4JUIA

Crystal structure of tannase from from lactobacillus plantarum
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
470
structure length
470
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTAAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 160
structure length 470
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4juiA00
5JAUA 2J3DA 3C5WP 4N8EA 3FYTA 1T4MA 1ZGCA 2BGRA 5BOVA 5AOBA 3PF9A 4MXDA 3O4IA 4N5IX 5CXXA 5AOAA 5JAOA 1MNQA 1QONA 4PW0A 4QE3A 4X95A 3A2NA 2DR0A 2I3DA 2AJ8A 3WA7A 1UXOA 1DQZA 2ZJFA 2D5LA 4BZWA 3R41A 5AM5A 4F60A 2ES4A 3G0CA 5ALOA 2XQJA 4GECA 1JFRA 4Y2SA 4CCYB 4G8DA 2XUFA 1EH5A 5D3ZA 1CIJA 1ETHA 3OM8A 2PU7A 1R9MA 4CCWA 4WDQA 4K6KA 1JJBA 5AI6A 3FYUC 4Y2XA 3VDXA 2JGFA 2QTBA 2XUJA 3STYA 5AM2A 2BUBA 3HLKA 5LP1A 3HSSA 2V98A 4Y2UA 5EHQA 1AZWA 1BCSA 2B4KA 4L3WA 3WYNA 1WHSA 4G4JA 2XLBA 3HYSA 5AK3A 1CUUA 2DQZA 5FXMA 4LHEA 2XI4A 5EI5A 2AJCA 5ALUA 5JARA 2R11A 4FNGA 4FWBA 4J7AA 1FFEA 3WKEA 5EHNA 1FFAA 4FLEA 1XQYA 1O6FA 3DD5A 4UHHA 1KU0A 2PKYX 3HEAA 1UK9A 5HF6A 1U2EA 1E66A 2WLSA 3OG9A 2AJDA 2HU5A 5ALPA 3E0XA 2JGEA 5JD5A 1H2WA 2IX9A 4MEAA 4HRXA 4JUIA 5FDFA 2OQVA 4KJXA 1QO9A 1H2XA 3T4UA 2WG1A 2H1IA 1LPBB 3AFIA 1EX9A 4DMHA 4BVKA 4ZRDA 2JF0A 1IVYA 4C4ZA 4QZVA 5FP0A 5CT8A 1DQYA 2XUPA 4DSZA 1WPXA 3DEAA 1LBTA 3STVA 1CUGA 3WL6A 1B41A 5D7BA 4DSAA 1YS1X 3G9TA 1VXRA 3QITA 1QTRA 3IA2A 3V1KA 1BN6A 1FFCA 1DT3A 2H9YA 4H7KA 1XQVA 3I6MA 1LPNA 4J0HA 2BGNA 3H17A 2V9ZA 5A2GA 4GXNA 2GBCA 2ONCA 4GI1A 4BVJA 2VAVA 4D9JA 1HQDA 2OQIA 5BV7A 1GT6A 3C70A 3GROA 3QMVA 1VA4A 4XJVA 3QPAA 2HHAA 4DYHA 2RHWA 3DL7A 2VSQA 5EHXA 1X2EA 1FJ2A 3WL5A 4K6GA 1QOZA 2DSNA 1DX4A 4FNMA 5HQ3B 4UBKA 1CR6A 1XQXA 3TRDA 5EIEA 3D2CA 2PU5A 2WFZA 3I6YA 1UOQA 5JASA 3W9UA 3FWHA 5CT4A 4F0JA 3D0KA 3M83A 1E3QA 3ESAA 5K5EA 1XQWA 2WTMA 3WI7A 3KD2A 4Q3LA 3ZLUA 2C5FA 4RGYA 1JMYA 3WZLA 5AM4A 1LGYA 4J03A 3DOIA 3ICWA 3MUOA 1RYYA 3C8DA 5ALEA 1I6WA 4AMYA 1R3DA 1UT6A 4PSUA 7YASA 2VATA 1UWCA 3CCBA 5DLPA 5AM3A 5AIAA 2QUAA 1VXOA 3RK4A 1DT5A 2QM0A 4KRYA 4H7JA 1ZI9A 1MJ5A 2HL6A 3I2KA 4OUKX 1YA8A 3STWA 3D3NA 4BCCA 4M0MA 2FJPA 2I03A 5DJ5A 2XQFA 1TIBA 4X92A 4B7ZA 4G9GA 5JYCA 2XMDA 2J3QA 1JI3A 5IVKA 5JD6A 1TCCA 4E11A 5AKJA 2Z8XA 3VVLA 1XZDA 2HFJA 1AKNA 3EBLA 2JBWA 2O2IA 3C5VA 4BE9A 3H1AA 4LXHA 3LS2A 1ZIXA 2XUOA 5ALJA 2JEZA 4BVLA 3Q8WA 3H2GA 2EDCA 1GKKA 3F97A 1WPRA 2WU3A 3G02A 3FYUA 3G9ZA 4G4GA 1FFBA 2HA0A 1EINA 4X85A 5AO9A 3V1LA 1ZJ4A 3ZLTA 3Q0TA 1XKTA 3H2IA 4B9AA 5IVIA 3FYUB 4P92A 3I2IA 3C6BA 1IMJA 1ACJA 2PUJA 4V2IA 5LZ5A 3LLCA 2C0QA 5I7UA 1F0NA 1QIEA 1L7RA 4H7EA 2G4LA 5T4HA 4H7DA 3C43A 5AI4A 4ARAA 3MVEA 4N8DA 3HC7A 3WWCA 2PX6A 3QBJA 1QIGA 1MTZA 1QIHA 2HA7A 4KYVA 5K3DA 4OYYA 4BP9A 4B0OA 4X3CA 4G4IA 4Y2QA 4A16A 4HZGA 4AO7A 3DYVA 4HXFB 2OCKA 3AZQA 1F6WA 4H7HA 5T4EA 4EHBA 2YXPX 5A7HA 5AI0A 5AJHA 2WILA 2PSFA 1G42A 3IIIA 4AN0A 3BJRA 4WFIA 1XFDA 3NUZA 3O4HA 2G5PA 5I9IA 1JJFA 2QR5A 1CUCA 2DHCA 2QRUA 3H2HA 4QA9A 3DOHA 1ODSA 4OPMA 4YASA 3KOOA 4M0FA 3WK9A 3ZLVA 3WKAA 4FDMA 2BCEA 1EDBA 3FLEA 4IH4A 4DNOA 1TQHA 1HLGA 1EDDA 2WHQA 2BAGA 4B85A 4DTCA 3BF7A 2Z3WA 2PM8A 3WMRA 1LLFA 3AIKA 1GKLA 5KBYA 5KREA 3MGAA 2OG1A 4B83A 5J3JA 5LZ9A 4J0DA 2CUTA 3B12A 4X6XA 3C6ZA 4BDTA 3WJ1A 5FOQA 3OPMA 1QIIA 5HF8A 2HRQA 3H19A 1Q0RA 2Y6VA 3KSRA 4BRZA 4Q34A 5CH5A 4UHCA 1VJ5A 5ALVA 3N0TA 4BATA 2HFKA 1MU0A 2ACKA 3R0VA 3R3XA 3WZMA 3BXPA 4JNCA 4FMPA 2ZYSA 4CFSA 1XZHA 1XRRA 1ZD5A 4H18A 1ISPA 3V1NA 1XZLA 1GXSA 2GZSA 3O9VA 2LIPA 1XLVA 3I1YA 1EB8A 3DKRA 2BFNA 3HRHA 3SC2A 2O7RA 5ALQA 3G0IA 5CT9A 5JZ9A 3WIOA 5JADA 3FVTA 4B84A 4BE4A 5IVHA 4C4YA 4UHBA 4BZZA 3AJAA 4BCDA 5AK6A 5FKJA 4EA6A 2C7BA 1BEZA 2Y1KA 4W1PA 3QVMA 3PI6A 3PICA 2WUEA 4ROTA 1XZCA 2ORYA 1WB5A 1XZEA 4UBOA 1AUOA 4JYMA 3WK4A 4EY7A 3H0CA 4ITVA 3D2BA 3R3ZA 1MNAA 3ZI7A 4LIPD 5T4FA 3F9CA 4X6UA 3TGLA 2GYVA 1MX9A 2HU7A 4Y7DA 2Z3ZA 3H1BA 1XRMA 2V96A 3QH4A 2VJCA 4EY4A 5CW2A 4U2DA 2XE4A 2HA5A 2WIGA 4Y2TA 1GPLA 2OCLA 1ACLA 4GBGA 4MYSA 2WIFA 2XMGA 3AZPA 1TRHA 3D7RA 2I78A 1YSCA 5AH0A 4X90A 5C8XA 2XMRA 4MWTA 5AKHA 2X8BA 5JATA 1Y7HA 3O4GA 2RHTA 4J0KA 2VAXA 3VISA 4HRYA 3LIIA 2Y6UA 5ALKA 4B80A 5CH8A 1T2NA 3M81A 1CUXA 1N5RA 2XLCA 2YASA 1XRQA 3AINA 1Y7IA 1J06A 4CCYA 3OURA 5AK5A 1BEEA 2C4HA 5LKAA 1W75A 4MEBA 3HXKA 2WTNA 3FSGD 4M0EA 3KWFA 4UBJA 4FFWA 4ZGBA 5BWCA 3EQ7A 4Q05A 1AMNA 3SX4A 1CVLA 1SOMA 1CRLA 1O6GA 2XUIA 3WL8A 3PE6A 3V48A 2WIJA 4B9EA 1JU3A 3GUUA 4CG2A 4QWMA 2PPLA 1ORWA 4FTWA 3BDVA 3QMWA 1PJAA 4KE6A 5ALZA 4G5XA 2X5XA 1MX1A 4X7BA 4OB6A 3ZV7A 4UFOA 1UZAA 4U2CA 3BL8A 4YPVA 4P93A 5D6OA 4W9RA 1WCYA 1ORVA 4BTVA 2RAUA 1VLQA 1XZAA 3W06A 4B82A 3ANSA 3QPCA 3IURA 5HKBA 4X6YA 3C8HA 1K6EA 1EDEA 4H77A 4ZV7A 4LYEA 5IH7A 3IUNA 4ZV9A 3M82A 3QYJA 4OCZA 4HXGA 3BDIA 4QDZA 4EY5A 1YR2A 3OOSA 3DLTA 1LPPA 1CUIA 1GQRA 3PUIA 4QLOA 1QZ3A 1VA5A 1ZI8A 2HADA 2ZSHA 5ALMA 1UK6A 2VEOA 1JKMA 3EQ9A 3D2AA 2YH2A 3NGMA 4A23A 1U8EA 4E14A 4ARBA 4GDMA 5AKYA 1TAHA 3HI4A 5DYWA 1SFRA 1E8NA 3UMJA 3HZOA 1N8SA 2X76A 2O2GA 5HQ3A 3FNBA 4Q1VA 1UKCA 3F96A 1QJ4A 5CMLA 5HF9A 3WWEA 1F0PA 2VJBA 2BUCA 1ZIYA 1CQZA 5HK8A 1SC9A 2QJRA 5FPPA 1W1IA 2HRRA 4O08A 1P0IA 4OB8A 1DX6A 1UK8A 4XVCA 3FCXA 1JJIA 4KAFA 2VA9A 1UOOA 5DNWA 5EGNA 1CUVA 1N1MA 4FOLA 1XZJA 5HF5A 3AUKA 1CFJA 5CXUA 5LKRA 3PF8A 5SYMA 4AZ3A 5LIPA 2HA2A 4DGQA 3F98A 4ETWA 1ZD3A 4CIAA 4KAAA 1CUJA 3DJYA 4X93A 5LZ8A 2OXEA 2FX5A 2CMFA 3K9BA 5HCUA 4BC0A 1E8MA 4HAIA 4BAUA 1YASA 4AN1A 1OCEA 1QGED 5LZ7A 3I1IA 1C4XA 1MX5A 4AX4A 2C58A 4BYMA 3UUFA 3IDAA 3T52A 3WL7A 1S8OA 5K3CA 3G8YA 5DYTA 4DMKA 3LP5A 1VOTA 3OC0A 3IBTA 5JZBA 4IH9A 2WG2A 5LZ2A 4CG1A 3EF3A 4W1QA 4U2FA 1VKHA 1SCQA 4E46A 5CT5A 1NU8A 2WQZA 4MYDA 2XMBA 4RPCA 3F8SA 1CUDA 3B3QA 3WWDA 4GEGA 4DIUA 2Y2VA 1CUFA 1QIFA 1LPOA 1E5TA 3TJMA 2CEKA 3R40A 5A62A 2H7CA 5D3KA 4BDSA 1MO2A 3BIWA 5ALTA 3FCYA 4OYLA 5JAPA 1XZBA 1XLWA 1ZICA 5AI8A 1YAJA 4G1FA 3HACA 3NOXA 3I2JA 2VJDA 3L1HA 1CUBA 3RLIA 2W6CX 4Y9SA 5DWDA 3IUJA 2ROQA 4CG3A 2WJ6A 2RIPA 2HU8A 1R50A 2C0PA 4OU4A 1IUOA 2G63A 3K2IA 4FBLA 2QVBA 3E1GA 1R88A 2H7XA 4Z49A 3RKSA 4ZWNA 1P0QA 3ESBA 2XMCA 3JWEA 5T4BA 2VJAA 4ZREA 4W1SA 4BB0A 1J2EA 5HK9A 4UBIA 1UK7A 2ZYRA 2WIKA 1OXMA 3D59A 1U4NA 3H2KA 1THTA 1XRNA 1CQWA 1QO7A 2XMZA 3G9UA 3PFCA 4YK7A 3EIOA 5AKXA 3R3VA 3KXPA 1EB9A 1WM1A 3E4DA 1AC5A 2FJ0A 1TK3A 4IHAA 4S0XA 1L7AA 1A88A 3U1TA 1J07A 3C45A 2XUHA 1C7IA 3I2FA 3H04A 4KE8A 4J3JA 5JD4A 4MQMA 1N5MA 1MAHA 3DDUA 1VZ2A 1X2BA 4QDTA 5JIBA 4ZI5A 4XWGA 5K3FA 3H2JA 5HFAA 1G4HA 5ALHA 3R3YA 1JU4A 4TVKA 5K3FB 2GYWA 3R3UA 1XZGA 2G5TA 5C8ZA 4H0CA 4UHEA 5AKEA 4INZA 2AJLI 1XZFA 5AKGA 2HDWA 1YS2X 4MQLA 5BWBA 2WFLA 4LXIA 1Q83A 4GWLA 1LBSA 4BC1A 2GBIA 3D4LA 1H2YA 5AK4A 5ALYA 5H3HA 2WFLB 4W63A 1DU4A 2XQKA 4PF1A 1VE6A 4C6HA 3LIPA 2HA4A 1R1DA 1G66A 4QLAA 3A2LA 3RM3A 4WJLA 2PSDA 1TKRA 2Z8ZA 1QE3A 1R9NA 2OAGA 3RARA 3PDCA 3DQZA 3WA6A 3SWWA 4FFVA 5JALA 4FHZA 1ODCA 3AIMA 4WDRA 1BE0A 1BCRA 5E2IA 5CT6A 3CN7A 1IZ8A 1CUEA 3U0VA 4AB1A 3WLAA 4L9AA 3P2MA 1TCBA 1BRTA 3GBSA 1P0MA 4EY6A 2D0DA 4Q3OA 2OGTA 2B9VA 4C88A 5FLKA 2FUKA 5CH3A 3VJKA 3M3DA 4Y2YA 1A8SA 5ALNA 1YAHA 4UFPA 1LZLA 2O7VA 3DS8A 3GZJA 2WHRA 2RONA 2WJ4A 3QPDA 4U2GA 5A71A 4G8BA 4AMZA 4Y2JA 3PUHA 1MN6A 1XROA 4UHFA 1AQLA 4AO6A 4DLNA 3IVMA 1KU6A 3BE8A 3DKKA 3WK7A 5CBKA 2QXUA 2GZRA 2QOEA 5HFNA 3ESCA 4BRSA 3ESDA 4F21A 1GGVA 3AILA 1XZKA 3NWOA 3CCCA 5CURA 3YASA 1LNSA 2IIVA 4X71A 4I19A 1CUSA 1WOMA 2QJWA 3IUMA 3DCNA 3W05A 2H7YA 1ODTC 2BUAA 2DHDA 4JEIA 1OILA 4IQ4A 4P08A 4I3FA 4UPDA 2WKWA 4TGLA 5K3EA 2RI6A 5HZGA 3SK0A 3G0GA 5LYYA 2WU4A 4KACA 5C8VA 4K6HA 4UFNA 1XLUA 2JEYA 5ESRA 5CRIA 1MAAA 1GQSA 5ALLA 1EHYA 3TEJA 3O0DA 4C01A 4MWSA 4I4CA 1CUYA 1CV2A 2DQYA 2QKYA 4EZIA 5JANA 1CPYA 3FAKA 3WK5A 3BWXA 3FLBA 5AKZA 1UOPA 4N5HX 3WYDA 1K5PA 2WUFA 5YASA 1YB6A 1QIMA 2ZJ6A 2QMQA 4BAGA 3N2ZB 5I8PA 3F67A 2W22A 4NS4A 3STTA 4NZZA 4UBMA 1LZKA 1YB7A 3WJ2A 3DYIA 5ALRA 4PSDA 2ACEA 4DM7A 4XX1A 4CI9A 1FSSA 1B6GA 2RGUA 3GFFA 2OCIA 3QM1A 5JAHA 3G0BA 5HKAA 3VKFA 1E8DA 1Y37A 2QS9A 1CEXA 2XMQA 1GPKA 4RE6A 4JYPA 4BAZA 5DYYA 2HA6A 2I3ZA 4C4XA 5EIAA 1ZD2P 3FOBA 2XDWA 4QNNA 3UUEA 4X97A 4OSEA 5AICA 1Q84A 3JW8A 3ANTA 3WKCA 1ZD4A 5EFZA 1A8QA 2Q0XA 1BROA 5AHXA 4FBMA 5E4YA 3VJMA 4PSCA 4LYDA 2O2HA 2V97A 1W52X 5FV4A 1HL7A 2XUDA 2WHPA 2XUAA 1DWQA 3CXUA 1L7QA 1PV1A 4NVRA 4FLFA 4DMFA 3I6ZA 4U2EA 4KRXA 4C89A 3D5EA 2CB9A 3S2ZA 2WHPB 1H23A 5A6VA 4J0CA 3BJMA 1QIKA 2WJ3A 4HXEB 3G9XA 3PFBA 5ALFA 2XUKA 5FUMA 4J0GA 3G0DA 5AIBA 3WWOA 1JMKC 1W76A 3OTQA 1XRLA 1RWQA 2OCGA 4MJ3A 1USWA 3L1IA 5C7YA 3WK8A 3L1JA 4HVTA 3WKDA 3AIOA 3DNMA 2CBGA 3WQHA 4EB0A 4PO3X 1AGYA 2GBFA 1A7UA 4G8CA 3I2HA 4F5ZA 1KEZA 2EDAA 1CLEA 1ZI6A 1QIDA 2C5GA 1EK2A 2ZYHA 2VTVA 1AX9A 1TCAA 1THGA 1UKAA 4QDXA 3FLAA 2J4CA 5AKKA 4E15A 1JT2A 4PQEA 1R4ZA 3I2GA 1H2ZA 5DTJA 2PL5A 2XT0A 5ALIA 2ZVDA 2ZJ7A 3QZUA 1CUHA 5JZSA 1K8QA 4U2BA 1AURA 1LPMA 1HKHA 2DFPA 2JGKA 2XQGA 3W04A 4CIBA 2XB6A 4LKOA 2EEPA 4HS9A 5A7FA 1WB4A 1GZ7A 4LXGA 5LLSA 3VJLA 3I28A 4N8SA 4WFJA 1SCIA 2PSHA 3ZWQA 5AI9A 3FBWA 4UBLA 1K4YA 5IVDA 4X91A 3C6XA 1F8UA 2Y2UA 1Q0ZA 1HDEA 1IUPA 3GA7A 4BTLA 4B81A 3MUNA 1XKLA 3A6ZA 4B0PA 4GHWA 4H7IA 4DNPA 3C87A 4Q82A 3G7NA 1DWOA 5FPQA 1NU6A 3CN9A 1WHTA 1Z68A 3C6YA 1BS9A 3ICVA 4XIIA 5CTAA 4QDOA 2J4FA 1D07A 2JGLA 4IH1A 2WUGA 3H18A 4X00A 5FRDA 2JGIA 3KWJA 4EY8A 5ALGA 1U65A 2BJHA 1QIJA 3A70A 1IZ7A 1SCKA 2QT9A 4NMWA 2OLEA 4W1RA 5KWIA 2DHEA 4WFKA 2OAEA 1UKBA 1J1IA 2WUDA 1EVEA 4RE5A 3V9AA 4AXBA 5EIHA 1ZGBA 3KDAA 2QUBA 4H35A 4OB7A 2UZ0A 2E3JA 2AXEA 4AQDA 1C7JA 1VZ3A 4K5QA 5AP9A 1MPXA 2PBLA 3AZOA 5DTIA 4DMCA 4PNZA 3W9BA 4BP8A 2OGSA 5ISMA 5ALDA 1CUWA 4C87A 2QXTA 5AI5A 4KE9A 3LCRA 1LPAB 2Z5GA 4L72A 4Q3KA 4WY8A 5KWJA 2PVSA 4FLMA 3B5EA 4JH0A 2WFMA 1QFSA 1QTIA 1A8UA 1K63A 1HPLA 1EXWA 2YYSA 1X70A 4Y2VA 3O95A 4OU5A 1NX9A 1VE7A 3WKBA 2P8SA 1CUZA 3ED1A 4QEKA 2K2QB 4AZ0A 4UBNA 2CZQA 1PFQA 2DCMA 3R3WA 1YCDA 2VT6A 1WB6A 5ALSA 2AJBA 2WIDA 3QMMA 4BBZA 2B61A 2XUQA 2JIDA 2VT7A 2WM2A 2JGMA 1HBJA 1XZIA 3BIXA 5DNVA 3E3AA 3DL4A 2ECFA 4HTAA 4KEAA 5ALWA 3JYHA 1G5FA 3WWPA 1H22A 3BF8A 5DNUA 3A2MA 3VVMA 3WK6A 1LPSA 2XUGA 2GYUA 2VQ6A 3FSGA 5IKXA 4H7FA 4UHDA 3IB3A 4WY5A 2IITA 4J0JA 3K6KA 4GW3A 1BN7A 2PUHA 1W6RA 1DTEA 1ZOIA 4YX9A 2OGZA 3IUQA 1CUAA 4P9NA 3V1MA 2HA3A 3STXA 2ZYIA 4K2AA 3W2TA 1RP1A 1EK1A 4GLBA 4B6GA 4G9EA 2R8BA 4DNQA 2PSJA 5K3BA 1EA5A 1DWPA 3ZPXA 1MT3A 4TPKA 1XZMA 1FFDA 3S8YA 3GELA 4L0CA 5ALXA 1E89A 4KR0A 1ZJ5A 4BCBA 2B20A 1GPNA 1DINA 2XQIA 2WG0A 3WIBA 3ILSA 5AM0A 5E4JA 1BU8A 3FVRA 5EHZA 6YASA 5K3AA 2OPHA 5F4ZA 1W4LA 1M33A 3HABA 5A7GA 4Y2RA 4J0IA 5LZ4A 1P0PA 4IO0A 3IULA 2BKLA 3X3HA 4FKBA 2HIHA 4EUSA 3EQ8A 4KE7A 1EVQA 1QFMA 2QZPA 5AKLA 5E4TA 2JGJA 4PV7A 2WSLA 1XRPA 4DNFA 2PSEA 4Y2PA 4UUQA 5C81A 2NW6A 4OD0A 1UFOA 4KAJA 2VF2A 4RNCA 4ZXFA 3O9MA 5AM1A 1QLWA 2HM7A 1IUNA 3HJUA 1YA4A 3VXKA 5AOCA 4EBBA 4QWWA 1EI9A 5SYNA 3O4JA 4X94A 4QDUA 4WCVA 2ZSIA 2GBGA 4AO8A 2CKMA 4A5SA 3STUA 2CJPA 5AKIA 2XMSA
chains in the Genus database with same CATH superfamily
3JVDA 2EBWA 5JAUA 4LVOA 5IAKA 5KNCH 1ZN7A 2IYYA 4YDHB 2RJ3A 1PJTA 5KOIA 2FWNA 4B3TB 4N8EA 4JC0A 5CIYA 2QT1A 5C8YF 5DX1A 4LBZA 4LQLA 4AVYA 2X8WA 3QI7A 3K0FB 2BGRA 2HBRA 4LGVA 4M83A 5AOBA 4P4UA 5BOVA 4QT4A 2VTBA 3A3PA 2WWGA 4E2WA 4UDYX 1J90A 4XQEA 4YGYA 1E1CA 5ENZA 1O5IA 3B2QA 3O4IA 4N5IX 5ILQA 1ZIPA 2V5UA 4BXOA 5CLFA 1XXHE 2PYDA 1JR4A 2Q6OA 1KAOA 3PDIB 4R1LA 5KQSA 3AVTA 4PW0A 4FE4A 4U7TB 4ITRC 2YV5A 1G41A 3AG5A 4R01A 2ZI6A 3V7YA 2OCXA 3BZUA 3FNGA 1WO8A 3O7WA 3VR5D 4AF8A 2DR0A 2ZROA 3HJGA 4ANFA 4P6VF 2AJ8A 1PTKA 2DWPA 3A05A 3N8DA 2ZJFA 2BMEA 2WYWA 3UJAA 4F4UA 1O96A 4B17A 2D5LA 2OHJA 3WIEA 4CL2A 3R41A 2C07A 3UT5A 1RKVA 2IVZA 2GF2A 2VQ3A 3K0CC 1KVTA 3KE9A 5DSZA 3V8PA 2EFHB 4YCSA 4XJXA 4AJPA 4V03A 2R8PA 1Q2UA 1UMCB 1K7EB 3OIVA 4TUYA 4NS1A 3LKDA 3PNKA 5M3BA 1MPTA 1JDSA 4HDSA 1FXSA 3SR0A 3BFKA 3L43A 4NFSA 4HV4A 3W8DA 1WJGA 2H9AA 4YI3A 4EVSA 1UDAA 1VSUA 4FHCA 4FEEA 4NYMR 1L4KA 5KX5F 3ZCRA 4HDNB 1NULA 3AL3A 3GAFA 3L3BA 2FG5A 4HTFA 5EQDA 5AI6A 4G36A 4E2ZA 1NM5A 4Y2XA 3VDXA 2JGFA 2PWPA 4Z4EA 4GNKA 1YQDA 4GX5A 3UK2A 3OKFA 1T9GS 1YV9A 4P36A 2HWUA 5CJPA 5E4FA 4CKZA 4B1FA 5KYYA 2EJTA 1H5QA 2YHIB 4PHCA 4ZCQA 5L3QA 2BH2A 3V2IA 1RMQA 4RTSA 2WIAA 4DV1B 5EHQA 1MXHA 4B76A 1G8AA 3LNTA 5E6UB 5H3LA 3D8HA 5HRUA 4EHNA 4L3WA 3FETA 4JU9A 3B6JA 3WYNA 4HNHA 4EEXA 1GA6A 1SQFA 1MP0A 2XLBA 1S3SA 2DQZA 2XI4A 1EFPB 1PE0A 3ZQUA 3P94A 4B7UA 4ZTUB 3FLMA 5ALUA 1IBMB 4BNWA 1OH7A 3OIYA 4AKEA 4FNGA 4XWOA 4HMQA 1FJHA 4DHWA 4FWBA 2ZWMA 3KEGA 3WKEA 1KAHA 3KD3A 1WHSB 3B60A 4M0LA 4HGPA 1DFIA 2IE0A 1O6FA 3EFHA 3IQFA 4Z1OA 2YCLA 3HEAA 4TXLA 3WGMA 4NMXB 3FNEA 1WNFA 1HOTA 1ORTA 3QE3A 2Q5LA 4JBWA 4KXLA 2UYYA 1X7HA 1SCUA 3EFOB 3WQBA 1UDRA 4EG3A 5B7PA 1RXCA 3OQBA 1E66A 4KVGA 1FDRA 4PWZA 2Q45A 2OSBA 5JNUA 1KRXA 4DLZA 3OG9A 4IP0A 1I1OA 2HU5A 3MF4A 5ALPA 4MCHA 2JGEA 3NCTA 1AUQA 3I32A 3OP4A 4TMTA 3SYNA 4U8HA 4DDKA 3TL6A 4IVPA 5HYVA 3GPBA 1PD1A 2OQVA 1CK4A 3HDVA 4IOMA 5ED0A 3Q9NA 3V00A 1UDWA 2VRNA 3AETA 3BMOB 1KZ4A 1C29B 1E1RA 2WQ6A 4HQKA 3ODGA 4ML3A 3GDGA 3AFIA 1U1EA 4R41A 2ZWIA 4L7QA 1NVKA 2KM1A 2GPSA 5TE9A 1RYZA 1JQKA 1JG2A 3MJHA 5EJ5A 1TEXA 1KEKA 2AOUB 3F5QA 1SM4A 2ONKA 4O6VA 2FWBA 3OJCA 1L5FA 1C50A 2ZB4A 4NABA 4M1TA 2DQKA 1N4AA 1GEEA 3MGGA 5CT8A 1UM8A 3OPXA 1KMQA 3N86A 2HLDD 4MVJF 4RX1A 2IL1A 5GJVC 2W4IA 4P81A 1ZU4A 1Z62A 2O0HA 5FAXA 1ZN9A 1KQPA 1OXBB 1XP5A 5JXJA 5EJ8A 1CUGA 1KAGA 1UMBA 3RHSA 5KEIA 3NGLA 1JYEA 1T5LA 2EJCA 4IEIA 3I83A 1GZVA 1PLJA 2CNBA 1HSZA 5D7BA 1XDWA 3N7UA 1W59A 1YS1X 1D1QA 1E64A 3G9TA 3L7BA 4OV6B 4DSAA 2B30A 4TT8A 1RJFA 2POCA 3QITA 2XYVA 4LJAA 3W9YA 5EHGA 1G7CA 1G98A 4V3BA 1ND5A 4WK0B 4DDHA 3ABQB 4PRYA 1FFCA 1U3FA 2AC7A 2GLXA 3L7JA 1DT3A 4OHPA 4Q47A 3W5AA 4BEJA 4NDAA 4MI6A 5EUBA 3TQIA 2R4TA 4PXSA 4U0KA 3E9YA 2O8EB 1O5TA 3MJRA 1HY3A 3WFJA 3HA5A 3UJHA 4D4MA 5E9WA 9ATCA 1LPNA 4R98A 5I5GA 3TKLA 1V8ZA 5LQCA 1JKJA 1FPQA 1A4XA 2JFNA 3CKMA 1G0NA 2BI7A 2VF8A 3GMDA 4L9WA 2GBCA 1X7XB 3A4NA 1QHHB 4QELA 1PDOA 3I6QA 3ZZNA 1U63A 1PSDA 5BV7A 1OT5A 2LD4A 1WWKA 1GT6A 3B9QA 3C39A 3D5TA 3IQEA 1L8QA 1J5PA 4B6FA 5KOJB 4DJAA 1DIRA 2Q28A 5CVDA 1QS0B 4ZQGA 4C6SA 5IZCA 1TCVA 2F48A 2FX3A 4OATA 5ETJA 4MR8A 3MCVA 2P8JA 5ICFA 3TQRA 4DLXA 5IJZA 4UU8A 4PM4A 5EHXA 4URZR 4NZOA 3HJBA 2ZBEA 3WL5A 1BD4A 2ZRPA 4H1UA 1CY6A 4MAMA 3ICOA 3LF2A 1N0HA 2XZLA 4J6EA 1W73A 4Q4HB 5FX2A 3DP7A 4L78A 2FOIA 4IKOA 2PU5A 1QXSA 2R5WA 3QENA 4LZLA 3EVTA 3D4OA 2QTNA 3SN6A 1CNMA 5JASA 1TTQB 5CGZA 3W9UA 3FCCA 4OXRA 1T8SA 4YXWA 5HXAA 3BHMA 2QSUA 3ZH2A 2GVNA 2RHMA 1N2HA 4F0JA 2FZLA 7MDHA 4NBNA 2J6BA 3PHHA 3K9GA 1DTWB 1E3QA 1Y34E 1OBVA 3NJ4A 4A9AA 5IJ9B 2XHEA 4EYOA 3GHYA 4FGUA 3KT8A 1XQWA 2UDPA 3RQSA 3T1VA 1U0SY 3H75A 5EE0A 3KD2A 4Q3LA 3WI7A 3ZLUA 2FLKA 2PH5A 3M5CA 3RJZA 1TW3A 2OO7A 4MKGA 3Q3JB 2PMFA 3WZLA 2GVZC 5J63A 4BPBA 2Q5CA 3KKNA 4Z9YA 4XYBA 4AK9A 3UAGA 1NQ5A 2XA1A 4IXMA 3U26A 2HRDA 4M49A 3AOEC 5DBFA 1PWYE 1DC8A 2GPJA 2VF5X 4IILA 4L16A 3REQB 4AP6A 1DOHA 5FFNA 3SEQA 1D1PA 1JEAA 3VTKA 2XCUA 621PA 3GP8A 1FOEB 3ECSA 4EELA 3FHTA 1UT6A 7YASA 3HRIA 2YW9A 4BX9A 3CKYA 4M9UA 4Z7JA 2ZUBA 1LTQA 4LI3X 1Y3BE 1B00A 2E0IA 1Y33E 1E2NA 1H4TA 2RHGB 2P5SA 4MJLA 4P3NA 2XYHA 5FBRB 3Q5DA 3WQSB 3ZBPA 1KMCA 4Z3DA 2QG6A 4H3VA 2VSNA 1NN3A 1VXOA 5A02A 1U0OC 4YROA 1KDVA 4B35A 3QFTA 3CNHA 4F71A 1ZISA 1GZ4A 4K88A 5CUQA 1CVRA 221PA 3HKCB 1U04A 3A7DA 3K53A 5JECA 1II8B 1SBYA 4M0MA 5B3KA 4N3BA 4LYGA 2I03A 2A5JA 4TLCA 4QTZA 1E2MA 2GI4A 4XJTA 4DZZA 1O0BA 2UXCB 1EXDA 3TMYA 4ENSA 4B7ZA 3AHIA 1G20A 4LTDA 2QYTA 1NY5A 3G2NA 2J0QA 1SGWA 2XMDA 3LVQE 2DHQA 1Q7BA 3RIEA 4A8PA 4WQMA 3VO8A 4YV2A 2HJVA 3EZXA 4KU4A 2V7GA 2ZAOA 3KJEA 5BN4B 4JASB 4CMEA 2ORIA 1XT6A 1OT3A 3KYDA 4KVZA 2ZIGA 4A82A 1J4AA 2DFVA 2C7VA 3OHSX 5AKJA 3VVLA 2GD0A 3DKIA 1NVMB 2HFJA 2YY6A 3FWKA 2YFYA 3GRVA 4TZ0A 1QUEA 3GRPA 2WVJA 2NTNA 2OXRA 5B58T 2RH4A 2VEDA 2O2IA 3IAS6 2IPMA 2D00A 1OBHA 2QYSA 1FSGA 2VWPA 3H1AA 3ROEA 4D3FA 5LQNA 3J81k 1R6AA 4QOFA 1YR1A 4J16C 1ZUWA 1GPH1 2DTXA 3EH2A 3KYCB 3F97A 1DLIA 4MSUA 4OQMA 2BF7A 4QXOA 3IMKA 3Q6IA 4D41A 4D92A 4EHIA 3ZHVA 4Q9HA 2K4MA 1QANA 2IYLD 2P5YA 2YHUA 3W5VA 3WDSA 5KU7A 3LQ4A 3SF8A 5EJ9A 1N34B 1IULA 4DR5B 4CN9A 3BRWD 2CLKB 3ZJUA 5BUCA 2C7GA 4B3XA 5MN6A 3KZKA 2FSGA 3PT9A 5DOZA 3C3KA 2OMEA 2P2DA 3ZZ1A 5FNVF 3GZNA 3ROTA 4HMOA 1N6PA 2F1HA 2ZETA 5AJZA 3I9JA 1TM1E 2DUMA 4QX6A 3ZLTA 3EY4A 4CIYA 1KYXA 2DR2A 3OHPA 4JMPA 4WRRA 3G23A 1PEKE 4P0PB 4QOHA 1Z28A 1TYAE 2VLBA 3LBFA 3TLCA 4ZEVA 1PR3A 5BW8A 5CFPA 2BH9A 2W6OA 1A50B 3OQ6A 1FJXA 4QDKA 4AY6A 3Q72A 4NZNA 1ZM7A 1ID8A 1SVNA 3C7TA 3T5MA 4K0KB 2P78A 1ACJA 4HJRA 5LZ5A 3WHKA 1ZMXA 2PUTA 3Q0EA 1VL2A 4KWHA 5I7UA 2CYBA 5EE9A 2CSUA 4LQCA 1CQPA 1QIEA 1UBMS 1QBGA 2B36A 3DT9A 3F73A 4H7EA 1OLSA 3LQQA 1F9EA 1U2RA 5KYKA 4DQXA 3EXEA 3BQ9A 2AKEA 1QF7A 2EKDA 3ZJVA 3D8UA 3E1KA 4QUGA 5PNTA 5BT8A 4H7PA 3CHYA 5L9AA 2JHGA 4AZWA 4IQ8A 4NBUA 4O2AB 2XOEA 4LE1A 1E63A 1TO2E 3B3AA 2WAAA 5JU6A 3U60B 1YQEA 3WWCA 1GDDA 3TINA 3D8RA 3DMTA 3KJZA 5IKMA 2I3BA 2QN3A 1XUOA 4HWKA 1Z0UA 4X5OA 1I1QB 2HMUA 4Z6KA 5E7MA 5LUBA 5B36A 1Z0KA 3CLTD 2QAGB 2G7MC 4A36A 4PPFA 4ER5A 1ND6A 4WN9A 4B6JA 2NP6A 1NNUA 1QIGA 3IUEA 4QNMA 1MTZA 1NONA 3FDIA 4YT8A 3LY5A 4KO2S 5TSDA 2AR9A 2JD0A 4KXXA 1HK7A 3H97A 3OOYA 2HA7A 2B5WA 3BWCA 4KYVA 1JN0A 3VTAA 5J2UA 1N9GA 1CZUA 1DCMA 2WF8A 5K3DA 3LDHA 3T7RA 4TZKA 1XMXA 3KEQA 1GZ5A 4X3CA 3GRCA 4LOHA 2VT3A 3EVBA 4P3KA 3HVRA 2VSOA 4AO7A 1SOVA 2FFAA 1NVVR 4ABTA 3RBAA 2BE9A 5EJFA 3IXMA 4RVUA 1NC3A 1P4JA 5GM1A 4G2TA 1F6WA 3F7OA 5LL6P 2AOVA 1K4MA 3KQOA 1ZM2A 2XVXA 4H7HA 4XUDA 1S0UA 2DFDA 2PO5A 1PNRA 3IKLA 3HNOA 3LYHA 3W5UA 4G85A 3LQFA 1GQFA 3M6AA 5I9MA 1I51A 5A7HA 5BUZA 1YUBA 4E1AA 5JVDB 3IVCA 2YY5A 1L8XA 2WV9A 5DE3A 3OKPA 4NY1A 3FAZA 5JY6A 1J7KA 1Z0ZA 1U8ZA 1GFSA 1XEXB 1XKQA 2A88A 2P30A 3GB9A 1GUDA 3QJ5A 4UULA 2PZAA 1ST3A 1SA0A 3NUZA 4X54A 2VK4A 4K6MA 2WKPA 3VNVA 2G09A 2WD7A 2VYVA 1Z33A 5B55A 1Z6PA 5AJVB 2B8EA 1W87A 5D6NA 2QLFA 3H2HA 2EYQA 3NONA 4QA9A 1GSHA 2PX4A 5BUSA 4OPMA 2VPTA 2VH5R 3EVGA 3ZEIA 3DBRA 1UPCA 3KOOA 1PJCA 2WTEA 5I3CA 1PW7A 4M60A 2ADFA 3WKAA 4AL4A 3HGQA 1IG3A 1J2UA 4IIDA 1FQWA 2VP0A 3B13B 1G1MA 2RB4A 3HYLA 3LX6A 4JBXA 4FYKA 4UQPA 4UTRA 4Q3CA 4RETA 3RUCA 4C0AC 1PJQA 3ABZA 1KORA 3Q2KA 5KAMA 5HTOA 1ZK2A 2H4JA 3QYAA 4O4HA 4RIHA 3AHGA 2ZVJA 3UY4A 4D8XA 2GFQA 2ZDGA 5A4DA 2J6CA 4D1YA 1POXA 2BAGA 2BFCA 1N2XA 3HHEA 3NHUA 4QT0A 5TQ0B 2XNSA 1YNOA 1JSRA 2CNWA 2P6OA 4I55A 4XDZA 3BRQA 4CMKA 2PX2A 4DTCA 2BBWA 2Z3WA 1E9CA 4ZVUA 2ECOA 1I5OA 2FGKA 5EWMA 2FW8A 421PA 2XGOA 1S8NA 1X7YA 1UAYA 3K35A 1GADO 1SG0A 2F2TA 4MB6A 3WSWA 5AUPB 3DLBA 2L2QA 1KBZA 3NM4A 1W5BA 1LWNA 3ID6C 1RM4A 4RZXA 3U3MA 4AF7A 2ZRGA 4X3OA 4TYNA 1GAJA 2Z4RA 3CLUD 4NFLA 2C5LA 1KVQA 5J3JA 3MT7A 1ODLA 1COWA 2O8CB 2BFAA 3LCCA 3NHPA 3NWEA 5CYFA 4EJSC 3H5VA 2PCJA 5LZ9A 4EKYA 4J0DA 1WDKA 1F3OA 3SG0A 4AJ1A 1M8GA 3QVXA 2WT9A 1XIVA 3WJ1A 4B7XA 1DJNA 5T41A 5FOQA 1QQ5A 3PEYA 3OPMA 2CMDA 2AZTA 4LSWA 2O8FA 4L0QA 4MRAA 3TUIC 2WPNA 1LA2A 3BE6A 4Y7CA 2HRQA 2QMZA 1UBRS 1NI3A 1PS9A 1LS1A 1YVRA 1M2OB 3G8CA 2GARA 4BRZA 1E1NA 5CH5A 1MJNA 1YGPA 3GMIA 5LYJB 1JHVA 1UJ5A 3CURA 2O9JA 3B7PA 3H1EA 3GLFA 3UANA 2ACKA 3R0VA 4WK6A 3R3XA 2RD2A 4TL9A 1BA2A 3AM3A 4LXUA 1UXIA 3KETA 4BEBA 2XZDA 3OZ7A 1GQOA 4FMPA 1C0KA 2Q9AA 1WSBA 2P2NA 2PS9A 2GCEA 4HB0A 4W5RA 3GUHA 3JQ8A 1XRRA 2ID7A 4J29A 3R8FA 1ZAKA 4IDPA 4AJ9A 4RHFA 1TVEA 2AE2A 3MWYW 4FDAA 2I6UA 1DO8A 4YUWA 1PS0A 1ISGA 4OHFA 7MHTA 3M9XA 3NHWA 3ME5A 4FILA 3UW1A 4WBNA 2GN4A 5BQXA 3C1TA 3R7NA 4YUZA 3RS7A 1UP7A 2Q3FA 2YVLA 4FGZA 1M1ZA 4IIJB 2NVUB 3SC2A 3TXYA 5L3VA 4G41A 3AHHA 4HNSA 5ALQA 1ZZGA 3G0IA 1RPNA 5AT1A 3UMGA 4D9KA 2W2NA 2W2KA 4DLUA 2GF0A 4DZRA 3WIOA 3PENA 3FVTA 5KIAA 4PG5A 4BE4A 1A2KC 3JAKA 3NHBA 2BEWB 4UHBA 1YBFA 1FC0A 2P9CA 1K97A 5ERGB 2V3WA 1HYGA 4EHKA 5FKJA 4HNUA 5KMGA 3SHVA 3H0KA 1ZGZA 4PZCA 5EEGA 2Y1KA 3OBBA 1NWCA 2HR1A 2HO5A 3NOOA 3TD2A 3ZQ6A 2P1RA 3UMMA 1UAAA 4W1PA 3ZD8A 3IAUA 3ZVMA 4JXZA 2JLSA 2L82A 2ABWA 3PNPA 3DTTA 4BB6A 4ROTA 4ICIA 1WRBA 2ORYA 1QHIA 5AD1A 5G0WA 3U7FB 3RR2A 2QV0A 5T57A 3FDZB 5DYGA 5GPBA 3L46A 2EZUA 1OSNA 3RH0A 3VPBA 2IZZA 3BPSA 2ZAYA 1EMDA 4TRMA 3H11A 2E87A 4L02A 4DIBA 1C7EA 2PSSA 1WMEA 3L8EA 5AW1A 1V5FA 1YL7A 2EAUA 1DRUA 4RZSA 3GEDA 2PJUA 1NVWQ 2XCRB 1QLJA 1X7GA 4C0SA 1XSEA 4L6IA 1AF4A 4MRNA 4E13A 3AI2A 5FTKA 2CUKA 2BSXA 4RDHA 3WL4A 1IOLA 4ITVA 4N5NA 4HNTA 5D8DA 1G3MA 2XR1A 3B1ZA 5DN9A 1Z0IA 5DCWA 4Z9FA 2FN4A 3E9QA 3R3ZA 4FNAA 3RF7A 3UMSA 5JSZA 1LLQA 2NQ8A 2VWHA 4LC1A 5T4FA 5HX7A 3L7LA 3B5IA 5KSYA 2FMKA 1SXJC 2Y1OA 3F9CA 4XQCA 2PFSA 1W46A 3R7FA 3UGTA 4CMAA 3TGLA 3OD1A 2Y4NA 1Z5GA 1B1AA 2DM6A 2GFIA 2QROA 3H1BA 2RK3A 1U0GA 1B0PA 4DGSA 4DY4A 4B4KA 4U7DA 4KI0A 4XM2A 3ESZA 4M7WA 4QAQA 1TGYA 4W4TA 5CW2A 2E4AA 2R7KA 4U2DA 3V1TC 5IEBA 4CTKA 1UINA 3FOCA 2B34A 2QIPA 1BE1A 1OVGA 3JARB 2EJBA 2XE4A 4PZZA 2HA5A 1GL7A 1W9MA 2RHOA 3F6SA 1SG6A 1V5IA 1FSZA 1CF2O 1JALA 2FDXA 5CNKA 1KI6B 2V7TA 3CR3C 4JP3A 4P1ZA 3BH7A 3C6KA 3FGNA 1O94C 1ZBDA 2CLHB 3FMGA 2O5VA 2GCNA 1XTQA 1M1YA 1YJQA 3ASUA 2IE8A 4NH4A 4XIFA 3AQ4A 5DM0A 3AHCA 4UDOA 4GG1A 5EMLA 1K7YA 4YMHA 1ZDMA 2ZIWB 1X74A 2H5IA 2XA2A 3D7RA 5JPCA 4MV6A 4ZDWA 2UZ4A 4O4JF 4MWCA 2CNKA 3FJ1A 1DXHA 1L1QA 2ENUA 1QE0A 3T1NA 2RE8A 4PXYA 4GL2A 3BERA 4WKPA 4DRXA 3I0ZA 2BEKA 2LCQA 1KK3A 1EEHA 3VISA 4CUKA 3OE4A 1GGKA 4HGQA 4Z8XA 2PR2A 2VAMA 3A27A 1I2DA 2E18A 3JQPA 2WUWE 4IGKA 5DNAA 3MYRA 3CLSD 4HAXA 3K8QA 1T2NA 3M81A 4BJ3A 1K6MA 5FI5A 3SJZA 1LDEA 1K6IA 4C0BA 1P73A 2X6TA 3JQDA 4QXPA 4OMDA 4CM8B 1WCIB 3I9LA 4H3SA 4ZKDA 3UMBA 5BXQC 5KTOA 1Q7GA 3U5TA 3OURA 3FR7A 1T9BA 5CX4A 5AK5A 4FHFA 4XWWA 5KJCA 1GCOA 3IEUA 1SWVA 1ZUNB 2RKOA 1VFPA 2DMRA 3AUXA 4MEBA 3HXKA 1Q17A 5IJAA 1I36A 3OESA 1F7VA 4X20B 2NUPA 1G3UA 1F9AA 1Y3FE 3DUFB 4M0EA 2I8LA 2AZDA 4DQDA 3SR4A 4UBJA 1WUYA 1O54A 5EKDA 4HDRA 4RMIA 3CX8A 4EECA 3AW9A 3EGDA 5BWCA 3U4MA 4G84A 2Y0EA 3GFPA 3KSUA 3O90A 1P4HA 2A1UB 5I6DA 2V3CC 3VO9A 2J7PD 1A9PA 2QRVA 3PNLA 3LKZA 1X8KA 1CVLA 3MT0A 3CZAA 1CRLA 1Y98A 1JB9A 2GZ3A 3MWEB 1KY4A 5H4GA 5AVSA 4NAHA 3BG5A 2OK8A 4JI0B 2FQ1A 3O3NB 3OPQA 5EXPA 3I8XA 3ZWYA 3OPYB 3ABRB 3NB0A 5DLEA 2X15A 3X0DA 1U4SA 4EF6A 4ENPA 3N6RA 2WT8A 3GUUA 1ZNZA 1QO0D 1O97D 1T5BA 1UBTS 5I3ZA 3AX6A 1E9EA 2H4WA 3L6UA 1DO2A 4RUKA 4WXEA 4PN3A 4RSHA 1ORWA 4ROSA 4JOQA 3GDWA 3QMWA 4RVFA 2FN3A 4DAOA 3AC0A 1RWOA 1JQLB 1NW3A 1Z88A 2GKGA 1UIMA 2E5FA 4EG4A 3LT0A 1UC8A 3AGPA 3OZUA 4KO4S 1DELA 2XB9A 3L0IB 4QGSA 3X1YA 5JNTA 4HADA 1ATZA 4Y98A 1WBBA 2G8NA 3KR0A 1J5XA 1IHDA 4X7BA 4XVQA 1UJBA 1KOGA 1H6DA 4I4TA 1ZOLA 3ZV7A 1NXSA 4KBYA 5FR2A 1MMFB 3ZYZA 2HJ9A 3BL8A 3CJTA 4HAUA 3BBLA 4ZQEA 3T5BA 3WJAA 1FSFA 1L8AA 4XCQA 3DOCA 5ERYA 3FZEA 4P93A 5JTUA 2ZDHA 3B36A 1CYEA 2FP3A 3WGLA 2QNIA 1E5XA 4F6LA 2YZGA 4O25A 5D6OA 4KUEA 4TZ6A 5CA1B 5FNZA 1GFZA 4FI3C 1F6BA 3FMIA 2H5JA 2QI9F 4TV8F 3RIHA 2V0GA 2Q27A 2V9PA 2ZTHA 4RFSA 2RAUA 1J9EA 1E2QA 1VLQA 1Q16A 5LBTA 3GVPA 3R5JA 1B8OA 1B93A 2JIMA 5FHRA 5E8RA 3QWFA 1EJBA 4GLLA 5A3RA 2YXBA 3IURA 1N7IA 3JALA 3KWLA 4UVIA 3C8HA 4DIOA 1K6EA 5FYDA 1EDEA 2FY8A 2ZU0C 3CUUA 3UQYS 1EPUA 2RGBA 1V0JA 4P7FA 3HU5A 2GB4A 2Q1XA 3H65A 4JN6B 1T5SA 1G8MA 3FMPB 4LEIA 1TF2A 5BQ5A 3CVVA 4PZDA 1E79A 1TYBE 2C5HA 1RACA 4BYGA 4HN2A 2DZDA 2HPZA 3GGCA 4HXGA 4EY5A 1N2CA 3U80A 4MUYA 1KC3A 2B2NA 4R9SA 2XTMA 3EZGA 4V0KA 3DLTA 2K7FA 2GHRA 1LKZA 5JJKA 1DAGA 3AF3A 3DHVA 2ORED 2WAXA 2HMSA 3LX8A 2Z43A 1GQRA 1O77A 4H3HB 2G1KA 3DCIA 3RVSA 3W3AA 3LHIA 4OREX 2JRCA 1WA5A 3M6WA 4ZT7A 4BLVA 1QZ3A 5D51S 4D6PA 1P62B 5C1BA 1ZI8A 1ZOSA 3WK6A 3NYIA 4IDEA 4JITA 3PUJA 1XXHB 2J41A 4PLHA 4WCDA 1YJAA 1DFGA 3FZNA 4GKVA 3WLHA 1MA3A 3PUWA 4CDMA 2R4UA 1QGUB 1CXZA 2IHTA 2VN8A 3H5WA 3PIIA 3L4KA 4EI9A 4ID9A 3A4MA 3NTVA 3HY4A 3JQ7A 5IAAA 5C8YB 2YH2A 3EZFA 2ORVA 5SICE 4J7XA 4X8OA 2EKLA 4CLOA 1U9ZA 1G20E 1PT5A 2LNDA 4ARBA 2WLTA 5AKYA 4XSHA 4QHSA 5BWNA 4DUZB 3GJTA 3BHIA 3BEOA 3DQQA 3UG7A 1U9CA 4PHTA 3VV2A 2EJUA 3PRHA 1G16A 2IVFA 1NVDA 4M9RA 2XCSB 1Y80A 3MMXA 1XGKA 5FH9A 1J2JA 2X0RA 2O2GA 3RYCB 3FNBA 3DXFA 1YO6A 4Q1VA 4ZZ3A 1NQAO 1HFEL 4UVHA 2GHIA 3FHLA 1W5TA 4CQNA 2A86A 1WY7A 4EGFA 1QJ4A 4KKVA 2ODEA 1T8RA 2R87A 5HF9A 3T4XA 4ZJPA 2NZVG 2GRJA 1KIMA 1VKRA 1L7VC 4RENA 4OJKA 2W6NA 5CP8A 1QHYA 2ZSAA 5TEWA 1ZIYA 2NZ8A 1EUDA 2PEZA 1KO1A 3WV5A 1JH9A 3QJGA 3VR4A 1POWA 2YY7A 3O3OB 4TWZA 4S35A 5J4HA 1W1IA 5DM70 2OLKA 1GRCA 2HRRA 1ZOOA 3MBOA 1ILWA 2ZCVA 3L0CA 4YH1A 1F4VA 3FPEA 4KAFA 2VA9A 3I1FA 4KPGA 3IYLW 2F00A 3GCXA 3WAGA 2WSMA 1HI9A 1LFDB 3WHPA 2QVGA 1IEWA 1UPFA 1UOOA 1F17A 2AX3A 1QX4A 2AC4A 2FLWA 1UDXA 2YINC 2CNDA 5TRTA 1XZJA 3ELYA 1XQ1A 2C7PA 3TX6A 2JLVA 1GSAA 2BLNA 1AO3A 2GASA 2P9EA 3TQHA 5ADHA 2QUKA 2PT5A 4O1IA 3RDPA 4WCFB 5CXUA 3PEEA 4Q15A 1XTVA 5EWLA 4AZ3A 3ZV4A 5HJEA 5IF3A 3TSYA 4BU1A 2B83A 3AXTA 2PKCA 3FFWA 4DGQA 2O6LA 3EGIA 1IQPA 3IUBA 1LNZA 1GZSA 2PRZA 3SQMA 5AVTA 4ETWA 1XMSA 1I6LA 1YDGA 2W6PA 5JXGA 2CHEA 4K9SA 1CUJA 1JQ3A 2Y1FA 3L1VA 4RXTA 3W6UA 3GUVA 4PANA 3G13A 4ZZ2A 1JLRA 4MAFA 5J2UF 2CLDX 4DCPA 4B75A 4B3FX 3UWPA 1ATIA 2VYNA 1I0LA 1KHTA 2Y27A 2WD8A 3GQBB 4LWOA 4Q4LA 4FS8A 4S0ZA 1ZMTA 5B7NA 1TF7A 1LXCA 1Z7WA 1E8MA 3KLOA 4HAIA 4C6RA 2JZCA 1QAMA 1IHPA 2K7ZA 2B1IA 1BHO1 1U0BB 1LLCA 1Y1PA 3Q2IA 5LZ7A 2JLXA 2JAWA 2XECA 1USVA 3I1IA 4CQMA 2AN3A 2FUCA 2VJOA 4B32A 1KI3A 3UUFA 4DLSA 2FMIA 4ITUA 2XTAA 3T52A 1AV7A 3O4JA 3WL7A 2O19A 2JZOA 5BN5B 4MVYA 4JI3B 3EJ6A 1BMTA 2QRNA 2VPIA 4BNUA 1NJ6A 1PW5A 3QELA 4ALNA 3B6EA 4BFUA 2X42A 3WE7A 3UICA 4EHDA 5FTJA 3N5CA 4B44A 2NP7A 1EKXA 3OECA 4XYMA 3V4PB 4AY5A 1HNXB 2WG2A 3KOXA 4LOJA 3SM9A 4CMJA 2DG2A 1ZLXA 5AW7A 5JFTA 3CUYA 3U9TA 4A26A 4UTPA 3G1WA 3BK1A 4CV1A 3KQTA 3RRNA 1XAJA 2IGTA 3P9XA 3UOWA 4O33A 4YMVA 5GTDA 2FF5A 4BTEA 3E5HA 3R6LA 3C1OA 1ZKDA 1DC7A 3ZZUA 2VJLA 1GFIA 3DFZA 5CT5A 2GBLA 3IVXA 3AB7A 1K92A 1E0DA 2QRHA 3GNSA 2WIBA 1M3SA 3RGGA 1L1RA 3PXXA 2QLLA 3ZCVA 4J1SA 4XH9B 5CA0F 3ZW9A 3MLBA 5DULA 5HEKA 2HCFA 3K1ZA 2B1JA 1L5LA 4C0HA 3CE9A 3NVDA 5CX1B 2P2YA 3PNYA 3NT4A 3ZY6A 3FUCA 4BO4A 5MN5A 2DAPA 1W0KD 2W2OA 4WE3A 3WWDA 5F3DA 2VXBA 5C1IA 2NUTA 4AJOA 4JA0A 4ARUA 4EQZA 3FMVA 1QIFA 2I2DA 1AA9A 1YH3A 2BGTA 4HKTA 4MRMA 1GZ6A 1PK9A 1GUAA 4I55F 4CCAA 5JI3E 1LPOA 1O58A 4PS0A 3RRJA 2G5CA 3RK0A 3U2QA 5DRYA 1KI1A 3TJMA 2CEKA 3AUSA 3EVEA 2FE1A 3RTDA 1H42A 3AH8A 1YR7A 1HT0A 2IV3A 1Z5OA 4Q9KA 2H1VA 1NT2A 3LF1A 3LLSA 4YONB 4N65A 2CLFB 3NG1A 3KYJB 1B73A 4IIEA 4KCGA 2Q8PA 4RORA 2IBSA 2FFQA 3TW8A 2V54A 4PEVA 5ALTA 5MFZA 1ZM9A 5IRCD 1JAIA 5E6SB 1UH5A 3C2QA 1ZICA 1Y8QA 2MU1A 5EWJB 2JARA 5KNDD 4A8HA 1J0BA 2BD0A 4AQYB 5LQDA 1SQ5A 4G1FA 4EVRA 1IVNA 2BEUB 3HBMA 8AT1A 3NAZA 4WZBA 2PO7A 2XT9A 2OZEA 2GPTA 3NOXA 1G5HA 4YJHB 1LBIA 4F84A 5IUJC 1OFHA 2VJDA 4MR9B 2HHCA 4BVAA 3RBVA 1NW7A 1CUBA 2P2GA 3RLIA 2GK3A 4BLTA 3EXHA 5M5BA 5CEFA 2H2FA 4Y9SA 2I2WA 3D7SA 4RHTA 2WJ6A 3D4BA 3P0FA 4NI5A 3RUPA 2GNOA 2HU8A 4YRQA 1KTVA 2F3TA 4ZT5A 2C0PA 1KKLA 3L92A 4OU4A 1TUBB 1T9DA 1ZESA 2WU1A 3BCSA 1JDNA 2GZHA 4RV4A 4TL8A 3S2EA 8OHMA 3PCRB 4MX8A 1PX0A 1M2JA 3G79A 5L6LB 3I45A 1E2BA 1HGXA 1UFRA 2PZEA 2HQRA 1OLXA 3ABSB 3OFSA 4OA5A 5CAEA 2HW8A 2JBHA 2BPOA 2VDMB 4G07A 2QVBA 4MULA 2H4XA 4IFEA 1FDTA 1QH1A 3E1GA 1Z06A 3MGBA 4WBNF 3HXMA 4Z49A 3WLRA 1VMIA 1DV1A 4YAKA 1LLDA 2F3PA 1O87A 3BFPA 3HLYA 3GLFE 4H1VA 2F9MA 4KIUA 2C4UA 3N6VA 2C57A 1PDVA 4C7VA 1NVTA 3H83A 2CT8A 1HLDA 3ZWKA 2O14A 3IPRA 4PC3A 2PGXA 4LWZA 5REQA 4D46A 1L5QA 3KUKA 4UNNA 1H3EA 4AUKA 4M21A 3KELA 1UK7A 2H52A 3FPBA 1TZ2A 2ZIFA 1GRRA 1NLFA 3HDGA 3KSBC 5AJYA 4ZCLA 3NQ41 1JHXA 1U4NA 4YS6A 3Q8MA 1WB9A 4PGFA 2FG7C 3P2OA 3RODA 1R7RA 3DT6A 4D9IA 1OYOA 2XMZA 3OZVA 3SOZA 4YLEA 5G4KB 3FNQA 3G9UA 3F5FA 3LDAA 4YK7A 3UO8B 3K6JA 2QTMA 2HREA 2P40A 1JX6A 2Q3HA 3A37A 1P8AA 1SPBS 3NJRA 4J3FA 5AKXA 3SFVA 5BQFA 3R3VA 4PIMA 1N4DA 2VQDA 4LRXA 4Q6BA 4DMMA 1Q22A 1B4DA 4I9UA 2VZ0A 4O3MA 4RQTA 3HG7A 4B6QA 2ILTA 4F2GA 4EGCB 3GLIB 4WESA 1V1RA 1CZLA 4BNLA 2F55A 4CTOA 5JAIA 1N3LA 1GUFA 4IWXA 3GLUA 4DS3A 2A0WA 5H1YA 3L7NA 1J07A 4HPWA 4C07A 4PS1A 4E46A 1DOZA 3FNRA 1CEQA 1U5BB 2PRSA 2YVAA 1BGXT 2XNHA 3CB2A 3PEVA 4LZZA 2J33A 3VX4A 3CVYA 1NURA 2CUZA 3FPLA 3ZTYA 1FPMA 4CIVA 1T3SA 4GVPA 5IC5A 2N75A 2B92A 1OB5A 3A04A 4MQMA 3I2YX 4IW3B 1VFNA 4QUAA 1XELA 3DDUA 3PWTA 3Q6NA 4KMOA 4GYKA 4ZAVA 1FP1D 2UYHA 3NORA 2OYRA 3LNCA 2IV7A 4Y6RA 4ZI5A 3C3EA 5K3FA 3PQ5A 4K3UA 4YJDA 3H4MA 4DC1A 3GBPA 3H2JA 1YONA 4Q12A 3JATA 4LSGA 4W5HA 1MC5A 1VKOA 4BMXA 4BPRA 3KB2A 1JE0A 4YO8A 4WK2B 3ZGVA 3B89A 3TQCA 5CITA 3TQFA 2OBNA 2PGDA 3HKBB 5CB4A 4LY9A 4PG8A 2I66A 5JHGB 5LP6F 2DWOA 2GYWA 4DT1A 3R3UA 3MJSA 2IEZA 4R7ZA 4J1NA 2ARKA 2P9ZA 1K0UA 1FUUA 1PUIA 2PLAA 4H0CA 4TRJA 4BO3A 2I6GA 1I2CA 5CVEA 4ZCRA 3E5NA 5GGYA 1QZXA 5D1NA 2RK6A 2QTZA 2HDWA 4Q4JA 2NYAA 1LRJA 1V3UA 4HYEA 1WQ3A 1DI0A 2JI9A 4OAPA 5EVJA 4BMYA 4CEJA 1ZJZA 1NRWA 4EO7A 4JJAA 3CBGA 3OCWA 2H3EA 1T5OA 4FSDA 1NE2A 1Z8FA 2WE8A 1HE3A 1UBEA 1K8XB 2HQSA 1CIPA 5C37A 3ORQA 4A3SA 1DKQA 1FRNA 3MMSA 2Q99A 1V6AA 5FNVB 2ZREA 1IXZA 4JSYA 3ZDEA 3AR9A 4BC1A 1I6MA 2H4FA 5L3SA 1B0AA 4KQKA 5TEVA 2KHZA 2AZ4A 3N8NA 3IBGA 4LECA 3UZUA 4P0TA 4Q4AB 2DRIA 4CTMA 5ALYA 4YIKA 2BONA 3DBLB 3WYFA 3BIFA 1M1YE 3URMA 5JDCA 4ZU3A 2WFLB 2VJMB 1DU4A 4B8YA 2XY4A 4BMSA 1EG7A 4ZCMA 2VA8A 4DMGA 3DR5A 4RHXA 3DAPA 3KS9A 5I4BA 2P2LA 3D02A 4F45A 5B57C 1JS1X 5T8KA 3RM3A 1C3VA 1G60A 4F4JA 1TKRA 2OV1A 3RI3A 4ZJYA 5CFMA 4MLDA 2Z8ZA 1AF7A 1YBAA 3TVYA 4N01A 2F1KA 1NDHA 3DQZA 1QR2A 2VPYA 3WA6A 4QHYA 4XD7A 4FHZA 2J0SA 1UZLA 2FPIB 2OBXA 3OZWA 1XEWY 2O20A 3RRZA 1TM7E 4GVLA 4LK2A 2C9ZA 4X24A 4HB2A 3TOCA 3CN7A 4B4VA 4Z0TA 2WMYA 2M6LA 1CUEA 1U2GA 4JJKA 1KIAA 3URKA 4AB1A 4ECEA 2QGZA 2ISSD 2ZT8A 5F1OA 3DO5A 4BO7A 1JDBC 3CLTC 3BEDA 121PA 3CNQS 2X4LA 3T35A 1KSHA 1CQIB 1PZMA 1ZXXA 2I6TA 3M9LA 4EY6A 4Q3OA 1HUQA 3TL2A 4QG3A 1E2HA 1K8YB 4C88A 3OTHA 1FVOA 2XD4A 3V80A 4OVKA 1EQ2A 2VCHA 2CDNA 1JZTA 4A5OA 2FUEA 1ZINA 2PBFA 4OOFA 1FK8A 4Q3EA 4Y2YA 3ETEA 5AMXA 1U0RA 3D0QA 4NHOA 4BQNA 3GDHA 4JFAA 1GOTA 2AG0A 4RK6A 1A8SA 3QYFA 4KG7A 1Y3AA 1GHTA 2VHZA 1P61B 1I4OA 4QGAA 3KO8A 4IXNA 4OQPA 5A0VA 1P3Y1 4D79A 3DS8A 2OECA 2BOVA 1T8TA 2C78A 3DZGA 2ZPAA 5SY9A 4LXTA 3LWNA 2WJ4A 3JWPA 1NXOA 1YXMA 2O4CA 4JLNA 3T1TA 1PV2A 4KC0A 4J1TA 4G8BA 4NJMB 3EPKA 2AK3A 4FFBA 2HNKA 2NV2B 3O73A 2DBYA 4LRQA 3VR6A 4OGKA 1GGEA 4KWCA 2ZUDA 1E94E 1AK1A 2A4MA 3ZCUA 5A5DA 1Z0AA 2PRKA 3FH0A 2VDVE 1FNMA 1RABA 4X8HA 1RI1A 1XPJA 3AM5A 2QN2A 3KSDO 2EX4A 3KTAB 1G9XA 2A59A 1W8DA 2JJ8A 1AQLA 5A4KA 2IEIA 2GAOA 3MFQA 3MTBA 1XMQB 1T29A 1YR9A 3LK7A 2AFIB 1A4UA 1DJPA 4OMFG 4ZOCA 5I4KA 4W9NA 3K30A 3A0UA 5BQOA 1B16A 4GSLA 4AY4A 3F5DA 1SIBE 4EZBA 1OZ0A 5IYZA 2FDRA 1G5RA 5GVSA 1XU7A 1S9DA 5HFNA 2NTVA 3ESCA 3N1UA 1W4BA 4O59O 1U2ZA 1Z2CA 3MWGA 4F21A 1UXHA 4MW9A 3AILA 2P1DA 2Y1CA 4DLTA 4KZPA 5CURA 1ESCA 4A03A 1P3JA 1NSTA 4YNBA 5EZYF 1CUSA 1K8ZB 1N0VC 1O6BA 1VIVA 3FA2A 3LKBA 4QVKA 3VPXA 4CQLA 1L5RA 4RK4A 5L7TA 5IXSA 5JOQA 3DCNA 3UN1A 4F2HA 4BKMA 2IOYA 4QOJA 1A72A 1AA6A 3WLOA 1I4LD 3RAFC 2P4EA 4BX0A 3JPYA 4OLFA 4MB2A 5G0VA 3ZX4A 2AMFA 4UREA 3ZE8A 4KYTA 4UPDA 4BBAA 5IANA 4F38A 3LBNA 3H4IA 3RUIA 3CLUC 5IAGA 3QBVA 2M98A 3NXKA 3F71A 3DE1X 1DKNA 4OQFA 5LYYA 3IMCA 3SXUA 2WU4A 1GGMA 3L7AA 3SYTA 5C8VA 1N2CE 1Z6AA 4F46A 7REQA 3NVKI 1G6Q1 4CKCB 5L6MB 1KP3A 1XLUA 3HVUA 2JVIA 2YZMA 1TYDE 1HE8B 1RBYA 5MHTA 2QRKA 3ANXA 4EM6A 1ZQ1A 3PVSA 4MW4A 2AUTA 4F86A 2FW0A 5LQKA 5C53B 1ZSNA 2G08A 5JJCA 3N75A 1C7ZA 3F47A 3PXGA 4MI3A 4OQYA 1CV2A 1U6JA 1CJCA 1OLUA 3NC4A 2IZ7A 5AW5A 4GPZA 1Y5RA 2FP4A 3SYMA 2QGNA 5JCOC 4BXOB 3H4VA 3HCPA 3MAJA 3RYHA 2V03A 3TPFA 4EF5A 2FSIA 1H9BA 1D1SA 1RBMA 3FAKA 3OE1A 4Q3BA 5FQOA 5IJXA 5ITWA 2HNAA 5AFSA 1EFHA 1R5OA 3FLBA 5DX8A 1N3BA 4Q3AA 3ILVA 3IQXA 3PA6A 5AKZA 4ENQA 3PLAE 4ESHA 2H8GA 2REBA 3H0EA 5WRFA 5I51A 2VCYA 1XPRA 1K5PA 2WUFA 3U16A 2QPOA 2R48A 1W0JD 1YB6A 5B64A 2ZJ6A 3BCRA 4PGGA 4C7OA 4MVWA 5COAA 4R8LA 4BAGA 2X7HA 1S5PA 3I72A 2HDNB 1RJ9A 4PLPA 4BKOA 2FSSA 5I8PA 4UW9A 4MYUA 1H65A 2HJWA 3EIEA 1AKWA 4OHXA 1WQ1R 4O4IA 4GR5A 5GZ3A 3P4YA 5A06A 2Q3LA 2PA3A 4N7JA 1KDZA 3VRHA 1RXUA 3MTDA 5IC6A 4NARA 3U44A 3STTA 2LP4Y 1FUKA 5LQMA 1KYYA 4UBMA 2BDTA 3KFLA 1G0OA 1YB7A 3Q1KA 4QXMA 5ECGC 2JRLA 3Q2OA 4TKVB 4BNDB 3WJ2A 3VPFA 3DYIA 4M22A 4V1CI 5MGBA 4QYIA 3R74A 1QH9A 3DCYA 5TT0A 2D5AA 1CRZA 4HDSB 4KR9A 3O3CA 1WW3A 2FR8C 4TLBA 3RTAA 1BWPA 2HV9A 2VOJA 3AHJA 3B70A 3EE6A 3N39C 5K0CA 1X3LA 1S96A 1UPUA 1T9HA 3EA4A 3INNA 2JK1A 2CZCA 2OCIA 4TTAA 4WAUA 1C5KA 1VHDA 3IEPA 4CGYA 1MW8X 4HTFB 4PX5A 9LDBA 5F7XA 1RZRD 1VL8A 2CKDA 4LCEA 5H0IA 1IPFA 1RI4A 1ORDA 2XH8A 5SZIA 1QAQA 4WA7A 5HS6A 3CRRA 2G8LA 5FLYA 5B4VA 3WIUA 2QGFA 2OO5A 3OQIA 1NTOA 2XMQA 3G88A 4CLRA 1SOAA 2J3KA 1XE3A 4RE6A 1T9CA 3WVNA 3G59A 2DLNA 2BGGA 4PPQA 1QFZA 1XYVA 2V6BA 3PR3A 3EF0A 3QVLA 2YWEA 3PXUA 2QRQA 3BB3A 4E4RA 1AB6A 3W8EA 4QEZA 1SBQA 3EISA 1WSDA 2HAEA 4GE3A 5EIAA 3NM5A 1IIRA 3DV0B 4L5YA 4JENA 1H8ED 1KZ9A 3FOBA 3JQGA 2ZI9A 4G5RA 4HWRA 2XDWA 3B9RA 1KY5A 1V5EA 2IYEA 4N3GA 4B34A 4RF5A 2UYQA 3DZCA 4LWQA 3SIRA 2ISQA 3DULA 1BJKA 1OC4A 4G65A 2ASEA 2N1MA 3MJTA 1DTSA 3O38A 4MROA 4TWBA 1JEYB 2YN4A 2FRDA 2EP8A 4J75A 1U7XA 1DEAA 3R0QA 3RTGA 1FYDA 4YDQA 5LA6F 1V95A 3E22A 5B1HA 1SCUB 5F9FA 2PK3A 3KAJA 3TR0A 2IXEA 3DFKA 3NAQA 1IN5A 2GHQA 5AHXA 3FCSB 3KQNA 4IM7A 2AW3A 1AKUA 2WQ7A 2QMHA 4QYMA 1P60A 2DY0A 5E38A 5A3VA 3SYRA 1ZA1A 2KLHA 4L5IA 3SGLA 3W7BA 4AUNA 3JQFC 4MVJP 1PJRA 1IM5A 1RQ7A 2O2HA 4PCUA 1TZKA 2C31A 5HWSA 2VDQB 2MYTA 1PO7A 4WOJA 1SCAA 4DR6B 1NXQA 1SQ0A 2D2IA 3CXUA 2J09A 1L9KA 1L7QA 2FPGB 4PICA 4X0EA 5DI3B 1NIPA 5BWLA 4C2BA 3LUKA 3OD5A 2BW0A 1D0VA 1E3LA 1PV1A 1ZVJA 3KPYA 3L0ZA 2BGKA 4URUR 1YS7A 4G4SP 3R7WB 3P52A 4DBLE 1NJSA 4CFYA 3WX0A 4O4JB 4YRLA 5ESWA 2CW5A 2GCOB 4DMFA 4U2EA 4YGXB 1DIOB 1PWEA 4C89A 4RD1A 3KOUA 5TV2A 4EKGA 4RQBA 4I1UA 1H2AS 4LHVA 2CB9A 2ZPUA 1WSWA 3NRCA 1H23A 5HE9A 3M4ZA 4J0CA 4E5PA 3S1LA 3MEQA 3U40A 4HXEB 3SY8A 4BIMA 1M5UA 2XRFA 3MMNA 4NIMA 3TIXB 1WOYA 2J31A 2GCPA 3HE3A 4X6LA 4D0LB 1TM2A 2LR0A 2NO6A 2A5LA 2OAQ1 3GGJA 4PLTA 4WKOA 5A6SA 4ND4A 4EENA 4IDFA 2JFWA 4MARA 1OGJA 2ZUUA 5GONF 3HI6A 3TQQA 4AURA 5AIBA 5LQJA 2P41A 3R9XA 3VNSA 3OTQA 2QR2A 3SEAA 3RAJA 3C1UA 3TNFA 1KL7A 1PVVA 3RAGA 1RWQA 3CLSC 4RPJA 4WBSA 4MJ3A 1TIKA 4BKUA 2DY1A 2V45A 3DTYA 4KP7A 4JCOA 2W9XA 4QBKA 1JIUA 1GP2A 2CVOA 4WPGA 4XB2A 3ORFA 3PZRA 4CM1A 1NBEA 3WK8A 4GSYA 2OCBA 3V55A 4KKXB 3GG9A 3OLXA 4HVTA 4QPJC 3TRHA 2ZCJA 5C31A 4RKRA 3EIHA 1UT5A 3TCXB 5HR5A 5G41A 1HZJA 1JKJB 3N2IA 4B48A 5BW5A 4IOKA 3UKDA 4HC4A 4O8CA 5EAIA 1W7AA 3AB3A 4AN4A 3I2HA 1SUDA 2DUJA 2VK8A 1KEZA 3THRA 1US8B 3PSAA 3V34A 3GJ6A 5D5PA 2HCBA 3N74A 1ZH2A 2C3OA 5EJGA 3I73A 1M8KA 2PS3A 3O83A 3HDQA 2OQRA 4MR8B 1LDYA 1R18A 2CMGA 1MQ9A 4AS3A 1OFTA 4ESEA 2ZYHA 4BJ1A 5F21A 3VKUA 3ZI4A 4CETA 1THGA 1UKAA 2IU0A 4BX3A 1RD4A 4QDXA 3GH3A 5AKKA 1UBUS 1CE8A 1R66A 2W6IA 4HATA 3SQLA 3TIVA 1DBWA 1R8YA 2XZTA 3ZE0B 4G23A 2HF2A 4I6GA 4N0EA 4MH0R 2J3MA 3SIXA 4CYMA 1H2ZA 1TO6A 1JQEA 3Q7SA 4WZBE 4YHBA 3VZPA 2CXQA 2XT0A 3BTOA 4V0OA 1O97C 4GPIB 5ALIA 4EAAA 1UKYA 2NZXA 5JZSA 4U2BA 2XWBF 4HNRA 2RC5A 1N6KA 1IXYA 1AURA 4NV0A 3NHMA 2CXHA 1HKHA 4LNAA 2P6PA 2YV2A 4KR3A 3OIUA 3OKAA 3S7TA 1V2GA 4RABA 3SX4A 2I9PA 3NDIA 4K7JA 3GLKA 4XI9A 4MHSA 4LFAB 1PKXA 4R8KA 4BKRA 3K4PA 2NZWA 4CIBA 5K8UA 3IBSA 2O2SA 3RVPA 4NMHA 3MS7A 2GJ8A 2H17A 3RRBA 13PKA 1OU4A 3DAOA 1CS4C 1P9RA 3CZPA 3N5KA 1O89A 2XVMA 3FPSA 1YRHA 3SYLA 3B82A 5CCDA 1GZ7A 4OHKA 2CDRA 5B4UA 4C4OA 1GJRA 2BFDB 3OZEA 1CX9B 1RHUA 1YBMA 4JLVA 4E5VA 3A3KA 1A9QA 1VC2A 2R44A 2ZPTX 3RUEA 5K05A 1YK1A 4TV8B 1JWLA 1P1HA 3UM9A 3EW9A 4DJDC 2FKNA 3DLPX 3DMYA 1JWBB 5IVDA 1R27A 3VDNB 4KQ1A 1A5SB 2Z57A 4RVCA 5HG0A 3DFFA 3UWSA 5U4QA 2ATIA 5BOSB 1I7DA 5G1OA 1UBGA 4GKJB 4FP9A 2GJ4A 2WYVA 3OCYA 3EX7C 4I9GA 3VR6H 3ZR4B 4Y9TA 2A14A 1X1TA 1HDEA 3PKJA 1CIVA 3FOEC 3TRIA 1ZMOA 2OMKA 3F90A 3GA7A 3VZBA 1X0XA 4LDJA 3H8JA 4M53A 1M8JA 1X7DA 4BFSA 3CNBA 1XPOA 4ZMBA 1K86A 4E09A 4W6ZA 3A6ZA 2ET6A 1EP1B 2OWDA 5KAPA 3MNFA 4Z3KA 2NNWB 3BICA 4Q82A 3MGCA 4CCSA 3CM0A 1XNGA 3P8ZA 1P81A 2QU8A 1MT0A 5JSKA 3DVSX 5KJ6A 3BH6A 1G20B 3GLHB 2DERA 4R5HA 3CN9A 1FDUA 3SLGA 4E33A 3OEEA 1LV7A 2BFMA 1HX7A 4YMSA 1PD0A 4B45A 1NJ1A 4E21A 1KJ8A 3H99A 3W7VA 4NXNB 2F3UA 2JVJA 4YRBA 5T7BA 3AR5A 4G1MB 3BMCA 4KXUA 1SURA 2VJQA 3T61A 1SVWA 1E1RD 2OD2A 1G3IA 4S2UA 3H18A 4Q93A 2I1WA 3QHQA 3RSOA 2JGIA 3JQBC 1JHPA 1U9JA 3MTAA 3U3XA 1YRBA 3SSNA 1OBFO 1V96A 4P98A 4EPYA 4FYMA 4TN5A 1GTSA 1NT4A 2BJHA 4L8FA 1QU3A 2F43B 3TZCA 1ODIA 3UFXB 2OLEA 2VDLB 3HCNA 4ID3A 1TJNA 4JLJA 4W1RA 2ZUWA 3GJXC 1W94A 3TS1A 4RY8A 2Y0PA 2JLBA 1XALA 3Q5GA 3F1LA 4Y8VA 1OYWA 3BXHA 3LT1A 4YCLA 1JHOA 5L4LA 2ODQA 4DC9A 1GTRA 1Z0DA 3GDOA 1NVUQ 1BHJA 4TL7A 4ATNA 1E0JA 3QYPA 3DE3X 1ZGBA 4QRDA 4BMVA 2BWJA 4KAXA 2Y68A 1JR6A 4YAUA 1JNYA 4XGRA 5GIPE 5KOYA 1RWXA 3HV2A 4IOJA 2VLIA 3A32A 1GQQA 1QVWA 5DCUA 4C7JA 3G1UA 4GLOA 2F62A 3R1IA 1C7JA 1Q1GA 5BRAA 4YAFA 2IKSA 1GYRA 3JWGA 3ISVA 4JQOA 2WSSA 5MN4A 1L8LA 1S2MA 3PC2A 2J8ZA 3CB4A 2N42A 3QXJA 1JA9A 4Q18A 3CZQA 1G8JA 1X3SA 3G2IA 4JKYA 1MPXA 2NACA 3FBGA 5GP1A 2PBLA 3O47A 3ZJ4A 1E62A 1NUPA 5K0JA 1H6BA 4GR4A 4MP8A 4YRMA 4KFSA 1SRRA 2FWRA 4R6WA 3P0IA 4RZQA 4DLBA 4WXHA 5JS8A 4BP8A 2QAJA 3F3YA 3THWB 3AM1A 1WPQA 2AHRA 5ALDA 3WXMA 1FVXA 1CUWA 3EXEB 4TLEA 1RYHA 2RHHA 1HDGO 2V0NA 4C0LA 5AI5A 4MQ4A 5KDLA 2D8MA 3LCRA 4AY3A 1Q92A 4LBYA 2A9QA 3TL3A 4YRIA 4K9KA 1GN9A 3AESA 4PFSA 4Q3KA 5ICMA 3UXMA 4FM9A 5F2OA 2ZEJA 4C05A 2YQ5A 1S4MA 4JXJA 1JG6A 2PVSA 4MQ6A 3T12A 3AKEA 3KPWA 5ICCA 3QKRA 5DGTA 1MA0A 1DHTA 4MPPA 2ZYWX 4WN9B 1G8GA 3F3MA 3PFNA 4JNKA 4LISA 3I09A 5AQ1A 2FAXA 2O8DA 1WP9A 2OO3A 3ONDA 4YXWD 3O95A 1JBKA 4OU5A 2P9GA 3DJFA 5J2UB 4I81A 5E95A 3N53A 2WHXA 5LJIA 5G4LA 3PCXA 1UBHS 1VE7A 1YIAA 1BXRA 3HYRA 4KIGA 1SHKA 4WNIA 4X9XA 4XGQA 5ERXA 3T3IA 4DPMA 1PQWA 1PNVA 1T2VA 2IF0A 1W47A 3OCUA 2O2DA 4EYKA 2A9RA 4LF4B 3SVLA 2K2QB 3L6EA 4G2NA 3ANNA 4JSTA 4YAJA 2GPYA 2VDKB 1TPYA 2BFWA 2Y0DA 1FBTA 1YCDA 2MSCB 4HAZA 4UUNA 5EYPA 4TLLB 5ALSA 3IDZA 3IIJA 1KMHA 5ICSA 5L7YA 2XUQA 2H5LA 4IF4A 5F12A 1KMNA 4TVOA 1CDEA 3RUDA 1DC6A 1RWWA 1ULHA 3KQQA 4N39A 4O0LA 4RHEA 2P77A 4DILA 3OVMA 1USIA 1ZU5A 2O2CA 3BOSA 3DL4A 2YZKA 4TSKA 4L3OA 4NULA 1AUPA 1DDIA 2AXPA 2FZ5A 5AVQA 1NQTA 2CFRA 3JYHA 4Y9RA 2WD7B 4TYMA 3NTLA 5BWOA 1SHLA 2ZB2A 4UE3S 1G5FA 4JJ4A 1G6KA 1TKBA 1S3GA 2OB2A 4KMSA 4L5BA 2YX1A 1H22A 1P0CA 1ZK1A 3BMQA 4R7TA 3WOHA 5C52B 1ABEA 5H7XA 2A5FA 2GS9A 3TI7A 1J0CA 1Z47A 3VZQA 2AN1A 2C94A 3CRVA 3VVMA 2XZOA 3OFKA 4S1NA 2C99A 3AKZA 4G67A 2E4VA 5CA0B 1D0IA 5IKXA 1G6HA 1L6RA 1X7WB 1YZVA 2ZRHA 2W4MA 1BDBA 4P5EA 1ECCA 1W5EA 1NVFA 4UHDA 4J0JA 3ZCTA 1ML4A 2P62A 3O94A 2JI4A 1VPWA 2DQSA 3KG2A 4OI2A 1PT7A 4GW3A 4FXPA 3WRXA 2IS6A 1BEUB 5CDFA 4R3WA 1BN7A 1IJKA 4N6NA 3G5MA 5ITZA 3CF6R 1W2WB 4I55B 1EA7A 3MJCA 3HUEA 4OIFA 1RS0A 2NUAA 2VTEA 2JVKA 3H9JA 4H60A 5JHHB 3HMQA 2NXWA 4P80A 4P9NA 4UUBA 1AXEA 1QWOA 2ZYIA 3B6IA 3STXA 1X6VA 2CC2A 4PSAA 3ZWCA 4BMCA 1A7KA 3DE5X 3FBTA 1R4AA 4K2AA 1PJ3A 2PX3A 4K9QA 1Z7EA 1EK1A 4PGHA 4JT4A 1PGPA 4YP5A 3ZHUA 1PVDA 1SU4A 4GLJA 2QL6A 1S2OA 1Y89A 1RWPA 2XJ9A 5H70A 1GTG1 1YQ9A 2GH1A 4HEA6 2R8BA 3AKDA 4PCAA 4QREA 4XR4A 3CVWA 3IEXA 4DNQA 4BO2A 5CYGA 1H2HA 2G70A 1EK5A 1U2DA 3DOUA 4IHJF 3KT3A 4RQUA 4KK3A 5IBQA 1E3IA 2JLWA 1EA5A 1BH6A 1T4GA 2JBAB 4GX2A 3HYNA 4I0WB 5GJBA 2E21A 2FPPA 3MTIA 1PBNA 1XZMA 1MV8A 1FFDA 3NTRA 3OCCA 3OOEA 4HEA1 4HZIA 3RJTA 3A25A 3X1JA 2DR3A 2ZQZA 4GPAA 1JSZA 2ZAGA 3PPVA 4KLNA 1L5SA 3CLRD 3QFRA 1G21A 5HGJA 1VJGA 2HV8A 3DFUA 1HE4A 3KPJA 2R2GA 4L50A 2I2AA 4MV9A 4BCBA 1C1YA 4O2BA 5F7JA 1R4MA 4CMIB 1BHQ1 3WIBA 2B4AA 4X65B 2GEDA 1H93A 2W2PA 4PG4A 2HGSA 5KVAA 3NDJA 3I9V6 4JP1A 5AUOB 3OJEA 1ZRMA 2X7XA 4MMXB 6YASA 3JQ8B 2OPHA 2GT1A 3C8ZA 5F4ZA 10MHA 4D99A 2CN1A 4AWBA 4B43A 4LJ6A 1Z4PX 4CKWA 3J7TA 1M33A 1EVIA 3E61A 1GLVA 4WBNB 2B1RA 5A7GA 2OHVA 4UARA 4NMMA 3GZTB 3ZG6A 5LM3A 5LZ4A 1HMYA 1HNNA 2B25A 2OY0A 2ZI5A 4IO0A 4HAVA 4IQ0A 4WX2B 3OT5A 4E5MA 1Y3DE 2W2KB 3D6VA 1JIXA 1TA4A 3X3HA 3HFGA 2M9MA 1VHWA 3COWA 5BUQA 1C1XA 4FSHA 3IOCA 1AQJA 3JAKB 1KWKA 1CY7A 4W5TA 5DVZA 4DCGA 2FPMA 4RU1A 1T15A 4F8JA 1QFMA 2VUSA 1H1DA 5LNK6 2Q2OA 4JHXA 2ZIZA 3FUUA 4IDOA 2VBGA 4ZVOA 1XZQA 2XNCA 2I3GA 5AKLA 4QLBA 4PHFA 4MUFA 1BE6A 1EJ6A 4PLVA 2GVDC 4IXTA 5F98A 3U4AA 1Z0SA 2WJZB 3ZNOA 2YDXA 1BG6A 2RGGA 4Y2PA 2EIXA 5BYBA 2I22A 5ICGA 3QLTA 2PJRA 2P90A 2DT5A 1BKDR 5LVAA 4OD0A 1UFOA 2YC4C 1XCOA 1WDLA 4A8JC 5F64A 2QQ5A 3IKVA 3IJPA 3DTVB 4DLWA 2IYQA 5DLDA 1QLWA 1SXGA 3EDMA 4CL8A 2OORA 4LRYA 5A03A 1P33A 5BNIA 1S2GA 1KERA 2Z04A 5BRJA 4R8VA 2NO0A 1FQJA 1NOKA 3HXTA 3L07A 4KDEA 5CIWA 3VXKA 3DAGA 4GXRA 4FYPA 4WMLA 3PL1A 4EBBA 2G04A 1ZJ6A 3PFHA 4HDMA 4TV9A 4QWWA 1EI9A 1T4BA 1KC1A 2PGNA 1F20A 3I3OA 1M7GA 2NZYA 1SC3A 3C0KA 2MYPA 3IIMA 4QDUA 1HEYA 1A9XA 1PJZA 2R6HA 1FY2A 5JZOA 2CKMA 3AW8A 2FOXA 4G56A 3KQVA 4LJ5A 5CCXA 2JA2A 1VG8A 4U1RA 1E3MA 5EIWA 3R5FA 3FVWA 3CH5A 3CZCA