4JUIA

Crystal structure of tannase from from lactobacillus plantarum
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
470
structure length
470
Chain Sequence
b'SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTAAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 160
structure length 470
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4juiA00
3LCRA 3H1AA 4EY5A 2XQFA 3B12A 4CG2A 3ZLVA 2XUIA 3WLAA 5LZ4A 2QKYA 2VATA 4L72A 4B9EA 3GA7A 3GZJA 5IKXA 1UOPA 3DKKA 4QDUA 2WJ6A 1VZ3A 5EIAA 4W63A 1MAHA 1AQLA 2JEYA 2WHPA 3B5EA 3OPMA 4YASA 2K2QB 5EIHA 1EB8A 4K6HA 2JEZA 1MU0A 1J2EA 4XWGA 5SYMA 1T4MA 2J4FA 4BBZA 3ZPXA 5HKBA 5I9IA 5LKRA 5LZ8A 4EY8A 3O4IA 1Q83A 1QFMA 1UT6A 3ESBA 4BAGA 4UBJA 1UOQA 3N2ZB 3QPAA 2I78A 3IB3A 5BWBA 3O4JA 4RGYA 4UHEA 3R0VA 3CXUA 3O4HA 4BE9A 3Q0TA 2ZJ6A 2H9YA 5AHXA 4P9NA 3I2GA 4JYPA 5EHXA 2XB6A 3DQZA 1FJ2A 4H7JA 1NU8A 1A8QA 3E1GA 5AKYA 1YA4A 4FFWA 4MXDA 2HA2A 1A8SA 3H2HA 4Y2TA 1N5RA 1W76A 5D3KA 3SK0A 4QLOA 3DJYA 5ALLA 4WDRA 3QM1A 4I3FA 3HYSA 4BRZA 2O2HA 3STTA 4TVKA 5ALMA 2XMSA 1CUUA 5CH3A 4EY6A 1E8NA 5AM4A 1XZAA 4G4JA 5ALFA 1CUCA 3A2LA 1MNAA 1EI9A 3QPCA 1JI3A 4DTCA 3PE6A 3WL8A 1PV1A 3V1MA 5CXXA 4MEAA 5JATA 2ACEA 3C5WP 3DL7A 1DX4A 5CURA 3F96A 1HPLA 1THGA 2GYWA 2XDWA 3I2KA 2QR5A 3G8YA 3M83A 5C81A 2O2GA 4LIPD 3D2BA 4N5HX 1C4XA 2OGTA 4BATA 3FWHA 2W6CX 4Q3KA 1XQVA 2D5LA 5JZ9A 1DQYA 2RHWA 1XQYA 2Z8ZA 5ALPA 5EHZA 2XQKA 3FCXA 5AKLA 2Z3ZA 1YS1X 3DCNA 5AIAA 4G4GA 5JADA 4FNMA 1ZGCA 5HF6A 1LPPA 4B85A 1AZWA 5FDFA 1TCCA 4FNGA 3I1YA 4HZGA 1SFRA 4BVKA 5A2GA 5FKJA 3AIKA 2JGKA 1EDEA 3WK5A 4UHFA 4J7AA 4H7KA 3E0XA 4NMWA 1CUXA 4BP9A 4J0HA 1AKNA 2H7CA 2V98A 1GKLA 1Y37A 1B41A 1EXWA 2HU5A 2AXEA 4UUQA 2Z5GA 4LHEA 1Q0RA 1D07A 2WJ3A 5KREA 4Y9SA 5AKZA 4RPCA 3G0GA 4H7FA 2RGUA 4HRYA 2PU5A 4B6GA 1LZKA 4QWMA 3FYUC 2ES4A 3WL5A 2WHPB 3I28A 2XMGA 2Z3WA 2OXEA 4FDMA 3WL7A 3VJLA 3DKRA 2HHAA 2CUTA 4K2AA 1ACLA 1KEZA 4H77A 5ALUA 4QDZA 1E8DA 4UHHA 2J3QA 5DNUA 4H35A 3BDIA 4Y7DA 3WIBA 4WJLA 3STXA 3DOHA 3EQ9A 1ODCA 1AUOA 4Q82A 2VTVA 3STWA 1YAHA 1GKKA 5FRDA 1H22A 4W1SA 3O9MA 3WK8A 3TEJA 4BCCA 5HF8A 4I4CA 3WA7A 4H18A 3A70A 3V1KA 1K63A 3QMMA 2WIGA 4HVTA 5AM1A 1XFDA 1ZI8A 3BF7A 5CT6A 2JBWA 4X6YA 2VQ6A 1CUZA 2PX6A 1JT2A 3I2IA 1R9MA 4NVRA 4J0GA 5J3JA 1GPKA 1CR6A 2BKLA 5HQ3A 4AZ0A 4F21A 1TKRA 2DCMA 2VJCA 4LXHA 3WI7A 2BFNA 3R3UA 1LLFA 1CQZA 3ANTA 4EY4A 4DIUA 5CTAA 1XKTA 5CT9A 1QIFA 3HABA 4LKOA 3QZUA 3T52A 4YK7A 1WOMA 2QJRA 3M82A 5AKJA 5EGNA 4JYMA 3IDAA 3OOSA 1F8UA 4C6HA 1AMNA 4UBOA 5JASA 3H2JA 2XUAA 4L0CA 1IUOA 4GXNA 2HIHA 2V96A 1QTIA 4B82A 1CVLA 4UFNA 2HDWA 2PSFA 3G0CA 3K9BA 3V1NA 2H7YA 3RLIA 3V9AA 2JIDA 3AIMA 4B81A 1CUSA 4MQLA 4MEBA 4PW0A 4S0XA 1FFDA 4L9AA 4D9JA 1TRHA 5ALEA 1CFJA 4ZV7A 2PPLA 2RONA 3KXPA 1CUIA 3ILSA 3SWWA 4C87A 5CBKA 4G4IA 3WYDA 2OPHA 4HXGA 1VOTA 2HA7A 2VJBA 2C0QA 4DNPA 1GPNA 5ALQA 1QO9A 4CCWA 4X91A 5ALKA 4X6XA 4AB1A 2OQVA 1MX5A 3JW8A 1XZCA 5AK4A 3G9XA 4UBMA 1MPXA 3N0TA 2UZ0A 1FFEA 2WIDA 4RE5A 2BGNA 3LLCA 1MJ5A 4GDMA 1EK1A 2IX9A 4BAUA 2QXUA 4U2GA 4UBKA 4X94A 4K5QA 2XUGA 4HXFB 4DMFA 1UKCA 1K6EA 2BUAA 5FPPA 5JD5A 1K5PA 1YAJA 2PL5A 1JJIA 4GEGA 3V1LA 5CT8A 2FJ0A 4JUIA 1CRLA 2GZSA 3CN7A 1SCIA 4BYMA 3L1HA 4Y2RA 2RIPA 5DNVA 1W75A 2PUHA 1ZD3A 2PUJA 1OILA 4ARAA 5A6VA 4X93A 2X76A 2BJHA 1Z68A 1EDDA 1LPOA 2CJPA 2PU7A 5K3DA 2C0PA 1E3QA 3G9UA 1IZ8A 1QIKA 2C58A 4C4ZA 2PSJA 2XMBA 4X90A 5ALIA 3S8YA 4F5ZA 2XT0A 3QITA 5CH8A 5LZ5A 4DMKA 5HK9A 4U2CA 3YASA 4FFVA 3PI6A 1MT3A 4I19A 3CN9A 2WU3A 3WL6A 3I2HA 1PJAA 1MAAA 1XZJA 5AK6A 1ZICA 3R40A 4F60A 5CT5A 2HU7A 5HQ3B 4MJ3A 4Q3LA 1G66A 3FSGD 1ZD4A 1USWA 2WUGA 4BP8A 3C6YA 4OUKX 5T4BA 4Y2PA 3OM8A 3WMRA 3C43A 4ZI5A 2VJDA 3G9ZA 2RAUA 2ZSHA 5HKAA 3PUHA 1YASA 1UXOA 4AX4A 3FNBA 1LBTA 2DQZA 1TCAA 1DWOA 5LKAA 2DFPA 3BJRA 4X7BA 1MNQA 3HZOA 1QZ3A 3WWEA 3R3YA 1G5FA 3VKFA 3R3ZA 1ZD2P 4JEIA 1XZLA 4AO6A 3R3WA 2D0DA 3C6ZA 5JAPA 1EK2A 5DLPA 5DJ5A 5ALGA 4IQ4A 1UK9A 1QOZA 2CMFA 1EB9A 5K3FA 2XUFA 4C4XA 3DL4A 4Q05A 2XQGA 2HRRA 2ZYHA 4WFIA 1CUJA 3CCBA 4EB0A 1E66A 4CG1A 4C4YA 2GBGA 4CFSA 3VISA 3W05A 1ODSA 3DD5A 4AZ3A 3PFCA 2ORYA 5LZ7A 3RM3A 5I8PA 4AMZA 2XQJA 5DYWA 1HL7A 3DOIA 1AGYA 4P08A 1LPAB 2PSHA 3F8SA 3OG9A 3F9CA 2WHRA 3H19A 4MWTA 5EI5A 4L3WA 3I1IA 4H7IA 5AKIA 2HA0A 3AUKA 5AO9A 5A7GA 1BEEA 4EZIA 4LXIA 4AXBA 3G9TA 3TJMA 5IVHA 4C88A 1VA5A 1XRNA 2WSLA 3H2IA 5JD6A 1G42A 5EHNA 1HBJA 4BCDA 1DWPA 4OSEA 3M81A 1QTRA 1G4HA 2I3DA 2WG2A 1YSCA 3O4GA 2R8BA 4H7EA 4BDTA 5DTIA 3X3HA 2XUQA 3GUUA 2ZYRA 4UBLA 5ALOA 2GBFA 5JAUA 4BVLA 1C7JA 1HLGA 5HK8A 1ZIXA 4M0FA 4ZRDA 2CEKA 1P0PA 2WTMA 2ACKA 1QIMA 5T4HA 2YXPX 1IUPA 2C4HA 1U4NA 2LIPA 3A2MA 2JGJA 5HFNA 4V2IA 5AICA 2YYSA 3IUNA 3OC0A 2JGMA 1R9NA 1K8QA 1UKBA 5A71A 1SC9A 2CKMA 3WWOA 4QNNA 2XMRA 4ARBA 2XUDA 4AO7A 4WCVA 4XIIA 3I6YA 3OURA 5K3EA 3QPDA 5AM0A 1P0QA 2QVBA 4PQEA 3ZI7A 5JZBA 2FUKA 2XUPA 3C6XA 3O0DA 1EA5A 4Y2QA 4DMHA 1R50A 3WK7A 3DLTA 1XZBA 3B3QA 2I3ZA 3HI4A 1VZ2A 2V97A 4AN0A 5ALZA 3EQ8A 2WLSA 3K6KA 5ALJA 2QOEA 1C7IA 2B61A 1QLWA 2WIFA 3DYIA 3E3AA 1J1IA 4A5SA 4DM7A 1CUGA 4FOLA 3BIXA 2WU4A 3AINA 3AFIA 5T4EA 2OCIA 4PF1A 1QJ4A 3R3XA 5K3FB 2PKYX 3R41A 3VJKA 1WPXA 4M0EA 1CV2A 1TK3A 1CUEA 2XQIA 1RWQA 3D59A 5AI9A 1QIJA 1MN6A 4UHBA 1MTZA 5JAOA 1CUFA 4IO0A 1J06A 4DNFA 2Y2VA 3VVMA 2HA3A 3MVEA 3SC2A 4KE9A 4TPKA 5DNWA 1BN7A 5FOQA 1XROA 3FYUA 2QS9A 1ETHA 2RI6A 4OYLA 3HC7A 4F0JA 1UFOA 1YR2A 4Y2UA 3D0KA 2WG1A 1IUNA 4B84A 3M3DA 4KJXA 1LZLA 1JJBA 4E15A 4W1PA 3WWCA 5ALYA 3HEAA 4DLNA 3FLBA 1EHYA 5A7HA 5HFAA 4GECA 1HDEA 3GFFA 3KSRA 1JJFA 2BCEA 5BWCA 1AC5A 3TGLA 2DR0A 3EQ7A 1QGED 1U8EA 1T2NA 3FOBA 5ALNA 5FLKA 1CLEA 3WIOA 3ICWA 1CPYA 1F6WA 4UBNA 4CI9A 3DDUA 4Y2YA 4CIBA 4KRXA 4J0CA 3PFBA 4WFKA 2WILA 1ZGBA 3IIIA 5ALTA 4W1RA 1IZ7A 1S8OA 4XJVA 3WJ1A 2BGRA 2QUBA 3H1BA 2H7XA 3IBTA 4Y2JA 3BJMA 5LP1A 1F0PA 3DNMA 1DWQA 4J0DA 5JANA 1BEZA 3WKEA 3K2IA 2B20A 3JYHA 4CIAA 1ZD5A 4Z49A 5HZGA 2HA4A 1GXSA 2B9VA 3FCYA 1VE7A 2OGZA 2WM2A 2HFJA 1XRLA 5DYYA 3UMJA 3VVLA 3I2FA 1SCKA 2JF0A 2P8SA 2BAGA 1VE6A 2HL6A 3G7NA 1UK6A 5AI5A 3W9BA 2EDAA 2WG0A 3ANSA 2WFZA 4KACA 3D3NA 4PNZA 2OAEA 1RYYA 3WKBA 4Q3OA 4ZREA 1JU3A 2QM0A 1XRMA 1LBSA 1KU0A 4KRYA 1EVEA 4BZWA 3WA6A 2XLBA 1FFAA 1XZFA 2G5TA 2YH2A 4C01A 4G8BA 2ZJFA 1VXOA 5JD4A 5BV7A 1XKLA 4OD0A 4FLEA 5IVDA 3WK9A 4G8DA 3NOXA 4E14A 1ZI9A 1JMYA 2ZJ7A 2ZVDA 2NW6A 6YASA 1O6GA 2O7VA 1SCQA 3EF3A 1CUVA 3WK6A 1JFRA 5AOBA 1QO7A 2XUOA 3DS8A 2J4CA 2WTNA 1QIHA 1MO2A 4P93A 5IVKA 2WJ4A 2VEOA 3BIWA 1A8UA 2JGFA 4Y2XA 3GROA 3D7RA 4NS4A 1DINA 2QZPA 3RARA 4A23A 5AKKA 1WB5A 2HU8A 5E2IA 4FBMA 1DU4A 3W04A 5ALVA 1P0MA 3LIIA 1RP1A 2QJWA 1XZHA 3PF8A 4XX1A 4CG3A 1SOMA 4QA9A 1M33A 5D7BA 3FYUB 4K6GA 2W22A 4AN1A 4KE7A 4Y2SA 1L7QA 3WKCA 3I6ZA 5EHQA 3LP5A 3U0VA 3KOOA 2XMDA 4ROTA 5FPQA 3VXKA 3D4LA 2C5GA 5SYNA 4JH0A 2ZYIA 1XLWA 1F0NA 2PSEA 2QRUA 2CB9A 4AMYA 2RHTA 1HKHA 1H2ZA 3FLEA 3WKDA 4WFJA 2HA6A 2GYUA 1ORWA 3EBLA 4WY5A 3D2AA 1E89A 4P92A 3HRHA 1ACJA 3A6ZA 2B4KA 4J3JA 3U1TA 1XRPA 4QDOA 5E4JA 3HLKA 2IITA 5A62A 1E5TA 1Q84A 1GGVA 2XMCA 1EVQA 3FVRA 4BTVA 5H3HA 4QEKA 1CUDA 2AJDA 4X00A 2JGLA 4WY8A 1VJ5A 2GBIA 5ALHA 5K5EA 4OB6A 5IH7A 2OCGA 5AOAA 1I6WA 5D6OA 2OG1A 4MYSA 3RK4A 5AIBA 4HXEB 3IUMA 4Q34A 4ETWA 4MYDA 1CUAA 1U2EA 1XRQA 2GZRA 5CH5A 1CUWA 1XZIA 2VT6A 3H2KA 4A16A 2H1IA 4PSDA 3IURA 3BF8A 1HQDA 4W9RA 5AP9A 3FSGA 2HFKA 2VF2A 3G0BA 3QMVA 4DMCA 4KEAA 2G5PA 2XLCA 4HS9A 3QBJA 2XUHA 4BAZA 1YCDA 3QH4A 3H18A 3W2TA 2WFLA 1BCRA 3C5VA 4B0OA 3FAKA 1ZI6A 2O2IA 5KBYA 3PUIA 3H17A 1TQHA 7YASA 4DSAA 5IVIA 2QUAA 1X2BA 4EHBA 4K6KA 1O6FA 2QT9A 3E4DA 4X95A 1MX1A 3IVMA 4GI1A 1VXRA 4ZV9A 4X3CA 5LZ2A 3ZWQA 3D5EA 1ODTC 4DGQA 2Y6UA 1BCSA 1WPRA 2R11A 3NGMA 2AJBA 1ZOIA 5BOVA 5AK3A 1IMJA 2OGSA 5AKEA 4YX9A 2VAXA 3WWPA 1R1DA 1A88A 4GLBA 3BL8A 2XUJA 2OCLA 3WZLA 4BRSA 4J0IA 5JARA 4UPDA 2Z8XA 3ZLUA 1XQWA 5ISMA 4KR0A 4H7DA 1THTA 5JYCA 4PV7A 3UUEA 4J0JA 3SX4A 3STYA 1KU6A 4MQMA 4OPMA 1P0IA 3P2MA 5AH0A 2VSQA 3PICA 1ZJ4A 1Q0ZA 4PSUA 3WZMA 1CEXA 4FHZA 2J3DA 4FBLA 3C45A 2HRQA 2G4LA 1LGYA 1X70A 1QIEA 3LS2A 1WB4A 2EEPA 4H0CA 2HA5A 3EIOA 5AI8A 3GBSA 1FSSA 1Y7IA 4GWLA 2O7RA 4UHDA 3VJMA 3I2JA 5ALSA 4OYYA 4KYVA 1U65A 3QMWA 4HRXA 1XLUA 3WWDA 1UWCA 5JIBA 2AJCA 5CW2A 1EDBA 4GW3A 4FWBA 5FUMA 4OCZA 4FLMA 2V9ZA 1YB7A 5ESRA 1ZIYA 2PSDA 1QIGA 5C8VA 3BE8A 1H2YA 4EY7A 3W06A 1ISPA 1CIJA 3NUZA 3ZLTA 4HAIA 1LNSA 3FBWA 1GQRA 3WJ2A 4UFPA 3ED1A 4IHAA 1ORVA 3HXKA 2BUCA 1DX6A 3CCCA 4LYEA 2AJ8A 2HADA 4E11A 2I03A 2CBGA 4Y2VA 4IH4A 1K4YA 5HF9A 3AIOA 4U2DA 4RE6A 1CQWA 4QE3A 4X92A 5AM3A 1X2EA 1XZDA 4EA6A 1H2XA 1TIBA 3H2GA 4BB0A 2OLEA 1WB6A 2ROQA 1DTEA 2WFLB 3WYNA 3FYTA 3FVTA 1IVYA 4GHWA 4BE4A 3KDAA 5D3ZA 5AKGA 1J07A 2QXTA 5ALXA 2XUKA 4BVJA 2VJAA 2OQIA 4N5IX 3C8DA 5AJHA 2VT7A 4DSZA 3NWOA 4G5XA 4H7HA 4ZXFA 1E8MA 4IH9A 5AI6A 4DNOA 4CCYA 3KWJA 1R3DA 3H04A 5K3AA 1AX9A 3PF9A 3D2CA 4LYDA 5YASA 2JGEA 1NU6A 4BC1A 1OXMA 1PFQA 2WIJA 4MWSA 4X85A 4RNCA 1CUHA 1BN6A 1FFCA 3BDVA 1BROA 5ALRA 5AI4A 1BRTA 1WHTA 4G1FA 4FTWA 1UK8A 1WM1A 3G0IA 4YPVA 4JNCA 1VLQA 3WKAA 1BS9A 4FLFA 3AZQA 5I7UA 4UFOA 3ICVA 4QWWA 5AI0A 4J03A 2DHDA 1GQSA 4FKBA 4J0KA 4ZWNA 3O9VA 5C8ZA 4UHCA 2ECFA 2WUFA 1OCEA 4BTLA 1XZGA 4OU4A 4G9GA 3R3VA 3W9UA 4NZZA 2AJLI 3UUFA 2IIVA 5E4YA 3A2NA 2EDCA 1XLVA 2C7BA 3IULA 1QE3A 1YA8A 1L7RA 4B0PA 5AKXA 1UKAA 1JMKC 3KWFA 2X5XA 2VA9A 1EINA 1MX9A 1JKMA 4U2EA 3L1IA 4GBGA 4HTAA 1YS2X 2JGIA 3S2ZA 3JWEA 5HF5A 5DTJA 3STUA 5CT4A 3QVMA 5K3BA 5JAHA 2C5FA 4OU5A 4E46A 4N8EA 1B6GA 5KWJA 3C87A 4Q1VA 3ZV7A 1NX9A 4G8CA 5LYYA 5ALDA 5JZSA 2HM7A 3IUJA 4DNQA 4AO8A 4QDTA 2QMQA 2Q0XA 4B7ZA 5DYTA 1YB6A 3WK4A 5T4FA 4U2FA 2Y1KA 2G63A 4PO3X 4INZA 4UBIA 3GELA 2XE4A 5CRIA 5LLSA 1QONA 4QZVA 1EH5A 1WHSA 1A7UA 2Y2UA 1H23A 4PSCA 2WUEA 1XZKA 1LPNA 3F98A 3MGAA 3ESCA 2XI4A 1Y7HA 2DSNA 1FFBA 1DQZA 5CXUA 1GPLA 4ITVA 1QFSA 2BUBA 1EX9A 5E4TA 4X6UA 5JALA 3C8HA 2CZQA 1XZMA 1CUYA 4N8DA 5C7YA 2VAVA 5LIPA 4AQDA 3OTQA 3IUQA 5KWIA 1W52X 4KAAA 1UZAA 3HACA 1W4LA 2Y6VA 1L7AA 3MUNA 4KAFA 5AK5A 4DYHA 5AM2A 2WUDA 4WDQA 5AKHA 1DT5A 2DHEA 3FLAA 5FV4A 2YASA 3TRDA 1WCYA 4KE8A 1ZJ5A 3DYVA 3L1JA 5CMLA 5ALWA 4B80A 3AZOA 4IH1A 2WKWA 1LPBB 4BDSA 1BU8A 2XMZA 3PDCA 4CCYB 4X71A 1UK7A 1W1IA 4G9EA 3VDXA 4BZZA 3AZPA 4KE6A 2WQZA 1UOOA 1GT6A 5AM5A 5K3CA 3C6BA 2OAGA 1XRRA 3AJAA 4EUSA 3DEAA 3HSSA 2PVSA 2XMQA 2DHCA 4B9AA 3O95A 4QLAA 3LIPA 2FJPA 3RKSA 3AILA 4LXGA 4XVCA 4N8SA 5F4ZA 2GYVA 2X8BA 1TAHA 1QIIA 5AOCA 3H0CA 1JU4A 1XZEA 2DQYA 3KD2A 4X97A 4TGLA 5C8XA 1CUBA 3MUOA 1DT3A 2WFMA 2ONCA 5DWDA 4BCBA 2PM8A 2WIKA 4B83A 3G02A 4M0MA 1R88A 3F97A 3I6MA 5HCUA 1VKHA 2FX5A 4FMPA 4EBBA 3BXPA 3T4UA 2PBLA 5EFZA 3STVA 3QYJA 3C70A 1N5MA 2GBCA 2ZSIA 5FP0A 5A7FA 3BWXA 3IA2A 1N8SA 1W6RA 4U2BA 2E3JA 1AURA 3V48A 2WHQA 4OB8A 5LZ9A 4BC0A 1H2WA 1XQXA 1QIDA 4W1QA 2OCKA 5EIEA 1GZ7A 3Q8WA 3HJUA 3ESAA 4C89A 4QDXA 1TCBA 1R4ZA 3WQHA 1N1MA 3G0DA 1BE0A 4ZGBA 5FXMA 1VA4A 2ZYSA 3F67A 4OB7A 4KAJA 2QTBA 1LPSA 4O08A 1LPMA 3ESDA
chains in the Genus database with same CATH superfamily
3T7TA 5F7ZA 2CZCA 3CEHA 1CJKC 1RM4A 2QRGA 3C8MA 1GLNA 1MXHA 3N39C 1U7WA 5TPWB 2CSXA 3FN4A 4NPAA 1U3GA 1NY6A 4RSGA 2NU7A 4AULA 1VG8A 4RD1A 4IYJA 4A82A 1M66A 1C3LA 2X41A 3GMDA 5HM8A 1QPBA 1BDIA 1PZFA 4AAYA 3TNDA 3NTXA 1NJ5A 1ZCZA 4GWGA 3EGVA 2I1LA 3GZJA 4HNSA 3QLEA 1TMYA 3IEKA 1WHSB 3EZ9A 1UOPA 4MLPA 5JDIC 2WJ6A 2I29A 4O4IF 3MMSA 3ZCVA 1FLNA 4WOJA 3HJTA 4KX5A 3STHA 3IC5A 4WHMA 1W36D 4EAAA 4G81A 4KFTA 1NNEA 1MAHA 2JEYA 4HZUB 5HXAA 2FPIA 1VLMA 2DFVA 3INGA 3EVZA 4BQNA 5IZCA 4L9RA 7ABPA 4M8SA 2DCUA 4P5PA 5DSZA 2OD7A 1HRKA 4E4TA 4RFVA 3PZBA 2QSZA 4B48A 4IIUA 3IEIA 3QBEA 2BHNA 2IPOA 4DJTA 3U49A 4CFZA 1YKGA 1IWPB 2I7TA 3I45A 4K6HA 1RHQA 4PZPA 5FOUA 4P4GA 4P32A 1NJGA 3EWIA 3NR2A 2PKQP 1J2EA 1QSGA 1SXHA 4CIDA 4WEQA 5SYMA 2XA1A 3FPFA 1IXKA 3I6BA 4MP8A 3N07A 3W7VA 4CL0A 4YR9A 3PHLA 4JJKA 4IUDS 5I9IA 3JQ8A 3Q3CA 1AGPA 2HK8A 3DVLA 3IXMA 3KYIB 3R4CA 5KJEA 1RJ9A 1P1IA 3CWCA 3G7UA 4IMPA 4WNIA 5JSYA 4FT2A 2NU8A 3CNQS 4J6FA 5HRAA 1SC4A 4IS3A 2NP7A 1TMGE 3E61A 5FTWA 1IJKA 2GVNA 2EFGA 1QFMA 4CMJA 3ICEA 4OHRA 4WZBB 4Z0TA 5LUAA 1E2DA 1XELA 3RW9A 4I4TF 2Q5OA 4MV1A 4F4DA 4MLDA 3K4QA 3N2ZB 4FSHA 4MVJH 1KAEA 1U7OA 4MA5A 5EJ6A 2XF8A 5BWBA 5B6JA 3V8VA 4M9XA 4NZOA 1R5NA 1LBHA 2IHTA 3CXUA 4ENTA 1PUIA 3V1UA 4BE9A 3DE7X 3U4HA 3HADA 3V7WA 1VYVA 2JVKA 2RGGA 3RO7A 3PZRA 1U28C 1GRQA 2W98A 4P9NA 5AK0A 3ZHZA 4D79A 2IPXA 4YAEA 4JYPA 4JT9A 3R7AA 2RHOA 4B7UA 1CS0B 1JQ5A 1CQIB 4RTLA 2BOVA 1GTRA 1SKMA 3K1YA 4NXNB 3BMOB 4H7JA 4BNDA 1JMVA 2BFEA 2R1TA 2ZRDA 4BLQA 1JIKA 1ISSA 3AHFA 3TDKA 4CWAA 1NQWA 1YA4A 4PLGA 3ZC3A 5BN5B 1I2MA 2R5NA 1C0LA 1A8SA 2YIDA 3PUZA 4PQYA 4MR8B 2J6CA 2J3JA 3H2HA 5EJ2A 5I4IA 5FLXA 3IEMA 1EM8B 1TOAA 1XB2A 4EG3A 2IYWA 4IO1A 2FR1A 3NC0C 1GRVA 3SK0A 2OHFA 5E6SB 1KZ9A 1VBNA 3FVQA 1P9OA 2JD1A 3DJYA 3LECA 3WRWA 1PQPA 5ILGA 4ZKEA 3VAZA 4L0MA 2LV8A 2JGDB 4MJXA 4MW4A 4NC9A 5C7IO 3NYQA 1YH3A 3H97A 2E48A 2PKEA 2NZJA 2XH8A 3EPRA 4HAWA 2IIBA 2QHXA 4WLNA 5CH3A 1BHQ1 3AV3A 1QGAA 1XZAA 1VKOA 2KYRA 1DXOA 1Y89A 2VDVE 4IQGA 4ZO7A 3OIGA 3HA7A 3T0FA 2IXBA 1Z82A 5JAZA 4TMWA 1BYUA 1SZCA 2ODWA 3JVIA 4LFCB 3IDZA 4FI3F 4Y30A 1A8HA 3BKXA 4O8ZA 3GHYA 2C31A 2ZRGA 3A2LA 3LQ1A 2ONJA 1Z3IX 2QTCA 3LL4A 3BE5A 5AJWA 2A3NA 3ZCSA 4DTCA 1VSVA 1KTIA 1SCJA 5EE1A 4NQZA 4HL6A 3V1MA 5BWOA 2FPPB 2ZGVA 3PWTA 5D84A 4US2R 5JATA 3HXLA 1Y3DE 3HFRA 3C5WP 3FRHA 4RVUA 4WCFB 2XZLA 3RUIA 1X15A 3SYRA 1DX4A 1L9KA 1UBUS 4EB3A 2DU8A 3AFGA 2XTZA 4LRYA 1NZJA 3PLNA 4YUYA 4R05A 4X1YB 1THGA 4DV2B 1AE1A 1B93A 2XDWA 1BFKA 2RGAA 2EQ5A 3E1SA 5GJWC 3M83A 3SSMA 4FJ1A 1UBGA 1COWD 5DGXA 3V8BA 2CF5A 1ECJA 1LVUA 1M7BA 2QLNA 5DTEA 1A4RA 2O2GA 4FMBB 1VIYA 3D2BA 1C29B 3EFOA 2AYYA 2CW5A 4IGAA 2VC2B 2DUNA 2B4QA 1AXRA 3VDQA 2O2EA 3HA2A 2BV3A 3L77A 1X9GA 2JGNA 4Q3KA 2EJUA 3QNMA 5K0BA 2D5LA 3NZEA 2H4YA 4D8YA 4G09A 2WUVA 3U17A 4JD5A 2YV1A 3LWDA 1O6CA 2X9QA 2WWIA 3CW8X 3N8GA 3UPUA 1N1DA 2AN4A 1FMFA 2E89A 2W2NA 5IN5A 1HG1A 1IN1A 3ITEA 2QM8A 3QX9A 4NP6A 3K9WA 4V0OA 3JARA 1H8HD 2Z9CA 3FIUA 4RQAA 4ZVPA 4MRSA 3UMCA 5F7OA 1XYYA 4GMGA 1C4KA 1ZSNA 3MINA 4REOA 2O1XA 4G4GA 5JADA 3FYHA 4ZN6A 2XWQA 2BH2A 1ULUA 1NSFA 4TMTA 4I9HA 5HF6A 3KZOA 3N7TA 3E2MA 3LNCA 4O2RA 4OK6A 1QCZA 4YC7A 5A03A 3ERCA 1A7AA 3R5TA 4JI5B 2O8BB 8MHTA 5EXTA 3T5PA 2BHTA 4BKMA 4XYBA 4YUXA 3SF0A 2P6RA 2XV1A 1OX4A 3HCBA 4XB6B 5C9ZA 3DFMA 1GUYA 4UEQA 5HE9A 4CM4A 1JQLB 4WAUA 5BV0A 3AIKA 1RE0A 4HB3A 1NBOA 3F4LA 4UDNA 3GOQA 3EBPA 5LP6B 1J5XA 2MINB 1JLRA 4XWTA 4H7KA 2PXXA 3E0XA 3FMFA 1FMLA 2I22A 5CA1A 1KAHA 3AEQA 2UUCB 1SM4A 4JLPA 4ZPJA 5EKDA 5DNAA 5JLJA 1CUXA 4QGHA 5BSEA 2YXLA 4HTFB 3HCRA 4DV7B 1N2GA 3M4YA 2OB2A 1G59A 4QAQA 3AY6A 1IXZA 4B73A 1LFDB 1Q16A 3O3MB 1GKLA 4JELA 3EVNA 1LC3A 2I6GA 1A1SA 3URMA 4J16A 2PZJA 4EHAA 1MO6A 2AA3A 1PR9A 1RQ2A 2VXBA 1OLXB 2WWGA 3E5HA 1T5SA 2HU5A 2PS3A 2AXEA 3QJ5A 4HGRA 4LBZA 2B5VA 3AEXA 4AWAA 3OBBA 3TB4A 1QGUB 4GMXA 4P7GA 2IYFA 4R2MA 3FWKA 1I9GA 2JIMA 2WF9A 1U1CA 1CB0A 3O4VA 4E88A 2F90A 2Y4OA 2C4KA 4HN9A 1X9HA 1ZS9A 5E0OA 1T9CA 4PO9A 3KOMA 3TZKA 2H11A 3GUHA 1P6XA 3DB2A 1U8FO 3K0KA 1O77A 1R4MB 2PD3A 2RGUA 3H42B 1GNTA 3S2FA 3K30A 3VYSB 3CTMA 1D4ZA 2F3RA 2A58A 3C1TA 4BN5A 2DUWA 2PZLA 4QWMA 4EHIA 5MFPA 3OIYA 4CVNA 5HE8A 1B23P 3VQTA 1RCFA 3I3SR 3KYBA 2C4NA 4DF3A 2BMFA 4FDMA 1ZITA 1Z5NA 3DKRA 4D3FA 2ZUVA 3NBYC 1T34A 2ABWA 3OBIA 2N1BA 4WNCA 4CZ2A 4H77A 2D0IA 4X3OA 1QH9A 1VC2A 2QORA 5AHKA 3RAGA 3UAZA 5LOVA 1Q92A 1PWEA 2I3BA 5ENZA 4CT0A 1SKYB 3K5IA 3P20A 3I4FA 4IIBA 4MUIA 4E2YA 5KTMA 4RC9A 2D1RA 1F6DA 2CDCA 3K09C 3EDRA 4BNJA 5IT4A 2NAPA 4XW2A 3RYCB 1K7CA 4EHFA 1FL9A 3BDIA 2XCRB 1W88B 1JEDA 4WJLA 1GPMA 3STXA 5CJJA 2GLTA 3EQ9A 1YU6A 1WP4A 4D41A 1ODCA 1Z38A 5CFOA 1JFFB 5T3YA 4V38A 2X0DA 2OFOA 1JNXX 1UP7A 3Q11A 4LY0A 1VCHA 2P9YA 3K9NA 1G8KA 1VJCA 1RAAA 3F2VA 1EFRA 4BKPA 1P5RA 3O9MA 1A9ZA 2XGOA 2Z1DA 5DN6A 4BCCA 3AY0A 1NP7A 4S1TA 3E2IA 4I4CA 4D46A 4IIYA 1O95C 2YNMD 2IGBA 5C7LO 4MS4B 2FUNB 3SJ7A 4EX7A 3A70A 4J1TC 5JS2A 2CLEB 3B13B 2VNSA 1I32A 2G9UA 3BB3A 4DBLE 2R84A 2WIGA 1K8XB 2HJHA 2VF4X 3RNOA 4B31A 2VF7A 3GLFA 1ZI8A 3BF7A 4IFTA 4CTOA 2JBWA 1HDGO 2V6GA 3PC8A 1UDXA 3DMFA 2H4FA 3IB6A 1QGDA 2XOKA 3R74A 1JNYA 2PX6A 1OLSB 4BQSA 4H31A 1C9JA 1FNDA 4M38A 4NZPA 5F1YA 2TYSB 5F7XA 5CX4A 2VBFA 1IAQA 3KU4A 2YFYA 4QYMA 2PT5A 4PZZA 2AI1A 2Y1WA 5J3JA 1GPKA 1OFGA 2BKLA 1K75A 2B83A 4KDEA 2I6FA 1TO6A 2DBZA 2WUWE 4BB5A 3ORHA 2GHIA 1Y6GA 4YAUA 4CM1A 1L5YA 1PFWA 1Q3HA 1RWPA 1RQGA 4NWIA 5JO0A 1RKQA 3WI7A 3QVLA 2P2NA 1TUBB 1FFXB 3D02A 3NJ4A 1QK3A 4YGYA 3FGPA 4B32A 1Z5OA 2BFNA 3R3UA 1FX0A 5IABA 2B78A 3CG0A 4EJFA 3RC8A 4JODA 3OPYB 1POXA 4QG7A 1P3DA 4CQLB 4BNYA 5J5CA 1U8CB 4ZYZA 4OG2A 1SAYA 1I1QB 4R71A 5IKPA 5CT9A 3IKJA 4O4LB 4TLCA 3T7IA 4DE5A 3H5TA 2XZPA 3RLFA 2B1IA 4LKOA 4ARZB 3IPRA 1EDZA 5L4LA 1OKKA 1WOMA 4YK7A 5CA1F 1J5EB 3FG9A 3I9LA 3THWA 3F6CA 4RPJA 4F3RA 3AR5A 4MB6A 5G1PA 5EGNA 2JFWA 3BSWA 4NEQA 4TRNA 3RF7A 1COZA 1P2UA 3GEBA 3OOSA 4Z3DA 4C6HA 2SICE 1AMNA 1EGQA 1HDRA 2PH7A 3M6IA 2O05A 3LQ2A 1AK2A 5E6UB 3VV3A 4ZO8A 5CB4A 1KWKA 1QM5A 1IUOA 3CB4A 3EEYA 4L0CA 4F46A 3VR6H 1YVRA 3EPPA 1YK1A 4LCBA 5J2TB 5KIAA 3S27A 1U90A 2HIHA 2XOXA 3S1LA 4BFXA 1LJUA 4CETA 1QTIA 2IYYA 3RGWS 3S7ZA 2RKOA 5I8WA 2X7HA 3VR1A 1WR8A 3B2EA 2HDWA 3GZTB 4QYXA 3UAOA 4AL4A 1X1TA 3W5CA 3R3SA 4PG7A 3WQQA 2VXYA 3AW8A 2MYNA 2UDPA 3LTNC 4C0KA 3KL2A 1CUSA 1RPNA 2C98A 3MXOA 4U9HS 4IDDA 3D3WA 4MEBA 1ZGZA 2EC5A 4Z2YA 3TE6A 4PN7A 2Y1OA 4ZO4A 1SXJD 3K9LA 4Q1CA 1PGQA 4I1UA 5G3YA 5JY1A 1RQNA 1XPJA 3RIMA 4FMCF 2X2OA 4EG8A 1G8YA 2XGJA 4OK5A 2A9JA 5BQPA 3TI7A 1HH4A 5THKA 2DRIA 1W0CA 1VSTA 3A4VA 2IP2A 3L92A 4MKFA 2A6PA 5LQKA 5D87A 4QNRA 4LHVA 5KSOA 1CUIA 1VLLA 1P7YA 3ILSA 4MHOA 5CBKA 2FKNA 4EB6B 4AJ4A 3H3FA 4F4UA 5LOVF 1E2KA 1PBTA 1E1KA 4KYUA 2OPHA 4M7WA 1U3UA 1EWKA 3EIFA 3UFXA 3QXJA 4M37A 5M7EA 4QUDA 3TIVA 2OWDA 4HXGA 5EVJA 2UZIR 4ZMRA 3OX3A 3L40A 1HFJA 3B89A 3TSZA 2C0QA 2XADA 1IN5A 2NV2B 1JHPA 2CJXA 3OOHA 4FFLA 4X20B 1S2GA 3I8OA 4HX9A 3U3MA 2XA9A 3WC4A 1GPNA 1MOZA 1R0SA 1MR3F 1VMIA 4L3VA 4OO3A 3UAGA 2DETA 1P5HA 4E5PA 4ZAZA 1Q0TA 3DXYA 1XVLA 2RI1A 4BO6A 4DB2A 3C5EA 1M6VA 1ZHHA 2VXOA 3SMVA 4X91A 2KWIA 4TTIA 5ALKA 3OZRA 3DM5A 2DHQA 5IT9A 3O9ZA 4P0PB 3VGPA 2HSEA 4BL5A 2Z95A 5FA8A 4Q1EA 3U56A 3QVJA 2OQVA 1SQFA 1YVDA 1YJBA 1MX5A 2OCDA 3THYA 3T5BA 2R6FA 3QFCA 2P2SA 4FDLA 4Z4CA 4JU8A 4RTKA 3NO4A 4UBMA 1AMOA 1PK9A 3N0TA 4ZAYA 1T1IA 2UZ0A 4DUPA 2HW8A 3VO8A 4WA7A 1H4TA 4IQ8A 3AKEA 4XFJA 5B3JA 5LQNA 2WWYA 2CNBA 5JSUA 2L42A 3BULA 4ZQEA 1BTOA 1PN3A 4FZRA 5ERGB 4J2OA 4AMVA 1ORTA 2H2DA 2R6CA 4CIWA 5JG7A 1KZ6A 2XR1A 3HJFA 2F7SA 4UZSA 1LRLA 2J5BA 2NZ2A 3IOBA 4X44A 4X94A 3B1WA 4YTEA 5IJAA 4Z4HA 3D3EA 2JI6A 5BVGB 5IUKC 1MENA 2Y99A 4OYRA 4EO7A 3EVDA 2FCAA 1C9KA 2XECA 3S5JA 5L9AA 2O5CA 3JQAB 2ZBGA 3AHEA 4IDFA 2IPAB 5ER6A 3QVUA 3FJYA 3T4EA 3PXDA 1K5PA 1OXTA 5JD5A 1T3TA 4MGKR 3LLVA 1XV5A 3BM5A 4LX0A 4Q6BA 3ZHXA 3UWPA 2PJUA 4MKRA 1XKQA 1QDLB 2JHPA 1JG6A 3MD0A 3QBVA 3H1GA 3MAGA 3SSOA 3DLHA 4R8RA 3NEYA 2OORC 2FJ0A 3UZUA 4WOBA 4I9GA 1RU3A 4D74A 2TMGA 4JUIA 2P6UA 3GFSA 1XEWX 1RYNA 2PH3A 3QKWA 2NZ8A 2XKAA 5JROA 4FN5A 1NLZA 2GZSA 2RHLA 5SZKB 4BYMA 5KNCA 1H1LB 1NKSA 3FWYA 4HEA1 3VC7A 3R5JA 3R6DA 2RIPA 4HYQA 4CKEB 5DNVA 4XWWA 3OUUA 4KK3A 1BVYF 4Q5IA 4CE6A 4EZBA 1W7AA 4TS4A 1XDZA 1CYEA 3H1FA 4ARAA 5A6VA 2IY9A 3ZD7A 1GTSA 1G291 1T13A 2J59A 5EFOA 2PY6A 2QTHA 2Z9BA 4QU5A 3GGDA 4DT1A 4M76B 1R2QA 1Z68A 4YT5A 4UDXX 3ZBUA 4IF6A 1EDDA 1LPOA 1Q15A 2CJPA 1Y4AE 5EP2A 4UNQA 1D8TA 2QT0A 4LX8A 3ZU4A 5BW4A 3FUXA 2C0PA 3ID6C 3G9UA 2ECKA 3SFZA 1C3EA 3IILA 1KP9A 4C03A 1FMTA 2Y1FA 4DYVA 1M2EA 3NLLA 1WUYA 3ZE0B 1NI4A 3PJGA 4EUEA 1Q0HA 2P0EA 3CC8A 2NQ2C 1GO2A 3PHIA 5T8KC 4CT5A 3GLGE 2P5TB 1JECA 3EW7A 3HBNA 1BA2A 2IW1A 3GUCA 5ALIA 9GPBA 4YNBA 3R9KA 1T9BA 4NICA 2ZI4A 3FHOA 4J1NA 5CH8A 5LYJA 4DMKA 3EUWA 4V0RA 1KR5A 5TMBA 1AB6A 3ETEA 4LF8B 2PTHA 5DXFA 4MI9A 2XXAA 3U5TA 3OQMA 3YASA 4FFVA 2B3TA 1TZKA 3ON5A 5JS8A 5G40A 4KVZA 1FNSA 3LPMA 2D0PB 5A4AA 2I7VA 2EF1A 1QQ7A 1ZSVA 4ETNA 5JFTA 2XZTA 2XVMA 2P9GA 3N86A 3PYXA 3WL6A 1KO4A 3A6HA 3D1VA 4HEJA 4AVYA 4F2DA 1QS0B 5KHOC 3SYNA 3BZBA 2JJ2A 1QH1B 4UEJA 3M2PA 4LZZA 2O8NA 2J30A 3ZZUA 3KZ1E 3MJEA 4KGVA 3LDAA 4JN6B 2VTBA 3ANNA 1V3UA 3KKNA 1EESA 1V5FA 1C1DB 5HCIA 4BWFB 1N7GA 4LV6A 2WZQA 2H2AA 3IXQA 4JLMA 2XWBF 5KJFA 3M9LA 1DTSA 4BP8A 2FMKA 3OD5A 1P7PA 1L8AA 4F4IA 4DZRA 3ZI0A 1ZNWA 2GEDA 2JZCA 1B0UA 3TEMA 3AMVA 3EF0A 5T4BA 3TI9A 5CYPA 3WMRA 2ZQZA 4AP5A 3CRMA 1M2VB 4DOMA 1K4KA 1O96A 3VR0A 1JHUA 3ABQB 3NEJA 3G9ZA 5I4BA 1ST2A 2V7PA 1VLZA 4WJZA 4YRGA 2FLKA 2M1XA 4MVJG 1WV0A 1JTVA 4LJ6A 3W6PA 5JRZA 2HMYB 2JVIA 3FNBA 5C5IA 1TVMA 4PGMA 4HEQA 4TKMA 3ZUPA 3BH6A 1DWOA 2NO0A 2OB1A 4I1SA 4MS3B 4G67A 5LKAA 2Q9CA 4MEJA 3IJ5A 3C7TA 3G49A 4MRVA 4ILKA 2F8MA 3T5AA 4AIRA 2R86A 5F1OA 3CLUD 3FTCA 3SBXA 3K73O 1RAIA 3BVPA 3LYAA 3KYCB 4UPEA 2VYNA 3AXSA 3FZNA 3BX1A 2QD2A 5I7VA 1TM7E 2IU4A 5IWAB 3UPTA 2IUFA 1OQAA 3IHTA 3JZMA 1FDTA 4KXQA 3WFIA 3V8NA 1RVV1 4ATNA 3ETHA 1X14A 2PX5A 1UZLA 4ND4A 4JHXA 4BO3A 4DILA 4BEWA 1QAOA 4CKBA 1ZD2P 3QI2A 4P1ZA 3F3KA 4ZCIA 5LLDA 4JEIA 4RMGA 3IFSA 5L4SA 1I30A 1XZLA 1UBJS 4AO6A 4I6GA 2CXSA 1DC4A 2D0DA 2JFNA 3FPBA 3MS4A 3C6ZA 4FI3C 4UEKA 3ULKA 4B3BA 2XB2A 3A7EA 3O93A 1JHOA 2AFHB 4NCAA 3P0FA 5DJ5A 2PX8A 5G1OA 5ALGA 5GZ6A 4B4UA 2FZLA 2YHIB 1X7ZA 4IQ4A 1RJFA 3FCCA 4B8YA 1QOZA 1LRJA 4FR0A 4TOIA 2DFLA 1JBQA 1EB9A 1H6DA 2Q5LA 5K3FA 5KU7A 2PRZA 2C95A 1CY0A 5BNFA 1HX7A 3KCNA 1KS2A 1XUOA 3HHPA 3DL4A 2FWIA 2ID8A 2UVPB 3DZFA 4K9LA 2ZYHA 4WFIA 4YRNA 2QRNA 1CUJA 1CY6A 2XE8A 1K8RA 1MABB 3LYHA 1P0CA 2GCPA 2FH5B 1Q3TA 3DBLA 3T3EA 4OFBA 4L95C 5MGNA 2IS6A 1N36B 1DIAA 4M9QA 2GM3A 3DKVA 1GKYA 1DP4A 1M1XB 3CF4G 4YJ3A 5B64A 2MWMA 1GZ4A 4EB0A 3UV7A 1E66A 4BWGA 3L05A 3IAXA 2FSVA 1FDWA 1IM2A 5E38A 1F5NA 1HQKA 3AEKB 1E1QD 3RVQA 4ES6A 2IKQA 2QENA 4K81B 5C1DA 4CG1A 4C4YA 1OWLA 3QE0A 3KSBC 4RQBA 1EFPA 2UVQA 3M89A 4EI2A 1XMSA 1KI9A 5B6IA 4KI7A 5A5DA 1J25A 5FTMA 3S2GA 3VOAA 4CFSA 4FCWA 3W05A 4YBZA 1C2YA 4UATA 3EXIA 5TF4A 3U3XA 2P1RA 1MPTA 3I0NA 3RUAA 4C3UA 2CXNA 2BN4A 1WVMA 3OM1A 4HFJA 4J75A 4XSGA 2PQ6A 4IS2A 2BZSA 2IOYA 4ZALA 4CMIA 3S0JA 2FG6C 1DJOA 4NNJA 4AMZA 3I92A 2D8AA 4OMFG 3B3GA 4R8LA 1F14A 1YQUA 3CSDA 4KWTA 4XDGA 2V6FA 1YIDA 1ZUNB 4ZC1A 1UJ5A 5EZYA 4C4AA 1C7QA 5DOVA 5IF9A 1PT9A 2ECOA 5JTUA 2VR1A 2QIPA 2HF7A 3OCUA 1WKBA 1M6NA 3HUTA 1KDRA 1LPAB 2ZSDA 4BFUA 1B76A 3F8SA 3HS3A 1FUEA 3NKFA 3OG9A 2I2FA 3F9CA 3PFWO 4CMAA 1J21A 1K3UB 1IOWA 1PQYA 2G80A 2Z3VA 3H19A 4R1TA 2WWRA 3GH1A 4MWTA 1V5GA 2H9IA 4M98A 4UVHA 5EP3A 2YHBA 1K8ZB 3I1IA 4H7IA 5AKIA 5DH9A 3U4IA 2B4TO 4KRFA 1HDZA 2B8TA 2VFAA 2XCIA 2ZRCA 3GZNB 1Z2OX 2EVWX 3P9ZA 4EG7A 5LMCA 1LI4A 3E9YA 4TMKA 2G9RA 3B52X 4YAJA 3W8EA 5A7GA 5EKTA 1BEEA 1YE3A 2CDNA 5HCNA 4EZIA 4LXIA 2NXCA 4ZJUA 1UMCA 1ZA1A 3G9TA 3PJFA 1AHPA 2II6A 2BYTA 4IIGA 3RAEC 5IVHA 5A9SB 1E1CB 1MIHA 4D82A 5LQRA 4IGIA 3PQ4A 4PZLA 3RSFA 1LSJA 1O5OA 1RMQA 1XRNA 4NBRA 4I5FA 3HU1A 4JJAA 2GEKA 1HNXB 1HBJA 3OE1A 4LRWA 1Z8DA 1UEJA 4QXPA 1AIPA 2P6MA 4RACA 4S1NA 1O9BA 4NU6A 4MRAA 1N7IA 4BKOA 4ER5A 5G1NA 2CMGA 2H92A 2ODAA 2Z5FA 3ND9A 2WSSD 4CM5A 2PZGA 2J31A 4NCJA 3ILHA 2AHOA 3SEAA 1JVNA 4LBYA 4P58A 5ICGA 4UM9D 3IP1A 1AB5A 1GNRA 1G6Q1 4ZVKA 3RROA 3BGVA 1SXQA 4OFXA 1F8XA 1MRNA 4CKCB 1XTZA 3SS9X 2BMJA 2H0AA 4UBLA 1T8WA 2VP0A 1XWWA 2GBFA 4NNOA 5JAUA 2VPXA 1P1BA 4R9SA 3F9IA 3EWNA 5GJVC 1GDDA 5M3BA 2OYRA 2G0AA 2H1FA 1NDUA 4HLCA 5JS7A 3QK7A 1BMQA 4NHEA 1ZIXA 3IDOA 3M6XA 2IIPA 3PP8A 3QQPA 4JASB 4QICA 4WQMA 5L7WA 3J81A 3EEOA 3C5HA 4D97A 3BXXA 4HRVA 3IQDB 2WTMA 4V1CA 4OLJA 2YXPX 2SHKA 4EI7A 5EQDA 1PQWA 2QL6A 3DO8A 5LDHA 3G59A 1QVAA 2C4HA 2R97A 5EPOA 2GPBA 3V7UA 3Q2IA 5ICCA 1LC0A 1JQKA 1NI3A 4S35A 5CVJA 1LDEA 1OX5A 2B7LA 2A33A 2PN1A 3CLRC 4DKXA 3TSWA 2YYSA 3AEZA 5F76A 5KX5B 1N6NA 3IUNA 5LKRA 3HJCA 5DYIA 2E0IA 1D09A 3B7GA 3QX8A 1INLA 4Z4FA 1E9AA 1HMPA 1R9NA 2XIQA 3Q6NA 1KJNA 4AURA 4XDYA 1ZH0A 3E6AA 5CLQA 2XAAA 3S3TA 1AY0A 2JIQA 5IS2A 5TGZA 4MIKA 2W42A 3KVVA 2PSSA 1SC9A 3K72B 1C0PA 3H86A 1NQOA 2VTKA 1UJ2A 1MQ9A 2BF4A 4LJ9A 4P83A 4GMDA 1G5RA 2UYHA 3D7SA 4HGPA 4WI1A 3BG5A 2W48A 4F2HA 1JLLB 4W7SA 1FFHA 4KYTA 4YJ3F 1R64A 2CLIB 2E1PA 2YX1A 3W5IA 2IZZA 2R60A 1QP0A 1IK4A 2PUWA 5ERXA 4GUDA 2BF7A 4XIIA 3FNGA 3KVNA 5K8IA 3F73A 2AD5A 1JE0A 2AOXA 2Z58A 4FIZA 4GUAA 1V37A 4KTTE 1DWUA 1I1OA 2ZWAA 1R15A 1R0ZA 2NUPB 5FADA 4YFVA 4K9KA 5CDUA 4CDMA 2B6HA 3G0OA 1GD1O 1P2TA 4IDCA 4JX9A 1KQPA 4O1MA 3Q7QA 4PAOA 5JH7A 1SBHA 1GQFA 3Q0EA 4KHPB 3FLMA 1ODIA 3NP9A 4BBAA 3F5DA 2ZUTA 2XUPA 3DE1X 3LRPA 2DP4E 2EGGA 2EP7A 4PTLA 5FUXA 1JHMA 3UEOA 3WB1A 1FJGB 1B3BA 4K1XA 2GEVA 4Y2QA 1OXKB 1MA3A 1GN9A 3A0RB 4GX5A 5DXJA 2J46A 4JGGA 2WM9B 3KFVA 5DHUA 2AMVA 2G72A 1SQSA 2G7MC 3LV8A 2FSIA 5SY4A 3W8DA 4Z7JA 5AQ1A 1KZ4A 3SC3A 8OHMA 2V7GA 4MLCA 2WJPA 1U3VA 3AF0A 4LRUA 4AN0A 5ALZA 1MAVA 3GIWA 2PL9A 4YAIA 1JDNA 3ETNA 2XNJA 3RIYA 2G07A 2OK8A 4MUEA 1C7IA 3AI3A 2G77B 3B70A 1WG8A 2P0AA 5EKSA 2NSDA 1QK5A 3TTUA 1RTKA 4ZK2A 1DC5A 3E3AA 2BMEA 4Q4HA 1IY1A 5K4HA 1COWA 3N0VA 1GQYA 1PTKA 1RHKA 4ZCMA 3IDQA 1FVHA 2WD7A 5DBFA 1EXDA 3AINA 4NJOA 1U63A 4BN0A 2J09A 2ZRAA 3WHLA 5K8JB 4PF1A 4D0GA 5IJ9A 3K6SB 2M9MA 1XNRB 4YV2A 3L8FA 1KSJA 3Q7PA 5FNVB 3UC5A 3WB9A 2PKYX 3FFXA 1BJTA 1C30B 3NDJA 4FW8A 4UEOA 5FWAA 3VJKA 1TT7A 1TK3A 3W1WA 5TT1A 1JEQB 3I73A 4LXYA 3UHFA 3GMSA 4GDFA 4TUYB 3EZ7A 4K8OA 3ZKWA 1EXVA 4DV6B 2BEUB 4J0QA 1CE8B 2YMQA 1H8HA 1Z0FA 1QIJA 5K8VA 3HK2A 4IIJA 1FVFA 2QD5A 2WJJA 1TGVA 5DM2A 2ZIXA 4EECA 5K45A 2CWDA 3VFDA 1CUFA 3D3QA 2P2YA 3E7WA 5F2OA 1UC4B 5IAKA 4KOAA 1SCNE 1F4LA 4XCXA 1OI3A 2Y2VA 3VVMA 4FYYA 5IJZA 3SC2A 5AVVA 3O94A 1D2GA 3VAAA 2NT3A 1G6OA 1C81A 4FOSA 5F2KA 1JUDA 2CBXA 1KYYA 2AMLA 4XOIA 4L4RA 2IHYA 1A5AB 1JSZA 4PIMA 4F5EA 2EGHA 1I24A 4S04A 1JDPA 3C3DA 3OHMA 3QPUA 3D4NA 4GSYA 5HP4A 1NJ2A 1JVBA 4RTNA 1RJDA 4TYWA 1W46A 4UVEA 3ZJ4A 3MJSA 3B6JA 4OSOA 1NT2A 1YS9A 5B55A 1NRWA 5BR4A 4NCBA 2J3KA 4RZHA 1U2SA 3A1VA 1HETA 4MPPA 2HCFA 3D0KA 3LQ4A 1BW9A 2NZVG 2CDBA 1L5WA 1NLMA 2GO1A 4HWRA 4KJXA 4RM3A 5AXDA 4Q3CA 1JJBA 2DT8A 1K8YB 4RADA 3K0AA 4O2LA 3UJPA 3MJRA 4GXQA 4NOMA 5IUJC 3OWOA 2XXBA 2IY7A 2GD1O 3ZCTA 4NFHA 1V9CA 4XPIA 2Q5JA 5DNYB 2IP1A 1FQKA 3FLBA 5D8DA 2V03A 3EGIA 1S8NA 2JFVA 3E9MA 5HFAA 1CF9A 1SHJA 4GECA 5CVCA 3I9V6 5KTPA 3ROMA 1PT7A 1Y42X 3ROGA 3TLXA 1RRKA 1LQTA 2ZIZA 3H5RA 2ETXA 1VG0B 2FRXA 4ABTA 4FJ2A 1AC5A 2DR0A 2WV7A 2GZHA 2A84A 3PX3A 3O1JC 3HO6A 1KL7A 3UMRA 5ER9A 4B6JA 1QGED 5CFPA 5A3RA 3F7NA 1LDBA 4LTDA 3DNPA 3ZNPA 1W44A 1GY8A 2C7VA 1DXHA 2ACVA 1E4VA 3LT5A 1U8EA 1DCFA 2C1ZA 3AM3A 1IRXA 1T2NA 3FOBA 1H9AA 4BNZA 1RPTA 2L2QA 5JR3A 3TIXB 3PNKA 2ODQA 4HOYA 2CNDA 2IE8A 1F6WA 1NV8A 1Q6ZA 3I9FA 4OQZA 1IL0A 1Y3AA 1QPZA 3DDUA 1A4IA 4E09A 1GN8A 1I4LD 2QTVB 3LBNA 1XMQB 4XRGA 1RC1A 4ALJA 3H84A 5L3SA 3MAAC 3LUKA 5D51S 3R6GA 3E22B 2FX3A 1JR6A 1KSFX 3PFBA 2J0UB 1OPRA 5TQ2B 5HOEA 4YY3B 1ESDA 1JS1X 4D4LA 3QEBZ 5FTLA 4W1RA 1IZ7A 1L4MA 1O8BA 4AJKA 1PG0A 2P4SA 2A0KA 2R62A 3DDWA 3RG2A 4EMTA 5B58C 4OBBA 2Z83A 3ENZA 3B1XA 3H6KA 4X62B 1ATIA 4IICA 4BX0A 1MO5A 3TW6A 1I3MA 2AVDA 3H1BA 1G1MA 2H7XA 3C3JA 2G1KA 3IBTA 4GIBA 2WSBA 1VPLA 4LOLA 1WULS 4PXAA 4C6TB 1PF7E 3CLTC 3HDTA 3KXLA 2FKAA 3PC3A 2O3JA 1QHXA 3PHJA 4JITA 3F8TA 3T5GA 1VMDA 2CUNA 3WRYA 5BPFA 3V4ZA 1F2DA 2SKDA 3PHCA 1DE0A 1BEZA 2P6OA 1TXGA 5FWYB 5KQSA 2QTGA 3M6VA 4ZHQA 2YNMA 4INJA 3NORA 4JK3A 1YDWA 4RY2A 5SICE 3JYHA 2BFCA 4IHQA 2FSUA 4HGYA 4I4LA 1GADO 3VHQA 4INAA 4B34A 4LZPA 4YPOA 4MTLA 4PBRA 2HA4A 4CKWA 2VYFA 2ZB7A 1ZVJA 5TV2A 3RDPA 3ETCA 2H3EA 1HF3A 4DR7B 2OVBA 3FB1A 4L57A 4Y0AA 3CVVA 1SCKA 3RGGA 3MPOA 4W5RA 1MAWA 2N46A 2P8SA 2IUTA 3H2ZA 3G5UA 3QA3E 3W1VA 3ZU5A 2J9FA 3B1YA 3KV3O 2GWHA 2HWYA 4R2WA 3WLLA 2WNSA 3OTHA 3PNOA 3WDSA 4EA9A 2M6SA 4DSNA 5AVZA 1ADBA 3A3NA 5FPYA 1E18A 3VTZA 1US8A 3FDZA 1WZUA 3PBKA 4IIJF 4HFNA 3ZWOA 1L7EA 1TU3A 4JHLA 1NM5A 2XRFA 3SEQA 4D96A 5BUQA 3QWFA 2I2DA 4NMXB 1Z88A 1WCV1 1T3ZA 1AHHA 4BFTA 1QORA 1YGYA 1RYYA 2HREA 3ETGA 3DO6A 2D00A 2WIBA 5FI0B 1LEHA 1GNLA 3PGMA 4Q3OA 1M1YB 1JKJB 3A3OA 2CBZA 2WFAA 3TW8B 3X44A 2IYPA 2QM0A 4YCMA 3ACBA 4YAKA 4G6ZA 5EE3A 2Q7XA 2EKLA 4LGVA 1YZGA 1I6MA 3O6VA 4CM9D 4U7TB 4BEBA 4Q1FA 2A0FA 1Z7GA 4KRYA 1EVEA 3NBAA 1NVBA 3A58B 1TRKA 3OZIA 3H4MA 1SB8A 2G5TA 3EB9A 3H05A 3I0MA 3NHFA 4Q4AA 3EXAA 1N9GA 5L3VA 3ZBQA 2VAWA 4F2WA 1EVZA 2LRHA 2EIHA 2O8EA 1XKLA 2OOKA 4FLEA 5IVDA 4JOSA 3SX2A 3NOXA 1ZC4A 4B3RB 5CB6A 4LZJA 3TOSA 5F2EA 1H42A 1FBNA 1NVXQ 1ZM9A 5SZIA 4LFAB 2JLVA 3RV3A 3LX8A 3IR7A 2DTXA 5AOBA 1QO7A 2GDZA 4B3MB 2TMDA 1IZ9A 4J4BA 2J4CA 5JCOC 3D1JA 4JVLA 4LK3A 2Q3BA 3LO8A 4DCVA 2E4YA 5JZMA 1K7YA 2PGLA 1P18A 2JA1A 2YQ5A 2C04A 1RPZA 1B6SA 5E2BA 3UWKA 4H4EA 1XZNA 2AFRA 2QTNA 4P93A 3AL3A 5IVKA 1AGRA 2EL9A 2WJ4A 4RA9B 1V41E 1ENPA 2WICA 3EY9A 4NFLA 1XN1A 2YMLA 1KI6A 3KCQA 4WECA 4F06A 2PUCA 1OYOA 3JQRA 1MW9X 3LF2A 2IYRA 4NCHA 5I48A 1SXJA 4LSZA 3BEOA 3R9IA 3QU2A 4JLWA 4NS4A 4QUGA 3A6DA 3U7JA 3P9YA 4A23A 1T29A 2P9TA 2WABA 2X1MA 3AT1A 3OD1A 4KB5A 5AKKA 3T38A 4AROA 4GOXA 2WKRA 1WB5A 4KIUA 4WBNA 1WMFA 3DE3X 5E2IA 1L1FA 4FBMA 2SECE 4EG0A 3R7WA 1VL5A 2XBUA 3KJZA 5IM5A 1LW7A 3AB7A 1H3EA 3LRTA 1EZ1A 1RP1A 2KHZA 1MLDA 1PEDA 3FPSA 3LOQA 1SUIA 4OREX 3CLKA 3OF5A 4WLEA 3PLRA 1NRIA 3P0HA 4MJ7A 3ZE1B 1FLDA 1FOEB 3EHEA 3FNIA 2Q6KA 3U4CA 1WDWB 2PXCA 1YWGO 3LL7A 4LYHA 2GILA 4KDFA 4XYGA 2BI4A 3TW4A 4JKIA 4QA9A 1X87A 1IBMB 1SKUA 2XE7A 4QYTA 3CZ4A 1U04A 4K6GA 3TVTA 1Q0SA 5JNLA 1JAHA 2EFDB 1FRFS 1SVUA 4DQKA 1L7QA 4FILA 4GVLA 3T4XA 4EO9A 3UN1A 3PEYA 2FEMA 3I6ZA 3F5FA 4OI4A 1T91A 3RRXA 1NAHA 2C8KA 3NAQA 4ZVMA 4ZHQF 1B42A 4B3CA 1X6VA 3H5AA 3OLCX 1SZJG 5FA5A 4E31A 3TLJA 5FPQA 4OHFA 3H4VA 3UXMA 4KQJA 5KQLA 5F33A 3ZQUA 3WMXA 2D5CA 3ZHRA 1BE6A 3B8EA 4JC5A 3R9WA 3LNTA 1DJQA 1TVCA 2IYAA 3LYLA 3OIVA 5IZ4A 1NN0A 3V46A 1YR6A 1X7XB 3IT3A 2HCTA 3WTBA 2ZYIA 4QQKA 1F0NA 4Q9HA 4O2BB 1CR0A 1KMHA 4BJ1A 2EWVA 3GUZA 2X23A 4X0EA 2RHTA 2IHUA 2ZTLA 2X2PA 1NNI1 1U0OC 1H2ZA 3GO4A 4LNHA 3RFXA 1KQOA 2VK8A 1AGNA 3VR3A 3FLEA 3AETB 2SNIE 4WACA 1ZXXA 4WFJA 5BUSA 5AW1A 1U8TA 3GQBB 5IDVA 3WYCA 3ORYA 5IASA 3VC2A 1JDTA 2BJWA 3LP8A 3CIFA 3TFWA 2K6GA 3DDHA 3N6RA 3OEED 3HRHA 2AOTA 2PCLA 3WLPA 1E2LA 5C5EA 2VNHA 3OZAA 4AWXA 5K8TA 1PL6A 3ZHYA 3NDIA 1YTUA 4MO9A 5DK6A 5JE8A 1E98A 1T43A 2C2BA 3N2KA 4J3JA 5F98A 1TM2A 1YZQA 2BI7A 3S99A 621PA 3U1TA 2Q50A 4R40A 5JYEA 3JASB 1XRPA 1QH8A 4QTZA 1T8TA 2XYPA 4D9BA 2O59A 2EWWA 2JAOA 1R6DA 4O4HA 4FR2A 1OXUA 4GOKA 1E4EB 4PQFA 1M8JA 1SRRA 3CA8A 3NB0A 4EOGA 5A62A 1Q84A 2HNKA 3JZIA 1GGVA 3HVIA 4OKIA 4P4UA 1TJYA 3M3PA 3HWRA 3QTTA 1Z17A 1ES9A 2PGAA 3ELDA 1VL1A 2ZUDA 1MOSA 2QX7A 2BFDB 1BE8A 3DMTA 3EOZA 3K4PA 5E7JA 4K26A 5H3HA 5TXGA 1T2FA 2FSPA 3JAKA 4QEKA 4N0QA 1V7CA 2CL5A 1LTKA 2FQ1A 5DLQC 1J0BA 3WLIA 3MELA 5LCXA 2P3QA 2IWHA 5LWHA 1I2BA 2GBIA 2IHKA 1CY2A 4HVAA 2EFYA 4CUJA 3CNNA 3RRZA 3JWHA 3UMYA 2ILVA 2P4HX 4L8LA 4W5OA 4HMPA 1HE1C 5AOAA 2A9QA 1GXSB 5J1SB 2R00A 2GBLC 1ZOPA 1OIVA 4NJEB 1NUAA 3X1ZA 1E61A 4CRWB 2C7OA 5AW6A 2AXNA 2UZ1A 1RIIA 4L6AA 2NO7A 4J4HA 3RK4A 5AIBA 2YJ3A 4W5JA 3IUMA 4Q34A 4ETWA 4MYDA 4KMSA 4UTNA 1AU9A 4K3UA 4KVAA 3VOTA 5D5QA 3JXEA 2X7XA 4OQNA 4V3BA 5CH5A 3RVDA 4BO4A 1GU1A 4R2LA 4XYMA 3L0DA 1PE0A 2Q5QA 3JQGB 2EZ4A 4LY6A 4PSDA 1XCGB 4RABA 1D1SA 1CR1A 2EAUA 3EGDB 4FEYA 2K4MA 2GRJA 1X1CA 3H8JA 3G8AA 1NMQA 3UM9A 4EG6A 5D01A 5JCXA 1ZK3A 1T10A 3TPZA 4WBNF 3TQOA 1ZH2A 3DMGA 3DLBA 2C57A 1AXGA 4EUHA 1N2CA 3A31A 4MUGA 1YZLA 4HNHA 4ILEA 3ZWAA 1JBEA 1M0SA 3IA7A 1YQTA 3G0HA 2Q5IA 3QEAZ 2V7EA 4M88A 3F0TA 3P9PA 3EH2A 3VTFA 2YY7A 4DMCA 1KOLA 1AH2A 1EFVB 3AJ9A 3NV7A 2WYHA 3K94A 3RVMA 4KQHA 1JQAA 4N40A 4HVCA 1EUCB 5JXHA 1IJEA 2WE7A 3ZZ0A 2PFGA 2XUHA 3UJDA 4KSYA 1F1BA 3CY6A 4JI4B 3U4GA 3H18A 4F3CA 3K3PA 1P4GA 4EUNA 2FG5A 3IV7A 1BCRA 2ODPA 3C5VA 4B0OA 3ESXA 1ZK4A 2VZ8A 2AYXA 3DAYA 5EZSA 4OJMX 1M67A 1Z4OA 2QRQA 1E2HA 3RS9A 4OOEA 1FVXA 3AHJA 3G5MA 3QEMB 2QGFA 4DWJA 5HWSA 4LISA 1I7QB 3M5CA 4MW2A 2ZTHA 2CNKA 1H2AS 3LU1A 4LV5B 1PP4A 4CLDA 2DE0X 1O2DA 3EFEA 1EFHA 1GAWA 3I9NA 1P7CA 1QBKC 1RZ3A 1YS7A 4J49A 4ACBA 2QT9A 1IZZA 1CJBA 1U2GA 3LRXA 4FZ5A 1HK7A 1VG9B 4XUCA 1NVAA 1I4EB 2Y1GA 3IVMA 2ASVA 4FGLA 4KUGA 1G7CA 5JSFA 4RTMA 1FIUA 1XOIA 1VXRA 1BIFA 1VJGA 1Z28A 5EJ7A 5E9WA 5JWHA 4ALKA 3AYZB 4MNTA 5LZ2A 4RV9A 1F2UB 2GZMA 3D5EA 5FCDA 1ODTC 5LQDA 1W94A 4WZAB 1V4VA 2JPDA 2Y6UA 1BCSA 4RCVA 1WPRA 2AOUB 1SBQA 2F1JA 3KKZA 4AP6A 1Z47A 1RNLA 4M8IA 2P3LA 1D9XA 1S7CA 3COVA 2C29D 1S3SA 2E6KA 3EEIA 5BOVA 4YAGA 1YRHA 2IXGA 2F1OA 3AU9A 5CYOA 4KN9S 4NV3A 1V4BA 5AKEA 2C9MA 4RQTA 1RC8A 1NQAO 2IOFA 3MOGA 1A88A 2VH5R 3HA5A 1ZVQA 1TEHA 5DM4A 3GDWA 4ZZ0A 4Q3AA 3WZLA 3UT5B 5GVRA 3QLUA 2EGUA 4J0IA 5JARA 3I53A 1J8YF 3KOZA 3IEXA 3O26A 1E1QA 2FTKE 2GEBA 4L5IA 1A2OA 1KP3A 2Z8XA 4XX0A 3ZWCA 1LD3A 3ZLUA 1W36C 3QSGA 1QQAA 3OCYA 1EE2A 1G2IA 1QCYA 1YB2A 2GJ4A 3IYLW 3PPXA 2NXWA 3C4JA 4KR0A 5FUVA 2QJOA 1QU3A 4RVHA 4UHJA 3UJ3X 1OLUB 3WICA 1W25A 5G0WA 1D2CA 1ADGA 1VKNA 1XMIA 4RPKA 5M2QA 1WW2A 3KAKA 3GCDA 4NZ9A 2GM9A 5BMVB 1FB5A 4FHEA 2Y1CA 3NGXA 3UUEA 2X58A 3VI3B 3VOBA 4GL4A 1KU6A 3ZNQA 3K2EA 4Y1EA 5GOTA 4G9BA 3HCAA 2AD1A 1DSSG 2OV1A 4HV4A 3PQDA 1P0IA 5DTRA 3DKPA 3OTGA 1P5JA 4KR3A 2LZ0A 2A14A 5AH0A 1YB5A 3HEBA 4JLSA 4P22A 1DKRA 4WZ6A 4YDQA 4YRQA 3V8QA 2O0LA 1MRZA 1QX3A 3GVCA 3RRJA 1ZJ4A 5A4FS 5D6NA 2P30A 2QTLA 5EEHA 2Y4NA 3NWJA 4IVRA 5KVCA 3GD5A 3FWPA 1CRWG 2I1WA 2PR7A 2QQFA 5CLLA 4ZCQA 4ALMA 4FN4A 1E1DA 3U4QB 2ANBA 2Y77A 5FTJA 3W8RA 4A91A 2ZCVA 4TT8A 3QXSA 4NS1A 4QPNA 1HT3A 4YIKA 5KYUA 3IMEA 3ITNA 2ZEJA 4DCJA 1WB4A 1WZNA 3QU5A 4H15A 2WT8A 5JWRA 4EA7A 3TRKA 1TTHA 2HA5A 5DBIA 1TLFA 4C2UA 4HADA 2RJOA 2X0NA 5DMHA 3ED5A 1A96A 1EU1A 2H5IA 5DZSA 4A73A 2MMCA 1C9DB 1B26A 5BQ3A 1JFTA 4OAPA 4XUDA 5ALSA 1OIXA 3NDRA 5L7TA 2ZIEA 5D3QA 2MSLA 3IP7A 1DMSA 3JPWA 2OE2A 1U65A 2DMRA 3DZDA 3LHIA 4JU9A 4JUFA 4KSBA 1XLUA 4E5KA 2J41A 3WWDA 4MCHA 4Q1BA 2C7GA 1DEKA 4DDUA 4DLXA 1XDUA 5EMKA 2WSSA 1JQ3A 1UWCA 2VWHA 4XFKA 3PNVA 4DSOA 2J5XA 4EF5A 1Z15A 5CW2A 3GLHB 3VUEA 3B9PA 4EYOA 1CULC 5K9ZA 2MSCB 4OCZA 1C3XA 1NF8A 2R9VA 4RTJA 2XTNA 1MOQA 3L6UA 4HB0A 1XGKA 1HYEA 2IEBA 5KYTA 4BVHA 1U2QA 4Y6OA 3EODA 2YXNA 5H68A 4P8RA 5C7OO 3NEPX 4IKEA 1IB0A 5FBQB 1E0AA 5ILQA 2VT2A 3LY5A 1L9XA 4R51A 1H2YA 3GLIA 4F04A 3ZZTA 4YT8A 1NBWB 4HAOA 1ISPA 5EIFA 2IQIA 1BHJA 5FIUA 4X45A 1HSOA 1XC7A 3W5AA 1XF1A 1LNSA 3HBJA 5A3VA 1AMUA 3CJTA 1NW7A 3ED1A 2Z9DA 4EKEA 1K3FA 4MVXA 4YJGA 1U2TA 4AT1A 2OBBA 3GVHA 3USZA 1D4AA 2BZGA 3COWA 2V58A 2AXPA 1FRZA 2OO3A 1HV8A 4LNUA 3H6HA 2NU9B 1YOVA 4HWKA 3BSFA 2AI2A 4XWYA 2W2QA 1G63A 1B8UA 2HADA 3PE3A 4PYNA 2OZPA 4UM5A 4NCNA 4R7GA 5IC5A 4ENSA 1UBKS 4Y0VA 3JQAD 3AU8A 1ZBDA 1ZOSA 5B1DA 5DV9A 3EIQA 3LX4A 4Y2VA 5TDHA 3IP5A 3HQ4O 1E59A 5KYXB 1YCHA 3PVCA 5TPZD 3B7PA 4NBSA 5CLGA 1TE2A 3LLMA 4G0VA 1QQTA 1S4MA 3HCNA 3ADPA 3II6X 3ZOKA 3F47A 2Q28A 1ISRA 2BKAA 1ZYUA 2ZBPA 1W47A 2OV6A 4RE6A 4QE3A 4IP0A 1QYXA 3UGJA 3VMFA 3LXMA 3HN2A 4X92A 2I4IA 4JJ8A 4HPXB 1M8GA 3FTEA 1VLJA 3F6SA 3ENNA 4NLLA 5TE9A 3QLJA 5AM3A 2QG9A 1XZDA 4NX2A 1H2XA 4OBWA 3C3PA 5A1JA 2YZ2A 1YQ9A 4ARVA 3H2GA 2OLEA 2LKCA 4RL4A 4ZAXA 1B1CA 1N4DA 4YP1A 1H2RS 1ULZA 3E9ZA 3AVPA 4C29A 3DHVA 2PFSA 2W2OA 2H1HA 1CXZA 4D2IA 1IVYA 1U0NA 3ZV6A 1BGXT 4NJMA 1JR3D 2I66A 3VNBA 4PLVA 4RA6A 4AMGA 1F9AA 4EKDA 1YOBA 2JH8A 2JKVA 4IZIA 2YWGA 4KPEC 2VJAA 2O19A 2KBFA 3C8DA 4N5IX 1K98A 3MNFA 4BVBA 2YCLA 4MDFA 3MJFA 3NWOA 1S3GA 2IU3A 1HMYA 2QJTA 3RSSA 3TZQA 2YWEA 3CLSD 4PVCA 4J9UE 3D6FA 2W8ZA 4CIVA 3MWGA 2BMAA 1TO2E 4H7HA 4B6PA 2FZCA 2ZUSA 1Z5ZA 3P9XA 1A9OA 4LDZA 3V34A 2C2HA 4ZXFA 4FNOA 4Z53A 3DZKA 3RTCA 2V3CC 1Q14A 3N0WA 3H9GA 3N9IA 3UKJA 5DHPA 3LO5A 1T0IA 3BJEA 4DNOA 4OHZA 1M1UA 4PLHA 2YWCA 2E1RA 4G4SO 4WOKA 3N0RA 5JI3E 2CNWD 4MB2A 2JB9A 4MQBA 4YIHA 4FMDF 3PF9A 3ICOA 3SZMA 3T6KA 2HZBA 4Z1MD 1SUSA 5YASA 2JGEA 3I32A 4NDNE 2ESRA 3VSAA 4GLLA 1X8XA 4KQ9A 2X9LA 3WDLA 1TU4A 3QNWA 1PFQA 2QE6A 4I9NA 1A8IA 1J0AA 3U0BA 1M1NB 2VRCD 2VHEA 1NN5A 2D06A 1P73A 2LCIA 3FRJA 2JI7A 2NU8B 1CUHA 1BN6A 4ZARA 3KAQA 4EABA 1S2MA 5J40A 4F2GA 1XI2A 1YRQA 3R0ZA 1BRTA 1MBZA 4UMEA 4E07A 2WINI 2F9FA 4R54A 2JHFA 1T36A 2O20A 2BEWA 2PQ2A 3EC1A 3PXUA 4RZQA 4KU4A 1XXHE 4UDYX 1XHFA 3FOAA 4ZQHA 5ERYA 4LI3X 4N3CA 4BNTA 4EM6A 5EJ8A 2A0UA 3R5HA 4GG1A 3AJRA 2VSOA 4YUZA 4FFOA 3KL4A 5CDGA 4JT4A 3OJLA 1Z0ZA 1WY5A 2QRPA 4V1CI 4RVCA 4AJ9A 4OFWA 5DLEA 1AO0A 1WKCA 4C1BA 1C3OB 3EOBI 1RXVA 3G79A 2FR8C 3PHHA 4JC4A 1BS9A 4FLFA 1L5GB 1A1VA 4IWNA 4CV3A 3VGJA 4L5CA 4QWWA 1QRTA 1J6UA 3T9AA 1M75A 5LA6A 1O58A 2B8JA 3ZX4A 2FFBA 1JIJA 2QPAA 2QTAA 3KR9A 3RU2A 3PTAA 2GEUA 5ICFA 1XJQA 3PC6A 4HDNA 4DM4A 4PCLA 4TS3A 3HY6A 1E0DA 3O9VA 4GR9A 5C53B 2A1UB 1KQFA 2CLMB 1O87A 1U8ZA 2HCRA 4LTNA 1JJ7A 2DLNA 1OAKA 2WUFA 3B6ZA 3M70A 4BTLA 3K1TA 3MJTA 4PC2A 4G24A 4MVCA 2P9FA 4ER6A 2VZ9A 4OU4A 5IKOA 3EVGA 1KMIY 2R8OA 1H2BA 4G2NA 2BFFA 1J9EA 2WOOA 1A71A 3R3VA 4MW1A 5F78A 3V1YA 3ZY2A 1NXSA 4DC1A 1XMXA 2AJLI 2QL9A 5CU7A 4OHBA 1ECCA 3RVOA 1DAMA 1XVUA 3VPCA 2FPGA 1OFHA 4C07A 3GT7A 1YJXA 3EDYA 5LQSA 5FBVB 1XF9A 3T7JA 5K8CA 3K9GA 2OYSA 4MYHA 1I51A 1QE3A 1U02A 3IULA 2ZLBA 1FU7A 4QASA 3SQOA 2XKBA 2QTFA 3WRXA 1IRIA 4MI3A 2R8RA 1NYRA 1JMKC 4FEAA 3A9TA 5KINB 1JYEA 1ZM2A 2WI8A 3EVAA 4KLZA 1E5XA 1U1DA 2I2XB 1OR8A 5CDFA 4D9GA 1MX9A 1AKWA 3TB6A 4HQLA 4QOFA 1JKMA 5ABPA 4GBGA 2LE0A 5HZMA 2B5WA 2HUPA 4BBJA 4YYZA 4ENUA 1T1SA 1ID8A 1YS2X 1JSRA 4DPMA 4CMKA 1YBMA 2H18A 3SR3A 3GHHA 2YJGA 2LP4Y 1L7BA 3ZE7A 1HNNA 1LDNA 3EUFA 2GX6A 5DTJA 3VDMA 3STUA 5JNWA 3U44B 3LLSA 1V9LA 4NMMA 5E1OA 4ZTBA 2YWBA 1WCIA 1MC8A 2ZWMA 3A1UA 3QVMA 3L7NA 4Q4JB 1KJWA 3EYAA 4BVEA 1IONA 2IYSA 2XXJA 4TTPA 3KSZO 2QW0X 421PA 4URVR 1OV6A 3G2PA 3AUTA 4OU5A 4I3HA 4DXHA 3TOCA 5AUOB 1HORA 1B3RA 4ZQFA 4E46A 2C84A 5JS6A 5CIYA 1MB3A 4KZKA 4N8EA 4JYBA 1UFKA 4P86A 2R85A 2VCEA 2XUZA 4E03A 2QU7A 3ANXA 1G17A 3AR6A 1JEEA 4N01A 3U7RA 3W6ZA 1NX9A 4Y1RB 2R1ZA 1GSIA 4G8CA 2MIIA 5JAIA 5JUWA 5D85A 1M2JA 1A5TA 1ZU4A 3PIIA 4FB4A 4Y6QA 5K3SA 1W87A 3C0KA 3PQEA 3MCZA 3KETA 2P2LA 3OPVA 2OZLB 2Q5CA 3MTBA 3VO2A 3CUSA 3IUJA 4DNQA 5A6SA 3PI7A 5HTOA 4MYUA 1HYGA 2W43A 4KBYA 4TYMA 5JXJA 3JVEA 2QMQA 5CDHA 5KQPA 1NVTA 4JLJA 3NKLA 2Q0XA 2AG6A 1TYAE 1D03A 1VKJA 2HBZA 1G2QA 1MB2A 1BWPA 2VT3A 4NZYA 3PNSA 5DYTA 1Y0BA 1Z6YA 1FYVA 4G4SP 4RKWA 4U2FA 2RCYA 3GG2A 4D5EA 5JXIA 4Q7EA 4U8GA 4Q9KA 4MV8A 3NPAA 2FK8A 1Z2EA 2GUWA 3DDZX 4JBNA 5JC8A 2I76A 2ZRNA 3IVCA 3NVMB 5HIKA 3GLFB 2VWQA 2AQHA 3MINB 3AWIA 3AY3A 1J33A 3GARA 4LYGA 1ZM7A 4M7RA 5CRIA 5FTKA 3RS8A 3UHOA 2ZVJA 3DCYA 2HYDA 1WHSA 5G4LA 1KKUA 3JTEA 5L6MB 1H23A 3V2UA 4YRTA 3VZQA 2JAQA 4IDBA 2C96A 3RUFA 4UU0A 4EA8A 1CJMA 4CUKA 4UULA 4WVFA 4YV7A 5BRJA 3ZDAA 1RXEA 4HZUA 2CVQA 3L7IA 4KBFA 1JXOA 3MGAA 3KPJA 1C8LA 3RHTA 1CIPA 5KTOA 5BUCA 2UXDB 4L9WA 4NBTA 1KJ9A 4RK4A 2QL5A 2EQAA 1EBFA 4G5RA 3TNJA 2X14A 4KLAA 2NU6A 5KOJB 2W6ID 4C7VA 3W77A 1TEXA 1A76A 3CURA 4YROA 1ZNQO 5EIBC 1JHZA 4HMOA 3MAJA 5EPEA 4U63A 1UFVA 5CNMA 3KQUA 4ZVVA 1NX6A 1MA0A 4L08A 2FQQA 4GMHA 3SYKA 1PKXA 1G8MA 3UAVA 1DAKA 3GFQA 5CW1A 3C14C 1FUIA 4PX2A 1WVGA 1EX9A 1S96A 3OZTA 2ZBFA 4CM9A 1EQ2A 4LE1A 5JALA 3QQ5A 1DAPA 1XZMA 4U7HA 4DEVA 4FFDA 1IM8A 1QK4A 4ZZ2A 3OQJA 4K40A 1QFZA 3WSWA 3SJCA 4N8DA 1LLDA 5DDIP 3KKKA 5C7YA 1CZLA 4AX8A 5LA6F 5LIPA 1QHSA 1SBTA 3GRCA 3O5AA 4KW7A 3HU3A 1T2EA 2F9LA 2PD4A 4KAAA 1LBEA 1YJAA 4NG4A 4Z8YA 1S02A 2X1HA 3V5NA 4DIFA 2H07A 2FP3A 1PR2A 3GNLA 2EZTA 3S70A 4WZBA 2MMGA 2DPYA 1BGVA 1UXJA 4M9UA 2DB3A 1SIUA 1ZNYA 2CVHA 2O4CA 5AKHA 2I67A 4LAFA 1ZW6A 3PB3A 1CHDA 4A2QA 1MORA 2C4MA 5F9MA 3M34A 5EJ5A 4GH5A 4NE9A 3L1JA 1GRRA 2A9OA 1EGMB 1U2DA 2UYCA 3SR4A 3OETA 1NPDA 3HM2A 3NS7A 3OE4A 1EEHA 1LPBB 2BW0A 2JAPA 4PCVA 4F5YA 3PDCA 4P3PA 1QRRA 2G9QA 3A3KA 4JY7A 3GRFA 3UK2A 4BGDA 4EJ0A 3FPJA 1YKSA 4JNKA 2ZBQA 1CS0A 4F86A 2OSVA 1U2ZA 2WMDA 3OJ0A 5LOVB 2Q6IA 3PXGA 2JC3A 4DG5A 3QKUA 3FHTA 2WQZA 4PS0A 1W49A 3BMOA 4M0KA 2WWXA 3EZGA 1E7MA 1GT6A 4OHVA 1Y5IA 1D6NA 3GRPA 3BTUA 3IMGA 3C6BA 5BN5A 4F8JA 4MR8A 5T67A 3P1JA 4X1KB 4RLQA 1UJBA 5ITWA 3EVTA 1EM8A 3AH8A 1TAQA 2XMQA 3HSSA 2G8LA 3KJQA 1QF7A 4HQOA 2DHCA 1OFTA 5FOSA 3VR5H 4P3XA 2R1UA 5E6SA 2H7VA 4D0NA 1FTYA 5BW6B 3ZQJA 5IX8A 4QLAA 4UCFA 5TEVA 3KP1A 2YIJA 4BEJA 3LDGA 2JGDA 3RFVA 2HU2A 7GPBA 1L4YA 4HNUA 4L0QA 3E7XA 3MW8A 1G21E 5EZYF 3C4VA 3AHIA 3X0DA 6PFKA 1RRFA 1JU4A 4NBWA 2DQYA 4JMLA 4DMRA 1OUMA 2FEXA 3KD2A 1DJPA 2PKCA 1Z36A 3GD7A 1Z26A 2JIPA 3AR7A 4H1UA 5C8XA 3QYPA 3PJEA 2OVFA 4PRYA 4DY6A 1DT3A 5CG2A 2ONCA 3LTEA 1GLVA 1VE3A 4COOA 3P71T 3IJPA 4JLUA 1TQDA 3RR2A 2PM8A 2FPPA 2VLBA 2WIKA 4B83A 1MOPA 3AVWA 3UJCA 3HJHA 3O2JA 3JSAA 3PEVA 4WCFA 4K6CA 5L8VA 2FX5A 2WE8A 1UPBA 3WY9A 2O9JA 4HPJB 3PQ7A 2X86A 2O0JA 4X1YA 5AMXA 3IUBA 1F48A 4V03A 4BUZA 5BR1A 3ADBA 1QHHB 5EFZA 2B6NA 3QYJA 3C70A 3H8SA 1PX0A 2GBCA 3D6MA 1ZLXA 1R6VA 2QP9X 5FP0A 2WJWA 4II7A 1I36A 1KHTA 2Z2XA 4DV3B 1Q17A 2NLOA 4K3VA 5EZQA 1VSBA 3ZU2A 2GGSA