4LBMA 1NQDA 1WLTA 2IFRA 1OMIA 3IPVA 4JGYC 4DB5A 5J3UA 4UW4A 2XBO3 5JSPA 4FOVA 1AYN2 1ASJ3 4Q2FA 3W59A 1F31A 1VBB2 1YNAA 5FDBA 4QXKA 2WSUA 1RINA 3R4DB 3EHKA 1FT9A 2HWB2 3V0AA 4COZA 1C8M3 1G86A 1LKNA 1SBDA 3CO2A 5ACA1 4U36A 2ET7A 3NVCA 4UW6A 2BFUS 1FV3A 2BWAA 1DLLA 1PO23 4YZ1A 3V0BA 4ZU7A 2DCTA 1I3HA 4RR3A 1OPMA 1QJX2 4R4XA 1XYNA 4Z1VA 1Y7BA 4JGZC 2PHTA 3JB8A 1DYKA 1RUF3 1A8DA 4XJUA 3FBMA 4HANA 2RS11 2KXLA 2A5ZA 4L92A 1AXKA 3ST7A 4P9GA 2JX9A 3AB0A 5ACA3 1URXA 3MW2A 1C4RA 1CGPA 4PQ9A 1V70A 4I0AA 4BHPA 3ZIWA 4FSJA 3ZFFA 2PQQA 3OYWA 2ZKNA 2AENA 2JG9B 2TEPA 2ZOEB 1U5ZA 3AK0A 4RQPA 4RGGA 4AVSA 2HWC1 2G9GA 2I2SA 2JG9C 1C1FA 3JCIA 1BVVA 1IZ3A 1PO12 3ZYIB 1VALA 2B45X 2D40A 2Y26A 4YVSB 4Y1YA 1RHI2 1UU4A 2RJKA 5J7MA 2UYAA 2ZHLA 2PLV2 1J3RA 5JOXA 4A7YA 3FLRA 3M3EA 4IEYA 1ZRDA 2DCKA 4ISQA 4M3CA 1SLLA 3LOIA 2FQPA 4Q4V3 2RMU3 4URTA 3HBZA 2R30A 3VKLA 4NPRA 2MEV1 5KC6A 2WC2A 4B4PA 4H3WA 4C0HA 4OULA 1CPNA 4AGVA 2IXHA 1VBA1 2EA7A 2BBVA 4NOTA 4D94A 1PIV3 4YGCA 2EXJA 4FPFA 3ME2A 4CEWC 4CRQA 1D4M3 4K20A 1DQ5A 1DIWA 2QDRA 1FPN1 2GC1A 4XJZA 4FCAA 2DCJA 1CR7A 2R49A 4P9YA 4HN1A 4CDUA 3WQ0A 5J36A 4RS5C 4LA2A 2ETEA 2WFPA 1DG6A 4XQWA 4B8EA 1BJQA 1NCRB 2MEV3 1F5FA 2QJVA 1JW6A 3AZYA 2P3JA 3RI8A 1O3SA 2TNFA 1VBA3 4JAAA 3SCFA 1WUVA 4ASMB 3I54A 3LA7A 3RYPA 1OA2A 3VZOA 4AW7A 2RS32 4BLJA 4GULA 3WZ1A 3D0JA 3O5SA 1CAXA 4XFFA 3A4UA 1QOTA 4CYDA 3PVBB 4DRRA 1XU1A 1UKRA 2GU9A 1DQ1A 2GSYA 2LM3A 5D1IA 4LULA 4RHV1 4EN0A 5C9AB 1FYUA 2HEYF 1IGOA 1KQRA 1PVXA 2VVFA 1RUI2 5K8SA 1YRZA 1DYPA 4FTEA 1FOD2 4WZCA 4AVVA 3WG2A 5BXXA 2TUNA 5JDBA 4JVAA 4D3WA 4LBQA 3CLPA 2GC0A 2BGCA 5GZCA 4HK9A 2A73B 4BH9A 2TBVA 4YVWB 4N53B 5C6CA 1MZ5A 3T2TA 3V0AB 2H0BA 2BVVA 4O9EA 1DQ2A 4N53C 4Y26A 1LGNA 3N7MA 4RHV3 4YVWC 1MZEA 4FPYA 1AR91 4P14A 3V0BB 2OVUA 3GBWA 3VZKA 4AK3A 3H3ZA 1BEV2 4CEYC 4RR3B 2QZ2A 2WA3A 1AHSA 2K2SA 3VN4A 3UL2A 1RUH1 2ZX3A 4Q4Y1 2RR11 5I91A 4LNVA 3FBYA 5FO8B 2AUYA 1MQTA 4AI3A 4PLOA 4FPCA 1X50A 1AL21 4HT1T 3LCPA 3CJIC 3JBG1 3ZXLA 1RUJ2 1S1AA 3JQWA 1ZZ9A 1RGSA 4IEXA 4Q8KA 1SLBA 3AKSA 1X8MA 1EAH3 1AR82 1HRV3 2NM1A 1CAUA 3ZFFB 3OYWB 4BCUA 5FTTC 4DPNA 1J59A 2RM22 4KGQA 4N7UA 4RQPB 4ZU4A 1RUH3 4Q4Y3 1ZA4A 2DUOA 3PMEA 3AZXA 1NE6A 3GZTB 5FCCA 3LA3A 3H1YA 1AYN3 4BYYA 4EROA 4WVMB 1CX4A 1VBB3 5J96B 5BNOC 1AL23 3JBG3 4FPLA 2VNGA 1S0FA 2HWB3 2XKPA 2PA7A 4M3CB 3LSDA 2JKBA 4AQ2A 1QQP2 2YGMA 4XJAA 3MF6A 4KL1A 4MYEA 3VZLA 3CL1A 2D6LX 1H4GA 5SV5A 1Q8PA 2A75A 1R1ZA 3EXUA 2D98A 3N3HA 3I2DA 3J26N 4IV3C 2WINB 3URFA 5BNNA 5LEJA 4P9XA 4P5HA 1AR72 1M4WA 1ZM1A 5C8CC 1SLCA 2R6QA 2KM2A 2WZR2 3TYJA 1POV0 3HT2A 4NN0A 5KBFA 4WM7A 1IS4A 1VBE2 3ZYJB 3B9CA 2XWBB 4R52A 3RYRA 4QQPA 1B35C 4COWA 2OA2A 4XF4A 5BUVA 4XQDA 3TWIA 5C4WC 4AGRA 1PO13 4AI2A 4IEZA 2BVBA 2HYKA 1RUE1 1OA3A 2NMNA 4XMIA 2JICA 4XFIA 2PLV3 4ZXKA 1LEMA 3JZVA 1C8NA 3IT8A 4L2NA 4HETA 2B9UA 3B94A 3WLUA 4UXAA 4MXVA 2ZHMA 2NLRA 2AZ5A 1BCXA 2YROA 3HAGA 3JU9A 5F6KA 3IN9A 4IV1A 4LBQB 1FI2A 3WOGA 4RL7A 1G7YA 1RUE3 2DUPA 4YGBA 1H1AA 2DFCA 2ZJCA 1RJ7A 3AKQA 4QM8A 1GZCA 1XNDA 2I07B 3TB0A 3KQRA 4N9HA 2XGXA 3C2UA 4E2SA 2VH9A 4AQTA 1LOEA 5HCBA 1WCKA 3MDPA 3ZSKA