4JUIA

Crystal structure of tannase from from lactobacillus plantarum
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
470
structure length
470
Chain Sequence
b'SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTAAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
molecule tags Hydrolase
source organism Lactobacillus plantarum
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
total genus 160
structure length 470
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4juiA00
4IH1A 2I3DA 1JT2A 4ZXFA 2PKYX 4EHBA 5K3FA 4Y2UA 3M3DA 4JEIA 1XZBA 4W1PA 4UFNA 1TRHA 4U2EA 4ZREA 1O6GA 1G42A 2WG1A 1WPRA 5FOQA 1U65A 3FLAA 2B4KA 1VOTA 1F8UA 2OG1A 5AKEA 5ALSA 1ACJA 3A2MA 3VJKA 4FHZA 5JARA 5AHXA 4Y2PA 5HF9A 4Q3OA 1CUJA 5LZ7A 5CT9A 1XQVA 3FCXA 3AFIA 1TQHA 3KOOA 3IDAA 5ALGA 4H7EA 4EUSA 2JBWA 2XMDA 1Y37A 2XLCA 1MX5A 2XUPA 3HZOA 4FBLA 4Q3LA 5AJHA 2G4LA 2H9YA 2WM2A 3HI4A 1HL7A 4BVKA 3IUNA 4BATA 1FFDA 3QH4A 4XIIA 5ALPA 5ALRA 1ZIYA 1W6RA 1J2EA 1ODSA 4BDTA 3AINA 3N2ZB 4HXEB 2RHWA 4KYVA 1Q83A 1BEEA 2X8BA 4J0KA 4UFOA 1XQXA 4HTAA 4BCDA 3SK0A 3ZLTA 1EX9A 1G66A 4OU5A 1AMNA 3HSSA 4DSAA 2XMCA 1DT3A 2RHTA 3FAKA 5I7UA 2CEKA 5AM0A 3C5WP 1E89A 5BOVA 2ROQA 2BKLA 4UPDA 5LKAA 1XZAA 5YASA 4JNCA 2XQJA 3BF8A 4H7DA 4RE6A 2XUKA 2G63A 2IITA 5AK6A 3C5VA 1JJBA 4P93A 2HA6A 5DYYA 5K3AA 4H35A 3BE8A 5CT8A 4KE7A 2JEZA 5EFZA 3W9UA 1GGVA 4Q34A 4Q1VA 2WHPB 2YASA 1YA8A 4NMWA 2WUDA 4J03A 3V1LA 3BIWA 3OTQA 4K5QA 1HBJA 4MYSA 1KU0A 3H2KA 4EA6A 4DIUA 4DLNA 3C8HA 3IUMA 3R40A 3STYA 1QIDA 3M81A 1ZI8A 1VE6A 3TJMA 4AB1A 1E8NA 4G4GA 5A7FA 2WILA 1IUOA 2DQYA 1QTIA 5E4YA 4LIPD 2J4CA 4LXGA 1UK7A 3MUNA 4XJVA 2B20A 3WL7A 5D3ZA 1MU0A 5FKJA 3PDCA 4L72A 3WA6A 3P2MA 3DKRA 4OB8A 3VISA 1X2BA 3EIOA 4MWSA 5DWDA 1CIJA 3CN9A 4QLOA 1J1IA 1DU4A 3DL4A 3DEAA 4BBZA 2C4HA 5ALJA 2WLSA 3FYUC 1P0PA 1MAAA 3FSGD 1TKRA 5AK5A 4B0OA 4A23A 2JGMA 3ICVA 3QM1A 4UBNA 1BCRA 2HL6A 3IA2A 2BUAA 1CFJA 4ARAA 3HJUA 2JGKA 3I6MA 4KACA 4U2BA 1WM1A 2DHCA 2O2GA 1GPNA 3G0CA 3PF9A 5DNVA 3LCRA 1MJ5A 2FJ0A 3O4HA 4E15A 3W9BA 1AUOA 3V1KA 1E66A 4D9JA 1T4MA 4Y2YA 1Q84A 3F9CA 3ED1A 4QDTA 2DQZA 1ORVA 4CG1A 2OQIA 1CV2A 5BWBA 3BDIA 5ALWA 4KEAA 1CPYA 3EQ8A 1LZLA 2QM0A 3Q0TA 1IMJA 4AO8A 5C8XA 4X00A 3DQZA 1QIGA 2XMQA 5AP9A 2GZRA 1RYYA 5AKGA 1AC5A 1HLGA 4XVCA 3DCNA 1LPNA 3ZPXA 5JAPA 4AXBA 1E5TA 3DLTA 2QRUA 2HRQA 4Y9SA 5CXUA 3R41A 2XUFA 5SYNA 3E4DA 4KE6A 2DHEA 2WQZA 2XQKA 2QXUA 1UK8A 4EY7A 3KWFA 2VTVA 4QDOA 3R3VA 1N5MA 5HKBA 2H7YA 3OOSA 2VSQA 3IUQA 4ZWNA 4MWTA 4J0JA 4Y2QA 3WJ1A 4FBMA 4X94A 3F67A 2HFKA 2VJAA 3OC0A 4F60A 1EH5A 3HEAA 3QZUA 3V1NA 5CT6A 4E46A 3BXPA 3TRDA 3WA7A 1LBTA 1XRMA 5DLPA 3HACA 4F5ZA 5KWJA 2XE4A 2XUQA 3NWOA 3RKSA 1A8QA 2OAEA 3W04A 5HCUA 4Q05A 3PUHA 4BC1A 3WK6A 1CUSA 2G5TA 4B6GA 4X71A 3BJRA 5EHNA 3A6ZA 1BE0A 5AO9A 3ZV7A 1CVLA 2AJBA 1WB5A 2WJ4A 3DOHA 3B3QA 3BIXA 2XUJA 4EY8A 1R9MA 2CBGA 1R3DA 2GBCA 4GHWA 5A2GA 3NOXA 1CUAA 1SFRA 1XRNA 2WFZA 3JW8A 4L3WA 4XX1A 3K2IA 3E3AA 1AGYA 2JGFA 2ZYIA 1XRLA 5CH8A 4L0CA 1FJ2A 3PFCA 4BZWA 3HRHA 2XUOA 2WUFA 1GXSA 3PFBA 1P0IA 5ISMA 2WKWA 5ALVA 1LPBB 4GXNA 6YASA 3I2KA 3PICA 2Z3WA 3O0DA 3E1GA 4AO7A 3GUUA 3O9MA 4JYPA 1QJ4A 4X6XA 4WFKA 2Y2VA 3JWEA 3I28A 2WG2A 3H1AA 2WUGA 1A8UA 1P0MA 2J4FA 4FWBA 2XLBA 2HA4A 2YH2A 3BDVA 5JD5A 2LIPA 1K5PA 1SC9A 5E4JA 1LBSA 4MEBA 1QIJA 2ZYRA 5E2IA 3D2BA 2PM8A 4ROTA 4O08A 5HK8A 2XUIA 1KEZA 1VXRA 1J07A 1CUYA 3V48A 4QNNA 3CCBA 1XZMA 4EB0A 3WZMA 3WK5A 1WHSA 3VDXA 1W75A 3W05A 5DYTA 1CUUA 4CCWA 2PSFA 1LGYA 3V1MA 4EY4A 1ZD5A 2V98A 1GZ7A 4FKBA 1TAHA 5JZSA 2FX5A 5ALEA 4ZV9A 2XMGA 3FYTA 3T52A 2CUTA 2XUGA 1YASA 1UZAA 3FVRA 5DNWA 1ZGBA 3M82A 1EDDA 3IURA 5HZGA 3R3YA 2UZ0A 4J3JA 1EB8A 4QDZA 1XZKA 1YR2A 4AN1A 4W1SA 3FNBA 4KAJA 4B0PA 3A70A 4FNMA 4PSDA 2WHRA 5KREA 1ZI6A 1QO9A 5SYMA 3DKKA 4DNOA 1XLWA 1PJAA 1B6GA 2I03A 4KAAA 3C6YA 3R3WA 1CUCA 3G0BA 2WIDA 4G4IA 3FLBA 5EHZA 3G0IA 3S2ZA 5LZ4A 4UBOA 4C4YA 1DQYA 3WYDA 2QJRA 1MAHA 2X5XA 2ZJ7A 1AQLA 4K6HA 1FFEA 3G9XA 4C4XA 1J06A 2HA5A 2WTMA 1RP1A 1YS1X 4I3FA 4XWGA 3WKDA 1QGED 2J3DA 4LXIA 2C5GA 1C7JA 2VT6A 1K8QA 3D0KA 4FLEA 3VKFA 5AM2A 5KBYA 3WMRA 5FPPA 1AKNA 3OURA 1UFOA 3B5EA 3I1IA 2O7VA 1ZOIA 3ZLUA 1BROA 2V97A 4OU4A 4X95A 1MX1A 3KD2A 1DWQA 4PSUA 3O4IA 4KRXA 4LKOA 4W63A 1H2XA 5LYYA 2EEPA 4J0CA 2EDCA 2OCGA 2PSHA 4INZA 3L1JA 4OYYA 1XZDA 1CUHA 3ESDA 1HKHA 4IO0A 1IUNA 3G9UA 1THTA 2R11A 5AKIA 5EIEA 1H22A 3GROA 2ACKA 4AQDA 5IVIA 5HF8A 4X97A 5A71A 1XLVA 5AM4A 3AUKA 1CLEA 5LZ5A 4NVRA 5HKAA 4U2GA 4UFPA 4YPVA 4AZ3A 1XRQA 4FMPA 3VVMA 4B83A 1JU3A 4P9NA 2XMRA 3WIOA 2VJDA 2QS9A 2HHAA 4UUQA 1CEXA 5DNUA 4UBLA 4EY5A 2PBLA 4YX9A 4GBGA 1VA4A 2HA0A 3WWCA 3AZOA 3HXKA 4CCYB 1SCKA 1UWCA 2AJLI 1QOZA 3AIKA 3VJLA 1ISPA 4QE3A 2ZJFA 4WY5A 4G5XA 4Y2JA 3QPAA 1XZJA 1UKBA 1QFSA 3OM8A 4HRXA 3DL7A 2OCLA 4M0MA 1GKLA 2XQGA 2D0DA 3WZLA 4H18A 3TGLA 1W76A 5IKXA 1MX9A 3QVMA 2PU7A 4C4ZA 3MVEA 4PF1A 4MEAA 3H2IA 4UBKA 5FUMA 1W4LA 3ZI7A 5ALOA 3FBWA 4MYDA 1YB7A 2DSNA 2X76A 1XQYA 2WHPA 3TEJA 3BF7A 1XZLA 4HZGA 4EY6A 2JGJA 1JMKC 3X3HA 5JIBA 3F96A 4L9AA 4KE8A 3HC7A 3GELA 3DYIA 2GZSA 3D5EA 3EF3A 4PNZA 3C87A 5ALLA 3R3ZA 5ALQA 2WTNA 2VT7A 2PX6A 3N0TA 5AKJA 3D59A 1QIFA 5EHQA 5AM3A 4GLBA 1DINA 2OAGA 2VJBA 3STUA 5EIAA 4UHEA 3G9ZA 3HABA 3C6ZA 2IIVA 4FTWA 4X6YA 3QBJA 4X90A 1XZHA 2ONCA 2ECFA 1H23A 3CCCA 3QMWA 4UBJA 5HQ3B 1JKMA 1CUZA 3G0DA 5A6VA 1EVEA 4WFIA 4N8EA 4MXDA 3D2AA 4MQMA 2QTBA 4CIBA 3GZJA 4J0IA 4N5HX 2JGEA 3UUEA 3PF8A 4RNCA 1QIHA 4HRYA 4BP8A 1ETHA 3G0GA 1LPAB 1EINA 3FYUB 4CG2A 1H2ZA 1R4ZA 4Y2XA 2HIHA 2OXEA 4AN0A 4H7HA 4LYDA 3ICWA 1BN6A 3JYHA 1OCEA 2Z8XA 1EVQA 1ZIXA 1ZD3A 4UBMA 1GQRA 3ANSA 3STTA 3D2CA 3FOBA 5JALA 4DM7A 4RE5A 3GFFA 1L7QA 4H7FA 5ALHA 3WKBA 3SWWA 2Y2UA 1VLQA 5AOCA 2OGSA 1E8DA 4J0HA 3ESAA 1YAHA 1MNAA 2Q0XA 4HS9A 1WOMA 4JYMA 1BS9A 3WKCA 1ZD4A 1TCCA 3WWDA 4DNFA 4G4JA 4G9EA 3WKEA 2QR5A 2I78A 3OPMA 1P0QA 3WIBA 2QJWA 4BAGA 5BWCA 3WYNA 1FSSA 2HM7A 2OGTA 2XQFA 2VAVA 1R88A 3AIOA 3FSGA 2WIGA 3WJ2A 1ODTC 3G9TA 2WFMA 3FWHA 2GYUA 1E8MA 3YASA 3RARA 2BJHA 4F21A 1THGA 4B9AA 1IZ8A 1UOPA 1DWOA 3QMMA 4CG3A 1XKTA 2OLEA 5AKHA 2I3ZA 2PVSA 3IVMA 4X91A 3C70A 4Y2TA 2D5LA 2ES4A 4DYHA 4GEGA 5FPQA 5AKLA 5AOAA 5AH0A 4X7BA 2C0PA 1IUPA 1F0NA 4LXHA 4BCCA 4DSZA 1NU8A 3L1IA 5CT5A 1W1IA 4HVTA 2O2IA 3WWPA 1F6WA 1A88A 2CJPA 5JYCA 3F98A 1A8SA 4WFJA 4C87A 1QIIA 1H2WA 4G1FA 3O95A 3VVLA 2XUDA 1JFRA 1IVYA 3I2GA 5EI5A 4Y7DA 1OILA 2J3QA 1R1DA 1LPSA 5JASA 4WCVA 4BAZA 1BN7A 4OD0A 4OUKX 2XMSA 2B9VA 3WL8A 2PSEA 2VEOA 4CFSA 2JGLA 4B81A 2C5FA 4GI1A 4JUIA 3BWXA 1MPXA 2WHQA 1WPXA 3QMVA 4K6GA 1MO2A 4FNGA 1USWA 4IH9A 2BUCA 1VJ5A 4X93A 1QIMA 2DHDA 1XRPA 4ARBA 4DTCA 4N8SA 4A16A 4QWMA 1VA5A 5CURA 3CXUA 1UXOA 5ALMA 5HFAA 5IH7A 4OSEA 3AZQA 2PUHA 1K6EA 4X85A 4W1RA 1X2EA 1DX4A 1X70A 3WWOA 4P08A 1OXMA 5FP0A 2E3JA 1H2YA 5C81A 1K4YA 7YASA 4OYLA 5EIHA 2VATA 2V96A 3ILSA 5D3KA 4P92A 4DNQA 1DX6A 4G9GA 1QONA 1ZD2P 5ALKA 3C43A 1ORWA 1U4NA 3I2IA 2Y6UA 4Y2RA 5JATA 3O4JA 2CKMA 2ZJ6A 5AKXA 5LLSA 5K3EA 2C58A 5AK3A 3QPDA 5H3HA 5ALYA 2OPHA 3LS2A 1WHTA 2ACEA 1XROA 4LHEA 4OCZA 1YA4A 5LKRA 1M33A 2Z8ZA 4H0CA 4NS4A 2BGNA 4GWLA 3DS8A 2GYWA 4BC0A 3ZLVA 5JADA 5CTAA 5FLKA 1QZ3A 3FVTA 4F0JA 2BAGA 1LZKA 2G5PA 5C8VA 4MQLA 4KRYA 3UUFA 3I2FA 1QTRA 2FJPA 2GBFA 4J7AA 3EQ7A 4N5IX 4CI9A 4Q3KA 4BE4A 1AURA 1JI3A 4PO3X 4ITVA 4UBIA 3PE6A 5T4HA 1GPKA 4BDSA 2VA9A 3L1HA 5DTJA 3Q8WA 4B80A 4HXFB 2BGRA 3QYJA 4HXGA 4A5SA 3AZPA 2HADA 4QDUA 4UHBA 3HLKA 4DMFA 1EK2A 4I4CA 3R0VA 2OCKA 2GYVA 2QOEA 4B9EA 1R50A 4BAUA 1L7AA 4X92A 1EA5A 1EDEA 2FUKA 1L7RA 1XLUA 1Q0RA 2WJ3A 3LIIA 4I19A 5LP1A 4HAIA 3RK4A 2HA2A 4QEKA 1W52X 1GQSA 4GDMA 5A7GA 3S8YA 2OGZA 2ZVDA 3G8YA 5BV7A 4JH0A 1U2EA 5DTIA 5CT4A 1QE3A 4X3CA 1BCSA 5FDFA 5LIPA 5LZ8A 4H7JA 5IVKA 4FFVA 1XZFA 2PPLA 5DYWA 2O2HA 4QWWA 3DDUA 4G8CA 1VZ3A 1CR6A 3WL6A 3ANTA 5A7HA 4BZZA 5AKKA 5IVDA 5ALDA 3U1TA 1BEZA 3G02A 2QZPA 1S8OA 2BCEA 1CUEA 5JD6A 5EHXA 1EB9A 5F4ZA 1QLWA 4OPMA 3OG9A 3VJMA 4CIAA 5CW2A 5K3BA 3D7RA 3H2JA 5C7YA 4ZV7A 1VZ2A 5J3JA 1CUIA 2AJ8A 1ZI9A 3GBSA 5D6OA 4AMZA 3SC2A 4G8DA 1MTZA 5JANA 4C89A 2XUAA 2WUEA 1LNSA 2CMFA 2K2QB 2IX9A 3I6YA 2H7XA 1DWPA 1YSCA 1LPOA 4PSCA 1XFDA 1UOQA 1CUFA 1ODCA 1UK9A 5K5EA 3E0XA 2HDWA 5AI9A 1HDEA 1YB6A 1JU4A 4AMYA 5AI0A 1HQDA 4FOLA 1G5FA 2HA3A 2WG0A 2H1IA 4FFWA 2XB6A 1Q0ZA 5HK9A 2VF2A 4KJXA 2WJ6A 4M0FA 5HQ3A 2NW6A 3KWJA 1VE7A 5LZ9A 3W2TA 1E3QA 2XDWA 3DOIA 3WK4A 4WDQA 5HF5A 4BRZA 4QZVA 3T4UA 3IBTA 1NX9A 1ZJ4A 1EHYA 4WDRA 4UHDA 2XMZA 3KDAA 4QDXA 2HFJA 3RLIA 4E11A 2OQVA 2QXTA 5FV4A 4LYEA 4ETWA 5AM5A 3LIPA 1WB4A 4DMCA 3MGAA 3FCYA 5AK4A 1PV1A 4FLFA 3WL5A 4J0GA 4N8DA 2PSDA 4BCBA 3C6BA 4Z49A 5JAOA 5K3CA 4H77A 5A62A 2QMQA 1I6WA 3G7NA 1GPLA 3F97A 1GT6A 3IIIA 1C4XA 5CBKA 1C7IA 4BTVA 2JF0A 4KAFA 3R3XA 3H19A 2QVBA 2BUBA 5CH5A 3MUOA 1CQWA 2WIKA 5JD4A 4B82A 2YXPX 1AX9A 2QT9A 2HA7A 1XZEA 4YASA 3WKAA 4UHHA 1VXOA 3D3NA 4BRSA 4E14A 4X6UA 2C7BA 4C01A 1Y7IA 4Y2SA 1SCIA 1K63A 1BU8A 3LP5A 4OB7A 3STWA 2YYSA 1WCYA 1N1MA 5JZ9A 5T4EA 3WK8A 3O9VA 5D7BA 3FYUA 1EI9A 2PL5A 3H2GA 3K9BA 5ALNA 2RONA 1MN6A 5EGNA 3O4GA 5I8PA 2PSJA 2DFPA 3DJYA 3HYSA 4W9RA 1QFMA 1Y7HA 3KXPA 2C0QA 3LLCA 2H7CA 3AILA 4BVJA 1UK6A 1TIBA 1ZGCA 3QITA 4AO6A 3K6KA 5AKYA 4M0EA 4WY8A 1EXWA 1CUXA 2XT0A 4DMHA 1FFCA 3W06A 5K3FB 3WQHA 4K6KA 3BL8A 1CUDA 4H7IA 1QIKA 3WI7A 4BYMA 3H18A 1TCBA 2GBGA 4PV7A 1SOMA 4PQEA 2Y6VA 1XQWA 4OB6A 1JJIA 1YCDA 4W1QA 1KU6A 1R9NA 1YS2X 1YAJA 3ESBA 4B7ZA 3C45A 2CB9A 1RWQA 1MT3A 3WK9A 3VXKA 2ZSIA 4B85A 3C8DA 2Z5GA 4BP9A 4U2FA 2BFNA 1D07A 1ZJ5A 4WJLA 3V9AA 4QA9A 4QLAA 3PUIA 4ZRDA 5I9IA 1CUGA 1VKHA 1XZGA 4DGQA 4G8BA 2AJCA 1UKAA 4FDMA 2QKYA 2WFLA 2QUAA 4K2AA 2P8SA 4RPCA 4RGYA 2XI4A 5JAHA 3STVA 5JAUA 5ALUA 2CZQA 3U0VA 3NGMA 1JJFA 1IZ7A 4BVLA 2ZSHA 3A2NA 4GECA 2DCMA 2V9ZA 3IUJA 5FRDA 5AKZA 5CXXA 3F8SA 3DD5A 4V2IA 1HPLA 1QIEA 5CRIA 1EK1A 5K3DA 3R3UA 2ZYSA 2Z3ZA 3M83A 3UMJA 2DR0A 5AOBA 1XZCA 1CUBA 5AI6A 4YK7A 1U8EA 4IQ4A 3DYVA 2WU4A 1CRLA 3STXA 1AZWA 2ZYHA 4U2CA 4AZ0A 2WU3A 3AIMA 5AI8A 5AIAA 4J0DA 4C6HA 4Y2VA 3IULA 2WIFA 1JMYA 5FXMA 3QPCA 1A7UA 3A2LA 3BJMA 1BRTA 5AM1A 1TK3A 3H0CA 1WB6A 4IH4A 1B41A 5JZBA 1XRRA 1ACLA 1T2NA 2VQ6A 1UKCA 4GW3A 5ALXA 4BTLA 3PI6A 1DTEA 5ALTA 4TVKA 4KE9A 5ALIA 4B84A 2XMBA 2PU5A 3C6XA 1G4HA 2W6CX 1NU6A 1PFQA 5CMLA 3H04A 2B61A 2R8BA 4U2DA 4C88A 3H17A 4FLMA 2VJCA 3WWEA 1CQZA 5CH3A 1UOOA 4ZI5A 1SCQA 2O7RA 1F0PA 4CCYA 4ZGBA 3AJAA 4AX4A 4H7KA 3KSRA 5KWIA 5T4BA 2OCIA 4Q82A 5ESRA 4IHAA 4KR0A 4PW0A 2EDAA 2ORYA 3WK7A 4BB0A 3NUZA 2PUJA 2RI6A 1O6FA 5AIBA 5HF6A 2HU7A 3DNMA 5E4TA 4DNPA 1N5RA 1XKLA 1LPMA 3GA7A 5AI5A 2HU8A 3RM3A 2W22A 2WFLB 4NZZA 5AICA 2RGUA 1ZICA 1QO7A 5IVHA 2QUBA 3D4LA 2AJDA 1Z68A 3I2JA 4TPKA 4DMKA 5LZ2A 1CUWA 5DJ5A 3I6ZA 1MNQA 3H2HA 1CUVA 3ESCA 4EBBA 1EDBA 3WLAA 1GKKA 1N8SA 2JIDA 2XUHA 2RIPA 2XQIA 2GBIA 2JEYA 4S0XA 4BE9A 1LPPA 5HFNA 2AXEA 2HRRA 4MJ3A 4UHCA 2RAUA 3ZWQA 3H1BA 1DQZA 3EQ9A 2HU5A 5C8ZA 4TGLA 1FFAA 2WIJA 1TCAA 4UHFA 5ALFA 3SX4A 1XZIA 1FFBA 1LLFA 3I1YA 2VAXA 4EZIA 1DT5A 1UT6A 2JGIA 5ALZA 3CN7A 2WSLA 3EBLA 3IB3A 3I2HA 3FLEA 5AI4A 3B12A 5T4FA 2Y1KA
chains in the Genus database with same CATH superfamily
3C5CA 5A9TA 2HSEA 2HNKA 1NUPA 1W85A 3M49A 1IG0A 4I6EA 1NLMA 4EHBA 5K3FA 4Y2UA 2J0QA 3NGLA 1M1NA 3M3DA 3UXEA 1XWIA 1NKSA 3RBVA 3RVJA 4CUJA 3WL3A 4L27A 5TDHA 2OSBA 5E1BA 4KQFA 3TCNA 1UMDB 1UPUA 4LJAA 1GPBA 3MCUA 1DBRA 4IDNA 3BTOA 4ZANA 1U65A 4NS1A 3W34A 1F2VA 1G5QA 4B6EA 4EG1A 1J4AA 3TLYA 1ZN7A 1TW3A 4B6JA 4D9MA 2FH5B 4B76A 1N9KA 3EFEA 4D3YA 4ZK2A 1P45A 4X24A 2ET6A 4JP5A 1XYGA 3QV1A 1YE3A 1F8UA 2OG1A 2G4CA 3T5AA 4ZRMA 2G08A 3WGNA 4D9HA 2WWYA 1N8TA 4XVQA 5ALSA 3DVAA 3LGXA 3O2SB 5JOQA 2ETXA 1S2MA 3O84A 4C3OB 3VJKA 3QYFA 2XGOA 5KYXB 4PNEA 4POOA 2PX2A 1E2BA 3LX8A 1ZK2A 1EFRD 5JARA 2Z9DA 2Z2JA 5AHXA 1QQ5A 5HF9A 3WFZA 1MKYA 2IY7A 1EGMB 1M34E 2VK2A 4KXXA 4TTRA 4A2CA 4Q3OA 2J0SA 3E7DA 3ICOA 4H59A 5LZ7A 1L5SA 4B5LA 5CT9A 1CFZA 5I7FA 4O2RA 4LOKA 4WOKA 4D8VA 3WLQA 2ODNA 3PL5A 3BD6A 2G72A 3SF8B 3S0JA 1D9ZA 1XFAA 1ZX1A 3HVUA 2Q3EA 2O52A 3RKUA 5FAKA 3LMKA 4RCVA 3LX4A 3GJRA 4Q7JB 2SNIE 2XEDA 5EP4A 5EWMB 4LY0A 3KTOA 3BZBA 4U0KA 1VIYA 3RUAA 5BWOA 4MPJA 3LECA 2B36A 3AEZA 1CS4C 5ALGA 3DFUA 3O83A 5FJIA 5G3YA 4BPRA 3WAGA 2LGJA 1Y37A 1QQTA 3UJHA 4B7UA 2FFAA 4POAA 4IQFA 3LO5A 1JDJA 4DR7B 1NV9A 4FBLA 3T12A 5IRCD 1TF2A 1Q44A 2LCFA 3NHRA 3QX8A 4JEMA 3DV0B 2HSWA 2H9YA 3OT4A 4LXTA 4AJOA 2BEVB 1ISSA 2EARA 3VPBA 1ABEA 4LNUA 4EH1A 1OLUA 1U3TA 2GNPA 1SHKA 1EJ2A 5CM2Z 2OLKA 4HDAA 1HL7A 2FG7C 4IIFA 2ZITA 4MRRA 3T3EA 4L02A 4RJKA 1VSUA 2HPZA 2W6QA 5BVHB 3K92A 4MUGA 4DE5A 5F64A 2Q1YA 5ALPA 3T1TA 1GL3A 1R4MA 2CV0A 2QGNA 3UNXA 4DA8A 1W6RA 3PYLA 1ODSA 3HCAA 2AOUA 5EAIA 4BDTA 4I5FA 4NESA 3TTWA 1KI2A 4OHVA 4WOJA 3K1AA 1YQXA 5I3ZA 2FG6C 3IE1A 2ZIEA 4BVBA 1D8TA 4J0KA 2PH3A 5ED4A 3N2IA 4S04A 4TKZA 4CKYA 5JBNA 1BFKA 1NLZA 2DH5A 4PZAA 2OFFA 4TT8A 3KV1A 4BCDA 4C7OB 4LV6A 4EO7A 1YF3A 2NXEA 1L4UA 2ATIA 2ZZMA 3PX3A 3WB1A 1EX9A 1YNSA 1G66A 2HIAA 3F8WA 1V8DA 3GB9A 3HJHA 3K0AA 4TYMA 1KH3A 3UQZA 4E2WA 4A8JB 3M6MD 3T5MA 2JLBA 1P19A 2AQ8A 1I5RA 4B32A 1YJAA 4FT2A 4AT1A 1Y0BA 3EEYA 5A7GA 3D5TA 5JWOA 4D1YA 2QD1A 2R00A 3V4VB 3SXJA 3FAKA 4OGFA 1O5TA 1NW3A 1NVEA 3FHLA 2FPPB 1SHLA 3ZGYA 5JC8A 3O4VA 5JE8A 3P0IA 4DAEA 3ACCA 4A8JC 3BTVA 2G82A 1FMJA 3OIWA 1G20A 1RQGA 3OIYA 1N5DA 2VDLB 4X9XA 4XUCA 4PG7A 4RESA 4UTRA 4AVYA 5A5VA 4R5HA 3C24A 2BFBA 2BLLA 2DLDA 3P4YA 1BSVA 5J4YA 4Y30A 4KR7A 2GVZC 1DDIA 1PS8A 3EA4A 4EMSA 4F4FA 3RUHA 5EJ5A 2YV4A 5LIRA 3QLTA 3AC0A 4M1OA 3QKWA 1VMKA 4H7DA 3GLIA 4QJ3A 1G55A 2VPQA 1TCVA 1RE0A 4LJ8A 4E4TA 2NVBA 2P9ZA 4S24A 4CMEA 3R6LA 4I4IA 2EFEB 4U7DA 2XVMA 3RAEC 4D6PA 5CFZA 4RZ3A 1HLPA 2G63A 3X1MA 2VJLA 2AZTA 2VJYA 3MOSA 2Z8YA 4X45A 4PAOA 5MDHA 2DBVO 2Z4TA 3BTSA 4P93A 3TD9A 2PSSA 3FKJA 4KUGA 4EEZA 3AESA 3AQIA 4YRDA 3RRXA 3DDSA 1PKEA 2FPIA 4HSEA 3WBFA 2XX3A 2JEZA 4DCCA 2PD6A 3PQEA 4RK1A 3AF0A 1GGVA 1NYLA 2BHSA 3ABQB 4QUEA 4Q34A 4R8KA 1U3DA 1KY3A 4PCVA 4CM5A 2OD2A 4EGQA 3KALA 2WHPB 2YASA 1W4AA 4KUHA 2AJTA 4RHXA 3SSMA 5FOWA 4D3XA 1VB5A 3ZU6A 1K98A 4LXQA 1V1RB 4DMMA 1YJQA 1T36B 3I92A 4C4AA 1I0ZA 3RFTA 1R0XA 3BIWA 2P41A 3IR6A 3OTQA 5AW6A 4K5QA 1LX7A 5KYGA 4K9RA 4KIGA 1T9HA 2QXYA 2WMYA 1OH8A 2OO5C 2AC2A 4QRIA 3ULKA 3X1XA 5M5BA 1QYRA 3E5RA 5H3LA 4LZJA 3W1VA 4ZVTA 1F8YA 4DLNA 5TQ2B 5ANRB 5HGJA 4DQLA 3TNYA 4OLBA 2TECE 5I9TA 4R1OA 3STYA 5GVRA 1VFNA 2E49A 2P0AA 4XQ9A 1QIDA 5B3AA 4AZSA 1O97D 3HB7A 4PC6A 2JK0A 3EPPA 6REQA 2I6TA 2RG7A 3DKPA 1ZI8A 1VE6A 1R00A 2ZPTX 4XWAA 4YAWA 1DS6A 5EMLA 4AB1A 3ZJUA 1E8NA 4MO2A 3PQ4A 5HMLA 4K9MA 4Q4HB 3RT9A 4EUKA 2B4AA 4PHCA 5D51S 4V0RA 1Z28A 5H70A 2R1TB 5D86A 2QJFA 4LGMA 1NF2A 3LY8A 5H9WA 1NXXA 5EUCA 5FWNA 5H16A 5TSDA 1PLLA 4JDUA 4BO6A 1AQIA 3WNZA 4BKMA 2HHLA 3E1SA 1VLMA 4PN3A 5J2UF 3BZUA 2CLOB 1RW4A 3DL2A 4LXGA 2AMYA 1PLJA 1Y3BE 4OHUA 1MH1A 1X94A 5K3SA 5BYJA 3T1VA 2PH5A 2DJIA 4MI3A 3IVGA 2HF8A 3BSYA 4B2LA 4IOMA 1VYVA 2GOYA 2CCJA 4WW0A 4HDSB 1RR6A 3M5WA 2FHPA 2B8JA 5E3HA 3SD7A 5LCXA 3GBVA 2O6HA 3ZCTA 4RNDB 4A8TA 2AEJA 1KS2A 1ZOSA 5IUJC 2Y99A 4RHCA 3PA8A 2MIIA 1PEAA 2CXNA 4Q3NA 3HDQA 1N0VC 3HFRA 2MR5A 1VJRA 1F12A 2QM8A 4HWSA 4RWEA 1X2BA 4W8HA 5FX2A 4MWSA 2PUDA 4B3TB 2JLWA 3T5PA 1SHZA 3QP9A 2DRIA 3C3YA 2I4MA 4HQNA 1UBHS 4CFYA 1TVEA 4KBFA 1H6AA 1CIJA 1G8GA 5JXGA 2HZBA 3O2NA 3P2KA 3HY6A 4YXWA 3TECE 1J1IA 3GJ6A 1FQJA 2VNKA 5E7IA 1XCLA 2GN2A 1R16A 1LDYA 1R4MB 2Q49A 5K0BA 2V7XA 4EABA 2FZEA 3FYUC 5I45A 4JMPA 3DBHB 1QHHB 3CF6R 4GPAA 4M0DA 4U9UA 1ZN2A 4IF4A 1I2CA 1O4VA 1A04A 4C4OA 2WF6A 2YWCA 1JR6A 1Z0AA 2B6HA 4C08A 1U6KA 3TTVA 1BCRA 3VU1A 2BRUA 5BRAA 5AW1A 2I2BA 3IA2A 4ARCA 3AETA 5FBVB 2C4UA 4OHRA 3I6MA 1G5PA 4QO8A 5E6RA 1ZMBA 4B3RB 1LBIA 2PXXA 3HA3A 2R96A 2FP4B 2J41A 1ZVMA 4Q02A 4TVBA 2DHCA 3KL2A 4XW2A 3PUZA 1NJ8A 4NXNB 3PD0A 3MLEA 1WB9A 4IEFB 3EHEA 1VHQA 1UODA 5EHGA 2CBXA 2HC9A 2DQSA 3LCRA 2MSCB 3K7EA 3UFXA 4Z4IA 4K0KB 2CL7X 4O2AA 3G2HA 2FJ0A 4ZYZA 1F1JA 4JBGA 3KWLA 1BD4A 3FPHA 1T9ZA 5IW8A 1AQJA 2BFWA 1AUOA 2CL0X 1FNSA 1H94A 4D9NA 1EQ2A 3VH1A 2VDQB 4G81A 2XPCA 1TMYA 4D4JA 1SEVA 3FOFC 2IHBA 5DHFA 4QQ8A 3ZGOA 2VUHB 4IIYA 3ED1A 2PKQO 2DQZA 1ORVA 4AKEA 4Z9FA 5K03A 1QU3A 1KDTA 2L69A 2O8CB 4AMVA 3FDJA 2GPTA 4NU0A 1OGJA 3ZWPA 4MUYA 2B2XA 4BJHB 2EKDA 1GU0A 2QSZA 1ZC4A 4NJEA 1T3HA 3B7WA 1UKYA 4PE5B 1NUHA 4C6SA 2V7WA 5T3YA 4D80A 5JZVA 1SJ9A 3E5NA 1CERA 1KZ7B 3JX9A 4ZYVA 1IXKA 2DQ4A 4FCTA 5DK6A 3DH0A 3KFXA 1YE8A 4GVPA 3DQZA 4L8WB 4PRLA 4TYWA 4FC6A 4JB8A 4XWYA 1TUIA 2NXJA 5AP9A 2GZRA 1ZEMA 3CPEA 3LUGA 5CA1A 5L7TA 4QYIB 3QFFA 1E2JA 1GZ3A 4GPZA 3TWOA 3CKMA 4KYTA 3DE0X 3A1CA 3SQLA 1EUDB 5FTKA 3ILVA 2ZT8A 4JB3A 3TSAA 4AJ2A 5JNWA 4BASA 1M2EA 4TWBA 3H3FA 3IEXA 4US2R 2ZUBA 3ZPXA 5CA0F 2CVZA 2OA0A 3D5QA 5FADA 3U37A 1T0JB 4AXBA 1TJYA 1ZUWA 2QPAA 3FROA 1WVIA 4KQKA 2W9XA 3DLTA 3EG5A 3FCAA 5JJBA 1P8AA 1USUA 3KJNA 4RJJA 4JC8A 4B35A 1KDZA 3SC6A 2V1XA 1R6DA 3ZVMA 1VLVA 4KE6A 2OZVA 4BO7A 2UYCA 1HX7A 4G56A 3FF1A 1XXHE 3O1IC 1NRIA 4EY7A 3DV2A 4C7VA 2DHRA 4QDOA 1Y1RA 2FW0A 3MT0A 2Q0QA 4S3MA 2FMHA 2NU7A 3OKCA 3R3VA 4QTZA 1V2GA 2I9PA 2XITA 2Y3IA 5KU7A 1MCZA 2VDNB 1J24A 3GFPA 3WO0A 1GZ4A 4LJKA 3WP1B 2P77A 3HFGA 4QBTA 1ENOA 1LRLA 2WSSA 2WVAA 1A76A 2I7TA 4MWTA 2R6AA 4J0JA 2RBKA 4X94A 2GNOA 4HQFA 721PA 1FJXA 1UPFA 2PS3A 1AUXA 1Q0LA 1UJ4A 4CM4B 1GDDA 1OAAA 1JH8A 2HX1A 3RTCA 3UENA 3ZNOA 3GT0A 1OSNA 3OX2A 4YCNA 4O4JA 1RKXA 8MHTA 1UM9B 3AM5A 4EW6A 4IBOA 4BNKA 1FNDA 4CTKA 1J7JA 8ADHA 3BDAA 4BO1A 1EH5A 3HEAA 4HQ0A 2TSYB 4RK7A 4R16A 1WOYA 2EFDB 1YQDA 2X2EA 4QODA 5LP6B 5CT6A 5FWYA 1E0DA 3NJ4A 2C03A 4IIJB 4BNDB 2ENUA 3NHJA 4E12A 2O6LA 1B73A 3FMFA 4U7HA 3BERA 4XDHA 4DRZA 4PYOA 2NXNA 1O8CA 3UN1A 3KQYA 3SZMA 2X6QA 1E1LA 3WA7A 1LBTA 3CEJA 4A8HA 1CD5A 1C8LA 2A58A 4DIEA 2IYSA 5B1DA 2G76A 2QMYA 2WA1A 3HACA 3V2HA 3JAKB 2XE4A 1UQRA 1N7JA 3GF4A 3UOAB 4OMFG 3DPIA 2I6GA 3TRJA 4CF6A 1RYEA 2ZAOA 3QE0A 4F4JA 2CL6X 3F3SA 4K9QA 4YJGB 3SHOA 1F6BA 5SZKB 1RWVA 4JCCA 4OA5A 1PUJA 3O94A 4JBIA 2VIIA 2BP7A 4OL9A 1CEYA 5TLSA 2VP2A 2YZNA 2IYUA 3EDMA 4S2EA 3WB2A 3ECAA 1K7CA 3PHLA 1Z4PX 2HF2A 4GMFA 3RS4A 4NKRA 5IT4A 3U3JA 3PHIA 2L0XA 4A6XA 1F7UA 1T5LA 2P5SA 3X1KA 2AVDA 1GU1A 1LNZA 2B1IA 1A4UA 2DECA 3FIJA 3LDAA 3OOWA 5EHNA 3SOPA 1DAOA 3WGGA 2Q07A 2I4IA 5CXQA 1R5JA 4LHZA 4O4IB 2GTIA 2EIHA 3SEZA 4JXZA 2GKGA 4O6VA 3CC8A 4OM7A 3L41A 2B4TO 2WJ4A 5KOJA 3DM5A 3DOHA 4XZ3A 3N7UA 3VC3A 4LF9B 3KHSA 4CL8A 5SY4A 4C0KA 2EVWX 3H8VA 2CVOA 2E82A 2FW6A 4KC0A 4PBRA 1KBQA 4HTFA 5T3UA 3WG9A 4IDBA 1K2WA 4CHTA 1V2HE 2HYDA 4PSKA 1R9MA 3BMQA 4NFYA 4Q1DA 4XAQA 4WK6A 3QUBA 3NDJA 4M8LA 3TOCA 3BOSA 4C0JA 3H83A 3GNLA 5A2GA 3NOXA 1PR3A 1VCNA 2X19A 2Q6TA 1GNRA 1N0HA 2WE7A 1F8FA 3M2PA 2QL5A 3AJDA 3EXHA 3M5CA 4IJWA 2Z2ZA 1U5BB 1PWEA 1N34B 1YGPA 4IJUA 2J87A 1UC8A 4UTVA 3SXUA 1SUIA 1DNPA 3IODA 2EZTA 2ZRQA 3PWSA 1P1HA 1RKQA 3VX3A 4AKIA 3RYCB 3QTBA 4JJKA 4L0QA 2BD0A 1UKZA 2H1FA 3OIFA 5EPUA 4CIVA 2B2NA 2JGFA 5ILOA 1HNXB 1DXYA 1J39A 4L0CA 4L85A 3AKYA 3PFCA 1H1TA 1K0FA 3M4NA 3FBTA 4WFQA 5H83A 3BHIA 3HRHA 4DYVA 5FLXA 3OEWA 4NDAA 1PI3A 3JQGA 4ZHSA 3PFBA 1M1UA 3GRFA 2Q99A 3N2NA 1OGYA 2C83A 1FS4A 5D2CA 3ZK9A 4EG8A 4B46A 2E7ZA 2IPAB 2Y0CA 1TUEA 5FI1B 1A1VA 4GSLA 5I7VA 1JQ5A 4GXNA 4CQMD 6YASA 3W8NA 3LUAA 1UJ6A 2OILA 3DJFA 3BD9A 2I99A 3Q1KA 3K1JA 2VOEA 3O75A 1GQOA 3HLTA 3GJXC 1LRKA 1VSQA 3KBOA 2GFHA 2VZEA 3O9MA 3B38A 1TADA 2C92A 4JYPA 4PZUA 4X6XA 3QA9A 4TUYA 5B2EA 4O0LA 1U3VA 2J31A 5G4LA 4YDSA 3I28A 3ZQJA 2PUEA 4BRUA 1N33B 4BQIA 1JA9A 2CJWA 3KYCB 4TLAA 1SBZA 1RT9A 3GP5A 2FFBA 3OM0A 4RMIA 4AKSA 4TVSA 5JQGA 3KKZA 3OHSX 3QVVA 4XIJA 1P7PA 5KWEA 1TOAA 2ZZKA 3FZGA 1Z2DA 3HU2A 4FWBA 4RPJA 1ZM7A 3ME5A 1E63A 2X4GA 3HKDB 4MVJP 2PR2A 2OP1A 3PGA1 5LBIA 5KEIA 4LYFA 1VL8A 2IHZA 2LIPA 2PLWA 2BMEA 2YIDA 4YCSA 8GPBA 4H0FA 5E4JA 1LBSA 1F20A 1JWBB 2YJ4A 2QVZX 4MMZB 3ITNA 4MW6A 1IHXA 1P5HA 2WF8A 3EXEB 1IRIA 2ZYRA 3N6VA 4UJ5A 5E2IA 1GTRA 4LF4B 1Z0KA 5DI3A 4DLKA 4IRMA 3OAAA 4I55B 2XUIA 1U1DA 1JAXA 2NM0A 4IZIA 1KEZA 3LRXA 3MLBA 5EE1A 2GN6A 2DQKA 1WMSA 1B0ZA 1M73E 4RK5A 4PGHA 1N4AA 3VGPA 4QNNA 3G1TA 4MV0A 1NP3A 1YRYE 3CCBA 3EOBI 4GAEA 3WZMA 5I7OA 2C9ZA 2NQ2C 3BVPA 4XQGA 5CVVA 2CNOA 3CGGA 3WK5A 4OY3A 4FONA 1WHSA 3VDXA 1J2TA 5C51B 1S3GA 1SY7A 3VNSA 3HVHA 3W05A 2IXEA 4DRXB 4JJAA 4YRTA 3AQ4A 1ZRHA 4JI7B 2GZAA 2JJ1A 3RV3A 4CCWA 1P60A 3IAS1 2BEUA 4YREA 1LGYA 4D4LA 2A7QA 3BGSA 3LYLA 5AMXA 2PT5A 2H9AA 4GM4A 2R62A 1ZD5A 4HLCA 2VBGA 4KYIB 5DCYA 4PG8A 5LP6A 1UP7A 1UBGA 1UR5A 5AQ1A 1FRVA 3G2IA 3PWTA 1JDBB 2EZUA 2QAIA 1Q6ZA 4G5OA 4KCGA 3ZU3A 2ENWA 1L4HA 1YONA 3KIPA 1CRPA 1R0ZA 3KOMA 3WB9A 2H18A 2XMGA 2H4FA 2VTBB 4YQZA 1JAHA 2X8LA 5K8JB 2CUTA 1UBLS 1JPUA 1XEWX 2X8AA 1YB4A 1VRCA 4HSGA 4L9SA 4BVGA 3OZFA 1LI7A 3RWOA 5K0SA 1RJWA 1JEOA 2H17A 1ZWLA 2P9BA 1ZGBA 3K1YA 1RFLA 1N6OA 3ZDFA 1SUCA 3CF4G 4X6LA 3AI7A 3EVCA 4E30A 4XQEA 1NYTA 3PR1A 4ZMSA 3GQVA 5A4DA 2B5OA 1GLNA 3Q5DA 5CVUA 1X7ZB 4CMEC 4CJXA 5CITA 7MHTA 5AVTA 3ZCRA 1OTYA 3R3YA 1N3BA 2BJWA 2DPXA 1C4OA 4JL6A 1EB8A 2AN5A 4MKHA 4QDZA 1DKOA 3WLNA 2HYIC 2ACWA 3WJ7A 1K0UA 3QSYA 2QP4A 1KWGA 1AIPA 2FEMA 4RY9A 1DPGA 2F3UA 1SB9A 3TRFA 3ZHTA 5DGXA 4QRDA 4YS6A 5TEVA 4Q03A 2R97A 5GINE 4KAJA 5JU6A 3NRCA 2YVLA 5CEJA 3FN4A 4Q1AA 2I4RA 3A70A 4CMAA 4U5QA 2A0WA 2HCJB 2WHRA 4O4LA 1M5RA 3L0ZA 4WLEA 1WDMA 2N0SA 3LLSA 3S2SA 3SCZA 3FKSA 1J8DA 3DKKA 3PLRA 4RSGA 2BC9A 4ML3A 4A6DA 4E7OA 3LPDA 1QX3A 1EVYA 1ZXXA 2EQBA 3PNPA 1PJAA 3BMCB 4R1LA 5ICSA 4ZA2A 4GKKB 1T8RA 1RHKA 3G0BA 3UWMA 3ZDRA 3QQ5A 4DDUA 3U7HB 3JZFA 4FEAA 1KMHB 1EBUA 1TLLA 3OOHA 4ON9A 4GRDA 1RM5A 3GY0A 4MV6A 3TW6A 4UMVA 4UASA 4CYMA 3IAEA 4ENTA 5EMHA 1DQYA 4AWAA 3EN0A 1VECA 2VC2B 3O38A 1X1RA 2INGX 4ZQGA 2ONYA 5C37A 3UF0A 4LHXA 3WDMA 2FU5C 4HNAB 4MDHA 1CX9B 1H3FA 2P4HX 3FWZA 3LY5A 4RFSB 1T8YA 1ZGZA 1EK6A 2Y76A 3NHUA 3G9XA 2FZWA 3QPUA 3K09A 4MINA 2WTMA 2QW0X 2WYWA 3FBGA 3FRHA 4I3FA 4XD2A 2Y93A 3MRXA 4ATNA 4XTCS 4NH0A 1CJKC 2PWPA 1KI6B 2PWZA 4KFSA 4O3FA 4P32A 5IJAA 2OYCA 1GRNA 2BMFA 4TMZA 1W4BA 3KJEA 5DRYA 5AUPB 1SKYB 1SZJG 1UBEA 4NULA 1C7JA 1JLKA 3FPSA 2VT6A 4GICA 4P36A 1O95A 4Q4AB 1K8QA 3DUWA 4WWHA 1R0SA 1DKQA 1I30A 5AM2A 3WMRA 3BUSA 4EG6A 3IEKA 5EL0A 3R77A 4P38A 3PRYA 2XTJA 1XTSA 2J0EA 3T5GA 2CJFA 1TMOA 1WS6A 2OMKA 3EODA 3C0KA 1TK2A 4GBJA 2IPOA 1ZOIA 2ONJA 2PEYA 4V1CA 3LHKA 3HYCA 4URFA 2FNAA 4X95A 3DKIA 2WQ6A 1MX1A 2C5EA 5A4JA 3AR7A 3GCXA 3U4DA 1KSFX 4IV8A 3H1PA 4L5CA 4RFLA 1TVMA 1WXDA 4QOGA 1KGSA 4MKXA 1XNJA 1CDEA 4DC1A 3KD3A 2GWRA 3VVLA 2WKRA 3DOJA 4TMFA 2EDCA 3NWEA 2NMVA 1BG6A 5KOHA 2GF0A 2FW1A 3GDHA 3L6EA 3PNLA 2BT4A 4QYSA 3W4JA 2C2OA 4OO3A 3L1JA 4KVFA 4M87A 4MICA 1XZDA 1JEQA 2WT4A 5A6SB 1T6ZA 1WHSB 4OQPA 4F1KA 3EXHC 4HAUA 2EWMA 3E6AA 2LPMA 3ESDA 3B51X 4C4RA 3BMXA 1YKFA 3CRQA 4HEA1 4FVTA 1TYBE 1LKZA 1DRUA 3KZNA 5EE3A 3G9UA 3JAKA 2ZUUA 1UEJA 3AONB 2R11A 1COWA 3A4VA 1SVWA 4PINA 5J59A 3IR7A 2XA2A 4LXUA 3P9RA 1E0JA 5EYPA 1A4IA 4DLUA 4EPXA 1L5ZA 4TT3A 3D6FA 5AKIA 1T1JA 5H1YA 5J9FA 5K2MA 1X1SA 5DEOA 4CODB 2PNJA 1KYVA 3KXIA 3R0XA 4GLFA 4M0PA 4BNXA 3B1YA 5HF8A 5KSPA 1WY5A 2PQ6A 5IFKA 1XLVA 3HCBA 1NQXA 1YL6A 1QC5B 3UKOA 4ESOA 2NP6A 3FXAA 1CJMA 3Q8XB 5IM4F 1DKLA 5I7EA 2IYVA 5IDVA 1CLEA 3I9MA 4H3KB 3SBOA 3QU4A 2QVCA 2VXOA 4D43A 1TEHA 3LX5A 3IO5A 4QUDA 2AEFA 4AZ3A 4MULA 1B8PA 4D8UA 4HMQA 3H1EA 2Z4RA 2Q8QA 1S3FA 1JU3A 4JI3B 2XNJA 4AJEA 3B9RA 3CH6A 3UWSA 1RRVA 1RADA 3Q87B 1V8ZA 4N0DA 1MB3A 2XMRA 3BRWD 3GJ3A 4PONA 1T9CA 3WYCA 2QS9A 4AYWA 1C30A 1ST2A 3HKCB 2HHAA 3OHMA 3TSYA 2IDJA 2W93A 1TEZA 1CEXA 1UINA 2O3UA 1N9GA 3BE6A 4NU6A 3UJAA 3ZGXA 3GUCA 1D6JA 1SH7A 2MINB 4XOIA 5IDXA 2J9FB 3WWCA 1OJLA 1VA4A 4BFZA 3R3HA 3PEYA 3VSBA 1QHXA 3ZIDA 1X80A 3CLTD 3DDZX 3DLCA 1KETA 1HRKA 1TEVA 1E3LA 1KZ1A 4IFBA 5DM60 4CCYB 4KIJA 3KK0A 1P73A 1WKVA 2RI0A 2PUWA 1QOZA 2ZBVA 3AIKA 3JASB 4HG2A 3HZRA 3BWMA 3OEHD 4YAUA 4PG5A 1SO8A 4Y0AA 5FFNA 1G8AA 1Q1BA 2JJ2D 3VOAA 3PUYA 3DMYA 4K46A 3VJLA 4FEYA 4QE3A 3OOEA 1RXCA 1Y8RB 1MOPA 5DGHA 4CQMA 1H4QA 4CM1A 3CKKA 3VOBA 3ZHOA 3L0YA 3VO1A 3UA3A 3FPJA 4KYUA 1P9WA 1IFXA 1UADA 2F00A 2D3TA 1NE7A 2VQ3A 2UZ3A 2RBGA 1JI0A 1WE2A 2F2TA 3LUDA 5LBUA 2YS6A 4U0JA 1W76A 3GD7A 1MC8A 2QRGA 1I94B 1YBMA 2FEAA 2FI1A 1DAFA 1NW6A 1Q3TA 2F48A 1RJDA 1UT8A 3DEJA 3I53A 1L7OA 3F6PA 5CDUA 3TG2A 1UPBA 5BXQC 3AESB 1OTXA 3MVEA 3D7NA 3SQXA 1UT5A 4LQDA 1YI1A 2NG1A 3PIDA 4LJLA 3TQFA 4WV3A 3EEOA 3QEKA 4BVHA 5EQDA 1ZNZA 4UUOA 3L2OB 3VVCA 4IXTA 4D97A 1SHUX 2Q45A 1N8KA 3IC5A 1WMDA 5CGZA 4B47A 4U39A 3GLTA 4PZLA 3CWQA 4PAMA 1PQYA 3ZVNA 3U16A 1L4NA 2JI9A 5JHHB 2WJHA 4MV8A 3MFQA 1WMAA 3TB4A 1AO0A 3O8LA 4HQKA 2CDBA 2CXPA 4JVLA 3UMVA 4MV9A 2D00A 2HWWA 3EIUA 5EIBC 5SICE 4JFAA 1YZGA 4RJLA 1RQRA 2ZT7A 5CA0A 3HI6A 4JKOA 4Y98A 1XZLA 1LVUA 2V5AA 3HNRA 1JMKC 2AG8A 2NUTA 4G0QA 3S5JA 4CL0A 4Z1OA 3KEGA 1DIAA 4LGCA 3UFBA 5K0ZA 2ZIXB 1EFHA 2O2JA 4KX5A 4I9UA 3OFNA 4PZEA 1PEYA 4LXXA 4PTYA 2QTMA 3AHIA 1FL9A 3X44A 1URPA 3PQ7A 5GONB 3EZLA 1CZUA 4GG1A 1PT8A 3L4JA 3EF3A 3HHPA 4LGVA 4QGAA 3WMFA 4U2KA 1I7PA 3C87A 4WD3A 5ALLA 3L0OA 3LNCA 4EGFA 4YRAA 3R3ZA 4YRBA 2RKWA 3F6CA 4L5BA 5HJ5A 2WAYA 3QGMA 4B3IA 2IOFK 2G9VA 3HL4A 2W4QA 3HXLA 4BB5A 3GFOA 1ULUA 5AKJA 4KO4S 5IF3A 3I58A 3T7RA 1Y5RA 4WHMA 4ZGWA 1T2EA 1ZM4A 4RA6B 1SCNE 4FS3A 2IH4A 4Q9JA 1XLTA 2QM3A 3TCKA 2I3BA 2VJBA 2UVPA 3NFYA 4UHEA 5EIAA 4TMVA 2V7GA 1T1SA 1L6RA 3MA0A 1S2DA 1KEUA 2ERXA 2X0JA 4BMVA 3NATA 2GGSA 3COJA 1D3AA 3M4YA 2PWBA 4AZTA 4WBNB 1O4WA 3DVQX 3QVSA 1SZCA 4S1VA 6Q21A 4FTWA 1NVUQ 3LKBA 3O8QA 3QWBA 3EGOA 5CNJA 3AF6A 5B4TA 2QQEA 5K45A 1JG6A 1Z07A 4X90A 1XZHA 1JYEA 2ONCA 2NU8B 4JLMA 1KI7A 1E3DA 3VJRA 2H2AA 1AF7A 3NGXA 4NICA 4AI6A 3DFMA 3NHZA 5F23A 2WNHA 3ZDDA 1T4GA 4H1VA 4KQJA 1VLZA 1H23A 1M2NA 1WXIA 4MYCA 4Q4HA 1GRQA 4EL5A 5HQ3B 1JKMA 3K15A 1GG2A 1NOKA 4D4MA 4GL4A 1T9GS 1TZCA 4ZMBA 2DFTA 5TXGA 5I9MA 4YRZA 4OBBA 4Q7EA 1U0HC 4NU5A 3CX3A 4JI0B 4AJNA 1Z7WA 3BBPA 2H4YA 3KO8A 1NDHA 3LGAA 1ADGA 1EVEA 4OG2A 4WGGA 4RKRA 5JS7A 3RVNA 2QMHA 3Q9UA 2OP0A 4WCDA 4Q7QA 3W0LB 2QTBA 2ZRMA 3AV0B 1DUSA 3O31A 2CJYA 2YXEA 4CIBA 3KU1A 2ZSBA 4D26A 3VDMA 3UUEA 2ABWA 3VVBA 2C5HA 3PF8A 2I2WA 4IXMA 4IX9A 4RNCA 4RCZA 4IGAA 5FBRB 4QGFA 2HGSA 1QWOA 1MB4A 4IEIA 5CFMA 4QYMA 3G0GA 1U2QA 1KTVA 2KW5A 1EINA 3DZJA 4OXQA 3UMMA 1EU1A 3QXJA 5K6AA 3CEMA 4UM9B 5BW8A 1KYXA 1W1UA 2Z5VA 4GOND 4M9ZA 1R4ZA 4QATA 3WDSA 2TMYA 4Q5IA 4OJMX 5AW5A 1Z37A 1M2OB 5JD3A 5EWJA 2IF0A 4X66B 3EIQA 1N9GB 1O03A 1YBFA 2FKAA 5F1PA 2AN9A 4XQCA 3THRA 3ICWA 4N40A 5CDYA 4DEVA 3OP4A 1AMOA 2C82A 2C2KA 3GUZA 4FKMA 4BB6A 3P27A 3UBMA 1XUOA 4NF2A 5GGYA 4ZYLA 2W6OA 5REQA 3FFTA 4X3PA 3QXGA 2ZULA 1PWHA 3LFTA 4FD2A 4QQKA 3UK7A 5IHPA 3CO5A 3SE0A 2XNKA 2J5XA 1MV8A 3ANSA 4NLLA 1YK0A 4Q12A 3U4MA 2DLCX 9MHTA 5IZCC 1PCXA 2EBHX 1ISMA 1ND5A 5IPFA 3D2CA 2UXCB 3R0JA 1GP2A 3JQRA 3H9GA 4BB9A 5GTDA 1KRXA 2BM8A 4DM7A 1SCDA 3TSZA 3BCRA 5J2UA 1F0KA 3WKBA 2BMJA 4QPDA 1VLQA 3FMVA 2J9GA 3RT7A 2JW5A 3CSSA 4CPDA 3LRTA 3BH0A 4G85A 4KAXA 3K6SB 2HNAA 1F3OA 4KLCA 3C4QA 2ALJA 4BX8A 4PGGA 4EJSB 2L82A 2GS9A 1WOMA 2E18A 2I6UA 5A9SB 2AW5A 4JYCA 2WF7A 1T35A 1SC6A 4XM1A 2XYGA 2QE6A 4MQFB 4PQYA 5E6UB 2F3QA 3RV4A 1Z4MA 2FV8A 4I9FA 1QHGA 4FHCA 3NT5A 5I7WA 1DEXA 1P7WA 2AG1A 4G9EA 2QR5A 3TK1A 4NAUA 1JG2A 2YJ6A 4ILEA 3RG2A 5LMNB 1YR7A 1ZM9A 2MMCA 2QU7A 3PK0A 3CINA 4M3NA 4WA8A 5DV9A 3IH5A 4JQZA 3Q7PA 5DFAA 3RH0A 2GRAA 5HX7A 3IKVA 2YMQA 1TJNA 1RPNA 3EUAA 3N28A 2EQAA 2OCDA 2QSYA 1S2NA 3E9EA 3S6JA 3DQQA 5KVSA 2FYTA 1E1CA 1AUPA 1P2GA 2C2GA 3N2EA 3FSGA 3MJVA 4L7VA 4NDNE 5L3SB 5L51A 1DAEA 3T7KA 3HR8A 1PGOA 1OIXA 5LA6F 4M7OA 4IDQA 4LJ6A 5D3MB 1C9KA 3G9TA 1OZHA 5DLYA 3KYBA 3L84A 3IESA 2IZ6A 5ER6A 5ULLA 3RARA 5TQ0A 2VTBA 1THGA 4DLPA 1UOPA 1K75A 2Q4RA 2ZWIA 4H60A 4TL8A 3OZCA 2ZI3A 4AKHA 1RXWA 3FVQA 4ZO4A 5C5DA 1DAGA 1KEKA 4L51A 1T1EA 1NX6A 3K0CC 1JEQB 4DOMA 2IYOA 4JELA 1XPOA 3F5DA 4RD6A 1EBFA 2OLEA 1GPMA 3F2IA 3O74A 5AKHA 5HCIA 3VR3D 5K7SA 2G70A 2AE1A 1NPTO 1UF9A 4LMRA 4JLOA 4LMAA 2XWBF 2ZTMA 3DHWC 3IGFA 3R4CA 1PSWA 3RR2A 2X9LA 4CV0A 2NZ8A 4HNSA 4G37A 4PGAA 4DYHA 5CK4A 1L5HB 1E92A 3AW9A 4CV2A 4DSNA 3IAM6 4S1NA 2FPPA 1DLJA 2FQYA 2AYXA 2M1ZA 1JQJC 5AH0A 1L8AA 4X7BA 3PNKA 3RKRA 4C9BA 2C61A 3DLHA 2OK8A 4L22A 2QMUA 1ADJA 3GT3A 4UNIA 4JLBA 1OX6A 3VR5D 2O07A 1ADBA 2O23A 3K32A 3CG4A 1B2RA 2B4QA 13PKA 1TIKA 2I33A 2RHOA 3PL1A 5EXXA 4ZI7B 1QRSA 4KRFA 2GD6A 2WWHA 1ZUIA 2DCUA 2WJJA 3VU0A 2C2WA 4HVTA 1JNXX 3SYTA 3K6JA 1T6YA 1Y3AA 2X7XA 4Q18A 1OWPA 1QE5A 2WE8A 1GKIA 1E1QA 1KJQA 1KOLA 2CGEA 2PFKA 2IU3A 3R9IA 1YRWA 3JRNA 1F2DA 1AQYA 3NRJA 3QTTA 2QRPA 1HLDA 1GPJA 1R0YA 4LTMA 2PJUA 5FO1A 4M49A 4YUVA 1M5UA 3N3AC 1UP4A 1KQOA 3RDPA 3VU9B 1SXHA 3OCVA 1QIIA 3UH1A 4RELA 1T5OA 2ECOA 5DYNA 1I2MA 4YT4A 1ZISA 3RYFA 2I7XA 4YAKA 3KSBC 1LFAA 3TIGA 2CSXA 3RODA 1QYVA 2E37A 3RGWS 1EQAA 1JFRA 2IZ1A 3GNTA 4HEHA 4LDQA 1RYBA 3THSA 3F4BA 1OILA 1T34A 4RVSA 5GIOE 1ZOPA 5FD8A 1O9HA 1OLXB 5HHTA 2SKEA 3N1UA 2E0IA 1WY7A 1LPSA 2IYPA 1KI3A 3AEUB 2HLHA 4JU8A 4WCVA 3B1FA 5BQXA 4OX9Y 2QL9A 3DLBA 3C4JA 3EOAI 4HL6A 4BNMA 3OICA 3JQQA 1L1RA 1QNLA 1QAOA 2GZDA 4OUKX 4ZVKA 5CLHA 1H93A 3NWPA 3W8FA 2FPKA 3UV3A 3WGJA 4DDKA 1IOVA 4R3NA 4RDCA 1K5HA 4RVFA 4YPOA 4MVCA 1D5CA 2OV4A 1D0SA 3B48A 1SBYA 3JQCA 1CEQA 2REBA 4K8RB 1MTOA 2W71A 4PBTA 4TXHA 2G9NA 1H05A 4I3GA 3T3PB 4U8GA 4EJSC 1OC2A 1Q0TA 4KDRA 1W9HA 2C95A 4K6GA 1BC5A 2OK7A 4BNZA 4PC1A 2BUCA 3FPLA 1NUUA 3OE1A 4R2XA 4R0NA 2DFNA 3BHJA 2X14A 3ZTWA 5HDBB 1KQGA 1CCWA 1KEEA 4X93A 2Z1MA 3I04A 4KMOA 5G02A 1RBMA 1VP3A 4FOSA 1QIMA 4KFTA 4MTCA 1U2TA 3KZOA 4PIVA 2Z6UA 1TT5A 5EP3A 4F4DA 1WQ4A 4L0DA 4YDHB 4RORA 2VP5A 3NQ41 5C32A 4M1KA 4CN9A 1CP2A 3SLKA 1H9CA 1WSDA 3KB8A 3WB0A 4P31A 3ADCA 4KUEA 3DOFA 2ID4A 5HFAA 4HWPA 4RVOA 2PUHA 2QTWB 3L3BA 5K99A 3UG6A 2HMWA 3FW1A 5FUXA 2WUWE 4R69A 1VGRA 5IC4A 1X70A 2YTZA 1C1DA 3ZDZB 1JVSA 3FZNA 1V8BA 4MARA 1BQ4A 1GADO 1ISHA 1OJ7A 2ZJOA 4R84A 1P75A 2W8ZA 3LW8A 1LFDB 1RFGE 4TSKA 4EEXA 1UBMS 5FP0A 4F3NA 1EFDN 2E3JA 1IQUA 1JQEA 2QVXX 2JLQA 1K4YA 3HDYA 3GPCA 1T8WA 4K1XA 1II9A 2BEWA 4JVSB 4HXYA 2J0UA 2I55A 5IAKA 5AW3A 3IV7A 4QUHA 1IWPB 3ECSA 4MUHA 2XB8A 2PUBA 2DC1A 1DDGA 4GE3A 4YQFA 3COVA 2FSHA 1WTCA 1WXEA 4JT9A 3W79A 3HXQA 1MW8X 2WYUA 3VV3A 1E62A 1RLIA 4DNQA 2BFFA 2FSFA 1Z17A 3DTTA 4P4SA 5AW9A 3P8ZA 1NZJA 2Y1DA 2NVUB 1QONA 1ZD2P 3SVZA 4NAHA 4C29A 2PKQP 4G26A 3DR5A 2ZYVX 4UKDA 2A5YB 3TLAA 3O8CA 1D0VA 1K6XA 1ZBDA 1I32A 2O8VA 3I2IA 3WIVA 1O5OA 3PEFA 4DT1A 5B4UA 5JDIA 1HK7A 1B15A 4DUYB 1N0UA 4BFYA 2H16A 3EF0A 5LLSA 4HFMA 4NCBA 3RS0A 4DHEA 2ETVA 2XOKD 1DAKA 1Q20A 4MI6A 1QRDA 3IOYA 1E7SA 2J9RA 4HDCA 4HWTA 5TB5A 5TJHA 1WZUA 3DE4X 3GWGA 2V0CA 2N46A 3Q85A 3LS2A 4ZEWA 4AIIA 1WHTA 1QVRA 3HUEA 4LRSB 1ONNA 3PQFA 4YFVA 1NVXQ 2Z8ZA 4QL3A 2HSJA 3LYUA 4H0CA 3KJGA 2BGNA 4R8RA 4GWLA 4XFDA 3E22B 5FUBA 2GYWA 2IYEA 2ZE8A 3H6KA 3OJFA 5C31A 1SKYE 1FQOA 1KYTA 2YOFA 3WLIA 2IIQA 3LVRE 2FEPA 5JADA 5LQJA 2I5PO 2ODBA 3E35A 3A6LA 1LF5A 4NYJQ 5LJIA 3HWWA 4HX5A 4BQFA 1D4AA 4UOQA 1JDVA 3RYIA 1JEEA 5HIAA 3PC4A 1DZ3A 1IHOA 2RHLA 2YUIA 1EFRA 1W0CA 2VRWA 4DVJA 2AR7A 5JS8A 1SPXA 3FF4A 1BYIA 2GAAA 4OLAA 5A5FA 4L78A 2YWDA 2FJPA 1D2MA 3RO7A 3V7YA 3V9PA 3VAYA 4F3CA 3NXKA 4BE4A 4NBRA 1AS0A 4K9OA 1M2WA 1ISGA 4DY6A 4Q9DA 2NQ8A 4YQYA 4IDFA 4DBLC 3U56A 2C00A 3T9EA 3D8TA 4NCJA 3LSTA 5D00A 2Q7XA 5LQUA 1YVDA 5AT1A 3GJZA 1P1BA 1V16A 3HBAA 4UBIA 4EQZA 1Y8ZA 1DBSA 4MW9A 3T0IA 3L6RA 4X54A 5EZQA 4AK9A 3FNQA 3WTCA 1JKFA 3L1HA 4WBSA 3OQBA 4G3XA 5DTJA 5D5PA 1JQDA 2IIBA 3QK7A 3W77A 4GVXA 4ZEVA 5CA1B 5JRJA 1SOWA 3QU5A 1WHTB 4LTNA 4DMUB 1HRDA 1MC5A 1W6UA 4Y0NA 2O8FA 1BRMA 4RXTA 3TXXA 3QLJA 4HXGA 2D8AA 4JOCA 1JIQA 4EYEA 2WDPA 2A67A 2H63A 3SHTA 3QLUC 5LNK6 3IKTA 3RYCA 3AZPA 2HADA 5FT9A 4RK0A 3HCFA 4I5DA 1S8FA 3HLKA 2F3RA 3U7JA 1J6UA 1W85B 3MRTA 4B5KA 1E6UA 1HDIA 3VYUB 1C2TA 1E1YA 2J3HA 1L5YA 4AD8A 2OZLB 1U5CA 4ZEMA 2GYVA 4A6PA 3MERA 1EM8A 1R50A 3LBYA 1TKCA 1PR5A 2COKA 1AKEA 1Q14A 2P62A 3W2EA 1VMEA 4Y9UA 1X8JA 1IWOA 1UM8A 2CDNA 2XDAA 4OBXA 2FUKA 4NHOA 3SJ7A 3W3AA 1O57A 1KFJB 2NN3C 3TLGB 3PI7A 1XLUA 1AKRA 1Q0RA 2WJ3A 3LIIA 4LE1A 3HEMA 4BQRA 3AF2A 5JZMA 2XYHA 1XA4A 1LI5A 5TQ0B 1DTWB 1C7QA 1OLOA 3E7FA 1ISJA 1OXKB 4QEKA 4R05A 3OLWA 3T8YA 1R6BX 5JT1A 1KRWA 3FHOA 1DZIA 3CVWA 1VCHA 4CEHB 3S8YA 2JI7A 1V8FA 3QELA 2AMLA 1NZDA 3G8YA 4E4RA 4JH0A 1SUAA 1L1EA 3BXFA 4PX5A 4BFUA 5A5DA 5FWXB 3WGIA 2ODEA 3V46A 1JHZA 3HWX1 3VYTB 4BV3A 5ADUS 4IJQA 3TSCA 2FZLA 4HLUA 4LFCB 1R8XA 5BR1A 3MILA 2Q3JA 5FDFA 3RB8A 5LIPA 3U60B 1PEKE 1VE5A 2JGDA 4PNPA 1GQFA 3GEIA 1DHRA 4KI7A 4O02B 5LZ8A 3QEBZ 1DQRA 1ECGA 4FFVA 3P9IA 2QZZA 1SPBS 3FCEA 4DADA 1KEWA 3TNJA 4IVQA 2R44A 2D7JA 5KJ6A 1HA3A 4QWWA 3CTMA 4FFMA 1MP0A 3BE4A 4Q7LA 3AM4A 3AY0A 1K5DA 4G8CA 1KF0A 2KMLA 3TOSA 4ITUA 4DG8A 4N9WA 4N12A 1CR6A 1J5EB 2P40A 3RNLA 1KO5A 5FUVA 4EPVA 1P2VA 1QVZA 3ANTA 1LTQA 2FB9A 3TL6A 3ZVKA 3FH0A 5DO9A 3U13A 2CV2A 1M6EX 2EKPA 3HSYA 4ALJA 3QOFA 2WWTA 3UAOA 5DLEA 2PUAA 2CFRA 3E0QA 5AKKA 3QBTA 4IVPA 1XZQA 2GAJA 1BEZA 1YDMA 2C2BA 3N2LA 4M37A 4C21A 1XHEA 1YCGA 1Z5GA 1QH1A 1RIFA 4NOJA 1OHHA 4DJJA 1O94C 5B1SA 3R5KA 2EZ9A 1YOVA 1N2CA 3GLSA 4QUAA 5DWVA 3KQVA 5F4ZA 5FIUA 4EX6A 3FWKA 4OK3A 4IKPA 4YCJA 3ELYA 3BJIC 3T4EA 2WA2A 1ARZA 3H2JA 1EXNA 1ZDMA 1HURA 3O91A 1XTTA 4TKMA 4GF5A 4XX0A 1YQ9A 5JAZA 5C7YA 2ZE5A 3V7UA 2ZIGA 2XR1A 3P2EA 5DIZA 4XIGS 1C9DB 2ZR9A 1N92A 4HWRA 4ZCTA 3SJUA 4AF8A 5IT9A 1S5PA 1K4KA 1MOZA 3TX6A 3UXMA 4C78A 2FFQA 1ZI9A 2ISSD 2Q41A 3NEJA 4ZOLA 5E9AA 3W3ZB 5JFGA 4DCMA 1T13A 3AVXA 1LUAA 2JIRA 4NP6A 2PGJA 3C85A 1BMFA 2ZW9A 1MTZA 5CHYA 3VZDA 1DIRA 1JFFB 1R27A 1NFFA 1W30A 2NU9A 3CLSD 3DWGA 4KLZA 4Q3CA 3ROKA 3Q40A 4FQ8A 3LPNA 4BX2A 4F8YA 4OI0A 3VU9A 4FI3F 2ZR7A 1VBKA 2A6PA 2CMFA 1BXRA 3BYZA 3L82B 2EAUA 2G07A 2QLLA 1W88B 3WMGA 4MV4A 3I6YA 2UYQA 5H0IA 3KKOA 1W73A 4MS3A 3TDNA 4E1AA 1YSCA 5G0SA 2JFPA 1JE1A 1WP4A 2RHRA 1EE2A 5DSZA 2IS2A 3PHHA 1HG1A 3OU7A 1QGUA 2P65A 3WLFA 4Z8XA 3SYRA 2GO7A 4JLJA 1A82A 2NT3A 3R3JA 4N03A 3TLJA 4F6RB 1QBGA 3JQEA 5KJ1A 1XTRA 2BCGY 1IMOA 5BN4A 4B3FX 1ECJA 2HDWA 4OHYA 4GP9A 5LYJF 1DRWA 3DSRA 1RYNA 3UOGA 1X7DA 1O87A 1LW6E 3QF4A 1JU4A 3G2JA 5JG7A 1X8LA 5JH7A 5MGNA 3EHDA 2DHQA 1CJTC 1SRRA 1T29A 1EJ6A 2VAPA 4I6GA 4YBZA 5AI0A 1NQOA 1HQDA 3VZRA 3WR5A 1G6HA 10MHA 5E6RB 4G0VA 2JIPA 1ZK4A 1KIMA 2YWEA 3I9OA 3LH5A 5K0TA 3V3TA 5AUNB 1VBNA 1HWYA 2HA3A 3ZE6A 1OZGA 2E4WA 4A2QA 8AT1A 3ICPA 2VOJA 1CVIA 3BRCA 3TTYA 2Q1XA 1QGYA 3S5UA 4KJXA 2ZDGA 1KK1A 1BDIA 2HJ9A 2LDXA 1E2QA 2UUAB 3KWJA 2DPLA 3OWOA 4RTSA 2W2QA 1PTKA 4LMPA 2QPTA 3MYYA 3NLLA 3PQDA 4MKRA 3I4CA 2YINC 3LWBA 1J1ZA 3RSOA 1R8SA 3WLEA 5LZ9A 3KEQA 1EDZA 2REOA 3A6KA 2ZRNA 4MA4A 3W2TA 4EB6B 1A4XA 4HR7A 4YXWD 3DOIA 5JXHA 2MHCA 4UULA 3ZNNA 1XTKA 1SAYA 4F9FA 3RUCA 5A3RA 1AK2A 1Y81A 1XTVA 2WVGA 4NZYA 1BU5A 3I5UA 1FLNA 1JLHA 1PNOA 1TPYA 2A0KA 3IDSA 5HF5A 4GI3A 1DQPA 4QZVA 3UXHA 1ZGJA 4REOA 3AFNA 1QKJA 3NPAA 2XOXA 4UEOA 4RHTA 1SHJA 3MMXA 1L5RA 4UHDA 4WDRA 5FWDA 2PKWA 1KH1A 2GCGA 3RS7A 1Q12A 2FR8C 1GVHA 4J2HA 4G8JA 3J80A 2I7CA 1L7XA 2HLPA 3IAXA 4G5GA 4BO2A 3T9BA 4HEJA 1MJNA 2HDHA 1PDWA 1PVVA 3RLIA 2HW8A 2JZNA 2GYYA 1QV7A 2XHEA 4LDPA 2OQVA 2VFAA 1Z8HA 3H0KA 1WB4A 1CQXA 4ETIA 1UBRS 4NZOA 5KOIA 1C1HA 1EVZA 4XGQA 2POCA 3HZHA 4WKGA 1BHJA 2JBHA 2FHSA 4RTJA 3RVMA 4J91A 3MGAA 1YV9A 3W6NA 5G0VA 1RRCA 1NXOA 4ENUA 2VCYA 4H2DA 3ZTTA 1IL0A 1PV1A 3FKQA 4PYJA 4MW2A 4W82A 4KN8A 1HSOA 5BUQA 1FYVA 5FL7D 5J2UB 1CLUA 2PH1A 1FZTA 1B0AA 1DCKA 3OQ1A 1OXBB 4MUXA 2WTAA 5HSGA 2G7MC 2NTYC 4KWTA 1P0CA 2OXCA 3Q98A 5EKSA 1XMIA 3MWJA 4QHSA 5FI3A 1TM4E 3ZWKA 1QQ6A 1ZR4A 3HDJA 4HQOA 2GCIA 3CUTA 4GMXA 2B3DA 3PITA 5BVGB 1GPLA 1VG1A 3ESQA 3TZLA 4CT0A 1IQ0A 3ZIUA 3LT4A 3QFRA 3IIIA 1ZCAA 2YXLA 3R7NA 4EVSA 3KC2A 5H80A 2R6ZA 4BTVA 1I3CA 4DZRA 4AY2A 2I9KA 4XYLA 2JF0A 5FNVA 3GHHA 1XMSA 4KAFA 4MUKA 3H19A 4HAZA 3Q8MA 1GNTA 1S6YA 3IHTA 1QE0A 2VJKA 2QAGB 4R3UC 3WGMA 4R9RA 4B6QA 3DO6A 1X7WB 3GEGA 2YYAA 3IQDB 2DT8A 4WVFA 1CQWA 4O59O 1MO4A 3NAZA 4X1OA 2GESA 5JD4A 3M6UA 3RC1A 3R44A 4INJA 3R1IA 3T61A 3QXSA 3H4VA 2HA7A 3E2IA 2WWIA 2MSEB 3EA0A 3CX8A 2FGKA 3MJ4A 3BCUA 3AHEA 1OGIA 2Z2XA 4OXYA 3WTBA 5KPDA 1QVAA 3CVOA 3EISA 4IX1A 3QHPA 1RZ3A 2OR3A 4KH1A 5IS2A 4J6FA 3IOEA 1ELOA 3IIMA 3QYAA 3ZE7A 2VDRB 4INAA 4D96A 1KS9A 5D85A 1E61A 4KNVA 3U44A 1Y7IA 1BMQA 1BWSA 3S44A 3THOA 3WLKX 4EB3A 2EYUA 1BCRB 1BU8A 1K63A 1QZUA 2WYOA 4LOAA 1RZUA 2YYSA 4PPGA 1XTIA 4FWIB 3F0TA 3NV7A 4EYQA 4B4WA 5T7BA 4EGSA 4REQA 1NA5A 1V5FA 2JGNA 4HGYA 4A27A 5T4EA 4HK4A 1XP5A 3UT0A 4TYNA 4NYIR 4RHUA 5LC1A 2XGGA 1PQPA 1XTBA 2CXRA 2HJGA 2IQ5A 1CZNA 2ZP1A 3KZMA 3NCHA 3LQFA 2ZREA 3NYQA 4GZLA 2RJNA 1DPFA 3L8EA 4G1MB 4X7PA 1F4LA 4PN7A 1YDGA 2A4KA 1G8FA 1VL1A 1G8MA 1ZITA 1MN6A 3URKA 4BV9A 4ES6A 1L4GA 2A94A 5EGNA 1S89A 2HBQA 1M72A 3TBKA 5I8PA 3TVDA 1LJLA 1KYYA 2P27A 1V11A 1N5KA 2HCRA 5EJGA 3HYSA 5EHIA 2ZJYA 3B1XA 3NBUA 3LPAA 1JAZA 3SS8A 4B4KA 1KYQA 4ENQA 2GK4A 2VR1A 4RXUA 3T35A 2C0QA 1C1YA 3ZE1B 1Z5VA 3W7AA 1N2OA 3UVEA 2A86A 2M6LA 1PK9A 1OBVA 1TIBA 1NJ5A 4RVUA 3AR6A 4JKYA 5ILGA 1SXQA 1T9GR 1C9YA 4BV8A 4AO6A 4C5BA 1KAMA 2H57A 1NY6A 3AI1A 5AKYA 4M0EA 3LQQA 3N0RA 2F43A 2WZBA 4D25A 4V1CB 1J23A 2JLVA 4FUQA 4BMYA 5GMOA 3RJ5A 3NIWA 4YAIA 5DK4A 1J7KA 1Y5MA 2ONZA 2OV8A 1TU4A 5DNEA 5FYQA 5TC4A 2LXNA 1CUDA 4WNIA 4COKA 3UV6A 5HCNA 4ZVPA 4C0LA 4X44A 1QIKA 3IMKA 4BYMA 4GC9A 5CFLA 3OPYI 1PG5A 2BR4A 3Q5EA 2UDPA 3H18A 3LX6A 3FDXA 5ER9A 3RFFA 4E5SA 4KODA 1D9XA 1LJ8A 2QR3A 1GRCA 1M0TA 2W6JD 4RSHA 4YRFA 3RCBA 1XQWA 3U2QA 4DQ0A 4A36A 3LAWA 1R6UA 3WXBA 3BK1A 4KRGA 3U4GA 1KU6A 2WQ7A 2FVXA 3DZ8A 1U2SA 2Y27A 4WOPA 1MQ8B 3K16A 3EFOA 3EWSA 1RQ7A 3ENQA 3JWPA 4DLBA 4JQYA 3SZGA 3CVJA 4L8LA 4FJ0A 3IPYA 4AJJA 5K8VA 3FUTA 4DQVA 1FLAA 4TTIA 4AJKA 3GX1A 3WK9A 1CY8A 2FN8A 1E9CA 1E1DA 1PWXA 1DOAA 4JJIA 5H59A 1XA0A 3VXKA 4IDAA 5EE5B 1QG6A 2HTFA 4KPEC 1V39A 4GBED 2QM7A 3DTVA 1MIOA 2DP4E 1USIA 1GA4A 5DRTA 5JYBA 3OZIA 2G09A 1Y5NA 1SVIA 3N76A 4AMUA 5KTKA 4AG3A 1R0KA 4WJLA 3V9AA 3WYBA 4ER7A 2QROA 2IYAA 1TD9A 3DHEA 4F97A 4OXRA 1E0SA 1TIPA 3PQCA 4JT4A 1HC7A 3CNOA 4KL8S 4QLAA 4ZRDA 5EMJA 4TL9A 4OFWA 1D03A 3TGWA 2JIMA 4EZBA 3H65A 1CUGA 1VKHA 2I80A 1PDOA 2NPOA 4P1ZA 1DVRA 1AT1A 3RAFC 2C99A 3P0EA 1N6RA 2MWMA 2X8JB 4PFQA 2L17A 3LM8A 4O0MA 5JPCA 5GZ6A 4MP6A 2CLKB 2XXBA 4P3XA 2O8DB 4F72A 4BKPA 3ET4A 1V16B 2FWNA 4K2AA 3BL5A 1CR2A 3H5OA 4J8PA 4RPCA 1U2DA 3L5OA 2IYLD 2ZS9A 3GD5A 4NBWA 3HA2A 4JR0A 5JAHA 5JAUA 1BH6A 3L01A 2CZQA 1QYIA 4QVIA 2HQ1A 2NTEA 2EYQA 3K31A 1NVDA 1QGUB 3DFKA 3FOWA 3DV0A 4J43A 4BVLA 1M6WA 4CFZA 1O96A 1M2VB 3PRKE 2N1MA 2ZUWA 3L02A 2DCMA 2V9ZA 3IUJA 3LC2O 3QEMB 4CMHA 2Z9BA 2FETA 1SVNA 1HPLA 4MRNA 4LYJA 4MWBA 4RQAA 2Y0EA 4BNFA 2BSQA 5EJFA 1F2TA 5AVXA 3U7FB 3NIGB 4OJNA 4OXNA 3ZJ4A 1XCOA 3AVYA 5JMOA 1W2WB 2JZOA 4KGZA 2W0MA 3OSZA 1H6CA 4B6PA 4EPYA 2MMGA 5B7NA 4I3HA 3PQ6A 4PYNA 1EM6A 4ZAYA 3AUXA 1E6MA 1PYDA 4Y9DA 1K7XB 1OV4A 3OLCX 2NTNA 1U0JA 2Z3ZA 2CL5A 2K7ZA 2DFDA 3SQMA 3WGUA 5KNBH 1AQNA 3NTVA 3EPJA 1JEJA 4YJDA 2ODWA 3MWLA 4MRVA 3UMJA 2HT6A 3V33A 2Y68A 4J7XA 4QJ4A 3E9RA 4WY2A 4YK7A 5EEHA 3BORA 5H3CA 2UZ1B 2VUIB 4DCUA 1MD9A 2QN9A 4V03A 4ND1A 5IJXA 1PT5A 3QLVA 4WERA 5CLGA 4PVDA 1EWKA 4PAGA 3TRKA 3ZCXA 4OEHA 1IQRA 4QPPA 3F7MA 3TTUA 4Z54A 5C5CA 1OVGA 5JLJA 2CT8A 3ES9A 3SG0A 4A0SA 1SRQA 3WFJA 1KDVA 4AZ0A 2C9YA 1WJGA 3AIMA 3HXTA 3BJEA 4I66A 3QVKA 4LZOA 2BHTA 4C6HA 5IAAA 3W5CA 2V7PA 4Y2VA 5IANA 3GYBA 4EMTA 3NVDA 2VRCA 4L4RA 1JMYA 3A3OA 1US8B 4OQEA 3VSDA 2DH6A 3QVGB 4FYIA 1A7UA 1PF7E 2YJNA 1QGZA 1TM3E 1JHOA 3BJMA 4OQYA 2LWIA 4DEXA 3OQHA 3VYWA 4KFRA 3JPYA 3JYNA 1Y98A 2H48A 1X1AA 3H16A 2I91A 3EVFA 2IE8A 5F2KA 4XWOA 5ABPA 4TQAA 1GZHB 1R37A 2IOYA 3G23A 4MB6A 5EIBD 2Q1TA 2I8CA 5TMPA 4AQ7A 2FZ4A 4MPDA 1XRRA 1MZPA 1V3TA 2YHAA 3GRCA 3GZNA 1TM7E 2IHKA 1DFHA 4C43A 1DXHA 1X7YA 4AG6A 1NL3A 1VYUA 4KIWA 1T2NA 4N39A 3MJCA 1J20A 3SIWA 2QN1A 1YTLA 1Z15A 4YO8A 1DTEA 5E38A 3HPRA 3M6XA 3Q0EA 2I7DA 3EY4A 4MRPA 4DS3A 4GKAA 4TVKA 2RHHA 2B21A 1T6XA 3OEYA 1AA6A 1KNQA 2XKJE 3H87A 3HCRA 4TT3D 4Q1FA 4F1JA 2ID7A 5I5EA 2DETA 2IS4A 4G5FA 4F06A 4PYQA 5SZHB 4ICIA 4L28A 4UNRA 2C8VA 3MTGA 4DSTA 1V71A 4GOKA 3OZTA 1G3MA 3QIVA 4NPHA 2RC6A 3KJXA 3PCRB 4EITA 3KPJA 1Q5PA 3PIIA 4O2BF 2BMDA 3HHEA 4WT7A 1DRVA 4JZYA 4L50A 5AVJA 1G4HA 2BVNA 5SZIA 3VO2A 3W90A 4F9EA 4JI2B 3MGGA 4W5OA 1UFKA 3DOEA 3BWCA 3W5AA 4QFDA 4I9HA 4FLMA 2ZJ8A 4LQ4A 4K9KA 2BR3A 3PC2A 5HILA 2BGKA 5CH3A 4ZVOA 2WHEA 1T25A 3AR5A 4RQTA 1F0PA 3R9KA 1QPBA 3K9CA 4EX7A 2R8PA 3CB4A 4FX2A 4AX4A 4YV0A 2UUPA 1NF9A 1E2DA 2GEVA 3EEQA 3HKDA 2ZTUA 4IYJA 4JUBA 4QXAA 3SZUA 1G2OA 4B79A 5KWIA 4GVLA 3E9CA 4BXOA 2IEYA 3NUGA 4LUCA 2BHLA 1IYZA 3OQIB 4IHJF 1E1NA 3DOCA 3GGOA 3H11A 4KR0A 4KQEA 2WFAA 2EDAA 1E5QA 2ORYA 2NUPB 3ORHA 4BVFA 4KO1S 1JSXA 1YO6A 5BXYA 3MNFA 4CBVA 4QM6A 2WIBA 2V6FA 3PEUA 2GPSA 1A1SA 4N3NA 3U6BA 1U0NA 2PUJA 2P7HA 4JXKA 4BLRA 4ACBA 1O6FA 2PKXA 2OHOA 2VHZA 3JQFC 3QKSB 4RWZA 5AIBA 2EFGA 4L4SA 1GV0A 4JT2A 4RX1A 4MZXA 3HFJA 2YKGA 4XCVA 1U2PA 4ZC1A 2HU7A 3ZX4A 5BV2P 1RI1A 5K8IA 3KYDB 4TXNA 3UQYS 2IU0A 2JFBA 5AI5A 3W8EA 2DPYA 1LVHA 3RM3A 4YMVA 1RNLA 2QRVA 1C3LA 1C9MA 4CLXA 2ZB3A 1TPZA