4JUQA

Pseudomonas aeruginosa metap t2n mutant, in mn form
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
258
structure length
258
Chain Sequence
NVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 79
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4juqA00
3FMQA 1WKMA 4MATA 1QXZA 4FO8A 4U6CA 4FLKA 3TAVA 3PKBA 2P99A 2Q8KA 5CLSA 2GG2A 3L24A 4ZNGA 1YW9A 2BWVA 2GA2A 2V3YA 4IKUA 2GU4A 1YVMA 2EVCA 1QXWA 4RZYA 2GU5A 4U71A 5JI6A 4KM3A 1WN1A 1A16A 4S2TP 2BHDA 2B3KA 2GGBA 2BHAA 1N51A 2BB7A 2BWUA 2GG5A 3IU9A 3PKAA 5D6EA 4IKSA 4FKCA 3D27A 5D6FA 1MATA 4IU6A 2BWSA 4IPAA 4Z7MA 1YW7A 2OAZA 4FO7A 3CTZA 4IECA 1R5GA 3CB5A 1QZYA 4ZWOA 1C23A 3MX6A 4U6JA 4U6WA 4ZWPA 3BIQA 2GGCA 5CDLA 4FLLA 3BITA 4S01A 2EA4A 2EVOA 4FUKA 2BHCA 1C21A 4U6ZA 1O0XA 2NQ6A 3CB6A 4PNCA 2BHBA 4IDYA 4FLIA 4S00A 2NQ7A 1WLRA 1PV9A 3PKEA 1WBQA 2GU7A 3MR1A 2GG8A 1M35A 1WY2A 1C27A 2G6PA 1R5HA 4A6WA 3FM3A 5CE6A 4U69A 2P9AA 1JAWA 2GG3A 2BWTA 2V3XA 3L7GA 4IKTA 1B59A 2OKNA 4IKRA 4RZZA 4U76A 4U70A 1C22A 5CDEA 4OOKA 2BWXA 2V3ZA 1KQ0A 3BIPA 4FLJA 1XGMA 1W2MA 1Y1NA 1BOAA 3IU7A 4U6EA 1WL9A 4EGEA 1XGSA 2GTXA 4U75A 4B28A 3Q6DA 2P98A 2EVMA 1XGOA 2V6CA 3PKDA 4RGZ1 4A6VA 2IW2A 3MATA 1R58A 2GG7A 4U1BA 3IG4A 3S6BA 5JFRA 2Q96A 5FCHA 5FCFA 1B6AA 5CDVA 5CNXA 2GZ5A 4ZWUA 1XGNA 2GG9A 3IU8A 4R60A 4U73A 1BN5A 2BWYA 4IF7A 1W7VA 2Q93A 1KP0A 4S2RP 1QXYA 2DFIA 1C24A 3RVAA 1WL6A 4QR8A 2BWWA 2Q92A 1CHMA 2BN7A 1YW8A 2MATA 2B3HA 5CIKA 5E5BA 2GU6A 2B3LA 3PKCA 1XNZA 2ADUA 2ZSGA 5JHUA 3FMRA 4JUQA 2BH3A 1YJ3A 4PV4A 4HXXA 2GG0A 1KQ9A 2EA2A 2Q94A 3TB5A 2Q95A 2HOWA 3RORA
chains in the Genus database with same CATH superfamily
3FMQA 1WKMA 4MATA 1QXZA 4FO8A 4U6CA 4FLKA 3TAVA 3PKBA 2P99A 2Q8KA 5CLSA 2GG2A 3L24A 4ZNGA 1YW9A 2BWVA 2GA2A 2V3YA 4IKUA 2GU4A 1YVMA 2EVCA 1QXWA 4RZYA 2GU5A 4U71A 5JI6A 4KM3A 1WN1A 1A16A 4S2TP 2BHDA 2B3KA 2GGBA 2BHAA 1N51A 2BB7A 2BWUA 2GG5A 3IU9A 3PKAA 5D6EA 4IKSA 4FKCA 3D27A 5D6FA 1MATA 4IU6A 2BWSA 4IPAA 4Z7MA 1YW7A 2OAZA 4FO7A 3CTZA 4IECA 1R5GA 3CB5A 1QZYA 4ZWOA 1C23A 3MX6A 4U6JA 4U6WA 4ZWPA 3BIQA 2GGCA 5CDLA 4FLLA 3BITA 4S01A 2EA4A 2EVOA 4FUKA 2BHCA 1C21A 4U6ZA 1O0XA 2NQ6A 3CB6A 4PNCA 2BHBA 4IDYA 4FLIA 4S00A 2NQ7A 1WLRA 1PV9A 3PKEA 1WBQA 2GU7A 3MR1A 2GG8A 1M35A 1WY2A 1C27A 2G6PA 1R5HA 4A6WA 3FM3A 5CE6A 4U69A 2P9AA 1JAWA 2GG3A 2BWTA 2V3XA 3L7GA 4IKTA 1B59A 2OKNA 4IKRA 4RZZA 4U76A 4U70A 1C22A 5CDEA 4OOKA 2BWXA 2V3ZA 1KQ0A 3BIPA 4FLJA 1XGMA 1W2MA 1Y1NA 1BOAA 3IU7A 4U6EA 1WL9A 4EGEA 1XGSA 2GTXA 4U75A 4B28A 3Q6DA 2P98A 2EVMA 1XGOA 2V6CA 3PKDA 4RGZ1 4A6VA 2IW2A 3MATA 1R58A 2GG7A 4U1BA 3IG4A 3S6BA 5JFRA 2Q96A 5FCHA 5FCFA 1B6AA 5CDVA 5CNXA 2GZ5A 4ZWUA 1XGNA 2GG9A 3IU8A 4R60A 4U73A 1BN5A 2BWYA 4IF7A 1W7VA 2Q93A 1KP0A 4S2RP 1QXYA 2DFIA 1C24A 3RVAA 1WL6A 4QR8A 2BWWA 2Q92A 1CHMA 2BN7A 1YW8A 2MATA 2B3HA 5CIKA 5E5BA 2GU6A 2B3LA 3PKCA 1XNZA 2ADUA 2ZSGA 5JHUA 3FMRA 4JUQA 2BH3A 1YJ3A 4PV4A 4HXXA 2GG0A 1KQ9A 2EA2A 2Q94A 3TB5A 2Q95A 2HOWA 3RORA
chains in the Genus database with same CATH topology
3FMQA 1WKMA 4MATA 1QXZA 4FO8A 4U6CA 4FLKA 3TAVA 3PKBA 2P99A 2Q8KA 5CLSA 2GG2A 3L24A 4ZNGA 1YW9A 2BWVA 2GA2A 2V3YA 4IKUA 2GU4A 1YVMA 2EVCA 1QXWA 4RZYA 2GU5A 4U71A 5JI6A 4KM3A 1WN1A 1A16A 4S2TP 2BHDA 2B3KA 2GGBA 2BHAA 1N51A 2BB7A 2BWUA 2GG5A 3IU9A 3PKAA 5D6EA 4IKSA 4FKCA 3D27A 5D6FA 1MATA 4IU6A 2BWSA 4IPAA 4Z7MA 1YW7A 2OAZA 4FO7A 3CTZA 4IECA 1R5GA 3CB5A 1QZYA 4ZWOA 1C23A 3MX6A 4U6JA 4U6WA 4ZWPA 3BIQA 2GGCA 5CDLA 4FLLA 3BITA 4S01A 2EA4A 2EVOA 4FUKA 2BHCA 1C21A 4U6ZA 1O0XA 2NQ6A 3CB6A 4PNCA 2BHBA 4IDYA 4FLIA 4S00A 2NQ7A 1WLRA 1PV9A 3PKEA 1WBQA 2GU7A 3MR1A 2GG8A 1M35A 1WY2A 1C27A 2G6PA 1R5HA 4A6WA 3FM3A 5CE6A 4U69A 2P9AA 1JAWA 2GG3A 2BWTA 2V3XA 3L7GA 4IKTA 1B59A 2OKNA 4IKRA 4RZZA 4U76A 4U70A 1C22A 5CDEA 4OOKA 2BWXA 2V3ZA 1KQ0A 3BIPA 4FLJA 1XGMA 1W2MA 1Y1NA 1BOAA 3IU7A 4U6EA 1WL9A 4EGEA 1XGSA 2GTXA 4U75A 4B28A 3Q6DA 2P98A 2EVMA 1XGOA 2V6CA 3PKDA 4RGZ1 4A6VA 2IW2A 3MATA 1R58A 2GG7A 4U1BA 3IG4A 3S6BA 5JFRA 2Q96A 5FCHA 5FCFA 1B6AA 5CDVA 5CNXA 2GZ5A 4ZWUA 1XGNA 2GG9A 3IU8A 4R60A 4U73A 1BN5A 2BWYA 4IF7A 1W7VA 2Q93A 1KP0A 4S2RP 1QXYA 2DFIA 1C24A 3RVAA 1WL6A 4QR8A 2BWWA 2Q92A 1CHMA 2BN7A 1YW8A 2MATA 2B3HA 5CIKA 5E5BA 2GU6A 2B3LA 3PKCA 1XNZA 2ADUA 2ZSGA 5JHUA 3FMRA 4JUQA 2BH3A 1YJ3A 4PV4A 4HXXA 2GG0A 1KQ9A 2EA2A 2Q94A 3TB5A 2Q95A 2HOWA 3RORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMQ A;  1WKM A;  4MAT A;  1QXZ A;  4FO8 A;  4U6C A;  4FLK A;  3TAV A;  3PKB A;  2P99 A;  2Q8K A;  5CLS A;  2GG2 A;  3L24 A;  4ZNG A;  1YW9 A;  2BWV A;  2GA2 A;  2V3Y A;  4IKU A;  2GU4 A;  1YVM A;  2EVC A;  1QXW A;  4RZY A;  2GU5 A;  4U71 A;  5JI6 A;  4KM3 A;  1WN1 A;  1A16 A;  4S2T P;  2BHD A;  2B3K A;  2GGB A;  2BHA A;  1N51 A;  2BB7 A;  2BWU A;  2GG5 A;  3IU9 A;  3PKA A;  5D6E A;  4IKS A;  4FKC A;  3D27 A;  5D6F A;  1MAT A;  4IU6 A;  2BWS A;  4IPA A;  4Z7M A;  1YW7 A;  2OAZ A;  4FO7 A;  3CTZ A;  4IEC A;  1R5G A;  3CB5 A;  1QZY A;  4ZWO A;  1C23 A;  3MX6 A;  4U6J A;  4U6W A;  4ZWP A;  3BIQ A;  2GGC A;  5CDL A;  4FLL A;  3BIT A;  4S01 A;  2EA4 A;  2EVO A;  4FUK A;  2BHC A;  1C21 A;  4U6Z A;  1O0X A;  2NQ6 A;  3CB6 A;  4PNC A;  2BHB A;  4IDY A;  4FLI A;  4S00 A;  2NQ7 A;  1WLR A;  1PV9 A;  3PKE A;  1WBQ A;  2GU7 A;  3MR1 A;  2GG8 A;  1M35 A;  1WY2 A;  1C27 A;  2G6P A;  1R5H A;  4A6W A;  3FM3 A;  5CE6 A;  4U69 A;  2P9A A;  1JAW A;  2GG3 A;  2BWT A;  2V3X A;  3L7G A;  4IKT A;  1B59 A;  2OKN A;  4IKR A;  4RZZ A;  4U76 A;  4U70 A;  1C22 A;  5CDE A;  4OOK A;  2BWX A;  2V3Z A;  1KQ0 A;  3BIP A;  4FLJ A;  1XGM A;  1W2M A;  1Y1N A;  1BOA A;  3IU7 A;  4U6E A;  1WL9 A;  4EGE A;  1XGS A;  2GTX A;  4U75 A;  4B28 A;  3Q6D A;  2P98 A;  2EVM A;  1XGO A;  2V6C A;  3PKD A;  4RGZ 1;  4A6V A;  2IW2 A;  3MAT A;  1R58 A;  2GG7 A;  4U1B A;  3IG4 A;  3S6B A;  5JFR A;  2Q96 A;  5FCH A;  5FCF A;  1B6A A;  5CDV A;  5CNX A;  2GZ5 A;  4ZWU A;  1XGN A;  2GG9 A;  3IU8 A;  4R60 A;  4U73 A;  1BN5 A;  2BWY A;  4IF7 A;  1W7V A;  2Q93 A;  1KP0 A;  4S2R P;  1QXY A;  2DFI A;  1C24 A;  3RVA A;  1WL6 A;  4QR8 A;  2BWW A;  2Q92 A;  1CHM A;  2BN7 A;  1YW8 A;  2MAT A;  2B3H A;  5CIK A;  5E5B A;  2GU6 A;  2B3L A;  3PKC A;  1XNZ A;  2ADU A;  2ZSG A;  5JHU A;  3FMR A;  4JUQ A;  2BH3 A;  1YJ3 A;  4PV4 A;  4HXX A;  2GG0 A;  1KQ9 A;  2EA2 A;  2Q94 A;  3TB5 A;  2Q95 A;  2HOW A;  3ROR A; 
#chains in the Genus database with same CATH topology
 3FMQ A;  1WKM A;  4MAT A;  1QXZ A;  4FO8 A;  4U6C A;  4FLK A;  3TAV A;  3PKB A;  2P99 A;  2Q8K A;  5CLS A;  2GG2 A;  3L24 A;  4ZNG A;  1YW9 A;  2BWV A;  2GA2 A;  2V3Y A;  4IKU A;  2GU4 A;  1YVM A;  2EVC A;  1QXW A;  4RZY A;  2GU5 A;  4U71 A;  5JI6 A;  4KM3 A;  1WN1 A;  1A16 A;  4S2T P;  2BHD A;  2B3K A;  2GGB A;  2BHA A;  1N51 A;  2BB7 A;  2BWU A;  2GG5 A;  3IU9 A;  3PKA A;  5D6E A;  4IKS A;  4FKC A;  3D27 A;  5D6F A;  1MAT A;  4IU6 A;  2BWS A;  4IPA A;  4Z7M A;  1YW7 A;  2OAZ A;  4FO7 A;  3CTZ A;  4IEC A;  1R5G A;  3CB5 A;  1QZY A;  4ZWO A;  1C23 A;  3MX6 A;  4U6J A;  4U6W A;  4ZWP A;  3BIQ A;  2GGC A;  5CDL A;  4FLL A;  3BIT A;  4S01 A;  2EA4 A;  2EVO A;  4FUK A;  2BHC A;  1C21 A;  4U6Z A;  1O0X A;  2NQ6 A;  3CB6 A;  4PNC A;  2BHB A;  4IDY A;  4FLI A;  4S00 A;  2NQ7 A;  1WLR A;  1PV9 A;  3PKE A;  1WBQ A;  2GU7 A;  3MR1 A;  2GG8 A;  1M35 A;  1WY2 A;  1C27 A;  2G6P A;  1R5H A;  4A6W A;  3FM3 A;  5CE6 A;  4U69 A;  2P9A A;  1JAW A;  2GG3 A;  2BWT A;  2V3X A;  3L7G A;  4IKT A;  1B59 A;  2OKN A;  4IKR A;  4RZZ A;  4U76 A;  4U70 A;  1C22 A;  5CDE A;  4OOK A;  2BWX A;  2V3Z A;  1KQ0 A;  3BIP A;  4FLJ A;  1XGM A;  1W2M A;  1Y1N A;  1BOA A;  3IU7 A;  4U6E A;  1WL9 A;  4EGE A;  1XGS A;  2GTX A;  4U75 A;  4B28 A;  3Q6D A;  2P98 A;  2EVM A;  1XGO A;  2V6C A;  3PKD A;  4RGZ 1;  4A6V A;  2IW2 A;  3MAT A;  1R58 A;  2GG7 A;  4U1B A;  3IG4 A;  3S6B A;  5JFR A;  2Q96 A;  5FCH A;  5FCF A;  1B6A A;  5CDV A;  5CNX A;  2GZ5 A;  4ZWU A;  1XGN A;  2GG9 A;  3IU8 A;  4R60 A;  4U73 A;  1BN5 A;  2BWY A;  4IF7 A;  1W7V A;  2Q93 A;  1KP0 A;  4S2R P;  1QXY A;  2DFI A;  1C24 A;  3RVA A;  1WL6 A;  4QR8 A;  2BWW A;  2Q92 A;  1CHM A;  2BN7 A;  1YW8 A;  2MAT A;  2B3H A;  5CIK A;  5E5B A;  2GU6 A;  2B3L A;  3PKC A;  1XNZ A;  2ADU A;  2ZSG A;  5JHU A;  3FMR A;  4JUQ A;  2BH3 A;  1YJ3 A;  4PV4 A;  4HXX A;  2GG0 A;  1KQ9 A;  2EA2 A;  2Q94 A;  3TB5 A;  2Q95 A;  2HOW A;  3ROR A; 
#chains in the Genus database with same CATH homology
 3FMQ A;  1WKM A;  4MAT A;  1QXZ A;  4FO8 A;  4U6C A;  4FLK A;  3TAV A;  3PKB A;  2P99 A;  2Q8K A;  5CLS A;  2GG2 A;  3L24 A;  4ZNG A;  1YW9 A;  2BWV A;  2GA2 A;  2V3Y A;  4IKU A;  2GU4 A;  1YVM A;  2EVC A;  1QXW A;  4RZY A;  2GU5 A;  4U71 A;  5JI6 A;  4KM3 A;  1WN1 A;  1A16 A;  4S2T P;  2BHD A;  2B3K A;  2GGB A;  2BHA A;  1N51 A;  2BB7 A;  2BWU A;  2GG5 A;  3IU9 A;  3PKA A;  5D6E A;  4IKS A;  4FKC A;  3D27 A;  5D6F A;  1MAT A;  4IU6 A;  2BWS A;  4IPA A;  4Z7M A;  1YW7 A;  2OAZ A;  4FO7 A;  3CTZ A;  4IEC A;  1R5G A;  3CB5 A;  1QZY A;  4ZWO A;  1C23 A;  3MX6 A;  4U6J A;  4U6W A;  4ZWP A;  3BIQ A;  2GGC A;  5CDL A;  4FLL A;  3BIT A;  4S01 A;  2EA4 A;  2EVO A;  4FUK A;  2BHC A;  1C21 A;  4U6Z A;  1O0X A;  2NQ6 A;  3CB6 A;  4PNC A;  2BHB A;  4IDY A;  4FLI A;  4S00 A;  2NQ7 A;  1WLR A;  1PV9 A;  3PKE A;  1WBQ A;  2GU7 A;  3MR1 A;  2GG8 A;  1M35 A;  1WY2 A;  1C27 A;  2G6P A;  1R5H A;  4A6W A;  3FM3 A;  5CE6 A;  4U69 A;  2P9A A;  1JAW A;  2GG3 A;  2BWT A;  2V3X A;  3L7G A;  4IKT A;  1B59 A;  2OKN A;  4IKR A;  4RZZ A;  4U76 A;  4U70 A;  1C22 A;  5CDE A;  4OOK A;  2BWX A;  2V3Z A;  1KQ0 A;  3BIP A;  4FLJ A;  1XGM A;  1W2M A;  1Y1N A;  1BOA A;  3IU7 A;  4U6E A;  1WL9 A;  4EGE A;  1XGS A;  2GTX A;  4U75 A;  4B28 A;  3Q6D A;  2P98 A;  2EVM A;  1XGO A;  2V6C A;  3PKD A;  4RGZ 1;  4A6V A;  2IW2 A;  3MAT A;  1R58 A;  2GG7 A;  4U1B A;  3IG4 A;  3S6B A;  5JFR A;  2Q96 A;  5FCH A;  5FCF A;  1B6A A;  5CDV A;  5CNX A;  2GZ5 A;  4ZWU A;  1XGN A;  2GG9 A;  3IU8 A;  4R60 A;  4U73 A;  1BN5 A;  2BWY A;  4IF7 A;  1W7V A;  2Q93 A;  1KP0 A;  4S2R P;  1QXY A;  2DFI A;  1C24 A;  3RVA A;  1WL6 A;  4QR8 A;  2BWW A;  2Q92 A;  1CHM A;  2BN7 A;  1YW8 A;  2MAT A;  2B3H A;  5CIK A;  5E5B A;  2GU6 A;  2B3L A;  3PKC A;  1XNZ A;  2ADU A;  2ZSG A;  5JHU A;  3FMR A;  4JUQ A;  2BH3 A;  1YJ3 A;  4PV4 A;  4HXX A;  2GG0 A;  1KQ9 A;  2EA2 A;  2Q94 A;  3TB5 A;  2Q95 A;  2HOW A;  3ROR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...