4JUQA

Pseudomonas aeruginosa metap t2n mutant, in mn form
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
258
structure length
258
Chain Sequence
NVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 79
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4juqA00
2ADUA 2BHAA 2GG3A 3IU9A 2BHDA 2BHBA 3IU8A 2EA4A 1KQ0A 4IDYA 1C24A 1C23A 2BWYA 5CDVA 1WN1A 4EGEA 5JFRA 5FCHA 1XGNA 4S2RP 4U73A 3MR1A 4KM3A 2V3ZA 4FO8A 1WBQA 2BWUA 5CDLA 5JHUA 1WL6A 4OOKA 2Q92A 2V3XA 4U6ZA 1XGSA 2DFIA 1WL9A 2GU7A 1B6AA 1M35A 4IU6A 2GA2A 4FO7A 3CB5A 1QXWA 5CLSA 1W2MA 3MX6A 3PKAA 4FLKA 4U6CA 2Q96A 2B3HA 4IKTA 1C22A 1MATA 1XNZA 2GZ5A 3BIQA 3L24A 2Q8KA 2BH3A 2OAZA 1QZYA 2EVMA 3FMRA 1R5GA 3BITA 4R60A 4U69A 4FKCA 3RORA 2GU4A 5D6EA 4A6WA 3S6BA 4PV4A 1KP0A 2EVOA 4JUQA 5CE6A 3L7GA 2BWSA 2BN7A 4A6VA 3Q6DA 4S2TP 1QXYA 4FUKA 1YW7A 4Z7MA 2NQ7A 3TB5A 4U6JA 2BB7A 4U75A 3RVAA 1YJ3A 4RZZA 2GTXA 1R5HA 4B28A 4U76A 2B3KA 1C27A 4ZWOA 4FLLA 3MATA 1YVMA 4IECA 2Q93A 5JI6A 1WKMA 4U6WA 1O0XA 1PV9A 4RGZ1 1JAWA 5CIKA 1BN5A 4IKRA 2BWXA 1CHMA 2OKNA 4FLJA 4U70A 4U71A 4QR8A 2GGCA 2IW2A 1QXZA 3IG4A 1A16A 2HOWA 2ZSGA 4IKUA 5D6FA 4FLIA 2BHCA 2GG0A 4U6EA 2P98A 2NQ6A 2MATA 2Q94A 3CTZA 3FM3A 4S01A 2V6CA 3PKBA 4IPAA 3D27A 1YW9A 4S00A 2Q95A 1BOAA 2GG5A 4IF7A 3PKDA 1WLRA 1B59A 2EVCA 3CB6A 2GU5A 3FMQA 3BIPA 5E5BA 4U1BA 1Y1NA 1N51A 2BWTA 2GG2A 1XGMA 4ZNGA 2BWWA 3TAVA 1C21A 5FCFA 1KQ9A 2GU6A 4RZYA 4PNCA 5CNXA 1W7VA 2GGBA 1WY2A 3PKEA 4HXXA 2P9AA 2B3LA 2GG8A 4ZWUA 2GG9A 3PKCA 1XGOA 2EA2A 2BWVA 2G6PA 2P99A 1R58A 3IU7A 4ZWPA 5CDEA 4IKSA 1YW8A 2GG7A 2V3YA 4MATA
chains in the Genus database with same CATH superfamily
2ADUA 2BHAA 2GG3A 3IU9A 2BHDA 2BHBA 3IU8A 2EA4A 1KQ0A 4IDYA 1C24A 1C23A 2BWYA 5CDVA 1WN1A 4EGEA 5JFRA 5FCHA 1XGNA 4S2RP 4U73A 3MR1A 4KM3A 2V3ZA 4FO8A 1WBQA 2BWUA 5CDLA 5JHUA 1WL6A 4OOKA 2Q92A 2V3XA 4U6ZA 1XGSA 2DFIA 1WL9A 2GU7A 1B6AA 1M35A 4IU6A 2GA2A 4FO7A 3CB5A 1QXWA 5CLSA 1W2MA 3MX6A 3PKAA 4FLKA 4U6CA 2Q96A 2B3HA 4IKTA 1C22A 1MATA 1XNZA 2GZ5A 3BIQA 3L24A 2Q8KA 2BH3A 2OAZA 1QZYA 2EVMA 3FMRA 1R5GA 3BITA 4R60A 4U69A 4FKCA 3RORA 2GU4A 5D6EA 4A6WA 3S6BA 4PV4A 1KP0A 2EVOA 4JUQA 5CE6A 3L7GA 2BWSA 2BN7A 4A6VA 3Q6DA 4S2TP 1QXYA 4FUKA 1YW7A 4Z7MA 2NQ7A 3TB5A 4U6JA 2BB7A 4U75A 3RVAA 1YJ3A 4RZZA 2GTXA 1R5HA 4B28A 4U76A 2B3KA 1C27A 4ZWOA 4FLLA 3MATA 1YVMA 4IECA 2Q93A 5JI6A 1WKMA 4U6WA 1O0XA 1PV9A 4RGZ1 1JAWA 5CIKA 1BN5A 4IKRA 2BWXA 1CHMA 2OKNA 4FLJA 4U70A 4U71A 4QR8A 2GGCA 2IW2A 1QXZA 3IG4A 1A16A 2HOWA 2ZSGA 4IKUA 5D6FA 4FLIA 2BHCA 2GG0A 4U6EA 2P98A 2NQ6A 2MATA 2Q94A 3CTZA 3FM3A 4S01A 2V6CA 3PKBA 4IPAA 3D27A 1YW9A 4S00A 2Q95A 1BOAA 2GG5A 4IF7A 3PKDA 1WLRA 1B59A 2EVCA 3CB6A 2GU5A 3FMQA 3BIPA 5E5BA 4U1BA 1Y1NA 1N51A 2BWTA 2GG2A 1XGMA 4ZNGA 2BWWA 3TAVA 1C21A 5FCFA 1KQ9A 2GU6A 4RZYA 4PNCA 5CNXA 1W7VA 2GGBA 1WY2A 3PKEA 4HXXA 2P9AA 2B3LA 2GG8A 4ZWUA 2GG9A 3PKCA 1XGOA 2EA2A 2BWVA 2G6PA 2P99A 1R58A 3IU7A 4ZWPA 5CDEA 4IKSA 1YW8A 2GG7A 2V3YA 4MATA
chains in the Genus database with same CATH topology
2ADUA 2BHAA 2GG3A 3IU9A 2BHDA 2BHBA 3IU8A 2EA4A 1KQ0A 4IDYA 1C24A 1C23A 2BWYA 5CDVA 1WN1A 4EGEA 5JFRA 5FCHA 1XGNA 4S2RP 4U73A 3MR1A 4KM3A 2V3ZA 4FO8A 1WBQA 2BWUA 5CDLA 5JHUA 1WL6A 4OOKA 2Q92A 2V3XA 4U6ZA 1XGSA 2DFIA 1WL9A 2GU7A 1B6AA 1M35A 4IU6A 2GA2A 4FO7A 3CB5A 1QXWA 5CLSA 1W2MA 3MX6A 3PKAA 4FLKA 4U6CA 2Q96A 2B3HA 4IKTA 1C22A 1MATA 1XNZA 2GZ5A 3BIQA 3L24A 2Q8KA 2BH3A 2OAZA 1QZYA 2EVMA 3FMRA 1R5GA 3BITA 4R60A 4U69A 4FKCA 3RORA 2GU4A 5D6EA 4A6WA 3S6BA 4PV4A 1KP0A 2EVOA 4JUQA 5CE6A 3L7GA 2BWSA 2BN7A 4A6VA 3Q6DA 4S2TP 1QXYA 4FUKA 1YW7A 4Z7MA 2NQ7A 3TB5A 4U6JA 2BB7A 4U75A 3RVAA 1YJ3A 4RZZA 2GTXA 1R5HA 4B28A 4U76A 2B3KA 1C27A 4ZWOA 4FLLA 3MATA 1YVMA 4IECA 2Q93A 5JI6A 1WKMA 4U6WA 1O0XA 1PV9A 4RGZ1 1JAWA 5CIKA 1BN5A 4IKRA 2BWXA 1CHMA 2OKNA 4FLJA 4U70A 4U71A 4QR8A 2GGCA 2IW2A 1QXZA 3IG4A 1A16A 2HOWA 2ZSGA 4IKUA 5D6FA 4FLIA 2BHCA 2GG0A 4U6EA 2P98A 2NQ6A 2MATA 2Q94A 3CTZA 3FM3A 4S01A 2V6CA 3PKBA 4IPAA 3D27A 1YW9A 4S00A 2Q95A 1BOAA 2GG5A 4IF7A 3PKDA 1WLRA 1B59A 2EVCA 3CB6A 2GU5A 3FMQA 3BIPA 5E5BA 4U1BA 1Y1NA 1N51A 2BWTA 2GG2A 1XGMA 4ZNGA 2BWWA 3TAVA 1C21A 5FCFA 1KQ9A 2GU6A 4RZYA 4PNCA 5CNXA 1W7VA 2GGBA 1WY2A 3PKEA 4HXXA 2P9AA 2B3LA 2GG8A 4ZWUA 2GG9A 3PKCA 1XGOA 2EA2A 2BWVA 2G6PA 2P99A 1R58A 3IU7A 4ZWPA 5CDEA 4IKSA 1YW8A 2GG7A 2V3YA 4MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADU A;  2BHA A;  2GG3 A;  3IU9 A;  2BHD A;  2BHB A;  3IU8 A;  2EA4 A;  1KQ0 A;  4IDY A;  1C24 A;  1C23 A;  2BWY A;  5CDV A;  1WN1 A;  4EGE A;  5JFR A;  5FCH A;  1XGN A;  4S2R P;  4U73 A;  3MR1 A;  4KM3 A;  2V3Z A;  4FO8 A;  1WBQ A;  2BWU A;  5CDL A;  5JHU A;  1WL6 A;  4OOK A;  2Q92 A;  2V3X A;  4U6Z A;  1XGS A;  2DFI A;  1WL9 A;  2GU7 A;  1B6A A;  1M35 A;  4IU6 A;  2GA2 A;  4FO7 A;  3CB5 A;  1QXW A;  5CLS A;  1W2M A;  3MX6 A;  3PKA A;  4FLK A;  4U6C A;  2Q96 A;  2B3H A;  4IKT A;  1C22 A;  1MAT A;  1XNZ A;  2GZ5 A;  3BIQ A;  3L24 A;  2Q8K A;  2BH3 A;  2OAZ A;  1QZY A;  2EVM A;  3FMR A;  1R5G A;  3BIT A;  4R60 A;  4U69 A;  4FKC A;  3ROR A;  2GU4 A;  5D6E A;  4A6W A;  3S6B A;  4PV4 A;  1KP0 A;  2EVO A;  4JUQ A;  5CE6 A;  3L7G A;  2BWS A;  2BN7 A;  4A6V A;  3Q6D A;  4S2T P;  1QXY A;  4FUK A;  1YW7 A;  4Z7M A;  2NQ7 A;  3TB5 A;  4U6J A;  2BB7 A;  4U75 A;  3RVA A;  1YJ3 A;  4RZZ A;  2GTX A;  1R5H A;  4B28 A;  4U76 A;  2B3K A;  1C27 A;  4ZWO A;  4FLL A;  3MAT A;  1YVM A;  4IEC A;  2Q93 A;  5JI6 A;  1WKM A;  4U6W A;  1O0X A;  1PV9 A;  4RGZ 1;  1JAW A;  5CIK A;  1BN5 A;  4IKR A;  2BWX A;  1CHM A;  2OKN A;  4FLJ A;  4U70 A;  4U71 A;  4QR8 A;  2GGC A;  2IW2 A;  1QXZ A;  3IG4 A;  1A16 A;  2HOW A;  2ZSG A;  4IKU A;  5D6F A;  4FLI A;  2BHC A;  2GG0 A;  4U6E A;  2P98 A;  2NQ6 A;  2MAT A;  2Q94 A;  3CTZ A;  3FM3 A;  4S01 A;  2V6C A;  3PKB A;  4IPA A;  3D27 A;  1YW9 A;  4S00 A;  2Q95 A;  1BOA A;  2GG5 A;  4IF7 A;  3PKD A;  1WLR A;  1B59 A;  2EVC A;  3CB6 A;  2GU5 A;  3FMQ A;  3BIP A;  5E5B A;  4U1B A;  1Y1N A;  1N51 A;  2BWT A;  2GG2 A;  1XGM A;  4ZNG A;  2BWW A;  3TAV A;  1C21 A;  5FCF A;  1KQ9 A;  2GU6 A;  4RZY A;  4PNC A;  5CNX A;  1W7V A;  2GGB A;  1WY2 A;  3PKE A;  4HXX A;  2P9A A;  2B3L A;  2GG8 A;  4ZWU A;  2GG9 A;  3PKC A;  1XGO A;  2EA2 A;  2BWV A;  2G6P A;  2P99 A;  1R58 A;  3IU7 A;  4ZWP A;  5CDE A;  4IKS A;  1YW8 A;  2GG7 A;  2V3Y A;  4MAT A; 
#chains in the Genus database with same CATH topology
 2ADU A;  2BHA A;  2GG3 A;  3IU9 A;  2BHD A;  2BHB A;  3IU8 A;  2EA4 A;  1KQ0 A;  4IDY A;  1C24 A;  1C23 A;  2BWY A;  5CDV A;  1WN1 A;  4EGE A;  5JFR A;  5FCH A;  1XGN A;  4S2R P;  4U73 A;  3MR1 A;  4KM3 A;  2V3Z A;  4FO8 A;  1WBQ A;  2BWU A;  5CDL A;  5JHU A;  1WL6 A;  4OOK A;  2Q92 A;  2V3X A;  4U6Z A;  1XGS A;  2DFI A;  1WL9 A;  2GU7 A;  1B6A A;  1M35 A;  4IU6 A;  2GA2 A;  4FO7 A;  3CB5 A;  1QXW A;  5CLS A;  1W2M A;  3MX6 A;  3PKA A;  4FLK A;  4U6C A;  2Q96 A;  2B3H A;  4IKT A;  1C22 A;  1MAT A;  1XNZ A;  2GZ5 A;  3BIQ A;  3L24 A;  2Q8K A;  2BH3 A;  2OAZ A;  1QZY A;  2EVM A;  3FMR A;  1R5G A;  3BIT A;  4R60 A;  4U69 A;  4FKC A;  3ROR A;  2GU4 A;  5D6E A;  4A6W A;  3S6B A;  4PV4 A;  1KP0 A;  2EVO A;  4JUQ A;  5CE6 A;  3L7G A;  2BWS A;  2BN7 A;  4A6V A;  3Q6D A;  4S2T P;  1QXY A;  4FUK A;  1YW7 A;  4Z7M A;  2NQ7 A;  3TB5 A;  4U6J A;  2BB7 A;  4U75 A;  3RVA A;  1YJ3 A;  4RZZ A;  2GTX A;  1R5H A;  4B28 A;  4U76 A;  2B3K A;  1C27 A;  4ZWO A;  4FLL A;  3MAT A;  1YVM A;  4IEC A;  2Q93 A;  5JI6 A;  1WKM A;  4U6W A;  1O0X A;  1PV9 A;  4RGZ 1;  1JAW A;  5CIK A;  1BN5 A;  4IKR A;  2BWX A;  1CHM A;  2OKN A;  4FLJ A;  4U70 A;  4U71 A;  4QR8 A;  2GGC A;  2IW2 A;  1QXZ A;  3IG4 A;  1A16 A;  2HOW A;  2ZSG A;  4IKU A;  5D6F A;  4FLI A;  2BHC A;  2GG0 A;  4U6E A;  2P98 A;  2NQ6 A;  2MAT A;  2Q94 A;  3CTZ A;  3FM3 A;  4S01 A;  2V6C A;  3PKB A;  4IPA A;  3D27 A;  1YW9 A;  4S00 A;  2Q95 A;  1BOA A;  2GG5 A;  4IF7 A;  3PKD A;  1WLR A;  1B59 A;  2EVC A;  3CB6 A;  2GU5 A;  3FMQ A;  3BIP A;  5E5B A;  4U1B A;  1Y1N A;  1N51 A;  2BWT A;  2GG2 A;  1XGM A;  4ZNG A;  2BWW A;  3TAV A;  1C21 A;  5FCF A;  1KQ9 A;  2GU6 A;  4RZY A;  4PNC A;  5CNX A;  1W7V A;  2GGB A;  1WY2 A;  3PKE A;  4HXX A;  2P9A A;  2B3L A;  2GG8 A;  4ZWU A;  2GG9 A;  3PKC A;  1XGO A;  2EA2 A;  2BWV A;  2G6P A;  2P99 A;  1R58 A;  3IU7 A;  4ZWP A;  5CDE A;  4IKS A;  1YW8 A;  2GG7 A;  2V3Y A;  4MAT A; 
#chains in the Genus database with same CATH homology
 2ADU A;  2BHA A;  2GG3 A;  3IU9 A;  2BHD A;  2BHB A;  3IU8 A;  2EA4 A;  1KQ0 A;  4IDY A;  1C24 A;  1C23 A;  2BWY A;  5CDV A;  1WN1 A;  4EGE A;  5JFR A;  5FCH A;  1XGN A;  4S2R P;  4U73 A;  3MR1 A;  4KM3 A;  2V3Z A;  4FO8 A;  1WBQ A;  2BWU A;  5CDL A;  5JHU A;  1WL6 A;  4OOK A;  2Q92 A;  2V3X A;  4U6Z A;  1XGS A;  2DFI A;  1WL9 A;  2GU7 A;  1B6A A;  1M35 A;  4IU6 A;  2GA2 A;  4FO7 A;  3CB5 A;  1QXW A;  5CLS A;  1W2M A;  3MX6 A;  3PKA A;  4FLK A;  4U6C A;  2Q96 A;  2B3H A;  4IKT A;  1C22 A;  1MAT A;  1XNZ A;  2GZ5 A;  3BIQ A;  3L24 A;  2Q8K A;  2BH3 A;  2OAZ A;  1QZY A;  2EVM A;  3FMR A;  1R5G A;  3BIT A;  4R60 A;  4U69 A;  4FKC A;  3ROR A;  2GU4 A;  5D6E A;  4A6W A;  3S6B A;  4PV4 A;  1KP0 A;  2EVO A;  4JUQ A;  5CE6 A;  3L7G A;  2BWS A;  2BN7 A;  4A6V A;  3Q6D A;  4S2T P;  1QXY A;  4FUK A;  1YW7 A;  4Z7M A;  2NQ7 A;  3TB5 A;  4U6J A;  2BB7 A;  4U75 A;  3RVA A;  1YJ3 A;  4RZZ A;  2GTX A;  1R5H A;  4B28 A;  4U76 A;  2B3K A;  1C27 A;  4ZWO A;  4FLL A;  3MAT A;  1YVM A;  4IEC A;  2Q93 A;  5JI6 A;  1WKM A;  4U6W A;  1O0X A;  1PV9 A;  4RGZ 1;  1JAW A;  5CIK A;  1BN5 A;  4IKR A;  2BWX A;  1CHM A;  2OKN A;  4FLJ A;  4U70 A;  4U71 A;  4QR8 A;  2GGC A;  2IW2 A;  1QXZ A;  3IG4 A;  1A16 A;  2HOW A;  2ZSG A;  4IKU A;  5D6F A;  4FLI A;  2BHC A;  2GG0 A;  4U6E A;  2P98 A;  2NQ6 A;  2MAT A;  2Q94 A;  3CTZ A;  3FM3 A;  4S01 A;  2V6C A;  3PKB A;  4IPA A;  3D27 A;  1YW9 A;  4S00 A;  2Q95 A;  1BOA A;  2GG5 A;  4IF7 A;  3PKD A;  1WLR A;  1B59 A;  2EVC A;  3CB6 A;  2GU5 A;  3FMQ A;  3BIP A;  5E5B A;  4U1B A;  1Y1N A;  1N51 A;  2BWT A;  2GG2 A;  1XGM A;  4ZNG A;  2BWW A;  3TAV A;  1C21 A;  5FCF A;  1KQ9 A;  2GU6 A;  4RZY A;  4PNC A;  5CNX A;  1W7V A;  2GGB A;  1WY2 A;  3PKE A;  4HXX A;  2P9A A;  2B3L A;  2GG8 A;  4ZWU A;  2GG9 A;  3PKC A;  1XGO A;  2EA2 A;  2BWV A;  2G6P A;  2P99 A;  1R58 A;  3IU7 A;  4ZWP A;  5CDE A;  4IKS A;  1YW8 A;  2GG7 A;  2V3Y A;  4MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...