4JUIA

Crystal structure of tannase from from lactobacillus plantarum
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
470
structure length
470
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTAAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords Tannase
total genus 160
structure length 470
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4juiA00
5D3KA 3WZMA 1MAAA 2HU7A 4UHCA 4IH1A 5SYMA 5DLPA 5ESRA 4J0DA 4Q3LA 2JGEA 4MEBA 1IUPA 2WHQA 3QYJA 3WL5A 4BTVA 2XMGA 5FP0A 5AKEA 3C6XA 3DCNA 4EY6A 5LP1A 4FWBA 2HIHA 5LKRA 4HVTA 5D7BA 3FNBA 4TVKA 4HRXA 1TRHA 5DTIA 2BFNA 1LLFA 5JASA 5CH5A 3I1IA 1WB4A 5CT6A 2JGJA 1KU6A 3QMMA 1AC5A 2JBWA 2V97A 5JZBA 1VE7A 5ALYA 1EA5A 4H0CA 2DSNA 2HA4A 3D2CA 5I8PA 3VISA 4E15A 5AIBA 1EDDA 1CUEA 2AJBA 2QVBA 5E4JA 4RGYA 1XZHA 1SCIA 3MUNA 1RP1A 2RHWA 5LZ4A 4F60A 2RAUA 1LPPA 4C88A 3DYIA 5ALIA 1THTA 4Q34A 3R3XA 3W9BA 2H7YA 5A71A 3G9XA 2YASA 3BL8A 4BC0A 3GELA 4RE5A 1QZ3A 4X91A 4J03A 1CUSA 2WM2A 3EQ8A 4N5IX 2P8SA 5ALMA 2BUBA 5AOAA 1QFMA 5JARA 1CUUA 3A70A 4OSEA 1CLEA 3LP5A 4CI9A 2JF0A 1LBSA 5AOBA 3OPMA 1Y7IA 3G0GA 4JUIA 1CUGA 5FLKA 2H7XA 3C5WP 5FXMA 5AJHA 4NVRA 1E8DA 1EDEA 4ZI5A 3L1HA 2XUAA 5DYYA 3DD5A 3STYA 3QITA 2QR5A 1R1DA 3RK4A 1XZMA 1HPLA 1QGED 4CCWA 2O2IA 3VXKA 1YAJA 1GZ7A 4HS9A 2WIGA 4ZWNA 3W05A 4J0JA 5HQ3A 4CFSA 3HZOA 3T4UA 4OB8A 5CMLA 3DDUA 2VTVA 2B4KA 3DLTA 5D6OA 2BKLA 4G8DA 1AGYA 2WTMA 1N1MA 2XT0A 1ZJ4A 2IITA 4X90A 1G5FA 2X8BA 2Z5GA 3LCRA 1QTRA 1R9MA 1ZIYA 3I1YA 2WFLA 1XROA 4DYHA 4PW0A 2Y6UA 4U2GA 3QPAA 4G5XA 2XLBA 3FVRA 4BTLA 3KOOA 2WUGA 3AUKA 3O9VA 4AZ3A 5JAUA 1AURA 5JZSA 5AI0A 2B61A 1XQWA 3BIXA 3AZPA 4BDSA 2HFKA 3H2GA 4C01A 1I6WA 2VT6A 4DSZA 5EIEA 1CUIA 3FYUC 1R4ZA 3H04A 2VAVA 1UOPA 3C43A 2OAGA 2XB6A 1CIJA 1MO2A 2EDAA 1J2EA 3GA7A 4HXGA 5E4YA 3I2FA 3LIPA 2HA3A 4EY5A 4Y2XA 1LPBB 2CZQA 4B85A 3F96A 5DWDA 3CN7A 3WYNA 4BRSA 4BP9A 4W1SA 1K5PA 4X6YA 2Q0XA 3IURA 4XVCA 4HXFB 5JADA 5AI6A 1VJ5A 1B6GA 3ICWA 1QO7A 2ZYRA 4K6GA 4XIIA 1WHTA 3G0DA 1WB6A 2VF2A 1OCEA 2GYVA 4EBBA 3KWJA 4B81A 2G4LA 3WK7A 1YASA 1SC9A 5EIAA 1UXOA 2QMQA 2QTBA 1SOMA 5EFZA 4IH9A 3F8SA 3HACA 5LYYA 4BZWA 5HF6A 2PPLA 3DL4A 5CXXA 1ZGCA 4GWLA 5CXUA 3G7NA 1Q0RA 4BP8A 2HHAA 1SFRA 2VJCA 4C87A 3KD2A 3C45A 3O4IA 1AZWA 1YCDA 2XUOA 3NUZA 1ZJ5A 2JGLA 1CUYA 1BRTA 1CVLA 2DCMA 5EHXA 3G8YA 5AKYA 3C70A 3IUMA 2G5PA 1Y7HA 2ZYIA 3KXPA 3L1IA 4FHZA 3W06A 4BE9A 5JIBA 3A2MA 5AM0A 3WK6A 1YSCA 4DNQA 3R3WA 1BROA 3QVMA 5DJ5A 3BIWA 1HDEA 3AIKA 1WB5A 2CJPA 4W1QA 3GBSA 1LPOA 5AHXA 2X76A 2OCGA 2WHPB 1ZD5A 2GBIA 3FSGA 5AM4A 5C8ZA 4C4XA 3N0TA 4G9GA 3VJLA 3VVMA 5HQ3B 5LZ7A 3ANSA 4BAUA 2VATA 1GPLA 5T4HA 3ZLVA 4QLAA 1R9NA 1WOMA 2GZSA 1CUHA 5C81A 5DNUA 1QIEA 4X00A 1UT6A 1CQWA 5AIAA 2GYWA 4QWMA 1MNQA 3WWEA 1BEZA 4KAFA 1G42A 5JAOA 4HZGA 4DMCA 3R3UA 3I2HA 4H7IA 3V1LA 5CW2A 1LZLA 2J4FA 3ZLTA 3DS8A 4KR0A 1EHYA 5IKXA 2WIFA 3AJAA 4FFVA 3W9UA 4J0IA 2ZJ7A 3QM1A 2XI4A 2HA6A 2I78A 2GYUA 1EXWA 1CQZA 2HM7A 3WA6A 5HKBA 5EHQA 2QOEA 4B80A 3H2JA 4Y7DA 2ONCA 1XLVA 5DNWA 2PU5A 4HTAA 3AIOA 3VJMA 1XZKA 4DMFA 3HXKA 1JJIA 1UKCA 3WKBA 1MX9A 1DX4A 4BVLA 2OG1A 3O95A 2BUCA 4OU5A 3WJ2A 4DMHA 3WWPA 3PE6A 2WUDA 4DIUA 3UUEA 4PV7A 3PICA 3M82A 3H2IA 4UHEA 3CCCA 1W76A 1XRRA 4CG1A 4E14A 3UUFA 3WL7A 2J3QA 2WFMA 1J06A 3WK9A 3H18A 2D0DA 1IUNA 2O7RA 3G9ZA 4Y9SA 2XMDA 2ECFA 3WIOA 1Q84A 2AXEA 2HRQA 2RGUA 5HF5A 5JANA 5ALTA 1CV2A 2WG0A 1DT5A 1YS1X 4KE8A 1E66A 4BATA 3I2GA 2C4HA 1QLWA 5LZ2A 3DJYA 2O2GA 3QPCA 3L1JA 3O4JA 3SK0A 3DEAA 3ESBA 3N2ZB 2WJ6A 3Q0TA 5AM3A 4KYVA 3STTA 2WHPA 2GBGA 3PFCA 3WK4A 1SCKA 4E46A 4IO0A 5KREA 4G1FA 4PO3X 2OCIA 4A16A 3H2HA 2CKMA 2QUBA 3I28A 2W6CX 4BRZA 5ALSA 2RONA 4J0GA 3PUIA 1MN6A 4U2CA 2FJ0A 3DOHA 2HU8A 2XUKA 5BWCA 4ARBA 3R0VA 3D7RA 4HXEB 3SWWA 2XQKA 3B3QA 3EIOA 1NU8A 1UZAA 1BE0A 2WTNA 2H9YA 1BEEA 5HKAA 5ALRA 4RE6A 1UKAA 1DQYA 1DWOA 1F0NA 4B9EA 1A88A 1FFEA 4KJXA 4LHEA 3X3HA 1IUOA 3STXA 1KEZA 1UOOA 2Y1KA 4FLMA 1F0PA 4B83A 2XLCA 3H1AA 2ES4A 4X93A 4BAZA 1PFQA 4UBOA 1YA8A 2ZYSA 1XZFA 1RWQA 2ACKA 4FLEA 4JNCA 2RI6A 5T4BA 1UFOA 2BCEA 2V96A 1U8EA 3C6BA 2XUGA 2QJRA 1VXRA 2C7BA 3FVTA 4GBGA 1LPSA 1JJFA 5LZ9A 1GQRA 1EI9A 2C5FA 5ALZA 2DHCA 3IUQA 4CG2A 5AKZA 2OCLA 5DYWA 3E1GA 2H1IA 1U4NA 2DQYA 2ZJFA 5HFNA 3FLBA 3RM3A 4AMZA 3VKFA 5A7FA 3BF7A 1DWPA 4MYSA 1Z68A 3I6YA 2VJBA 4H7KA 4YPVA 1ACLA 1CUXA 4WFJA 5CT8A 3AINA 5ALEA 2OAEA 2XUJA 4M0EA 1LBTA 4NZZA 1XKTA 4BCCA 1QE3A 4NMWA 4U2DA 3FLAA 1CUWA 4AZ0A 4KE7A 3D59A 5ALFA 4B0OA 1LZKA 2DHEA 1E3QA 5FRDA 4LYEA 4B0PA 1ODSA 2QM0A 4MWSA 4X95A 1L7QA 1QIIA 1K63A 2HL6A 2PUJA 2B9VA 2WJ3A 2NW6A 1VA5A 4J0CA 4PSUA 3K2IA 1IMJA 2JGKA 5IVIA 4HAIA 1VOTA 1HKHA 1ORVA 5HK8A 1GKKA 3E4DA 4GEGA 2WFLB 2Y6VA 2G5TA 3PFBA 1WPXA 4H35A 4LXHA 4QWWA 4N8DA 3V9AA 4I3FA 4ZRDA 3V1MA 3ESDA 2Y2UA 2WUEA 5AI9A 3ZI7A 5JAPA 3G02A 1P0IA 1NX9A 3BF8A 2PU7A 4X97A 4DNPA 2OGTA 4QE3A 2WLSA 3G0IA 4ITVA 1ZOIA 5ALKA 5CH8A 4X94A 3HSSA 4KAJA 1EDBA 3WKAA 4C89A 4EHBA 3A2NA 2OQVA 1TQHA 1LNSA 1R50A 4WY5A 5C8XA 3A6ZA 4UBMA 2QUAA 3EQ7A 3FOBA 4X7BA 4KACA 1GPKA 4GLBA 1EVEA 4AB1A 3H19A 5E2IA 5FOQA 1E8NA 4DGQA 5ALUA 2XQIA 3HI4A 2PSHA 5SYNA 3WZLA 3D5EA 5I7UA 2RHTA 2XE4A 1LPNA 1VZ3A 4Y2YA 1CUVA 5AH0A 3ZWQA 3R41A 1UKBA 4OD0A 4QDUA 4F21A 2WSLA 5EI5A 4G4IA 2XUHA 1XLWA 4EY7A 4P08A 2Z3WA 3M83A 3WIBA 4FKBA 3CN9A 3R3VA 5AKIA 1TKRA 4X6UA 5ALDA 5HF8A 4UFNA 3H0CA 1P0PA 4PSCA 3LLCA 1UWCA 2RIPA 4LXGA 1VKHA 3JW8A 2I03A 7YASA 3ICVA 4BBZA 1YR2A 1XZLA 2R8BA 2PSDA 2OQIA 4ZV7A 2WU4A 1VE6A 1AKNA 4OCZA 4P93A 3DOIA 3QPDA 4QZVA 4TPKA 1XQYA 5J3JA 1BN6A 2XUIA 1J1IA 1WPRA 1UK7A 1MTZA 1JU3A 2AJLI 1N8SA 1XRLA 1K8QA 5C7YA 3R3ZA 5LZ8A 4GHWA 5LIPA 2VJDA 4W63A 3G9TA 4DSAA 1QIJA 4N8SA 2XMSA 3DNMA 3DQZA 1QIGA 3BJMA 1EK1A 1FFDA 3GROA 2JGMA 4X92A 1Q0ZA 3FWHA 5CH3A 4Y2SA 4PF1A 3E0XA 3H2KA 1S8OA 5HK9A 2BGNA 5K3DA 4RNCA 4ROTA 4UHFA 1Y37A 1LPAB 3ZPXA 1BCRA 3M81A 4LXIA 1PV1A 3WI7A 5JD6A 4MEAA 4X85A 1UK8A 3WYDA 2BGRA 2I3ZA 1N5MA 1DU4A 2QKYA 4MWTA 1UK6A 2VQ6A 4GW3A 4UHDA 1JJBA 2ZVDA 5HZGA 1HL7A 3ZV7A 3U0VA 1K4YA 5ALNA 3V48A 1VA4A 2PSFA 4QDTA 3H1BA 3STUA 2C0PA 1P0QA 3AFIA 5CT9A 5D3ZA 4D9JA 2XMZA 4H7DA 1EINA 5BWBA 2FJPA 3IB3A 1E8MA 1ZD3A 3I2JA 2Z8ZA 1QOZA 2O2HA 3CCBA 2VT7A 4CG3A 4M0FA 3WWDA 1QJ4A 3I2IA 3EBLA 4IQ4A 1XRMA 3ESCA 1J07A 4UUQA 1VXOA 4BVKA 5KWJA 2VSQA 4BE4A 4K6KA 2PL5A 1XQVA 3WKEA 3G9UA 4DLNA 2ACEA 5AI8A 1G4HA 3IUNA 3HLKA 5AI4A 3T52A 5ALVA 3OC0A 4X71A 3WKCA 4B82A 4UHBA 1XZIA 1VLQA 2ROQA 1TAHA 4Q1VA 3OTQA 4K2AA 2Z3ZA 1H2YA 1HQDA 3C6ZA 4QLOA 2QZPA 3KSRA 3DKKA 2QXTA 2ZYHA 4Y2PA 1PJAA 3BXPA 4JEIA 1DINA 1JMKC 4U2BA 2UZ0A 4EY8A 3GZJA 5IVKA 1CPYA 1CUJA 4FBMA 5K3FB 1K6EA 3HYSA 1GT6A 2J3DA 4Y2UA 2Z8XA 5AKHA 1ODTC 4C6HA 3I6MA 4JYPA 2DFPA 1CUCA 4DNOA 1QIMA 2B20A 5ALPA 1HLGA 4WCVA 2E3JA 1DTEA 5AKKA 4P9NA 1A8QA 3O4GA 4I4CA 4GDMA 1CR6A 2WIJA 1UK9A 3VDXA 1O6FA 1BCSA 1A8UA 1F6WA 5A7GA 3Q8WA 3FAKA 2PVSA 4YK7A 1H2WA 4ZREA 5HCUA 3RARA 4W1RA 2G63A 3FYUB 3QMVA 3DKRA 1JKMA 4FNGA 4WFKA 4AN1A 5ALGA 1DQZA 3S8YA 4S0XA 2WQZA 4ZV9A 5ISMA 1CUAA 4MQMA 3S2ZA 3F97A 1CUFA 4DTCA 1GXSA 4UHHA 1XQXA 4FDMA 1QFSA 5AKGA 5AM5A 4GECA 5ALJA 3F9CA 4FOLA 5JATA 1GPNA 5ALLA 2FX5A 2DR0A 3M3DA 1FFAA 1CEXA 2WFZA 5CURA 2CBGA 3W04A 5E4TA 3R3YA 5CT5A 4DM7A 1B41A 1JU4A 3W2TA 2XQJA 1UOQA 5AKLA 5AKXA 1MPXA 3VJKA 1ZD2P 2V9ZA 5IVDA 1EX9A 2WILA 4AO6A 3IUJA 3ILSA 2WJ4A 1CUBA 3OM8A 2CUTA 1EB9A 2ZSHA 2YXPX 4K5QA 5IH7A 3C8DA 2JGIA 1ISPA 4PSDA 2OCKA 2YYSA 3AILA 5AOCA 2IX9A 5K3FA 4UBIA 4EB0A 1R3DA 4L72A 4EUSA 5AM2A 4LKOA 5JD4A 1ZD4A 2HDWA 3RKSA 1JMYA 1THGA 5CT4A 5AI5A 2HADA 4EY4A 3FSGD 5FPQA 1LGYA 4FNMA 3PF8A 4AX4A 1OXMA 4Q82A 2CEKA 3O0DA 3P2MA 1IZ7A 1TCBA 2ORYA 2DQZA 4QDZA 3YASA 2HFJA 3MVEA 3C87A 4BVJA 3G0CA 5ALXA 3OURA 4H7JA 4J0KA 4BZZA 4EA6A 3F98A 5AM1A 1XZCA 1X2BA 4WDRA 5FPPA 3UMJA 4X3CA 4J0HA 3WK5A 5AP9A 4G9EA 5HF9A 3RLIA 1E89A 2VJAA 1FFCA 1IVYA 1IZ8A 4KRXA 5LLSA 2WG1A 5K5EA 4OUKX 1W6RA 4F0JA 1X70A 4UBNA 4XWGA 3D0KA 4UFPA 5HFAA 1VZ2A 2WHRA 4KE6A 2XMRA 5FUMA 1EVQA 3PUHA 4CCYA 1CUZA 4QNNA 2XUQA 4Q3KA 1QIKA 4U2FA 4Y2QA 2HA2A 3IULA 3B12A 1FJ2A 2H7CA 3NGMA 5DNVA 3WL8A 2PBLA 4K6HA 1GKLA 3WQHA 4KEAA 3TGLA 5JAHA 5ALOA 4H7FA 3C8HA 2D5LA 5I9IA 1YB6A 1XRPA 1QTIA 4FBLA 4OPMA 5DTJA 1GQSA 2C0QA 3HABA 1KU0A 1GGVA 2QS9A 2W22A 4N8EA 4H7HA 5EHNA 1XZAA 5LZ5A 4X6XA 1W1IA 2XQGA 4RPCA 4V2IA 2PUHA 4MJ3A 4ZGBA 2ZJ6A 5EIHA 5K3EA 4AN0A 3FYUA 2OXEA 3K6KA 5AICA 4FMPA 3F67A 4Z49A 3GUUA 1CUDA 3KWFA 2FUKA 1EB8A 1NU6A 1W52X 2GBCA 2CB9A 3I6ZA 4O08A 3QBJA 5BV7A 1M33A 4BCBA 4AMYA 4FFWA 1ZICA 4MYDA 4Y2JA 4L3WA 3WWCA 2V98A 5LKAA 5K3AA 2VEOA 3STVA 3AZOA 4CCYB 1AQLA 1O6GA 1W4LA 4F5ZA 4Y2TA 3HRHA 1XZJA 2QXUA 5ALWA 3D2BA 2EDCA 2K2QB 2PM8A 3C6YA 4DMKA 4UBJA 3PI6A 4L9AA 3MGAA 1MNAA 4UPDA 1WM1A 1JT2A 5CRIA 2XQFA 1AMNA 4UBLA 1USWA 2OGSA 1HBJA 1X2EA 2JEYA 3C5VA 5AKJA 2ZSIA 5F4ZA 5T4EA 1ODCA 3D2AA 2AJ8A 3OOSA 4AO8A 5C8VA 3K9BA 3IBTA 4INZA 4AQDA 2PSEA 5JALA 2OLEA 2JIDA 2PKYX 4NS4A 6YASA 3AIMA 3FLEA 1XFDA 4KAAA 1TIBA 5KBYA 4C4YA 2GBFA 5A62A 1C7IA 4BDTA 5JYCA 1W75A 1QIFA 2AJDA 1JFRA 1L7RA 1QO9A 5AK5A 1XZBA 3TRDA 1MX1A 4Y2VA 1ZGBA 3O4HA 4OYYA 5EHZA 1C7JA 1H22A 2HA5A 4UFOA 3JWEA 2LIPA 4GXNA 1H2ZA 3WMRA 1T4MA 4IHAA 3U1TA 2C5GA 1A7UA 4AXBA 4B6GA 4A23A 2J4CA 4MQLA 3BDIA 3WK8A 4OB7A 2QT9A 5ALHA 3BWXA 4LIPD 3ZLUA 4PQEA 4B84A 2XDWA 4J3JA 3IDAA 3O9MA 1EK2A 1BN7A 4PNZA 1ORWA 3HJUA 2PSJA 4IH4A 1ZI9A 4CIBA 3FBWA 5BOVA 2XMBA 4UBKA 4B7ZA 1SCQA 5FKJA 4XX1A 3ED1A 1EH5A 5DYTA 2WG2A 3HC7A 3D4LA 3BDVA 4ZXFA 4BCDA 1WHSA 2OPHA 3DL7A 3V1KA 5AO9A 5H3HA 4H77A 4J7AA 1DX6A 1QONA 5CTAA 3VVLA 2AJCA 5KWIA 5IVHA 4BAGA 3EF3A 3ESAA 4H18A 1TCCA 2Y2VA 4WDQA 3MUOA 4QDOA 1ZIXA 5JD5A 4ARAA 4N5HX 1FSSA 1R88A 3LS2A 4OYLA 2WKWA 4KE9A 3WKDA 4WY8A 1Q83A 4QDXA 3KDAA 4AO7A 2XUPA 3HEAA 2XMCA 4QA9A 1DWQA 4C4ZA 5JZ9A 4XJVA 2VAXA 1D07A 5K3CA 1WCYA 2OGZA 4QEKA 3AZQA 2EEPA 3STWA 3BE8A 1P0MA 3IVMA 1ZI8A 3V1NA 5T4FA 1U65A 2PX6A 4CIAA 5EGNA 4A5SA 5A7HA 3TEJA 2QRUA 3LIIA 1C4XA 4L0CA 3IIIA 4G4GA 1XZEA 3BJRA 3NOXA 1TK3A 2BUAA 3G0BA 4G4JA 2C58A 2XMQA 2XUDA 3QH4A 1FFBA 1MJ5A 1XZDA 3FCXA 3D3NA 4OU4A 2R11A 2GZRA 2I3DA 4FTWA 4ETWA 4GI1A 4KRYA 2WIDA 4W1PA 1CFJA 3WLAA 4DNFA 2CMFA 5AK6A 5FV4A 4OB6A 4HRYA 2YH2A 5AK3A 5CBKA 2X5XA 3E3AA 3ANTA 1N5RA 3OG9A 1XZGA 4JYMA 2JGFA 2IIVA 4G8BA 3SX4A 5ALQA 3TJMA 4W9RA 4MXDA 1BS9A 4P92A 1CRLA 2WU3A 1ACJA 4Q3OA 3WJ1A 2HRRA 3B5EA 4TGLA 1H2XA 3EQ9A 1XLUA 2O7VA 3FYTA 3FCYA 5K3BA 3PF9A 1YB7A 2VA9A 3WL6A 3QZUA 1RYYA 1XRQA 1YAHA 1MT3A 4G8CA 1QIDA 1E5TA 1AX9A 1XRNA 1OILA 1AUOA 2WIKA 4M0MA 4BYMA 4WFIA 2HA0A 2JEZA 3I2KA 4H7EA 4YASA 4EZIA 2WUFA 1T2NA 3A2LA 3GFFA 3SC2A 4U2EA 1MU0A 4YX9A 3QMWA 3WA7A 4BB0A 5A2GA 4B9AA 5YASA 3WWOA 3NWOA 1MAHA 1ZI6A 2XUFA 4JH0A 1XKLA 1F8UA 1DT3A 5A6VA 4FLFA 2BJHA 1BU8A 3IA2A 2QJWA 1JI3A 1U2EA 2HU5A 4LYDA 2HA7A 1TCAA 1LPMA 4Q05A 5AK4A 4E11A 4I19A 1YA4A 2BAGA 1YS2X 1ETHA 1QIHA 3JYHA 1A8SA 1MX5A 3H17A 4WJLA 1H23A 3DYVA 4Y2RA 4BC1A 1L7AA 3R40A 5FDFA 1G66A 2DHDA 3PDCA 3CXUA
chains in the Genus database with same CATH superfamily
5D3KA 3VZSA 3RV3A 4HDCA 1EWVA 1MAAA 2AG1A 3MS7A 4KXWA 1XVIA 4QVKA 4UHCA 4IH1A 3FMVA 1S2NA 4N0MA 5ESRA 3D4NA 3ZHSA 1S9HA 4PG6A 2P5YA 4MEBA 1D5CA 3VYVA 4UARA 2WHQA 3G5MA 1W2HA 3QYJA 2R97A 2FDRA 1EUDA 3O31A 3VH1A 3TOCA 4FYJA 3RBXA 1JDUA 1KVQA 2IELA 5FLXA 3FFAA 5IEJA 3FCSB 1O0CA 3R23A 1TUBA 3AFOA 4FBGA 1YIDA 3RVMA 3QK7A 4DCNA 1T1SA 4YPOA 2D2EA 3ZEIA 1MRZA 2C54A 3I8SA 3LP8A 3O73A 4MA0A 3SJZA 4TLCA 1TIKA 1NQUA 5JXJA 4U3JB 1KMIY 5LP1A 4Q9IA 3TIXB 4FWBA 3LQ4A 2JB9A 3VOAA 2FWRA 2HIHA 3ZY5A 1LDNA 1RYNA 2CLLB 3G68A 4BP1A 5LKRA 4C07A 3EPHA 2V65A 3OH8A 3RBAA 1T5IA 4DC0A 5L4SA 3M5WA 1M6VA 3BFJA 4DLUA 1J0BA 4KQMA 5DX8A 3IBGA 3T5DA 4KPYA 2QLJA 1Z2EA 4ARVA 4OHBA 3ZLJA 1G1MA 3EZNA 4I9FA 1WB4A 1RAIA 1HT2E 2BMDA 1C7ZA 1F2TA 1JHRA 4KXNA 4P0TA 1S02A 3BD7A 3TTXA 4YP0A 4DKXA 3MWDA 2V9PA 2LRHA 5FYQA 3MIZA 5JAZA 1NBOA 5C1BA 3P1JA 1IWOA 3Q9SA 2FZEA 4IIDA 1AC5A 2JBWA 2XWBF 4WE3A 1AKWA 3AT1A 3AHDA 3GA5A 5FWYA 4NARA 3F71A 5JZBA 1I94B 4QOJA 5CB4F 5FV7A 4H0CA 2W6ID 5I8PA 1V35A 4LRWA 3ENWA 1B76A 1R6UA 2WVGA 3FH0A 3CVUA 5UKDA 1U7DA 4C3UA 3E9EA 3DC2A 3TZKA 4JAVC 3RYHB 4D8XA 4M37A 3K5PA 4LRQA 5D5QA 3RS7A 1Y3HA 3PXGA 1KK3A 2ZE6A 4FNOA 2IE0A 2X6TA 3WRVA 3CX6A 5A1JA 3DPIA 4MUFA 4A15A 1KK2A 1V9LA 3CWZA 3JSXA 1SCIA 1GTG1 1KJ9A 3RQIA 4CLXA 3ORRA 1NM5A 1I1HA 5DBFA 2VSOA 1IXZA 2JLQA 4MVWA 1IZZA 4LJ5A 1Q50A 4EVIA 3EEQA 2ZRQA 1PJRA 5F12A 2V5VA 3R5XA 5TV2A 5BOSA 4BV9A 3RYIB 4YDHB 5IDWA 5KO2A 2JDID 2YQZA 1EGAA 4IV0A 2RAUA 4TV8B 5LIRA 2PH5A 1FJHA 1I4DD 3KKMA 3PDHA 4C88A 1XDGA 5F9FA 2XCTB 2YMLA 5ALIA 4MA4A 1NOJA 1Z88A 3X1XA 4R98A 2IDMA 3JASB 4K05A 2OE2A 4KWTA 4G24A 2IEBA 4JLUA 1HLFA 4D82A 1XK6A 2HNBA 4NOMA 1VMKA 2WFAA 2H7YA 4ZCLA 4TWZA 5A71A 4DQUA 5EXTA 3TLJA 1WDWB 3G9XA 3IHKA 4ZFNA 4IP0A 2FFHA 1KFJB 2DKFA 5FFMA 3NXSA 4U00A 1POWA 3U9LA 1NQXA 2OKCA 3BMCA 4J03A 2OD2A 1CUSA 4RVFA 1KO4A 4HZIA 3REQA 1LDBA 4D9IA 1D4AA 3A06A 4JXJA 1EFUA 2YDYA 2YTZA 5IH3A 5ALMA 4LBYA 2XCUA 1FU7A 2BUBA 3IS3A 3OAAA 2MSLA 2XXAA 4BRWA 4PZAA 3DKIA 3GF4A 1PNRA 4UAUA 3H5LA 2Q1WA 4LOJA 2ATXA 4MR8B 3EFBA 3WOHA 2PLFA 4ZVOA 5JNWA 4PLTA 1X1QA 3ZY4A 2VDLB 1CUUA 2F55A 4QUBA 1NBMD 2EX1A 4RLQA 1UMCB 3I05A 1FUUA 1KQFA 5DN6A 1Z29A 4LSZA 3RUDA 5AOBA 3OPMA 4NZMA 1R4MA 2RCYA 3E9RA 3OZTA 3PFIA 3LQFA 1U3TA 2LTAA 1MXHA 1T13A 1TMKA 1CUGA 3BIFA 5FLKA 1K6MA 3HI6A 2G76A 4REOA 1KI3A 4Z3OA 1P81A 4NVRA 4KHZA 2GJSA 1XHLA 1E8DA 4BGDA 2ORIA 3QUBA 3EZ2A 1PQ4A 1U9CA 1WAMA 1CQIA 3FPFA 1TM7E 3D0OA 4NOKA 2WWVD 2L82A 5AVZA 1M34E 5FHQA 1R1DA 2AV6A 4BO7A 1RCFA 2BJVA 2XA1A 3FGOA 5C34B 2VPXA 1KE1A 5FI3A 3WIEA 1E1QA 1HPLA 1IIRA 4G84A 1KE2A 1QX3A 2O2IA 1RTTA 5KNBA 3U56A 3JYQA 1DBPA 1G21B 1KDTA 1ZK0A 2D2FA 3CIFA 4WCDA 1UP6A 3VH3A 4XA8A 2IIQA 3HR8A 3LLUA 2C2HA 3PJDA 4CFSA 1KDZA 4RJLA 2BRUC 2JLRA 1UDWA 1M2WA 1ZKMA 1RBZA 2A5DA 2QVCA 1PSWA 2ZKLA 3DWFA 1OLOA 3BT7A 4O2AB 2AW5A 3BL5A 2IUUA 3OA0A 3BD6A 4NV0A 3EHDA 3DLTA 4P32A 2FOIA 4PSVA 3TTVA 1N3IA 4G8DA 3SNHA 3FN4A 5F2EA 1AA9A 5EEHA 1DAEA 4WNCA 4DJJA 1PS0A 2HAEA 3BH0A 3H5RA 2XT0A 2GA8A 4HQLA 3ZV5A 2FXIA 3FPCA 1TYEB 4I9GA 4REQA 1DFIA 1ICIA 2I2CA 4LRSB 1JS1X 2Z5GA 3OE7D 4JITA 4JYZA 3HHPA 5DGCA 3HM9A 1L5FA 3AI1A 5T64A 2V4ZA 3CKMA 4N49A 4ZQGA 4ALNA 2QD2A 3FOZA 2YBEA 3SBOA 1TYCA 2IYRA 2BEKA 2VRCD 2QMEA 4IHJA 2APJA 3F47A 4ABTA 2IH4A 2V7UA 1FMLA 3T15A 4KRFA 2YMPA 4LBZA 4R84A 1BMFA 4U2GA 3QPAA 1PZGA 3NWEA 4HAUA 1PYDA 1RM3A 3H2SA 4XLTA 4XX0B 4H1UA 2H5IA 4TYQA 1X1SA 4QQNA 1KMNA 1NBHA 2EJBA 5C51B 3Q9NA 2J8ZA 1HT3A 1JYEA 1MBZA 5JZSA 4UNSA 1KYIA 1VI5A 1I6LA 4ZVMA 2R8XA 1RWKA 1G3QA 3BIXA 4P3KA 2J32A 3AZPA 1Z8HA 3N2LA 1QGUA 1GCAA 1DKMA 1KEEB 3EW9A 1YZTA 1TZBA 2QP4A 1I14A 3I9V6 4WLNA 2GJ9A 2HJSA 2X4DA 4GYKA 4DR2B 1XCOA 3GUHA 4A73A 1NRWA 2VYND 2YDXA 2PS9A 1SXIA 4MSUA 4ZO4A 3IV7A 2W0MA 4RELA 3WYAA 1CUIA 4G65A 3BK7A 2VAVA 4MIOA 3QE9Y 2IS4A 1K2WA 1VMEA 4I7EA 3UXHA 1YKFA 3VX4A 4DANA 6PFKA 4RO0A 1ADYA 1RYEA 3BC1A 3NJRA 1NZDA 4ZEVA 3DO8A 3TD2A 4IDNA 2D5IA 3B52X 4LCJA 3FI0A 1K5DA 4P58A 3DTVB 4ZC8A 3GX1A 3OCCA 2ASVA 4RK5A 3W2GA 3LIPA 1OYVA 3A31A 4M3NA 1V3VA 1YKGA 1LPBB 4ZI2A 2CZQA 1GSIA 3SX2A 3BRSA 2ESRA 2EW1A 2OECA 3OF3A 2VWPA 1PV2A 1R8XA 4FDAA 3G8AA 4HNQA 3V1UA 3ROGA 5HIKA 1U0EA 5KJ1A 4CETA 3A0RB 4PZDA 2P11A 1P7ZA 2ZSFA 4I36A 1NTRA 3EA5A 3PC8A 1XO1A 2VUUA 4KGVA 4JI6B 1DDOA 3IQDB 2Q0XA 4RHUA 4X60A 4XVCA 3UXYA 1XPRA 1OH8A 3GGSA 3TL3A 2UU9B 4G1UC 1WU7A 3OY7A 3EGWA 4P5DA 1JBKA 3NPMA 4JENA 3OD1A 5TEWA 2O7QA 3SI7A 5EZYA 3EMVA 3QSYA 2MJLA 3HCCA 4Y1FA 1WOYA 2QD5A 4HHEA 1FYFA 4JB3A 2IP2A 3FF4A 4PIPA 1G2OA 4BB5A 1ESMA 1SG0A 4DUGA 4OI0A 1HDRA 3JZIA 2ZYRA 2D6FA 1U11A 1SRRA 1Z13A 4K6GA 3RUAA 4ENVA 1FCJA 1UJCA 2EFHB 1XTBA 4WZAB 3G0DA 1JKIA 1GTJ1 1BX3A 4EBBA 3MQ2A 3KWJA 1DUVG 1SC4A 4HWTA 3WK7A 1UR5A 1IY9A 3C3MA 1SC9A 1JPJA 4GOMD 4YRQA 5B57C 5JBNA 1QG0A 5A9SB 2HYIC 1UOEA 2OCDA 2QTBA 4TLMB 1LA2A 1W47A 4WOKA 4PHCA 1OKKA 2O59A 4E6PA 5E2BA 1JYSA 4BNZA 4WESA 2AF4C 1AHIA 1A8HA 1UWKA 2JRLA 3K6JA 1LRKA 2GEJA 1GZHB 4PR0A 4KI0A 1I0LA 1Q19A 3G17A 2VZEA 2OZKA 2WHEA 3BX1A 4UM9B 4ZYWA 4LC9A 2GD6A 2XRMA 4NBKA 1NQTA 3D8BA 3DL4A 2Q8NA 5ITVA 4RHCA 2FSGA 2ISSD 4REQB 4IOLA 5JSKA 3CCFA 2GNAA 3IIKA 1Q3TA 3P0JA 5CXXA 2I91A 4B3FX 3OLCX 4RPLA 1RCTE 3B89A 5DI3B 3VYUB 5KTYA 5G0UA 2R1VB 5HGXA 4QUDA 4AM8A 1UC9A 1LSJA 5CA0A 2BT4A 3RTAA 2EQAA 4C87A 1DV2A 4OQXA 3PGA1 3C45A 5BN3B 4GOND 1C1DB 1YJBA 1NHGA 3O4IA 2JHAA 2BEJA 1GZ6A 2Y1XA 3RJ9A 3LBNA 1SY7A 4UAVA 1ZJ5A 5EQTA 5CAEA 2HMYB 1UPBA 4CLRA 3JY6A 2W6QA 2ZROA 2OYSA 4BLSA 2CNWD 4UCWA 3LOQA 2QTVA 2RDMA 1GZDA 2EP8A 3M1IA 4IFIA 4DIBA 3AVYA 3GNSA 1ZC4A 2J5BA 4Q21A 1APBA 1E9FA 5EHXA 1J9EA 5ENVA 4ISCA 3SVTA 3MJCA 2IEGA 3CNEA 4K3VA 3CLRC 1G20B 4M9SA 1JAHA 4K1XA 3KQHA 3PGKA 3LL7A 3Q7PA 5KCZA 3GQVA 1A7AA 1Z62A 2O50A 2C9YA 2CFRA 4F5EA 3B78A 1ULBA 1OWNA 4IGIA 2QAIA 5MDHA 2QM8A 4TSFA 2QU8A 3VA7A 3D4BA 3GJZA 3KZOA 1O94A 4ZI3A 1V4BA 5FOSA 4MRAA 4UZFA 2IV3A 2ONKA 4TSFD 3RSGA 4BE9A 5JIBA 4Z4CA 1NN0A 4K9PA 3FZEA 4EX6A 2VJMA 3E8XA 3PQ5A 3HZRA 3U7IA 1PAUA 1UBJS 4B74A 4F5WA 2IBSA 3KHTA 4KZKA 3T3PB 3W6PA 4RGVA 4P5EA 2VT3A 2WSMA 3SKVA 4DNQA 2H00A 4D4LA 1UPAA 4Z4EA 1BROA 1A9TA 2C57A 1ADCA 1E9CA 4LGCA 5EPUA 4EH1A 1G5TA 4FT4A 4E1BA 3W2IA 3T35A 4L28A 2C29D 4KSBA 2EQBA 4PG8A 3LYUA 3QXJA 2CJPA 2VK1A 1UZMA 2I3GA 1DAOA 2JZCA 3GBSA 4D43A 1T15A 2RH4A 5AHXA 3EXEB 4CMCA 3IQEA 4Y0NA 2A4MA 1WVGA 1PSDA 1L8OA 4MVJD 4OP3A 5ELXA 1XJQA 1ZD5A 2Q3MA 5AM4A 5B64A 4FEYA 4IKEA 3N0TA 4IIJB 5IBQA 1C9NA 1PEDA 2AGVA 2VHQA 4MVJA 4W9NA 3VJLA 4AP5A 4BLUA 3NOQA 3U16A 1XTUA 3K2EA 2CLDX 1ZYUA 3QYFA 4IILA 1KYTA 5LZ7A 4M0PA 3TSYA 5EMNA 3UA4A 1CNFA 2ABWA 2F4VB 1J99A 2VN8A 4H0NA 2QE6A 2OD9A 2NGRA 5MF6A 2IEYA 3O3MB 2A5LA 3ZLVA 3T5AA 1Y89A 4WWHA 4M87A 3RRFA 1OAAA 2ZBVA 1S2IA 3LECA 1T36A 2JFQA 4QLAA 1CUHA 1PDVA 4PC2A 2LDBA 2VBFA 1J0CA 4MINA 1UT6A 2DAPA 3N2KA 5IJAA 5A9SA 4JBYA 2JI7A 4DDUA 3WGTA 3RT7A 5AIAA 2GYWA 2PQMA 2Z2YA 1KP3A 1MNQA 1IZ0A 4KAFA 1G9XA 3PX3A 3ZJ4A 3L82B 1TECE 1GSAA 3RCBA 1KMQA 4DMCA 3QY9A 4E03A 1TTPB 3UB3A 1JW9B 4WJKB 3WAKA 4ER0A 4D9HA 2FPGA 1RE1A 1T9KA 3WMXA 5CW2A 4RC9A 4ZXPA 1LI4A 4CQMA 2IS6A 1T8YA 3TSZA 3CGGA 4QTTB 3CSDA 3RF7A 1G8AA 1SOWA 2Q5EA 4IX9A 3IAAA 3ZGOA 1POXA 1MMFB 3EA0A 3PFNA 4LJYA 3BYZA 2R86A 3DS8A 4B4VA 2NMVA 5THQA 3QQPA 3UNXA 3WV4A 1H6AA 3F5FA 4UUNA 1U8TA 4I3HA 4WLEA 5SZJA 3W9UA 2GD0A 4J0IA 3RK1A 1DBQA 3W5DA 2ZUVA 3PRKE 4F2GA 1FIUA 1QGZA 3T1NA 2XI4A 4MWEA 4WLOA 4ZVPA 1OT5A 4F9EA 4OXXA 5EL0A 1GPMA 1UBSB 5K3OA 2OWDA 4RLFA 4DRXB 3EC1A 1H3EA 2I78A 4FMCF 2D59A 3A6EA 2BFFA 1U3WA 1QCDA 3WA6A 5EHQA 3K0AB 2Q8QA 3WXBA 4MS3A 2YMQA 1QGDA 1ZK3A 2HJGA 5L51A 3I76A 2ONCA 4EB8A 2ISCA 4HEQA 2P5TB 2A9FA 3P2YA 3KJIA 4AZ0B 4AY4A 3J80A 4QKQA 3P8ZA 3DFFA 4A03A 4HAYA 1NY6A 4QOFA 3AV0B 2G9NA 1JECA 4EEZA 1ZW1A 2MINA 4LISA 1HMPA 2FSUA 1ZH2A 2BOVA 1LV7A 3SYTA 4BVLA 1U9IA 3KLNA 4D26A 2FGJA 3BCUA 1FY2A 4MGEA 5LD2C 1ULAA 4YCLA 3H5TA 1JLLB 1I32A 3WJ2A 3OCYA 3R6DA 1D1QA 3GLIA 3ZU3A 4KUGA 2R6ZA 5C8YB 4D4KA 4BECA 2G9QA 3UUEA 4JP5A 4ZAZA 3THRA 1VL5A 4PV7A 3PICA 3M82A 1Q1EA 4TL6A 1RAAA 1BXKA 1PT7A 4BIMA 1GO2A 1SCJA 3S1AA 1CETA 3ABOB 1G9TA 4O4JA 4W5JA 4G5SA 4CG1A 1J5EB 3U4QA 4D5GA 2J3QA 1QK4A 1J06A 1FDRA 3WK9A 5BRJA 2D0DA 3KEOA 4J43A 1Y9AA 2Q3BA 2OHXA 4AJ1A 1E3DA 3H9JA 4Y9SA 2EBFX 4UOZA 1ZAKA 4HQ0A 4JODA 1KP9A 2H11A 5TPWA 1RCUA 3D3JA 3DE3X 4KUEA 1M1XB 1VHDA 4UNIA 3U3KA 5CXQA 5HM6A 1AXRA 3A4LA 2P41A 1ISGA 4MPPA 1UAYA 1ZUNB 3SHOA 4DA4A 2RGUA 4EO9A 5LM3A 2K7FA 4BNIA 2YYAA 2RK6A 2V7TA 3IP5A 3GYBA 4FP9A 5EIOA 1DT5A 3MJSA 3WGUA 2M6SA 1FUKA 1YS1X 4KE8A 3U3RA 3Q98A 3VR3D 3NHMA 2NV0A 4BFZA 4GR5A 4R9VA 4GVLA 3I2GA 2REOA 4WZZA 3EJWA 1FNBA 2ZWVA 3OSUA 1E1NA 1Z0AA 5FB3A 5IAKA 1NW9B 3EY4A 1QLWA 3NT2A 4JVOA 4AVYA 3FVQA 1I3KA 1Y34E 1SQSA 2QNIA 2UZIR 3KZMA 5JS6A 5F52A 3UV7A 1JQ5A 4FPXA 4JSYA 5ICGA 1SXJB 2F9LA 2A33A 3EDQA 4OHWA 3JAMA 3SK0A 2R68A 4M8KA 1YI8A 1Z22A 2JFVA 2O8NA 2WJ6A 2JEOA 1S4QA 1X7XB 3MAJA 1ISIA 1BXZA 1IY0A 1ORIA 1QO0A 3B1YA 2AUTA 2OSVA 4NHOA 3M9LA 1GNPA 5GV8A 3UT0A 1VB3A 1R4NA 1Q0LA 3RFFA 1SCKA 1Z4OA 1F1JA 4JHXA 1U8UA 1J56A 1Q2UA 4G1FA 4WT7A 1W2GA 3QX8A 5K0EA 1CEEA 1IN4A 3P9SA 4YRMA 5JHHB 2F67A 2WA1A 3BGOS 3KPVA 4GMKA 3JXEA 3R5TA 3P9RA 3NHFA 2BELA 2KLHA 4A16A 4BRUA 2O0LA 2CKMA 4TRJA 3S7ZA 4ZYLA 1I13A 1Z25A 1ZWKA 4NULA 2W6CX 3TL6A 4Q3CA 2OVFA 3OQVA 1ULHA 3E2MA 4OKSA 1L4GA 3KJFA 4Y1RB 1RYMA 1XI2A 3DDNA 4XARA 4M54A 4U2CA 1V7QA 3G6KA 3DOHA 3IXLA 1QPGA 2I4TA 4NP6A 4U02A 5DGXA 2EAUA 4C6RA 5FTJA 5I48A 1W35A 1X39A 4EG3A 5BWCA 5C8DA 4FDTA 1TTQB 3R0VA 1PJ8A 1NYTA 2C1ZA 1DTWA 3UF0A 3D7RA 2BTOA 3CW8X 2TECE 2CJYA 1GPBA 2D2XA 2G09A 3P9KA 1A5SB 4X1KA 3EC2A 3SC4A 3L4JA 1NFQA 2IKQA 2JASA 3SWWA 3G6WA 1DRWA 1OPXA 4EL5A 4O2LA 1NU8A 2A7QA 2GRUA 3B3AA 3QBTA 3J7TA 2EX4A 5GPBA 4F91B 4BO3A 5ECWA 2ZI3A 2ZWOA 4CQMB 5FEMA 4YMUA 4EYSA 3OKPA 4PCAA 4GVPA 4R2WA 3NETA 4L73A 4BO8A 3HXOA 1NBAA 1RRPA 5CDUA 1UM9B 5AK0A 1NM5C 4PAWA 1U80A 3E9CA 4CTOA 1KORA 3F7TA 3OMWA 4HNAB 2HF9A 4B8YA 4JJGA 1FFEA 3B20A 2BP7B 4KJXA 4OOEA 3FUUA 3N2IA 3FDZB 4Y8VA 3X3HA 1IUOA 3O94A 1PZHA 3DYBA 4PLFA 4FSHA 2NO5A 1WV1A 3SDZA 2OORA 5DHQA 4DLYA 2BTEA 2XLCA 3H1AA 2GR9A 5EP4A 1TTTA 3RC7A 3L4SO 3X43A 4BAZA 1AIPA 1AJEA 1NSTA 5CLLA 2CVHA 3GNLA 4R31A 2LKCA 3COYA 3PPIA 2JLYA 2H2AA 4HQFA 1DL5A 4DMRA 4DDVA 3MCTA 3PT5A 5KX5A 3MWEA 3OU6A 3F3MA 4WBNB 5EKDA 1Z7YA 1D2CA 3L0OA 1BNCA 4B4DA 2ACKA 5D2CA 4ZDWA 1XT6A 4M1OA 3F9IA 4N0DA 2HQBA 4GO1A 3CR7A 1LJLA 4QHTA 1T8UA 3COJA 2BMVA 4HR7A 1KRWA 4OJKA 3GRVA 4HNGA 3MMXA 3T7AA 2RI6A 4XSHA 3P2KA 2BGTA 1NVKA 3ZHCA 4P22A 2IY8A 2QQ0A 3ONWA 4JB8A 2IHJA 3KOWA 2X6RA 4ZCSA 1P60A 3KZVA 1YOVB 4DUPA 4QQKA 2QJRA 3PD7A 4MW2A 5C4GB 3ZNPA 1LNZA 4U7WA 2C7BA 2JLBA 1AGXA 3A9UA 3BORA 2UUPA 2NSDA 3L4BA 4GBGA 3MRXA 3OUZA 4PC1A 5IAEA 5EAIA 3TJRA 5B4VA 5GZ3A 2KYRA 4RZUA 4YO7A 5BNZA 1EI9A 3GCWA 3A11A 4MDHA 3GWZA 1E0AA 4L2IB 4J29A 4MRMA 4DWVA 3TLXA 4MUGA 4URHA 3GXOA 1VLZA 3IUPA 4GP6A 3GVCA 4G56A 4S1VA 4ZAVA 5DYWA 2EX0A 3E1GA 1U0HC 2HRBA 2CKDA 3QWAA 1BDMA 1MA3A 3RRNA 1O6BA 2H1IA 2HCFA 4EW6A 1HE3A 1C30A 3AOGA 1U4NA 3MCAA 2HJRA 3MHPA 4Q7JB 1W4BA 3U7GA 2IYQA 3TFWA 4YRAA 5B6PA 5CB6A 5JBQA 3CUTA 4AAYA 2C96A 5JFGA 3AEUA 1ZXLA 5BR4A 2OHFA 3EG5A 3M6LA 1WR8A 1JG3A 3IMKA 2XNDA 4EG5A 1CJVC 4G25A 4UNQA 4AUMA 3FHLA 4DPKA 4FJ2A 2NZWA 1DWPA 1JQEA 2CCGA 4GWGA 4UE6A 1JUDA 2BEUB 4DUYB 2O57A 4URWR 1Z68A 1OIXA 2X0KA 4OI4A 1QNLA 5A0TA 2OAP1 2R3SA 2WWFA 3PGXA 4F86A 1W30A 1HZJA 1DP4A 1A2KC 1GRCA 2RK3A 3OHSX 4GE0A 4WFJA 4XCQA 4F4HA 1X86B 1X7HA 1SQGA 4ZN6A 2W2OA 1T25A 4CMAA 5CT8A 4DR3B 3B48A 5LB4A 1OGIA 3KB1A 2PKRA 3SXUA 4ED9A 1ZM2A 1VHQA 4JOSA 3NPAA 4L4RA 5KJ6A 2K5UA 3A7DA 1S2MA 1ID1A 1YVEI 4PO8A 4C4TA 4M0EA 3ZS8A 4G89A 4NZZA 3AETB 3T7TA 5K0TA 1GCOA 3WR5A 2GWHA 2JDIA 3R7SA 3ZXUB 3K5WA 4A2QA 3FLAA 1CUWA 5HS6A 4AZ0A 1MENA 4MLDA 4G97A 2C61A 1BX0A 2EV9A 4FQ5A 4Q39A 3I5XA 5F73A 1DXOA 3OU7A 4PZ0A 4ALIA 3RB8A 4B0OA 2NP6A 4D02A 1GQFA 3B3JA 3BWYA 3JQDA 1YVRA 3ZI0A 1NNSA 4IGAA 4NESA 5SZKB 1V11A 3CPJB 3FHOA 4GDFA 4L9SA 4LYEA 2QZZA 4OHYA 5K0ZA 2FK7A 1DAHA 4AG3A 2MWMA 2I55A 4F9FA 1RR6A 5A3JA 4F8JA 1UT8A 2H52A 1Q1AA 4F3YA 2XHZA 2QN6A 4KVFA 4X3OA 1RACA 2LPMA 2Q1XA 2WTBA 3HJBA 1QV7A 2QMZA 4GC5A 2DB3A 4B3GA 4CKWB 2PL9A 3UTCA 2MMGA 3CLSD 1HNNA 3T7IA 1GRRA 1Q0QA 2B9VA 1QH8B 1QE5A 2FR0A 3INRA 3QVOA 5DNAA 4HRVA 4J0CA 1E9VA 3G0OA 1NRIA 4P3OA 3F46A 2VFAA 2AT1A 5MN5A 1QMPA 3S0JA 1DMRA 2ZU6A 3QNUA 5IVIA 5CDHA 3KETA 4HAIA 4OJYA 2PZ8A 1HKHA 1DG1G 1O9HA 4JGBA 5DASA 1TKAA 1GKKA 4QU9A 1JX6A 4WPGA 4F4FA 2BM0A 3SC6A 2Q3CA 1EUQA 1IHYA 3BXEA 4RTOA 5C8YF 1ZESA 3WICA 2X4LA 4HWPA 4Z0HO 4LXHA 5FFFA 1ZCBA 1GTVA 5PNTA 4YAOA 1RRFA 3JD3A 5BUCA 5B2ZA 1UQUA 4J75A 3V4OA 4I3FA 5I7WA 2EHJA 1YFLA 1KZ7B 1FXWF 1XMJA 3GJTA 4LZPA 2O20A 3KAPA 2YKGA 1QVZA 5HILA 2BMJA 4H4DA 3ZI7A 3A27A 3FMIA 4UZEA 4AJLA 4Z9AA 5JAPA 4UE2A 3RKRA 5CFRA 4HTFB 1OVGA 1YI1A 2QTLA 4NONA 4X9XA 4YYEA 4QPNA 3QY0A 4Y6OA 5AJXA 5CJPA 2J31A 1NXQA 2WSYB 3B7GA 4W5WA 4X97A 1WS6A 4DADA 2V6IA 4AKEA 2QL6A 1ZMBA 3FFTA 2YOGA 4QE3A 3KQNA 3HKDB 3NVAA 2RHMA 4I5EA 2JAWA 1RI2A 4X94A 3SG0A 3HSSA 3LJKA 4ENRA 3TGPA 2YL2A 1MG5A 1T2FA 1MO6A 4C89A 4O5OA 2Z1DA 2ZIGA 1N5DA 3IP7A 3TKLA 2VHUA 4KMRA 1DAPA 1I2CA 1NP3A 2RJNA 3A2NA 1ZUIA 1KJYA 2DFTA 5G4KB 1FX0A 1LRJA 1XD9A 4KL8S 1TE2A 4RA6B 1LNSA 2BE7A 3HNOA 5E7IA 4OF4A 1KJ8A 1CQPA 3A6ZA 4YREA 1J00A 4RMJA 2QUAA 4UBMA 3GJ7A 2FOLA 5GIOE 3OPYB 4KACA 4KR3A 1OLXB 3AGPA 4K8OA 3GJXC 5KTPA 3HLTA 1AS0A 3H19A 5F5LA 4JP3A 4HX9A 2FSVA 4LZZA 4DGQA 4IDFA 5FOQA 1SCBA 3P2IA 4C7OB 1KFEB 5ALUA 3OZ7A 2W2KB 1CRWG 2H57A 2GKOA 1EBFA 3HI4A 5CEFA 1N9GA 1G98A 5D86A 1E0DA 2VDJA 1NBMA 3G2NA 2PXCA 2YJ4A 3DZDA 2EL9A 1PLJA 4HATA 5JWOA 2P68A 1FRNA 4ND3A 4LRUA 3ILXA 4UC0A 2DF8A 2PJUA 1LBQA 4V0SA 3EF0A 4R2XA 3DBRA 5HFJA 1VZ3A 3AJ9A 3MILA 4H15A 4QGGA 4QT4A 4YBZA 1JZTA 2Q27A 4OD0A 4OQNA 4TMXA 4QDUA 3VU3A 3FOFC 3CWCA 2NUAB 5J5CA 1S3FA 3PUYA 4QUGA 3ZIUA 5JVDF 5TJHA 2DUMA 4E2WA 5EY5B 2QBYA 1V5WA 1XLWA 2ZIZA 3M1LA 1I51A 2OG2A 4C0XA 1U2DC 1MW9X 2ST1A 1IQUA 3QF7A 3VDMA 4AMVA 2YWXA 5CW1A 4EFMA 2FEKA 4K9RA 3OQHA 4NCIA 5HF8A 4ZK2A 2B5VA 3IKMB 4DWWA 1GLNA 2WYHA 3W1VA 3K16A 1RYDA 1KY5A 1ZINA 4ND7A 3H0CA 1YZLA 3NBMA 4UFNA 1RU3A 4QC2A 4H1WA 5JAMA 3LQ2A 3M6MD 1Z8DA 2J41A 3I4CA 1T4BA 2F17A 4JDUA 1Z0FA 1E2EA 4A0SA 5AVVA 1TA0A 4W7IA 1XXHB 4LXGA 4FWTA 1FC0A 1E58A 2AS0A 2JIBA 4JA0A 3O82A 5M29A 2HZ7A 3DOEA 4MGIR 1IEQA 2A1UB 3DC7A 3ICVA 4BBZA 1ENOA 2ERYA 3C7KA 1Z0UA 3VAYA 1XNGA 1F2UA 1Q2XA 1YK1A 2ZUTA 2Q49A 5KYGA 4DG8A 5A3SA 4I99A 1QH1A 5A5GA 4CM9A 1AKNA 4EARA 4OCZA 3PA8A 1BH6A 4QZVA 3MAAC 3WFJA 3DAFA 2H1LA 4KMMA 4HB0A 4MKFA 4NRDA 5JLAA 4BQNA 4UVHA 4HWOA 2XUIA 3GLGB 3U4DA 1OBVA 3FWKA 4WOJA 1DCTA 2JIOA 3DCIA 1PJTA 4EUFA 3L0SA 3KT8A 4KV7A 4TWRA 2FZWA 1D4OA 3VSEA 5IUJC 2AJLI 1ZK2A 3B85A 2BSQA 1PG5A 4TT3D 3RNLA 3RUIA 3KYDA 1WXEA 5C7YA 1E59A 3R3ZA 3MINB 4IZOA 5ILOA 4GHWA 2V59A 4F3NA 1MOZA 4W63A 1J7KA 1FK8A 2B7CA 1H2FA 2QMOA 4MWDA 3G9TA 2FSHA 3FCCA 3L1UA 4N8SA 4OAPA 5CB4A 3DNMA 1JDTA 3PNLA 4KMSA 4QBIA 1ZO8A 2X2OA 5IAGA 2HK7A 1DHTA 4LY9A 3GDWA 3DQZA 4R5HA 4RQUA 1N78A 2OK8A 2Z1NA 4DQDA 2DT5A 1JLSA 3KG2A 1SUIA 1FFDA 1UPXA 3GROA 5GGYA 1MT0A 4BTEA 3KELA 2J4DA 4R83A 4CR6A 1P2GA 3GEPA 1AQYA 5CA0F 1Q0ZA 3ZD6A 1RS0A 2C98A 2X0DA 1G5QA 3VBEA 1BVUA 1W87A 1Z0SA 2QTWB 4JBIA 5IUKC 1DEXA 1FFXB 4DQVA 1V5IA 3CHYA 5IU6A 2GEBA 4PF1A 4EG7A 3ENQA 4P4LA 2H3HA 1E2HA 1OAKA 2DQ4A 2FZGA 1S8OA 2Q0SA 3BXOA 5HP4A 4B73A 2HXGA 3WRWA 2C84A 5HK9A 3T3NA 2BGNA 5EIBC 3I9KA 1BWRA 3PENA 4YR7A 1MVOA 4JB2A 4D96A 2AFIE 1G55A 4YFYA 1KS9A 3N8IA 4NS1A 3TFQA 1TT5A 2BI7A 1OU0A 4RBNA 1EDZA 1PW5A 2XMPA 3KZXA 1FX1A 4N3CA 5JNUA 4YA6A 1FFXA 1P4HA 1U28A 2AMLA 1C9DB 3M81A 1CF2O 3ZPXA 4LXIA 1DQRA 1ZFNA 2H4XA 3LCVB 2B99A 3RRZA 4HWRA 4MEAA 1W34A 3C1TA 1LF0A 3LI2A 3T6KA 3K0FB 3JD1A 1RLUA 1H42A 5J4LA 5FPKA 3HHEA 3SYLA 3VUFA 2GUGA 2BGRA 2GN9A 3C5CA 4I3GA 4PQGA 3U9TA 1BA2A 3AEKB 2E6KA 4RZSA 5J1TB 1ABBA 3QKRB 4PG4A 4H16A 1NWCA 5CIQA 4R1MA 2R00C 4QYIB 1Z15A 2GI4A 3NUQA 1LC3A 5ALNA 1GSHA 3HDYA 4HUQA 4JNKA 2GDJA 2C95A 3E5MA 3I5AA 1JWBB 4B4KA 2BGKA 3TLGB 1I80A 2Q9CA 3G88A 4LXXA 4P7BA 3UQYS 4KMOA 1FMTA 4PX5A 1G8KA 1RJ9B 5EWMB 3Q9LA 3TW4A 4A0FA 4KVAA 4AKTA 1P0QA 2J45A 3AFIA 3IAHA 3PEUA 2ZJYA 1QDUA 2Q5IA 3GB9A 2G88A 3SEQA 4N3BA 5K6AA 4MMXB 2XMZA 3NS7A 3N86A 4HP8A 1U63A 3OA2A 3L6UA 2FJPA 1R5NA 2CHGA 4DFDA 1ZD3A 3GBVA 3LA8A 4ARIA 2GF0A 3M0EA 5BV0A 4WADA 5IYZF 2ZCVA 4HQ6A 4K87A 1PT5A 4IF4A 4E7OA 5L53A 3F6RA 3HUTA 2X58A 4ARSA 3UQZA 1QOZA 4LQCA 4NDAA 2Z8YM 1V37A 2VT7A 3K9FC 1BXRA 1Y1QA 5K0FA 1D6JA 3WWDA 3SQWA 1W6UA 3AETA 2IP1A 2IUTA 2B21A 2KE5A 1QJ4A 2RC6A 2XVYA 4R41A 3WGJA 4XLLA 2HF8A 2GCNA 3NHYA 3EBLA 3MT9A 2D3WA 3BICA 3D3EA 4PG7A 5LP6C 3HL4A 2A92A 4JFRA 4NBSA 5AFSA 3RG8A 1EIZA 4X64B 5KVCA 3GQBA 1I9GA 3E9QA 4L4SA 1UCFA 2VNAA 4GE3A 4MUMA 1F0YA 4A6XA 2A0XA 2HJWA 3AUTA 4BE4A 3I30X 5F1YA 4OTZA 5B3JA 1QKJA 1FMCA 3N87A 3WKEA 1FDTA 1QQ6A 4R6XA 4RHTA 5FBHA 2RI0A 4KB5A 4BUZA 4IW3B 1NQOA 1IATA 4OLFA 1CJUC 3CSSA 1YRHA 5M5BA 2WC1A 1GQOA 1V16A 1XDDA 4K1LA 5AI8A 3VI4B 4A7PA 4A8HA 9LDTA 3IUNA 3VR2D 3NHZA 3HLKA 4PYQA 1NFFA 3JWHA 3IE1A 2YFHA 4M0KA 3F2VA 4AF7A 2Y0DA 3ZWMA 1NZJA 4LEIA 1JA0A 2B8NA 1EWQA 4UHBA 3ORQA 2H2IA 4ZT7A 1WV0A 2HDNB 3D64A 4F3KA 1VLQA 3LE8A 3DGFC 3IDFA 2R2AA 4WN9A 4RUKA 1CZRA 1RFGE 3MW8A 4FGLA 5TE9A 3LT5A 1VKNA 1H8HA 2XDQB 3K4HA 5I9TA 2HGZA 2V54A 3W4KA 1RI4A 1KZ6A 4JI8B 1Y5LA 1S7GA 4NCKA 2XCSB 3HUFA 3OZIA 1GL7A 2IPMA 2JAPA 2REXB 1HQDA 1IHDA 2O8FB 3WE7A 3GH3A 3WLKX 2Y27A 4QLOA 3BHMA 3KSRA 3FJOA 4QOGA 1Q3HA 3JD4A 5HIJA 2PAFA 1RMYA 1F9EA 2P9FA 5TQ0A 6LDHA 2A86A 1JFTA 1R37A 4Z4QA 2IEAA 4MPDA 3BXPA 2R7NA 2F1JA 1IRXA 1Q1QA 5H83A 3THYB 4R1NA 4CF3A 4GD3Q 4ZOLA 1YE5A 3GLTA 4IGEA 2R6HA 4E33A 3H5NA 2YCLA 3H1GA 1IG0A 1G2QA 1QHFA 4YAKA 2WTXA 1R16A 4MW0A 1FDIA 1CUJA 2NU6A 2SICE 2QPAA 2QN2A 4DLKA 5B1EA 5K3FB 4AQ7A 4BUCA 1ZCAA 1NIPA 2GD2A 4HT3B 2J3DA 2EJUA 3P0FA 5DNDA 2IDZA 3C3EA 3SSNA 1V26A 2QUHA 3HJGA 5A5EA 4XB1A 3SYMA 1QP4A 3GUCA 4WEOA 1ZM3A 4D7AA 3AVTA 1W4CA 3C41J 2IYAA 4IXMA 4IVRA 1KZ9A 3I6MA 1HT0A 2DFPA 1XVAA 1QIMA 4XWKA 1RSZA 2PNFA 2PWBA 3F5DA 1T2VA 3NGXA 3VC3A 1HLGA 1AK2A 2HHJA 4WCVA 2E3JA 1W4ZA 2RK4A 2X8JA 1MEEA 3A1SA 1N5LA 1QHGA 2VK2A 1NKTA 2FN3A 1NW6A 1YQXA 2ZB4A 5ITZB 4XD2A 3WGIA 1T5OA 3TE7A 3W2HA 3TUZC 5BPHA 1ECBA 4JJKA 3EXHC 4D0LB 3VDXA 4YAWA 1G21A 2FPSA 2P2GA 2QENA 4XKJA 3W6OA 1H4QA 1OU4A 2OY0A 1M1NB 1YFKA 4L6AA 5A7GA 1OREA 4GFDA 4INJA 1ORDA 1I6KA 3M4NA 4MI9A 2PEZA 4PZ9A 3JR7A 4ALMA 4CV1A 3DZGA 1RXUA 4ZREA 1WA5A 1ULUA 1VSUA 4P4UA 4Q1FA 5HCUA 1GQQA 4GI7A 4Z9YA 2L42A 4NCHA 4WZBE 5FNZA 2H54A 1II8A 1E62A 4DEYA 1YJCA 3D7KA 4TKZA 4TMYA 1ABEA 3HBLA 1R6DA 3L8CA 5HZKA 1A9OA 1LLUA 1RADA 2Q4EA 3CEAA 3HM2A 3ME5A 5ALGA 5F35A 5TJ9A 3D8SA 3QEBZ 3EFEA 4IEFB 1DQZA 2NOAA 5DM1A 2J0EA 5HHTA 5EHIA 4S0XA 2NADA 3RS0A 1X77A 3DBHB 2XKKA 3GAZA 2HEIA 2PRYA 1J20A 5KYTA 2DERA 1YD7A 2P9TA 1B8PA 3S2ZA 3IOMA 3OETA 5JJ5A 5I7FA 4QJ4A 1YS6A 1Z45A 4LZOA 1E9EA 1N2IA 1JNXX 4G1BA 1LC0A 5KSOA 3FVWA 1GXSA 3UJHA 4XOIA 5I8ZA 2O2JA 4JHLA 2GBLC 2R8RA 3W4JA 2O8BA 5AKGA 3GJ8A 1U0SY 1LH0A 3MWGA 4PR3A 2OYCA 4DARA 3BMOA 1M2KA 3PSHA 1A9SA 3RW9A 1P7YA 4FOLA 3MOSA 1FLAA 1CW2B 4PBTA 3W6UA 4ZDIA 3CW2A 1GDHA 3RUFA 4BU0A 2J3HA 2YY5A 3JQ9A 5FBKA 5EEGA 2PBRA 3VYTB 1KDVA 3ZG6A 4IIVA 1FFAA 1HDZA 3OEYA 4V0ME 4DR6B 5CURA 2YYZA 2H4FA 3HKDA 1BJKA 4FE3A 3DHWC 3LDUA 4A1FA 1O9GA 3IIJA 3N53A 3OF5A 3PA6A 1CFZA 5CT5A 4P3NA 2GXAA 2PZAA 3O8NA 4ZA2A 1S8FA 3K92A 4KU4A 3B9QA 3A9TA 3S8MA 3GU3A 4QBHA 1CY4A 2ZBEA 4BLOA 4EGFA 3K15A 3LZ6A 1SVMA 1ZD2P 4MI1A 3R4CA 2QAJA 2J7PA 4EDFA 4PPYA 3NV7A 4YRIA 3K6SB 2GHTA 1TVCA 4I5IA 4JELA 1WVMA 5B1HA 2WILA 2IYPA 3CLRD 2YC4C 3IUJA 2F3QA 1GFWA 1LDEA 1SKYB 2BHTA 4XPZA 3GLGA 2QIPA 3UMYA 3Q9UA 1NF3A 3FMPB 3Q5DA 4LF8B 2WJ4A 4MYTA 3QWBA 1CUBA 3GXBA 2P0AA 3OM8A 1JFVA 4HJXA 2ADFA 3T7DA 3LY5A 3ZCUA 1TB4A 2PA0A 2J9XB 4MX8A 4OAQA 2B83A 5BQ3A 2DFKB 1EP1B 3SS8A 3HFRA 3IMGA 3O1LA 4O8ZA 2Q2VA 5HTKA 3S4YA 4M7RA 4YECA 1HTTA 3RBVA 5I4KA 1G8HA 5KOYA 2H2GA 1P33A 2VDWA 3AU9A 4GPTA 4E13A 3UBTA 5A03A 1J25A 3OLZA 3D2LA 3LQ1A 4R8MA 1FUEA 3EHEA 5EMMA 1E7RA 1XQ1A 1RWNA 1DRUA 3K0HA 3AEQB 4KPEC 1UH5A 1QF6A 2E18A 5TX7A 5CDSA 3ZW7A 2QTFA 3NBQA 2OCKA 1E3SA 4WQMA 2JFXA 2GZHA 5ADHA 1RXSA 5CA1B 1F12A 4AYXA 3AILA 1PD0A 1R15A 3QQ5A 5J4KA 2IFTA 2MINB 2A9PA 3OQPA 2EZ8A 1BA3A 2W70A 3VPHA 4RDCA 4EUSA 5AM2A 4GGMX 1V11B 3KRTA 5AVQA 5JD4A 2DTDA 2VLIA 3O8DA 4RJ2A 5K0NA 3O8QB 3GUZA 3MPOA 2AWNA 1DUIA 2W37A 4MLPA 3ZLBA 5CT4A 1ZOOA 3EISA 4EGQA 2PCJA 2IZZA 1JG1A 3FSGD 5IJXA 2OB2A 3N5CA 5LMCA 3KTFA 3O26A 4HK4A 4MCAA 3GLQA 5AQ1A 1BS2A 2K6GA 1GY8A 3D5QA 4PINA 3WLNA 3NIDB 5DGHA 3ZTTA 5BQFA 1X7ZA 2J09A 2ZT8A 3MTDA 5B2EA 3PF8A 4WLUA 2WUVA 1Z2CA 4B48A 5B4UA 4Q82A 4TRRA 2PR2A 1YB5A 3P2MA 1P7WA 1IZ7A 1L5HA 3TIGA 1DTSA 4EI8A 5CG2A 1DV1A 1TD1A 1P1RA 1NP6A 3YASA 2HFJA 3GGOA 3PQ2A 4BVJA 3H9UA 3B7WA 5I9BA 3QHQA 5JCOA 5TR9A 4AG6A 1YZQA 5D3MA 3I9OA 1WCXA 2EKPA 4OQDA 3CF4A 4DV0B 2O8EA 1Q14A 1J0XO 2ID7A 2AR7A 4BZZA 3AHIA 4R01A 3KPUA 4PYLA 4BGEA 2YVUA 4LSMA 1HQCA 2RHDA 1NDUA 4KXQA 4U0JA 4BVFA 3TXAA 3OPYA 3DZBA 4F6LA 3EZXA 1H8ED 3UMJA 3IPXA 4DM3A 2BGMA 3TMYA 1N7GA 2NUBA 2PUTA 1M83A 5TF4A 5I51A 5LQJA 4RENA 5ESXA 4QRIA 4BO6A 3CRNA 4LDQA 3MT8A 1KSFX 3A1DA 1C1XA 1ZHFA 3GMTA 4RF5A 2WJIA 3A6GA 1OYOA 3DXYA 3M70A 5HF9A 1NMXA 1ORTA 3E0QA 1Z4KA 5EOVA 4QUIA 2OMEA 2VJAA 5F1OA 2P3SA 2DKNA 5CCEA 2IV2X 3ZY6A 3TBFA 5LLSA 4A9AA 2V1UA 1JAIA 4LNUA 3EUFA 2HLHA 2ZCUA 3FLMA 2IBTA 3ND8A 1T26A 1UJ4A 1T8SA 4TLBA 4TL9A 5ES3A 3N70A 2ZRIA 3D1VA 2P6MA 4ZYVA 4UFPA 2M32A 4YACA 2IZ6A 2IZ5A 5BSHA 1JKJB 3NBAA 4MCJA 3LAWA 1EVQA 3WNCA 2VIIA 3UUWA 5HA5A 2A9JA 2W83A 3BCRA 2VH2A 1BVYF 3L9XA 1WPGA 3ZKWA 4Q3KA 1QIKA 1Z17A 1NBIA 4XQ9A 4Y2QA 3IAS1 5DHAA 3RI3A 3ZHTA 3D8UA 3OFKA 4LSGA 2ZM6B 3QXGA 3B12A 3PUZA 4DILA 4JROA 1FJ2A 5A3RA 3JD0A 1V7ZA 3EIHA 2FZVA 2GJKA 5DNVA 5JHGB 4JLAA 1EQAA 3WDKA 3THOA 2ZIXA 1GKLA 3DDHA 5DT2A 1SUWA 2P91A 1XV5A 2QNRA 1I7QB 4G41A 1MOPA 2GVDC 2YJZA 3QLTA 4DIOA 2D5LA 1FTNA 2ZQZA 5EXEA 4EF6A 3EPJA 1E98A 1KEEA 1YB6A 1XRPA 1AUXA 1QTIA 4OPMA 2CEAA 3SF0A 1GQSA 1N3BA 3HABA 3ADBA 1KU0A 4F38A 1GGVA 2A5GA 1L0BA 1B93A 5EHNA 3TIVA 2XVXA 5LZ5A 1DX9A 3CUKA 1U3VA 2HKIA 3TLGA 3QX3A 3D8HA 3KOXA 3ER8A 1W1IA 2XQGA 2BZSA 2B4TO 3MELA 4RU1A 3T9DA 3TZHA 3ZWOA 1M2VB 1RKXA 3IPCA 4Q47A 4BWFB 1MC8A 3E22A 4V1CI 2PUHA 4MJ3A 3ZWDA 3L8DA 5TC4A 2YV4A 2CVQA 4CMJA 1L8AA 3KS9A 3RU2A 4RWEA 2OXEA 2E6UX 4K9KA 5GP1A 2VPQA 4HDSA 1O0BA 3WQQA 2OV8A 3DDSA 4M1YA 4CW7A 4MB2A 5A9RA 3U7RA 5GGXA 5JCJD 3A6LA 3K9CA 1EB8A 3NTRA 4KQEA 4IWXA 2WOOA 2WAOA 3EXHB 3KDPA 4J76A 1A0OA 1OW3B 4D6PA 4G5OA 1QQTA 1RBQA 3I45A 2PZBA 3BL6A 3BWVA 5JQWA 1Q0SA 1I4OA 2QRPA 3CNBA 3I6ZA 1WY7A 4JT9A 3WJ7A 5SICE 2ICAA 2ZYWX 3WIUA 2DPGA 3MWLA 4DCPA 3KVNA 4BMZA 4YUYA 3FXAA 3CRRA 1C0PA 3U7QA 4P98A 3KT0A 3QG5A 3W5IA 1ZZEA 3JYLA 3O90A 5HJ7A 4FFWA 4J1TC 1ANKA 1FNNA 1Z5OA 4CDNA 2AN1A 4BFCA 4FEEA 1N0HA 1JEJA 4Y2JA 5B2FA 4L3WA 3DVAA 3R6GA 5KYYA 3JAWB 3RYTC 4FX5A 5LKAA 4L9WA 1R0ZA 4Q1DA 1EKXA 4C0SA 1Y98A 4WCFC 1G7CA 5K3AA 4FR2A 5KYKA 3R9WA 1KAHA 1JXQA 5K0JA 2C9ZA 2R25B 4PZCA 1K06A 1SUEA 3LK7A 1ELOA 3DT8A 4LJAA 3A1EA 1L7XA 2J3KA 3AOEA 1W0JA 2CXQA 5ALWA 3T5GA 2FR8A 2WJGA 2O8VA 1SBCA 2XXJA 4QXQA 1QG4A 4ER6A 4DMLA 4Y6SA 4FOPA 4WESB 4IIGA 1U7PA 3D6HA 4N9QA 3COWA 4NOLA 3MCVA 1SVUA 2ETXA 4BFXA 1M7BA 1LBIA 5CIWA 3RIMA 2LR0A 2YHIB 4G0PA 4QTXA 1NYLA 2I7DA 3LUAA 3PI6A 2IHNA 2ZBRA 4L9AA 1X92A 4Q18A 1GEEA 1MNAA 1TQDA 4RD6A 4YT5A 1JT2A 4NAUA 2QP3A 3RLFA 1JWLA 1P4GA 4BX0A 4M9UA 3GRZA 4G0QA 4TM7A 3GIWA 3G8CA 5A4FS 1AKYA 4W5RA 3LFHA 4DXHA 3MMPA 1T0IA 4AJJA 4CNQA 1FTQA 2C42A 1P2DA 1RPNA 2X1VA 3IT2A 4N3AA 1D04A 2G5GX 1VL8A 4X6LA 5LUAA 1HBJA 2J9FB 2EKLA 5LOVF 1X2EA 3ASYA 2RIRA 4MV0A 3VO9A 5AKJA 3I58A 5K1ZA 2GBPA 1ZP6A 3VTKA 3AKZA 4LOKA 16PKA 3DWGA 2PMBA 5F4ZA 3UXMA 3D2AA 1R8YA 3SKXA 3KUDA 1H2RS 1L3BA 3DMHA 3OOSA 2J0UB 5C8VA 2IPOA 1MB4A 3E84A 1XVUA 3VNRA 4PC3A 5CLFA 1CERA 1DC6A 2QTZA 2YV2A 2FETA 3H8WA 4KIGA 4MP6A 3BOSA 2EWMA 2JIDA 1IB6A 3JZFA 1WETA 2P8JA 1RXWA 1XKQA 2V5UA 2ZRLA 2VHVA 4NS4A 2RG1A 3AIMA 5IHPA 3LRPA 1PG0A 4U4AA 3T1QA 4J49A 3WLSA 4IUDS 1XMSA 1UPCA 4KAAA 2NN3C 1SCUA 2EFEB 4WGGA 1LW7A 1YZVA 2CHEA 3PGVA 4H60A 3H9BA 4NICA 2MOKA 3EGXB 5TB5A 2OYRA 3NTOA 4ZT6A 4DR1B 1PJLA 1K3UB 1Y4SA 5A62A 4O5AA 2B5OA 4XJSA 5I6DA 3DXXA 2GLTA 3CMMA 3VR0A 4KQWA 2TYSB 3DM5A 1U2TA 1QIFA 3CRQA 2XB2A 1OOEA 4MK4A 5T7BA 4JQCA 3C1AA 1L7RA 1RHRA 3GY0A 4M9XA 2GCIA 5AK5A 5L8VA 1JE1A 1K3FA 1R27A 3RABA 3TRDA 4Y2VA 3N3BC 4YROA 1Z6ZA 1IB0A 3A9VA 3SHVA 1E2PA 3V4LA 3N59A 3SAJA 2IOFA 1GAQA 2G7ZA 4O1IA 2GZDA 5HKKA 4CEIA 1EMDA 1I3LA 4I8IA 1VRVA 3S2SA 2HLPA 2HW8A 4LA4A 3BWDD 1IN6A 3EUEA 3UW3A 2ZDQA 3F74A 4GXNA 1WP9A 5DHPA 3HKEA 4D3ZA 2ANBA 1ML4A 2WEKA 1YV9A 3GRUA 5F5NA 4V02A 2ZPAA 3G13A 4L4XA 5EJ4A 2X40A 1RXVA 4OHZA 3OBIA 2C5GA 3MD0A 5H82A 4BGUA 3HBMA 4RK0A 4AP9A 3U3XA 5KQSA 1AHPA 3KZNA 4LWZA 4BLWA 6REQB 3MOIA 4C5BA 3DOUA 2J4CA 4KYUA 5JYEA 1OROA 1F06A 2YIDA 5CK5A 4S12A 4NZYA 5JWHA 4DIEA 2UVDA 3A9CA 4GICA 4QAQA 5JJIA 2X3YA 1Q95A 2GKGA 1B7GO 4R8KA 2ONJA 4KH0A 4FYIA 1LJUA 3QW4B 4MS1B 3H4IA 1WCIB 1X8XA 2CFIA 2X0FA 4BNGA 4D3DA 4D25A 1DKLA 1XCMA 1HRDA 1EIWA 2B2CA 2LUOA 3JD2A 2Y0EA 5E1BA 1QYIA 1SCAA 4ZHQF 4Z4FA 1H4SA 5LMZA 1Z6AA 4PNZA 3AR3A 3OJXA 1KQPA 4PWZA 3K0KA 4B3BA 1FP4A 4TYNA 1RLIA 1QFYA 4O25A 3U5TA 1CF4A 3BSFA 1MO3A 3HJAA 4OGLA 4DBLC 1ZI9A 4CIWA 3GT0A 3WO1A 2DX7A 4BOYA 4ZQHA 2EFCB 3L06A 3T7KA 2R66A 3K0SA 3EULA 3FBWA 5BOVA 5EWLA 2DY1A 4ZDKA 3T3MB 2AVDA 5KNCD 2ODEA 4B40A 2AOUB 3ZEAA 4GYYA 1YQEA 4B7ZA 2B3DA 5P8WA 5E7MA 2P69A 4JCCA 4FWIB 4NV3A 2QN9A 1CY0A 3M2TA 1ZK4A 4MUXA 5AW5A 2BD0A 2DPYA 2VSXA 3ED1A 4MS4A 1EH5A 4CTNA 3GRAA 1FJGB 1OGYA 3SOZA 1WHSA 4GOJA 4BPRA 3V1KA 2H1FA 1CE8A 3B6IA 4WK4B 4XWTA 5KTSA 2WMDA 4GYJA 2ZIVB 1IIBA 4H77A 1W25A 5CBPA 1HYHA 4QTZA 1YBFA 3HEMA 4YAUA 2AVNA 1D2EA 1T3GA 1LLCA 1A4UA 1J39A 3IAM1 1JEQA 3PLNA 1E1LA 3OQBA 1XR3A 2V7QA 1E99A 5AHKA 2H2HA 5CTAA 1IY2A 2LD4A 1MZVA 2JIPA 4Z1MA 2JIRA 4G23A 1BMFD 1BQ3A 3R5HA 1V0JA 2AJCA 4X7PA 5CLQA 2GZ3A 2HMTA 4YIKA 4NXNB 1RLJA 1NJ1A 3GDOA 4H18A 2C00A 3W77A 2Q5OA 1YGPA 4TLAA 3MXTA 1MHTA 4LFBB 1C4WA 1AGRA 1URPA 5JNSA 4ESHA 4UAJA 2Q5HA 4LHVA 4LDJA 3MUOA 4O1MA 4NFYA 2QORA 3MIIA 4EA7A 1OA1A 3O8RA 3TBKA 1DBRA 4N5HX 5BP7A 4PCUA 1YCFA 5AW6A 3DF9A 3EX7C 4RA6A 3V7FA 4OYRA 3ZIDA 1PFWA 1R88A 3K2QA 3PKZA 4UU1A 2AKYA 3LS2A 5B36A 2CUNA 1L2TA 3A6PC 3ICEA 1DIRA 1EYZA 2A1TS 2BH2A 1C3OB 3RAJA 2WKWA 4HVLA 3WKDA 2BTQB 2HF7A 4PQRA 4QYWA 2BGUA 3KDAA 4JL5A 4C4OA 1W88B 1DWQA 2NXEA 3BJIC 4H27A 4LHXA 3RRXA 2HQRA 4Y9RA 3OLYA 1V45E 2XJ4A 3EZGA 2YWBA 3JALA 4MUKA 3GJ0A 4HMQA 5JZ9A 2XEDA 1A2QA 2P4QA 3WWZA 1T5TA 4JI0B 3OJ0A 1TEHA 3OM1A 3LWNA 2X13A 4XJVA 2WNSA 2ORWA 2O3UA 3LXXA 2C94A 3LYAA 5DTRA 2VAXA 4GRAA 4MUBA 3ZQUA 5A4IS 3MWFA 1UJ2A 1WCYA 2IYZA 2QD1A 2MU1A 2XTAA 4AMUA 5AVWA 2HQSA 3UJ8A 3S40A 1L4FA 4KLRA 1E5DA 4PSKA 4YCCA 2PX5A 4G3XA 3VR6A 5C1DA 4EG4A 1WNTA 3DH0A 3QBDA 5DM0A 5K8LA 3ICOA 3MRVA 3K0CA 3RG2A 4C14A 2JJ2D 5DZSA 3WRXC 4PHTA 4AXXA 1J8DA 3TZBA 1TU3A 1ZI8A 1CRZA 4BNFA 4EB6B 4A4DA 1H4VB 2OHHA 1FVOA 2EKDA 4LW8A 4IMJB 1Q7RA 2JJQA 3PGJA 5EKSA 1KNQA 1NJFA 5FO0A 4N47A 3DZ8A 3DL0A 4KR2A 5AVOA 3NCHA 1GNQA 1NVEA 1NLFA 2JCBA 2V0NA 3LIIA 4EEKA 5KSYA 1BDJA 4Q4DA 2ATIA 4AZ3B 2BC9A 1QRRA 3HYLA 2DOKA 3LSTA 4HS4A 2FPPA 1M72A 4IUCS 5EKTA 4D2IA 4EFNA 2V3WA 3LPLA 1XZEA 3EC7A 3T34A 3G0BA 4OJQA 4QX6A 2WF8A 5C0OE 2C58A 2YOFA 1E32A 2XIQA 3HA7A 2WV9A 1J2UA 2RBKA 3BA1A 2FUG1 3L84A 2EGHA 2ZTUA 3G59A 4FN5A 2WAYA 4EI7A 3L1VA 3W7VA 2EFDB 1CWUA 4LRXA 3RTCA 1QB7A 1ZH0A 3E23A 3OEHA 4RTJA 4CF4A 1E4VA 1JQKA 2BKAA 2R11A 4Q4HA 3JVIA 3LGSA 2J0VA 1C9EA 1IOLA 1ECPA 3H8SA 4W1PA 4QG3A 4QUEA 1P2UA 3C1UA 3VPXA 2B30A 1UDAA 3OPVA 1LV8A 2CMFA 4FFMA 5AK6A 4D0NA 2J3JA 4OMUA 4OP2A 1VGRA 5IF9A 3JTEA 5CJJA 2IQIA 4R2LA 2O2EA 2DUNA 4ZZ2A 2OQ2A 3WDSA 4RK4A 4KFCA 2E5LB 2X4GA 5TMBA 3JV7A 2HV9A 1Y1LA 2L69A 2X5XA 4QFDA 3M6AA 3ZKWB 5KOIA 3BS4A 3AF2A 3TK1A 3NHKA 1N5RA 1G5IA 1XN4A 1XZGA 3EZLA 3T5TA 2RH9B 5T67A 2IIVA 4RGBA 1SCUB 1U2RA 1ZAYA 3R4VA 2BKUA 2I6UA 1RQGA 3TJMA 2IZ1A 1S96A 2YUIA 3ADOA 2JCXA 5CCDA 5E38A 5TEVA 4DNXA 4V38A 4BWGA 3R2JA 1G6OA 4N7RA 3B6MA 1LQ2A 1CRLA 4WASA 1HYQA 3HV2A 4ER3A 1FQKA 4Q3OA 2FPXA 3LUFA 3WYGA 1V6AA 4M6WB 2CCKA 1FA9A 2ZWMA 3H3FA 3OTWA 3CZ4A 1HG0A 3QVSA 2E4YA 3UIEA 5BR8B 2E4WA 3ANXA 3WAJA 1JXMA 1S3IA 2H1WA 1BWSA 3PTZA 4Z8XA 2XCLA 5IVPA 1XZ8A 1WHTB 2YWGA 1RI3A 1X7DA 5HMLA 3QZUA 4H6VA 4HADA 3W8FA 1G20E 2Z6AA 2PZEA 1CJMA 1VE3A 1YAHA 1UFRA 2FF7A 3AFHA 4BBAA 4D4MA 4DRZA 2PWPA 3LHIA 2C2YA 1PF7E 3BE5A 2NPFA 3ZOZA 3R7AA 1XL0A 2XA2A 3ZJ5A 5L3SB 1AX9A 1Z83A 3RVDA 1EGVB 3BRQA 1KI4A 3PKJA 4P4SB 3SJ7A 3PUXA 2JCSA 1AUOA 2Z98A 1QYWA 2HSZA 2MSDB 4MQEA 5JS8A 1YH3A 7MHTA 4WH0A 1M75A 1OE0A 2OT3B 2HA0A 1H65A 2ZVQX 1FP7A 2JEZA 4GX5A 3U7FB 3HCAA 3I2KA 4H7EA 4Y2GA 3JQQA 3NLLA 2H6EA 4LTDA 4R51A 4G2NA 5CFPA 3H2YA 1HTWA 2VJPA 3TX6A 5L3QA 5EA2A 2B4QA 3VYSB 5HR5A 2OV1A 1YOVA 5K8UA 4V0KA 4B35A 5U9CA 1NJ8A 2XSZA 3CINA 4DG5A 2AXPA 1MU0A 1HYEA 3ANNA 2I1LA 4OREX 3DUFB 2EJWA 2W6OA 4XVQA 2A9QA 4AKHA 3QJYA 3WWOA 2IOHA 2QPLA 1JSLA 4NKRA 5C80A 2ODQA 3E9DA 2O4CA 4KK4A 4J90A 1FRFS 4KFSA 2OK7A 2BFFB 1E2JA 3EFOB 1MHPA 3CU5A 4LMAA 3QWHA 3EYWA 2QROA 2O0KA 1JH8A 3TRJA 4NEGA 2XD4A 1V96A 2O8DB 1E6MA 4OA8A 1M8GA 2IRWA 2MMCA 3HVIA 5K2MA 4H1VA 4Q48A 1QVVA 1E6WA 5FTWA 3ETEA 1CY6A 2QJWA 2BEWB 3ND6A 2D8AA 3O9ZA 3UB4A 3RVPA 1KPGA 1ZY2A 1II0A 1QHSA 1X7YA 1C4OA 1ZLYA 2HA7A 2QQEA 2ZAOA 2O52A 2ZRKA 3IUYA 4FC7A 5DT9A 3EEYA 3AW9A 3RS9A 5JNVA 5B1DA 4PVDA 2Y92A 1C1XB 2EZTA 2XR1A 3L8EA 4KXVA 4Q3DA 2C4KA 3IP6A 5E3JA 1VBFA 5EG5A 3RIXA 1R0LA 1ZGAA 2X9GA 2XQVA 4OQMA 4E11A 4YRKA 4URXR 2PUFA 2BAGA 2EZUA 1ZMXA 5IKMA 5KB3A 4OHOA 3NYIA 3OE1A 5J2TB 1KDOA 3H97A 2C2XA 3D6TB 4RW0A 5DEIA 1MX5A 3H86A 2PX4A 4NR0A 1VIAA 2E82A 3ZNQA 4BJ5A