4JUQA

Pseudomonas aeruginosa metap t2n mutant, in mn form
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
258
structure length
258
Chain Sequence
NVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 79
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4juqA00
2GG9A 2GU4A 4PNCA 5FCFA 2GU5A 1WY2A 1C23A 1BOAA 4RZYA 2OAZA 4U76A 4S01A 3BITA 4A6VA 5CDVA 2Q95A 4FUKA 4U6JA 1XGOA 1WL9A 4IKRA 4ZWOA 1YW8A 4U71A 2MATA 2GG5A 1WL6A 4FO7A 4U6CA 5CNXA 4U6EA 2BHCA 3IU8A 4B28A 2GGCA 1A16A 1XGMA 2BWWA 5CE6A 1BN5A 2GG8A 4IECA 1QXWA 4IU6A 3TB5A 2EVMA 4KM3A 2G6PA 3PKBA 2B3HA 4U70A 2GZ5A 2GTXA 1MATA 1C21A 4FLJA 2P98A 1YJ3A 5D6EA 3FMQA 2B3LA 4QR8A 2BN7A 1B59A 3IG4A 3MATA 1YVMA 5CIKA 2BWYA 2GG2A 1CHMA 4U6WA 4IPAA 2Q8KA 1WBQA 2BHAA 1W7VA 5FCHA 3CB5A 4S00A 3L24A 1B6AA 1PV9A 2V3YA 3FM3A 4U75A 5E5BA 4IDYA 4ZWPA 3D27A 3MR1A 1QXZA 4FO8A 2EVCA 4JUQA 2BWSA 2GG7A 4U1BA 3S6BA 3TAVA 1N51A 4HXXA 2EA2A 1QXYA 2NQ6A 4IKUA 4U69A 2BWTA 4IF7A 4U73A 5D6FA 5CDEA 2EVOA 2GA2A 1R58A 4FLIA 3RORA 1C27A 3CB6A 5JHUA 2BH3A 1QZYA 2GG3A 4RZZA 3BIQA 2ZSGA 3CTZA 4S2TP 2GU7A 1XNZA 2P9AA 3PKCA 2V3XA 2Q94A 5JFRA 1JAWA 1KQ9A 2BB7A 1R5GA 1C22A 1M35A 3L7GA 2V6CA 3PKEA 4FLKA 4PV4A 2IW2A 4S2RP 4IKSA 1C24A 1W2MA 1Y1NA 3BIPA 2OKNA 2P99A 1XGNA 2Q96A 5JI6A 1KQ0A 2ADUA 2Q92A 2BWXA 4ZNGA 1XGSA 1R5HA 1YW9A 2BHDA 3PKDA 4RGZ1 4U6ZA 2BWUA 4ZWUA 4EGEA 1YW7A 3FMRA 5CLSA 2V3ZA 4OOKA 4R60A 4MATA 3PKAA 4FKCA 3IU7A 2HOWA 3RVAA 1O0XA 4FLLA 2EA4A 2GG0A 3MX6A 4A6WA 1WLRA 2B3KA 1WN1A 3Q6DA 5CDLA 2DFIA 2NQ7A 2Q93A 1KP0A 2BWVA 2GU6A 4Z7MA 1WKMA 2GGBA 2BHBA 4IKTA 3IU9A
chains in the Genus database with same CATH superfamily
2GG9A 2GU4A 4PNCA 5FCFA 2GU5A 1WY2A 1C23A 1BOAA 4RZYA 2OAZA 4U76A 4S01A 3BITA 4A6VA 5CDVA 2Q95A 4FUKA 4U6JA 1XGOA 1WL9A 4IKRA 4ZWOA 1YW8A 4U71A 2MATA 2GG5A 1WL6A 4FO7A 4U6CA 5CNXA 4U6EA 2BHCA 3IU8A 4B28A 2GGCA 1A16A 1XGMA 2BWWA 5CE6A 1BN5A 2GG8A 4IECA 1QXWA 4IU6A 3TB5A 2EVMA 4KM3A 2G6PA 3PKBA 2B3HA 4U70A 2GZ5A 2GTXA 1MATA 1C21A 4FLJA 2P98A 1YJ3A 5D6EA 3FMQA 2B3LA 4QR8A 2BN7A 1B59A 3IG4A 3MATA 1YVMA 5CIKA 2BWYA 2GG2A 1CHMA 4U6WA 4IPAA 2Q8KA 1WBQA 2BHAA 1W7VA 5FCHA 3CB5A 4S00A 3L24A 1B6AA 1PV9A 2V3YA 3FM3A 4U75A 5E5BA 4IDYA 4ZWPA 3D27A 3MR1A 1QXZA 4FO8A 2EVCA 4JUQA 2BWSA 2GG7A 4U1BA 3S6BA 3TAVA 1N51A 4HXXA 2EA2A 1QXYA 2NQ6A 4IKUA 4U69A 2BWTA 4IF7A 4U73A 5D6FA 5CDEA 2EVOA 2GA2A 1R58A 4FLIA 3RORA 1C27A 3CB6A 5JHUA 2BH3A 1QZYA 2GG3A 4RZZA 3BIQA 2ZSGA 3CTZA 4S2TP 2GU7A 1XNZA 2P9AA 3PKCA 2V3XA 2Q94A 5JFRA 1JAWA 1KQ9A 2BB7A 1R5GA 1C22A 1M35A 3L7GA 2V6CA 3PKEA 4FLKA 4PV4A 2IW2A 4S2RP 4IKSA 1C24A 1W2MA 1Y1NA 3BIPA 2OKNA 2P99A 1XGNA 2Q96A 5JI6A 1KQ0A 2ADUA 2Q92A 2BWXA 4ZNGA 1XGSA 1R5HA 1YW9A 2BHDA 3PKDA 4RGZ1 4U6ZA 2BWUA 4ZWUA 4EGEA 1YW7A 3FMRA 5CLSA 2V3ZA 4OOKA 4R60A 4MATA 3PKAA 4FKCA 3IU7A 2HOWA 3RVAA 1O0XA 4FLLA 2EA4A 2GG0A 3MX6A 4A6WA 1WLRA 2B3KA 1WN1A 3Q6DA 5CDLA 2DFIA 2NQ7A 2Q93A 1KP0A 2BWVA 2GU6A 4Z7MA 1WKMA 2GGBA 2BHBA 4IKTA 3IU9A
chains in the Genus database with same CATH topology
2GG9A 2GU4A 4PNCA 5FCFA 2GU5A 1WY2A 1C23A 1BOAA 4RZYA 2OAZA 4U76A 4S01A 3BITA 4A6VA 5CDVA 2Q95A 4FUKA 4U6JA 1XGOA 1WL9A 4IKRA 4ZWOA 1YW8A 4U71A 2MATA 2GG5A 1WL6A 4FO7A 4U6CA 5CNXA 4U6EA 2BHCA 3IU8A 4B28A 2GGCA 1A16A 1XGMA 2BWWA 5CE6A 1BN5A 2GG8A 4IECA 1QXWA 4IU6A 3TB5A 2EVMA 4KM3A 2G6PA 3PKBA 2B3HA 4U70A 2GZ5A 2GTXA 1MATA 1C21A 4FLJA 2P98A 1YJ3A 5D6EA 3FMQA 2B3LA 4QR8A 2BN7A 1B59A 3IG4A 3MATA 1YVMA 5CIKA 2BWYA 2GG2A 1CHMA 4U6WA 4IPAA 2Q8KA 1WBQA 2BHAA 1W7VA 5FCHA 3CB5A 4S00A 3L24A 1B6AA 1PV9A 2V3YA 3FM3A 4U75A 5E5BA 4IDYA 4ZWPA 3D27A 3MR1A 1QXZA 4FO8A 2EVCA 4JUQA 2BWSA 2GG7A 4U1BA 3S6BA 3TAVA 1N51A 4HXXA 2EA2A 1QXYA 2NQ6A 4IKUA 4U69A 2BWTA 4IF7A 4U73A 5D6FA 5CDEA 2EVOA 2GA2A 1R58A 4FLIA 3RORA 1C27A 3CB6A 5JHUA 2BH3A 1QZYA 2GG3A 4RZZA 3BIQA 2ZSGA 3CTZA 4S2TP 2GU7A 1XNZA 2P9AA 3PKCA 2V3XA 2Q94A 5JFRA 1JAWA 1KQ9A 2BB7A 1R5GA 1C22A 1M35A 3L7GA 2V6CA 3PKEA 4FLKA 4PV4A 2IW2A 4S2RP 4IKSA 1C24A 1W2MA 1Y1NA 3BIPA 2OKNA 2P99A 1XGNA 2Q96A 5JI6A 1KQ0A 2ADUA 2Q92A 2BWXA 4ZNGA 1XGSA 1R5HA 1YW9A 2BHDA 3PKDA 4RGZ1 4U6ZA 2BWUA 4ZWUA 4EGEA 1YW7A 3FMRA 5CLSA 2V3ZA 4OOKA 4R60A 4MATA 3PKAA 4FKCA 3IU7A 2HOWA 3RVAA 1O0XA 4FLLA 2EA4A 2GG0A 3MX6A 4A6WA 1WLRA 2B3KA 1WN1A 3Q6DA 5CDLA 2DFIA 2NQ7A 2Q93A 1KP0A 2BWVA 2GU6A 4Z7MA 1WKMA 2GGBA 2BHBA 4IKTA 3IU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG9 A;  2GU4 A;  4PNC A;  5FCF A;  2GU5 A;  1WY2 A;  1C23 A;  1BOA A;  4RZY A;  2OAZ A;  4U76 A;  4S01 A;  3BIT A;  4A6V A;  5CDV A;  2Q95 A;  4FUK A;  4U6J A;  1XGO A;  1WL9 A;  4IKR A;  4ZWO A;  1YW8 A;  4U71 A;  2MAT A;  2GG5 A;  1WL6 A;  4FO7 A;  4U6C A;  5CNX A;  4U6E A;  2BHC A;  3IU8 A;  4B28 A;  2GGC A;  1A16 A;  1XGM A;  2BWW A;  5CE6 A;  1BN5 A;  2GG8 A;  4IEC A;  1QXW A;  4IU6 A;  3TB5 A;  2EVM A;  4KM3 A;  2G6P A;  3PKB A;  2B3H A;  4U70 A;  2GZ5 A;  2GTX A;  1MAT A;  1C21 A;  4FLJ A;  2P98 A;  1YJ3 A;  5D6E A;  3FMQ A;  2B3L A;  4QR8 A;  2BN7 A;  1B59 A;  3IG4 A;  3MAT A;  1YVM A;  5CIK A;  2BWY A;  2GG2 A;  1CHM A;  4U6W A;  4IPA A;  2Q8K A;  1WBQ A;  2BHA A;  1W7V A;  5FCH A;  3CB5 A;  4S00 A;  3L24 A;  1B6A A;  1PV9 A;  2V3Y A;  3FM3 A;  4U75 A;  5E5B A;  4IDY A;  4ZWP A;  3D27 A;  3MR1 A;  1QXZ A;  4FO8 A;  2EVC A;  4JUQ A;  2BWS A;  2GG7 A;  4U1B A;  3S6B A;  3TAV A;  1N51 A;  4HXX A;  2EA2 A;  1QXY A;  2NQ6 A;  4IKU A;  4U69 A;  2BWT A;  4IF7 A;  4U73 A;  5D6F A;  5CDE A;  2EVO A;  2GA2 A;  1R58 A;  4FLI A;  3ROR A;  1C27 A;  3CB6 A;  5JHU A;  2BH3 A;  1QZY A;  2GG3 A;  4RZZ A;  3BIQ A;  2ZSG A;  3CTZ A;  4S2T P;  2GU7 A;  1XNZ A;  2P9A A;  3PKC A;  2V3X A;  2Q94 A;  5JFR A;  1JAW A;  1KQ9 A;  2BB7 A;  1R5G A;  1C22 A;  1M35 A;  3L7G A;  2V6C A;  3PKE A;  4FLK A;  4PV4 A;  2IW2 A;  4S2R P;  4IKS A;  1C24 A;  1W2M A;  1Y1N A;  3BIP A;  2OKN A;  2P99 A;  1XGN A;  2Q96 A;  5JI6 A;  1KQ0 A;  2ADU A;  2Q92 A;  2BWX A;  4ZNG A;  1XGS A;  1R5H A;  1YW9 A;  2BHD A;  3PKD A;  4RGZ 1;  4U6Z A;  2BWU A;  4ZWU A;  4EGE A;  1YW7 A;  3FMR A;  5CLS A;  2V3Z A;  4OOK A;  4R60 A;  4MAT A;  3PKA A;  4FKC A;  3IU7 A;  2HOW A;  3RVA A;  1O0X A;  4FLL A;  2EA4 A;  2GG0 A;  3MX6 A;  4A6W A;  1WLR A;  2B3K A;  1WN1 A;  3Q6D A;  5CDL A;  2DFI A;  2NQ7 A;  2Q93 A;  1KP0 A;  2BWV A;  2GU6 A;  4Z7M A;  1WKM A;  2GGB A;  2BHB A;  4IKT A;  3IU9 A; 
#chains in the Genus database with same CATH topology
 2GG9 A;  2GU4 A;  4PNC A;  5FCF A;  2GU5 A;  1WY2 A;  1C23 A;  1BOA A;  4RZY A;  2OAZ A;  4U76 A;  4S01 A;  3BIT A;  4A6V A;  5CDV A;  2Q95 A;  4FUK A;  4U6J A;  1XGO A;  1WL9 A;  4IKR A;  4ZWO A;  1YW8 A;  4U71 A;  2MAT A;  2GG5 A;  1WL6 A;  4FO7 A;  4U6C A;  5CNX A;  4U6E A;  2BHC A;  3IU8 A;  4B28 A;  2GGC A;  1A16 A;  1XGM A;  2BWW A;  5CE6 A;  1BN5 A;  2GG8 A;  4IEC A;  1QXW A;  4IU6 A;  3TB5 A;  2EVM A;  4KM3 A;  2G6P A;  3PKB A;  2B3H A;  4U70 A;  2GZ5 A;  2GTX A;  1MAT A;  1C21 A;  4FLJ A;  2P98 A;  1YJ3 A;  5D6E A;  3FMQ A;  2B3L A;  4QR8 A;  2BN7 A;  1B59 A;  3IG4 A;  3MAT A;  1YVM A;  5CIK A;  2BWY A;  2GG2 A;  1CHM A;  4U6W A;  4IPA A;  2Q8K A;  1WBQ A;  2BHA A;  1W7V A;  5FCH A;  3CB5 A;  4S00 A;  3L24 A;  1B6A A;  1PV9 A;  2V3Y A;  3FM3 A;  4U75 A;  5E5B A;  4IDY A;  4ZWP A;  3D27 A;  3MR1 A;  1QXZ A;  4FO8 A;  2EVC A;  4JUQ A;  2BWS A;  2GG7 A;  4U1B A;  3S6B A;  3TAV A;  1N51 A;  4HXX A;  2EA2 A;  1QXY A;  2NQ6 A;  4IKU A;  4U69 A;  2BWT A;  4IF7 A;  4U73 A;  5D6F A;  5CDE A;  2EVO A;  2GA2 A;  1R58 A;  4FLI A;  3ROR A;  1C27 A;  3CB6 A;  5JHU A;  2BH3 A;  1QZY A;  2GG3 A;  4RZZ A;  3BIQ A;  2ZSG A;  3CTZ A;  4S2T P;  2GU7 A;  1XNZ A;  2P9A A;  3PKC A;  2V3X A;  2Q94 A;  5JFR A;  1JAW A;  1KQ9 A;  2BB7 A;  1R5G A;  1C22 A;  1M35 A;  3L7G A;  2V6C A;  3PKE A;  4FLK A;  4PV4 A;  2IW2 A;  4S2R P;  4IKS A;  1C24 A;  1W2M A;  1Y1N A;  3BIP A;  2OKN A;  2P99 A;  1XGN A;  2Q96 A;  5JI6 A;  1KQ0 A;  2ADU A;  2Q92 A;  2BWX A;  4ZNG A;  1XGS A;  1R5H A;  1YW9 A;  2BHD A;  3PKD A;  4RGZ 1;  4U6Z A;  2BWU A;  4ZWU A;  4EGE A;  1YW7 A;  3FMR A;  5CLS A;  2V3Z A;  4OOK A;  4R60 A;  4MAT A;  3PKA A;  4FKC A;  3IU7 A;  2HOW A;  3RVA A;  1O0X A;  4FLL A;  2EA4 A;  2GG0 A;  3MX6 A;  4A6W A;  1WLR A;  2B3K A;  1WN1 A;  3Q6D A;  5CDL A;  2DFI A;  2NQ7 A;  2Q93 A;  1KP0 A;  2BWV A;  2GU6 A;  4Z7M A;  1WKM A;  2GGB A;  2BHB A;  4IKT A;  3IU9 A; 
#chains in the Genus database with same CATH homology
 2GG9 A;  2GU4 A;  4PNC A;  5FCF A;  2GU5 A;  1WY2 A;  1C23 A;  1BOA A;  4RZY A;  2OAZ A;  4U76 A;  4S01 A;  3BIT A;  4A6V A;  5CDV A;  2Q95 A;  4FUK A;  4U6J A;  1XGO A;  1WL9 A;  4IKR A;  4ZWO A;  1YW8 A;  4U71 A;  2MAT A;  2GG5 A;  1WL6 A;  4FO7 A;  4U6C A;  5CNX A;  4U6E A;  2BHC A;  3IU8 A;  4B28 A;  2GGC A;  1A16 A;  1XGM A;  2BWW A;  5CE6 A;  1BN5 A;  2GG8 A;  4IEC A;  1QXW A;  4IU6 A;  3TB5 A;  2EVM A;  4KM3 A;  2G6P A;  3PKB A;  2B3H A;  4U70 A;  2GZ5 A;  2GTX A;  1MAT A;  1C21 A;  4FLJ A;  2P98 A;  1YJ3 A;  5D6E A;  3FMQ A;  2B3L A;  4QR8 A;  2BN7 A;  1B59 A;  3IG4 A;  3MAT A;  1YVM A;  5CIK A;  2BWY A;  2GG2 A;  1CHM A;  4U6W A;  4IPA A;  2Q8K A;  1WBQ A;  2BHA A;  1W7V A;  5FCH A;  3CB5 A;  4S00 A;  3L24 A;  1B6A A;  1PV9 A;  2V3Y A;  3FM3 A;  4U75 A;  5E5B A;  4IDY A;  4ZWP A;  3D27 A;  3MR1 A;  1QXZ A;  4FO8 A;  2EVC A;  4JUQ A;  2BWS A;  2GG7 A;  4U1B A;  3S6B A;  3TAV A;  1N51 A;  4HXX A;  2EA2 A;  1QXY A;  2NQ6 A;  4IKU A;  4U69 A;  2BWT A;  4IF7 A;  4U73 A;  5D6F A;  5CDE A;  2EVO A;  2GA2 A;  1R58 A;  4FLI A;  3ROR A;  1C27 A;  3CB6 A;  5JHU A;  2BH3 A;  1QZY A;  2GG3 A;  4RZZ A;  3BIQ A;  2ZSG A;  3CTZ A;  4S2T P;  2GU7 A;  1XNZ A;  2P9A A;  3PKC A;  2V3X A;  2Q94 A;  5JFR A;  1JAW A;  1KQ9 A;  2BB7 A;  1R5G A;  1C22 A;  1M35 A;  3L7G A;  2V6C A;  3PKE A;  4FLK A;  4PV4 A;  2IW2 A;  4S2R P;  4IKS A;  1C24 A;  1W2M A;  1Y1N A;  3BIP A;  2OKN A;  2P99 A;  1XGN A;  2Q96 A;  5JI6 A;  1KQ0 A;  2ADU A;  2Q92 A;  2BWX A;  4ZNG A;  1XGS A;  1R5H A;  1YW9 A;  2BHD A;  3PKD A;  4RGZ 1;  4U6Z A;  2BWU A;  4ZWU A;  4EGE A;  1YW7 A;  3FMR A;  5CLS A;  2V3Z A;  4OOK A;  4R60 A;  4MAT A;  3PKA A;  4FKC A;  3IU7 A;  2HOW A;  3RVA A;  1O0X A;  4FLL A;  2EA4 A;  2GG0 A;  3MX6 A;  4A6W A;  1WLR A;  2B3K A;  1WN1 A;  3Q6D A;  5CDL A;  2DFI A;  2NQ7 A;  2Q93 A;  1KP0 A;  2BWV A;  2GU6 A;  4Z7M A;  1WKM A;  2GGB A;  2BHB A;  4IKT A;  3IU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...