4JTOA

Cysteine bound cysteine dioxygenase at ph 8.0 in the presence of cys and dithionite
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
b'ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jtoA00
2CGPA 3LWCA 4I3PA 5J3UA 1SFNA 2QVSB 4O9EA 3ST7A 2Q4SA 2UYBA 3C3VA 4LEJA 5BY5A 2XHKA 3FJSA 2GC3A 1U12A 1JUHA 4P9GA 1YHFA 1X82A 2UY9A 1QY4A 3TNQA 4KWKA 5FQ0B 3WW4A 1QXRA 4HVOA 4E2GA 3OGJA 3GBFA 1O4TA 2BEOA 4XFIA 4F7ZA 3SXWA 1RL3A 3PVBB 3ES1A 4AVCA 1IPKA 4XF0A 3H9AA 3MZHA 3H7JA 5JSOA 1CX4A 2OZ6A 4IETA 4OLLA 2P17A 2D5FA 2Z2SB 4D7SA 4LULA 2QNKA 4J1XA 4Q0QA 4XFFA 3GYDA 3NKTA 2XLGA 2XKOA 2PYTA 3CLPA 1CAWB 4HBNA 4H7LA 2PQQA 2IC1A 3G7DA 2ZKLA 1ZZ9A 4D7TA 1I5ZA 2I45A 5E16A 3FHIB 1WGPA 3IWZA 1RUNA 4K8FA 1O3RA 4EWDA 3ACLA 1LKNA 2QJVA 3H7YA 2K0GA 2ETEA 2IXKA 3SCGA 1CAWA 5FPZA 2GAUA 4UBGA 3FWEA 4BH9A 3JZVA 4QGLA 2GU9A 1ZRCA 4AVBA 1RC6A 3E97A 4QXKA 4WVZA 4MUVA 4O9GA 4RD7A 1O7FA 3OF1A 2XLAA 2ATFA 1ZNPA 2HKXA 2V09A 1I6XA 4GULA 4Q0VA 2OA2A 4FT8A 4XEZA 2N7GA 4QX5A 1VP6A 3FE5A 3WW2A 4MGZE 5I8TA 3N4MA 1WLTA 1X8MA 4IERA 2H0VA 1UCXA 1ZZBA 4META 4AQ2A 2PAEA 4HN1A 2D93A 1O3SA 4IEVA 2UY8A 3BCWA 3H3UA 5D1IA 1SQ4A 3EQEA 3BPZA 2F4PA 1ZX5A 3NJZA 4PIXA 2GC0A 1FXZA 4Q29A 4HLTA 3IDCB 4IEYA 4YARA 1XRUA 4IEWA 3CJXA 2K9ZA 4LTAA 4CYDA 3EHKA 4L2NA 2MHFA 5E1RA 3PNAA 3D0JA 5I8SA 4LA2A 3H1MA 4R8HA 1YWKA 5AVPA 2WFPA 4WBBA 5CU1A 4E2SA 3NW4A 4E2QA 4TLFA 3NL1A 3SMHA 3OD0A 4I02A 4MGKE 5FLIA 2FMYA 5KHHA 1YFWA 4B29A 4QGMA 4F8AA 4BHPA 5I0RA 3D0SA 4XF1A 1PM7A 3LOIA 5F1RA 1NZCA 1H1MA 1FT9A 3RYRA 1J3PA 3R6SA 2EA7A 4KWJA 1UIJA 4I01A 1PMIA 2C0ZA 4JV4A 5LEKA 1NXMA 5EZWA 3HT1A 5BXXA 3BALA 1UD1A 3FX3A 5JSPA 1XE7A 3FFQA 3ELNA 3ZDSA 4QM8A 1NE6A 3IIAA 4IEQA 4QGNA 2ZCWA 1QWRA 1LR5A 3LA2A 3RYPA 4IEUA 3CL1A 4JTNA 4AQ6A 1GQGA 1OI6A 1ZZCA 1Y9QA 2B8MA 3USSA 3L2HA 5JSRA 2Q0AA 3RNSA 3RZZA 1G6NA 4MX3A 2MNGA 2PHDA 4HSJA 2GC2A 1EY2A 4XETA 4QM9A 4XFGA 2MPFA 2XGXA 1YFUA 2D5HA 3ETQA 4BIFA 4XFHA 3BU7A 5I91A 1CAXA 3E5XA 3DV8A 4MGIE 5K8SA 3UKVA 5I93A 2BNNA 4N9HA 5HI0A 1FI2A 4FAHA 4UBHA 3QOPA 4IEPA 4DINB 2PAKA 3NSTA 4HZFA 4FBFA 3EJKA 1J1LA 3CO2A 4I09A 4Q0UA 3H3ZA 2E9QA 4IESA 5KHKA 4XFCA 4MGYE 2PFWA 1OFNA 2OYZA 3SCFA 4YNIA 2EAAA 3KCCA 4J1WA 4JTOA 3EBRA 3LZZA 2PTMA 1H1IA 1GQHA 2OZJA 5JR7B 5C6CA 2KXLA 4X6QB 3PLQA 4EWAA 4HVQA 1ZRFA 1ZREA 2VPVA 4PIYA 2ET7A 4I0BA 3D82A 5T3NA 2IXCA 3HT2A 3ES4A 3IDBB 4NVPA 5BUVA 3RYKA 4I0AA 3E5UA 3MYXA 4XFAA 4BYYA 4EV0A 3DKWA 5BV6A 1ZZ8A 2BYVE 1YFXA 4WZCA 2CAUA 4XF9A 4XF3A 5LRRA 2B9UA 5JAXA 1X7NA 3IBMA 3RPQA 2GZWA 2D40A 2Q30A 4YSFA 4Z82A 4HVRA 4I2OA 1RUOA 1VJ2A 5CADA 2XL7A 1EP0A 5I8YA 3U11A 3FZ3A 1Q3EA 4MH0E 2Z69A 4ZU4A 4YYOA 1LB2A 4LUKA 1X8EA 3E5QA 3MPBA 3S7IA 4PIZA 3WW3A 4MZUA 4HN0A 4A2UA 3B02A 2H6CA 5CVRA 3MDPA 3RDIA 4L11A 2PA7A 2DCTA 3KGLA 3CF6E 2Y0OA 2QDRA 1UPIA 3S0MA 3DN7A 4QMAA 1WA4A 2PHLA 4KU8A 1XE8A 3S7EA 1HW5A 1DGWA 2GC1A 1DZRA 5JCTA 5KHGA 4FAGA 1EYBA 3KSCA 4KL1A 4ZU7A 3I59B 2BNMA 3I54A 2XKPA 1Q5OA 3I7DA 3H8UA 2CAVA 4Q0SA 1CAXB 2BNOA 2FQPA 2O1QA 3I59A 5FQ0A 2PAMA 3E6CC 5J48A 1RGSA 4KU7A 1O5UA 4EROA 2ET1A 4XFBA 1O3TA 5LEJA 1J3RA 3E6BA 1J3QA 3BB6A 2QCSB 3O14A 4OFGA 1QXJA 2O8QA 3H50A 1YLLA 1ZRRA 2VECA 3UKTA 1Y3TA 5J7MA 1L3JA 2GH2A 2XL9A 3OCPA 3ROUA 5BPXA 5FPXA 3WW1A 3VHRA 3H1YA 1CAUB 2Q1ZB 2HJIA 3QACA 1UIKA 3NVCA 3TNPB 2B5HA 4R52A 1Q43A 4Q0PA 1V70A 3CEWA 4ZU5A 4ORFA 3H1WA 3HIFA 3KMHA 3OTFA 4UXAA 4YRDA 1OD5A 3LA7A 4MV2A 4AXOA 4AVAA 5I0TA 1J59A 1VR3A 1UW8A 2H6BA 1CGPA 1OMIA 1YFYA 1CAUA 1NE4A 1CAVB 4JVAA 2EVXA 4KWLA 4IEZA 4N9IA 2VQAA 5I0UA 1LRHA 1IPJA 4HSLA 3LA3A 4PJYA 1O3QA 5LRSA 1RTVA 2IXJA 3DL3A 5I0SA 5FDBA 1ZVFA 2XLFA 3SHRA 2UYAA 4LUMA 5C8WA 5KHJA 4HMZA 1CAVA 3HQXA 3M3IA 5EFUA 4XF4A 3KGZA 1J58A 1DZTA 3U0ZA 3M70A 2WC2A 5KHIA 2IXHA 3LAGA 1NYWA 5FCCA 5FLJA 2IXIA 1YUDA 5KBFA 4ONUA 3EO6A 1ZZ6A 1DGRA 2CV6A 3E6DA 1TQ5A 3UKNA 1SEFA 3SCHA 1ZZ7A 1ZRDA 4LA3A 4IEOA 2IXLA 3U10A 2OPKA 5FLHA 1EPZA 4LLOA 1O5LA 4Z07A 4EWEA 4X6RB 4IEXA 2BGCA
chains in the Genus database with same CATH superfamily
1UMZA 2GNTA 1KXGA 1R1A3 3LDKA 4HT1T 2CGPA 4NPLA 1SMVA 2PMWB 4HANA 5HV0A 1SFNA 1GZWB 2WWUA 4WVMA 5FKCA 1HRI2 2Q4SA 4FSJA 5SV8A 3C3VA 4LEJA 2QQVA 2E33A 3AXDA 3NRUA 4P5YA 5T5OA 2XHKA 4FPCA 4CRQA 5FP9A 5A3OA 2GC3A 1RYYA 2DBNA 1MS1A 1X82A 5EP9A 4ZHNA 3VHPA 5DUXA 1VMHA 1FPN3 3VD5A 1DQ6A 3WCRA 4KWKA 1PX4A 4RQPB 3LEIA 4AQTA 4N43B 3WQ7A 3ZR6A 1QXRA 1X36A 4LBQA 4E2GA 5FZ1A 3GBFA 5CKMA 4M4PA 4Z8BA 4QB2A 5IVEA 4F7ZA 3DUIA 5IJRA 2WYFA 5EIYB 4IE0A 2V5DA 4Y24A 3HQRA 4H3WA 5FR3A 5FY5A 3RZHA 2RS53 5F8PA 5A6ZA 3I3DA 1P8JA 1AL0G 1XNTA 1WBFA 4GJYA 3VBUA 4IE6A 1XNAA 2I74A 4O65A 4BWOA 4CU9A 2BWAA 4BMEA 2HWB2 2Y8KA 4XAEA 3CBNA 3H9AA 4LITA 2HEYF 5IATA 3MZHA 3H7JA 3UGGA 2FDHA 1W06A 2OZ6A 4OLLA 2P17A 2R061 4CEWC 5ACA3 1W6QB 1Y7BA 1ULPA 2D3PA 1BEV1 4YW4A 3PU3A 1WLWA 2A1XA 2ZGUA 4FPGA 4OMDA 1ULFA 1QH6A 3CIHA 3H42B 4XFFA 1ND3B 1PHMA 3NKTA 1NUKA 3RFRA 2XKOA 3C7OA 1CAWB 1SHWB 3U75A 4GMP1 1I5PA 4H7LA 1UX7A 2XVGA 4D7TA 3ILFA 4QQPA 4JC1A 1S2KA 3JXSA 3L9JT 2FD8A 2ZEYA 3IWZA 3WDYA 1XSRA 2BQPA 5KXCA 3DPRA 1JZ4A 5A3MA 2YFZA 3IPVB 2PELA 1H2KA 2DVDA 1LKNA 2J7MA 2QJVA 5FZ4A 5C70A 3I2OA 2ETEA 2WNEA 3S5QA 1EV12 3RG0A 3O1TA 3CZUA 4UBGA 3M1HA 2JDNA 1TNRA 3JZVA 1JHNA 5FPBA 2A75A 5F32A 1QEXA 1A34A 3A23A 1ZYBA 1QJFA 2XH6A 3V65A 4D6SA 5BNNB 2X05A 2ZBJA 4IUGA 4WVZA 1V9U2 4AF9A 3ZFFB 4B7KA 3TEXA 4O9GA 1WD3A 1JOPA 4CP0A 2Y33A 4FI9A 1HJGA 2HWD2 3AX4A 4LQRA 1MVEA 1HN0A 1RUE2 3EB7A 4LHNA 2ATFA 3Q8AA 1ULGA 2HKXA 2QTWB 1D0HA 2GNBA 1W9TA 4RS5C 1W9YA 5DDJ2 5EPAA 1IZ3A 5GLVA 4FT8A 5LA0A 3VBRC 3AYEA 5L7OC 4QX5A 5A80A 1ODNA 4P9IA 3FL7A 1VP6A 3T0BA 3ZO0B 5JDBA 3N4MA 2CYFA 1X8MA 1V6MA 3AMNA 2WT0A 1UCXA 5FWEA 1H6XA 2J1TA 1W6NB 3HN1A 4META 1JYCA 2WAAA 4CDXA 2BDRA 2EIGA 1E5HA 4HN1A 4N53C 2D43A 3LPGA 4CDWC 5SV5A 4IEVA 1K5MC 3CDZB 4JHTA 4LO8A 2VMGA 4AGRA 4DNYA 2VMDA 5HCFA 1JN2P 2W94A 1YC61 2RR11 2BU9A 1AXKA 1GLHA 3S5AA 3U37A 5GZCA 4LHSA 4JQTA 3RZGA 1QJX1 3BPSA 5FZHA 3UJQA 2O8OA 3ZYIB 4IEWA 4YARA 5IAXA 3VD4A 1MQTB 5GLTA 3VD7A 1HIXA 1NCQB 4FPHA 4WV8A 2R042 4M01A 4D3WA 1LENA 5FOJB 3PNAA 1V6JA 2QZ2A 1FOD3 2UWCA 5I8SA 4QPIC 1OUSA 4PBOA 3EMRA 4YW5A 4K7JA 3K3NA 4R8HA 4XUTA 1YWKA 5BNOC 2D98A 2WFPA 2GNMA 2JWPA 2QKDA 2WNVA 1ZBE2 2WRAA 1W8ZA 3KHBA 3NW4A 3OPTA 5CU1A 1SLCA 1DZQA 2LTNA 3NL1A 2DUPA 1Y9MA 5KHHA 3TN93 2Y26A 1AYN2 1YJKA 2PLV2 4FPLA 4FP3A 5A6XA 4B29A 3I3MA 4BHPA 5I0RA 3VKNA 4KQ7A 1IPSA 4CA9A 5B4NA 4XF1A 1W8FA 4Z1VA 3K75B 5DABA 3SC7X 1NZCA 4LJHA 1JU4A 3MFCA 3POEA 4PLOA 5ERLA 3RYRA 3THCA 1AL22 5LZ6A 1UYZA 4W6XA 3ZFGC 1SLAA 4YM1A 4AEDA 1CZVA 5CBLA 5IK8A 4I01A 2XG3A 4HOOA 4I30A 2C5DA 2P3YA 4NE9A 2EF6A 4WM8A 5LBEA 3WNKA 3MIEA 3H3LA 5EZWA 4JDMA 3X29B 4M00A 4LIUA 3BALA 3I2DA 1SLIA 3BKZA 3WNNA 3NNMA 5LATA 1W99A 4HK9A 5GZFA 3WG3A 4AFBA 2GH8A 3OUJA 5FZFA 3SH5A 1NE6A 3GALA 1VAVA 2RS13 4OQ9A 2R0HA 5J09A 1ASJ3 2EALA 2XWBB 2J42A 3KVAA 1DGRN 2ENRA 2D3RA 4QKFA 4GWNA 2J1RA 1UY3A 4XCAA 1LR5A 1C1LA 1N47A 1NY71 5LY2A 2PHUA 1BYHA 3I2JA 3VLBB 2RE9A 1APNA 1LNSA 1L7RA 1WMFA 2LRPA 1OI6A 1AR61 4NAOA 1RUH3 4LO5B 2HWC2 4YGCA 5JSRA 2ARCA 2SLIA 3H8RA 1RUG2 1ENXA 3FUOA 4EZ4A 1O91A 1LGNA 2Q0AA 4Y5Z0 3RNSA 1L7LA 5KXDA 4CDUC 5A7QA 5FZ3A 4WM7A 3ZFEC 2VZ3A 5B2GB 3VBHA 4NIIA 4HSJA 1B35B 1O8PA 4XE9A 2GC2A 2XXZA 4FOYA 1OQDA 1QOTA 3NO8A 4P9XA 4XETA 1W2TA 2X5IC 2NMNA 3B01A 4A41A 2MPFA 1C4RA 1DYPA 1YFUA 4LK7A 3HNYM 1M06G 4ZXKA 1EAH2 3MIHA 1HB2A 3SH3A 5IK4A 1SLLA 3WNOA 4CDQC 2RS33 5FY0A 3JD72 4NMIA 3E5XA 3DV8A 3S57A 4XIKA 1VBB2 1D4M1 2BJSA 4HKOA 4MSVA 2WIIB 2VH9A 5F3GA 3N9QA 4D6RA 5IVBA 5K8SA 1OLQA 5JPMB 2ZOEB 5IK7A 4GALA 5I93A 3LOBA 1F9KA 2A5ZA 3QH7A 4YG0A 3OEAA 5A32B 2RG4A 5K9YA 2AENA 2ZHLA 3VZJA 4COZA 4IEPA 3HR9A 3VDCA 2ARXA 1PIV3 2FZ1A 2P1BA 3NSTA 4DINB 2E31A 2YGMA 4O7XA 2NQYA 4PQ9A 4ES8A 1IOAA 4I09A 4JKKA 2Y0IA 2MEV1 3D5OA 4XTMA 2EIDA 1PZ9A 4IESA 2ZXQA 1NA1B 1Z0HA 1VALA 1QHDA 3ZVXA 1WLDA 1G9BA 3TB0A 4XABA 1DLLA 1OFNA 2Q1MA 5FZLA 3M3QA 3NAPB 1CJPA 2OQ6A 1S2EA 2XUMA 3QH6A 3MV01 2FBEA 3I3QA 2WZ8A 2VBDA 4CCMA 2ZGPA 5AFEA 1SBDA 2BOIA 3HOBA 1RUI3 5JIAA 1H8TA 3MPPG 5C6CA 1QJY3 2JD4A 1YRZA 4JQRA 2RMU2 3WD5A 1UYXA 3PLQA 1JW6A 4XTPA 2ADEA 3RS6A 4HVQA 1OXCA 4R4ZA 1NCRA 2OX0A 4PIYA 3AZVA 4N7IA 1UU4A 3MLLA 4MYEA 1UOBA 2W3JA 2IXCA 5IWFA 3B5LB 3WF2A 1ACCA 5C3SA 4C0HA 3RYKA 4KG0A 4ARYA 4AI9A 5FWJA 3OGVA 4BYYA 4EV0A 3O1OA 1NG0A 5FPLA 3GF6A 4OI1A 4PDWA 1K3IA 4WZCA 4XF9A 5ABJC 4NRMA 5A3TA 4Q4Y3 5C33A 2BBVA 1KFUL 5D8AA 2WFF2 1JZ8A 3VB9A 4CUBA 3VBSA 3IBMA 4NOTA 3IM0A 1ND2B 2Q1FA 3M4FA 3BN6A 3I2KA 1G8WA 5JWPA 4HVRA 4Y22A 5FZOB 2VZUA 1RUOA 4FTBA 3VBFB 2GP3A 4OCTA 5CG8A 3DGTA 4Y20A 1G7YA 3MLKA 4Q4X3 4YZ4A 4FPFA 3VDDB 2VVEA 4CCOA 5A33B 4RR3A 1D4VB 4LBKA 3O0XA 3UESA 3ZXLA 4BPZA 5I8YA 2YC4A 4PI2A 1JTZX 1VBC2 4O61A 1HQNA 4ZU4A 5GZDA 4YYOA 4EE2A 2YDEA 2J1VA 4LUKA 1UOGA 4AZZA 4NUBA 1GNHA 4RYDA 3S7IA 5FAXA 1R64A 2XJVA 2B42B 4PIZA 1GWMA 4FXGB 3B02A 2H6CA 1OOPA 2WS93 5ISLA 4NWVA 3MDPA 5CVRA 3RDIA 2XBO1 5C71A 2PA7A 2DCTA 3VL9A 3KQRA 4UYBA 2Y0OA 1UPIA 1AR72 3S0MA 4HETA 2VVDA 3RI8A 3ZSMA 3ZPYA 1XE8A 2VY0A 4FTSA 1RUD1 1DGWA 2DVFA 4QXHA 2QQMA 1RMU3 3K48A 1QIQA 1ZBA3 3WNXA 4XZUG 5JCTA 5KHGA 2RM21 1KJLA 3J8F2 1H9WA 2PQSA 5EYYA 3VN4A 2O0OA 5C7GA 1AR81 4GB33 1GZWA 1YXWA 1FNZA 2E7TA 1PVC3 1TME2 4K9SA 5T5LA 4AGVA 1VMJA 3I54A 4Q4V1 2VCAA 2WNUB 2JECA 3SH4A 1HKDA 1UZWA 3ZX7A 2AACA 2DTWA 1Q5OA 1LESA 2BFUL 2JE8A 3I7DA 1YJLA 3T2OA 2ZPXA 3NNGA 1RHI3 3I2IA 4RGAA 2XPJA 3LB9A 2EXHA 2TNFA 2AUYA 2FQPA 2ZGMA 1A6CA 2EXIA 2O1QA 5IK5A 4NHYA 5GM0A 5GKAC 1O8SA 3I59A 5DG1A 4N43A 3PUIA 3E6CC 1NLRA 3TBDA 4S2FA 1AYM1 2HWF3 5J48A 2FMDA 1O5UA 3AXEA 2Q8CA 2CU5A 3MUY1 2AZ5A 1QU0A 1OD3A 1J3QA 2W92A 2YROA 4NHMA 1R081 3O14A 5FK7A 3RJRA 4KBZA 1AR91 2YBSA 4YVSB 3RVHA 1COV1 1YLLA 1OVSA 1XOYA 1UMHA 4NJ4A 5F2WA 3TN91 1BJQA 5KC5A 1L3JA 2XL9A 1R1ZA 3K4ZA 3HQUA 3OCPA 3ROUA 4IV3A 3HMYA 1S0JA 4KH9A 2ZX3A 5FYSA 1US3A 5FZ7A 2IFRA 4HKWA 1LOAA 4GWMA 1CAUB 1X50A 3QACA 3NVCA 3OOXA 4G3YC 4LE4A 4NRQA 4CPBD 1W2AX 4KBBA 4AG4A 4NPMA 1SBEA 3PMSA 1LOEA 4ZU5A 4IE4A 4DXRA 5HCAA 2G9GA 2E32A 2QQWA 4XXAA 2WR9A 3H1WA 1LEMA 1XYPA 4MHRA 2F6BA 3OTFA 4UXAA 2XVLA 4YRDA 3WF4A 4MV2A 4B8EA 4YW3A 4UFMA 1CAVB 2Y6LA 5C8CB 2EVXA 1W6MB 5GLWA 1FYUA 1W2OA 2VQAA 4YW6A 5FKBA 4DPNA 1LRHA 1QF3A 1IPJA 5FREA 4E8CA 4EN9B 3CMGA 3LA3A 1UOJA 1KDMA 3IPVA 1QDCA 1R092 3AYAA 2YUEA 1SDWA 1LHOA 3OBTA 1G9AA 4IQPA 3SHRA 2D6NA 4LUMA 4BQ5A 5IHRA 1TG7A 1XU2A 2WN3A 3P3NA 3KGZA 2VMIA 5BNNA 4X8NA 3U0ZA 1KJRA 3M70A 4YFWA 4W6YA 4QX3A 4JKMA 1PK6A 3I2HA 3ZPOA 5KHIA 5F6LB 4F83A 3ATGA 2R063 4ASLA 3AP4A 1VBA2 2D6KA 4BISA 3FBMA 3HBKA 3N9OA 4TSVA 1BEV3 2VG9A 2W91A 4YVWA 1C3HA 1DU3D 3M7AA 4JKLA 1TE1B 3EO6A 1GR3A 4XJUA 5C4WC 5H9RA 4FXKB 4JGYB 3SEEA 2LS6A 1SEFA 3U4SA 1S0DA 2OVUA 4MGTA 2HWB1 1REEA 3J7HA 3FN9A 1ZRIA 2IXLA 4GMP3 1NKGA 5KXEA 4XIOA 4P00B 4YZ2A 2JG9A 3MIFA 5E8AA 5FXZA 3KHCA 4JAAA 3KT4A 4K1YA 1R1A2 1ULDA 3AP6A 1SPPA 2J1AA 1XYNA 3JBG2 5IVYA 3ZN6A 2KM2A 1O3SA 4ZS3A 2BGCA 5H9SA 1WKYA 2P3IA 1JOJA 3T2QA 4YZ5A 4XQWA 2ZHNA 3SNMA 1POV1 3LWCA 4I3PA 5J3UA 3ZXKA 3KT7A 1GOFA 4LOTA 1E57A 1MQTA 2WA3A 4IXLA 5APAA 5LWBA 3FHQA 1NCQA 4W50A 2J1EA 4GA9A 5F2SA 3AVSA 2YBKA 3ZR5A 5IVFA 4IGPA 1N3QA 1JUHA 2VE1A 4W4ZA 4Y1VA 4M3CB 3CU7A 4CXWA 3AK0A 1QY4A 1RB8G 3ZXDA 4PQQA 3JB8A 3WG1A 3ALQA 1EV11 2ID4A 3C7FA 3WW4A 3HBZA 1OKQA 4AGGA 3UGFA 4B7EA 3OG2A 5C3OA 2KD7A 3OGJA 4XACA 5IUQA 3ZSLA 1WCUA 5T50A 2BEOA 1RXFA 2X53S 4YM3A 3VBUC 1IQDC 1V9U1 1VRBA 4XQDA 2YPDA 5AC92 4BOWA 1KFXL 1F35A 3SXWA 1RL3A 5T5PA 1I1EA 5EJ1B 4HG6B 4OVEA 1RUE1 3ZKYA 4U2AA 4CEWB 4DZGA 3BTXA 2CWSA 4K3UA 5DDJ1 2LW8A 2VUDA 3PVOA 2RR13 4AVCA 1IPKA 3A4UA 5ACA2 1GQPA 4XUPA 2JDKA 4GJZA 4XUQA 4YM2A 3FBYA 1WBLA 1PGSA 2ZAAA 5GLZA 1QJX3 1CIYA 2Z2SB 4PI0A 4YM0A 4DUWA 1GOHA 1KDKA 2QNKA 4LULA 3A0KA 4COWA 4RHV1 4GD4A 4M0HA 5JOWA 1WCSA 3Q8BA 3B9IA 1JYIA 1MZ5A 4MXVA 3CLPA 5FY1A 4B3NA 1MS0A 2ZEZA 2DUQA 3GZUC 3IDAA 5HBAA 2IC1A 4Y4YA 3P1IA 2QQUA 3DKQA 1ZZ9A 3K4AA 4Q5OA 5D21A 3HEIA 4YLZA 1GWLA 2R041 5FYUA 3WHUA 1O3RA 1CWPA 1MACA 3GHMA 4CU8A 1PM4A 5DAWA 2ZEXA 1PVXA 2ZZQA 5CFDC 4IV1C 3H7YA 2IXKA 1H4HA 3MLJA 2WNOA 3SCGA 3T30A 2GAUA 5FYBA 3T4VA 3FWEA 5C5UA 4BH9A 2VQUA 3THTA 5JVVA 4D8MA 4QGLA 2GU9A 4XW3A 2WSVA 1YNAA 1AYN1 1UZVA 2PLV1 3E97A 5T52A 1E5RA 4RS5B 5T5JA 3F2ZA 2R49A 4E4DX 4XUOA 3VBRB 4RD7A 1A78A 5L7OB 3K2OA 2QUOA 2XLAA 1RVF1 3ZIXA 1AL21 1LHWA 4GULA 5L19A 3ZSJA 1UYPA 2NZ9A 1CX1A 2TUNA 2OA2A 1PNGA 1N1YA 1UZZA 3EXUA 4NROA 4CDXC 2OKXA 4CDWB 1C8M2 2DF7A 1K5MB 4NO4A 5A32A 1WLTA 3VD9A 3KV6A 1OPMA 3I8TA 3SQOA 1YI7A 3HVDA 1E5IA 1W9SA 1ZZBA 1OH3A 4QKDA 2WABA 1SFPA 1OBNA 1U5YA 1AR63 2PAEA 2WO3A 5G05L 4R9CA 2D93A 1QQP1 4YGEA 5A3PA 1W8TA 1DG6A 1UN1A 3H3UA 1NA1A 1DYOA 3EQEA 3ZYPA 3RRDA 2V4AA 4AVTA 3ENRA 1TVGA 1ZX5A 4PIXA 4Q29A 4OULA 4P9LA 1RUF1 4QPIB 3N36A 4QQ2A 2H0BA 2K46A 1HX6A 3C7HA 1O4YA 5FUPA 3NQHA 5BNOB 3VHNA 4QWNA 3FUQA 3EHKA 4L2NA 4LHKA 1QXPA 2WNVC 3T1MA 5CA6A 5FZEA 2HWC1 2GMEA 2VMFA 3BOWA 4FPOB 5KC6A 4FFFA 5LA1A 1WWYA 1RUG1 1CPMA 1PZ8A 4Q4W1 1F4HA 1QJZA 4WBBA 3WDXA 4BQ3A 4ZZ5A 4TTGA 3DYPA 4E2SA 1WCDJ 2XB6C 1D4M3 2ZGSA 3U14A 5HPOA 4BXFA 2JX9A 3OD0A 3O1VA 3O1SA 3MIDA 1JBCA 4QX2A 3ZFGB 1AZDA 4AEDC 1KS5A 2WN2A 4FTEA 5JXJA 4BDVB 4V1PA 4SLIA 3V64A 2YU1A 2VTXJ 3D0SA 3LOIA 5A3WA 4SBVA 1AVBA 4UFJA 1FT9A 1EAH1 3CJIA 2SBAA 3N9MA 4S2GA 2YHJA 3R6SA 3JD71 2W46A 1JI6A 1UIJA 2MEV3 3K77A 1JZ3A 2BZDA 1ND2A 1VBB1 1QGLA 5FZOA 2WZR1 5GZGA 4HFSA 2DU0A 4JV4A 2QQNA 5FP4A 3VBFA 1MZEA 4Y1XA 3VDDA 4UF0B 2BVBA 4PHZA 4XDQA 1UD1A 2X29A 3AB0A 3AM2A 1I9RA 3FX3A 5LA9A 1ASJ2 1XNCA 5JSPA 3FFQA 3ELNA 1UO9A 3ZDSA 3JCIA 4UW5A 1K42A 2R32A 4FFGA 4IEQA 3O5SA 2D3SA 2CHHA 4JRAA 1AX0A 4ET7A 2GN3A 2JIJA 2ZCWA 3B94A 2HWE2 1PO12 2WBKA 3RYPA 3PU8A 3NKGA 4AQSA 4IEUA 3CL1A 2W47A 3CHXA 4JTNA 5C9AC 2XOMA 4AQ6A 2JB4A 3VZOA 3UV9A 2W87A 1GQGA 1GYKA 1ZZCA 2R072 4CTEA 2IVJA 1LHNA 3OBZA 2ZGLA 4JRLA 4CDUB 4WM7C 3ZFEB 3J26N 2DFCA 4CXXA 2ORZA 3AFGA 1LODA 4NRPA 4XYXA 5FZ6A 1VMFA 3AYDA 2RMU1 4M3CF 3WCSA 2DCZA 4OHYA 4DB5A 4LBOA 2X5IB 4BQ1A 2DTYA 2PXJA 5CNAA 2WJSA 2R6QA 1HLCA 4QU1A 2J1UA 4QPWA 4CDQB 5LBFA 5FO7B 4CZSA 1EY2A 2WLPA 4QXCA 4AI1A 3MF6A 4QM9A 4AW7A 4RSUA 3VKMA 2W68A 2XGXA 3TEYA 3ETQA 5JOZA 4XPVA 4XDOA 2VUAA 3WP4A 4LBNA 4XFHA 3AL6A 4ISQA 3T0AA 2Y6JA 4QKBA 5CIRA 3QCWA 1JYWA 1BQPA 2WFF1 3WP5A 4JX0A 5GZEA 3MI8A 3UKVA 4H55A 1Q8OA 2BNNA 4BLJA 3HPNA 4XJZA 3ZMOA 4AEJA 5JOYA 1FI2A 2JG8C 4FAHA 2EIBA 2ZX1A 1OLME 2VOXA 4PF5A 1H0BA 3CQOA 2XBO3 2D6MA 3O7OA 1J1LA 2XJRA 4QQLA 4R9AA 2XQRA 4D6QA 2E9QA 4YVSA 2GALA 1UWWA 2VNOA 3WUCA 4LBLA 1VIWB 2LROA 1GP4A 1VBC1 5H9PA 5A7PA 3GJAA 5L9VA 1N3OA 1RUD3 1S1AA 1REFA 2CDPA 3SCFA 1FNYA 4YNIA 1V6KA 2RM23 5FYTA 2DBIA 4J1WA 1HN1A 1CONA 3OPWA 5D2AA 1AR83 4DFSA 1NCRC 3LZZA 3CNAA 4TLGA 2Y60A 3LEMA 1H1IA 3WEZA 1DQ0A 1GQHA 1HV0A 3LD8A 2B7YA 4Q4V3 3C2UA 1JZ6A 3CZJA 4Q1RA 2KXLA 4X6QB 1CESA 5ANNA 4YG3A 1S0CA 4XJAA 4EWAA 1C28A 1ZREA 1VB4A 4FOWA 3LKJA 1LTEA 4Y1YA 3D82A 3UGHA 3HT2A 4L8QA 1XE0A 1NZIA 3LDBA 3J8F1 4NVPA 5E6HA 3W20A 2HYKA 1V00A 2VGDA 4AAPA 4PDWC 5C3RA 3O1PA 5EXOA 5ABJB 1YYNA 1J84A 1WW7A 1KITA 1VBD1 3MYXA 4H7MA 4XFAA 5C8CA 4S2DA 1TME1 1WMDA 2GP5A 5D8AC 2WINB 3ZN4A 4NIHA 1AYM3 5BV6A 3ILRA 3VBSC 3LIHA 2QQIA 2RDSA 3J4UH 4Y5SA 4AI8A 3IIIA 2BYVE 5LBCA 3UL2A 3WG4A 5J98B 4AFAA 1JU3A 5DUUA 1R083 1PGW2 5LK7B 1XBFA 4L9BA 1AR93 5FZ9A 3VHOA 3FLTA 2YGLA 2D40A 3R4SA 1COV3 4Q4X2 4RR3C 3WNPA 4Z82A 1IS4A 3WP6A 1DIWA 3PL0A 4I2OA 3WNMA 2WZEA 4XVHA 4MXWA 1LU1A 3V0BB 3HNBM 3AMHA 3POGA 4LIVA 3FZ3A 1GZCA 1Q3EA 4GH4B 3U11A 3KQ4B 4EJRA 1GV9A 1MS3A 4OYUA 5FMOL 3RSJA 3W9AA 1S2BA 1SACA 1YO8A 1LB2A 1TNFA 2CSGA 1X8EA 3E5QA 3AZZA 2RJKA 3ACFA 3N7MA 4A2UA 2VZVA 1HB4A 2AGSA 4JGZA 3NNLA 4L11A 4A3XA 1MVQA 3JUUA 3KCYA 2IFWA 4CCLA 1Z7S2 4CU6A 1JS9A 3KGLA 4FCAA 2NPIA 2QDRA 2P34A 5LK5A 5JOXA 3O1RA 1LHVA 5AFBA 1WA4A 2PHLA 1JH5A 1HV1A 1HW5A 1DYKA 2GC1A 3SISA 4B1LA 2OS2A 4GB32 2P4EA 1OA3A 5EJZB 4C8DA 5A1LA 5F5CA 2Y34A 2ES3A 3KS7A 4WVVA 1GOGA 1EUTA 1HRV2 3KSCA 2D6OX 3BGAA 4OZOA 3W5NA 1LAJA 3OYWB 4AE2A 2XKPA 5FMDA 3USUB 5IVVA 4QHOA 5E89A 2VTXA 2AH2A 2Y6KA 3PHMA 1GICA 2EXKA 5CFCC 3H8UA 3BVCA 2VCMA 2CAVA 4BU2A 1GZTA 4EZHA 1LCLA 3QBQA 1R091 4LO7A 5JZGC 2HWF2 1Q8QA 3GXUA 2PAMA 1UOFA 4FOQA 3LIGA 4LORA 4ITCA 5J36A 1VAMA 2FZ2A 1URXA 4CEYA 3ABZA 2VMEA 4Y26A 5FPUA 3VKFC 1YQ5A 3OUIA 2HWB3 4V2VA 3BIWE 4NWWA 2VNVA 2ZTNA 2QCSB 3BB6A 4IV3C 4AHWA 3B3QE 3KV5A 1QDOA 2VECA 2VVFA 2FCUA 4ISRA 1VBA1 1REDA 3RMYA 5I0DA 2VNGA 1PO21 5J7MA 4CEWA 5JXIA 1W8WA 3KLSA 5FP8A 3U4XA 1VBE2 3NMBA 1DQ4A 1VE0A 4Q1PA 3NJYA 4KWUA 5K0UA 3WW1A 3H1YA 4IW3A 4FQZA 3GZEA 2Q1ZB 4OUEA 1POV3 2HLEA 3LQCA 1UL9A 4CVUA 1O59A 4AL9A 5J37A 1UIKA 5E88A 4OMCA 3TNPB 3NV1A 4Q0PA 3J9SA 4GQ7A 4J25A 4BQ2A 1WW5A 4UAPA 3T08A 4ORFA 3JBG1 2DCKA 3MIBA 3KMHA 4LR4A 2A6XA 3UT0A 1MEC2 1AJOA 1LHUA 1LGCA 5I0TA 1VR3A 1UW8A 2H6BA 4YZ3A 5IT6A 1OMIA 3WF3A 1Y9GA 2R7EB 1S0BA 4FOVA 2XQXA 1EV13 1UYYA 3A22A 4P9YA 1DQ1A 4QPGC 3WUDA 4M0NA 3MW3A 4P5HA 4PCRA 1QJU1 5C3QA 1OC1A 5BNPC 5DPNA 1RUJ2 1V9U3 4Q26A 3DL3A 2ZKNA 2A7AA 1TMF2 3FLPA 1VRH2 4ZKTB 2DCJA 2XLFA 4L92A 3WR0A 2YMZA 1CJDA 1IS5A 4XMIA 2BW8A 1RUE3 2C9AA 1C57A 1PK6C 4HMZA 3IAPA 1SZBA 5DDJ3 5EFUA 3RMXA 5M0TA 3D3AA 4YVWC 4AOCA 5A7NA 3I97A 5FY4A 5JXGA 2WC2A 5C4WB 5L7OA 1HXS2 2IXHA 3A0NA 5AC91 2G4IA 2IXIA 1GP6A 1YUDA 4A6OA 3NJXA 4ONUA 4QKNA 1ZZ6A 3NNJA 4RHV3 2CV6A 2JG9C 2E51A 5FZBA 5DQ0A 4CDWA 1QKQA 3ZM8A 4WVMB 2HBTA 1LOCA 1YQ2A 3U10A 1WUVA 4XURA 3ACGA 4RFRB 1RUC2 4LLOA 2DUOA 3DYMA 1W2NA 2A73B 3HD8B 4QD2A 1GU3A 1SLTA 2ZHMA 3G6JB 2R043 4IEXA 3OGGA 4BMBA 1HJFA 1V0AA 3PUHA 1W6OB 3BI3A 1RJ8A 4URAA 1OQ1A 1SFYA 2CNAA 2JE7A 4N8MA 1DCSA 5BNOA 3ZOIA 4O9EA 4LBQB 4CUAA 2UYBA 5BY5A 4ZXEA 1FMD2 3FJSA 2VUJA 1AYN3 2PLV3 1U12A 5DAPA 4BQYA 5FXVA 3KV9A 3KB5A 3VGIA 1KGYA 4P9GA 1BBT2 1YHFA 1DDLA 4AVVA 1V6NA 2UY9A 4N90A 3MGUA 4PT6A 1A8MA 3M8LA 3GNEA 1RVF3 4RGKA 3OEBA 5FIXA 1AL23 3VBUB 5FQ0B 1GMMA 3WOGA 1SBFA 4ZS2A 4P9JA 2E7QA 4XC9A 4HVOA 4Z2WA 4QHBA 4MLOA 3I4IA 1F15A 4LNVA 1OF4A 1O4TA 1OF3A 2VZQA 4BJ0A 5CEHA 4OI2A 3WDTA 5JLVA 2RR12 1QQP3 4QB6A 3ES1A 4A42A 4RQPA 4G9SB 1LOBA 1OKOA 2DWRA 3KCXA 4U36A 2JDAA 2VAUA 2R0FA 4UF0A 3POJA 2WSUA 4B4QA 1H4GA 2YZ4A 5HV4A 1C8M1 1CX4A 3BTZA 1RUF3 1DQ2A 4IETA 1D0GA 4OZXA 3HAGA 3N3HA 3WDUA 3WF1A 2BP6A 3SEPA 5F3EA 1HB1A 5CAZA 4EN8B 4Y1ZA 3OJBA 2DVBA 2W1SA 2XR4A 4Q0QA 5FK8A 2XJUA 2HWC3 1OT5A 4COVA 4F3JA 3GYDA 1RUG3 3D6EA 4CSWA 4Q4W3 4HBNA 5FYHA 2PQQA 1NOVA 4LE3A 3G7DA 4S2HA 2YC0A 1QOSA 5CFDB 5E16A 4IV1B 1W6QA 1WGPA 3ZFEA 2VZOA 4CDUA 1UY4A 1AHSA 4K8FA 4JCKA 1KEXA 3ZMNA 4CE8A 4EWDA 1TEIA 1WW4A 5EJ3A 2WO1A 4M4RA 2G19A 1ND3A 3RGBA 4BQWA 4L97A 2ZHKA 1EAH3 2K0GA 5FPAA 3W5MA 1CAWA 3KV4A 3JD73 2Z79A 5FPZA 4CDQA 2QQLA 3VV1A 1VBB3 2B39A 1GP5A 2UWBA 2L9LA 2WZR3 3PTYA 4NPRA 2FHRA 1UMIA 4AVBA 1RC6A 1HRI1 3GBWA 3PUAA 3VBOC 3B93A 3D8CA 4GIQA 1C8NA 4A45A 5ANQA 4CDXB 1S55A 1YQ8A 2DURA 3OF1A 2YY1A 4BE3A 2RJLA 1ZNPA 2A70A 2VMCA 3ON7A 4I3GA 3PIGA 4XEZA 1NQJA 3VDBA 2N7GA 1TZOA 1ST8A 1FV2A 3TYJA 2XHNA 3FE5A 1MR5A 3WW2A 5I8TA 1AR62 4JDOA 4A7ZA 4IERA 4HONA 3ZFFA 1H9PA 2ZGNA 3PUSA 2DU1A 3ORJA 4AQ2A 1OLMA 2HEVF 4XHXA 4Y3OA 1H1AA 2VOVA 2QQPA 5D1IA 5F7UA 1SQ4A 3T0DA 4IL7A 3O0WA 3GDBA 2EXJA 3NJZA 4Q8KA 2RMU3 1FXZA 2KR2A 1K45A 1SG3A 2HWE1 1PO11 2WNVB 2JE9A 3ZXGA 1WCKA 4HLTA 1ENQA 3IDCB 4IEYA 2B46X 3SLIA 1UY2A 1XRUA 2A3YA 1W6NA 3CJXA 4HXCA 5HXMA 3V56A 3WT3A 2K9ZA 3POWA 4LTAA 1NT0A 2R071 4XILA 2C24A 4CYDA 3UNPA 5C5TA 1OVPA 2CTVA 2FDKA 1WW6A 1D4M2 4QDQA 5AVPA 4AEDB 3I2GA 1YEWA 3AKRA 2OW4A 2BV4A 1XXNA 1UQXA 1PNFA 4TLFA 3WZ1A 4BQ4A 2WFF3 4I02A 4MHUA 5ABJA 1GBGA 3T09A 3CJIC 2P3KA 2ZACA 4ZONA 2R1BA 3OUHA 2JDMA 4QGMA 4F8AA 4A4AA 1F5JA 2UWAA 4M3CE 4OI4A 4XJWA 5DUVA 3TOJA 5J96B 2MEV2 1FPN2 5F1RA 2W1WA 3POBA 1H1MA 2BERA 2VZTA 5L9BA 3SKJE 5DZFA 4GWJA 3VZNA 3W21A 2DYCA 1MS4A 1PMIA 4QDSA 4QU2A 2ERFA 1W90A 5L9RA 1PGL2 4HK8A 1VBC3 1T2XA 1WZXA 5EYXA 5IFPA 3HT1A 2RDNA 4CP9B 5JXHA 4MGSA 5A6YA 1D2QA 2WO7A 3V0BA 5JMCA 2EIEA 5JMOA 1ENRA 5KWRA 4GH4A 4LXLA 2RS52 3A21A 1LU2A 4YWAA 2UURA 5HCBA 3IIAA 3PDQA 4K6BA 4QGNA 5C9AB 1O6UA 2HWD1 1UAIA 1CIWA 2AR6A 2Z5WA 1LECA 5JI7A 1A8DA 2BFUS 2ZA9A 4Q2FA 3FFZA 2BGOA 3LA2A 1W6PB 2VW2A 4LKFA 2X8KA 4WM7B 3SKVA 4DS0A 1MS5A 2JIGA 3TEZA 1DHKB 4XJ8A 1G9CA 1UZ0A 3J8F3 3ZYJB 1U5IA 2E6VA 1VBD3 1Y9QA 3USSA 1TME3 4OQ8A 2P6CA 4CPBA 1WMXA 2X10A 3RZZA 1W0PA 1IS6A 2YBPA 1BZWA 3LSDA 4XCBA 3ZN5A 1G6NA 1LJ7A 3KWVA 4KNCA 1IGOA 1US2A 2ZMKA 2MNGA 3DEMA 2W5FA 3DPRC 5FO9B 2ARBA 3CKHA 4LBQD 4LOSA 2C4XA 1W8UA 3USUA 5KXBA 3N7KA 1ENSA 5DAQA 2WDBA 2VMHA 1BMV2 3IB3A 3RWKX 4BIFA 4AHYA 4EN0A 4QHZA 5IYYA 5FJKA 4MGIE 1RJ7A 4FP2A 2JG8B 4PLNA 1PGW1 1UY1A 1B35A 1ZBE1 4N9HA 3WQBA 5HI0A 1KS4A 4UFKA 3OD4A 2PAKA 4HZFA 4FBFA 1YQ6A 3AC0A 4I0WB 3IDEA 3CO2A 4QQOA 4FPKA 1F5FA 5KHKA 1KQRA 4LKDA 4XFCA 1AX2A 2VTFA 1T6GC 1NCRB 3NV3A 4MGYE 4BIOA 3ILNA 4AEKA 2OYZA 2VU9A 1HDKA 4Y5TA 1U5XA 5DZEA 1W0NA 4N53B 3KCCA 5F3IA 4Z2AA 3VL8A 5FRAA 2OXBA 3EBRA 2YV8A 1X9TA 1M4WA 2PTMA 3AKQA 3GCWA 2OZJA 4CCDA 5JR7B 3N9NA 1LGBA 1Z7S1 1VAKA 3N9LA 4LKEA 4PDWB 1ZRFA 1N1TA 4UWDA 5H9QA 2ET7A 3UJOA 3PURA 5D8AB 1MS8A 3PIJA 2VOKA 5T3NA 3BTYA 4OI0A 3ES4A 3IDBB 3NAPA 3VBSB 5HCHA 3LSEA 5LA2A 1R093 2EICA 4UW3A 5K4LA 3ECQA 1HRV1 5L73A 3RI9A 1FOD2 1SDDB 3E5UA 1C1FA 2YG0A 2XONA 1H2NA 4Y22B 4D94A 1LOFA 3T2PA 3NV4A 1XYOA 4Y20B 4ASKA 4OUSA 1ZZ8A 2BUKA 4RR3B 1ODMA 1YFXA 1S0IA 2A6YA 3J7MA 4XF3A 2AEZA 4CUGA 3S6PA 1UX6A 5TSWA 2B9UA 3MFAA 3TN92 5CYYA 1X7NA 1OHFA 3KM5A 3WLUA 3RPQA 2GZWA 1DFQA 1LULA 2YB7A 2GMMA 1VBA3 4NN0A 4YSFA 3VKOA 2D97A 3AKSA 1PO23 3A7QA 5FZMA 5IAVA 4R9DA 4IE7A 3BOPA 4Y4RA 4YW1A 5FY8A 5LY1A 4AHZA 2WO2A 2VM9A 5DG2A 3VDAA 1W8NA 2WUHA 4QXBA 3O1UA 4LPLA 4ATFA 3O0VA 4WM8C 1VPHA 3POSA 5HXVA 3ZXJA 3GZAA 4P9WA 2ZX0A 4RL7A 2O14A 4JGZC 5FZAA 1OLRA 5FY7A 2B45X 3MPBA 3I3EA 3AYCA 3JU9A 5DMYA 4OHXA 3WW3A 3JBG3 4MZUA 2WT2A 4HN0A 1FAYA 4GKYA 2PHRA 1PMJX 4RN5A 1VBE1 3AP5A 1ZM1A 3WX5A 3LFIA 2RS12 2G9FA 4GWIA 4DEVA 3OGRA 2JDZA 3OY8B 5A33A 1AX1A 2ADDA 2BOJA 4XQ4A 5FZ8A 3DN7A 4UFHA 1WCQA 4RA0A 3AP9A 1XPWA 3S7EA 4KU8A 2JENA 1QJU3 4GMP0 1DZRA 4D7YA 3N9PA 3ZXEA 2BPA2 4QX7A 5GJ6A 2C26A 1ZA4A 2IWGB 1W6OA 3FC0A 3IMMA 4FPYA 1MEC1 1RUH2 2NM1A 4A7KA 2ORXA 4ZU7A 3I59B 5CFCB 5JI9A 2FDJA 3PVEA 4UFLA 1Y43B 2VCBA 4XZPA 5A1AA 5JZGB 3VBHC 1AXYA 3PTRB 5FZKA 4KG8A 4W8JA 3ACIA 3K3OA 4AK3A 2ZEWA 3Q9OA 2ZGQA 5FYIA 4ES9A 4Q0SA 1CAXB 2BNOA 1F8VA 3NNFA 1NLQA 3J7NA 4LBMA 4CEYC 1RUJ1 1N1SA 4HPKB 2XJQA 3ZSEA 5AC93 1JOBA 3WHTA 1TMF1 2V4VA 1VRH1 3K51A 4P08A 4CCJA 2TBVA 5FQ0A 2ZX2A 2PHFA 2VW0A 2W1UA 3LEKA 4IV3B 3E1F1 4PF1A 5JUVA 2WNUA 2RS32 4KU7A 1JYTA 2WT1A 3WF0A 1W9FA 2ET1A 1WLCA 3Q8EA 2XVKA 1J3RA 4KGGA 1ONAA 2DVGA 4LMFA 3BTAA 3MHZA 4OFGA 1QXJA 5K0UC 1HXS1 2YC2A 4XBNA 3UKTA 1AJKA 4MOAA 4Y33A 2GH2A 3AL5A 1K5JA 4BK5A 4FPEA 4Z92B 1PIV2 2VNRA 3IN9A 5GALA 2AEYA 1F31A 5LW9A 1OA2A 1QH7A 2W2IA 5FYMA 4XDPA 1A3KA 1V6OA 4RFT0 5DXDA 1LEDA 1BKZA 4NIDA 2I07B 1QOOA 3GJBA 3KZ4C 5A7OA 1RUC1 1IG3A 5A7WB 4C91A 4XJ9A 1ULCA 4QPGB 2DVAA 2QFEA 2XMLA 4AAXA 3LA7A 1H8TC 4AVAA 4LT5A 2CDOA 1ULOA 1RUI2 3AMQA 5GLUA 1YFYA 4JZRA 4Q8LA 1QJY2 5IW0A 1CAUA 4NIAA 5BNPB 5KR7A 1YIPA 2FDIA 4NIGA 3PJQA 4JVAA 4KWLA 1OSGA 5CFDA 4IV1A 4IEZA 4N9IA 1ALYA 2VUCA 1Z78A 1NAEA 3AJYA 5FO8B 3OGSA 1AR71 4HSLA 1FMD1 1PK6B 1H2MA 4IGOA 1O3QA 4K21A 1RTVA 3UK9A 4BQXA 3WY6A 5FP7A 1BBT1 5I0SA 3HWJA 5FDBA 4YVWB 4FQ4A 3T3YA 2BTVC 2A3XA 3N35A 2ZGTA 3LE0A 4P02B 4G4FA 4DO0A 1CAVA 3HQXA 3ZYHA 1UKRA 1W6MA 2VBPA 3M3IA 4XF4A 2FDFA 1IS3A 1J58A 4Q4Y2 3J7LA 1DZTA 1RXGA 4E27A 3P6BA 4TXWA 3WG2A 1C8M3 3ASIA 3C7EA 2JG9B 4X8PA 2XJSA 4CUCA 2JB8A 3LAGA 4RHV2 3O12A 2VXRA 3URFA 3ZKUA 5IVJA 1EUUA 3WNLA 1SPPB 3M3EA 3ZN6B 5A6QA 5FLJA 5KBFA 2ZGOA 2KA3A 1FX5A 4JHZA 5DZGA 2VZRA 1DGRA 3R0RA 1IKPA 5F5IA 4GKXA 4WZFA 4Y1UA 5FMCA 4OHWA 2WL1A 4DY3A 3SCHA 3R4UA 5AVAA 1UNBA 3DXTA 5LCWL 1ZRDA 4TZDA 2Y38A 1MPXA 4LLFA 1CPNA 3GBGA 5A3NA 1SLBA 5T54A 2D6LX 4DY5A 5FLHA 4AFMA 2ZAHA 1EPZA 4OHVA 1N1VA 1OOPC 4XHBA 5DUWA 1O5LA 4Z07A 1G86A 4X6RB 2AC1A 2WS92 4NHKA 1NQDA 1UXXX 1QJEA 4B1MA 4MGQA 3F95A 3R4DB 4JGYA 1BLZA 4LKSA 4XBQA 3BYWA 2QVSB 3VZLA 2GDFA 3KD4A 3ST7A 3N7LA 4AI2A 2NP0A 1RMU2 3APBA 3KVBA 1ZBA2 5CB7A 1W05A 3VUOA 4BLIA 1GNYA 2BRTA 4UI9L 1HRI3 5EV7A 1RVF2 4LBJA 1IHMA 5CKQA 1J83A 4CP2A 3T2TA 3WINE 1QNYA 1PVC2 5FZDA 3TNQA 4CP1A 4BCUA 3RZKA 1CZTA 4FO9A 3UYJA 1AF9A 1W9WA 3DXUA 4MADA 5CISA 2PHTA 2W0XA 1W2UA 2Y6FA 4RGGA 1RHI2 3QLQA 4EQVA 5FBZA 4QX8A 2WZPP 2QZ3A 1UZYA 4RQPC 4AYUA 1QQP2 4XFIA 4N43C 4M3CA 2BWCA 1DGWX 4DUXA 2Y6GA 3U1XA 3PVBB 1RIRA 1Q8SA 2JDPA 1W3XA 2TEPA 2W95A 3MO4A 4CCCA 1RUF2 2A71A 3UETA 4R4XA 2RV9A 5LBBA 4XF0A 4CP9A 3N7JA 2HWE3 1PO13 4UT5A 3ZYBA 2A6WA 5JSOA 3VZMA 1Y4WA 2A6VA 2LALA 3Q8CA 2D5FA 4IE5A 4D7SA 3DYOA 1DQ5A 2RVAA 4URTA 3AMMA 5JIUA 5C9AA 2R073 4J1XA 1KRIA 1OFSA 3NWKA 2UU8A 4Q4W2 1UY0A 3PUQA 1W6PA 4YZ1A 2NYYA 2DV9A 2XLGA 5FTTC 5K7PA 5A70A 2PYTA 4CCKA 3MBWA 3PJYA 4MO3M 2P37A 3IKWA 3V0AB 3MEPA 3BUCA 2ZKLA 5LB6A 1O4ZA 4BXSV 4EYUA 1I5ZA 2I45A 4AEMA 5BNQA 1ND3C 3GHNA 5FZCA 3FHIB 4A44A 1RUNA 2BBAA 2OUHA 1V6LA 2B4KA 2JDUA 4QX0A 4V2WA 2OIIA 1R1A1 3AKTA 4GXLA 3ACLA 1QNWA 2XJTA 2VW1A 4UW6A 3ZSKA 1H30A 1D2SA 2WZR2 3VBOB 3DF0A 5FUNA 2P2KA 1GFF2 5FYVA 3S30A 4JDNA 1ZRCA 4DRRA 2DCYA 2Y64A 4QXKA 1OH4A 4MUVA 4AI3A 4H2AA 3ZYFA 3WSOA 4COYA 5F5QA 1HQWA 1O7FA 2I2SA 1FPN1 5EWSA 2JG8A 5BNNC 4E4SA 2V09A 1I6XA 1W8OA 4Q0VA 5FZ0A 3ZFFC 2HWD3 2ARAA 2K2SA 2JEMA 2IUWA 3ZYGA 1PGL1 3H8XA 5DN2A 4MGZE 1JYNA 2H0VA 2R062 3ZXFA 1UF2C 5FYYA 5FY9A 1NXD1 4RS5A 2FDGA 3RJ2X 1BEV2 4K1ZA 3B00A 1HB3A 3VBRA 1IQAA 1JHJA 3AZYA 2RS51 2UY8A 1JMUB 2AYHA 2WLQA 2HH9A 3BCWA 4E9KA 1ZA7A 3BPZA 5JPNB 2F4PA 1VB2A 3K46A 1POQA 4UFIA 2GC0A 3OBRA 1AXZA 4ATEA 4N53A 4AHXA 4XAAA 4CCEA 1NLSA 3TEWA 1F4AA 2WWSA 1K5MA 1Q56A 3B9CA 3JB4C 4BM8A 2HEWF 2YXSA 3K4DA 5ACA1 5FOBB 2ZMNA 1OUXA 2OT7A 1S0GA 3WP3A 1H6YA 2MHFA 5E1RA 3D0JA 4J6GA 2Q8OA 4DXZA 3I49A 4LA2A 4LO4B 3ZLIA 4ASMB 3BODA 3H1MA 3POYA 1UXZA 1YIFA 1MQTC 3CJIB 3WDWA 5FJHA 3H8OA 1NCQC 4D69A 2PHXA 1Q8PA 5IVCA 4ZY9A 5FMOS 1DLCA 3W59A 1FATA 5FPVA 2E53A 4E2QA 4QPIA 3SMHA 2JXAA 4MGKE 5FLIA 1JUIA 2FMYA 5DAVA 5CKNA 1V6IA 4A7YA 1ZBE3 2WKKA 1YFWA 1D7PM 2GN7A 4B4PA 1N3PA 3ETPA 5LASA 1PM7A 4IGQA 4YGBA 1KD7A 1H8VA 3DCQA 4DQAA 3RZLA 1XNKA 1J3PA 1BMV1 2V5YA 2GMPA 3IMNA 2EA7A 4KWJA 4C0BA 2C0ZA 2DFBA 2JD9A 1UU5A 4GAZA 4GH4C 5LEKA 2WWJA 2YYOA 4R9BA 1NXMA 5BXXA 4LO6B 3ZFGA 5CG9A 1BK1A 4AVSA 3ACHA 3HJRA 1XE7A 3IT8A 2R30A 4QM8A 1PZ7A 1IKQA 1JZ5A 2VZPA 2RDRA 3GZTB 1JYXA 1Z7S3 3VD3A 2VD7A 1HQLA 1QWRA 2V73A 1JZ2A 5T55A 1QJX2 1YI9A 2Y6HA 3LDRA 1VBD2 2PHWA 2ZZJA 5FYCA 3JQWA 2AREA 2FCVA 2VJXA 4MG2A 1WA6X 3OY8A 3AZXA 4DXTA 3AZWA 1HRV3 3H0OA 2B8MA 4XOGA 4INDA 4AR2A 3L2HA 4AFCA 4AWDA 2CY6A 3FHAA 2CL2A 3DPRB 3VKLA 2CGNA 1UU6A 4MVTA 4TYSA 3AMPA 5FUIA 1K12A 2G9ZA 1DGLA 2RHPA 1CR7A 3TRSB 2QE3A 3ZXAC 2YPJA 4MX3A 3MW2A 2PHDA 2F4LA 4XBLA 4XUNA 5CFCA 4UW4A 3HNMA 3R05A 1JODA 1U5ZA 3IZOA 2ZABA 1FOD1 4XFGA 5JR2A 5JZGA 4D0QA 3U78A 4L99A 1YQCA 4DRVA 2D44A 2D5HA 3Q8FA 2VZSA 3AKPA 4WVWA 4QX1A 1B35C 3MV11 4YPJA 4ARXA 5F3CA 3BU7A 5I91A 1BK0A 1CAXA 1CN1A 4W65A 2VOTA 3ZIWA 2X5IA 2ZJCA 4QB1A 4QT6A 5J1XA 3POIA 1DBNA 4HPKA 5FP3A 4P14A 1BXHA 5FXWA 1H2LA 2W39A 3QD6A 2VCCA 5FZIA 1W39A 1W03A 3O1MA 2E7AA 2CWMA 2PN5A 4UBHA 2JICA 2QQOA 4BZ4A 1NX9A 3QOPA 1VBE3 3WXPA 3EJKA 3NJVA 3WQ1A 2NMOA 4Q0UA 3H3ZA 2VL4A 5L36A 1DF0A 2DDUA 2VULA 1NY72 2RDQA 1U0AA 1C5IA 1J1TA 1XJAA 1CVNA 3NV2A 4YG6A 4CU7A 2PFWA 1WMEA 2QBXA 4A3ZA 3L2YA 2R16A 2D7FA 5BYNA 2EAAA 2F17A 3WV6A 1YCIA 1NA1C 4JTOA 3W58A 1MEC3 2JDHA 2Q8EA 4NR1A 3RZJA 2RS11 1XQNA 2IZWA 4OUMA 1ASJ1 4C1WA 2Z42A 3NAPC 4FVVA 2R1DA 2HBUA 2QQJA 1L7QA 5F9TA 2X09A 5A7WA 3SITA 4BA6A 3OSDA 2G1MA 1W04A 1POV0 2VPVA 4QPGA 4I0BA 1BCXA 1LOFC 1I3HA 4K20A 1RINA 1FV3A 2XDVA 1RUJ3 5BNPA 3THPA 5BUVA 1RUH1 4I0AA 4N7UA 1TMF3 1W28A 1VRH3 4BB3A 3B7MA 2JDYA 2VBBA 3INAA 2J1SA 3DKWA 1GANA 4MXWB 4CCNA 2XWJB 1W0OA 2YFUA 3THDA 2CAUA 5LRRA 5FFOC 2VR4A 3WDVA 5JAXA 1G9DA 1PO22 2JKXA 1HXS3 2OPWA 2Q30A 3EYPA 4WM8B 4Q27A 1PMHX 3AVRA 3FLRA 3DECA 1VJ2A 4JGZB 4H14A 5CADA 3IAQA 1B09A 1GSLA 1BVP1 5F5AA 2QDNA 2RS31 2XL7A 1ND2C 4XMAA 5DAXA 1EP0A 1IG0A 1STMA 2WAOA 4GZ9A 2QQKA 4MH0E 3VZKA 4HKLA 2JJ6A 3VBFC 2Z69A 4BK4A 2NLRA 3VDDC 1VLNA 4OHZA 1XNDA 2JKBA 2YU2A 1RUC3 5FYZA 4HL0A 5C3PA 2VQTA 2ZGRA 4DIQA 1Q8VA 2C9KA 1X33A 1JYVA 4COUA 1PIV1 3ITQA 1XC6A 4EN7B 2NN8A 1QJU2 1DP0A 3P5BA 2P6HA 3CF6E 4YW2A 3ZYRA 4QQHA 3RWNA 3MUZ1 2A3WA 4ZPIA 4QMAA 2W52A 2LM3A 3M3OA 1X9PA 1EPWA 1MZ6A 1AR73 1BVVA 1FMD3 3D4KA 4FAGA 1EYBA 1JXNA 3ZDVA 1W8HA 1OPOA 2VZ1A 4A6SA 3VBHB 1BBT3 5CZKA 1S0FA 4KL1A 1XB9A 1CD3G 1F2NA 2BNMA 1RUI1 2D6PA 2XUEA 3LGRA 1QJY1 2EAKA 2GNDA 4L0PA 5FZGA 5F6KA 4CEYB 4EN6B 3AFKA 2GSYA 5A1FA 4QPYA 2W1QA 4DMIA 1OURA 4K8RB 2Q5TA 4IDZA 2WNUC 2WQ8A 3C7GA 2V72A 3JQXA 3OYWA 3BU0A 3MIGA 1WD4A 4LK6A 4ZZ8A 1G9FA 1RGSA 3WVJA 5K0UB 5FXXA 2WA4A 2W9XA 4EROA 1O3TA 4XFBA 4Q4Y1 2E26A 5LEJA 1UPSA 3E6BA 1LOGA 2A6ZA 4W6WA 2VQ0A 2FCTA 2O8QA 4DXSA 3H50A 1CZSA 1GKBA 1ZRRA 4KI5M 4TN7A 2W08A 2WQ4A 1BHGA 1QMJA 1GUIA 1Y3TA 3GCXA 4KGQA 5F39A 2IVIB 1XSQA 2VOWA 2Q8DA 3AP7A 3TWIA 1OQEA 2C1FA 4Q4X1 4PLMA 1C5HA 2WYSA 2XBO2 5BPXA 5FPXA 4YVSC 5IFTA 3LCPA 1UKGA 3VHRA 1T6BX 2ZMLA 3LEGA 2HJIA 3T1LA 5FMBA 4FFIA 5G04L 1AUYA 4NHXA 1H8TB 2B5HA 4R52A 1Q43A 4DUVA 1RUD2 1V70A 5A7SA 3CEWA 2RM22 3HIFA 2BGPA 4C90A 3BIEA 3KT1A 1AR82 1OD5A 2WS91 1MS9A 2ZX4A 2P5BA 3KF5A 4FPJA 3TAYA 4AXOA 1GWKA 1J59A 1CGPA 1XNBA 4Q4V2 3V0AA 4AFDA 1ULEA 1NE4A 4CXYA 3M3CA 2P3JA 4E4HA 3HN3A 3LPFA 2LUWA 1S4CA 3LF7A 1SCRA 4YGDA 3OPZA 5I0UA 3PMEA 4NHLA 4FFHA 4C1XA 1W3VA 3MICA 1RMU1 3ME2A 1ZBA1 1XU1A 4PJYA 4NAMA 3U07A 5LRSA 3P3PA 5C8CC 3PVNA 2IXJA 2VO5A 2VXJA 3POFA 4GB31 4KMQA 4XXPA 1ZVFA 3RQ0A 1GNZA 1PVC1 3AJZA 4K40A 3VBOA 2UYAA 4DOUA 2E63A 2XJPA 3KF3A 1AYM2 5C8WA 5KHJA 2Z4FA 3I2FA 4LHLA 4UOJA 1RITA 2OUJA 2ZS6B 3C8XA 1RHI1 2CGOA 1R082 3M2MA 1E5SA 4E4ZA 1GZ9A 3LFMA 5B4XA 1AR92 2RJ2A 5EQUA 3GGLA 4YW7A 1COV2 3OBAA 4PBPA 5EHDA 4AI0A 1NYWA 2ILMA 5FCCA 4B4RA 2B9VA 5A3UA 4YFZA 3FMGA 2C6SA 3MF9A 5FV3A 3RZMA 3OB8A 4DEQA 2OQ7A 4QAWA 2BVVA 2HWF1 3B69A 3E6DA 1TQ5A 5F37A 3UKNA 1OOPB 1SCSA 1ZZ7A 2WQZC 4LA3A 4E8DA 4IEOA 1MZFA 4QDRA 1S0EA 5A3LA 3GM8A 1CQ9A 2OPKA 1JZ7A 2VC9A 3I3BA 5C4WA 2HYXA 2ZGKA 1OA4A 1PX3A 4JGYC 4TWTA 3MW4A 5FBJA 3WQ0A 4EWEA 2J22A 3T4HB
chains in the Genus database with same CATH topology
1UMZA 2GNTA 1KXGA 1R1A3 4HT1T 2CGPA 1SMVA 4HANA 1SFNA 1GZWB 4WVMA 1HRI2 2Q4SA 4FSJA 5SV8A 3C3VA 4LEJA 3AXDA 5T5OA 2XHKA 4FPCA 4CRQA 2GC3A 1MS1A 1X82A 3VHPA 5DUXA 1FPN3 1DQ6A 3WCRA 4KWKA 4RQPB 4AQTA 4N43B 3WQ7A 1QXRA 1X36A 4LBQA 4E2GA 3GBFA 4Z8BA 4F7ZA 3DUIA 4Y24A 4H3WA 2RS53 1AL0G 4BWOA 1WBFA 3VBUA 2I74A 2BWAA 4BMEA 2HWB2 3H9AA 2HEYF 3MZHA 3H7JA 2OZ6A 4OLLA 2P17A 2R061 4CEWC 5ACA3 1W6QB 1Y7BA 2D3PA 1BEV1 4YW4A 1WLWA 2ZGUA 4FPGA 1ULFA 1QH6A 4XFFA 1ND3B 1PHMA 3NKTA 2XKOA 1CAWB 4GMP1 4H7LA 2XVGA 4D7TA 3ILFA 4QQPA 4JC1A 1S2KA 3L9JT 3IWZA 3WDYA 2BQPA 5KXCA 3DPRA 5A3MA 3IPVB 2PELA 1H2KA 2DVDA 1LKNA 2QJVA 2ETEA 2WNEA 1EV12 3RG0A 4UBGA 3M1HA 1TNRA 3JZVA 1JHNA 2A75A 2XH6A 1ZYBA 3V65A 5BNNB 2ZBJA 4AF9A 4WVZA 1V9U2 3ZFFB 4B7KA 4O9GA 1WD3A 4CP0A 2HWD2 3AX4A 1MVEA 1RUE2 4LHNA 2ATFA 1ULGA 2HKXA 1D0HA 2GNBA 5DDJ2 4RS5C 1IZ3A 5GLVA 4FT8A 3VBRC 3AYEA 5L7OC 4QX5A 4P9IA 1VP6A 3ZO0B 5JDBA 3N4MA 2CYFA 1X8MA 1V6MA 3AMNA 2WT0A 1UCXA 1W6NB 3HN1A 4META 1JYCA 4CDXA 2EIGA 4HN1A 4N53C 2D43A 4CDWC 5SV5A 4IEVA 1K5MC 4LO8A 2VMGA 4AGRA 4DNYA 5HCFA 1JN2P 2RR11 1AXKA 1GLHA 5GZCA 1QJX1 3UJQA 4YARA 2O8OA 3ZYIB 4IEWA 1MQTB 5GLTA 1HIXA 1NCQB 4FPHA 4WV8A 2R042 4M01A 4D3WA 1LENA 5FOJB 3PNAA 1V6JA 2QZ2A 1FOD3 2UWCA 5I8SA 4QPIC 4PBOA 4YW5A 4K7JA 4R8HA 5BNOC 1YWKA 2D98A 2WFPA 2GNMA 2QKDA 2WNVA 5CU1A 1ZBE2 3NW4A 1SLCA 1DZQA 2LTNA 3NL1A 2DUPA 5KHHA 3TN93 2Y26A 1AYN2 1YJKA 2PLV2 4FPLA 4FP3A 4B29A 4BHPA 5I0RA 3VKNA 4KQ7A 4XF1A 4Z1VA 1NZCA 3MFCA 4PLOA 3RYRA 1AL22 4W6XA 3ZFGC 1SLAA 4YM1A 4AEDA 5CBLA 5IK8A 4I01A 2XG3A 4I30A 2C5DA 2EF6A 4WM8A 3MIEA 5EZWA 4JDMA 3X29B 4M00A 3BALA 3I2DA 1SLIA 4HK9A 5GZFA 3WG3A 4AFBA 2GH8A 3SH5A 1NE6A 3GALA 1VAVA 2RS13 2R0HA 5J09A 1ASJ3 2EALA 2XWBB 1DGRN 2ENRA 2D3RA 4GWNA 1LR5A 1C1LA 1N47A 1NY71 2PHUA 1BYHA 3VLBB 2RE9A 1APNA 1WMFA 1OI6A 1AR61 1RUH3 4LO5B 2HWC2 4YGCA 5JSRA 2SLIA 1RUG2 1ENXA 3FUOA 1O91A 1LGNA 2Q0AA 4Y5Z0 3RNSA 5KXDA 4CDUC 3ZFEC 4WM7A 5B2GB 3VBHA 4HSJA 1B35B 4XE9A 2GC2A 4FOYA 1OQDA 1QOTA 3NO8A 4P9XA 4XETA 2X5IC 2NMNA 3B01A 2MPFA 1C4RA 1DYPA 1YFUA 1M06G 4ZXKA 1EAH2 3MIHA 3SH3A 5IK4A 1SLLA 4CDQC 2RS33 3JD72 3E5XA 3DV8A 4XIKA 1VBB2 1D4M1 4HKOA 4MSVA 2WIIB 2VH9A 5K8SA 1OLQA 5JPMB 2ZOEB 5IK7A 4GALA 5I93A 3LOBA 1F9KA 2A5ZA 3QH7A 4YG0A 5A32B 5K9YA 2AENA 2ZHLA 3VZJA 4COZA 4IEPA 3HR9A 4DINB 2ARXA 1PIV3 2FZ1A 3NSTA 2YGMA 2NQYA 4PQ9A 4ES8A 1IOAA 4I09A 2Y0IA 2MEV1 3D5OA 4XTMA 1PZ9A 4IESA 1NA1B 1Z0HA 1VALA 1QHDA 3ZVXA 1WLDA 1G9BA 3TB0A 1DLLA 1OFNA 2Q1MA 3M3QA 3NAPB 1CJPA 2XUMA 3QH6A 2FBEA 2ZGPA 5AFEA 1SBDA 1RUI3 5JIAA 1H8TA 3MPPG 5C6CA 1QJY3 2JD4A 1YRZA 4JQRA 2RMU2 3WD5A 3PLQA 1JW6A 4XTPA 4HVQA 3RS6A 4R4ZA 1NCRA 4PIYA 3AZVA 4N7IA 1UU4A 3MLLA 4MYEA 2IXCA 3B5LB 4C0HA 3RYKA 4KG0A 4BYYA 4EV0A 1NG0A 3GF6A 4OI1A 4PDWA 4WZCA 4XF9A 5ABJC 4Q4Y3 5C33A 2BBVA 1KFUL 5D8AA 2WFF2 3VBSA 3IBMA 4NOTA 3IM0A 1ND2B 3M4FA 1G8WA 5JWPA 4HVRA 4Y22A 1RUOA 4FTBA 3VBFB 5CG8A 3DGTA 4Y20A 1G7YA 3MLKA 4Q4X3 4YZ4A 4FPFA 3VDDB 2VVEA 5A33B 4RR3A 1D4VB 4LBKA 3O0XA 5I8YA 3ZXLA 4BPZA 1JTZX 1VBC2 4ZU4A 1HQNA 5GZDA 4YYOA 2YDEA 4LUKA 1GNHA 3S7IA 5FAXA 4PIZA 2XJVA 2B42B 4FXGB 3B02A 2H6CA 1OOPA 2WS93 4NWVA 3MDPA 5CVRA 3RDIA 2XBO1 2PA7A 2DCTA 3VL9A 3KQRA 2Y0OA 1UPIA 1AR72 3S0MA 4HETA 2VVDA 3RI8A 3ZSMA 3ZPYA 2VY0A 1XE8A 4FTSA 1RUD1 1DGWA 2DVFA 3WNXA 1RMU3 3K48A 1ZBA3 5JCTA 5KHGA 2RM21 1KJLA 3J8F2 1H9WA 5EYYA 3VN4A 2O0OA 1AR81 4GB33 1GZWA 1YXWA 1FNZA 2E7TA 1PVC3 1TME2 4K9SA 5T5LA 4AGVA 3I54A 4Q4V1 2WNUB 2JECA 3SH4A 1HKDA 3ZX7A 2DTWA 1Q5OA 1LESA 2BFUL 3I7DA 1YJLA 2ZPXA 1RHI3 4RGAA 2XPJA 3LB9A 2EXHA 2TNFA 2AUYA 2FQPA 2ZGMA 1A6CA 2EXIA 2O1QA 5IK5A 5GM0A 5GKAC 3I59A 5DG1A 4N43A 3E6CC 1NLRA 3TBDA 4S2FA 1AYM1 2HWF3 5J48A 2FMDA 1O5UA 3AXEA 2AZ5A 1QU0A 2YROA 1J3QA 4NHMA 3RJRA 1R081 3O14A 1AR91 4YVSB 1COV1 1YLLA 3TN91 1BJQA 5KC5A 1L3JA 2XL9A 1R1ZA 3OCPA 3ROUA 4IV3A 3HMYA 1S0JA 4KH9A 2ZX3A 2IFRA 4HKWA 1LOAA 4GWMA 1CAUB 1X50A 3QACA 3NVCA 4G3YC 4LE4A 4KBBA 4AG4A 1SBEA 3PMSA 1LOEA 4ZU5A 5HCAA 2G9GA 4XXAA 3H1WA 1LEMA 1XYPA 2F6BA 3OTFA 4UXAA 2XVLA 4YRDA 4MV2A 4B8EA 4YW3A 1CAVB 5C8CB 2EVXA 1W6MB 5GLWA 1FYUA 2VQAA 4DPNA 1LRHA 1QF3A 1IPJA 5FREA 4EN9B 3LA3A 1KDMA 3IPVA 1QDCA 1R092 3AYAA 2YUEA 1SDWA 1LHOA 3OBTA 1G9AA 4IQPA 3SHRA 2D6NA 4LUMA 1XU2A 3P3NA 3KGZA 2VMIA 5BNNA 4X8NA 3U0ZA 1KJRA 3M70A 4YFWA 4W6YA 1PK6A 5KHIA 5F6LB 4F83A 3ATGA 2R063 4ASLA 3AP4A 1VBA2 2D6KA 3FBMA 4TSVA 1BEV3 2VG9A 4YVWA 1C3HA 1DU3D 3M7AA 1TE1B 3EO6A 1GR3A 4XJUA 5C4WC 5H9RA 4FXKB 4JGYB 1SEFA 1S0DA 2OVUA 2HWB1 1REEA 4GMP3 2IXLA 5KXEA 4XIOA 4YZ2A 2JG9A 3MIFA 5E8AA 4JAAA 3KT4A 4K1YA 1R1A2 1ULDA 3AP6A 3ZN6A 3JBG2 1XYNA 2KM2A 1O3SA 2BGCA 5H9SA 2P3IA 1JOJA 4YZ5A 4XQWA 2ZHNA 3SNMA 1POV1 3LWCA 4I3PA 5J3UA 3ZXKA 3KT7A 1E57A 1MQTA 2WA3A 4IXLA 1NCQA 4GA9A 1N3QA 1JUHA 4Y1VA 4M3CB 3CU7A 3AK0A 1QY4A 1RB8G 3ZXDA 3JB8A 3WG1A 3ALQA 1EV11 3WW4A 3HBZA 1OKQA 4AGGA 4B7EA 3OGJA 5IUQA 3ZSLA 5T50A 2BEOA 4YM3A 2X53S 3VBUC 1V9U1 4XQDA 5AC92 4BOWA 1KFXL 3SXWA 1RL3A 5T5PA 1I1EA 4OVEA 1RUE1 4U2AA 4CEWB 4DZGA 2CWSA 4K3UA 5DDJ1 3PVOA 2RR13 4AVCA 1IPKA 3A4UA 5ACA2 4YM2A 3FBYA 1WBLA 1PGSA 2ZAAA 5GLZA 1QJX3 2Z2SB 4YM0A 1KDKA 4LULA 2QNKA 3A0KA 4COWA 4RHV1 4M0HA 5JOWA 1WCSA 3B9IA 1JYIA 1MZ5A 4MXVA 3CLPA 4B3NA 1MS0A 2DUQA 3GZUC 5HBAA 2IC1A 4Y4YA 1ZZ9A 4YLZA 2R041 1O3RA 3WHUA 1MACA 3GHMA 2ZZQA 1PVXA 5CFDC 4IV1C 3H7YA 2IXKA 1H4HA 3MLJA 3SCGA 2GAUA 3FWEA 4BH9A 3THTA 5JVVA 4QGLA 2GU9A 4XW3A 2WSVA 1YNAA 1AYN1 2PLV1 3E97A 5T52A 4RS5B 5T5JA 2R49A 4E4DX 3VBRB 5L7OB 4RD7A 1A78A 2QUOA 2XLAA 1RVF1 3ZIXA 1AL21 1LHWA 4GULA 5L19A 3ZSJA 2NZ9A 2TUNA 2OA2A 1PNGA 1N1YA 1UZZA 3EXUA 4CDXC 4CDWB 1C8M2 2DF7A 1K5MB 4NO4A 5A32A 1WLTA 1OPMA 3I8TA 1YI7A 1ZZBA 1U5YA 2PAEA 1AR63 4R9CA 2D93A 1QQP1 4YGEA 1DG6A 1UN1A 3H3UA 1NA1A 3EQEA 3ZYPA 3RRDA 4AVTA 3ENRA 1ZX5A 4PIXA 4Q29A 4OULA 4P9LA 1RUF1 4QPIB 3N36A 4QQ2A 2H0BA 1HX6A 1O4YA 5BNOB 3VHNA 3FUQA 3EHKA 4L2NA 4LHKA 1QXPA 2WNVC 3T1MA 5CA6A 2HWC1 2GMEA 3BOWA 4FPOB 5KC6A 1RUG1 1CPMA 1PZ8A 4Q4W1 1QJZA 4WBBA 3WDXA 4E2SA 1WCDJ 2XB6C 1D4M3 2ZGSA 2JX9A 3OD0A 3MIDA 1JBCA 3ZFGB 4AEDC 1AZDA 4FTEA 1KS5A 4V1PA 4SLIA 3V64A 3D0SA 3LOIA 4SBVA 1AVBA 1FT9A 1EAH1 3CJIA 2SBAA 4S2GA 2YHJA 3R6SA 3JD71 1UIJA 2MEV3 1ND2A 1VBB1 1QGLA 2WZR1 5GZGA 4HFSA 2DU0A 4JV4A 3VBFA 1MZEA 4Y1XA 3VDDA 2BVBA 4XDQA 1UD1A 2X29A 3AB0A 3AM2A 1I9RA 3FX3A 5JSPA 1ASJ2 1XNCA 3FFQA 3ELNA 3ZDSA 3JCIA 4UW5A 2R32A 4IEQA 3O5SA 2D3SA 4JRAA 1AX0A 2GN3A 2ZCWA 3B94A 2HWE2 1PO12 3RYPA 4AQSA 3NKGA 4IEUA 3CL1A 4JTNA 5C9AC 4AQ6A 3VZOA 3UV9A 1GQGA 1GYKA 1ZZCA 2R072 4CTEA 1LHNA 2ZGLA 4JRLA 4CDUB 4WM7C 3ZFEB 3J26N 2DFCA 3AFGA 1LODA 4XYXA 3AYDA 2RMU1 4M3CF 3WCSA 2DCZA 4OHYA 4DB5A 4LBOA 2X5IB 4BQ1A 2DTYA 5CNAA 2WJSA 2R6QA 1HLCA 4CDQB 4CZSA 5FO7B 1EY2A 2WLPA 4AI1A 3MF6A 4QM9A 4AW7A 4RSUA 3VKMA 2W68A 2XGXA 3ETQA 5JOZA 4XPVA 3WP4A 2VUAA 4LBNA 4XFHA 4ISQA 5CIRA 3QCWA 1BQPA 2WFF1 3WP5A 5GZEA 3MI8A 3UKVA 4H55A 1Q8OA 2BNNA 4BLJA 4XJZA 3ZMOA 4AEJA 5JOYA 1FI2A 2JG8C 4FAHA 2ZX1A 2VOXA 4PF5A 1H0BA 2XBO3 2D6MA 3O7OA 1J1LA 2XJRA 4QQLA 4R9AA 2E9QA 4YVSA 2GALA 2VNOA 3WUCA 4LBLA 1VIWB 1VBC1 5H9PA 1N3OA 1RUD3 1S1AA 1REFA 3SCFA 1FNYA 4YNIA 1V6KA 2RM23 4J1WA 4DFSA 1CONA 1AR83 1NCRC 3LZZA 3CNAA 1H1IA 1DQ0A 1GQHA 1HV0A 2B7YA 4Q4V3 3C2UA 4Q1RA 2KXLA 4X6QB 1CESA 4YG3A 1S0CA 4XJAA 4EWAA 1C28A 1ZREA 1VB4A 4FOWA 3LKJA 1LTEA 4Y1YA 3D82A 3HT2A 4L8QA 4NVPA 3J8F1 2HYKA 1V00A 2VGDA 4PDWC 5EXOA 5ABJB 1YYNA 1KITA 1VBD1 1WW7A 3MYXA 4H7MA 4XFAA 5C8CA 4S2DA 1TME1 1WMDA 5D8AC 3ZN4A 2WINB 1AYM3 5BV6A 3ILRA 3VBSC 3J4UH 4AI8A 2BYVE 3UL2A 3WG4A 5J98B 4AFAA 5DUUA 1R083 1PGW2 5LK7B 4L9BA 1AR93 3VHOA 3FLTA 2YGLA 2D40A 3R4SA 1COV3 4Q4X2 4RR3C 4Z82A 1IS4A 3WP6A 1DIWA 4I2OA 4MXWA 1LU1A 3V0BB 3AMHA 3U11A 3FZ3A 1GZCA 1Q3EA 4GH4B 4EJRA 1GV9A 1MS3A 5FMOL 3RSJA 3W9AA 1S2BA 1SACA 1YO8A 1LB2A 1TNFA 1X8EA 3E5QA 3AZZA 2RJKA 3N7MA 4A2UA 2AGSA 4JGZA 4L11A 4A3XA 1MVQA 3JUUA 3KCYA 2IFWA 1Z7S2 3KGLA 4FCAA 2NPIA 2QDRA 2P34A 5LK5A 5JOXA 1LHVA 5AFBA 1WA4A 2PHLA 1JH5A 1HV1A 1HW5A 1DYKA 2GC1A 3SISA 4GB32 1OA3A 2ES3A 3KS7A 4WVVA 3KSCA 1HRV2 2D6OX 3OYWB 4AE2A 2XKPA 3USUB 5E89A 2AH2A 3PHMA 1GICA 2EXKA 5CFCC 3H8UA 2CAVA 1LCLA 3QBQA 1R091 4LO7A 5JZGC 2HWF2 1Q8QA 2PAMA 4FOQA 4ITCA 5J36A 1VAMA 2FZ2A 1URXA 4CEYA 4Y26A 3VKFC 2HWB3 3BIWE 4NWWA 2ZTNA 2QCSB 3BB6A 4IV3C 4AHWA 3B3QE 1QDOA 2VECA 2VVFA 4ISRA 1VBA1 1REDA 3RMYA 2VNGA 1PO21 5J7MA 4CEWA 3KLSA 3U4XA 1VBE2 1DQ4A 4Q1PA 5K0UA 3WW1A 3H1YA 4FQZA 2Q1ZB 1POV3 1UL9A 5J37A 1UIKA 5E88A 3TNPB 3NV1A 4Q0PA 3J9SA 4GQ7A 1WW5A 4ORFA 3JBG1 2DCKA 3MIBA 3KMHA 4LR4A 2A6XA 1MEC2 1AJOA 1LHUA 1LGCA 5I0TA 1VR3A 1UW8A 2H6BA 4YZ3A 5IT6A 1OMIA 1S0BA 4FOVA 4P9YA 1EV13 4QPGC 1DQ1A 3WUDA 4M0NA 3MW3A 4P5HA 4PCRA 1QJU1 5BNPC 1RUJ2 1V9U3 4Q26A 3DL3A 2ZKNA 2A7AA 1TMF2 3FLPA 1VRH2 4ZKTB 2DCJA 2XLFA 4L92A 3WR0A 2YMZA 1CJDA 1IS5A 4XMIA 2BW8A 1RUE3 2C9AA 1C57A 1PK6C 4HMZA 5DDJ3 5EFUA 3RMXA 4YVWC 2WC2A 5C4WB 5L7OA 1HXS2 2IXHA 3A0NA 5AC91 2G4IA 2IXIA 1YUDA 4ONUA 1ZZ6A 4RHV3 2CV6A 2JG9C 2E51A 4CDWA 1QKQA 4WVMB 1LOCA 3U10A 1WUVA 1RUC2 4LLOA 2DUOA 2A73B 3HD8B 4QD2A 1SLTA 2ZHMA 3G6JB 2R043 4IEXA 3OGGA 4BMBA 1W6OB 1RJ8A 1OQ1A 1SFYA 2CNAA 2JE7A 5BNOA 4O9EA 4LBQB 2UYBA 5BY5A 1FMD2 3FJSA 2VUJA 1AYN3 2PLV3 1U12A 3VGIA 3KB5A 1DDLA 4P9GA 1BBT2 1YHFA 4AVVA 1V6NA 2UY9A 4N90A 3MGUA 1A8MA 3M8LA 3GNEA 1RVF3 1AL23 3VBUB 5FQ0B 3WOGA 1SBFA 4P9JA 2E7QA 4HVOA 4Z2WA 4QHBA 4MLOA 3I4IA 4LNVA 1O4TA 4OI2A 3WDTA 5JLVA 2RR12 1QQP3 3ES1A 4RQPA 4G9SB 1LOBA 2DWRA 3KCXA 4U36A 2R0FA 2WSUA 4B4QA 1H4GA 2YZ4A 1C8M1 1CX4A 1RUF3 1DQ2A 4IETA 1D0GA 4OZXA 3HAGA 3N3HA 3WDUA 5CAZA 4EN8B 4Y1ZA 3OJBA 2DVBA 4Q0QA 2XJUA 2HWC3 4F3JA 4COVA 3GYDA 1RUG3 3D6EA 4Q4W3 4HBNA 2PQQA 1NOVA 4LE3A 3G7DA 4S2HA 2YC0A 1QOSA 5CFDB 5E16A 4IV1B 1W6QA 1WGPA 3ZFEA 4CDUA 1AHSA 4K8FA 4JCKA 3ZMNA 4EWDA 1TEIA 1WW4A 5EJ3A 1ND3A 4L97A 2ZHKA 1EAH3 2K0GA 1CAWA 5FPZA 3JD73 2Z79A 4CDQA 3VV1A 1VBB3 2B39A 2UWBA 2WZR3 3PTYA 4NPRA 2FHRA 4AVBA 1RC6A 1HRI1 3GBWA 3VBOC 3B93A 3D8CA 4GIQA 1C8NA 4CDXB 1S55A 2DURA 3OF1A 2YY1A 4BE3A 2RJLA 1ZNPA 2A70A 4I3GA 4XEZA 1NQJA 2N7GA 1FV2A 3TYJA 3FE5A 1MR5A 3WW2A 5I8TA 1AR62 4JDOA 4A7ZA 4IERA 3ZFFA 1H9PA