4JUQA

Pseudomonas aeruginosa metap t2n mutant, in mn form
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
258
structure length
258
Chain Sequence
b'NVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 79
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4juqA00
2B3HA 1YJ3A 2EA4A 3PKAA 2V3ZA 5JFRA 3TAVA 4IDYA 3IU8A 4IU6A 4PNCA 5D6FA 1YVMA 1C24A 2GU4A 1C22A 4RZZA 5D6EA 5CDLA 4IKSA 1YW9A 2NQ6A 5CE6A 2V3YA 1WKMA 1XGNA 2BWTA 1KP0A 2BWYA 3RVAA 4IKTA 2NQ7A 2BHAA 1W7VA 4IPAA 3MX6A 4JUQA 4U6JA 2ZSGA 1QXYA 5JI6A 2GGBA 2BWSA 1BN5A 5CDEA 2GU6A 2V3XA 2IW2A 2GGCA 2Q95A 2GG2A 3IU7A 3L7GA 4U69A 4FLIA 1KQ0A 3PKBA 2BH3A 2BWVA 3FM3A 3CB6A 3PKCA 1XGOA 1A16A 3D27A 4IECA 4U6CA 5E5BA 4EGEA 1R5GA 2GG0A 2BWXA 4B28A 4U76A 3BIQA 4S2RP 4IF7A 4U71A 5FCHA 2Q93A 2BN7A 4R60A 2EVMA 1JAWA 3FMRA 5FCFA 3CTZA 3MATA 1WL9A 1XNZA 4MATA 1WL6A 4ZNGA 1QXZA 1CHMA 1R58A 2P99A 2EVOA 2V6CA 3L24A 2Q96A 2OAZA 3PKEA 5CLSA 1WY2A 3IU9A 1C21A 4U73A 1B6AA 1B59A 1R5HA 3IG4A 2BWUA 1C27A 4U6ZA 4FLJA 2BB7A 2P98A 3BITA 2BHBA 1BOAA 2GG3A 4ZWUA 1YW8A 1QXWA 1WLRA 4U6EA 2GU7A 2B3LA 2OKNA 2GA2A 2Q92A 4RZYA 4U70A 1Y1NA 4A6VA 4S2TP 5CNXA 2GG8A 2GZ5A 3S6BA 4FLLA 2EA2A 1M35A 3MR1A 4S00A 3CB5A 2BHDA 4FO8A 1O0XA 2GG9A 2GG7A 4PV4A 4ZWOA 2B3KA 4IKRA 2MATA 1C23A 4KM3A 3Q6DA 1KQ9A 2EVCA 3BIPA 5CDVA 4FO7A 1MATA 5JHUA 1N51A 1YW7A 4FKCA 1PV9A 3RORA 1WN1A 2GU5A 2ADUA 2GG5A 4U75A 2Q94A 2G6PA 2DFIA 4HXXA 3TB5A 2Q8KA 4A6WA 4U6WA 2GTXA 2P9AA 4QR8A 2BWWA 1W2MA 4Z7MA 4RGZ1 2HOWA 4S01A 1WBQA 1XGSA 3PKDA 4ZWPA 2BHCA 4FLKA 4FUKA 1XGMA 3FMQA 1QZYA 4OOKA 4U1BA 4IKUA 5CIKA
chains in the Genus database with same CATH superfamily
2B3HA 1YJ3A 2EA4A 3PKAA 2V3ZA 5JFRA 3TAVA 4IDYA 3IU8A 4IU6A 4PNCA 5D6FA 1YVMA 1C24A 2GU4A 1C22A 4RZZA 5D6EA 5CDLA 4IKSA 1YW9A 2NQ6A 5CE6A 2V3YA 1WKMA 1XGNA 2BWTA 1KP0A 2BWYA 3RVAA 4IKTA 2NQ7A 2BHAA 1W7VA 4IPAA 3MX6A 4JUQA 4U6JA 2ZSGA 1QXYA 5JI6A 2GGBA 2BWSA 1BN5A 5CDEA 2GU6A 2V3XA 2IW2A 2GGCA 2Q95A 2GG2A 3IU7A 3L7GA 4U69A 4FLIA 1KQ0A 3PKBA 2BH3A 2BWVA 3FM3A 3CB6A 3PKCA 1XGOA 1A16A 3D27A 4IECA 4U6CA 5E5BA 4EGEA 1R5GA 2GG0A 2BWXA 4B28A 4U76A 3BIQA 4S2RP 4IF7A 4U71A 5FCHA 2Q93A 2BN7A 4R60A 2EVMA 1JAWA 3FMRA 5FCFA 3CTZA 3MATA 1WL9A 1XNZA 4MATA 1WL6A 4ZNGA 1QXZA 1CHMA 1R58A 2P99A 2EVOA 2V6CA 3L24A 2Q96A 2OAZA 3PKEA 5CLSA 1WY2A 3IU9A 1C21A 4U73A 1B6AA 1B59A 1R5HA 3IG4A 2BWUA 1C27A 4U6ZA 4FLJA 2BB7A 2P98A 3BITA 2BHBA 1BOAA 2GG3A 4ZWUA 1YW8A 1QXWA 1WLRA 4U6EA 2GU7A 2B3LA 2OKNA 2GA2A 2Q92A 4RZYA 4U70A 1Y1NA 4A6VA 4S2TP 5CNXA 2GG8A 2GZ5A 3S6BA 4FLLA 2EA2A 1M35A 3MR1A 4S00A 3CB5A 2BHDA 4FO8A 1O0XA 2GG9A 2GG7A 4PV4A 4ZWOA 2B3KA 4IKRA 2MATA 1C23A 4KM3A 3Q6DA 1KQ9A 2EVCA 3BIPA 5CDVA 4FO7A 1MATA 5JHUA 1N51A 1YW7A 4FKCA 1PV9A 3RORA 1WN1A 2GU5A 2ADUA 2GG5A 4U75A 2Q94A 2G6PA 2DFIA 4HXXA 3TB5A 2Q8KA 4A6WA 4U6WA 2GTXA 2P9AA 4QR8A 2BWWA 1W2MA 4Z7MA 4RGZ1 2HOWA 4S01A 1WBQA 1XGSA 3PKDA 4ZWPA 2BHCA 4FLKA 4FUKA 1XGMA 3FMQA 1QZYA 4OOKA 4U1BA 4IKUA 5CIKA
chains in the Genus database with same CATH topology
2B3HA 1YJ3A 2EA4A 3PKAA 2V3ZA 5JFRA 3TAVA 4IDYA 3IU8A 4IU6A 4PNCA 5D6FA 1YVMA 1C24A 2GU4A 1C22A 4RZZA 5D6EA 5CDLA 4IKSA 1YW9A 2NQ6A 5CE6A 2V3YA 1WKMA 1XGNA 2BWTA 1KP0A 2BWYA 3RVAA 4IKTA 2NQ7A 2BHAA 1W7VA 4IPAA 3MX6A 4JUQA 4U6JA 2ZSGA 1QXYA 5JI6A 2GGBA 2BWSA 1BN5A 5CDEA 2GU6A 2V3XA 2IW2A 2GGCA 2Q95A 2GG2A 3IU7A 3L7GA 4U69A 4FLIA 1KQ0A 3PKBA 2BH3A 2BWVA 3FM3A 3CB6A 3PKCA 1XGOA 1A16A 3D27A 4IECA 4U6CA 5E5BA 4EGEA 1R5GA 2GG0A 2BWXA 4B28A 4U76A 3BIQA 4S2RP 4IF7A 4U71A 5FCHA 2Q93A 2BN7A 4R60A 2EVMA 1JAWA 3FMRA 5FCFA 3CTZA 3MATA 1WL9A 1XNZA 4MATA 1WL6A 4ZNGA 1QXZA 1CHMA 1R58A 2P99A 2EVOA 2V6CA 3L24A 2Q96A 2OAZA 3PKEA 5CLSA 1WY2A 3IU9A 1C21A 4U73A 1B6AA 1B59A 1R5HA 3IG4A 2BWUA 1C27A 4U6ZA 4FLJA 2BB7A 2P98A 3BITA 2BHBA 1BOAA 2GG3A 4ZWUA 1YW8A 1QXWA 1WLRA 4U6EA 2GU7A 2B3LA 2OKNA 2GA2A 2Q92A 4RZYA 4U70A 1Y1NA 4A6VA 4S2TP 5CNXA 2GG8A 2GZ5A 3S6BA 4FLLA 2EA2A 1M35A 3MR1A 4S00A 3CB5A 2BHDA 4FO8A 1O0XA 2GG9A 2GG7A 4PV4A 4ZWOA 2B3KA 4IKRA 2MATA 1C23A 4KM3A 3Q6DA 1KQ9A 2EVCA 3BIPA 5CDVA 4FO7A 1MATA 5JHUA 1N51A 1YW7A 4FKCA 1PV9A 3RORA 1WN1A 2GU5A 2ADUA 2GG5A 4U75A 2Q94A 2G6PA 2DFIA 4HXXA 3TB5A 2Q8KA 4A6WA 4U6WA 2GTXA 2P9AA 4QR8A 2BWWA 1W2MA 4Z7MA 4RGZ1 2HOWA 4S01A 1WBQA 1XGSA 3PKDA 4ZWPA 2BHCA 4FLKA 4FUKA 1XGMA 3FMQA 1QZYA 4OOKA 4U1BA 4IKUA 5CIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3H A;  1YJ3 A;  2EA4 A;  3PKA A;  2V3Z A;  5JFR A;  3TAV A;  4IDY A;  3IU8 A;  4IU6 A;  4PNC A;  5D6F A;  1YVM A;  1C24 A;  2GU4 A;  1C22 A;  4RZZ A;  5D6E A;  5CDL A;  4IKS A;  1YW9 A;  2NQ6 A;  5CE6 A;  2V3Y A;  1WKM A;  1XGN A;  2BWT A;  1KP0 A;  2BWY A;  3RVA A;  4IKT A;  2NQ7 A;  2BHA A;  1W7V A;  4IPA A;  3MX6 A;  4JUQ A;  4U6J A;  2ZSG A;  1QXY A;  5JI6 A;  2GGB A;  2BWS A;  1BN5 A;  5CDE A;  2GU6 A;  2V3X A;  2IW2 A;  2GGC A;  2Q95 A;  2GG2 A;  3IU7 A;  3L7G A;  4U69 A;  4FLI A;  1KQ0 A;  3PKB A;  2BH3 A;  2BWV A;  3FM3 A;  3CB6 A;  3PKC A;  1XGO A;  1A16 A;  3D27 A;  4IEC A;  4U6C A;  5E5B A;  4EGE A;  1R5G A;  2GG0 A;  2BWX A;  4B28 A;  4U76 A;  3BIQ A;  4S2R P;  4IF7 A;  4U71 A;  5FCH A;  2Q93 A;  2BN7 A;  4R60 A;  2EVM A;  1JAW A;  3FMR A;  5FCF A;  3CTZ A;  3MAT A;  1WL9 A;  1XNZ A;  4MAT A;  1WL6 A;  4ZNG A;  1QXZ A;  1CHM A;  1R58 A;  2P99 A;  2EVO A;  2V6C A;  3L24 A;  2Q96 A;  2OAZ A;  3PKE A;  5CLS A;  1WY2 A;  3IU9 A;  1C21 A;  4U73 A;  1B6A A;  1B59 A;  1R5H A;  3IG4 A;  2BWU A;  1C27 A;  4U6Z A;  4FLJ A;  2BB7 A;  2P98 A;  3BIT A;  2BHB A;  1BOA A;  2GG3 A;  4ZWU A;  1YW8 A;  1QXW A;  1WLR A;  4U6E A;  2GU7 A;  2B3L A;  2OKN A;  2GA2 A;  2Q92 A;  4RZY A;  4U70 A;  1Y1N A;  4A6V A;  4S2T P;  5CNX A;  2GG8 A;  2GZ5 A;  3S6B A;  4FLL A;  2EA2 A;  1M35 A;  3MR1 A;  4S00 A;  3CB5 A;  2BHD A;  4FO8 A;  1O0X A;  2GG9 A;  2GG7 A;  4PV4 A;  4ZWO A;  2B3K A;  4IKR A;  2MAT A;  1C23 A;  4KM3 A;  3Q6D A;  1KQ9 A;  2EVC A;  3BIP A;  5CDV A;  4FO7 A;  1MAT A;  5JHU A;  1N51 A;  1YW7 A;  4FKC A;  1PV9 A;  3ROR A;  1WN1 A;  2GU5 A;  2ADU A;  2GG5 A;  4U75 A;  2Q94 A;  2G6P A;  2DFI A;  4HXX A;  3TB5 A;  2Q8K A;  4A6W A;  4U6W A;  2GTX A;  2P9A A;  4QR8 A;  2BWW A;  1W2M A;  4Z7M A;  4RGZ 1;  2HOW A;  4S01 A;  1WBQ A;  1XGS A;  3PKD A;  4ZWP A;  2BHC A;  4FLK A;  4FUK A;  1XGM A;  3FMQ A;  1QZY A;  4OOK A;  4U1B A;  4IKU A;  5CIK A; 
#chains in the Genus database with same CATH topology
 2B3H A;  1YJ3 A;  2EA4 A;  3PKA A;  2V3Z A;  5JFR A;  3TAV A;  4IDY A;  3IU8 A;  4IU6 A;  4PNC A;  5D6F A;  1YVM A;  1C24 A;  2GU4 A;  1C22 A;  4RZZ A;  5D6E A;  5CDL A;  4IKS A;  1YW9 A;  2NQ6 A;  5CE6 A;  2V3Y A;  1WKM A;  1XGN A;  2BWT A;  1KP0 A;  2BWY A;  3RVA A;  4IKT A;  2NQ7 A;  2BHA A;  1W7V A;  4IPA A;  3MX6 A;  4JUQ A;  4U6J A;  2ZSG A;  1QXY A;  5JI6 A;  2GGB A;  2BWS A;  1BN5 A;  5CDE A;  2GU6 A;  2V3X A;  2IW2 A;  2GGC A;  2Q95 A;  2GG2 A;  3IU7 A;  3L7G A;  4U69 A;  4FLI A;  1KQ0 A;  3PKB A;  2BH3 A;  2BWV A;  3FM3 A;  3CB6 A;  3PKC A;  1XGO A;  1A16 A;  3D27 A;  4IEC A;  4U6C A;  5E5B A;  4EGE A;  1R5G A;  2GG0 A;  2BWX A;  4B28 A;  4U76 A;  3BIQ A;  4S2R P;  4IF7 A;  4U71 A;  5FCH A;  2Q93 A;  2BN7 A;  4R60 A;  2EVM A;  1JAW A;  3FMR A;  5FCF A;  3CTZ A;  3MAT A;  1WL9 A;  1XNZ A;  4MAT A;  1WL6 A;  4ZNG A;  1QXZ A;  1CHM A;  1R58 A;  2P99 A;  2EVO A;  2V6C A;  3L24 A;  2Q96 A;  2OAZ A;  3PKE A;  5CLS A;  1WY2 A;  3IU9 A;  1C21 A;  4U73 A;  1B6A A;  1B59 A;  1R5H A;  3IG4 A;  2BWU A;  1C27 A;  4U6Z A;  4FLJ A;  2BB7 A;  2P98 A;  3BIT A;  2BHB A;  1BOA A;  2GG3 A;  4ZWU A;  1YW8 A;  1QXW A;  1WLR A;  4U6E A;  2GU7 A;  2B3L A;  2OKN A;  2GA2 A;  2Q92 A;  4RZY A;  4U70 A;  1Y1N A;  4A6V A;  4S2T P;  5CNX A;  2GG8 A;  2GZ5 A;  3S6B A;  4FLL A;  2EA2 A;  1M35 A;  3MR1 A;  4S00 A;  3CB5 A;  2BHD A;  4FO8 A;  1O0X A;  2GG9 A;  2GG7 A;  4PV4 A;  4ZWO A;  2B3K A;  4IKR A;  2MAT A;  1C23 A;  4KM3 A;  3Q6D A;  1KQ9 A;  2EVC A;  3BIP A;  5CDV A;  4FO7 A;  1MAT A;  5JHU A;  1N51 A;  1YW7 A;  4FKC A;  1PV9 A;  3ROR A;  1WN1 A;  2GU5 A;  2ADU A;  2GG5 A;  4U75 A;  2Q94 A;  2G6P A;  2DFI A;  4HXX A;  3TB5 A;  2Q8K A;  4A6W A;  4U6W A;  2GTX A;  2P9A A;  4QR8 A;  2BWW A;  1W2M A;  4Z7M A;  4RGZ 1;  2HOW A;  4S01 A;  1WBQ A;  1XGS A;  3PKD A;  4ZWP A;  2BHC A;  4FLK A;  4FUK A;  1XGM A;  3FMQ A;  1QZY A;  4OOK A;  4U1B A;  4IKU A;  5CIK A; 
#chains in the Genus database with same CATH homology
 2B3H A;  1YJ3 A;  2EA4 A;  3PKA A;  2V3Z A;  5JFR A;  3TAV A;  4IDY A;  3IU8 A;  4IU6 A;  4PNC A;  5D6F A;  1YVM A;  1C24 A;  2GU4 A;  1C22 A;  4RZZ A;  5D6E A;  5CDL A;  4IKS A;  1YW9 A;  2NQ6 A;  5CE6 A;  2V3Y A;  1WKM A;  1XGN A;  2BWT A;  1KP0 A;  2BWY A;  3RVA A;  4IKT A;  2NQ7 A;  2BHA A;  1W7V A;  4IPA A;  3MX6 A;  4JUQ A;  4U6J A;  2ZSG A;  1QXY A;  5JI6 A;  2GGB A;  2BWS A;  1BN5 A;  5CDE A;  2GU6 A;  2V3X A;  2IW2 A;  2GGC A;  2Q95 A;  2GG2 A;  3IU7 A;  3L7G A;  4U69 A;  4FLI A;  1KQ0 A;  3PKB A;  2BH3 A;  2BWV A;  3FM3 A;  3CB6 A;  3PKC A;  1XGO A;  1A16 A;  3D27 A;  4IEC A;  4U6C A;  5E5B A;  4EGE A;  1R5G A;  2GG0 A;  2BWX A;  4B28 A;  4U76 A;  3BIQ A;  4S2R P;  4IF7 A;  4U71 A;  5FCH A;  2Q93 A;  2BN7 A;  4R60 A;  2EVM A;  1JAW A;  3FMR A;  5FCF A;  3CTZ A;  3MAT A;  1WL9 A;  1XNZ A;  4MAT A;  1WL6 A;  4ZNG A;  1QXZ A;  1CHM A;  1R58 A;  2P99 A;  2EVO A;  2V6C A;  3L24 A;  2Q96 A;  2OAZ A;  3PKE A;  5CLS A;  1WY2 A;  3IU9 A;  1C21 A;  4U73 A;  1B6A A;  1B59 A;  1R5H A;  3IG4 A;  2BWU A;  1C27 A;  4U6Z A;  4FLJ A;  2BB7 A;  2P98 A;  3BIT A;  2BHB A;  1BOA A;  2GG3 A;  4ZWU A;  1YW8 A;  1QXW A;  1WLR A;  4U6E A;  2GU7 A;  2B3L A;  2OKN A;  2GA2 A;  2Q92 A;  4RZY A;  4U70 A;  1Y1N A;  4A6V A;  4S2T P;  5CNX A;  2GG8 A;  2GZ5 A;  3S6B A;  4FLL A;  2EA2 A;  1M35 A;  3MR1 A;  4S00 A;  3CB5 A;  2BHD A;  4FO8 A;  1O0X A;  2GG9 A;  2GG7 A;  4PV4 A;  4ZWO A;  2B3K A;  4IKR A;  2MAT A;  1C23 A;  4KM3 A;  3Q6D A;  1KQ9 A;  2EVC A;  3BIP A;  5CDV A;  4FO7 A;  1MAT A;  5JHU A;  1N51 A;  1YW7 A;  4FKC A;  1PV9 A;  3ROR A;  1WN1 A;  2GU5 A;  2ADU A;  2GG5 A;  4U75 A;  2Q94 A;  2G6P A;  2DFI A;  4HXX A;  3TB5 A;  2Q8K A;  4A6W A;  4U6W A;  2GTX A;  2P9A A;  4QR8 A;  2BWW A;  1W2M A;  4Z7M A;  4RGZ 1;  2HOW A;  4S01 A;  1WBQ A;  1XGS A;  3PKD A;  4ZWP A;  2BHC A;  4FLK A;  4FUK A;  1XGM A;  3FMQ A;  1QZY A;  4OOK A;  4U1B A;  4IKU A;  5CIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...