4JUIA

Crystal structure of tannase from from lactobacillus plantarum
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
470
structure length
470
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTAAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords Tannase
total genus 160
structure length 470
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4juiA00
2W22A 4H0CA 1CUSA 4CG3A 4B81A 2XE4A 3LS2A 1JI3A 3D0KA 5HKBA 1LGYA 1DINA 1CQWA 2WFZA 4LYEA 3BE8A 5JARA 1E89A 3ESBA 4K6HA 3EBLA 3V9AA 3L1IA 3SK0A 5C8VA 4BVKA 1N1MA 4BVLA 4PSDA 2WQZA 1VXRA 1H22A 2J3DA 3DS8A 2QMQA 5JZSA 3STUA 3WKBA 1ZD4A 1SOMA 1ACJA 2Z3ZA 4CIBA 5ALYA 1R9NA 2JEYA 1WB5A 4OU5A 5HFAA 5T4EA 3FCYA 4OD0A 1VJ5A 3C6XA 4UFOA 2C58A 2XMQA 2PVSA 1Q84A 3C5VA 1J1IA 4EHBA 3VISA 1YAHA 5IVHA 2XUJA 4OPMA 3BL8A 4B85A 4UBMA 4FNMA 3D2BA 1DX6A 3LIIA 1OILA 3WJ1A 2LIPA 1ISPA 3ED1A 5AKIA 1CQZA 4JNCA 1CEXA 2GBGA 4X6XA 2H7YA 1DWQA 1ODCA 1XQVA 3GELA 4L0CA 4BCCA 5IVIA 2BGNA 1UOQA 4X90A 3V1LA 4K2AA 3ZLUA 4EZIA 3DLTA 1GT6A 2ZYHA 1XLWA 3N2ZB 4MQLA 4NVRA 1A8QA 4B0OA 2BUBA 4L3WA 2HHAA 2JBWA 2Y2UA 1EVEA 4ZI5A 5F4ZA 1T2NA 1LPNA 1YCDA 1GKLA 1XFDA 4J0GA 3M81A 4PSUA 4H18A 5ESRA 2QXTA 4L9AA 5FPPA 3W2TA 3DEAA 5DYTA 3PI6A 3A2NA 5LYYA 4NZZA 5AOAA 1E8DA 2OAGA 1VZ3A 1PFQA 5AP9A 4M0FA 3A2MA 5JADA 3QPAA 1CUCA 4W1PA 1U2EA 3C70A 3GBSA 1YAJA 3M82A 4AQDA 4QEKA 3BJRA 3FBWA 5FOQA 2AJLI 1G5FA 3ZLVA 1D07A 4EBBA 5LZ9A 2JGLA 4J0DA 4XJVA 2WKWA 2WG2A 4TPKA 1EB8A 2HA2A 5CH3A 5T4FA 4Y2RA 3R3UA 4K6GA 1W6RA 5CMLA 1TCBA 2WU3A 2OG1A 1XKTA 5ALJA 5HF8A 1QO9A 2OPHA 4Q34A 5BWCA 4Y9SA 4Q1VA 4CG2A 5EHZA 2ZJFA 5AICA 5ALFA 1GKKA 4OSEA 5FXMA 1ZI6A 1E8NA 1EXWA 4FOLA 2QUBA 1CFJA 1CUAA 1N5MA 3TRDA 2XMGA 3AFIA 2OGSA 4CI9A 1FFBA 1WB6A 2I03A 2QVBA 1BCSA 2IX9A 3HACA 4B6GA 2WFLB 3H19A 5K3CA 4A16A 1W75A 2DHCA 2PSEA 1UFOA 4QZVA 5I7UA 2YYSA 1A8UA 2XI4A 4X00A 5I8PA 4KE9A 4KAAA 3I28A 4GDMA 1XKLA 3F9CA 1EDDA 3QMWA 2GBCA 2O7RA 2VAXA 5E4TA 3ZWQA 3ESDA 4DLNA 5AKLA 3BXPA 1LPOA 2JGIA 3VDXA 4BTLA 3A6ZA 4DMFA 1SC9A 3DOHA 1YSCA 3STTA 3STVA 3KOOA 1BRTA 1R1DA 1IUPA 1TAHA 2DHDA 5HKAA 2WIFA 3O4HA 4KJXA 4RGYA 7YASA 4C4ZA 1EB9A 1CUFA 1VLQA 5FV4A 1ACLA 2QM0A 2R11A 5AI5A 4GLBA 4DMKA 4UBNA 3T4UA 5FP0A 1ORVA 4J0KA 3O4IA 2OCLA 3KWFA 1J07A 5EI5A 4W1SA 1CRLA 5CURA 2VTVA 1QONA 1CPYA 2XMCA 2GYVA 2ORYA 4IH1A 4I4CA 2XUDA 4PW0A 1WOMA 4WCVA 1ODTC 5K5EA 2O2IA 4HS9A 5AI8A 3ZLTA 5AKEA 2HL6A 1DT5A 5ALRA 2W6CX 1ZI8A 2VF2A 1XRPA 5AM5A 3EQ7A 3IURA 3R3YA 4BE9A 5JALA 2WIGA 5ALUA 1LZKA 3V1KA 1M33A 4AO7A 3O4GA 2R8BA 4H77A 3Q0TA 2O2GA 1XRRA 3ESCA 1Q0ZA 2HA7A 4QWWA 3I2FA 1K63A 1W76A 2FX5A 4J0JA 2OQVA 3OC0A 2PSJA 3WK8A 5HQ3B 3RM3A 4U2GA 4P9NA 4H7IA 2VEOA 1CUXA 2QKYA 2Z5GA 2XMRA 5AKYA 2XUAA 3ICVA 5CT4A 4BAUA 3CCCA 2AXEA 4HXGA 2VATA 1UKAA 2EEPA 5E4JA 1LNSA 1MJ5A 4G4GA 3JYHA 2X5XA 1XZKA 2O2HA 1J06A 3AIOA 3PF8A 3PFCA 4FFWA 4FLEA 5SYMA 1ZIXA 3WA7A 4Q3OA 1QIDA 2QRUA 4BCDA 5FLKA 3EQ9A 2GZSA 4KE8A 1XZEA 5ALSA 5AK6A 5ALOA 4I3FA 1IVYA 4P08A 1IMJA 3WL5A 3G0IA 2G5PA 3R3VA 4QLAA 3C6YA 5CH8A 4UHFA 5DLPA 5JATA 4UUQA 1GPLA 3E4DA 3V48A 3FOBA 2DHEA 1WPXA 3AIMA 2ZVDA 4O08A 3DNMA 2ZSHA 1O6FA 1EINA 3IA2A 2RHTA 2QOEA 4Y2QA 2XMSA 2J4CA 1VOTA 5AKZA 5ALGA 5A7FA 5FUMA 2WIKA 1U4NA 1CV2A 1YA4A 1UZAA 2WUFA 1Q0RA 1EH5A 4INZA 2X76A 4XX1A 1FJ2A 3ESAA 1ZGCA 4HXFB 2BUAA 1BN7A 1CVLA 1TCCA 2RIPA 3PUHA 1UK7A 5ALQA 4DSZA 1F0PA 1NU8A 4FHZA 5DNWA 1QTRA 3M83A 3D3NA 1MN6A 4QA9A 4W63A 2I3ZA 1VKHA 3I2HA 4QNNA 5D3KA 4C4YA 2PU5A 4DSAA 1XQYA 3IUNA 3D2CA 2I3DA 1UT6A 3R3XA 4YK7A 3QMMA 5K3DA 3F97A 4DGQA 4G9GA 2CMFA 2V97A 4KEAA 1VA4A 4D9JA 3IIIA 2EDAA 3QYJA 1SFRA 1XLUA 1K5PA 2WHPB 2HRQA 5FDFA 5HCUA 3D59A 3WWEA 5K3EA 1Q83A 5CT6A 5AJHA 3WL7A 5DJ5A 4G8CA 5IVDA 2HA0A 2QR5A 4X71A 1LPPA 4LXIA 4AZ3A 3I6ZA 1LPBB 1MT3A 1U65A 1SCQA 1QIKA 1CUJA 2XUIA 4DMHA 4X6YA 2I78A 4W9RA 5JIBA 2OXEA 2Z8XA 5IH7A 1J2EA 2YASA 1MNQA 1R9MA 2HA5A 5AHXA 2H9YA 3BDIA 1TIBA 1ETHA 2PSDA 1BU8A 4U2CA 3G8YA 5EHQA 3IBTA 4KR0A 1TCAA 1WM1A 4U2DA 2G4LA 2C0PA 4ZREA 3AZQA 5CT5A 1IUOA 2XQGA 4J0IA 4KACA 2WTMA 4LIPD 2AJDA 1CIJA 5CBKA 4N5IX 4UFPA 1AKNA 4YPVA 2WIJA 2PKYX 2WIDA 5YASA 3WK6A 3WZMA 3B3QA 4DTCA 4FWBA 5JD6A 3GZJA 2RAUA 1XZFA 3G9ZA 5AOBA 3E0XA 1PJAA 3O95A 4MEAA 3WKDA 3KDAA 1XRQA 2CUTA 3BIWA 5DWDA 1BN6A 2VJDA 5D3ZA 4OB7A 3VVMA 3C87A 1MO2A 1WPRA 2H1IA 4IH9A 4Q3LA 4BAZA 5J3JA 3OURA 5LKRA 4WFIA 4G8BA 2P8SA 1QE3A 2JGJA 1QJ4A 5LLSA 1CUDA 3D4LA 4UHCA 3I1IA 4GBGA 1TKRA 1H23A 3FVTA 3E1GA 3HI4A 5AH0A 2HFJA 4ETWA 1MX9A 4ZXFA 4KYVA 1LBTA 1XZCA 1GZ7A 4OU4A 1TQHA 2VT7A 1BE0A 3WL6A 4EUSA 3QBJA 1XZLA 3VVLA 5ALHA 2OCIA 1ZD2P 4QDUA 2VA9A 5A6VA 1UOOA 5AK3A 3EIOA 1FFDA 5CXUA 3WWDA 2K2QB 4IQ4A 5AKXA 1GGVA 4QWMA 4AO6A 2BGRA 5AI0A 4UFNA 2PX6A 3CN9A 2VJAA 1ZJ4A 3AJAA 3QZUA 3FVRA 1XRLA 3G7NA 4MYDA 2XQKA 2PUHA 4AZ0A 4TGLA 4DYHA 1Y37A 4E46A 3HLKA 1QFMA 4ITVA 2V96A 5ALXA 5LZ7A 3IUQA 1W4LA 2XMZA 4EY8A 3W06A 5HZGA 4BC1A 4FNGA 5LKAA 4EY7A 2QXUA 4MWSA 4FLMA 1LBSA 1Y7IA 3WK4A 2OGZA 4OCZA 2XUFA 1P0PA 1S8OA 2XLBA 1CUYA 5DNUA 4BAGA 4V2IA 2XUQA 4X93A 1P0MA 5FPQA 5EFZA 4BP9A 5JD4A 2HU5A 1QFSA 3PDCA 1F8UA 3E3AA 3F96A 3STYA 4PNZA 2QJRA 1YS2X 2C5GA 1LPAB 3K9BA 3Q8WA 4G8DA 4E14A 4C89A 3WWCA 2XLCA 2DCMA 5AI6A 2BKLA 4QE3A 3N0TA 1EX9A 3U1TA 5BV7A 4RE5A 3FSGA 3IULA 3ZI7A 5JANA 1XZAA 1YA8A 1FFAA 1CUWA 4Q82A 2WUDA 4BZZA 2XMBA 2HRRA 1UXOA 2ONCA 3WQHA 3LP5A 4AX4A 3LLCA 3I2JA 3I1YA 1JFRA 3EF3A 1DT3A 3X3HA 4J0HA 3G0DA 3QITA 5C8XA 1JKMA 4B82A 5AO9A 1C4XA 1X70A 1B41A 3CCBA 2WHRA 5ISMA 3OTQA 4H35A 1QZ3A 4CG1A 5ALLA 4X91A 1QIGA 5AK5A 3OPMA 4FBLA 2ROQA 1CUBA 4FLFA 1XZJA 1SCIA 4BTVA 5JZ9A 3HC7A 1XROA 1FFEA 4GHWA 4EY4A 1XRNA 3UMJA 2Q0XA 1I6WA 1QTIA 3WK5A 2WILA 4BCBA 2XUOA 2WM2A 3UUFA 2NW6A 5CT9A 3QVMA 2CKMA 4X92A 1A7UA 3WKAA 4ZGBA 3NGMA 1C7IA 3WYDA 2OCKA 3KSRA 4C87A 2IIVA 2PUJA 2FJ0A 1HLGA 2GYWA 5EIHA 2HU8A 4Y7DA 2JIDA 5AI9A 5AI4A 3PF9A 2HIHA 4Q05A 3FYTA 2BCEA 4H7DA 4GWLA 1QIMA 2GBFA 3R3WA 4PV7A 1L7QA 2ZYRA 5IVKA 5KREA 2VJBA 3QMVA 1R3DA 3FYUC 4FTWA 1CUVA 3H18A 4B9EA 3F98A 1ODSA 1W52X 1WCYA 3BDVA 1N5RA 3UUEA 3MUOA 1RP1A 1USWA 3HEAA 3HZOA 5EGNA 4MEBA 4ZV7A 3K2IA 5K3FB 4M0EA 2WJ4A 3PFBA 3DD5A 4F21A 3IDAA 1YR2A 2UZ0A 3WA6A 3HSSA 4G5XA 5KWIA 2WTNA 3QH4A 3WKCA 1UKCA 4LXGA 1UK8A 5A71A 3IUMA 4IO0A 2Y6VA 4H7FA 2D5LA 3FCXA 3HJUA 2OGTA 2JGEA 2WFLA 3PUIA 1AUOA 5C8ZA 4H7KA 1CUHA 5AM1A 3WK7A 4G4IA 5KBYA 1R50A 4AMZA 2J4FA 4ROTA 1ZIYA 3RLIA 1EDBA 3I6YA 1TRHA 4AN0A 1O6GA 4NS4A 3P2MA 3DJYA 3AINA 1KEZA 1ZJ5A 1UKBA 4S0XA 1XZHA 3DL7A 1EK1A 1G42A 2Y2VA 2VAVA 1CUIA 5AM0A 1R88A 3VKFA 4AN1A 4FMPA 5DYYA 1BROA 2PPLA 1A88A 1UOPA 4HRXA 5ALEA 3O9MA 2HA3A 2YXPX 4WY8A 4UHDA 3RARA 2CBGA 1X2BA 2QZPA 4DNQA 2JGFA 2RONA 1ZGBA 2G5TA 1KU6A 4UBJA 5K3FA 1YB6A 2WJ6A 5LIPA 1CUUA 2VT6A 3W9BA 1DWPA 4BE4A 1QIIA 1BS9A 3V1NA 3H2GA 4LKOA 4XVCA 2AJBA 4IH4A 1JMKC 3D2AA 2H7XA 3MUNA 3GUUA 1DQYA 3W9UA 3ILSA 1QLWA 4KE6A 4E15A 5JD5A 3KD2A 4XWGA 2Y1KA 3VJKA 4JEIA 1BCRA 1ZD5A 4ARAA 1HKHA 1BEEA 3PICA 5JYCA 1RWQA 4B83A 2BAGA 3ZPXA 5E2IA 4GECA 4X6UA 5KWJA 4B9AA 1CUZA 3WKEA 1T4MA 4W1QA 4B80A 5DTJA 4L72A 3NUZA 2WHQA 4UHHA 1MU0A 4GEGA 4DM7A 3WLAA 1LLFA 2HU7A 4DNOA 3FWHA 4AB1A 5DYWA 1AC5A 2C4HA 5JAHA 2DR0A 4CCYB 1WB4A 4Y2XA 4PSCA 1K4YA 2OQIA 3FNBA 4EB0A 4M0MA 3R40A 1WHTA 3FLEA 3PE6A 4AO8A 4PQEA 1B6GA 1N8SA 2RI6A 3WIBA 3V1MA 3SWWA 3C45A 3S8YA 4HRYA 5K3BA 2XUPA 5AKJA 4UBOA 3F8SA 4W1RA 2VJCA 2EDCA 1SCKA 1HPLA 4A23A 5LZ4A 3SX4A 1XRMA 5CW2A 1QIFA 1IUNA 5JAPA 3NWOA 2PBLA 4XIIA 3WK9A 1DTEA 2VQ6A 2ZJ7A 1FFCA 4HVTA 4X3CA 1Y7HA 5FKJA 3T52A 3BJMA 4BZWA 1DQZA 1UK9A 1JU3A 4G1FA 2XUHA 5ALMA 4BB0A 1NU6A 2WSLA 3C8DA 1ZI9A 2B9VA 1H2WA 1GPNA 1VE7A 4WFKA 5HF9A 2YH2A 3AILA 1OXMA 4A5SA 1ZOIA 3L1JA 4Y2TA 3D5EA 4CCYA 3BF8A 2HDWA 2ES4A 3C6ZA 4PO3X 1AGYA 1IZ8A 1E66A 4P92A 3FYUB 1AZWA 1FSSA 2XUKA 4NMWA 1WHSA 3BIXA 1JJFA 1E8MA 1XZGA 3FSGD 3DL4A 2C5FA 3DKRA 3H2IA 1ZICA 5EHXA 3DKKA 3I2GA 1EK2A 1QO7A 3BWXA 4DMCA 1F0NA 3I6MA 4KE7A 4HTAA 2OAEA 4C01A 1G66A 1RYYA 2XMDA 4FKBA 2BFNA 1VE6A 2WG1A 1AURA 3IUJA 2C7BA 4G4JA 5IKXA 4PF1A 1E3QA 4P93A 3O9VA 2JF0A 1IZ7A 3JWEA 4YASA 2OCGA 5ALKA 5EIAA 3R3ZA 3B12A 1R4ZA 2QTBA 5T4BA 2OLEA 5E4YA 1F6WA 4GXNA 3VXKA 3TEJA 2X8BA 3TGLA 1VA5A 5LZ2A 2AJ8A 5EHNA 5AOCA 3H1BA 4OYYA 2GYUA 2QS9A 5JASA 4AXBA 4DNPA 4KAFA 3HRHA 4YX9A 3KWJA 4BDSA 1BEZA 2XDWA 3VJMA 4IHAA 4N8DA 1KU0A 3AZOA 3GA7A 4QDOA 4K5QA 3DYIA 5DTIA 2HM7A 4KRYA 2QT9A 1EA5A 1THTA 2G63A 4X95A 3ZV7A 4QDZA 4MXDA 5FRDA 1GQSA 3WI7A 2XQIA 5I9IA 1AX9A 3CXUA 4UPDA 2PSFA 2DQZA 5CTAA 4TVKA 2AJCA 2WJ3A 2JGKA 2D0DA 3G02A 3H1AA 2J3QA 2IITA 5AKGA 4UBIA 4K6KA 4FFVA 3OM8A 2Y6UA 5K3AA 1VXOA 4UBLA 5ALPA 4B84A 1XQWA 1YASA 5BWBA 2WUEA 4RE6A 1XZDA 2WU4A 4X85A 1CUGA 4C4XA 2PL5A 3I2IA 4UHBA 4BDTA 2B61A 1QIHA 2CZQA 3G9TA 4U2FA 1K6EA 2V9ZA 1NX9A 2XT0A 4E11A 3O0DA 4BBZA 4J03A 2PSHA 5A7HA 1QOZA 5AIBA 4EY5A 4WFJA 3HABA 4X94A 3RK4A 5EIEA 3AZPA 5A7GA 2RGUA 4MWTA 5JAOA 3G0CA 3DDUA 4MQMA 4QDXA 5HK8A 3OOSA 3GROA 4BYMA 3R0VA 5JZBA 5AM4A 3H2HA 2DQYA 4F0JA 2QUAA 3FLBA 1DX4A 5CXXA 2CJPA 1JMYA 3L1HA 5AK4A 1MAAA 2WFMA 3HYSA 3WWOA 5CH5A 1GXSA 4WY5A 5D7BA 2PM8A 4OYLA 4LYDA 1MX5A 4C6HA 3C6BA 4C88A 4EA6A 1THGA 4KRXA 2ECFA 1XZIA 5AIAA 4BC0A 1XQXA 5A2GA 2HA6A 3MVEA 5CT8A 2VSQA 4HXEB 3W05A 4KAJA 2WUGA 5AM2A 1W1IA 2FJPA 3FYUA 2H7CA 4Q3KA 4J7AA 4H7EA 1HL7A 3STXA 4U2EA 2QJWA 1YS1X 3CN7A 3R41A 2XUGA 3C43A 2FUKA 5ALIA 1MAHA 1CR6A 1XZMA 2BUCA 2B4KA 4JUIA 3C8HA 5H3HA 3SC2A 1P0QA 4ZV9A 1X2EA 2HFKA 2CEKA 2GZRA 2Z8ZA 5C7YA 4ZRDA 3G9UA 3QPDA 3WJ2A 3ANTA 3H17A 3IVMA 4Y2VA 2DSNA 4H7JA 4FDMA 1UK6A 3F67A 2CB9A 1K8QA 5JAUA 1P0IA 4QLOA 1YB7A 4X97A 2ACEA 4DNFA 4G9EA 4Y2JA 1A8SA 4LXHA 3D7RA 4EY6A 1JJBA 2ZJ6A 4N8EA 1JU4A 5ALNA 1ZD3A 3EQ8A 5LP1A 1GPKA 3WIOA 3WYNA 4B7ZA 3WZLA 1L7AA 4Z49A 5LZ8A 1ORWA 3U0VA 1XZBA 5LZ5A 4JYPA 1OCEA 3IB3A 4B0PA 4MYSA 3AUKA 4CCWA 1JT2A 5C81A 3WMRA 1LPMA 4N8SA 4BRZA 1HQDA 3W04A 4LHEA 4DIUA 1VZ2A 5AM3A 3HXKA 1EHYA 2C0QA 1G4HA 3DCNA 2WG0A 3H2KA 2WHPA 4J3JA 4OB6A 5SYNA 2ZSIA 4CFSA 4F60A 4U2BA 1U8EA 3DYVA 3TJMA 3FAKA 1PV1A 3LIPA 5BOVA 4GW3A 3H04A 3G0BA 1MTZA 1LPSA 5AKHA 1C7JA 3G9XA 3ICWA 5T4HA 5ALZA 4BATA 5CRIA 1QGED 1XLVA 4JYMA 2HA4A 1AQLA 1MX1A 3YASA 3C5WP 1MNAA 6YASA 4F5ZA 4I19A 4JH0A 1QIEA 3RKSA 3STWA 1EVQA 1H2ZA 3H2JA 2JEZA 1CLEA 2RHWA 2WLSA 3ANSA 4ARBA 2E3JA 1QIJA 2JGMA 4WJLA 1E5TA 1EI9A 5ALTA 4X7BA 4HZGA 2Z3WA 4Y2UA 5D6OA 2V98A 1CUEA 4J0CA 2XQJA 4RNCA 3AIKA 2DFPA 1HDEA 2O7VA 2GBIA 4GI1A 3WWPA 2ACKA 3BF7A 1EDEA 4OUKX 3DQZA 4WDRA 1H2XA 4UHEA 2HADA 4HAIA 1JJIA 3VJLA 1Z68A 5ALWA 4BP8A 1DWOA 5HK9A 3A2LA 2B20A 5HF6A 4Y2PA 4Y2YA 3I2KA 1UWCA 4UBKA 3NOXA 5A62A 4FBMA 3O4JA 4WDQA 5ALDA 1HBJA 4MJ3A 5AKKA 3KXPA 5DNVA 3MGAA 3GFFA 3LCRA 2BJHA 3JW8A 1MPXA 4CIAA 3DOIA 4BVJA 3QM1A 3H0CA 3WL8A 5HQ3A 3OG9A 1DU4A 3M3DA 2ZYSA 3QPCA 2PU7A 4QDTA 3A70A 5HFNA 4H7HA 3K6KA 4BRSA 4N5HX 3FLAA 1L7RA 4ZWNA 2ZYIA 4Y2SA 2XQFA 5HF5A 3G0GA 1H2YA 4AMYA 3S2ZA 1LZLA 1GQRA 1AMNA 1TK3A 4OB8A 5ALVA 4RPCA 3B5EA 2XB6A
chains in the Genus database with same CATH superfamily
5J4LA 1RJFA 4XDGA 3Q6MA 4TWIA 2W22A 3W2IA 3JRNA 1WB9A 2NZXA 5G0WA 3IA7A 3BZWA 3KZ1E 3M7IA 1RAIA 3SR4A 4MICA 2XE4A 5DNAA 4D3XA 1CJSA 2Q6VA 3OO1A 4KV9A 1FLAA 3IS3A 3NZEA 4M37A 4RJIA 3C4QA 5C8YA 4JI5B 3R7SA 4E5PA 3LBYA 3VSAA 2WFZA 1XBTA 4YRAA 1L4NA 1FXWA 3BE8A 3OZBA 5KC8A 1E89A 4GSYA 4YRCA 2QTWB 1J7JA 2A9FA 4K6HA 1HC7A 4DLTA 2QP3A 3QE3A 2OXCA 3PWSA 1Y8QB 1TVMA 3AF3A 1WUJS 2ISQA 4GRDA 2V7TA 4PX9A 4RYDA 2XYHA 1HG0A 3GEIA 4MQEA 4MW9A 3IVXA 2JH8A 3ADDA 3VPGA 1E3DA 1Y63A 1P5ZB 5IEJA 4P4SA 4P84A 4PEVA 1VXRA 1BXZA 3BWEA 4IDCA 1H22A 3DOCA 5C4IA 1H2RS 5JJIA 3QOFA 1C8KA 5CFQA 3CF4A 1C14A 3BL5A 4K88A 2YYAA 5LBIA 4YUZA 3OZIA 4QPPA 3N6XA 3MQ2A 5CA0A 4MUFA 4WZAA 3F1KA 3R7LA 4ZV4A 2ZUFA 5GY7A 1KL7A 1BE8A 1KP3A 3O3MB 4WLVA 5KVSA 1RT9A 1QR2A 4BNKA 1U1EA 3L8GA 4A2WA 4BNXA 3K9LA 3OX1A 4M3NA 1P8JA 2GDZA 2B4RO 2QTVB 4K9RA 1WB5A 4KFSA 4XIGS 4BRUA 3AVTA 3DV2A 2E5FA 3LD9A 5BSKA 4OU5A 4J91A 1K8YB 3MMPA 5DMHA 1JDZA 2UZ1B 2WICA 1IK4A 2YW9A 3INRA 1Y1RA 2B99A 4Q03A 3RHSA 3PC6A 1NFFA 4N9QA 1VJ5A 1J22A 3VKWA 4YDRA 3RGGA 5CA1A 6GPBA 5AFSA 2G1JA 2ZT6A 3RSLA 2ZI4A 2RARA 1GVHA 1FNNA 4PC7A 2JJ1A 2XMQA 1NBME 1XCLA 3CT4A 4L9RA 2PVSA 3RS0A 1P4HA 4S2UA 4TWBA 2AVNA 3C5VA 2PDAA 1J1IA 1KY5A 3RRMA 1AUPA 2CVHA 4A8JA 3JD4A 3PGLA 1YAHA 2ASVA 5IVHA 3H1PA 4OHPA 4OPMA 4HYQA 1F8XA 1I8TA 3L0YA 4QO8A 1N2IA 1NKSA 2Y1EA 4Y6GB 1OILA 1PGPA 4IIUA 1W4BA 5DBFA 2BEVA 2LIPA 2CV0A 2GAAA 2NPFA 2YIMA 4QBIA 4YCMA 4MCAA 4KRFA 3H0KA 4EMUA 2VUSA 1PT5A 3VR0A 4A2CA 4XX0B 4LF4B 4KXXA 1R0ZA 2G1AA 3PS9A 1GYPA 4QXQA 1OTYA 3LBFA 5HRAA 1JQDA 1RQLA 4UVHA 3T3IA 4WX2B 2H7YA 4RD1A 1BMQA 3MWFA 1V5FA 2FW6A 4L0CA 4UOQA 1MIOA 4FZ5A 4BCCA 2VG8A 1QHFA 1HLDA 4HDMA 2PT6A 4NP6A 4FMCF 1NNSA 3ILXA 3QU4A 5JBNA 2FDRA 1NBAA 3OZEA 3I4FA 3SD7A 4YUAA 3GUVA 2GTPA 1Z3IX 3ESRA 3P94A 4X90A 3V1LA 3X1MA 4G0OA 5KQGA 1P2VA 2O05A 3D0OA 2XNCA 4ZOCA 1GZ4A 2CLOB 4C4PA 1XLWA 3GEPA 1RAFA 2ZUWA 3LSYA 3OY2A 4H1UA 4HO1X 4I9HA 3T8YA 4CEIA 4YLEA 3OE5A 4TLBA 2RD2A 2A5LA 2HXGA 4MQLA 5A4JA 3R24A 4G1MB 2COKA 4RJKA 3D3WA 1A8QA 3EE6A 4HDOB 3TINA 4FIDA 4B0OA 1VRCA 3Q72A 4LTMA 5LOVF 1SC1A 2P9BA 2Q3LA 3HWX1 3OP4A 1FNSA 2RMKA 3S2UA 2WB2A 3HBFA 3FOCA 5KX5B 2Y2UA 1EVEA 5LQKA 2R8YA 1NAHA 3FROA 5TJHA 1AKEA 1HYQA 3A4VA 3EDCA 4G5SA 4S1VA 3CURA 3H99A 2JNWA 4ZZ2A 3BBPA 1U9JA 1V37A 1PUXA 2QL6A 2QVZX 3BM5A 3BD7A 5DYIA 5DMXA 3WLIA 2ZRFA 3NTOA 3M81A 3A6LA 1XTTA 2HXYA 4P2BA 3W1VA 4F3TA 2JKVA 2H08A 2ZJZA 4BB9A 2JIOA 2QXTA 1PTJC 5EJ4A 1DC3A 1FU4A 3EH2A 1UJMA 4ND6A 2N47A 4UVEA 3QXCA 4UOEA 3JAWA 1UBRS 4E5VA 4RGBA 5DYTA 2QLBA 3PI6A 2C4UA 2JFBA 2BP7B 1ONBA 5CLIA 4IINA 2DFLA 3ROQA 3D1VA 5LYYA 4UNSA 1XX6A 1HO3A 3JWGA 3SC2B 4R6XA 4AYTA 4C06A 5JY1A 2BFFA 1P7WA 1R8YA 1GA6A 1X1DA 3K30A 1YBAA 2O48X 2OAGA 3PDJA 2GBLA 2EZ4A 3K20A 4NBWA 2HW8A 5G4KB 3PIRA 4GQBA 4IDDA 4M0FA 4RU1A 3QHPA 4D8TA 3QPAA 2EL9A 1XEWX 2G9RA 2QX4A 2VXCA 2VYFA 1U3FA 2WJHA 4C21A 4DJDC 5GIPE 1A5ZA 4MW1A 3RODA 1R8SA 1DZIA 2AW5A 2FZKA 3BGDA 2QMHA 4YMTA 5KHLB 4MX8A 1IHUA 3TVDA 4G8JA 1YAJA 2Y1GA 3GLGE 4IJVA 2AR7A 4GPBA 3M82A 3THOA 3I0NA 3FAZA 2Z1MA 3R6TA 1EJ6A 3LOQA 4KZKA 3UJPA 3ZDRA 3MCZA 4EHFA 5FOQA 2NP6A 3P32A 1G5FA 1AKYA 1ZK4A 2A0XA 4LSZA 4WZZA 4DXAA 1D07A 4GOJA 2VDMB 5LZ9A 4OUDB 3KL2A 3E9DA 4J0DA 1BMTA 1NHWA 2Q1YA 2GKOA 4XJVA 1J09A 2V7GA 4X3OA 2WG2A 4OK5A 3OT1A 4PZCA 4TPKA 1OGJA 3H5NA 1K3FA 4C2AA 4NEGA 2ZYDA 4O02B 2WP8J 1GCGA 3P2IA 4ZPJA 3PE4A 4Y2RA 3R3UA 4DV6B 1X3SA 4JKOA 4GXQA 4PSAA 3ZCTA 5JVDB 3VR4D 4BLUA 5I6DA 2FSFA 5CMLA 1HGXA 3LUBA 1J8DA 3R7WA 4ECEA 1W59A 2OG1A 4PYRA 3D2LA 3KAPA 1XKTA 3RYCB 3PQDA 4PG6A 2LE0A 1GPBA 4W5QA 4BFTA 2YWHA 5HF8A 1QO9A 4XVUA 4J9UE 3DD1A 3PHHA 4ZAWA 3FCOA 2BMDA 3RVQA 4MB0A 4ARIA 4OFZA 4CG2A 4OX9B 1XTSA 1ZVJA 2POCA 3D7SA 2HQSA 2Y4OA 3RYFA 5IZCA 4B6OA 5HIAA 4M1WA 2R47A 4OXRA 4Q93A 2UXDB 9MHTA 2J9RA 5G0VA 2DCUA 4B45A 3A3YA 4UE3S 1E8NA 1GHTA 2FP3A 2RGAA 2WV7A 5J4KA 1C2TA 1SCBA 3RABA 3G2JA 3NG1A 2ZQ5A 4Q48A 5L51A 1UMKA 4RL4A 5C1OA 3P52A 3RG2A 3LAWA 4BB5A 1H5NA 4JUDX 3UAYA 4ER5A 1K0UA 3IQGX 4LDZA 1N5MA 4UEJA 1XTBA 3B51X 1K7SN 3HUUA 1FNBA 1OLSA 4Z99A 4ARSA 1LSOA 3OH8A 4DDUA 4Y7CA 1T3HA 4CI9A 1OPXA 2AH5A 1JAZA 1SUIA 4YVFA 1PT8A 3DVLA 1DUSA 2PCJA 2DHQA 3ROGA 2V9CA 3OMWA 2BISA 1EM6A 1U1DA 3E03A 3F71A 3PFNA 4BGDA 4NPCA 1OKKA 3H19A 1NX6A 3BDAA 1W75A 2DWCA 1L7XA 1AMUA 1X1BA 5DHAA 5CDHA 1V5IA 3AVQA 4OBWA 4RZSA 5GZ1A 4Z4FA 1J42A 2DBRA 2Q4BA 3KTAB 1NUUA 4Y6RA 3P27A 1ISJA 1A8UA 2XI4A 4KE9A 4OLAA 3FUXA 3PA8A 3KFLA 4P86A 3I28A 5G0TA 3DB1A 1H9BA 4MI1A 1N2SA 2Z8YM 3HKEA 3IDSA 3WAGA 5C5DA 3H75A 4MIKA 3N53A 4XLTA 1YBVA 2O2JA 5CM8B 3JR3A 4MQ4A 3T0IA 3L6OO 3GJ4A 3S1AB 3V8QA 5GJWC 2VBFA 4B6QA 2FMXA 2H31A 1BXRB 3QF4B 1UZLA 4DA7A 3G2OA 4CLRA 5I3CA 4K1LA 1X9IA 3VDXA 4DRXB 1IM2A 5IAKA 3IHLA 3ZE2B 2VDQB 3AU9A 1H0SA 2QGFA 3CC8A 3KTFA 3W6NA 2X58A 4C3OB 3STTA 1Z4IA 1C3VA 2JK0A 1Z2AA 1NRXA 1T9AA 3GJRA 4JVLA 2VZ9A 4R4JA 5L6MB 1E94E 1IUPA 2EKPA 2J3HA 2R86A 2WJWA 2WIFA 4N3BA 4PFSA 2IH2A 2BSAA 2C4VA 4PYKA 3NVKI 4DE5A 2P8JA 4G24A 3QFFA 1DLIA 2H48A 1EB9A 2PGXA 2ZJBA 4GU5A 4C4ZA 1N7IA 1OZHA 2EF1A 2EX1A 4FQ5A 1RWWA 3LF1A 4G0NA 4KN8A 1ZCJA 2EQBA 2QF7A 3ZWPA 2Y76A 5LQRA 4TYYA 4OXXA 1GV1A 3RVKA 1ACLA 1QK5A 4JI1B 1J2TA 3P19A 3R5XA 3UHPA 4L0MA 2GRAA 2R11A 4HG2A 1G63A 2FR8A 2H29A 4K1XA 1H2HA 4JOBA 5AI5A 4PAOA 5FUWA 1EUYA 3S28A 4P7FA 1DDIA 1GGKA 1T1EA 5CVVA 2OKGA 3UNXA 1O96A 3CS3A 1MD9A 1SC4A 1M5TA 4J0KA 4JMLA 3GGDA 1X6VA 1BWRA 3T7IA 4DLSA 3BXOA 5EI5A 1W0KD 3ZVRA 1NATA 3T4XA 1WR8A 3M2TA 5CURA 2A5YB 3GLIA 3DNFA 1CPYA 3S8EA 2C4TA 5FA8A 1FBNA 1XCJA 2NUAB 3LVQE 1LLDA 1T6XA 4LJ8A 3NONA 2RHRA 2ORYA 3NHMA 3V4RA 3V8VA 1L3CA 2XUDA 2P6MA 2XVXA 1Z2OX 3FBTA 4PW0A 1JZTA 1Z4LA 3KZKA 4WCVA 1YR1A 2AE2A 3OIUA 4H9GA 4DSNA 1U3GA 1TYDE 3WADA 3RNLA 3IPAA 5AI8A 5FBQB 2DZDA 3QUSA 4PBRA 2KI5A 5DT9A 3DFUA 3PHJA 2HL6A 4XCVA 3JQGB 5EFOA 2X15A 3VDRA 1J2UA 4AG6A 1QP4A 2FPIA 4B6PA 5AJVB 2W6CX 3VSCA 1ZI8A 5SYMA 2QA5A 3T7RA 1XRPA 4O1HA 3EQ7A 3IURA 4O63O 1C2YA 1DEHA 1DKNA 4BE9A 3HYLA 1R4AA 1B8NA 4QUHA 2WIGA 1ZGJA 3CZMA 3HN6A 3Q15C 5JJ5A 2H54A 3ZKWB 3V1KA 4AO7A 1WQ1R 1L5ZA 3O4GA 1UL1X 1SU8A 3LLVA 1EKXA 4G1BA 3BD8A 4R1MA 5I9NA 3EEQA 5K51A 4KHZA 4UCWA 5E6RB 5IN5A 3JVVA 1R15A 2BLLA 4JGIA 2TMGA 3HKCB 4F71A 1EG2A 4IEIA 4L1KA 2HA7A 3F8TA 4PG5A 4QGAA 4QWWA 4DXHA 2WQ6A 2PZLA 4DMUB 4QX6A 1V9CA 1Z25A 4B7AA 1W76A 3BQ9A 2FX5A 2IPOA 1Z15A 3RH0A 2IYPA 3SBEA 5DEIA 3IAEA 3H8WA 4RIEA 3FOFC 3FWPA 2OQVA 1OBCA 3TQRA 1CRWG 2PSJA 3CYFA 3JZMA 3KLMX 4MR8B 4MZXA 4R1NA 1LLQA 2GHRA 4N65A 1GSAA 3RM3A 3T5DA 1BMDA 2MSKA 4M7RA 5UKDA 4A0FA 3CO0S 3E23A 5LBUA 4XJXA 3B6IA 4PCLA 4RPHA 4BQOA 2ZYUX 5COBA 5JE8A 4K6FA 5L3QA 1YVPA 4YCBA 3TR0A 2A0UA 5BN4A 1A0OA 2HT6A 3AP2A 3VDQA 3R7AA 4YMGA 1W4CA 3ZZMA 2AV6A 4MQBA 2C03A 3SNHA 2CHVA 3I0MA 2UU9B 1HURA 3AXTA 3ICVA 3ID6C 2F1HA 4LSWA 4MVJG 3ZV4A 2AXEA 1V4BA 2GCOA 4KQIA 4TLAA 2O0LA 5LD2C 5JCOA 1V8OA 3TQHA 3A1WA 4L4XA 1A9XB 2D5CA 1UKAA 1Y4AE 2FV8A 4MDEA 1XA3A 3GAFA 4RIHA 5E4JA 1Y3IA 1DAKA 1OWNA 1BVUA 2VPWA 2W70A 3WB2A 3ZD8A 4WKGA 1XEFA 4DR7B 3T99A 2BT4A 1LNSA 2DAPA 2GXUA 2O5RA 3C6MA 4LMAA 5C32A 1WDTA 3IIKA 4BTEA 4WTOA 1Z5UA 3WGNA 3Q3GE 3G1TA 4C7VA 1E2QA 3QVUA 4N4AA 3V4LA 5ICEA 2GA9A 1C29B 1IEQA 3I9FA 2BF4A 1MUUA 1XZKA 1Q21A 3IKMB 1MOPA 3QLVC 1U98A 4RFSB 2YHUA 2JZCA 3MN1A 3DT8A 4B40A 3QVGA 2I54A 2CFIA 2B82A 2PJDA 3FUTA 2I7DA 1RBQA 3E05A 3NYIA 4FFWA 4ESEA 1EVZA 2Y71A 3QPWA 1GQYA 3ZI0A 2ANBA 2JANA 3IEPA 4A8TA 1IUKA 2HEIA 5AR1A 4U6NA 1RPZA 1E6MA 4BX0A 1J6UA 2QRUA 2QD2A 2Q8QA 2LIVA 1UM9B 1WVMA 4ZEWA 1L8LA 4FFMA 3JY6A 4F4IA 3CBQA 3HYNA 4TXNA 4X60A 4MV8A 1O95D 4DSTA 1TEZA 3UOWA 3FCSB 4XQEA 2B3TA 3OIGA 4QBFA 5L40A 1EVLA 3KOUA 5JYEA 4XWWA 2EU8A 4HQ0A 5EWMA 1NI4A 3CGWA 1B0ZA 4BX8A 4YXFA 5BQFA 1KZ4A 1WQ4A 4KMOA 2H0QA 5BP7A 2B37A 3HJCA 2VL7A 3W4IA 2NXJA 5CITA 1RCUA 4NL4H 2J1LA 4E2WA 5E9QA 5HCNA 4LCBA 2IDJA 5KOHB 2XJ9A 1GZHB 1IMJA 1WZNA 3DWEX 4HATA 3BFVA 3RWOA 1UPBA 4C3VA 5JXIA 3ZVKA 2R48A 2Q7OE 1PK8A 3O8LA 1PVVA 4HDAA 1A76A 4P7BA 3GCXA 1PP4A 1CR0A 4EGSA 9LDBA 4BBPA 3FOBA 1I01A 4ISCA 1UFKA 1OIVA 3T5MA 4L8GA 4DQXA 4ALMA 1YOBA 5IFLA 4XYMA 3W3ZB 1ZBQA 2ZSHA 5TEWA 4JHLA 3L0PA 2PBZA 4L8VA 4FJ1A 4IFBA 3SS8A 1Z6QA 2KLBA 1QS0B 3EXFB 5A5EA 3V8PA 4Y2QA 2XMSA 4H1VA 1FP4A 5A0TA 1OX4A 3V7NA 1FX0A 3MYYA 3NDIA 4OXNA 1MKYA 1WSBA 2QV7A 4YI3A 4CEHA 1RWKA 3AGPA 3R5HA 4WOJA 4DDHA 3NNNA 2Q6OA 2C9BA 3TBKA 2VNIA 4EENA 4DDVA 4GVPA 4LVUA 4DIKA 2VF4X 1VHJA 2MSLA 5IKOA 4ZD6A 3EUEA 4N54A 3OX3A 4IUDS 4YFYA 4LYJA 4URYR 3EPLA 2X0RA 3HCEA 3JCZA 5CK4A 1FP6A 1L9XA 2Q3CA 4HXFB 4CQLB 4FB4A 4YRGA 6NULA 3RVBA 5AVWA 3SFTA 1U1CA 3U5TA 1BN7A 5G40A 3EISA 1WNTA 3M9LA 1BXGA 4EB8A 2FWPA 3DOJA 4PVCA 2W6PA 3BICA 1YC5A 4M0PA 2Z43A 2M6KA 1ZM4A 1MQAA 4J1TA 3K1TA 1I1QB 4GPTA 1UXIA 4YFVA 2QMEA 2WWXA 3E7DA 3MBKA 2ILVA 1G5PA 2H2FA 1PNRA 1JSXA 2PEYA 4KVFA 3B1JA 1Q6ZA 2IU3A 1VCIA 4B4VA 4LPSA 2OHFA 2YVKA 3UJBA 2O19A 4UNRA 5AW2A 1J8MF 1LI4A 2ALJA 3HB9A 4M1MA 4LZZA 1EFUA 4MJXA 4NONA 5K0CA 4ON9A 2QLLA 3A6JA 3GBVA 3EC2A 1GZ5A 2FYTA 3PX7A 2J9FB 1L5QA 3ULKA 1XTQA 2JBAA 5GQSA 1PR6A 3HR8A 5ECDA 1JHRA 2JGDA 2VNAA 3AKEA 4R1LA 1M5UA 1RXEA 3H5OA 1YNOA 8ATCA 2I3ZA 1ISIA 1LWOA 5D3KA 4BV8A 2A35A 2QUHA 4I7EA 3T34A 3K6JA 2B0CA 3M6WA 2ESRA 2FMIA 4RZ2A 4ZICA 2PX5A 1Z88A 3R8XA 2WAOA 4RV5A 1M2VA 1DV1A 1XQYA 2PZKA 2IYLD 3IUNA 4NPHA 2ZCJA 2BDUA 4FD3A 4DMLA 3PQCA 4DJFC 1L5YA 2NYVA 2Q4DA 2HTFA 5EVJA 3B1FA 3D3KA 3PIIA 4HUQA 2Z2YA 1JIKA 5C80A 4NYIR 5K8VA 4FSDA 3DHWC 1ZEMA 2X8AA 1N0UA 3TKYA 4KI0A 4KEAA 4EHAA 5HYVA 2NU7B 3IJPA 5AW1A 1R3UA 1YFZA 4TQGA 3O82A 2QD4A 4KIUA 2R68A 4DIMA 4PHGA 3OM0A 2VAWA 3DG9A 4BJ5A 1SFRA 5K3OA 4HH0A 3L1KA 3MZ0A 1XLUA 1I24A 3MTJA 4WLEA 4RY2A 1OZ0A 2GXQA 2FPPB 4TX1A 1AKVA 3FPJA 3C2QA 2GUWA 4RVNA 5HCUA 5F23A 5CM9C 4KWCA 2F90A 1Q83A 2HHCA 5CT6A 4QUAA 5AJHA 5DJ5A 1SVNA 3WL7A 1B8PA 2B8JA 3WLMA 4X71A 5IUNC 5TX7A 4CHTA 5IX8A 1ZNZA 4YBRA 1ZDMA 3F7MA 1NN3A 4BNDB 4RVFA 1Q17A 1THMA 1HLPA 1WEHA 4LXIA 4RD4A 5BMVA 4W5RA 1ORTA 5KVQA 4D7AA 1E3MA 3PQ8A 3I6ZA 4CV2A 2VDKB 2IOFA 3CM0A 1VGVA 4H59A 1QUFA 4LJRA 2PT5A 4GUDA 1U65A 1SCQA 1SO8A 4B5KA 1SAYA 4ABTA 5EQTA 3OA0A 3HMQA 5K03A 2YWGA 4YRPA 4A0HA 2B78A 1JLHA 5K45A 1YQWA 1YQDA 1YQXA 3DO5A 1NJSA 1Z7YA 4I1OA 4UMVA 4W7SA 2H06A 3DGEC 3ZHSA 1RWPA 1M1NB 1VBKA 4W9RA 2X9NA 1D7AA 1N2EA 3JATB 2OXEA 4KLZA 5TQ2A 2AZDA 2Z8XA 3U7QB 3W8FA 2XHEA 3HPQA 3Q11A 3T5BA 1YB2A 3WGVA 5TVKA 5IH7A 1MNQA 2O52A 2ZRAA 3WHKA 3NM6B 1HFEL 3DULA 3QIAA 2OR3A 4IWNA 1ETHA 2FZCA 3OFND 4HB2A 5FYQA 3SSNA 1TZCA 3OMXA 1U7HA 4J2OA 2QEQA 3PVSA 3UANA 4HMOA 1JDUA 2YWEA 2AFIE 2Z30A 5EHQA 5A4KA 4KQ6A 3UK0A 2NZ8A 3IBTA 4KWHA 5TQ0A 3X2SA 4X63A 2QIPA 4O3FA 3QPVA 3HEBA 1MT0A 3QVVA 2W71A 1KZHA 3K0HA 3EIXA 3BJIC 1Q12A 3FDZB 4OP2A 4WJZA 3FB4A 4I2VA 4CLOB 5CCBA 1EUCA 1KY2A 2V7UA 5A3SA 5LA6F 3UMFA 5CT5A 1RLJA 4Z4IA 2R1TB 1XXHE 4RADA 3UMGA 2CHEA 3MWGA 4M99A 2Y0DA 5TY0A 1U99A 1K7EB 3GG2A 1D0SA 1C0IA 2NNWB 1DMSA 3OOEA 4GM0A 3REOA 3AP1A 2R62A 3E5MA 2WIJA 4NEHB 3WQBA 5FPKA 4LYHA 4S1OA 5GONF 2FPSA 4FFDA 1A69A 4Q4JA 4AUNA 1U0SY 3BEDA 4L5YA 3WZMA 5KOYA 3B3QA 1V0JA 3QBTA 1LS1A 2DUJA 5JD6A 2DY1A 1JAHA 3WGLA 2ONJA 3PJRA 4P8RA 3QU7A 3T38A 1XMQB 1HXHA 4MTLA 4D98A 4CKZA 2DQ4A 2X4LA 5IXYA 1MF7A 3H5RA 3A4NA 4HDRA 2OE2A 4HP8A 3PQEA 4MKIA 3AKCA 1TECE 3R5KA 5IAEA 3G79A 2BEWA 3RK0A 5JS2A 3Q9LA 4UARA 2ET6A 3EVNA 4BEBA 3CRMA 1U0TA 4HPJB 2OYRA 2HY7A 1IULA 1JQEA 1RYNA 5FCDA 2DFKB 4B71A 3PFGA 3USES 1WPQA 1YS6A 2QU8A 5TSDA 3IVCA 1BN6A 1L5RA 1ZGZA 2BF7A 3H83A 4OB7A 3D4IA 2I7TA 3SM3A 4ER0A 5JUWA 5LMCA 3VVMA 4JBYA 4OI1A 3KSAC 3L0OA 4BO7A 4R2XA 2H1SA 5KQSA 1MCZA 2FK8A 3C87A 5JQGB 2PUAA 2ZQZA 4N7BA 1H69A 2OFXA 1ZK3A 1WU8A 4MRPA 1TUBA 1WPRA 5JDIA 1INLA 1PUIA 3DZ8A 4DVJA 4Q4LA 1CFZA 1ZWLA 4REQB 2B8TA 2IP2A 3OECA 2AHRA 3H4VA 2JIBA 4PIVA 1UPCA 4CM8B 3OD5A 5HP4A 4HGYA 3R5TA 3Q9NA 3IUSA 1G8JA 5FT9A 1RYEA 3A6EA 4EAQA 2WZDA 1EWKA 3LDGA 4C3ZA 1K98A 2ZETA 5FTLA 1GLVA 1A1SA 1YQTA 3LCJA 1CUDA 2BGUA 5LLSA 5B4VA 4G5GA 5JBIA 1TAUA 1GCUA 3U7IA 3GLFB 3UWOA 3G3EA 4MUNA 2B8EA 1T15A 2MINA 2PO5A 2RHDA 3OE4A 4YAGA 5A9TA 3VZQA 5I45A 3I1IA 4YT4A 2G72A 1P0CA 2ZAYA 4JVOA 5HZMA 1VG9B 4GBGA 4IJMA 3ED5A 2A1IA 2BHSA 3WBBA 3F6YA 3W0LB 1H4TA 1YZYA 2Q7DA 3VPBA 4WJKB 2FCAA 4O4LF 2AZTA 2YRXA 3CVYA 4F6LA 1KDZA 1QMPA 3FVWA 5JI3E 4Q1CA 1I4EB 2PH1A 4ETWA 3LBNA 1DHTA 3MTEA 1MX9A 2ZZKA 4LGYA 4KYVA 1LBTA 3WGZA 1X7XA 1XZCA 1EFDN 2GN2A 1U0OC 3LGSA 1ZLXA 3AJDA 1JUDA 2POQX 3FNRA 3NC1C 3TD6A 2O0JA 1TQHA 1OLXB 3TW0A 4UQLA 4L6IA 4YP1A 5CFZA 3LYLA 3WL6A 1NN0A 1X74A 3EDRA 3KLBA 4F8YA 3D8UA 3U9TA 4ARUA 2C04A 3HBAA 2A59A 5ALHA 3Q6NA 4OM7A 4C14A 1YOVA 2Y4NA 4IXMA 4QDUA 4W7IA 5EE3A 2J31A 3ESZA 3SLKA 2V0GA 1PQPA 1J56A 4ZMRA 1A8IA 3U2QA 1TO1E 3WO0A 1H8ED 1R7RA 2C5BA 4LEIA 5CXUA 5HSGA 1C41A 4UUOA 2FUG6 3VU9B 3V2GA 1XNQB 3K5HA 1E3WB 3QVXA 3F3MA 1X8XA 4XUDA 3JZDA 2W83A 4AMUA 4CKXA 4ZOAA 4O2BB 1RQ7A 2DBYA 4LJYA 2AK3A 2AKYA 2C29D 3VR3A 2C61A 4FNAA 4RK6A 5PNTA 1Y6FA 2DT5A 2GUGA 4F6CA 4F72A 5E2AA 1OXKB 3CN9A 2VJAA 1ZJ4A 4XIJA 3Q3CA 5HUQA 3F3SA 3NALA 1XRLA 4MYDA 1DKMA 1YBFA 4WNCA 4EOGA 4JBNA 3GARA 3OQPA 3I42A 3QBDA 1XALA 2M6LA 2PUHA 1ID8A 4D82A 4DYHA 1YIAA 1Y37A 3MC1A 1L4MA 3GGSA 4DARA 1GFSA 3PJEA 1E98A 2YXNA 5F3DA 5BQPA 4ITVA 1KVQA 4JN6B 5IDYA 2W6OA 1KMNA 3FMGA 1UDAA 4J90A 4DHWA 4B6RA 1TU3A 3U3XA 4CMGA 4I3HA 2GM3A 4HDSA 4MW2A 1B2LA 2IIBA 2H1OA 1I7SB 5B12A 3VV2A 5AW0A 5SV2A 1MX3A 1QO0D 2QXUA 1NUPA 4MWSA 4YMUA 3DDOA 3DLPX 3LUJA 3LYHA 3C1OA 1JTVA 3FH0A 4GLJA 3FUCA 1JEOA 1LBSA 3IAS1 3OZUA 1Q15A 3PNPA 3PPVA 4FHCA 4HVCA 4C2TA 2XVZA 3U19A 1QRTA 1P0PA 2D62A 1EEXB 3UUWA 2C9OA 1S1CA 1XQ1A 3EIFA 4D8VA 1GLGA 2C2ZA 1VG0B 3RYHA 3UJ6A 3PITA 4DLXA 4QPJC 5DNUA 2JARA 4V2IA 3QA3E 2DH6A 1Y8RA 4BXOA 5AVRA 4Q66C 2XUQA 2IELA 5FPQA 5EFZA 3N8NA 3B1KA 3L5OA 3UEOA 4BP9A 5JD4A 1H42A 2VHEA 2HU5A 1KXJA 4DM4A 4RTKA 2A57A 2B34A 1U1FA 1Z75A 3T95A 2QBYB 3QOYA 4FMBB 4FOPA 4CW7A 3B7PA 2ZJ1A 3IAUA 3STYA 3VBEA 2VTEA 1CZUA 4UJ3A 1X1RA 2GO7A 4PNZA 3AB3A 3CG0A 1RKUA 1AGXA 2C5GA 2P68A 5H80A 1ZS9A 4I6JA 1TQ8A 2ZITA 1G17A 1PJ2A 4E33A 3HCFA 4QE3A 5AI6A 2A6PA 3RV3A 4A10A 4D0SA 1O08A 1DEOA 1T35A 2GHQA 3A1UA 1UFQA 4TT3A 1EX9A 1G7RA 4KIFA 3KKQA 5GM2A 3TSCA 3Q4GA 3JZIA 3OPYI 4I9NA 3L3BA 4QAQA 3I52A 1BW9A 1W46A 4HNRA 2AOVA 4JDPA 3H6KA 1VL6A 3RFCA 1BWPA 1HLFA 4DQDA 1JA9A 3AI7A 4MW7A 3VNVA 3VZCA 3N6VA 1G8GA 1G18A 3UMRA 4S04A 2FVXA 3E3LA 3JXEA 1FFAA 3OCCA 3IP9A 4Q82A 2ATCA 4OJKA 4TMWA 4ZYVA 2BD0A 3UFBA 5I8ZA 3EGDB 1TYZA 3M6UA 4UUNA 1PKXA 4JC5A 3SKXA 1MB3A 1PCXA 4XRGA 5DU2A 3WYGA 4YAFA 4AJ1A 3JQ7B 3NAQA 2HRRA 1UXOA 4URUR 3QWHA 3K4PA 4AX4A 4YAKA 1HT3A 1WZEA 3MWDA 3UG7A 3I1YA 2GZ2A 2IC5A 2IZ1A 3M8KA 4B79A 1A1VA 3SICE 1X7WB 2B1RA 3CZ5A 4U5QA 5I47A 3BFKA 3QITA 1Y89A 4F4DA 1E2KA 3Q2OA 5E6UA 5JCJD 1P2BA 2BHTA 5J5CA 2PVCA 1P31A 3HU2A 2QM7A 3E7PA 3MLAA 2DLCX 4L9SA 3KR2A 3O73A 4CLHA 1ZX1A 4YAJA 4EPYA 1NKTA 2GJAA 3RPEA 3UKOA 4QAJA 4ITUA 3FM9A 4IEEA 3VOSA 1Q0PA 2Y0BA 4BVAA 3THYA 1TTPB 5CDGA 3TZQA 4TLCA 5C7IO 5EJ5A 2XH8A 2EW8A 3HA3A 1PN3A 1WUYA 4RPLA 5AK5A 2YOHA 4RAQA 3LKDA 4FEEA 1R0LA 2ROQA 1WULS 4PG8A 4ZAGA 3UVEA 2V1XA 4Z0PA 3W5HA 4W99A 3N74A 5JZ9A 3HC7A 4ASUD 4HTFB 5IJ0A 5ITZA 1IPHA 2UKDA 2BFCA 4EGQA 1XROA 2NVBA 2PLNA 3O92A 1GQQA 5AJUA 5EMLA 1N1GA 1FFEA 1G8YA 2VK1A 2LUOA 2XWQA 2TYSB 4JB8A 3JWIA 2BE9A 1V1RB 3VNQA 4JOSA 4EY4A 1E3SA 4MB2A 4QFDA 5A4FS 5JSUA 3LY5A 3OE7A 3OCZA 2ZS8A 1MOZA 3MCTA 4NJMB 4RANA 3KUUA 2GO1A 1Z45A 4O2AB 4YAOA 4ZU3A 3WBFA 1V1MA 2IYSA 1OXVA 1XTIA 3EEIA 4ZGGA 2WM2A 4PRZA 1F4VA 2O7QA 4XWKA 1DIHA 1NBEA 3UUFA 4E2YA 4EEZA 3SIPA 3NHWA 2Q4RA 4O0LA 1RKBA 3QVMA 4P3NA 2RGGA 2A9RA 3LW7A 3N87A 1P72A 4M9ZA 1V11A 4HQ6A 4RIFA 5DM0A 5B3AA 5EJ9A 1ZZEA 4D4HA 1XVTA 3NGMA 3T1VA 3WYDA 1E7YA 2QP9X 2V3CC 4Y1RB 5J63A 2HO4A 2GYWA 5E1OA 2R5FA 3KJGA 3WC4A 4YR9A 1TTHA 1IG0A 2JJYA 5CDTA 1IZZA 1ZCBA 2HU8A 2IDKA 3OA2A 3T9EA 4H2DA 1HZZC 4RKYA 5CX1B 2FW9A 3GRRA 2J5XA 3BMQA 3EG5A 4YDQA 2Q8NA 1N4DA 4ZDWA 2BH9A 3I5YA 1HF3A 2HIHA 1U4OA 2AEFA 2PRSA 3C3YA 4CPDA 3RS9A 4V3BA 5NULA 2ERYA 2FAXA 4NJEB 2QI9F 3FYTA 4HDQB 5ESDA 4EGFA 2H3EA 4J8PA 7REQA 4H7DA 2OMEA 3R1IA 4KGVA 4TL6A 1L6RA 3R3WA 5EXSA 3RSFA 3GDWA 4R2KA 5KJEA 3RTDA 1R6DA 3IDQA 1SVIA 2JIZA 2YHSA 4NIMA 4U8GA 2ZWAA 3SR3A 2QTMA 1F38A 1T9ZA 4G0MA 1SIOA 4NV3A 2NSDA 4PHCA 5KUTA 3KAJA 2AQIA 3TN7A 1GPJA 3AHGA 3VMFA 4R9UC 1Y3HA 1CUVA 1LTQA 5CEEA 5G4LA 1F2TA 3MD0A 5A9RA 1H4SA 1M34E 1F9EA 1XCBA 2J7PA 2A9QA 3N5CA 5JLAA 4RPIA 3JU3A 4C7XA 3HYCA 2QUZA 1XU9A 3F98A 5DLEA 4P53A 3R9KA 2F1OA 3L06A 4EI2A 1N5RA 2CDNA 1RWOA 2I2CA 4KGDA 1ZSNA 5EP3A 1II8A 4YQEA 2ZGVA 3RLFA 1GG9A 3RSOA 5EGNA 2PX2A 5C7LO 3HJRA 3HK2A 1A9SA 1JHPA 4RVUA 2JS7A 1CNMA 4EG7A 1COZA 1JHVA 2I91A 4ZHQB 4HAZA 4GG1A 4QVGA 5KSYA 1T8SA 4EYKA 4UEOA 3PFBA 1RXSA 1X1QA 5L3VA 1FYVA 1HL3A 3AHJA 2E48A 1SKYB 4HWKA 3KEQA 3P9XA 4RQBA 3IDAA 1OASA 1YR2A 4O4LB 3WA6A 3JQQA 1VJDA 3E7FA 4MV9A 3HSSA 1QU2A 4G5XA 4XGQA 4ZVPA 1CZRA 2O3QA 1QPZA 1XD2B 1A7KA 1RI4A 2OWDA 2P30A 1R2QA 2WDPA 4R9RA 1BHQ1 3IPYA 5IJWA 2WTNA 3FWYA 5IW8A 4GMHA 2I99A 2Q4EA 1XV5A 2R1VA 3KELA 1UK8A 3G2KA 4ZAZA 5E0KB 2PSSA 1W0JD 1XG5A 2QYOA 1XXLA 4H7FA 4P4TA 4RZQA 1PGQA 2NVWA 4MUEA 1T3SA 1Y3BE 4A0SA 1PYDA 3N39C 2ECKA 2D5LA 3C8MA 2QTLA 3OCWA 4US0R 2OGTA 2OHGA 1MJNA 4FE3A 4GUAA 4IIHA 4C0KA 1Y1SA 4Z7NB 2DR2A 4LDJA 4BZXA 4X0EA 3BCRA 4RMNA 2WFLA 4KXVA 2FPWA 1AUOA 1NVUQ 2CLIB 4H7KA 3WK7A 4AC9A 4DA6A 1Z6PA 4BFSA 3ZHTA 3KKOA 2J4FA 3H4MA 3OZTA 4A5OA 5JS7A 3OSUA 2WZBA 3PRKE 1I4OA 1ZIYA 2IYZA 3N8GA 1RMTA 1XLTA 3H16A 1EDBA 2H0RA 2Z2ZA 3FCEA 3ITDA 3LUGA 2BBSA 2YXLA 3LY9A 4Z0NA 5FTKA 3ZDYB 2CHGA 4IKOA 1BHO1 2CXHA 3QF7A 1KFJB 5TE9A 1L5NA 3FKSA 1YDWA 1YR7A 4YLGA 2CFSA 3SI7A 3ND6A 5K0GA 1J24A 1KEZA 1ZJ5A 2COUA 2C2WA 3ESQA 4MAAA 3WFZA 2WF6A 2X0IA 4DUGA 1U8TA 3QVSA 4JHXA 1RABA 1SOWA 1ZIOA 1RHQA 3UJHA 5U4XA 4J29A 3UJNA 3KX2A 3CVVA 3R2JA 4LVCA 2C9CA 2P6PA 2SCUB 1CB7A 1J0DA 4J7UA 4BGVA 3ZJVA 2I33A 2PKEA 4Q4AB 2PR2A 5JZVA 3INNA 1W581 3LQRA 1PUJA 1YJCA 1MGPA 4M21A 5DTMA 4C0SA 4JC8A 2H4WA 3WWZA 5AM0A 1B76A 1ZMXA 2ZR0A 2E85A 3EZ9A 5DSXA 4AN1A 3KSBC 3H42B 3CPJB 1BROA 4Z4CA 2PPLA 4L0QA 1UOPA 4GI7A 3LRTA 1C7RA 1KJQA 4U5XA 5IAGA 4RMIA 4EL0A 2JFGA 5EL0A 4K05A 2OHVA 4E6PA 1JZQA 4LY9A 2R96A 2NG1A 2VDRB 2B94A 3CX4A 1JKIA 1KQGA 4EEKA 1WAMA 2P9JA 5LWHA 3WG9A 1X1TA 1RZUA 3A37A 1KMQA 1U63A 2JKZA 1AIPA 2QLJA 2RONA 1RCFA 1ZGBA 2G5TA 1VLLA 3LP6A 4IKEA 4RORA 3AESA 2O8EB 3A3KA 1SUSA 2G9ZA 4WZAB 1A77A 4KQFA 1R8JA 3KZMA 5ENVA 4DIDA 4HFJA 2WMOB 2BOVA 3IIEA 3OFVA 3W9BA 4BE4A 4IOMA 5E6SB 3PXCX 1WHTB 4NZPA 4IFIA 1GRRA 1E9AA 3F5MA 4O2LA 1CJUC 3H2GA 2IYRA 1IEWA 3LP8A 1MDBA 3NHPA 3IKJA 1N8NA 4K9SA 4BWGA 4KNYA 2EZTA 2FI1A 2RAFA 2AJBA 3MSXA 3L0BA 1NUHA 4Q24A 3NETA 4XVCA 1I7QB 1TADA 1F1BA 5CAEA 4QTZA 2O5CA 1ZOOA 4LZLA 9ABPA 4ARCA 2GN8A 2QRVA 5DHSA 4BKOA 1JMKC 4QGSA 4QYIB 4AMBA 2GEUA 4PG4A 2G71A 1GTZA 2H7XA 3I83A 3MUNA 4BN4A 5FWYA 2YWFA 3AFGA 3D8HA 2IBSA 2RBKA 4L73A 4F92B 1EJ0A 2RKOA 4M46A 1US8A 1TUGA 3ILSA 3FKJA 4YO7A 5FX2A 2NT4A 4E15A 5JD5A 1M2FA 4A8JB 2DPLA 3O1IC 4JXJA 3ZLJA 4DREA 3I8OA 4XWGA 2Y1KA 3C1TA 1O97C 4YRKA 1ISGA 2WF9A 4TTSA 2YZGA 2IY7A 2WWGA 2HBRA 5FF9A 5K99A 3JASB 2XPCA 1G7SA 2OFWA 2Q2NA 2Z6VA 1NQOA 4EJ2A 3DM5A 4HFRA 2Q21A 2BEVB 2VDWA 5LN1A 4DUYB 1PZEA 5JYCA 3C3PA 3KUXA 3LNCA 2XDAA 2K7FA 2YV5A 4CKEA 1QRDA 1XPUA 4XJTA 3LJKA 5L3ZA 1CRPA 2BV3A 1V8PA 2GFHA 4Q15A 1V7CA 1GPMA 1M6WA 1LCIA 1FX1A 1WD5A 3W5BA 1QX3A 2VWHA 2Q1UA 2FFAA 1MJHA 1WKVA 3BD9A 3B1VA 3EGOA 1T9HA 4CIWA 2APJA 2A4KA 2GT1A 2ZJOA 4YPFA 2IEYA 2B2NA 5HX7A 1DJMA 1Q7BA 4B9AA 2R1UA 4GEKA 4UM5A 5C52B 2Q3FA 4B80A 3NUZA 1QWOA 1IG3A 3FGZA 3FN4A 3PTZA 5K0FA 1DVRA 1KAMA 1O5OA 1E62A 2Q29A 2FZGA 2FWNA 2ZB2A 3GZ4A 4UJ5A 2I29A 3B1WA 3EFOA 2PJRA 4GX5A 2Y67A 1JQAA 1E9CA 3OD1A 2HU7A 3RC9A 1DADA 4DS3A 1U2SA 4KMRA 3SQNA 2KWIA 4TKUA 5A6SB 1EGMB 3LQQA 1QRAA 4OY3A 1ULUA 3VAAA 3DKIA 5BR1A 3G82C 4FYIA 5TPZA 4I5DA 4GC9A 4CCYB 1XJCA 1WB4A 3QEBZ 5EWJB 5CDUA 3UCFA 1DEXA 1QBKC 2QMOA 4HGOA 4Y2XA 3VUEA 4Q9HA 4GDFA 1Z4QA 3QIVA 3DP9A 1MJFA 2FSIA 1ULHA 3I45A 3EGXA 2ODNA 5FI0B 5G0UA 5IASA 2ADOA 3RRYA 4WCFB 4QT0A 3C3BA 4TUYB 4M1ZA 1BQ3A 3NI2A 4J9VA 4LF9B 1T5IA 3I9KA 3QLUA 4AO8A 8ABPA 3T5AA 4LC0A 4XWAA 1N8SA 1GSOA 1EHCA 1EGQA 2RI6A 4TWJA 3WIBA 2O0KA 5FQOA 5SICE 4R3NA 2IYFA 4OQNA 5HM6A 3S8YA 5FFNA 3GLTA 1L5HA 4BV9A 4HS4A 5AKJA 3AOEA 5MDHA 3M4JA 2C57A 1E63A 4EKEA 1L9KA 2YZKA 4W1RA 1BFKA 4QFMA 3H87A 5FTJA 4EF4A 3D5TA 4PONA 2B92A 5LMUB 4QU8A 3HP4A 3C15C 3FUWA 2I4TA 3CNNA 2HPZA 4ZO7A 3LZDA 1QKJA 4A23A 2Y1DA 1T9GR 4XEUA 2BLNA 3SX4A 3VYSB 4WGGA 5LZ4A 3MFYA 1P3DA 4IDBA 2PGOA 5BPHA 1QVRA 1TCUA 3A1EA 2VPIA 3DBHA 3OTWA 4MQ6A 1NM5A 4WZBE 5F7XA 3L8YA 1P2UA 2NQ2C 4F11A 1I80A 2NO5A 1QIFA 2ZROA 1NP7A 4GR5A 1XMSA 2AOUB 2QNIA 2CJYA 2OV8A 2P1DA 3OJOA 1HT1E 1JIJA 3G5AA 4R84A 1TJNA 3EGVA 4EJFA 1H66A 1M2EA 2R9VA 2AZ4A 4JIMA 4KBFA 4PC2A 1DTEA 2DUMA 2ZJ7A 2VJNA 2C2GA 2CL6X 3FZNA 1HH4A 2ZBPA 4TS3A 2NZWA 1DIBA 4L02A 3I4LA 4O1MA 5DM2A 1Z5OA 1ZH0A 5FKJA 2V4MA 5LU8A 4BZWA 4L8FA 4OQMA 4OUDA 4G37A 1PFWA 5JG7A 4RD0A 4V02A 2RKBA 5IMBA 1GV0A 2PGNA 1B43A 2C83A 1DIAA 2QU7A 5DHQA 4JJAA 5ES4B 3U09A 2F43B 3JQAD 4HGPA 4WNYA 2WLTA 2WAAA 1WTCA 3NP9A 1FIUA 3OIFA 3H9JA 4WKNA 5M3BA 4RVCA 1G41A 2IBTA 1Y6RA 4YDHB 1K8ZB 3ZWKA 1RXUA 4D74A 1HA3A 3LUKA 3RU9A 3H9GA 3PR1A 1DV2A 1I51A 2B9VA 5CFMA 1C1XB 1GPNA 3FDIA 4WFKA 5HF9A 4K9QA 1JFFB 2YH2A 3OOWA 3U39A 3AILA 2BKVA 3GAZA 4PNHA 2E87A 2AYYA 2WPDA 3OIYA 3C3CA 4UTXA 3FHOA 3RJ5A 4CQMB 2QHXA 4R3UC 1L5SA 3BB3A 4C29A 4EO4A 3FGNA 3NTVA 4J1NA 3GJ3A 1V25A 2P67A 2Q46A 3CUWA 5ES3A 4TWAA 5A2QA 2FSGA 4MVJP 4C76A 1U0EA 2CFRA 1RE1A 2PRJA 4Z1MA 5I7EA 1IEVA 4NMWA 1Z8NA 2VC2B 2ZTMA 4H6XA 5L3RA 3VPCA 2HBQA 4RVGA 1CJKC 1QLJA 4OL9A 2UAGA 4FDLA 1ZMBA 3ZGVA 1JEYB 1Q7RA 1PK9A 4TLLB 4CTOA 2Q6IA 1E8MA 5TMDA 3ROZA 1E4OA 4X66B 1RHJA 3THXB 2PR7A 1RPTA 2VHCA 3DL4A 4Y8VA 4ENVA 4DV4B 2IEIA 3AJRA 3NNSA 3LI2A 2X1LA 2PV0A 4QJIA 1G60A 1PJZA 2C5FA 4O29A 4UDOA 2VSXA 2C99A 4IL5A 5JVDF 1Q0UA 3D02A 1Q14A 3GHYA 3Q41A 3SQDA 1VKOA 3I2GA 2NU8B 3IQWA 1EK2A 2VKQA 5T57A 4AWAA 4R31A 4RSHA 2VJYA 2BHNA 3L0ZA 2NYUA 2H85A 2YIJA 4G65A 1GNRA 4DMCA 1AZTA 1MGOA 1QORA 2YNMD 4PLZA 4TLMB 2EFYA 5K8CA 3HCWA 1I6LA 1JFTA 1PDOA 2NAPA 1JIIA 1G66A 1Z4KA 5LNK1 3NOQA 2BR5A 1L7MA 4GOKA 4Y0NA 1BXRA 2FN7A 1VE6A 2RH4A 3Q3VA 3TZKA 2WG1A 4CLRB 1RKXA 1XD8A 4DF3A 4JU9A 3HEMA 1CJMA 3DAYA 3E5HA 4M0KA 4V0OA 3HM9A 3ZKAA 1UC5B 5F35A 3ZV3A 4CCYA 3DZBA 5HKKA 5HXAA 2CLFB 2RJ3A 2HNBA 3I9JA 3O9VA 2WSSA 4QRDA 5EPOA 5B1EA 2JF0A 1N2OA 1PT6A 3E22B 1J8YF 4JB2A 4RSMA 4YASA 5H3LA 2EFDB 1T9BA 2ZJ0A 3D6UA 3K5PA 4GVXA 3O8CA 1OH8A 3ONFA 1QB7A 3G8DA 4FKZA 3SCZA 4O4HF 5EIAA 3R3ZA 4HWRA 3BMNA 4N7MA 4CKWB 2ZI7A 4WBNA 1CDDA 3VGJA 2WK1A 4FYMA 5T4BA 4BNHA 2XXAA 3I34X 5I7WA 2VQSA 5H68A 3VXKA 1DNPA 1QV7A 4ETNA 4OF4A 1FE8A 1FUIA 1Y9AA 2FA9A 3ZCRA 1TT7A 3EDYA 3F4BA 3U7GA 1GRNA 4W9NA 1PR3A 5EHNA 4OYYA 4WK0B 1X9GA 3C48A 2GSWA 2GYUA 3ON5A 1GUFA 3ZH2A 3PIDA 2L18A 3MS4A 4U7PB 1C9EA 3U9SA 4YX9A 2XOEA 1FVOA 3PD1A 1NQAO 2ZFUA 2OFFA 4EO9A 1S1MA 3I37X 3GLIB 2XDWA 2GHIA 2EJVA 2H1FA 4Z8YA 4IHAA 2CDRA 5TT0A 3SZLA 3VJMA 1H65A 3PE3A 4HI0E 1KU0A 3I5UA 1SB9A 1NPTO 1BCRB 1OX5A 2Y0CA 3JWPA 4Z3OA 2C2MA 1P2DA 3AVYA 3DYIA 1DDGA 3OPYA 1ZJ6A 2AEMA 4K2HA 2VYQA 1EFTA 1Q3HA 4D5EA 2HM7A 1XDWA 1WVIA 4M8LA 4UMFA 4FYVA 2QT9A 4EYQA 2BGTA 2OD9A 1N33B 1MV5A 3BOSA 1RWBA 3R6GA 1GKUB 3W79A 4TSFA 4MTCA 3JD3A 4IR7A 1NLUA 1U0NA 2I6SA 1GQSA 5ADVA 3WI7A 5IFKA 4PZZA 3PNMA 5I9IA 4HLUC 1AX9A 1JIXA 1Z07A 1T2CA 2G80A 2YWJA 3CXUA 4UAVA 3RTBA 2DQZA 721PA 1H4QA 4ESVA 4L5BA 2VJLA 4HYYA 4C43A 3L0SA 1W2HA 1RYHA 2YN2A 5KAPA 4MUAA 5SYAA 1GOTA 1VPVA 2WD7B 3RUFA 3U3MA 2AS0A 3BHNA 4HDNB 2XZPA 4R2LA 1YS7A 5JMPA 3TZ6A 2JGKA 1GNVA 5U4QA 1RADA 1WNFA 1SBQA 2XBUA 1SXJD 1GZ3A 2IODA 3C8ZA 5I4KA 1K66A 1W30A 4QOFA 5JH7B 2YFHA 4JELA 4K86A 4OK6A 2WA1A 3VR4H 4CMBA 1KYIA 3BULA 3K4QA 4HAUA 3NLLA 5AKGA 1FS4A 2ZZNA 3OO0A 1D4FA 3ZCUA 2AG8A 2YHIB 2PNJA 2AMFA 2Y6UA 1ABBA 3MJFA 3FMIA 3U5ZB 4GYKA 4IDQA 4Q5IA 5ILQA 3GP3A 2HO5A 2XRMA 4EWLA 1GZUA 5ALPA 2QDXA 5FI3A 3TVYA 1IBCA 5KZMB 1XQWA 1YASA 3KEMA 1DUVG 3AEUB 5BWBA 5JWOA 5KTOA 1HQYE 1XZDA 3JAKB 1SU4A 1OXTA 1MORA 2ZI5A 3GT3A 4X85A 3FJOA 1M8KA 4C4XA 3EXIB 1D09A 1KKUA 3I2IA 4Q12A 4FGUA 3KR9A 4G2NA 3UV3A 3W6PA 4F56A 4W5JA 6Q21A 2CBXA 2QW0X 2BM0A 4FFSA 3TCXB 1TW3A 2QDKA 2VP2A 3EULA 4BDTA 5LUAA 1ZAKA 1Q1QA 2R60A 4XAQA 4UOZA 2YXEA 4IZ6A 3KBOA 1ZH8A 3C5HA 3FPEA 3QKSB 3RU7A 5AVXA 2I9KA 3KT0A 1KETA 3AM3A 1CE8B 2P79A 1XCGB 4LQ4A 4LFCB 3RW9A 3EXEA 4BBZA 1XDBA 2I66A 3ILHA 1IH8A 1JA0A 1OWMA 3EVGA 5AIBA 1ZUWA 4WOPA 4NRDA 1LRLA 5DN6A 2XKKA 3O4VA 1U8YA 4KQCA 2VPZA 4EY5A 4MGEA 2ZDQA 2R5NA 1P5JA 3NTXA 4QOIA 5KC9A 4X7RA 3ISTA 3TJZA 5DKFA 4D4JA 1VHLA 1Z8HA 3AZPA 1USIA 1PI3A 3NHRA 5EIEA 2Y66A 3BRWA 4PHFA 2BE7A 3E61A 3L5KA 1RQGA 3QBEA 4FFLA 1G3RA 3G0CA 1RTKA 1XTKA 3QUCA 3NHLA 4TQ9A 4FBGA 2HQRA 2E37A 2X9LA 4BYMA 5AM4A 1RJDA 3H2HA 5TGTA 3OHMA 4KQEA 5AXAA 1JSZA 3MMZA 3H3XA 3GJXC 4WIAA 1E7QA 3ROPA 2O8BB 1VBFA 1KRXA 5EKXA 1DX4A 3OQNA 1CY8A 4A92A 1Z7EA 4ZOBA 2FW0A 5IXSA 1GARA 5C1PA 1MAAA 3SMVA 1QHHA 2H2WA 3QEMB 1J0AA 1PTKA 2WFMA 1RJWA 4RZXA 4TMFA 3AY6A 4YGXB 3SYRA 3TQSA 3W6UA 1SPXA 1ZXLA 1PG5A 3LSTA 4WY5A 5D7BA 2PM8A 4OYLA 2EATA 2H5LA 3GC6A 2B25A 4D9BA 3QVTA 3FUVA 2C20A 1NDUA 3CVOA 4LYDA 3TUIC 1FJXA 2WABA 1NI4B 1V48A 2HJVA 1MX5A 1PTJA 4KXFB 3GZNA 1KMHB 1I7PA 3RNOA 3KQSA 1CQJA 4I1YA 4M88A 2PVPA 4M6WB 3VHXA 3WMEA 4ACBA 1P6QA 4KRXA 1DJQA 1R9GA 3Q0EA 5BNZA 2C3PA 3Q40A 4A2PA 4C0WA 2QQFA 3GLFE 1LDMA 2C1XA 1ADFA 2XRYA 1ULAA 1DAHA 1IHYA 3H1FA 4BC0A 4BLWA 4BE7B 4Q9NA 4DIEA 3MEQA 3MVEA 4HWTA 5LR6A 1SCNE 1DELA 3FDFA 4MLCA 2QVLA 2G25A 1B14A 2ZWVA 3P20A 4KPFC 3W05A 1NXPA 2B1JA 4QOHA 2JLRA 2QAGA 3B8HA 4P4LA 1XDUA 2FRXA 4ZVNA 1F1JA 2BCGY 5AM2A 2BGKA 2C2YA 4TXMA 4RFLA 1JAXA 1YDFA 5H0IA 3BN3A 1F5NA 3CMCO 3WLSA 5BWNA 1IC6A 1LXCA 2FJPA 3FMOB 3FYUA 2H7CA 2PRKA 2W9XA 3OOYA 4HNGA 2F00A 2VSOA 3IQZA 1ECJA 4J7AA 4Q3AA 3AKZA 3IERA 2V0CA 1BNCA 3TPFA 4UXHA 4UU0A 3RTEA 1HL7A 2FOLA 2D2FA 4YHBA 3STXA 4B6JA 2C1ZA 3UMVA 5J1TB 1Z5VA 3P9QA 1EIZA 3ENVA 1YS1X 2B35A 1W25A 2HRDA 3CN7A 3C43A 3NOOA 1FX0B 1J9GA 1OXUA 2YWDA 4KGZA 5ARCA 4BNJA 4BNWA 5ITSA 3JD1A 4C0LA 1TVKB 2FUKA 1UBSB 2J4DA 1SK8A 2P3SA 5LXTB 1ZG3A 1XZMA 2BUCA 3ONWA 1QTNA 3UTDA 1K5GA 3LWBA 3GMSA 4NMLA 5IPFA 4JI0B 5EPUA 1T3TA 3C8HA 5FBWB 1R0KA 4BVHA 2Y1WA 2A92A 5EWLA 4U7DA 4P80A 1P0QA 4ENTA 1GUDA 3ZDZB 1OAAA 5A02A 4YEDA 4QGHA 5LOVB 2CEKA 1WQ3A 1VP3A 1KQ3A 1Z34A 5FBZA 5C7YA 1XB2A 3DZFA 3G9UA 2B3DA 3MWJA 2AEEA 3ZD6A 3FNIA 1GFIA 4H7JA 5KTYA 5DK6A 1Q0LA 4FINA 5FHRA 3A6DA 3SJAA 4L4YA 2VJPA 1ISSA 4KO1S 3UCEA 4OGLA 2J48A 3VU0A 3W8RA 1SEVA 4PFJA 1U6JA 2YJ6A 5GJCA 1SQ6A 1NWCA 2BR3A 2OVBA 1Z36A 3B3FA 2IS4A 3PGVA 1OLUB 1SULA 2D0IA 4FHEA 1EBFA 2I80A 2XNDD 4MVXA 3QHQA 2DG2A 2FMKA 2XA9A 4TMXA 1UEIA 4RK7A 4QEZA 1OGYA 4JI8B 3KUDA 3U3OA 3ITNA 1TJ5A 3DDHA 2FSSA 3QWAA 3W2HA 4E07A 3ZDDA 1KEWA 3TTVA 1JU4A 1GFWA 5ALNA 5EZSA 4HHEA 1ZD3A 2VP4A 2QAGC 1H0HA 4F9GA 5MGNA 1I0LA 5EUCA 3D1LA 1RU3A 5LP1A 1P2GA 1QP8A 2PYIA 5TF4A 3WYNA 2IX3A 1N6IA 3U7EB 4N41A 1VE1A 2H07A 3COWA 4JR0A 4M89A 1E9BA 2QNBA 2PMDA 3CUYA 2Q6KA 2JBAB 2J5QA 4Q7LA 2PLRA 2FUNB 1L7AA 1RAAA 1JZSA 2J3KA 4AWXA 3AUXA 4FC6A 3MTIA 5CNMA 5LZ8A 1ORWA 3TNFA 3MELA 1XZBA 2QGNA 2QPOA 2WINI 2X6RA 3GAMA 3HXLA 1F8GA 1UPTA 2E4ZA 2P5SA 4JYPA 1FFYA 3AETA 4X1YA 3GPDG 5BNWA 4H17A 4CTKA 2AWOA 1A4XA 3D6FA 2ZBGA 1ZCAA 2FQWA 2O8FA 1HWYA 1U0LA 1DBVO 4PX2A 3GRVA 4LK3A 4BVGA 1NNEA 2DPYA 4FVTA 1DKOA 5ANRB 1TUIA 3KZOA 3JQ8B 2GPAA 3DHVA 3N7TA 3KP1A 4IM7A 5CGZA 3KPJA 3NDPA 1F6DA 4PYIA 3J80A 3A1SA 3T3PB 4CCWA 4IDGA 1YT5A 1RZVA 2YOGA 3M70A 3QLJA 3V1UA 1AN9A 3HJBA 1LPMA 4IIJA 2F48A 5KQMA 2QRLA 4YCDA 3W04A 4XR9A 5LYJF 2P6OA 4NOMA 1UUFA 1XFAA 2ZTHA 3RIXA 2GKSA 1VZ2A 4C5BA 2C4KA 2V54A 4EL5A 1L7OA 1QZZA 4ZFNA 5TRTA 3TSAA 3ZWDA 5CLFA 1USGA 3MD9A 2ID7A 3ODPA 1CS4C 3ML1A 4Z4EA 4JA2A 1KBZA 3AEYA 2J5KA 1Y8CA 3H2KA 3G88A 2Q5CA 3AIIA 2FPPA 4IILA 4LY6A 3WGKA 2O1XA 5AOVA 4MITA 4ZK6A 2G0AA 5E9JA 2D0OB 2NU9A 2DU8A 1Z5PA 1WA5A 4HZUB 1E20A 3LA8A 4C0HA 3AEXA 1FQOA 3DYVA 5H7XA 1EFCA 4M8IA 4QPZA 1EE9A 4JODA 2CE7A 3Q8LA 2WSBA 1GDHA 4MMYB 4PG7A 1Z5ZA 2IU6A 3HRIA 5DDIP 5BOVA 4GW3A 4HD8A 3H04A 3FSJX 2HJHA 1NBMD 4EGCB 3NAGA 4UATA 2CT8A 1CNFA 4IGAA 5D01A 3VBCA 5F5LA 2IOHA 1OC4A 1BDMA 3ICWA 3OESA 2P0YA 5T4HA 3VHLB 3WSWA 3ZJ5A 2JFNA 5EZ5A 4ARZA 3HSKA 1KEVA 3I5XA 1P9LA 5CUQA 3S44A 5CA0F 1CF9A 4ZU1X 3D7LA 2HA4A 3NHUA 4Y18A 4R1QA 4ADSG 2VRNA 3IESA 4M1OA 3ROKA 2WKSA 3DW3X 1AQLA 4JBLA 2L19A 4AZTA 1X94A 3EH1A 1ZM7A 1USKA 3FTCA 3V4ZA 2DF8A 2IHUA 4IV5A 3AEZA 4OQZA 1MNAA 4EG5A 2X9QA 2IYWA 5JWHA 5TQJA 1KERA 4JH0A 5CEJA 1UBFA 3OIDA 2EYQA 3C3EA 1P6UA 1O97D 4MZDA 3GJ5A 4YI5A 3HL4A 3IDFA 2Z2XA 4HDCA 4UPVA 2J30A 4MO2A 1CLEA 4AKHA 5KSPA 3TTTA 2EWWA 2NAFA 2HBZA 3PXEA 4FN5A 4RKWA 4RTQA 3DGFC 5FTMA 4RH0A 3B6ZA 2DWUA 2R1TA 1O9GA 2PIDA 4NYIQ 5LVAA 2JGMA 3UT5A 1PS0A 3NDRA 4IICA 4PC6A 1WDWB 3NGLA 3CGGA 4M0CA 1NYRA 4Y6LA 4IX9A 2YXDA 2EG5A 5ALTA 1UMBA 2Z3WA 4Y2UA 2V3WA 3HL0A 3NB0A 5L8VA 2LDXA 4QXMA 2O6LA 4DDTA 1L8XA 2C4WA 4WW0A 4Y1FA 2PZEA 1T29A 3EWAA 3CH6A 5KNBA 2XQJA 1C0EA 4F6RB 3QE4A 3VR6D 1HYHA 2WZQA 3FRHA 5DCLA 5MGBA 1LDYA 3A9RA 1AHNA 3ZBUA 1OB2A 1K6IA 4XRRA 2O7VA 2O8NA 2VVTA 2WT9A 4OVKA 4X8MA 5BV2P 4GI1A 5CVDA 3G6WA 4QPDA 5D3QA 4FWTA 1D6NA 1D2CA 3KE9A 4PLYA 1WXGA 4NBTA 1TJ4A 5TQVA 3PNKA 3BF7A 1EDEA 1OJLA 1ZUIA 3HMKA 4KNVA 5AUQA 2ZU0C 1UZUA 2WDZA 5ERGB 4UHEA 3CJQA 3IH5A 4RV4A 3K2BA 2QZJA 4RLSA 2B2XA 2PA0A 4IIVA 4XCXA 3VJLA 2BFFB 2Z6QA 1JLKA 4F7DA 3ZPXA 1DJOA 3SSMA 1HT2E 5C8YB 4CYMA 1P45A 3DMPA 1RI2A 5FUYA 2EP5A 2WU8A 3WL4A 2B20A 4HWOA 4RX1A 3CG4A 4YJ2A 4CDMA 4G0ZA 3SU8A 2FRDC 2Q50A 3K0CC 1JDTA 1G5TA 5TB5A 1S4QA 4CMIB 4D26A 1RZRA 4Y2YA 1H0KA 1MAUA 3I2KA 4JMPA 3O38A 2ZYGA 1X7ZA 1SC6A 2EKDA 2EFHB 3RV4A 1ZONA 2OBFA 3CEJA 5HR5A